4XKIA

Human fibroblast growth factor - 1 (fgf-1) mutant s116r
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
b'MHHHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGRCKRGPRTHYGQKAILFLPLPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 1
publication title Biophysical characterizations of Fibroblast Growth Factor - 1 mutant with increased heparin binding affinity
rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 37
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4xkiA00
4I4PA 4EEEB 2J3PA 2D43A 4FGFA 1AXMA 4G9NA 3UJ0A 4EFPA 2NP0A 1G9AA 3WA1A 4G9MA 3BB2A 3CQAA 3UD8A 3UDAA 4KBBA 2Y9FA 5HPZA 2MLLB 3ZC8A 3H6RA 4I4SA 2RQ9A 1AF9A 3IM7A 3A23A 1EVTA 2RSTA 1G9CA 3QYDA 4GP0A 5F8WA 3AKHA 3BRFA 4OWJA 1IILA 1QXMA 2Z49A 4XKIA 1AVWB 3AZWA 3VSFA 3K1XA 5E24E 3VSZA 1IOBA 3A07A 1K5VA 3R4UA 3FUQA 4F83A 1AVXB 2F2FA 3AJ5A 2LIQA 2VXRA 3BADA 4IY9A 1V6XA 3NJ5A 3AH1A 2D7RA 4EB2B 3O4DA 4G6MA 3S8JA 1XHBA 3BTAA 5BP5C 4G1RA 3FJ9A 2I1BA 2KLLA 1JLXA 4LO8B 2X2SA 4OWLA 3FGMA 2IHOA 3O4OA 1DQGA 4GOYA 4D8HA 4LO7C 1FMMS 4F34A 4I3NA 2Y9XE 1FV2A 1DZDA 3V0AB 2F8XC 2NVHA 3RMXA 3MALA 4QD2C 1YYNA 3CRHA 1S0DA 1ILR1 3I2AA 3D7WB 1FQ9A 4ZGRB 2ESUA 3HN1A 1HWOB 1J0SA 3B9UA 2M49A 3HALA 3OGGA 3PUBA 4X39A 1GGPB 1TWEA 1R8OA 1I1EA 2RG9B 1CVSA 1S0BA 1S0EA 1BFFA 1WD4A 3CA6A 4GAFA 4AN6A 3HMYA 1RZOB 1M16A 3W9TA 4OWKA 2FDBM 1JQZA 3C9ZA 1RY7A 3IM5A 3V79C 1D0HA 4Q9GA 4I8MA 1EPWA 4JKXB 4QBVA 2AQZA 1PUUB 1JT4A 2D1ZA 1XG6A 2X2TA 3VEQA 41BIA 4J2KA 1XZZA 5G00A 4I4QA 4Z8SB 2MC2A 5FZYA 4OEFA 2DREA 1AVAC 2VUAA 1RMLA 1JTCA 4QD2B 1A8DA 4LO2A 1ISZA 1JT7A 5F8YA 1HCDA 3N7JA 3NBCA 4JPZA 3WMUA 1V6VA 2GO2A 3N7LA 5FZZA 4DENA 1PWAA 4IZXA 3OJVA 2Q9XA 5B2HA 4J2XA 3HSMA 3I29B 4EKXB 2Q3NB 2NTDA 3F62B 2Z48A 3H6RB 3CA1A 3OBTA 4II0A 4DEPA 4IZEA 2FFVA 5BP5A 3Q7XA 3OBRA 3HOMA 3O5WB 5FNWA 2K43A 3WINC 3FJIA 3AH2A 4EFQA 2DRYA 1HWMB 3T8SA 4I6IA 3QR5A 3P6IA 5GAQA 1TWMA 2HW9A 4IHZA 2WBCA 3V0BA 2HWAA 3AKIA 1FV3A 4J23B 4ZOTA 1BA7A 4Q91A 1S0LA 1FWVA 3JUTA 3KMVA 2K8RA 3AKGA 4GP3A 3O3QA 5BXTA 4ZFWB 3FJKA 3AZVA 1Q04A 4JP0A 3CRGA 1QQLA 1TP0A 1ONKB 4P6AA 1DFCA 8I1BA 3ZXGA 3CA5A 1BFCA 1BLAA 1ITBA 1G82A 4GAIA 3BA5A 1MD6A 3JRRA 2UUSA 5FNXA 3RMYA 2BFHA 1OQLB 2LIEA 3RTJB 4EFRA 1WD3A 4J2SA 4LO1A 5BXRA 3BAQA 2GZBA 4D0TA 4USOA 2D23A 4LO3A 1ISXA 5DZUA 3NBEA 4ENDA 5EHAA 1TTUA 3FJHA 1ISWA 3BRGC 5FZUA 1DJSB 2E4MC 1JT3A 4TLPA 3F1RA 1W3FA 2VSEA 1G9DA 1FGAA 2WRYA 4L4HA 1IT0A 1R8NA 1DZCA 2D22A 3NBDA 4XFUA 1T9FA 3MPPG 5EG6C 1W3AA 1JLYA 2AAIB 4QKSA 4A7ZA 2KI4A 2D44A 1E0OA 2Y9GA 4IQPA 4X38A 2AFGA 4Q9PA 1TIEA 3E8LC 4GOVA 4HJJA 1IRAX 4H04A 1WBCA 3N7MA 3WINA 4IY8A 1SZ6B 4I4OA 4KC3A 3PHZA 4QC4A 1NZKA 1S0GA 3A21A 3AJ6A 3LTQA 4CJMA 1Z2VA 3SNVA 3A22A 4PC4A 2ZQOA 3UD9A 1ABRB 2L5XA 4X3AA 2KKIA 3ZXDA 1F31A 3V0AA 2K4AB 1YTOA 3CA4A 1W3GA 4I4RA 3O49A 4JRAA 4P0JA 2KI6B 3CA0A 1SR4C 4HR6C 1PUMB 1HWPB 2BEAA 2ERMA 5EC5A 1YF8B 4I2SA 3BAVA 3RTIB 4G6JA 1EYLA 4IONA 2ZQNA 4I0YA 5JLVA 3AKFA 4QKRA 2VXTI 4ISQA 1HIBA 4H9WA 3CAHA 1XYFA 4XFSA 3FJFA 3OGFA 4L4IA 2FFUA 4DCKC 3N0KA 5JMCA 1KNMA 2AXMA 2P39A 3O4BA 4I37A 1IJTA 2ZR1B 3EF2A 4Z9WB 3O44A 4ZA3B 4ZKTB 1ISYA 4FVVA 6I1BA 2D20A 4I4XA 3IM6A 3FJAA 2ET2A 5BQUC 5I1BA 1HCEA 3R4SA 3BX1C 3BRDA 3HBWA 1IRPA 1FMZA 4ZLBB 1DQOA 1TOOA 2FGFA 1UPSA 2VU9A 4JKQA 3Q7YA 4I4YA 1HKNA 2NYYA 4LO0C 4X37A 3ILAA 2VLCA 3VUOA 1L2HA 4IYBA 3CA3A 3FUOA 3S8KA 3BAGA 4I1EA 2DS0A 1Z4SA 4USPA 3WO4A 4OUJA 3BAOA 4I96A 3OJ2A 5F90A 3VT2A 3UJ4A 3PG0A 2HZ9A 1AFCA 3FJ8A 3BA7A 1IHKA 3POKA 3FFZA 4OEEA 4ISRA 3IAGC 2YUGA 4ZFUB 4LO2C 4A7KA 2HWMA 3I2XA 4I4VA 1Z0HA 3WO2A 2QYIB 3ZX7A 1PC8B 2VSAA 3H6QA 9ILBA 1NUNA 5DSSB 3CU1B 1BFGA 3P6JA 1DFQA 1P63A 3CRIA 3RSJA 4A7YA 4D0ZA 3P53A 4OEGA 1I1BA 4JQ0A 3IIRA 1M2TB 2IWTB 3VT1A 4QO3A 1SR4A 1AVUA 2D24A 3PMEA 4HA2A 5BOWA 1V6WA 5BXSA 1YXWA 2DRZA 4OW4A 1YBIA 4QALA 1BFBA 1K5UA 3O4AA 1BLDA 3LLPA 1RG8A 3Q7WA 3FJEA 5D61A 1T4QA 1DIWA 1HWNB 1ISVA 4YOLA 3FJDA 1Q03A 2P23A 5BQUA 4KEIA 21BIA 4P0KA 2R9KB 5DVHA 3FJCA 3VWCA 3WO3A 1CE7B 5D62A 3TC2A 1BASA 5DUYA 3VT0A 1N4KA 3BAHA 4LO0A 1FN0A 1S0FA 3BA4A 3H6SE 2F2FC 1EV2A 4JAWA 1G9BA 4R6UB 4KEJA 4I1BA 2Y9WC 3AH4A 5D63A 3ZC9A 31BIA 2BEBA 4I4UA 4LO1C 2FO1A 3OJMA 1JT5A 1II4A 2QN4A 3WMVA 1V6UA 4J2YA 1FWUA 4LO3C 4LO7B 4I7IA 3NBNA 4ZFYB 3FJJA 5BXPA 5F8SA 2XOAA 1Q1UA 3FJBA 2NM1A 5BVPI 3V0BB 1WBAA 4ZBVB 4P0LA 2MIBA 1BARA 3UD7A 1JY0A 4QBCA 1QQKA 4XFTA 1DLLA 7I1BA 1PZZA 1MC9A 1VCLA 1TFMB 3N7KA 2NZ9A 2E4MA 4WBCA 3O4CA 2D7IA 1S0CA 4KEKA 2KH2A 4AN7B 3BAUA
chains in the Genus database with same CATH superfamily
4I4PA 4EEEB 2J3PA 2D43A 4FGFA 1AXMA 4G9NA 3UJ0A 4EFPA 2NP0A 1G9AA 3WA1A 4G9MA 3BB2A 3CQAA 3UD8A 3UDAA 4KBBA 2Y9FA 5HPZA 2MLLB 3ZC8A 3H6RA 4I4SA 2RQ9A 1AF9A 3IM7A 3A23A 1EVTA 2RSTA 1G9CA 3QYDA 4GP0A 5F8WA 3AKHA 3BRFA 4OWJA 1IILA 1QXMA 2Z49A 4XKIA 1AVWB 3AZWA 3VSFA 3K1XA 5E24E 3VSZA 1IOBA 3A07A 1K5VA 3R4UA 3FUQA 4F83A 1AVXB 2F2FA 3AJ5A 2LIQA 2VXRA 3BADA 4IY9A 1V6XA 3NJ5A 3AH1A 2D7RA 4EB2B 3O4DA 4G6MA 3S8JA 1XHBA 3BTAA 5BP5C 4G1RA 3FJ9A 2I1BA 2KLLA 1JLXA 4LO8B 2X2SA 4OWLA 3FGMA 2IHOA 3O4OA 1DQGA 4GOYA 4D8HA 4LO7C 1FMMS 4F34A 4I3NA 2Y9XE 1FV2A 1DZDA 3V0AB 2F8XC 2NVHA 3RMXA 3MALA 4QD2C 1YYNA 3CRHA 1S0DA 1ILR1 3I2AA 3D7WB 1FQ9A 4ZGRB 2ESUA 3HN1A 1HWOB 1J0SA 3B9UA 2M49A 3HALA 3OGGA 3PUBA 4X39A 1GGPB 1TWEA 1R8OA 1I1EA 2RG9B 1CVSA 1S0BA 1S0EA 1BFFA 1WD4A 3CA6A 4GAFA 4AN6A 3HMYA 1RZOB 1M16A 3W9TA 4OWKA 2FDBM 1JQZA 3C9ZA 1RY7A 3IM5A 3V79C 1D0HA 4Q9GA 4I8MA 1EPWA 4JKXB 4QBVA 2AQZA 1PUUB 1JT4A 2D1ZA 1XG6A 2X2TA 4H75A 3VEQA 41BIA 4J2KA 1XZZA 5G00A 4I4QA 4Z8SB 2MC2A 5FZYA 4OEFA 2DREA 1AVAC 2VUAA 1RMLA 1JTCA 4QD2B 1A8DA 4LO2A 1ISZA 1JT7A 5F8YA 1HCDA 3N7JA 3NBCA 4JPZA 3WMUA 1V6VA 2GO2A 3N7LA 5FZZA 4DENA 1PWAA 4IZXA 3OJVA 2Q9XA 4MZGB 5B2HA 4J2XA 3HSMA 3I29B 4EKXB 2Q3NB 2NTDA 3F62B 2Z48A 3H6RB 3CA1A 3OBTA 4II0A 4DEPA 4IZEA 2FFVA 5BP5A 3Q7XA 3OBRA 3HOMA 3O5WB 5FNWA 2K43A 3WINC 3FJIA 3AH2A 4EFQA 2DRYA 1HWMB 3T8SA 4I6IA 3QR5A 3P6IA 5GAQA 1TWMA 2HW9A 4IHZA 2WBCA 3V0BA 2HWAA 3AKIA 1FV3A 4J23B 4ZOTA 1BA7A 4Q91A 1S0LA 1FWVA 3JUTA 3KMVA 2K8RA 3AKGA 4GP3A 3O3QA 5BXTA 4ZFWB 3FJKA 3AZVA 1Q04A 4JP0A 3CRGA 1QQLA 1TP0A 1ONKB 4P6AA 1DFCA 8I1BA 3ZXGA 3CA5A 1BFCA 1BLAA 1ITBA 1G82A 4GAIA 3BA5A 1MD6A 3JRRA 2UUSA 5FNXA 3RMYA 2BFHA 1OQLB 2LIEA 3RTJB 4EFRA 1WD3A 4J2SA 4LO1A 5BXRA 3BAQA 2GZBA 4D0TA 2NS2A 4USOA 2D23A 4LO3A 1ISXA 5DZUA 3NBEA 4ENDA 5EHAA 1TTUA 3FJHA 1ISWA 3BRGC 5FZUA 1DJSB 2E4MC 1JT3A 4TLPA 3F1RA 1W3FA 2VSEA 1G9DA 1FGAA 2WRYA 4L4HA 1IT0A 1R8NA 1DZCA 2D22A 3NBDA 4XFUA 1T9FA 3MPPG 5EG6C 1W3AA 1JLYA 2AAIB 4QKSA 4A7ZA 2KI4A 2D44A 1E0OA 2Y9GA 4IQPA 4X38A 2AFGA 4Q9PA 1TIEA 3E8LC 4GOVA 4HJJA 1IRAX 4H04A 1WBCA 3N7MA 3WINA 4IY8A 1SZ6B 4I4OA 4KC3A 3PHZA 4QC4A 1NZKA 1S0GA 3A21A 3AJ6A 3LTQA 4CJMA 1Z2VA 3SNVA 3A22A 4PC4A 2ZQOA 3UD9A 1ABRB 2L5XA 4X3AA 2KKIA 3ZXDA 1F31A 3V0AA 2K4AB 1YTOA 3CA4A 1W3GA 4I4RA 3O49A 4JRAA 4P0JA 2KI6B 3CA0A 1SR4C 4HR6C 1PUMB 1HWPB 2BEAA 2ERMA 5EC5A 1YF8B 4I2SA 3BAVA 3RTIB 4G6JA 1EYLA 4IONA 2ZQNA 4MZHA 4I0YA 5JLVA 3AKFA 4QKRA 2VXTI 4ISQA 1HIBA 4H9WA 3CAHA 1XYFA 4XFSA 3FJFA 3OGFA 4L4IA 2FFUA 4DCKC 3N0KA 5JMCA 1KNMA 2AXMA 2P39A 3O4BA 4I37A 1IJTA 2ZR1B 3EF2A 4Z9WB 3O44A 4ZA3B 4ZKTB 1ISYA 4FVVA 6I1BA 2D20A 4I4XA 3IM6A 3FJAA 2ET2A 5BQUC 5I1BA 1HCEA 3R4SA 3BX1C 3BRDA 3HBWA 1IRPA 1FMZA 4ZLBB 1DQOA 1TOOA 2FGFA 1UPSA 2VU9A 4JKQA 3Q7YA 4I4YA 1HKNA 2NYYA 4LO0C 4X37A 3ILAA 2VLCA 3VUOA 1L2HA 4IYBA 3CA3A 3FUOA 3S8KA 3BAGA 4I1EA 2DS0A 1Z4SA 4USPA 3WO4A 4OUJA 3BAOA 4I96A 3OJ2A 5F90A 3VT2A 3UJ4A 3PG0A 2HZ9A 1AFCA 3FJ8A 3BA7A 1IHKA 3POKA 3FFZA 4OEEA 4ISRA 3IAGC 2YUGA 4ZFUB 4LO2C 4A7KA 2HWMA 3I2XA 4I4VA 1Z0HA 3WO2A 2QYIB 3ZX7A 1PC8B 2VSAA 3H6QA 9ILBA 1NUNA 5DSSB 3CU1B 1BFGA 3P6JA 1DFQA 1P63A 3CRIA 3RSJA 4A7YA 4D0ZA 3P53A 4OEGA 1I1BA 4JQ0A 3IIRA 1M2TB 2IWTB 3VT1A 4MZFB 4QO3A 1SR4A 1AVUA 2D24A 3PMEA 4HA2A 5BOWA 1V6WA 5BXSA 1YXWA 2DRZA 4OW4A 1YBIA 4UY4A 4QALA 1BFBA 1K5UA 3O4AA 1BLDA 3LLPA 1RG8A 3Q7WA 3FJEA 5D61A 1T4QA 1DIWA 1HWNB 1ISVA 4YOLA 3FJDA 1Q03A 2P23A 5BQUA 4KEIA 21BIA 4P0KA 2R9KB 5DVHA 3FJCA 3VWCA 3WO3A 1CE7B 5D62A 3TC2A 1BASA 5DUYA 3VT0A 1N4KA 3BAHA 4LO0A 1FN0A 1S0FA 3BA4A 3H6SE 2F2FC 1EV2A 4JAWA 1G9BA 4R6UB 4KEJA 4I1BA 2Y9WC 3AH4A 5D63A 3ZC9A 31BIA 2BEBA 4I4UA 4LO1C 2FO1A 3OJMA 1JT5A 1II4A 2QN4A 3WMVA 1V6UA 4J2YA 1FWUA 4LO3C 4LO7B 4I7IA 3NBNA 4ZFYB 3FJJA 5BXPA 5F8SA 2XOAA 1Q1UA 3FJBA 2NM1A 5BVPI 3V0BB 1WBAA 4ZBVB 4P0LA 2MIBA 1BARA 3UD7A 1JY0A 4QBCA 1QQKA 4XFTA 1DLLA 7I1BA 1PZZA 1MC9A 1VCLA 1TFMB 3N7KA 2NZ9A 2E4MA 4WBCA 3O4CA 2D7IA 1S0CA 4KEKA 2KH2A 4AN7B 3BAUA
chains in the Genus database with same CATH topology
4I4PA 4EEEB 2J3PA 2D43A 4FGFA 1AXMA 4G9NA 3UJ0A 4EFPA 2NP0A 1G9AA 3WA1A 4G9MA 3BB2A 3CQAA 3UD8A 3UDAA 4KBBA 2Y9FA 5HPZA 2MLLB 3ZC8A 3H6RA 4I4SA 2RQ9A 1AF9A 3IM7A 3A23A 1EVTA 2RSTA 1G9CA 3QYDA 4GP0A 5F8WA 3AKHA 3BRFA 4OWJA 1IILA 1QXMA 2Z49A 4XKIA 1AVWB 3AZWA 3VSFA 3K1XA 5E24E 3VSZA 1IOBA 3A07A 1K5VA 3R4UA 3FUQA 4F83A 1AVXB 2F2FA 3AJ5A 2LIQA 2VXRA 3BADA 4IY9A 1V6XA 3NJ5A 3AH1A 2D7RA 4EB2B 3O4DA 4G6MA 3S8JA 1XHBA 3BTAA 5BP5C 4G1RA 3FJ9A 2I1BA 2KLLA 1JLXA 4LO8B 2X2SA 4OWLA 3FGMA 2IHOA 3O4OA 1DQGA 4GOYA 4D8HA 4LO7C 1FMMS 4F34A 4I3NA 2Y9XE 1FV2A 1DZDA 3V0AB 2F8XC 2NVHA 3RMXA 3MALA 4QD2C 1YYNA 3CRHA 1S0DA 1ILR1 3I2AA 3D7WB 1FQ9A 4ZGRB 2ESUA 3HN1A 1HWOB 1J0SA 3B9UA 2M49A 3HALA 3OGGA 3PUBA 4X39A 1GGPB 1TWEA 1R8OA 1I1EA 2RG9B 1CVSA 1S0BA 1S0EA 1BFFA 1WD4A 3CA6A 4GAFA 4AN6A 3HMYA 1RZOB 1M16A 3W9TA 4OWKA 2FDBM 1JQZA 3C9ZA 1RY7A 3IM5A 3V79C 1D0HA 4Q9GA 4I8MA 1EPWA 4JKXB 4QBVA 2AQZA 1PUUB 1JT4A 2D1ZA 1XG6A 2X2TA 4H75A 3VEQA 41BIA 4J2KA 1XZZA 5G00A 4I4QA 4Z8SB 2MC2A 5FZYA 4OEFA 2DREA 1AVAC 2VUAA 1RMLA 1JTCA 4QD2B 1A8DA 4LO2A 1ISZA 1JT7A 5F8YA 1HCDA 3N7JA 3NBCA 4JPZA 3WMUA 1V6VA 2GO2A 3N7LA 5FZZA 4DENA 1PWAA 4IZXA 3OJVA 2Q9XA 4MZGB 5B2HA 4J2XA 3HSMA 3I29B 4EKXB 2Q3NB 2NTDA 3F62B 2Z48A 3H6RB 3CA1A 3OBTA 4II0A 4DEPA 4IZEA 2FFVA 5BP5A 3Q7XA 3OBRA 3HOMA 3O5WB 5FNWA 2K43A 3WINC 3FJIA 3AH2A 4EFQA 2DRYA 1HWMB 3T8SA 4I6IA 3QR5A 3P6IA 5GAQA 1TWMA 2HW9A 4IHZA 2WBCA 3V0BA 2HWAA 3AKIA 1FV3A 4J23B 4ZOTA 1BA7A 4Q91A 1S0LA 1FWVA 3JUTA 3KMVA 2K8RA 3AKGA 4GP3A 3O3QA 5BXTA 4ZFWB 3FJKA 3AZVA 1Q04A 4JP0A 3CRGA 1QQLA 1TP0A 1ONKB 4P6AA 1DFCA 8I1BA 3ZXGA 3CA5A 1BFCA 1BLAA 1ITBA 1G82A 4GAIA 3BA5A 1MD6A 3JRRA 2UUSA 5FNXA 3RMYA 2BFHA 1OQLB 2LIEA 3RTJB 4EFRA 1WD3A 4J2SA 4LO1A 5BXRA 3BAQA 2GZBA 4D0TA 2NS2A 4USOA 2D23A 4LO3A 1ISXA 5DZUA 3NBEA 4ENDA 5EHAA 1TTUA 3FJHA 1ISWA 3BRGC 5FZUA 1DJSB 2E4MC 1JT3A 4TLPA 3F1RA 1W3FA 2VSEA 1G9DA 1FGAA 2WRYA 4L4HA 1IT0A 1R8NA 1DZCA 2D22A 3NBDA 4XFUA 1T9FA 3MPPG 5EG6C 1W3AA 1JLYA 2AAIB 4QKSA 4A7ZA 2KI4A 2D44A 1E0OA 2Y9GA 4IQPA 4X38A 2AFGA 4Q9PA 1TIEA 3E8LC 4GOVA 4HJJA 1IRAX 4H04A 1WBCA 3N7MA 3WINA 4IY8A 1SZ6B 4I4OA 4KC3A 3PHZA 4QC4A 1NZKA 1S0GA 3A21A 3AJ6A 3LTQA 4CJMA 1Z2VA 3SNVA 3A22A 4PC4A 2ZQOA 3UD9A 1ABRB 2L5XA 4X3AA 2KKIA 3ZXDA 1F31A 3V0AA 2K4AB 1YTOA 3CA4A 1W3GA 4I4RA 3O49A 4JRAA 4P0JA 2KI6B 3CA0A 1SR4C 4HR6C 1PUMB 1HWPB 2BEAA 2ERMA 5EC5A 1YF8B 4I2SA 3BAVA 3RTIB 4G6JA 1EYLA 4IONA 2ZQNA 4MZHA 4I0YA 5JLVA 3AKFA 4QKRA 2VXTI 4ISQA 1HIBA 4H9WA 3CAHA 1XYFA 4XFSA 3FJFA 3OGFA 4L4IA 2FFUA 4DCKC 3N0KA 5JMCA 1KNMA 2AXMA 2P39A 3O4BA 4I37A 1IJTA 2ZR1B 3EF2A 4Z9WB 3O44A 4ZA3B 4ZKTB 1ISYA 4FVVA 6I1BA 2D20A 4I4XA 3IM6A 3FJAA 2ET2A 5BQUC 5I1BA 1HCEA 3R4SA 3BX1C 3BRDA 3HBWA 1IRPA 1FMZA 4ZLBB 1DQOA 1TOOA 2FGFA 1UPSA 2VU9A 4JKQA 3Q7YA 4I4YA 1HKNA 2NYYA 4LO0C 4X37A 3ILAA 2VLCA 3VUOA 1L2HA 4IYBA 3CA3A 3FUOA 3S8KA 3BAGA 4I1EA 2DS0A 1Z4SA 4USPA 3WO4A 4OUJA 3BAOA 4I96A 3OJ2A 5F90A 3VT2A 3UJ4A 3PG0A 2HZ9A 1AFCA 3FJ8A 3BA7A 1IHKA 3POKA 3FFZA 4OEEA 4ISRA 3IAGC 2YUGA 4ZFUB 4LO2C 4A7KA 2HWMA 3I2XA 4I4VA 1Z0HA 3WO2A 2QYIB 3ZX7A 1PC8B 2VSAA 3H6QA 9ILBA 1NUNA 5DSSB 3CU1B 1BFGA 3P6JA 1DFQA 1P63A 3CRIA 3RSJA 4A7YA 4D0ZA 3P53A 4OEGA 1I1BA 4JQ0A 3IIRA 1M2TB 2IWTB 3VT1A 4MZFB 4QO3A 1SR4A 1AVUA 2D24A 3PMEA 4HA2A 5BOWA 1V6WA 5BXSA 1YXWA 2DRZA 4OW4A 1YBIA 4UY4A 4QALA 1BFBA 1K5UA 3O4AA 1BLDA 3LLPA 1RG8A 3Q7WA 3FJEA 5D61A 1T4QA 1DIWA 1HWNB 1ISVA 4YOLA 3FJDA 1Q03A 2P23A 5BQUA 4KEIA 21BIA 4P0KA 2R9KB 5DVHA 3FJCA 3VWCA 3WO3A 1CE7B 5D62A 3TC2A 1BASA 5DUYA 3VT0A 1N4KA 3BAHA 4LO0A 1FN0A 1S0FA 3BA4A 3H6SE 2F2FC 1EV2A 4JAWA 1G9BA 4R6UB 4KEJA 4I1BA 2Y9WC 3AH4A 5D63A 3ZC9A 31BIA 2BEBA 4I4UA 4LO1C 2FO1A 3OJMA 1JT5A 1II4A 2QN4A 3WMVA 1V6UA 4J2YA 1FWUA 4LO3C 4LO7B 4I7IA 3NBNA 4ZFYB 3FJJA 5BXPA 5F8SA 2XOAA 1Q1UA 3FJBA 2NM1A 5BVPI 3V0BB 1WBAA 4ZBVB 4P0LA 2MIBA 1BARA 3UD7A 1JY0A 4QBCA 1QQKA 4XFTA 1DLLA 7I1BA 1PZZA 1MC9A 1VCLA 1TFMB 3N7KA 2NZ9A 2E4MA 4WBCA 3O4CA 2D7IA 1S0CA 4KEKA 2KH2A 4AN7B 3BAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4P A;  4EEE B;  2J3P A;  2D43 A;  4FGF A;  1AXM A;  4G9N A;  3UJ0 A;  4EFP A;  2NP0 A;  1G9A A;  3WA1 A;  4G9M A;  3BB2 A;  3CQA A;  3UD8 A;  3UDA A;  4KBB A;  2Y9F A;  5HPZ A;  2MLL B;  3ZC8 A;  3H6R A;  4I4S A;  2RQ9 A;  1AF9 A;  3IM7 A;  3A23 A;  1EVT A;  2RST A;  1G9C A;  3QYD A;  4GP0 A;  5F8W A;  3AKH A;  3BRF A;  4OWJ A;  1IIL A;  1QXM A;  2Z49 A;  4XKI A;  1AVW B;  3AZW A;  3VSF A;  3K1X A;  5E24 E;  3VSZ A;  1IOB A;  3A07 A;  1K5V A;  3R4U A;  3FUQ A;  4F83 A;  1AVX B;  2F2F A;  3AJ5 A;  2LIQ A;  2VXR A;  3BAD A;  4IY9 A;  1V6X A;  3NJ5 A;  3AH1 A;  2D7R A;  4EB2 B;  3O4D A;  4G6M A;  3S8J A;  1XHB A;  3BTA A;  5BP5 C;  4G1R A;  3FJ9 A;  2I1B A;  2KLL A;  1JLX A;  4LO8 B;  2X2S A;  4OWL A;  3FGM A;  2IHO A;  3O4O A;  1DQG A;  4GOY A;  4D8H A;  4LO7 C;  1FMM S;  4F34 A;  4I3N A;  2Y9X E;  1FV2 A;  1DZD A;  3V0A B;  2F8X C;  2NVH A;  3RMX A;  3MAL A;  4QD2 C;  1YYN A;  3CRH A;  1S0D A;  1ILR 1;  3I2A A;  3D7W B;  1FQ9 A;  4ZGR B;  2ESU A;  3HN1 A;  1HWO B;  1J0S A;  3B9U A;  2M49 A;  3HAL A;  3OGG A;  3PUB A;  4X39 A;  1GGP B;  1TWE A;  1R8O A;  1I1E A;  2RG9 B;  1CVS A;  1S0B A;  1S0E A;  1BFF A;  1WD4 A;  3CA6 A;  4GAF A;  4AN6 A;  3HMY A;  1RZO B;  1M16 A;  3W9T A;  4OWK A;  2FDB M;  1JQZ A;  3C9Z A;  1RY7 A;  3IM5 A;  3V79 C;  1D0H A;  4Q9G A;  4I8M A;  1EPW A;  4JKX B;  4QBV A;  2AQZ A;  1PUU B;  1JT4 A;  2D1Z A;  1XG6 A;  2X2T A;  3VEQ A;  41BI A;  4J2K A;  1XZZ A;  5G00 A;  4I4Q A;  4Z8S B;  2MC2 A;  5FZY A;  4OEF A;  2DRE A;  1AVA C;  2VUA A;  1RML A;  1JTC A;  4QD2 B;  1A8D A;  4LO2 A;  1ISZ A;  1JT7 A;  5F8Y A;  1HCD A;  3N7J A;  3NBC A;  4JPZ A;  3WMU A;  1V6V A;  2GO2 A;  3N7L A;  5FZZ A;  4DEN A;  1PWA A;  4IZX A;  3OJV A;  2Q9X A;  5B2H A;  4J2X A;  3HSM A;  3I29 B;  4EKX B;  2Q3N B;  2NTD A;  3F62 B;  2Z48 A;  3H6R B;  3CA1 A;  3OBT A;  4II0 A;  4DEP A;  4IZE A;  2FFV A;  5BP5 A;  3Q7X A;  3OBR A;  3HOM A;  3O5W B;  5FNW A;  2K43 A;  3WIN C;  3FJI A;  3AH2 A;  4EFQ A;  2DRY A;  1HWM B;  3T8S A;  4I6I A;  3QR5 A;  3P6I A;  5GAQ A;  1TWM A;  2HW9 A;  4IHZ A;  2WBC A;  3V0B A;  2HWA A;  3AKI A;  1FV3 A;  4J23 B;  4ZOT A;  1BA7 A;  4Q91 A;  1S0L A;  1FWV A;  3JUT A;  3KMV A;  2K8R A;  3AKG A;  4GP3 A;  3O3Q A;  5BXT A;  4ZFW B;  3FJK A;  3AZV A;  1Q04 A;  4JP0 A;  3CRG A;  1QQL A;  1TP0 A;  1ONK B;  4P6A A;  1DFC A;  8I1B A;  3ZXG A;  3CA5 A;  1BFC A;  1BLA A;  1ITB A;  1G82 A;  4GAI A;  3BA5 A;  1MD6 A;  3JRR A;  2UUS A;  5FNX A;  3RMY A;  2BFH A;  1OQL B;  2LIE A;  3RTJ B;  4EFR A;  1WD3 A;  4J2S A;  4LO1 A;  5BXR A;  3BAQ A;  2GZB A;  4D0T A;  4USO A;  2D23 A;  4LO3 A;  1ISX A;  5DZU A;  3NBE A;  4END A;  5EHA A;  1TTU A;  3FJH A;  1ISW A;  3BRG C;  5FZU A;  1DJS B;  2E4M C;  1JT3 A;  4TLP A;  3F1R A;  1W3F A;  2VSE A;  1G9D A;  1FGA A;  2WRY A;  4L4H A;  1IT0 A;  1R8N A;  1DZC A;  2D22 A;  3NBD A;  4XFU A;  1T9F A;  3MPP G;  5EG6 C;  1W3A A;  1JLY A;  2AAI B;  4QKS A;  4A7Z A;  2KI4 A;  2D44 A;  1E0O A;  2Y9G A;  4IQP A;  4X38 A;  2AFG A;  4Q9P A;  1TIE A;  3E8L C;  4GOV A;  4HJJ A;  1IRA X;  4H04 A;  1WBC A;  3N7M A;  3WIN A;  4IY8 A;  1SZ6 B;  4I4O A;  4KC3 A;  3PHZ A;  4QC4 A;  1NZK A;  1S0G A;  3A21 A;  3AJ6 A;  3LTQ A;  4CJM A;  1Z2V A;  3SNV A;  3A22 A;  4PC4 A;  2ZQO A;  3UD9 A;  1ABR B;  2L5X A;  4X3A A;  2KKI A;  3ZXD A;  1F31 A;  3V0A A;  2K4A B;  1YTO A;  3CA4 A;  1W3G A;  4I4R A;  3O49 A;  4JRA A;  4P0J A;  2KI6 B;  3CA0 A;  1SR4 C;  4HR6 C;  1PUM B;  1HWP B;  2BEA A;  2ERM A;  5EC5 A;  1YF8 B;  4I2S A;  3BAV A;  3RTI B;  4G6J A;  1EYL A;  4ION A;  2ZQN A;  4I0Y A;  5JLV A;  3AKF A;  4QKR A;  2VXT I;  4ISQ A;  1HIB A;  4H9W A;  3CAH A;  1XYF A;  4XFS A;  3FJF A;  3OGF A;  4L4I A;  2FFU A;  4DCK C;  3N0K A;  5JMC A;  1KNM A;  2AXM A;  2P39 A;  3O4B A;  4I37 A;  1IJT A;  2ZR1 B;  3EF2 A;  4Z9W B;  3O44 A;  4ZA3 B;  4ZKT B;  1ISY A;  4FVV A;  6I1B A;  2D20 A;  4I4X A;  3IM6 A;  3FJA A;  2ET2 A;  5BQU C;  5I1B A;  1HCE A;  3R4S A;  3BX1 C;  3BRD A;  3HBW A;  1IRP A;  1FMZ A;  4ZLB B;  1DQO A;  1TOO A;  2FGF A;  1UPS A;  2VU9 A;  4JKQ A;  3Q7Y A;  4I4Y A;  1HKN A;  2NYY A;  4LO0 C;  4X37 A;  3ILA A;  2VLC A;  3VUO A;  1L2H A;  4IYB A;  3CA3 A;  3FUO A;  3S8K A;  3BAG A;  4I1E A;  2DS0 A;  1Z4S A;  4USP A;  3WO4 A;  4OUJ A;  3BAO A;  4I96 A;  3OJ2 A;  5F90 A;  3VT2 A;  3UJ4 A;  3PG0 A;  2HZ9 A;  1AFC A;  3FJ8 A;  3BA7 A;  1IHK A;  3POK A;  3FFZ A;  4OEE A;  4ISR A;  3IAG C;  2YUG A;  4ZFU B;  4LO2 C;  4A7K A;  2HWM A;  3I2X A;  4I4V A;  1Z0H A;  3WO2 A;  2QYI B;  3ZX7 A;  1PC8 B;  2VSA A;  3H6Q A;  9ILB A;  1NUN A;  5DSS B;  3CU1 B;  1BFG A;  3P6J A;  1DFQ A;  1P63 A;  3CRI A;  3RSJ A;  4A7Y A;  4D0Z A;  3P53 A;  4OEG A;  1I1B A;  4JQ0 A;  3IIR A;  1M2T B;  2IWT B;  3VT1 A;  4QO3 A;  1SR4 A;  1AVU A;  2D24 A;  3PME A;  4HA2 A;  5BOW A;  1V6W A;  5BXS A;  1YXW A;  2DRZ A;  4OW4 A;  1YBI A;  4QAL A;  1BFB A;  1K5U A;  3O4A A;  1BLD A;  3LLP A;  1RG8 A;  3Q7W A;  3FJE A;  5D61 A;  1T4Q A;  1DIW A;  1HWN B;  1ISV A;  4YOL A;  3FJD A;  1Q03 A;  2P23 A;  5BQU A;  4KEI A;  21BI A;  4P0K A;  2R9K B;  5DVH A;  3FJC A;  3VWC A;  3WO3 A;  1CE7 B;  5D62 A;  3TC2 A;  1BAS A;  5DUY A;  3VT0 A;  1N4K A;  3BAH A;  4LO0 A;  1FN0 A;  1S0F A;  3BA4 A;  3H6S E;  2F2F C;  1EV2 A;  4JAW A;  1G9B A;  4R6U B;  4KEJ A;  4I1B A;  2Y9W C;  3AH4 A;  5D63 A;  3ZC9 A;  31BI A;  2BEB A;  4I4U A;  4LO1 C;  2FO1 A;  3OJM A;  1JT5 A;  1II4 A;  2QN4 A;  3WMV A;  1V6U A;  4J2Y A;  1FWU A;  4LO3 C;  4LO7 B;  4I7I A;  3NBN A;  4ZFY B;  3FJJ A;  5BXP A;  5F8S A;  2XOA A;  1Q1U A;  3FJB A;  2NM1 A;  5BVP I;  3V0B B;  1WBA A;  4ZBV B;  4P0L A;  2MIB A;  1BAR A;  3UD7 A;  1JY0 A;  4QBC A;  1QQK A;  4XFT A;  1DLL A;  7I1B A;  1PZZ A;  1MC9 A;  1VCL A;  1TFM B;  3N7K A;  2NZ9 A;  2E4M A;  4WBC A;  3O4C A;  2D7I A;  1S0C A;  4KEK A;  2KH2 A;  4AN7 B;  3BAU A; 
#chains in the Genus database with same CATH topology
 4I4P A;  4EEE B;  2J3P A;  2D43 A;  4FGF A;  1AXM A;  4G9N A;  3UJ0 A;  4EFP A;  2NP0 A;  1G9A A;  3WA1 A;  4G9M A;  3BB2 A;  3CQA A;  3UD8 A;  3UDA A;  4KBB A;  2Y9F A;  5HPZ A;  2MLL B;  3ZC8 A;  3H6R A;  4I4S A;  2RQ9 A;  1AF9 A;  3IM7 A;  3A23 A;  1EVT A;  2RST A;  1G9C A;  3QYD A;  4GP0 A;  5F8W A;  3AKH A;  3BRF A;  4OWJ A;  1IIL A;  1QXM A;  2Z49 A;  4XKI A;  1AVW B;  3AZW A;  3VSF A;  3K1X A;  5E24 E;  3VSZ A;  1IOB A;  3A07 A;  1K5V A;  3R4U A;  3FUQ A;  4F83 A;  1AVX B;  2F2F A;  3AJ5 A;  2LIQ A;  2VXR A;  3BAD A;  4IY9 A;  1V6X A;  3NJ5 A;  3AH1 A;  2D7R A;  4EB2 B;  3O4D A;  4G6M A;  3S8J A;  1XHB A;  3BTA A;  5BP5 C;  4G1R A;  3FJ9 A;  2I1B A;  2KLL A;  1JLX A;  4LO8 B;  2X2S A;  4OWL A;  3FGM A;  2IHO A;  3O4O A;  1DQG A;  4GOY A;  4D8H A;  4LO7 C;  1FMM S;  4F34 A;  4I3N A;  2Y9X E;  1FV2 A;  1DZD A;  3V0A B;  2F8X C;  2NVH A;  3RMX A;  3MAL A;  4QD2 C;  1YYN A;  3CRH A;  1S0D A;  1ILR 1;  3I2A A;  3D7W B;  1FQ9 A;  4ZGR B;  2ESU A;  3HN1 A;  1HWO B;  1J0S A;  3B9U A;  2M49 A;  3HAL A;  3OGG A;  3PUB A;  4X39 A;  1GGP B;  1TWE A;  1R8O A;  1I1E A;  2RG9 B;  1CVS A;  1S0B A;  1S0E A;  1BFF A;  1WD4 A;  3CA6 A;  4GAF A;  4AN6 A;  3HMY A;  1RZO B;  1M16 A;  3W9T A;  4OWK A;  2FDB M;  1JQZ A;  3C9Z A;  1RY7 A;  3IM5 A;  3V79 C;  1D0H A;  4Q9G A;  4I8M A;  1EPW A;  4JKX B;  4QBV A;  2AQZ A;  1PUU B;  1JT4 A;  2D1Z A;  1XG6 A;  2X2T A;  4H75 A;  3VEQ A;  41BI A;  4J2K A;  1XZZ A;  5G00 A;  4I4Q A;  4Z8S B;  2MC2 A;  5FZY A;  4OEF A;  2DRE A;  1AVA C;  2VUA A;  1RML A;  1JTC A;  4QD2 B;  1A8D A;  4LO2 A;  1ISZ A;  1JT7 A;  5F8Y A;  1HCD A;  3N7J A;  3NBC A;  4JPZ A;  3WMU A;  1V6V A;  2GO2 A;  3N7L A;  5FZZ A;  4DEN A;  1PWA A;  4IZX A;  3OJV A;  2Q9X A;  4MZG B;  5B2H A;  4J2X A;  3HSM A;  3I29 B;  4EKX B;  2Q3N B;  2NTD A;  3F62 B;  2Z48 A;  3H6R B;  3CA1 A;  3OBT A;  4II0 A;  4DEP A;  4IZE A;  2FFV A;  5BP5 A;  3Q7X A;  3OBR A;  3HOM A;  3O5W B;  5FNW A;  2K43 A;  3WIN C;  3FJI A;  3AH2 A;  4EFQ A;  2DRY A;  1HWM B;  3T8S A;  4I6I A;  3QR5 A;  3P6I A;  5GAQ A;  1TWM A;  2HW9 A;  4IHZ A;  2WBC A;  3V0B A;  2HWA A;  3AKI A;  1FV3 A;  4J23 B;  4ZOT A;  1BA7 A;  4Q91 A;  1S0L A;  1FWV A;  3JUT A;  3KMV A;  2K8R A;  3AKG A;  4GP3 A;  3O3Q A;  5BXT A;  4ZFW B;  3FJK A;  3AZV A;  1Q04 A;  4JP0 A;  3CRG A;  1QQL A;  1TP0 A;  1ONK B;  4P6A A;  1DFC A;  8I1B A;  3ZXG A;  3CA5 A;  1BFC A;  1BLA A;  1ITB A;  1G82 A;  4GAI A;  3BA5 A;  1MD6 A;  3JRR A;  2UUS A;  5FNX A;  3RMY A;  2BFH A;  1OQL B;  2LIE A;  3RTJ B;  4EFR A;  1WD3 A;  4J2S A;  4LO1 A;  5BXR A;  3BAQ A;  2GZB A;  4D0T A;  2NS2 A;  4USO A;  2D23 A;  4LO3 A;  1ISX A;  5DZU A;  3NBE A;  4END A;  5EHA A;  1TTU A;  3FJH A;  1ISW A;  3BRG C;  5FZU A;  1DJS B;  2E4M C;  1JT3 A;  4TLP A;  3F1R A;  1W3F A;  2VSE A;  1G9D A;  1FGA A;  2WRY A;  4L4H A;  1IT0 A;  1R8N A;  1DZC A;  2D22 A;  3NBD A;  4XFU A;  1T9F A;  3MPP G;  5EG6 C;  1W3A A;  1JLY A;  2AAI B;  4QKS A;  4A7Z A;  2KI4 A;  2D44 A;  1E0O A;  2Y9G A;  4IQP A;  4X38 A;  2AFG A;  4Q9P A;  1TIE A;  3E8L C;  4GOV A;  4HJJ A;  1IRA X;  4H04 A;  1WBC A;  3N7M A;  3WIN A;  4IY8 A;  1SZ6 B;  4I4O A;  4KC3 A;  3PHZ A;  4QC4 A;  1NZK A;  1S0G A;  3A21 A;  3AJ6 A;  3LTQ A;  4CJM A;  1Z2V A;  3SNV A;  3A22 A;  4PC4 A;  2ZQO A;  3UD9 A;  1ABR B;  2L5X A;  4X3A A;  2KKI A;  3ZXD A;  1F31 A;  3V0A A;  2K4A B;  1YTO A;  3CA4 A;  1W3G A;  4I4R A;  3O49 A;  4JRA A;  4P0J A;  2KI6 B;  3CA0 A;  1SR4 C;  4HR6 C;  1PUM B;  1HWP B;  2BEA A;  2ERM A;  5EC5 A;  1YF8 B;  4I2S A;  3BAV A;  3RTI B;  4G6J A;  1EYL A;  4ION A;  2ZQN A;  4MZH A;  4I0Y A;  5JLV A;  3AKF A;  4QKR A;  2VXT I;  4ISQ A;  1HIB A;  4H9W A;  3CAH A;  1XYF A;  4XFS A;  3FJF A;  3OGF A;  4L4I A;  2FFU A;  4DCK C;  3N0K A;  5JMC A;  1KNM A;  2AXM A;  2P39 A;  3O4B A;  4I37 A;  1IJT A;  2ZR1 B;  3EF2 A;  4Z9W B;  3O44 A;  4ZA3 B;  4ZKT B;  1ISY A;  4FVV A;  6I1B A;  2D20 A;  4I4X A;  3IM6 A;  3FJA A;  2ET2 A;  5BQU C;  5I1B A;  1HCE A;  3R4S A;  3BX1 C;  3BRD A;  3HBW A;  1IRP A;  1FMZ A;  4ZLB B;  1DQO A;  1TOO A;  2FGF A;  1UPS A;  2VU9 A;  4JKQ A;  3Q7Y A;  4I4Y A;  1HKN A;  2NYY A;  4LO0 C;  4X37 A;  3ILA A;  2VLC A;  3VUO A;  1L2H A;  4IYB A;  3CA3 A;  3FUO A;  3S8K A;  3BAG A;  4I1E A;  2DS0 A;  1Z4S A;  4USP A;  3WO4 A;  4OUJ A;  3BAO A;  4I96 A;  3OJ2 A;  5F90 A;  3VT2 A;  3UJ4 A;  3PG0 A;  2HZ9 A;  1AFC A;  3FJ8 A;  3BA7 A;  1IHK A;  3POK A;  3FFZ A;  4OEE A;  4ISR A;  3IAG C;  2YUG A;  4ZFU B;  4LO2 C;  4A7K A;  2HWM A;  3I2X A;  4I4V A;  1Z0H A;  3WO2 A;  2QYI B;  3ZX7 A;  1PC8 B;  2VSA A;  3H6Q A;  9ILB A;  1NUN A;  5DSS B;  3CU1 B;  1BFG A;  3P6J A;  1DFQ A;  1P63 A;  3CRI A;  3RSJ A;  4A7Y A;  4D0Z A;  3P53 A;  4OEG A;  1I1B A;  4JQ0 A;  3IIR A;  1M2T B;  2IWT B;  3VT1 A;  4MZF B;  4QO3 A;  1SR4 A;  1AVU A;  2D24 A;  3PME A;  4HA2 A;  5BOW A;  1V6W A;  5BXS A;  1YXW A;  2DRZ A;  4OW4 A;  1YBI A;  4UY4 A;  4QAL A;  1BFB A;  1K5U A;  3O4A A;  1BLD A;  3LLP A;  1RG8 A;  3Q7W A;  3FJE A;  5D61 A;  1T4Q A;  1DIW A;  1HWN B;  1ISV A;  4YOL A;  3FJD A;  1Q03 A;  2P23 A;  5BQU A;  4KEI A;  21BI A;  4P0K A;  2R9K B;  5DVH A;  3FJC A;  3VWC A;  3WO3 A;  1CE7 B;  5D62 A;  3TC2 A;  1BAS A;  5DUY A;  3VT0 A;  1N4K A;  3BAH A;  4LO0 A;  1FN0 A;  1S0F A;  3BA4 A;  3H6S E;  2F2F C;  1EV2 A;  4JAW A;  1G9B A;  4R6U B;  4KEJ A;  4I1B A;  2Y9W C;  3AH4 A;  5D63 A;  3ZC9 A;  31BI A;  2BEB A;  4I4U A;  4LO1 C;  2FO1 A;  3OJM A;  1JT5 A;  1II4 A;  2QN4 A;  3WMV A;  1V6U A;  4J2Y A;  1FWU A;  4LO3 C;  4LO7 B;  4I7I A;  3NBN A;  4ZFY B;  3FJJ A;  5BXP A;  5F8S A;  2XOA A;  1Q1U A;  3FJB A;  2NM1 A;  5BVP I;  3V0B B;  1WBA A;  4ZBV B;  4P0L A;  2MIB A;  1BAR A;  3UD7 A;  1JY0 A;  4QBC A;  1QQK A;  4XFT A;  1DLL A;  7I1B A;  1PZZ A;  1MC9 A;  1VCL A;  1TFM B;  3N7K A;  2NZ9 A;  2E4M A;  4WBC A;  3O4C A;  2D7I A;  1S0C A;  4KEK A;  2KH2 A;  4AN7 B;  3BAU A; 
#chains in the Genus database with same CATH homology
 4I4P A;  4EEE B;  2J3P A;  2D43 A;  4FGF A;  1AXM A;  4G9N A;  3UJ0 A;  4EFP A;  2NP0 A;  1G9A A;  3WA1 A;  4G9M A;  3BB2 A;  3CQA A;  3UD8 A;  3UDA A;  4KBB A;  2Y9F A;  5HPZ A;  2MLL B;  3ZC8 A;  3H6R A;  4I4S A;  2RQ9 A;  1AF9 A;  3IM7 A;  3A23 A;  1EVT A;  2RST A;  1G9C A;  3QYD A;  4GP0 A;  5F8W A;  3AKH A;  3BRF A;  4OWJ A;  1IIL A;  1QXM A;  2Z49 A;  4XKI A;  1AVW B;  3AZW A;  3VSF A;  3K1X A;  5E24 E;  3VSZ A;  1IOB A;  3A07 A;  1K5V A;  3R4U A;  3FUQ A;  4F83 A;  1AVX B;  2F2F A;  3AJ5 A;  2LIQ A;  2VXR A;  3BAD A;  4IY9 A;  1V6X A;  3NJ5 A;  3AH1 A;  2D7R A;  4EB2 B;  3O4D A;  4G6M A;  3S8J A;  1XHB A;  3BTA A;  5BP5 C;  4G1R A;  3FJ9 A;  2I1B A;  2KLL A;  1JLX A;  4LO8 B;  2X2S A;  4OWL A;  3FGM A;  2IHO A;  3O4O A;  1DQG A;  4GOY A;  4D8H A;  4LO7 C;  1FMM S;  4F34 A;  4I3N A;  2Y9X E;  1FV2 A;  1DZD A;  3V0A B;  2F8X C;  2NVH A;  3RMX A;  3MAL A;  4QD2 C;  1YYN A;  3CRH A;  1S0D A;  1ILR 1;  3I2A A;  3D7W B;  1FQ9 A;  4ZGR B;  2ESU A;  3HN1 A;  1HWO B;  1J0S A;  3B9U A;  2M49 A;  3HAL A;  3OGG A;  3PUB A;  4X39 A;  1GGP B;  1TWE A;  1R8O A;  1I1E A;  2RG9 B;  1CVS A;  1S0B A;  1S0E A;  1BFF A;  1WD4 A;  3CA6 A;  4GAF A;  4AN6 A;  3HMY A;  1RZO B;  1M16 A;  3W9T A;  4OWK A;  2FDB M;  1JQZ A;  3C9Z A;  1RY7 A;  3IM5 A;  3V79 C;  1D0H A;  4Q9G A;  4I8M A;  1EPW A;  4JKX B;  4QBV A;  2AQZ A;  1PUU B;  1JT4 A;  2D1Z A;  1XG6 A;  2X2T A;  4H75 A;  3VEQ A;  41BI A;  4J2K A;  1XZZ A;  5G00 A;  4I4Q A;  4Z8S B;  2MC2 A;  5FZY A;  4OEF A;  2DRE A;  1AVA C;  2VUA A;  1RML A;  1JTC A;  4QD2 B;  1A8D A;  4LO2 A;  1ISZ A;  1JT7 A;  5F8Y A;  1HCD A;  3N7J A;  3NBC A;  4JPZ A;  3WMU A;  1V6V A;  2GO2 A;  3N7L A;  5FZZ A;  4DEN A;  1PWA A;  4IZX A;  3OJV A;  2Q9X A;  4MZG B;  5B2H A;  4J2X A;  3HSM A;  3I29 B;  4EKX B;  2Q3N B;  2NTD A;  3F62 B;  2Z48 A;  3H6R B;  3CA1 A;  3OBT A;  4II0 A;  4DEP A;  4IZE A;  2FFV A;  5BP5 A;  3Q7X A;  3OBR A;  3HOM A;  3O5W B;  5FNW A;  2K43 A;  3WIN C;  3FJI A;  3AH2 A;  4EFQ A;  2DRY A;  1HWM B;  3T8S A;  4I6I A;  3QR5 A;  3P6I A;  5GAQ A;  1TWM A;  2HW9 A;  4IHZ A;  2WBC A;  3V0B A;  2HWA A;  3AKI A;  1FV3 A;  4J23 B;  4ZOT A;  1BA7 A;  4Q91 A;  1S0L A;  1FWV A;  3JUT A;  3KMV A;  2K8R A;  3AKG A;  4GP3 A;  3O3Q A;  5BXT A;  4ZFW B;  3FJK A;  3AZV A;  1Q04 A;  4JP0 A;  3CRG A;  1QQL A;  1TP0 A;  1ONK B;  4P6A A;  1DFC A;  8I1B A;  3ZXG A;  3CA5 A;  1BFC A;  1BLA A;  1ITB A;  1G82 A;  4GAI A;  3BA5 A;  1MD6 A;  3JRR A;  2UUS A;  5FNX A;  3RMY A;  2BFH A;  1OQL B;  2LIE A;  3RTJ B;  4EFR A;  1WD3 A;  4J2S A;  4LO1 A;  5BXR A;  3BAQ A;  2GZB A;  4D0T A;  2NS2 A;  4USO A;  2D23 A;  4LO3 A;  1ISX A;  5DZU A;  3NBE A;  4END A;  5EHA A;  1TTU A;  3FJH A;  1ISW A;  3BRG C;  5FZU A;  1DJS B;  2E4M C;  1JT3 A;  4TLP A;  3F1R A;  1W3F A;  2VSE A;  1G9D A;  1FGA A;  2WRY A;  4L4H A;  1IT0 A;  1R8N A;  1DZC A;  2D22 A;  3NBD A;  4XFU A;  1T9F A;  3MPP G;  5EG6 C;  1W3A A;  1JLY A;  2AAI B;  4QKS A;  4A7Z A;  2KI4 A;  2D44 A;  1E0O A;  2Y9G A;  4IQP A;  4X38 A;  2AFG A;  4Q9P A;  1TIE A;  3E8L C;  4GOV A;  4HJJ A;  1IRA X;  4H04 A;  1WBC A;  3N7M A;  3WIN A;  4IY8 A;  1SZ6 B;  4I4O A;  4KC3 A;  3PHZ A;  4QC4 A;  1NZK A;  1S0G A;  3A21 A;  3AJ6 A;  3LTQ A;  4CJM A;  1Z2V A;  3SNV A;  3A22 A;  4PC4 A;  2ZQO A;  3UD9 A;  1ABR B;  2L5X A;  4X3A A;  2KKI A;  3ZXD A;  1F31 A;  3V0A A;  2K4A B;  1YTO A;  3CA4 A;  1W3G A;  4I4R A;  3O49 A;  4JRA A;  4P0J A;  2KI6 B;  3CA0 A;  1SR4 C;  4HR6 C;  1PUM B;  1HWP B;  2BEA A;  2ERM A;  5EC5 A;  1YF8 B;  4I2S A;  3BAV A;  3RTI B;  4G6J A;  1EYL A;  4ION A;  2ZQN A;  4MZH A;  4I0Y A;  5JLV A;  3AKF A;  4QKR A;  2VXT I;  4ISQ A;  1HIB A;  4H9W A;  3CAH A;  1XYF A;  4XFS A;  3FJF A;  3OGF A;  4L4I A;  2FFU A;  4DCK C;  3N0K A;  5JMC A;  1KNM A;  2AXM A;  2P39 A;  3O4B A;  4I37 A;  1IJT A;  2ZR1 B;  3EF2 A;  4Z9W B;  3O44 A;  4ZA3 B;  4ZKT B;  1ISY A;  4FVV A;  6I1B A;  2D20 A;  4I4X A;  3IM6 A;  3FJA A;  2ET2 A;  5BQU C;  5I1B A;  1HCE A;  3R4S A;  3BX1 C;  3BRD A;  3HBW A;  1IRP A;  1FMZ A;  4ZLB B;  1DQO A;  1TOO A;  2FGF A;  1UPS A;  2VU9 A;  4JKQ A;  3Q7Y A;  4I4Y A;  1HKN A;  2NYY A;  4LO0 C;  4X37 A;  3ILA A;  2VLC A;  3VUO A;  1L2H A;  4IYB A;  3CA3 A;  3FUO A;  3S8K A;  3BAG A;  4I1E A;  2DS0 A;  1Z4S A;  4USP A;  3WO4 A;  4OUJ A;  3BAO A;  4I96 A;  3OJ2 A;  5F90 A;  3VT2 A;  3UJ4 A;  3PG0 A;  2HZ9 A;  1AFC A;  3FJ8 A;  3BA7 A;  1IHK A;  3POK A;  3FFZ A;  4OEE A;  4ISR A;  3IAG C;  2YUG A;  4ZFU B;  4LO2 C;  4A7K A;  2HWM A;  3I2X A;  4I4V A;  1Z0H A;  3WO2 A;  2QYI B;  3ZX7 A;  1PC8 B;  2VSA A;  3H6Q A;  9ILB A;  1NUN A;  5DSS B;  3CU1 B;  1BFG A;  3P6J A;  1DFQ A;  1P63 A;  3CRI A;  3RSJ A;  4A7Y A;  4D0Z A;  3P53 A;  4OEG A;  1I1B A;  4JQ0 A;  3IIR A;  1M2T B;  2IWT B;  3VT1 A;  4MZF B;  4QO3 A;  1SR4 A;  1AVU A;  2D24 A;  3PME A;  4HA2 A;  5BOW A;  1V6W A;  5BXS A;  1YXW A;  2DRZ A;  4OW4 A;  1YBI A;  4UY4 A;  4QAL A;  1BFB A;  1K5U A;  3O4A A;  1BLD A;  3LLP A;  1RG8 A;  3Q7W A;  3FJE A;  5D61 A;  1T4Q A;  1DIW A;  1HWN B;  1ISV A;  4YOL A;  3FJD A;  1Q03 A;  2P23 A;  5BQU A;  4KEI A;  21BI A;  4P0K A;  2R9K B;  5DVH A;  3FJC A;  3VWC A;  3WO3 A;  1CE7 B;  5D62 A;  3TC2 A;  1BAS A;  5DUY A;  3VT0 A;  1N4K A;  3BAH A;  4LO0 A;  1FN0 A;  1S0F A;  3BA4 A;  3H6S E;  2F2F C;  1EV2 A;  4JAW A;  1G9B A;  4R6U B;  4KEJ A;  4I1B A;  2Y9W C;  3AH4 A;  5D63 A;  3ZC9 A;  31BI A;  2BEB A;  4I4U A;  4LO1 C;  2FO1 A;  3OJM A;  1JT5 A;  1II4 A;  2QN4 A;  3WMV A;  1V6U A;  4J2Y A;  1FWU A;  4LO3 C;  4LO7 B;  4I7I A;  3NBN A;  4ZFY B;  3FJJ A;  5BXP A;  5F8S A;  2XOA A;  1Q1U A;  3FJB A;  2NM1 A;  5BVP I;  3V0B B;  1WBA A;  4ZBV B;  4P0L A;  2MIB A;  1BAR A;  3UD7 A;  1JY0 A;  4QBC A;  1QQK A;  4XFT A;  1DLL A;  7I1B A;  1PZZ A;  1MC9 A;  1VCL A;  1TFM B;  3N7K A;  2NZ9 A;  2E4M A;  4WBC A;  3O4C A;  2D7I A;  1S0C A;  4KEK A;  2KH2 A;  4AN7 B;  3BAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...