4XKIA

Human fibroblast growth factor - 1 (fgf-1) mutant s116r
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
MHHHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGRCKRGPRTHYGQKAILFLPLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical characterizations of Fibroblast Growth Factor - 1 mutant with increased heparin binding affinity
rcsb
molecule keywords Fibroblast growth factor 1
molecule tags Growth factor
source organism Homo sapiens
total genus 37
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4xkiA00
1SZ6B 3WO3A 4KBBA 3Q7WA 3V0BA 3BA4A 2F2FC 4CJMA 2Q3NB 3LLPA 1UPSA 5D61A 4HA2A 1S0EA 3N7LA 2ZR1B 1XYFA 4I3NA 1FQ9A 4IZXA 3Q7XA 3FJKA 2Z48A 3AKGA 4II0A 3I29B 1M16A 1G9CA 1ISXA 2GZBA 3NBNA 3H6QA 1KNMA 3FJAA 4DCKC 4XFTA 4QBCA 4ZGRB 3BTAA 4EB2B 3D7WB 2HWAA 1DQOA 4G1RA 1IRAX 5BXTA 3E8LC 4AN7B 3VEQA 2LIQA 4A7ZA 5F90A 1TIEA 3BRDA 4LO0C 1W3FA 4JKQA 3WA1A 3WINA 1Q03A 4P0JA 4XFUA 3WMVA 1AVAC 5BXSA 3HALA 1AFCA 3FUQA 4I4YA 3IAGC 3KMVA 4GP0A 1ILR1 1PZZA 3FUOA 2J3PA 3UD8A 4EFRA 1NZKA 3O4AA 2AXMA 1T4QA 3A21A 1DFQA 1ISYA 2M49A 1ITBA 3FJDA 3CA6A 1AVXB 4LO3A 4QD2C 1I1EA 5BP5C 1WBCA 3IIRA 4OW4A 5FZYA 2FGFA 1PUUB 1JT7A 2Z49A 3PG0A 2UUSA 2F2FA 1BLDA 1JT4A 3UD7A 3VSZA 2D44A 1Z4SA 3LTQA 1S0DA 3ZXGA 3JRRA 2Y9XE 3O5WB 4OEEA 3NBCA 1S0LA 4I1EA 3S8JA 5B2HA 4Q9PA 5F8YA 4ZOTA 1W3GA 4QD2B 3MALA 2NVHA 3HN1A 3K1XA 4ZKTB 2D43A 3NBEA 2DREA 4XFSA 1XHBA 1FV3A 3O4CA 3JUTA 5BQUC 3BAUA 1JT3A 1DIWA 3N7JA 4LO7C 3RSJA 1E0OA 1S0BA 4I8MA 1P63A 2ZQNA 3AJ5A 1FWUA 2D24A 1YTOA 4IQPA 1T9FA 1TFMB 2RSTA 4I37A 3VT2A 2HW9A 3OBRA 1TTUA 2MLLB 4LO8B 1QXMA 3VT1A 2K8RA 2XOAA 4Q91A 2ZQOA 3R4UA 2VUAA 1HCDA 2VXRA 2D23A 2NP0A 3AKIA 5D62A 4P0LA 4J23B 4JP0A 1FMMS 4QKRA 3AKFA 2RQ9A 4H04A 4QKSA 2Q9XA 3POKA 1AVUA 1FV2A 3UJ4A 3OGGA 3H6SE 5BP5A 2P23A 3BAOA 4ISQA 2X2TA 3IM5A 2AQZA 1XZZA 1R8OA 3A07A 5F8WA 1DLLA 4P0KA 1FMZA 21BIA 1F31A 5BVPI 4J2KA 3FGMA 3P6JA 2VU9A 3O44A 4JAWA 4I96A 1AVWB 1S0FA 3AH2A 3IM6A 1YBIA 3ZX7A 2VLCA 3I2XA 4I4UA 2BEBA 3F62B 4GAFA 4TLPA 3VWCA 2DRZA 2P39A 4I4XA 1BARA 3PMEA 1CE7B 1HWOB 3O3QA 3CRIA 3OJ2A 5DZUA 2WRYA 2YUGA 3I2AA 1BASA 3VT0A 3C9ZA 2D1ZA 2BEAA 4QC4A 4USOA 3FJFA 3N7KA 3OJVA 3CRGA 1V6UA 1DJSB 1G9AA 1K5UA 3O4BA 5FNWA 4OEGA 3AH4A 1SR4C 2WBCA 3UJ0A 3HOMA 4DEPA 5HPZA 4JRAA 1PC8B 3ILAA 2NZ9A 1DZCA 2KLLA 2MIBA 1BFBA 1MC9A 5BXRA 3OGFA 4R6UB 1QQLA 3RTJB 1VCLA 1EV2A 1ISVA 4J2XA 4LO2C 3VSFA 1DQGA 4I0YA 1G9BA 1OQLB 2NTDA 4ZLBB 3VUOA 3BAVA 4X38A 4H9WA 4F83A 1HKNA 4G6JA 1JT5A 4J2SA 4G6MA 5FZUA 3CQAA 3UDAA 1Z2VA 8I1BA 2D20A 2HZ9A 1TOOA 3CA0A 1IT0A 1YXWA 5JLVA 2I1BA 3CA4A 4QALA 3W9TA 1IHKA 4I1BA 4GAIA 5JMCA 3F1RA 3OJMA 3AZWA 41BIA 1BA7A 4IY9A 2NM1A 4JQ0A 5G00A 2QN4A 4I4VA 5DSSB 4AN6A 5E24E 3V79C 4OWLA 4ZBVB 1HCEA 4QO3A 3BAHA 1S0GA 2D7RA 1NUNA 1WD4A 4Q9GA 9ILBA 4LO0A 1CVSA 5I1BA 4I2SA 4OUJA 4EFQA 3BA5A 1SR4A 4ENDA 2FFUA 2IWTB 4A7KA 3AKHA 3S8KA 3V0AB 4IYBA 1RZOB 1RG8A 4I6IA 4QBVA 5FZZA 4L4HA 2Y9WC 3BADA 3V0BB 1G82A 4GP3A 1AXMA 4LO2A 3BAQA 4X37A 4OWKA 5F8SA 2KKIA 5EG6C 4D0TA 3WO4A 4KC3A 3PHZA 1FWVA 3FJCA 1ISZA 3FJ9A 3N7MA 2DS0A 1M2TB 3P6IA 2BFHA 4KEKA 1PWAA 3HMYA 1BFCA 1II4A 4WBCA 1BLAA 2R9KB 2KI6B 1V6WA 1DZDA 4ISRA 2X2SA 4X3AA 3RMXA 4IHZA 5GAQA 3PUBA 2ESUA 2E4MC 3B9UA 1A8DA 4OEFA 4HJJA 2KH2A 2HWMA 3FJEA 5BQUA 4FVVA 4ZFWB 4IY8A 5D63A 3CA5A 3BRGC 4GOYA 7I1BA 3AZVA 1IRPA 3CAHA 4D8HA 3BAGA 1L2HA 4D0ZA 5BOWA 3OBTA 4IZEA 1IJTA 3QYDA 2MC2A 1HIBA 1V6XA 4Z9WB 2FDBM 1TP0A 4FGFA 3FJBA 1RY7A 3AJ6A 4KEIA 4G9NA 4F34A 2K43A 1IILA 1HWMB 2Y9GA 1EVTA 3N0KA 2AAIB 1IOBA 3FJHA 4EFPA 1JTCA 5EC5A 1GGPB 1AF9A 3T8SA 1YYNA 4A7YA 2K4AB 2AFGA 2ET2A 1YF8B 3R4SA 4OWJA 4I4RA 4JPZA 1ISWA 3O49A 3FFZA 1W3AA 3Q7YA 1JQZA 3A22A 3CU1B 2GO2A 3QR5A 4I4PA 2NYYA 2RG9B 4GOVA 4P6AA 4Z8SB 1Q1UA 3MPPG 3AH1A 3H6RB 4G9MA 4JKXB 4ZFUB 2E4MA 1K5VA 3BB2A 4IONA 1RMLA 4I7IA 2D7IA 3ZC8A 31BIA 1V6VA 3NJ5A 4EKXB 4I4OA 2F8XC 2DRYA 3O4DA 1HWPB 1JLXA 3IM7A 4LO1C 3ZXDA 1WD3A 4USPA 2D22A 3CA1A 3EF2A 1HWNB 1MD6A 1BFGA 1G9DA 4PC4A 4I4QA 2VSAA 3TC2A 3WO2A 3UD9A 4KEJA 3CRHA 5DVHA 2FFVA 3BX1C 4I4SA 1EYLA 3O4OA 1J0SA 3RTIB 3H6RA 3P53A 1EPWA 3ZC9A 1R8NA 3WMUA 1XG6A 4XKIA 4ZA3B 1PUMB 1ONKB 3A23A 2L5XA 3HSMA 1I1BA 2Y9FA 2KI4A 4X39A 1Z0HA 1JY0A 1Q04A 1ABRB 2LIEA 2FO1A 2VXTI 3CA3A 1N4KA 4ZFYB 1FN0A 3FJIA 1JLYA 4J2YA 5FNXA 3HBWA 3BRFA 4DENA 3WINC 1WBAA 2VSEA 4LO7B 3SNVA 2ERMA 3BA7A 4YOLA 1FGAA 1BFFA 4EEEB 5BXPA 1DFCA 1TWMA 1D0HA 1S0CA 2QYIB 4L4IA 2IHOA 1TWEA 4HR6C 4LO1A 3V0AA 5DUYA 3FJ8A 3NBDA 4LO3C 5EHAA 1QQKA 3RMYA 6I1BA 3FJJA
chains in the Genus database with same CATH superfamily
1SZ6B 3WO3A 4KBBA 3Q7WA 3V0BA 3BA4A 2F2FC 4CJMA 2Q3NB 3LLPA 1UPSA 5D61A 4HA2A 1S0EA 3N7LA 2ZR1B 1XYFA 4I3NA 1FQ9A 4IZXA 3Q7XA 3FJKA 2Z48A 3AKGA 4II0A 3I29B 1M16A 1G9CA 1ISXA 2GZBA 3NBNA 3H6QA 1KNMA 3FJAA 4DCKC 4XFTA 4QBCA 4ZGRB 3BTAA 4EB2B 3D7WB 2HWAA 1DQOA 4G1RA 1IRAX 5BXTA 3E8LC 4AN7B 3VEQA 2LIQA 4A7ZA 5F90A 1TIEA 3BRDA 4LO0C 1W3FA 4JKQA 3WA1A 3WINA 1Q03A 4UY4A 4P0JA 4XFUA 3WMVA 1AVAC 5BXSA 3HALA 1AFCA 3FUQA 4I4YA 3IAGC 3KMVA 4GP0A 1ILR1 1PZZA 3FUOA 2J3PA 3UD8A 4EFRA 1NZKA 3O4AA 2AXMA 1T4QA 3A21A 1DFQA 1ISYA 2M49A 1ITBA 3FJDA 3CA6A 1AVXB 4LO3A 4QD2C 1I1EA 5BP5C 1WBCA 3IIRA 4OW4A 5FZYA 2FGFA 1PUUB 1JT7A 2Z49A 3PG0A 2UUSA 2F2FA 1BLDA 1JT4A 3UD7A 3VSZA 2D44A 1Z4SA 3LTQA 1S0DA 3ZXGA 3JRRA 2Y9XE 3O5WB 4OEEA 3NBCA 1S0LA 4I1EA 3S8JA 5B2HA 4Q9PA 5F8YA 4ZOTA 1W3GA 4QD2B 3MALA 2NVHA 3HN1A 3K1XA 4ZKTB 2D43A 3NBEA 2DREA 4XFSA 1XHBA 1FV3A 3O4CA 3JUTA 5BQUC 3BAUA 1JT3A 1DIWA 3N7JA 4LO7C 3RSJA 1E0OA 1S0BA 4I8MA 1P63A 2ZQNA 3AJ5A 1FWUA 2D24A 1YTOA 4IQPA 1T9FA 1TFMB 2RSTA 4I37A 3VT2A 2HW9A 3OBRA 1TTUA 2MLLB 4LO8B 1QXMA 3VT1A 2K8RA 2XOAA 4Q91A 2ZQOA 3R4UA 2VUAA 1HCDA 2VXRA 2D23A 2NP0A 3AKIA 5D62A 4P0LA 4J23B 4JP0A 1FMMS 4QKRA 3AKFA 2RQ9A 4H04A 4QKSA 2Q9XA 3POKA 1AVUA 1FV2A 3UJ4A 3OGGA 3H6SE 5BP5A 2P23A 3BAOA 4ISQA 2X2TA 3IM5A 2AQZA 1XZZA 1R8OA 3A07A 5F8WA 1DLLA 4P0KA 1FMZA 21BIA 1F31A 5BVPI 4J2KA 3FGMA 3P6JA 2VU9A 3O44A 4JAWA 4I96A 1AVWB 1S0FA 3AH2A 3IM6A 1YBIA 3ZX7A 2VLCA 3I2XA 4I4UA 2BEBA 3F62B 4GAFA 4TLPA 3VWCA 2DRZA 2P39A 4I4XA 1BARA 3PMEA 1CE7B 1HWOB 3O3QA 3CRIA 3OJ2A 5DZUA 2WRYA 2YUGA 3I2AA 1BASA 3VT0A 3C9ZA 2D1ZA 2BEAA 4QC4A 4USOA 3FJFA 3N7KA 3OJVA 3CRGA 1V6UA 1DJSB 1G9AA 1K5UA 3O4BA 5FNWA 4OEGA 3AH4A 1SR4C 2WBCA 3UJ0A 3HOMA 4DEPA 5HPZA 4JRAA 1PC8B 3ILAA 2NZ9A 1DZCA 2KLLA 2MIBA 1BFBA 1MC9A 5BXRA 3OGFA 4R6UB 1QQLA 3RTJB 1VCLA 1EV2A 1ISVA 4J2XA 4LO2C 3VSFA 1DQGA 4I0YA 1G9BA 1OQLB 2NTDA 4ZLBB 3VUOA 3BAVA 4X38A 4H9WA 4MZHA 4F83A 1HKNA 4G6JA 1JT5A 4J2SA 4G6MA 5FZUA 3CQAA 3UDAA 1Z2VA 8I1BA 2D20A 2HZ9A 1TOOA 3CA0A 1IT0A 1YXWA 5JLVA 2I1BA 3CA4A 4QALA 3W9TA 1IHKA 4I1BA 4GAIA 5JMCA 3F1RA 3OJMA 3AZWA 41BIA 1BA7A 4IY9A 2NM1A 4JQ0A 5G00A 2QN4A 4I4VA 5DSSB 4AN6A 5E24E 3V79C 4OWLA 4ZBVB 1HCEA 4QO3A 3BAHA 1S0GA 2D7RA 1NUNA 1WD4A 4Q9GA 9ILBA 4LO0A 1CVSA 5I1BA 4I2SA 4OUJA 4EFQA 3BA5A 1SR4A 4ENDA 2FFUA 2IWTB 4A7KA 3AKHA 3S8KA 3V0AB 4IYBA 1RZOB 1RG8A 4I6IA 4QBVA 5FZZA 4L4HA 2Y9WC 3BADA 3V0BB 1G82A 4GP3A 1AXMA 4LO2A 3BAQA 4X37A 4OWKA 5F8SA 2KKIA 5EG6C 4MZFB 4D0TA 3WO4A 4KC3A 3PHZA 1FWVA 3FJCA 1ISZA 3FJ9A 3N7MA 2DS0A 1M2TB 3P6IA 2BFHA 4KEKA 1PWAA 3HMYA 1BFCA 1II4A 4WBCA 1BLAA 2R9KB 2KI6B 1V6WA 1DZDA 4ISRA 2X2SA 4X3AA 3RMXA 4IHZA 5GAQA 3PUBA 2ESUA 2E4MC 3B9UA 1A8DA 4OEFA 4HJJA 2KH2A 2HWMA 3FJEA 5BQUA 4FVVA 4ZFWB 4IY8A 5D63A 3CA5A 3BRGC 4GOYA 7I1BA 3AZVA 1IRPA 3CAHA 4D8HA 3BAGA 1L2HA 4D0ZA 5BOWA 3OBTA 4IZEA 1IJTA 3QYDA 2MC2A 1HIBA 1V6XA 4H75A 4Z9WB 2FDBM 1TP0A 4FGFA 3FJBA 1RY7A 3AJ6A 4KEIA 4G9NA 4F34A 2K43A 1IILA 1HWMB 2Y9GA 1EVTA 3N0KA 2AAIB 1IOBA 3FJHA 4EFPA 1JTCA 5EC5A 1GGPB 1AF9A 3T8SA 1YYNA 4A7YA 2K4AB 2AFGA 2ET2A 1YF8B 3R4SA 4OWJA 4I4RA 4JPZA 1ISWA 3O49A 3FFZA 1W3AA 3Q7YA 1JQZA 3A22A 3CU1B 2GO2A 3QR5A 4I4PA 2NYYA 2RG9B 4GOVA 4P6AA 4Z8SB 1Q1UA 3MPPG 3AH1A 3H6RB 4G9MA 4JKXB 4ZFUB 2E4MA 1K5VA 3BB2A 4IONA 1RMLA 4I7IA 2D7IA 3ZC8A 31BIA 1V6VA 3NJ5A 4EKXB 4I4OA 2F8XC 2DRYA 3O4DA 1HWPB 1JLXA 3IM7A 4LO1C 3ZXDA 1WD3A 4USPA 2D22A 3CA1A 3EF2A 1HWNB 1MD6A 1BFGA 1G9DA 4PC4A 4I4QA 2VSAA 3TC2A 3WO2A 3UD9A 4KEJA 3CRHA 5DVHA 2FFVA 3BX1C 4I4SA 1EYLA 3O4OA 1J0SA 3RTIB 3H6RA 3P53A 1EPWA 3ZC9A 1R8NA 3WMUA 1XG6A 4XKIA 4ZA3B 1PUMB 1ONKB 3A23A 2L5XA 2NS2A 3HSMA 1I1BA 2Y9FA 2KI4A 4X39A 1Z0HA 1JY0A 1Q04A 1ABRB 2LIEA 2FO1A 2VXTI 3CA3A 1N4KA 4MZGB 4ZFYB 1FN0A 3FJIA 1JLYA 4J2YA 5FNXA 3HBWA 3BRFA 4DENA 3WINC 1WBAA 2VSEA 4LO7B 3SNVA 2ERMA 3BA7A 4YOLA 1FGAA 1BFFA 4EEEB 5BXPA 1DFCA 1TWMA 1D0HA 1S0CA 2QYIB 4L4IA 2IHOA 1TWEA 4HR6C 4LO1A 3V0AA 5DUYA 3FJ8A 3NBDA 4LO3C 5EHAA 1QQKA 3RMYA 6I1BA 3FJJA
chains in the Genus database with same CATH topology
1SZ6B 3WO3A 4KBBA 3Q7WA 3V0BA 3BA4A 2F2FC 4CJMA 2Q3NB 3LLPA 1UPSA 5D61A 4HA2A 1S0EA 3N7LA 2ZR1B 1XYFA 4I3NA 1FQ9A 4IZXA 3Q7XA 3FJKA 2Z48A 3AKGA 4II0A 3I29B 1M16A 1G9CA 1ISXA 2GZBA 3NBNA 3H6QA 1KNMA 3FJAA 4DCKC 4XFTA 4QBCA 4ZGRB 3BTAA 4EB2B 3D7WB 2HWAA 1DQOA 4G1RA 1IRAX 5BXTA 3E8LC 4AN7B 3VEQA 2LIQA 4A7ZA 5F90A 1TIEA 3BRDA 4LO0C 1W3FA 4JKQA 3WA1A 3WINA 1Q03A 4UY4A 4P0JA 4XFUA 3WMVA 1AVAC 5BXSA 3HALA 1AFCA 3FUQA 4I4YA 3IAGC 3KMVA 4GP0A 1ILR1 1PZZA 3FUOA 2J3PA 3UD8A 4EFRA 1NZKA 3O4AA 2AXMA 1T4QA 3A21A 1DFQA 1ISYA 2M49A 1ITBA 3FJDA 3CA6A 1AVXB 4LO3A 4QD2C 1I1EA 5BP5C 1WBCA 3IIRA 4OW4A 5FZYA 2FGFA 1PUUB 1JT7A 2Z49A 3PG0A 2UUSA 2F2FA 1BLDA 1JT4A 3UD7A 3VSZA 2D44A 1Z4SA 3LTQA 1S0DA 3ZXGA 3JRRA 2Y9XE 3O5WB 4OEEA 3NBCA 1S0LA 4I1EA 3S8JA 5B2HA 4Q9PA 5F8YA 4ZOTA 1W3GA 4QD2B 3MALA 2NVHA 3HN1A 3K1XA 4ZKTB 2D43A 3NBEA 2DREA 4XFSA 1XHBA 1FV3A 3O4CA 3JUTA 5BQUC 3BAUA 1JT3A 1DIWA 3N7JA 4LO7C 3RSJA 1E0OA 1S0BA 4I8MA 1P63A 2ZQNA 3AJ5A 1FWUA 2D24A 1YTOA 4IQPA 1T9FA 1TFMB 2RSTA 4I37A 3VT2A 2HW9A 3OBRA 1TTUA 2MLLB 4LO8B 1QXMA 3VT1A 2K8RA 2XOAA 4Q91A 2ZQOA 3R4UA 2VUAA 1HCDA 2VXRA 2D23A 2NP0A 3AKIA 5D62A 4P0LA 4J23B 4JP0A 1FMMS 4QKRA 3AKFA 2RQ9A 4H04A 4QKSA 2Q9XA 3POKA 1AVUA 1FV2A 3UJ4A 3OGGA 3H6SE 5BP5A 2P23A 3BAOA 4ISQA 2X2TA 3IM5A 2AQZA 1XZZA 1R8OA 3A07A 5F8WA 1DLLA 4P0KA 1FMZA 21BIA 1F31A 5BVPI 4J2KA 3FGMA 3P6JA 2VU9A 3O44A 4JAWA 4I96A 1AVWB 1S0FA 3AH2A 3IM6A 1YBIA 3ZX7A 2VLCA 3I2XA 4I4UA 2BEBA 3F62B 4GAFA 4TLPA 3VWCA 2DRZA 2P39A 4I4XA 1BARA 3PMEA 1CE7B 1HWOB 3O3QA 3CRIA 3OJ2A 5DZUA 2WRYA 2YUGA 3I2AA 1BASA 3VT0A 3C9ZA 2D1ZA 2BEAA 4QC4A 4USOA 3FJFA 3N7KA 3OJVA 3CRGA 1V6UA 1DJSB 1G9AA 1K5UA 3O4BA 5FNWA 4OEGA 3AH4A 1SR4C 2WBCA 3UJ0A 3HOMA 4DEPA 5HPZA 4JRAA 1PC8B 3ILAA 2NZ9A 1DZCA 2KLLA 2MIBA 1BFBA 1MC9A 5BXRA 3OGFA 4R6UB 1QQLA 3RTJB 1VCLA 1EV2A 1ISVA 4J2XA 4LO2C 3VSFA 1DQGA 4I0YA 1G9BA 1OQLB 2NTDA 4ZLBB 3VUOA 3BAVA 4X38A 4H9WA 4MZHA 4F83A 1HKNA 4G6JA 1JT5A 4J2SA 4G6MA 5FZUA 3CQAA 3UDAA 1Z2VA 8I1BA 2D20A 2HZ9A 1TOOA 3CA0A 1IT0A 1YXWA 5JLVA 2I1BA 3CA4A 4QALA 3W9TA 1IHKA 4I1BA 4GAIA 5JMCA 3F1RA 3OJMA 3AZWA 41BIA 1BA7A 4IY9A 2NM1A 4JQ0A 5G00A 2QN4A 4I4VA 5DSSB 4AN6A 5E24E 3V79C 4OWLA 4ZBVB 1HCEA 4QO3A 3BAHA 1S0GA 2D7RA 1NUNA 1WD4A 4Q9GA 9ILBA 4LO0A 1CVSA 5I1BA 4I2SA 4OUJA 4EFQA 3BA5A 1SR4A 4ENDA 2FFUA 2IWTB 4A7KA 3AKHA 3S8KA 3V0AB 4IYBA 1RZOB 1RG8A 4I6IA 4QBVA 5FZZA 4L4HA 2Y9WC 3BADA 3V0BB 1G82A 4GP3A 1AXMA 4LO2A 3BAQA 4X37A 4OWKA 5F8SA 2KKIA 5EG6C 4MZFB 4D0TA 3WO4A 4KC3A 3PHZA 1FWVA 3FJCA 1ISZA 3FJ9A 3N7MA 2DS0A 1M2TB 3P6IA 2BFHA 4KEKA 1PWAA 3HMYA 1BFCA 1II4A 4WBCA 1BLAA 2R9KB 2KI6B 1V6WA 1DZDA 4ISRA 2X2SA 4X3AA 3RMXA 4IHZA 5GAQA 3PUBA 2ESUA 2E4MC 3B9UA 1A8DA 4OEFA 4HJJA 2KH2A 2HWMA 3FJEA 5BQUA 4FVVA 4ZFWB 4IY8A 5D63A 3CA5A 3BRGC 4GOYA 7I1BA 3AZVA 1IRPA 3CAHA 4D8HA 3BAGA 1L2HA 4D0ZA 5BOWA 3OBTA 4IZEA 1IJTA 3QYDA 2MC2A 1HIBA 1V6XA 4H75A 4Z9WB 2FDBM 1TP0A 4FGFA 3FJBA 1RY7A 3AJ6A 4KEIA 4G9NA 4F34A 2K43A 1IILA 1HWMB 2Y9GA 1EVTA 3N0KA 2AAIB 1IOBA 3FJHA 4EFPA 1JTCA 5EC5A 1GGPB 1AF9A 3T8SA 1YYNA 4A7YA 2K4AB 2AFGA 2ET2A 1YF8B 3R4SA 4OWJA 4I4RA 4JPZA 1ISWA 3O49A 3FFZA 1W3AA 3Q7YA 1JQZA 3A22A 3CU1B 2GO2A 3QR5A 4I4PA 2NYYA 2RG9B 4GOVA 4P6AA 4Z8SB 1Q1UA 3MPPG 3AH1A 3H6RB 4G9MA 4JKXB 4ZFUB 2E4MA 1K5VA 3BB2A 4IONA 1RMLA 4I7IA 2D7IA 3ZC8A 31BIA 1V6VA 3NJ5A 4EKXB 4I4OA 2F8XC 2DRYA 3O4DA 1HWPB 1JLXA 3IM7A 4LO1C 3ZXDA 1WD3A 4USPA 2D22A 3CA1A 3EF2A 1HWNB 1MD6A 1BFGA 1G9DA 4PC4A 4I4QA 2VSAA 3TC2A 3WO2A 3UD9A 4KEJA 3CRHA 5DVHA 2FFVA 3BX1C 4I4SA 1EYLA 3O4OA 1J0SA 3RTIB 3H6RA 3P53A 1EPWA 3ZC9A 1R8NA 3WMUA 1XG6A 4XKIA 4ZA3B 1PUMB 1ONKB 3A23A 2L5XA 2NS2A 3HSMA 1I1BA 2Y9FA 2KI4A 4X39A 1Z0HA 1JY0A 1Q04A 1ABRB 2LIEA 2FO1A 2VXTI 3CA3A 1N4KA 4MZGB 4ZFYB 1FN0A 3FJIA 1JLYA 4J2YA 5FNXA 3HBWA 3BRFA 4DENA 3WINC 1WBAA 2VSEA 4LO7B 3SNVA 2ERMA 3BA7A 4YOLA 1FGAA 1BFFA 4EEEB 5BXPA 1DFCA 1TWMA 1D0HA 1S0CA 2QYIB 4L4IA 2IHOA 1TWEA 4HR6C 4LO1A 3V0AA 5DUYA 3FJ8A 3NBDA 4LO3C 5EHAA 1QQKA 3RMYA 6I1BA 3FJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZ6 B;  3WO3 A;  4KBB A;  3Q7W A;  3V0B A;  3BA4 A;  2F2F C;  4CJM A;  2Q3N B;  3LLP A;  1UPS A;  5D61 A;  4HA2 A;  1S0E A;  3N7L A;  2ZR1 B;  1XYF A;  4I3N A;  1FQ9 A;  4IZX A;  3Q7X A;  3FJK A;  2Z48 A;  3AKG A;  4II0 A;  3I29 B;  1M16 A;  1G9C A;  1ISX A;  2GZB A;  3NBN A;  3H6Q A;  1KNM A;  3FJA A;  4DCK C;  4XFT A;  4QBC A;  4ZGR B;  3BTA A;  4EB2 B;  3D7W B;  2HWA A;  1DQO A;  4G1R A;  1IRA X;  5BXT A;  3E8L C;  4AN7 B;  3VEQ A;  2LIQ A;  4A7Z A;  5F90 A;  1TIE A;  3BRD A;  4LO0 C;  1W3F A;  4JKQ A;  3WA1 A;  3WIN A;  1Q03 A;  4P0J A;  4XFU A;  3WMV A;  1AVA C;  5BXS A;  3HAL A;  1AFC A;  3FUQ A;  4I4Y A;  3IAG C;  3KMV A;  4GP0 A;  1ILR 1;  1PZZ A;  3FUO A;  2J3P A;  3UD8 A;  4EFR A;  1NZK A;  3O4A A;  2AXM A;  1T4Q A;  3A21 A;  1DFQ A;  1ISY A;  2M49 A;  1ITB A;  3FJD A;  3CA6 A;  1AVX B;  4LO3 A;  4QD2 C;  1I1E A;  5BP5 C;  1WBC A;  3IIR A;  4OW4 A;  5FZY A;  2FGF A;  1PUU B;  1JT7 A;  2Z49 A;  3PG0 A;  2UUS A;  2F2F A;  1BLD A;  1JT4 A;  3UD7 A;  3VSZ A;  2D44 A;  1Z4S A;  3LTQ A;  1S0D A;  3ZXG A;  3JRR A;  2Y9X E;  3O5W B;  4OEE A;  3NBC A;  1S0L A;  4I1E A;  3S8J A;  5B2H A;  4Q9P A;  5F8Y A;  4ZOT A;  1W3G A;  4QD2 B;  3MAL A;  2NVH A;  3HN1 A;  3K1X A;  4ZKT B;  2D43 A;  3NBE A;  2DRE A;  4XFS A;  1XHB A;  1FV3 A;  3O4C A;  3JUT A;  5BQU C;  3BAU A;  1JT3 A;  1DIW A;  3N7J A;  4LO7 C;  3RSJ A;  1E0O A;  1S0B A;  4I8M A;  1P63 A;  2ZQN A;  3AJ5 A;  1FWU A;  2D24 A;  1YTO A;  4IQP A;  1T9F A;  1TFM B;  2RST A;  4I37 A;  3VT2 A;  2HW9 A;  3OBR A;  1TTU A;  2MLL B;  4LO8 B;  1QXM A;  3VT1 A;  2K8R A;  2XOA A;  4Q91 A;  2ZQO A;  3R4U A;  2VUA A;  1HCD A;  2VXR A;  2D23 A;  2NP0 A;  3AKI A;  5D62 A;  4P0L A;  4J23 B;  4JP0 A;  1FMM S;  4QKR A;  3AKF A;  2RQ9 A;  4H04 A;  4QKS A;  2Q9X A;  3POK A;  1AVU A;  1FV2 A;  3UJ4 A;  3OGG A;  3H6S E;  5BP5 A;  2P23 A;  3BAO A;  4ISQ A;  2X2T A;  3IM5 A;  2AQZ A;  1XZZ A;  1R8O A;  3A07 A;  5F8W A;  1DLL A;  4P0K A;  1FMZ A;  21BI A;  1F31 A;  5BVP I;  4J2K A;  3FGM A;  3P6J A;  2VU9 A;  3O44 A;  4JAW A;  4I96 A;  1AVW B;  1S0F A;  3AH2 A;  3IM6 A;  1YBI A;  3ZX7 A;  2VLC A;  3I2X A;  4I4U A;  2BEB A;  3F62 B;  4GAF A;  4TLP A;  3VWC A;  2DRZ A;  2P39 A;  4I4X A;  1BAR A;  3PME A;  1CE7 B;  1HWO B;  3O3Q A;  3CRI A;  3OJ2 A;  5DZU A;  2WRY A;  2YUG A;  3I2A A;  1BAS A;  3VT0 A;  3C9Z A;  2D1Z A;  2BEA A;  4QC4 A;  4USO A;  3FJF A;  3N7K A;  3OJV A;  3CRG A;  1V6U A;  1DJS B;  1G9A A;  1K5U A;  3O4B A;  5FNW A;  4OEG A;  3AH4 A;  1SR4 C;  2WBC A;  3UJ0 A;  3HOM A;  4DEP A;  5HPZ A;  4JRA A;  1PC8 B;  3ILA A;  2NZ9 A;  1DZC A;  2KLL A;  2MIB A;  1BFB A;  1MC9 A;  5BXR A;  3OGF A;  4R6U B;  1QQL A;  3RTJ B;  1VCL A;  1EV2 A;  1ISV A;  4J2X A;  4LO2 C;  3VSF A;  1DQG A;  4I0Y A;  1G9B A;  1OQL B;  2NTD A;  4ZLB B;  3VUO A;  3BAV A;  4X38 A;  4H9W A;  4F83 A;  1HKN A;  4G6J A;  1JT5 A;  4J2S A;  4G6M A;  5FZU A;  3CQA A;  3UDA A;  1Z2V A;  8I1B A;  2D20 A;  2HZ9 A;  1TOO A;  3CA0 A;  1IT0 A;  1YXW A;  5JLV A;  2I1B A;  3CA4 A;  4QAL A;  3W9T A;  1IHK A;  4I1B A;  4GAI A;  5JMC A;  3F1R A;  3OJM A;  3AZW A;  41BI A;  1BA7 A;  4IY9 A;  2NM1 A;  4JQ0 A;  5G00 A;  2QN4 A;  4I4V A;  5DSS B;  4AN6 A;  5E24 E;  3V79 C;  4OWL A;  4ZBV B;  1HCE A;  4QO3 A;  3BAH A;  1S0G A;  2D7R A;  1NUN A;  1WD4 A;  4Q9G A;  9ILB A;  4LO0 A;  1CVS A;  5I1B A;  4I2S A;  4OUJ A;  4EFQ A;  3BA5 A;  1SR4 A;  4END A;  2FFU A;  2IWT B;  4A7K A;  3AKH A;  3S8K A;  3V0A B;  4IYB A;  1RZO B;  1RG8 A;  4I6I A;  4QBV A;  5FZZ A;  4L4H A;  2Y9W C;  3BAD A;  3V0B B;  1G82 A;  4GP3 A;  1AXM A;  4LO2 A;  3BAQ A;  4X37 A;  4OWK A;  5F8S A;  2KKI A;  5EG6 C;  4D0T A;  3WO4 A;  4KC3 A;  3PHZ A;  1FWV A;  3FJC A;  1ISZ A;  3FJ9 A;  3N7M A;  2DS0 A;  1M2T B;  3P6I A;  2BFH A;  4KEK A;  1PWA A;  3HMY A;  1BFC A;  1II4 A;  4WBC A;  1BLA A;  2R9K B;  2KI6 B;  1V6W A;  1DZD A;  4ISR A;  2X2S A;  4X3A A;  3RMX A;  4IHZ A;  5GAQ A;  3PUB A;  2ESU A;  2E4M C;  3B9U A;  1A8D A;  4OEF A;  4HJJ A;  2KH2 A;  2HWM A;  3FJE A;  5BQU A;  4FVV A;  4ZFW B;  4IY8 A;  5D63 A;  3CA5 A;  3BRG C;  4GOY A;  7I1B A;  3AZV A;  1IRP A;  3CAH A;  4D8H A;  3BAG A;  1L2H A;  4D0Z A;  5BOW A;  3OBT A;  4IZE A;  1IJT A;  3QYD A;  2MC2 A;  1HIB A;  1V6X A;  4Z9W B;  2FDB M;  1TP0 A;  4FGF A;  3FJB A;  1RY7 A;  3AJ6 A;  4KEI A;  4G9N A;  4F34 A;  2K43 A;  1IIL A;  1HWM B;  2Y9G A;  1EVT A;  3N0K A;  2AAI B;  1IOB A;  3FJH A;  4EFP A;  1JTC A;  5EC5 A;  1GGP B;  1AF9 A;  3T8S A;  1YYN A;  4A7Y A;  2K4A B;  2AFG A;  2ET2 A;  1YF8 B;  3R4S A;  4OWJ A;  4I4R A;  4JPZ A;  1ISW A;  3O49 A;  3FFZ A;  1W3A A;  3Q7Y A;  1JQZ A;  3A22 A;  3CU1 B;  2GO2 A;  3QR5 A;  4I4P A;  2NYY A;  2RG9 B;  4GOV A;  4P6A A;  4Z8S B;  1Q1U A;  3MPP G;  3AH1 A;  3H6R B;  4G9M A;  4JKX B;  4ZFU B;  2E4M A;  1K5V A;  3BB2 A;  4ION A;  1RML A;  4I7I A;  2D7I A;  3ZC8 A;  31BI A;  1V6V A;  3NJ5 A;  4EKX B;  4I4O A;  2F8X C;  2DRY A;  3O4D A;  1HWP B;  1JLX A;  3IM7 A;  4LO1 C;  3ZXD A;  1WD3 A;  4USP A;  2D22 A;  3CA1 A;  3EF2 A;  1HWN B;  1MD6 A;  1BFG A;  1G9D A;  4PC4 A;  4I4Q A;  2VSA A;  3TC2 A;  3WO2 A;  3UD9 A;  4KEJ A;  3CRH A;  5DVH A;  2FFV A;  3BX1 C;  4I4S A;  1EYL A;  3O4O A;  1J0S A;  3RTI B;  3H6R A;  3P53 A;  1EPW A;  3ZC9 A;  1R8N A;  3WMU A;  1XG6 A;  4XKI A;  4ZA3 B;  1PUM B;  1ONK B;  3A23 A;  2L5X A;  3HSM A;  1I1B A;  2Y9F A;  2KI4 A;  4X39 A;  1Z0H A;  1JY0 A;  1Q04 A;  1ABR B;  2LIE A;  2FO1 A;  2VXT I;  3CA3 A;  1N4K A;  4ZFY B;  1FN0 A;  3FJI A;  1JLY A;  4J2Y A;  5FNX A;  3HBW A;  3BRF A;  4DEN A;  3WIN C;  1WBA A;  2VSE A;  4LO7 B;  3SNV A;  2ERM A;  3BA7 A;  4YOL A;  1FGA A;  1BFF A;  4EEE B;  5BXP A;  1DFC A;  1TWM A;  1D0H A;  1S0C A;  2QYI B;  4L4I A;  2IHO A;  1TWE A;  4HR6 C;  4LO1 A;  3V0A A;  5DUY A;  3FJ8 A;  3NBD A;  4LO3 C;  5EHA A;  1QQK A;  3RMY A;  6I1B A;  3FJJ A; 
#chains in the Genus database with same CATH topology
 1SZ6 B;  3WO3 A;  4KBB A;  3Q7W A;  3V0B A;  3BA4 A;  2F2F C;  4CJM A;  2Q3N B;  3LLP A;  1UPS A;  5D61 A;  4HA2 A;  1S0E A;  3N7L A;  2ZR1 B;  1XYF A;  4I3N A;  1FQ9 A;  4IZX A;  3Q7X A;  3FJK A;  2Z48 A;  3AKG A;  4II0 A;  3I29 B;  1M16 A;  1G9C A;  1ISX A;  2GZB A;  3NBN A;  3H6Q A;  1KNM A;  3FJA A;  4DCK C;  4XFT A;  4QBC A;  4ZGR B;  3BTA A;  4EB2 B;  3D7W B;  2HWA A;  1DQO A;  4G1R A;  1IRA X;  5BXT A;  3E8L C;  4AN7 B;  3VEQ A;  2LIQ A;  4A7Z A;  5F90 A;  1TIE A;  3BRD A;  4LO0 C;  1W3F A;  4JKQ A;  3WA1 A;  3WIN A;  1Q03 A;  4UY4 A;  4P0J A;  4XFU A;  3WMV A;  1AVA C;  5BXS A;  3HAL A;  1AFC A;  3FUQ A;  4I4Y A;  3IAG C;  3KMV A;  4GP0 A;  1ILR 1;  1PZZ A;  3FUO A;  2J3P A;  3UD8 A;  4EFR A;  1NZK A;  3O4A A;  2AXM A;  1T4Q A;  3A21 A;  1DFQ A;  1ISY A;  2M49 A;  1ITB A;  3FJD A;  3CA6 A;  1AVX B;  4LO3 A;  4QD2 C;  1I1E A;  5BP5 C;  1WBC A;  3IIR A;  4OW4 A;  5FZY A;  2FGF A;  1PUU B;  1JT7 A;  2Z49 A;  3PG0 A;  2UUS A;  2F2F A;  1BLD A;  1JT4 A;  3UD7 A;  3VSZ A;  2D44 A;  1Z4S A;  3LTQ A;  1S0D A;  3ZXG A;  3JRR A;  2Y9X E;  3O5W B;  4OEE A;  3NBC A;  1S0L A;  4I1E A;  3S8J A;  5B2H A;  4Q9P A;  5F8Y A;  4ZOT A;  1W3G A;  4QD2 B;  3MAL A;  2NVH A;  3HN1 A;  3K1X A;  4ZKT B;  2D43 A;  3NBE A;  2DRE A;  4XFS A;  1XHB A;  1FV3 A;  3O4C A;  3JUT A;  5BQU C;  3BAU A;  1JT3 A;  1DIW A;  3N7J A;  4LO7 C;  3RSJ A;  1E0O A;  1S0B A;  4I8M A;  1P63 A;  2ZQN A;  3AJ5 A;  1FWU A;  2D24 A;  1YTO A;  4IQP A;  1T9F A;  1TFM B;  2RST A;  4I37 A;  3VT2 A;  2HW9 A;  3OBR A;  1TTU A;  2MLL B;  4LO8 B;  1QXM A;  3VT1 A;  2K8R A;  2XOA A;  4Q91 A;  2ZQO A;  3R4U A;  2VUA A;  1HCD A;  2VXR A;  2D23 A;  2NP0 A;  3AKI A;  5D62 A;  4P0L A;  4J23 B;  4JP0 A;  1FMM S;  4QKR A;  3AKF A;  2RQ9 A;  4H04 A;  4QKS A;  2Q9X A;  3POK A;  1AVU A;  1FV2 A;  3UJ4 A;  3OGG A;  3H6S E;  5BP5 A;  2P23 A;  3BAO A;  4ISQ A;  2X2T A;  3IM5 A;  2AQZ A;  1XZZ A;  1R8O A;  3A07 A;  5F8W A;  1DLL A;  4P0K A;  1FMZ A;  21BI A;  1F31 A;  5BVP I;  4J2K A;  3FGM A;  3P6J A;  2VU9 A;  3O44 A;  4JAW A;  4I96 A;  1AVW B;  1S0F A;  3AH2 A;  3IM6 A;  1YBI A;  3ZX7 A;  2VLC A;  3I2X A;  4I4U A;  2BEB A;  3F62 B;  4GAF A;  4TLP A;  3VWC A;  2DRZ A;  2P39 A;  4I4X A;  1BAR A;  3PME A;  1CE7 B;  1HWO B;  3O3Q A;  3CRI A;  3OJ2 A;  5DZU A;  2WRY A;  2YUG A;  3I2A A;  1BAS A;  3VT0 A;  3C9Z A;  2D1Z A;  2BEA A;  4QC4 A;  4USO A;  3FJF A;  3N7K A;  3OJV A;  3CRG A;  1V6U A;  1DJS B;  1G9A A;  1K5U A;  3O4B A;  5FNW A;  4OEG A;  3AH4 A;  1SR4 C;  2WBC A;  3UJ0 A;  3HOM A;  4DEP A;  5HPZ A;  4JRA A;  1PC8 B;  3ILA A;  2NZ9 A;  1DZC A;  2KLL A;  2MIB A;  1BFB A;  1MC9 A;  5BXR A;  3OGF A;  4R6U B;  1QQL A;  3RTJ B;  1VCL A;  1EV2 A;  1ISV A;  4J2X A;  4LO2 C;  3VSF A;  1DQG A;  4I0Y A;  1G9B A;  1OQL B;  2NTD A;  4ZLB B;  3VUO A;  3BAV A;  4X38 A;  4H9W A;  4MZH A;  4F83 A;  1HKN A;  4G6J A;  1JT5 A;  4J2S A;  4G6M A;  5FZU A;  3CQA A;  3UDA A;  1Z2V A;  8I1B A;  2D20 A;  2HZ9 A;  1TOO A;  3CA0 A;  1IT0 A;  1YXW A;  5JLV A;  2I1B A;  3CA4 A;  4QAL A;  3W9T A;  1IHK A;  4I1B A;  4GAI A;  5JMC A;  3F1R A;  3OJM A;  3AZW A;  41BI A;  1BA7 A;  4IY9 A;  2NM1 A;  4JQ0 A;  5G00 A;  2QN4 A;  4I4V A;  5DSS B;  4AN6 A;  5E24 E;  3V79 C;  4OWL A;  4ZBV B;  1HCE A;  4QO3 A;  3BAH A;  1S0G A;  2D7R A;  1NUN A;  1WD4 A;  4Q9G A;  9ILB A;  4LO0 A;  1CVS A;  5I1B A;  4I2S A;  4OUJ A;  4EFQ A;  3BA5 A;  1SR4 A;  4END A;  2FFU A;  2IWT B;  4A7K A;  3AKH A;  3S8K A;  3V0A B;  4IYB A;  1RZO B;  1RG8 A;  4I6I A;  4QBV A;  5FZZ A;  4L4H A;  2Y9W C;  3BAD A;  3V0B B;  1G82 A;  4GP3 A;  1AXM A;  4LO2 A;  3BAQ A;  4X37 A;  4OWK A;  5F8S A;  2KKI A;  5EG6 C;  4MZF B;  4D0T A;  3WO4 A;  4KC3 A;  3PHZ A;  1FWV A;  3FJC A;  1ISZ A;  3FJ9 A;  3N7M A;  2DS0 A;  1M2T B;  3P6I A;  2BFH A;  4KEK A;  1PWA A;  3HMY A;  1BFC A;  1II4 A;  4WBC A;  1BLA A;  2R9K B;  2KI6 B;  1V6W A;  1DZD A;  4ISR A;  2X2S A;  4X3A A;  3RMX A;  4IHZ A;  5GAQ A;  3PUB A;  2ESU A;  2E4M C;  3B9U A;  1A8D A;  4OEF A;  4HJJ A;  2KH2 A;  2HWM A;  3FJE A;  5BQU A;  4FVV A;  4ZFW B;  4IY8 A;  5D63 A;  3CA5 A;  3BRG C;  4GOY A;  7I1B A;  3AZV A;  1IRP A;  3CAH A;  4D8H A;  3BAG A;  1L2H A;  4D0Z A;  5BOW A;  3OBT A;  4IZE A;  1IJT A;  3QYD A;  2MC2 A;  1HIB A;  1V6X A;  4H75 A;  4Z9W B;  2FDB M;  1TP0 A;  4FGF A;  3FJB A;  1RY7 A;  3AJ6 A;  4KEI A;  4G9N A;  4F34 A;  2K43 A;  1IIL A;  1HWM B;  2Y9G A;  1EVT A;  3N0K A;  2AAI B;  1IOB A;  3FJH A;  4EFP A;  1JTC A;  5EC5 A;  1GGP B;  1AF9 A;  3T8S A;  1YYN A;  4A7Y A;  2K4A B;  2AFG A;  2ET2 A;  1YF8 B;  3R4S A;  4OWJ A;  4I4R A;  4JPZ A;  1ISW A;  3O49 A;  3FFZ A;  1W3A A;  3Q7Y A;  1JQZ A;  3A22 A;  3CU1 B;  2GO2 A;  3QR5 A;  4I4P A;  2NYY A;  2RG9 B;  4GOV A;  4P6A A;  4Z8S B;  1Q1U A;  3MPP G;  3AH1 A;  3H6R B;  4G9M A;  4JKX B;  4ZFU B;  2E4M A;  1K5V A;  3BB2 A;  4ION A;  1RML A;  4I7I A;  2D7I A;  3ZC8 A;  31BI A;  1V6V A;  3NJ5 A;  4EKX B;  4I4O A;  2F8X C;  2DRY A;  3O4D A;  1HWP B;  1JLX A;  3IM7 A;  4LO1 C;  3ZXD A;  1WD3 A;  4USP A;  2D22 A;  3CA1 A;  3EF2 A;  1HWN B;  1MD6 A;  1BFG A;  1G9D A;  4PC4 A;  4I4Q A;  2VSA A;  3TC2 A;  3WO2 A;  3UD9 A;  4KEJ A;  3CRH A;  5DVH A;  2FFV A;  3BX1 C;  4I4S A;  1EYL A;  3O4O A;  1J0S A;  3RTI B;  3H6R A;  3P53 A;  1EPW A;  3ZC9 A;  1R8N A;  3WMU A;  1XG6 A;  4XKI A;  4ZA3 B;  1PUM B;  1ONK B;  3A23 A;  2L5X A;  2NS2 A;  3HSM A;  1I1B A;  2Y9F A;  2KI4 A;  4X39 A;  1Z0H A;  1JY0 A;  1Q04 A;  1ABR B;  2LIE A;  2FO1 A;  2VXT I;  3CA3 A;  1N4K A;  4MZG B;  4ZFY B;  1FN0 A;  3FJI A;  1JLY A;  4J2Y A;  5FNX A;  3HBW A;  3BRF A;  4DEN A;  3WIN C;  1WBA A;  2VSE A;  4LO7 B;  3SNV A;  2ERM A;  3BA7 A;  4YOL A;  1FGA A;  1BFF A;  4EEE B;  5BXP A;  1DFC A;  1TWM A;  1D0H A;  1S0C A;  2QYI B;  4L4I A;  2IHO A;  1TWE A;  4HR6 C;  4LO1 A;  3V0A A;  5DUY A;  3FJ8 A;  3NBD A;  4LO3 C;  5EHA A;  1QQK A;  3RMY A;  6I1B A;  3FJJ A; 
#chains in the Genus database with same CATH homology
 1SZ6 B;  3WO3 A;  4KBB A;  3Q7W A;  3V0B A;  3BA4 A;  2F2F C;  4CJM A;  2Q3N B;  3LLP A;  1UPS A;  5D61 A;  4HA2 A;  1S0E A;  3N7L A;  2ZR1 B;  1XYF A;  4I3N A;  1FQ9 A;  4IZX A;  3Q7X A;  3FJK A;  2Z48 A;  3AKG A;  4II0 A;  3I29 B;  1M16 A;  1G9C A;  1ISX A;  2GZB A;  3NBN A;  3H6Q A;  1KNM A;  3FJA A;  4DCK C;  4XFT A;  4QBC A;  4ZGR B;  3BTA A;  4EB2 B;  3D7W B;  2HWA A;  1DQO A;  4G1R A;  1IRA X;  5BXT A;  3E8L C;  4AN7 B;  3VEQ A;  2LIQ A;  4A7Z A;  5F90 A;  1TIE A;  3BRD A;  4LO0 C;  1W3F A;  4JKQ A;  3WA1 A;  3WIN A;  1Q03 A;  4UY4 A;  4P0J A;  4XFU A;  3WMV A;  1AVA C;  5BXS A;  3HAL A;  1AFC A;  3FUQ A;  4I4Y A;  3IAG C;  3KMV A;  4GP0 A;  1ILR 1;  1PZZ A;  3FUO A;  2J3P A;  3UD8 A;  4EFR A;  1NZK A;  3O4A A;  2AXM A;  1T4Q A;  3A21 A;  1DFQ A;  1ISY A;  2M49 A;  1ITB A;  3FJD A;  3CA6 A;  1AVX B;  4LO3 A;  4QD2 C;  1I1E A;  5BP5 C;  1WBC A;  3IIR A;  4OW4 A;  5FZY A;  2FGF A;  1PUU B;  1JT7 A;  2Z49 A;  3PG0 A;  2UUS A;  2F2F A;  1BLD A;  1JT4 A;  3UD7 A;  3VSZ A;  2D44 A;  1Z4S A;  3LTQ A;  1S0D A;  3ZXG A;  3JRR A;  2Y9X E;  3O5W B;  4OEE A;  3NBC A;  1S0L A;  4I1E A;  3S8J A;  5B2H A;  4Q9P A;  5F8Y A;  4ZOT A;  1W3G A;  4QD2 B;  3MAL A;  2NVH A;  3HN1 A;  3K1X A;  4ZKT B;  2D43 A;  3NBE A;  2DRE A;  4XFS A;  1XHB A;  1FV3 A;  3O4C A;  3JUT A;  5BQU C;  3BAU A;  1JT3 A;  1DIW A;  3N7J A;  4LO7 C;  3RSJ A;  1E0O A;  1S0B A;  4I8M A;  1P63 A;  2ZQN A;  3AJ5 A;  1FWU A;  2D24 A;  1YTO A;  4IQP A;  1T9F A;  1TFM B;  2RST A;  4I37 A;  3VT2 A;  2HW9 A;  3OBR A;  1TTU A;  2MLL B;  4LO8 B;  1QXM A;  3VT1 A;  2K8R A;  2XOA A;  4Q91 A;  2ZQO A;  3R4U A;  2VUA A;  1HCD A;  2VXR A;  2D23 A;  2NP0 A;  3AKI A;  5D62 A;  4P0L A;  4J23 B;  4JP0 A;  1FMM S;  4QKR A;  3AKF A;  2RQ9 A;  4H04 A;  4QKS A;  2Q9X A;  3POK A;  1AVU A;  1FV2 A;  3UJ4 A;  3OGG A;  3H6S E;  5BP5 A;  2P23 A;  3BAO A;  4ISQ A;  2X2T A;  3IM5 A;  2AQZ A;  1XZZ A;  1R8O A;  3A07 A;  5F8W A;  1DLL A;  4P0K A;  1FMZ A;  21BI A;  1F31 A;  5BVP I;  4J2K A;  3FGM A;  3P6J A;  2VU9 A;  3O44 A;  4JAW A;  4I96 A;  1AVW B;  1S0F A;  3AH2 A;  3IM6 A;  1YBI A;  3ZX7 A;  2VLC A;  3I2X A;  4I4U A;  2BEB A;  3F62 B;  4GAF A;  4TLP A;  3VWC A;  2DRZ A;  2P39 A;  4I4X A;  1BAR A;  3PME A;  1CE7 B;  1HWO B;  3O3Q A;  3CRI A;  3OJ2 A;  5DZU A;  2WRY A;  2YUG A;  3I2A A;  1BAS A;  3VT0 A;  3C9Z A;  2D1Z A;  2BEA A;  4QC4 A;  4USO A;  3FJF A;  3N7K A;  3OJV A;  3CRG A;  1V6U A;  1DJS B;  1G9A A;  1K5U A;  3O4B A;  5FNW A;  4OEG A;  3AH4 A;  1SR4 C;  2WBC A;  3UJ0 A;  3HOM A;  4DEP A;  5HPZ A;  4JRA A;  1PC8 B;  3ILA A;  2NZ9 A;  1DZC A;  2KLL A;  2MIB A;  1BFB A;  1MC9 A;  5BXR A;  3OGF A;  4R6U B;  1QQL A;  3RTJ B;  1VCL A;  1EV2 A;  1ISV A;  4J2X A;  4LO2 C;  3VSF A;  1DQG A;  4I0Y A;  1G9B A;  1OQL B;  2NTD A;  4ZLB B;  3VUO A;  3BAV A;  4X38 A;  4H9W A;  4MZH A;  4F83 A;  1HKN A;  4G6J A;  1JT5 A;  4J2S A;  4G6M A;  5FZU A;  3CQA A;  3UDA A;  1Z2V A;  8I1B A;  2D20 A;  2HZ9 A;  1TOO A;  3CA0 A;  1IT0 A;  1YXW A;  5JLV A;  2I1B A;  3CA4 A;  4QAL A;  3W9T A;  1IHK A;  4I1B A;  4GAI A;  5JMC A;  3F1R A;  3OJM A;  3AZW A;  41BI A;  1BA7 A;  4IY9 A;  2NM1 A;  4JQ0 A;  5G00 A;  2QN4 A;  4I4V A;  5DSS B;  4AN6 A;  5E24 E;  3V79 C;  4OWL A;  4ZBV B;  1HCE A;  4QO3 A;  3BAH A;  1S0G A;  2D7R A;  1NUN A;  1WD4 A;  4Q9G A;  9ILB A;  4LO0 A;  1CVS A;  5I1B A;  4I2S A;  4OUJ A;  4EFQ A;  3BA5 A;  1SR4 A;  4END A;  2FFU A;  2IWT B;  4A7K A;  3AKH A;  3S8K A;  3V0A B;  4IYB A;  1RZO B;  1RG8 A;  4I6I A;  4QBV A;  5FZZ A;  4L4H A;  2Y9W C;  3BAD A;  3V0B B;  1G82 A;  4GP3 A;  1AXM A;  4LO2 A;  3BAQ A;  4X37 A;  4OWK A;  5F8S A;  2KKI A;  5EG6 C;  4MZF B;  4D0T A;  3WO4 A;  4KC3 A;  3PHZ A;  1FWV A;  3FJC A;  1ISZ A;  3FJ9 A;  3N7M A;  2DS0 A;  1M2T B;  3P6I A;  2BFH A;  4KEK A;  1PWA A;  3HMY A;  1BFC A;  1II4 A;  4WBC A;  1BLA A;  2R9K B;  2KI6 B;  1V6W A;  1DZD A;  4ISR A;  2X2S A;  4X3A A;  3RMX A;  4IHZ A;  5GAQ A;  3PUB A;  2ESU A;  2E4M C;  3B9U A;  1A8D A;  4OEF A;  4HJJ A;  2KH2 A;  2HWM A;  3FJE A;  5BQU A;  4FVV A;  4ZFW B;  4IY8 A;  5D63 A;  3CA5 A;  3BRG C;  4GOY A;  7I1B A;  3AZV A;  1IRP A;  3CAH A;  4D8H A;  3BAG A;  1L2H A;  4D0Z A;  5BOW A;  3OBT A;  4IZE A;  1IJT A;  3QYD A;  2MC2 A;  1HIB A;  1V6X A;  4H75 A;  4Z9W B;  2FDB M;  1TP0 A;  4FGF A;  3FJB A;  1RY7 A;  3AJ6 A;  4KEI A;  4G9N A;  4F34 A;  2K43 A;  1IIL A;  1HWM B;  2Y9G A;  1EVT A;  3N0K A;  2AAI B;  1IOB A;  3FJH A;  4EFP A;  1JTC A;  5EC5 A;  1GGP B;  1AF9 A;  3T8S A;  1YYN A;  4A7Y A;  2K4A B;  2AFG A;  2ET2 A;  1YF8 B;  3R4S A;  4OWJ A;  4I4R A;  4JPZ A;  1ISW A;  3O49 A;  3FFZ A;  1W3A A;  3Q7Y A;  1JQZ A;  3A22 A;  3CU1 B;  2GO2 A;  3QR5 A;  4I4P A;  2NYY A;  2RG9 B;  4GOV A;  4P6A A;  4Z8S B;  1Q1U A;  3MPP G;  3AH1 A;  3H6R B;  4G9M A;  4JKX B;  4ZFU B;  2E4M A;  1K5V A;  3BB2 A;  4ION A;  1RML A;  4I7I A;  2D7I A;  3ZC8 A;  31BI A;  1V6V A;  3NJ5 A;  4EKX B;  4I4O A;  2F8X C;  2DRY A;  3O4D A;  1HWP B;  1JLX A;  3IM7 A;  4LO1 C;  3ZXD A;  1WD3 A;  4USP A;  2D22 A;  3CA1 A;  3EF2 A;  1HWN B;  1MD6 A;  1BFG A;  1G9D A;  4PC4 A;  4I4Q A;  2VSA A;  3TC2 A;  3WO2 A;  3UD9 A;  4KEJ A;  3CRH A;  5DVH A;  2FFV A;  3BX1 C;  4I4S A;  1EYL A;  3O4O A;  1J0S A;  3RTI B;  3H6R A;  3P53 A;  1EPW A;  3ZC9 A;  1R8N A;  3WMU A;  1XG6 A;  4XKI A;  4ZA3 B;  1PUM B;  1ONK B;  3A23 A;  2L5X A;  2NS2 A;  3HSM A;  1I1B A;  2Y9F A;  2KI4 A;  4X39 A;  1Z0H A;  1JY0 A;  1Q04 A;  1ABR B;  2LIE A;  2FO1 A;  2VXT I;  3CA3 A;  1N4K A;  4MZG B;  4ZFY B;  1FN0 A;  3FJI A;  1JLY A;  4J2Y A;  5FNX A;  3HBW A;  3BRF A;  4DEN A;  3WIN C;  1WBA A;  2VSE A;  4LO7 B;  3SNV A;  2ERM A;  3BA7 A;  4YOL A;  1FGA A;  1BFF A;  4EEE B;  5BXP A;  1DFC A;  1TWM A;  1D0H A;  1S0C A;  2QYI B;  4L4I A;  2IHO A;  1TWE A;  4HR6 C;  4LO1 A;  3V0A A;  5DUY A;  3FJ8 A;  3NBD A;  4LO3 C;  5EHA A;  1QQK A;  3RMY A;  6I1B A;  3FJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...