4XLLA

Toxoplasma gondii dj-1, oxidized
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
184
structure length
183
Chain Sequence
AVKVLVPVAHDSEEIEAVSIIDTLRRAGAEVVVASVEDTEIVRMSRGVCVKADKLISAVENETYDCIAIPGGMPGAERCRDSAALTAMLKTHKAQGKLIAAIASPAVVLQTHGLLQGEKAVAYPCFMDQFPADMRGEGRVCVSNKIVTSVGPSSAIEFALKLIEVLYNKEQAKKIAAQLLYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toxoplasma DJ-1 regulates microneme exocytosis through an association with the plant-like kinase, CDPK1
rcsb
source organism Toxoplasma gondii
molecule tags Unknown function
molecule keywords DJ-1 family protein
total genus 67
structure length 183
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xllA00
1R9GA 1A9XB 3EZGA 3NOOA 2YWCA 3BWEA 4OGFA 4S0ZA 4Y1GA 1C30B 3FIJA 3TQIA 2VPIA 4L8YA 4OQ4A 2NV2B 5E9AA 2VRNA 2ZUUA 1Q7RA 3BHNA 4L8WB 4P35A 1OX6A 4MNTA 1VHQA 4JQSA 4MGHA 2YWJA 4Y1RA 4MTCA 2R1UA 4OGGA 1GGFA 3CZAA 4B40A 4ENTA 4B7AA 4ENSA 1GGEA 1ONSA 4ZDJA 3PQ4A 1JDBC 1PE0A 4AULA 3SF8A 1OX5A 4D1YA 4LGYA 3PQ2A 1U9CA 4RKWA 1OI4A 1C3OB 3L7NA 4Y1EA 4I2NA 1KEEB 1OX4A 4P36A 1QF7A 1O1YA 4E08A 1I7SB 1VCNA 3NOQA 1KXJA 1L9XA 1G2IA 4L95C 3R75A 1VCMA 3P9SA 3PQ5A 5SY9A 4WXYB 1GGKA 3EN0A 5IP5A 2R1TA 3D54D 1CE8B 4GE0A 1GPMA 4L8FA 3ZR4B 3PQ6A 1KWKA 4PXYA 3TTXA 4UCFA 5SY6A 4GUDA 2ZUVA 3CNEA 4E5VA 4ZGGA 4L78A 3CYFA 3PQ8A 2ISSD 1QWSA 3NONA 2VKTA 3EFEA 4OJYA 2AD5A 2FEXA 3ZJ5A 1QVVA 4ZDKA 1KWGA 3CZ9A 1PV2A 2ABWA 3GRAA 1CS0B 1SOAA 1IPHA 1S1MA 3EWNA 1GPWB 2A9VA 1P7ZA 4WINA 1FYEA 4UZSA 1N57A 3P9PA 4B2YA 5K4AA 2AB0A 3UGJA 4Y0NA 1JVNA 3SF8B 2RK3A 1Q2UA 4N12A 2ZUTA 3F71A 3MIIA 2RK4A 4OFWA 2W7TA 3OT1A 1WL8A 2IUFA 1KA9H 1GGHA 4B5KA 5JZMA 3P9RA 3TTSA 2ZUWA 4QYTA 5SY4A 3EJ6A 3UOWA 3ER6A 1QVZA 4L7QA 4UNIA 2R1TB 4RKYA 4OIFA 2OR3A 3UK7A 3OT1B 1T36B 3PQ7A 3F5DA 1PDVA 5JZOA 1J42A 3VU3A 4ENQA 4BTEA 1P81A 1I7QB 2RK6A 3RHTA 3FSEA 1P5FA 1T3TA 5BV2P 2R1VA 4I46A 4LRUA 4R7GA 1UCFA 4K2HA 1OX4B 1IZYA 3P9QA 4ENWA 4XLLA 4AUMA 3NORA 1GG9A 2XF2A 1VCOA 2WJZB 4BIMA 2VXOA 3WFZA 3ZJ4A 1GGJA 4P2GA 4UOQA 3TTWA 2VDJA 4P34A 3R76A 1PDWA 4ZDIA 4Y1FA 3L18A 3TTVA 4I4NA 3UMMA 2GK3A 2R1VB 3N7TA 1K9VF 3L4EA 3B3AA 3R74A 3UJNA 3M3PA 4AJ9A 1IZZA 3NOVA 4HCJA 1P80A 3PQ3A 2ZUSA 1M6VB 3TTTA 4B31A 2NV0A 2V4UA 4P5PA 5SYAA 2YWBA 4ENRA 3KKLA 4ENUA 3SOZA 4GE3A 1OY1A 4QYXA 3L3BA 1SY7A 1BXRB 4BFLA 3CY6A 1I1QB 1T0BA 1FY2A 2H2WA 5DFAA 1P7YA 3B38A 3NVAA 3TTUA 4UOZA 4Y1RB 4ADSG 4ENVA 4ENPA 2LXNA 3B36A 4AUEA 3TTYA 3MGKA 5LIRA 2YWDA 4AUNA 4N0MA 1QDLB 2GHRA 2D7JA 1CF9A 1QVWA
chains in the Genus database with same CATH superfamily
2JIRA 2BKEA 3I8OA 4QHTA 1WIWA 4KK4A 4CM6A 2JFQA 4MUFA 2JBHA 1NJFA 2WJWA 1E6MA 1F48A 3SXPA 5K20A 1H0SA 1HFKA 3NEAA 3V4FA 2A58A 2P1RA 2QUHA 4QREA 3UCXA 3OWXA 3PQCA 3TMKA 2ZUEA 4U7WA 1AB6A 3P2IA 4TL7A 3G02A 3VSEA 5IJ9B 4IVRA 1XZAA 1RJEA 3AQ4A 1X14A 3CJTA 3SEZA 3M70A 4AJ2A 4ETNA 5MN5A 4FR2A 4CT4B 5JDIC 4YJHB 3JQAB 1FFBA 4K81B 4CI0B 1HDOA 2BHNA 3CCFA 4HDRA 4OLAA 3BG5A 4H3KB 2WMNB 4UQLA 1RKVA 1Z17A 2TS1A 1A72A 4IFEA 1FNDA 1SZCA 2Z2XA 3ZVMA 4GZ3A 3FYUA 1Q95A 2I6QA 3R09A 4I50A 3WK4A 1J70A 2IH5A 3QI7A 4CU5A 2ILVA 3U7JA 3P0RA 2A0KA 5C1IA 3S5UA 3T7KA 5C8YF 2P9JA 2X0KA 1VKJA 5GMOA 1UAYA 4I4TF 4OGKA 3L82B 4MHOA 2ZJ3A 2OO5C 4OFBA 2GPNA 4ZOCA 4KO3S 2CXSA 3SQWA 1F12A 5K3AA 2NZVG 6AT1A 1DCMA 3CZ9A 4MEBA 5DIZA 5H7XA 2JAOA 2WFLB 5YASA 2W8ZA 3RSOA 2FWRA 4YJFA 1JR6A 3RJMA 2R6HA 3AKEA 4V3CA 1GV1A 3ZUPA 4A8PA 4BS9A 4CHTA 3WA7A 4BZQA 1CQXA 5ITSA 3LE8A 4GWKA 2XMGA 4FMCB 1KEKA 2YY6A 2O7NA 4XVUA 3K05A 2OV6A 4DLVA 5ECYA 2JLXA 3M83A 1IB0A 2W11A 4XWTA 5FBLB 5A1JA 1E94E 2Z1MA 3AVTA 3Q41A 3P0FA 4MI3A 4LE0A 1E96A 1TJ3A 1XNHA 5CX1A 1I13A 2PM8A 2UUCB 1KO7A 1W2WB 4HS9A 4ZVMA 1D8AA 1HPLA 1LLDA 5AOCA 3AG6A 3JQ8A 4G4GA 4JLUA 4U39A 4PQGA 2P9QA 3KT0A 1CY7A 3OEYA 5DM0A 4PGHA 1KVSA 3HV0A 4HSGA 3G23A 3P20A 4NBKA 1P2SA 4I1PA 3Q5DA 1VDZA 3CZ5A 3D7SA 2Z1NA 1FNNA 2PWAA 3SK0A 3X1DA 3SR3A 4BIMA 1QKKA 3BTUA 5KVVA 1IULA 1EEHA 5GV7A 1OFUX 2OV4A 1VLMA 3FETA 1QGUA 3A3KA 2V5AA 1Z62A 2H63A 5TX7A 1XZJA 1Z2AA 4QQ8A 2NXNA 1KDYA 2QR3A 1Q15A 3AR8A 4I55B 2IDKA 5CEJA 5CCXA 1KOGA 3N7TA 4HUJA 3HWSA 1PEAA 4Q48A 3I2HA 4AL4A 4MW9A 1Z73A 4ZT3A 4FEAA 3SC2A 3AO0B 2Z4TA 3TQQA 1S4QA 1JR4A 3UOAB 2H7VA 4JXXA 1EWKA 3RUPA 3VH4A 2Y1EA 4DSTA 2GEVA 4CF4A 4TUYA 4YMWA 3RK1A 1V5EA 1JSZA 2BC9A 2BGKA 4H08A 5T3UA 5I3ZA 4KTTE 3M2TA 2WHQA 4YHHB 4UDNA 3A3OA 5IF9A 3CWCA 3LG2A 4C20A 4JJ7A 3WLTA 2HA4A 2MMCA 3EEFA 3IBSA 4OQYA 4AUNA 4XM1A 4POOA 5HIKA 2ILTA 1ECGA 1RWXA 2QP4A 1NBWB 1NDQA 2ADFA 4YMSA 5ETJA 2OC4A 4D9NA 5B2FA 2WYHA 2B69A 1O08A 1WPRA 3ZW8A 1YZVA 3V4PB 1JKMA 3MF4A 2R48A 1Z08A 4LDZA 3CW9A 2C77A 1U1EA 4MWTA 2ZSKA 4URZR 4UD6A 4FFBA 1K97A 2GCGA 2XSZD 2XGJA 1ZM3A 3W4JA 4CM8B 3I09A 3U5ZB 1FSZA 2WZBA 3UV7A 5LBTA 2RGUA 3AVYA 3VPSA 5JPIA 3T1OA 3E9EA 3PQ2A 3AP2A 4V0NA 1Q3TA 2OQIA 2YL2A 2Y0CA 4Z49A 4TLEA 4JT2A 2FLVA 4MA0A 3FSJX 2HY7A 2VZ9A 2VPZA 1MNQA 2W37A 4HVLA 1VCHA 1KY3A 2SKCA 2PMCA 2FK8A 1TF7A 1GPMA 3LFHA 3LGXA 3IKVA 1P8JA 1Q84A 3U7GA 2I71A 2AVDA 3X1WA 2UU9B 3CZRA 3AF0A 1SVSA 2XLBA 1RAHA 1HG1A 5MGBA 1DTSA 2ZTHA 3PVCA 4YCCA 1ZWLA 4N5LA 2O5EA 2FUNB 2YCLA 1MVOA 1CBUA 4UHJA 2ATCA 2R6FA 1JX6A 3A6FA 1EP2B 2GHTA 2BFBB 3H5AA 1LRJA 3KBOA 1A2KC 4N4AA 5JYEA 1WZ2A 1SOAA 1E0AA 4BFCA 1JEQB 1JIVA 1NNI1 3K9LA 4PRZA 3R5JA 2FWBA 1YVPA 1WUTA 4ME6A 1DAOA 1WUHS 3IAEA 5E8RA 3SF8B 3RT9A 1DBWA 1NYTA 2J9FB 2IV2X 3IEUA 1W47A 1TJ5A 3W1VA 3JALB 5C32A 3LP8A 2XXAB 3AU9A 4HJRA 2NTEA 3KQPA 4HMOA 2VJQA 2ZJYA 4Q3DA 1Z56C 4QO7A 4F2WA 1CERA 1CZNA 3PFBA 4UUQA 5FUVA 4MCHA 4ZAGA 4YWHA 1CVLA 4R68A 5HTKA 4QBFA 2WIKA 3WNVA 1OBCA 1NAHA 5D1NA 4PWYA 2QAJA 4XPZA 1JB1A 1T0IA 3D8RA 3KLNA 5CXSA 4ERNA 6REQB 5BN5B 3A32A 3IUNA 2RIRA 3FROA 1UDAA 1ZD3A 2IRWA 5I4KA 1ZAYA 4W5RA 3LC2O 4R2MA 1MEEA 4XFKA 1SVWA 1KARA 3EHDA 2C4HA 3KCNA 3OCWA 2H8KA 4G5YA 3S40A 5LP6A 3BUSA 2Q3BA 2DT8A 2MT9A 4ZP1A 1GZUA 1P72A 4NK4A 4OL0A 3RIYA 3WOHA 2EBFX 1XZKA 2PGNA 4M1TA 4ARIA 2YW9A 4U2DA 4OSOA 4BV2A 1KZHA 3F2VA 1T6NA 3PC8A 1KF0A 1JYFA 1S1CA 2CLLB 4XYGA 3T7RA 4G0XA 1CY2A 1SQSA 3T3EA 3SS7X 5KNCH 2VYQA 2JLCA 4AFNA 2YV3A 1SXJB 1NIPA 3KJEA 3MWEA 4KOAA 1W52X 1YRAA 2IYNA 3UMSA 4IXDA 4C76A 2JLVA 2NSHA 1FX1A 2OFXA 4MCAA 1A7AA 3E2PA 2I6TA 1L5KA 4BBZA 3MMZA 1L3CA 2A0XA 5G2OA 3WNCA 4P0QB 3ZHTA 3DWIA 2H9AA 1N9KA 4UNSA 4XH9B 4L9SA 1K7EB 3B70A 4RAQA 3C14C 1ZK0A 5KOIA 2B99A 1JIUA 4C4RA 4EGSA 5CX4A 1Q1BA 3C41J 1YE5A 2F43B 1L3IA 2C5LA 1LBSA 4FEGA 4MAMA 3DAYA 2DKOA 4IJKA 3E9QA 3RW9A 2DR0A 1EBBA 2DHCA 4MULA 2DPGA 5BQXA 4N3CA 1SKAA 5LZ8A 3K4HA 4YR9A 4HDQB 3CG0A 4WOPA 4YY3B 4LXHA 3WL4A 1WMSA 1MQ9A 1HLGA 1HT1E 1OLUB 4PCUA 2MR5A 1OD6A 3QE0A 4EAAA 1KEWA 5CVJA 1QP8A 2G8NA 4Q01A 2FFJA 3T3HA 3K35A 2M1ZA 1KMCA 3F90A 3GJRA 3N2KB 5DLEA 4F92B 1QOZA 1TFUA 3LCVB 3PDWA 1YZTA 3AEQA 4GZLA 3WKEA 3OAAD 3M81A 2NPIA 1ULTA 4RPCA 4YK7A 3WL3A 3KJNA 4G1FA 5BXQC 4RPGA 3FDZA 1TD1A 3SI7A 3OH8A 3UMBA 2X5KO 2Z9DA 1DJNA 4EY3A 4QARA 2A1TS 4S12A 4JP1A 2NXWA 5IAEA 3ZX5A 2IYLD 1YIOA 2UVPB 3SQNA 3BPSA 4RTOA 4M21A 1DCFA 3KAJA 5IAGA 4KDRA 2B61A 1ISFA 3E15A 2A9VA 4A92A 1M2OA 1TAGA 1P0FA 1QFYA 1F6DA 2E4ZA 3KUUA 5K4AA 5KCMA 4AN1A 2XMBA 3MTQA 3HZOA 3A1SA 1H2WA 1JAIA 1XYGA 1NN1A 2C29D 3SY8A 3ZHVA 2PZMA 4CMEC 1PBNA 1RYYA 2XUIA 3ZV7A 4ZHSA 4YCDA 4QFMA 5IK2A 3V7WA 3U26A 5KB3A 5E6UB 2ZRPA 4W9RA 1GPNA 3SR4A 5HRCA 3EGDB 4ZXPA 4NNOA 4AG3A 2RGCA 4HLUC 1Y4ZA 4Y98A 5DLPA 5JXHA 4LN1A 4ZV7A 1MIOB 2ZPTX 4WNIA 1SAYA 1AC5A 3OCCA 4UUPA 1YCDA 3K2BA 4GLOA 2YZKA 4C3OB 3V5NA 4XB1A 3URMA 1NNEA 2ZZNA 4MV6A 4NY1A 4I6EA 4OH7A 1N3LA 1J0DA 1Y4UA 5DGTA 3TFQA 1OROA 3UJCA 4EQ6B 3PT9A 3W9YA 3FBGA 1UXIA 2TECE 4IQFA 2BMWA 3R8CA 3CJQA 3DYBA 3OCUA 2O48X 2YNMD 4ZI7B 2XYVA 1EFRD 1PJ8A 1YQ9A 2BMFA 3K2QA 4Q12A 5IJZA 2JFPA 4JIGA 4DLKA 4F45A 2Q5JA 3IPYA 2ZE6A 2EJTA 1APBA 4I9UA 1BVHA 4KQ2A 1IQPA 3A4VA 2D8MA 3FHCB 2W93A 1R64A 2ZUCA 1U0RA 4AX8A 2P9TA 1RLJA 1WWKA 2RGDA 2WILA 4ZO7A 3MOSA 5HCIA 3UVEA 4EUKA 4ZYLA 1DXHA 4RJKA 2I78A 4UOZA 5AIAA 4BTLA 4EPRA 5AI5A 3A6ZA 1OYWA 1JBQA 3FG9A 4J0QA 5AQ1A 4NZNA 3ZU4A 4QG3A 2FMUA 2ZBGA 2DJ5A 3PNKA 1DBIA 2YS7A 3MLEA 3VR0A 1O4WA 3HUUA 1IIBA 5LC1A 2YKGA 4XIIA 3SDZA 1HL3A 4K6HA 4QDTA 1X7HA 2E49A 1V3UA 5ELXA 2R6ZA 4LGCA 4IKPA 2O8BB 2C4VA 3OJEA 2A0FA 3TG2A 2PSFA 5DNVA 4HB2A 1O94A 4EVIA 2QY9A 3U3OA 1DC8A 3ZPXA 5BV1A 4HDRB 5AKLA 1W36C 3WNQA 4X63A 3JAWB 3I9LA 3VOAA 2OA0A 3VR5A 1IMJA 1M2FA 2W4QA 3F6YA 2HW8A 3LUAA 1E2MA 2A1UA 4D9FA 4GOMD 2IXFA 2OHXA 3TMYA 5F2EA 2Q0HA 4MYCA 2RHDA 4CL8A 3R24A 2A86A 5ILQA 3IERA 5A4AA 1N1MA 1OWPA 3ST7A 1KR5A 2JGEA 3FSRA 3BT7A 3ZR4B 4DA9A 3E58A 2GCOB 4BP3A 3HBFA 1LDMA 4EG7A 1HGXA 2KJQA 4IJWA 1WXQA 3OX3A 4D42A 1NF2A 1ZEJA 2PS1A 3JQEA 1JLKA 2QA5A 2CHUA 3AYZB 4LWZA 1M1UA 1ORIA 2X5XA 1ZK4A 2F1JA 2GUGA 3AHGA 3OTQA 4IO0A 4RMJA 4CL3A 1BO6A 4W8HA 5F4BA 3DFKA 4O63O 4BNDA 1FFGA 1M10A 1P3Y1 2AW5A 3DO8A 3H04A 5HKKD 4I08A 1WA5A 2G6TA 2OQRA 2XQVA 1U0SY 4BAZA 3CNHA 3QOFA 3FMVA 2JJ1A 1EWYA 1SCUB 5DHFA 2BFEA 3TEJA 4UC0A 3W4KA 1XVLA 1JLHA 2QRHA 4IIVA 2X1MA 4R9NA 4RQAA 5EHNA 3OLCX 4Z54A 5JAIA 1E1CB 3G2LA 4GPAA 1FS5A 5A0FA 1QR6A 5LA6A 1HR0B 2QUBA 3X1JA 4PRLA 3I4LA 1JQBA 2YRFA 4QQRA 4M46A 3AFMA 3S7TA 1RRPA 2GYWA 3UO8B 1GQFA 3DOIA 4DLLA 2PX5A 4GRDA 2HD4A 4EF4A 4U3JA 2FA9A 1KFJB 5IJWA 3P2MA 2SHKA 1WNFA 1HE2A 4LXYA 4XWGA 1FVFA 2VRBA 4F4DA 3A7DA 4Y6GB 4M76B 4B43A 4Q00A 1SC4A 5AK6A 4RW0A 3EZ2A 3HHEA 4UBKA 3ZJ4A 2O8FA 4L22A 2JW5A 4F8EA 1EVJA 1GNPA 4INJA 1KJNA 3O2JA 4L1KA 4GR4A 4ZC8A 1YZLA 3T7EA 1VJ5A 3OHMA 2V7UA 1UF9A 4F2HA 2FF5A 4PHFA 2JHFA 3CLTD 4M9ZA 1BU8A 4BJ3A 2ZBFA 2X7XA 5LZ9A 4JYAB 2H4FA 3U31A 2RGRA 3KVRA 2JDID 2QZ4A 3B20A 4C1NA 1T25A 2UV8A 1G66A 4QU5A 4BE7B 1B73A 1N7HA 2XBUA 4DJ5X 5D87A 5T4BA 3DAHA 1EG7A 2R79A 5ITWA 1FQJA 1Y8AA 4EECA 3OLXA 1MTZA 5DMHA 5IYZB 3I62A 3ZJUA 2YJZA 3UXEA 2HIGA 3WRXA 3L1UA 5ED4A 4F6CA 4CODB 5I9BA 4DADA 1CPYA 1FK8A 2B5WA 3A58B 1M1YE 3DLCA 4NZ9A 1Q3KA 1XRLA 3BX1A 2WM3A 2PKYX 4OBEA 1V11B 2CNDA 3KSMA 4HWRA 4W7SA 3S2UA 1LV8A 4MV3A 2QRPA 2A14A 3CLVA 4RKFA 4UBJA 5J2UA 3IL2A 4Q7JB 4Y3UA 4RE5A 5LP6F 4LZJA 1FLDA 3C5WP 1PNRA 2PKXA 4JA2A 3TINA 1HA3A 1T43A 4O2AF 1ZOIA 2NU6B 2V59A 4RC9A 5DXJA 1WD5A 3L7AA 4OHWA 1NHGA 4XPIB 1UDXA 2BF4A 4BB9A 1RNLA 1O5TA 1JN0A 1I30A 1RPTA 3G88A 1D2AA 4LGYA 2WFAA 4WOKA 3RFVA 2H65A 4RKWA 3GLTA 3HYLA 2X0EA 3O7WA 5TPWA 1OFVA 4F56A 1G9TA 1QCDA 3L2OB 9ABPA 2X9QA 4X8LA 1P2FA 3U44A 1AHNA 5INTA 2WVGA 4V2IA 3ZIAA 2PT9A 3G17A 1S8NA 4RVDA 1UP4A 3LWNA 1FU7A 1K3FA 1PGQA 2P3QA 2P6NA 4XR4A 4JSRA 1OCEA 7MDHA 2DXIA 5L4LA 2QL6A 2WM9B 4UM5A 4I4IA 3FJ1A 2JFVA 1BMQA 1XMPA 2C3OA 5FUXA 4DWWA 5A4DA 1DT3A 1R50A 4Z4CA 4HDSB 1SK8A 4OB7A 3FHLA 5JZVA 1OXXK 4BO7A 5J2TA 3GFTA 3ZY2A 3VX3A 2VTVA 4J1TC 1ODIA 1XTSA 2M6RA 2DHDA 4J0IA 1NVTA 3BD8A 2YIVX 1GPDG 3CZQA 4GXNA 5FPHA 5DXFA 4KFCA 1XEAA 1AKNA 2P69A 4HRVA 4TLBA 2GZDA 2YXDA 1UJ4A 5FBVB 3LPDA 2FZKA 1NE7A 4A27A 4DB2A 2XNHA 3T1YB 3PHBE 3IQIX 3QUCA 2VNJA 2OCXA 3O93A 3WXMA 4X66B 1JDPA 1QTNA 2ODBA 4Z51A 1BC5A 1C0LA 4Q1CA 1ZUIA 4LK2A 1ESNA 1WVGA 2NYAA 5AW0A 2K2QB 1F7UA 4WASA 4M55A 4D4HA 1XZCA 4DAOA 2P4UA 2R1ZA 5DO9A 5KQGA 3EGOA 1N9GA 2J7PA 1K8RA 3HA5A 1EB8A 3G68A 2O7SA 1ZUHA 3PKZA 2H1VA 2XJ4A 3TL3A 4KRYA 5EUCA 1E5VA 3RF7A 3DEZA 4AMGA 1GG9A 1IBMB 5HNKA 3MNFA 4JCCA 4V0MA 2JLWA 1DIAA 4Z9XA 2O19A 1SEVA 3ZK8A 4EITA 4TTAA 2WOJA 2ZFUA 2H7XA 3RTCA 4TVOA 3HVKA 1CXZA 3AMVA 1BVRA 2LCIA 1EFDN 5DCUA 3GJXC 3NPAA 5JCJA 3RFCA 1C2YA 3ASZA 4TQGA 5C18A 3FM9A 4C7VA 1J9EA 1GZVA 1HSZA 2I3DA 3W2IA 5ES4B 1RM0A 5LQAA 1K7CA 3WLFA 4YCSA 1ECCA 4C5AA 2O0HA 4OX9Y 1PS9A 1SXJE 3IOCA 3ETNA 4EPWA 2QSJA 1AXEA 1C8BA 2OP0A 3NBXX 1QYDA 1RS0A 4HVCA 4LWOA 3HUEA 1PF7E 1EVKA 2YBDA 3BGSA 3JQBC 4OMCA 1HDIA 4X64B 4YRAA 3B1ZA 4H31A 6YASA 1YR2A 4W5JA 2NVUB 5I01A 2A5FA 1NBMA 3WGYA 2J67A 2R7AA 1C8VB 4NZMA 1Y3HA 3KLMX 1DE0A 1FDOA 4CJXA 4E09A 4F1JA 1ZN7A 3RAPR 3COVA 1JDSA 4Q4AB 3IQEA 4WERA 1JPNA 3DGEC 3GVXA 5AP9A 4H16A 5T8KC 5DASA 2EJVA 2VTEA 4JUAA 4N3AA 3UA3A 3EHEA 3FUUA 1ATZA 3CX4A 2HJWA 1ZM2A 2QK4A 1FJGB 2YQZA 1QTQA 3N2KA 5BOSB 2EGGA 1NJ8A 4WY5A 2VNSA 3B9QA 4NMHA 4B84A 1E7YA 4QJ3A 4MHTA 3BXXA 1QHXA 3AUYA 5TQ0B 3WFIA 5HUJA 2PUCA 4C88A 5K8LA 3DTVA 3QP9A 3DAGA 1TAUA 5A3VA 4UHCA 1Z4LA 1EJ6A 1ZCAA 1FP4A 1R8YA 2D74A 4PONA 4IMPA 4N6NA 3O92A 4OAPA 4KPFC 2FR1A 3H1BA 3HCFA 4TN1A 2V3CC 1VE7A 1Y7HA 3KAKA 3IMKA 2V45A 1PSZA 1F0PA 1YL5A 2W6QA 4REOA 5A5GA 1QH9A 4B45A 3DE5X 5MFZA 5HEKA 3AR4A 1A9OA 3NIGB 4UHBA 3B6ZA 4E94A 5DW0A 1G7RA 4YCJA 1XSEA 1ZQ1A 4L08A 4TV8A 4II7A 3LECA 4TMWA 4ZREA 4MP3A 2BP7B 1W87A 2WUFA 1G20B 4NMMA 4IUDS 4BKQA 2KB0A 1P9WA 3HRKA 2IZ0A 3VJMA 1XHEA 4LBZA 4XSHA 3TZKA 3CVUA 2FMKA 2AW3A 5KDLA 5NULA 5CRIA 4MR7B 1P1RA 2YWEA 4G67A 3GEHA 3KXPA 4INPA 2Y71A 4JX8A 3VPXA 3W1WA 3W2EA 3ZD8A 4RKYA 4C6HA 4C87A 1JA9A 1B6SA 1LX6A 1RWWA 4WN3A 2H4HA 2AN4A 2IHUA 3AKCA 3FW1A 4F1WA 1AXRA 2B4KA 2X40A 1R66A 1RTTA 5K1ZA 3WGVA 1T5OA 2IVFA 4RTPA 4JXZA 2CNLA 3JALA 3LDFA 4KKVA 2PV7A 3HYCA 1HURA 5HUHA 3E61A 4DNPA 2PUEA 4PZLA 4IWYA 4E51A 5CLFA 4NCAA 1JEJA 4LY3A 2RKBA 4V0LA 1UT6A 5B7GA 1P3JA 3D6MA 1N32B 1SXJA 2G25A 4FDLA 2ODTX 4IEFB 5DP1A 1Y1KE 1ISSA 3ICCA 3WKCA 1GKYA 4CKYA 1WPQA 3ZY6A 1G8AA 4R3UC 1Y3CE 4RJIA 1C41A 3C3MA 3R3UA 3RVQA 3TW8A 1T1JA 2ORWA 3JQGA 4I14A 2FHSA 3LA8A 3MXOA 2G04A 4KUGA 4PYNA 2FQXA 2PFKA 3E03A 5KYTA 1DWPA 2IGTA 3OTOB 1JQ3A 4ZGWA 1HI9A 3M3DA 1QRSA 1WB5A 2ZRCA 3LUKA 2ID9A 2NO1A 4GD3Q 1FSPA 1T8TA 3GU3A 3HMKA 4JBHA 3GAMA 3LX5A 1GITA 3TXAA 1EWVA 1XQXA 1B6RA 1JHAA 2EQAA 3DS8A 3JAMA 3C7KA 1Z29A 4OHPA 3P2JA 5LP6C 1RKUA 2OYCA 5E4TA 3PFFA 4QLOA 1TW3A 2JGIA 1R6BX 2NU7A 3DXYA 5C0OE 2P3OA 3G79A 4FONA 1TGVA 3PFHA 1RTKA 4OM8A 3V48A 3H13A 4L8YA 2ZUUA 3QWHA 3OIVA 1YS6A 1YQXA 1P44A 1G2QA 3JQPA 2J4CA 3CVOA 1B15A 4LHEA 3HP4A 1EJ2A 4R2LA 5JXGA 1NBOA 3HGMA 3JRWA 2RHGB 2NXCA 3R6TA 2I54A 4MVJA 1B76A 3T35A 1HMPA 2E4UA 2VJMB 1I6MA 4UVEA 3REGA 4YAKA 4KNVA 4LK3A 1DBRA 1UEJA 3PE3A 5C8DA 3OE7A 4S2UA 5L3QB 2QN3A 3AVVA 1BRMA 3MYRA 4KKXB 3E7XA 5IBRA 1S01A 1OI4A 3LBAA 1OX4A 1S7CA 2FJUA 1Q22A 1TJ4A 1T2DA 1MOSA 3CZ4A 1XMOB 3P9SA 1W5AA 2G3YA 3BGOS 4I19A 3MWDB 1W8DA 1RJ9A 2ES4A 3VVMA 3L7YA 3IJPA 3IUEA 3R7DA 1N77A 3D7NA 1T5SA 2LV8A 4DHWA 2GVDC 1NBEA 1Z0IA 2GJ9A 2H00A 3DAOA 4QZVA 1PEKE 1T4CA 1QHFA 3HC7A 4BV3A 2IF0A 4X45A 1V6CA 3R7WB 1L8AA 4X0EA 4XIJA 3FGOA 2WA2A 2XXJA 2ZRQA 2I1WA 3IPRA 4KQWA 4PNEA 4KIFA 3GMIA 5CDFA 4BX9A 3GRZA 5MFPA 1PQ4A 3EXHC 1KL7A 1R4NA 1TQDA 4IIJB 1NXPA 2ZRAA 1H1DA 2J3HA 5JY1A 4EL0A 5JSQA 3GVCA 3OBIA 2O8EA 2E7ZA 1C0IA 3D8HA 3HCEA 1U7ZA 5IBCA 4BKPA 2G09A 1C3XA 5FULA 8ABPA 3HEBA 4K2AA 1LXCA 5B30A 1EK2A 3SS9X 5EN4A 4XGKA 2CYCA 2LW7A 3ZD6A 3L02A 5KWVA 3VXKA 2WUWE 3PRHA 4FB4A 1ZJ6A 1RC0A 3UCFA 1TLLA 1OFHA 4P4SA 5LLTA 1I0IA 3PNOA 4PN7A 1I7QB 1DPFA 3MTDA 4JLPA 1QRDA 1DXQA 4TVKA 5K3BA 3F98A 1WR8A 5CA1A 3LWDA 3R8FA 5BN4A 1RYFA 2WD9A 4FGLA 4LRUA 2QLJA 2G0TA 2FETA 3AHDA 3VPCA 3VYWA 4CLDA 1HG0A 1HYBA 2WYUA 4RPIA 1KORA 5AJUA 1TPZA 3MCAA 4DFDA 2PD4A 2VDVE 1JFSA 2Q41A 5TLSA 3I5XA 1JR3D 3WBJA 3ANSA 2Z2YA 1CQJA 1U0LA 3C3XA 3S1LA 1BHSA 1KMIY 3GJ3A 5KO2A 1U2EA 2HC9A 2ZJ4A 4PLYA 2GTHA 3RTEA 1XNQB 4F11A 2ZXUA 1BQ4A 4WXRA 1CETA 2XTAA 3AY0A 3OIYA 2CWWA 3KKQA 5K4GA 4NYIQ 1E1RA 2GNPA 3EOAI 5T5QA 4R5MA 1Z7EA 4XVCA 3GDGA 3L93A 2JBAA 4CV1A 3B3QA 5DULA 4QIHA 5IFKA 4MQEB 2HU2A 2WKPA 3F6SA 1C29B 1NVMB 1YK1A 2Y0BA 3I2FA 3NJ8A 1I3OA 3OFND 5AVWA 4KGDA 1OY1A 1T9HA 3V2HA 3V9AA 4MVJE 4HH4A 2JAQA 2P2GA 3O26A 4LGVA 5FUWA 3FMOB 4BAGA 2I99A 3RYHB 2ZVJA 2PPVA 5GGXA 1JBKA 2C03A 3MD0A 1QHHA 1IEXA 4NDZA 4LXUA 3RVKA 2X15A 3LY8A 1E8NA 3IESA 4BATA 4HHEA 1R5OA 5FTKA 3I53A 3JYLA 2GBCA 3P9CA 2WBLC 2PV0A 5G4KB 5H3HA 3TW4A 4MQ5A 1XVAA 3MUNA 1RZRA 5K3OA 4L5YA 4QXOA 5FTNA 4WFJA 4YMHA 5BN4B 4UQOA 1MXHA 2H1WA 4FTWA 3NHRA 2MYUA 1V3TA 3T5MA 4JK3A 3ZE9A 5HDBB 4LWQA 2QD4A 5DTMA 2N0SA 3S1SA 1N7GA 1TPYA 1VL0A 4KBYA 1NOJA 1Y8QA 3ZX4A 1ORWA 2NUPA 3F8WA 2XDAA 3Q7RA 3AZPA 4M1EA 3N3AC 1A98A 4LPKA 1W0KD 5COBA 1Z2DA 5K45A 2CZQA 2O8BA 3MAGA 3HL4A 1ZNXA 2AEMA 4CCYA 1M1NA 4L8FA 1HNNA 2B0CA 1GEEA 3RRJA 1UKBA 1TNDA 5ICGA 1Y9AA 1GT91 4HDSA 4Q4HB 5ES3A 3D5QA 1C2TA 2YASA 3JWHA 3QKSA 1W75A 1DMSA 1WXXA 2BCJQ 3D4NA 3QU4A 2QLLA 2QVGA 2IOHA 3DBOB 2HT1A 4B2LA 3R3ZA 3M9XA 1C1XA 1Z2CA 2PNFA 2VUIB 5DM2A 4NXMB 1ZNQO 1IU9A 1V2GA 4PU0A 1PV2A 1T35A 3O1LA 1JEAA 4YIHA 2C31A 4F3KA 4Y6PA 1P7ZA 1I6LA 2JH9A 8GPBA 4FU0A 1GT6A 2DX7A 1LJ8A 3I2YX 5IBQA 4BMNA 3DQQA 4EZEA 3RC1A 1NP7A 3H7IA 1YASA 5JNRA 3MVEA 2QQEA 2B5VA 421PA 3QU7A 3LSTA 3CX7A 4G23A 1O97D 1RACA 1V8DA 3ETGA 3IC5A 3HUDA 4WDRA 4XRRA 2XMRA 1U3WA 5F12A 3WP1B 4W5NA 4Y7CA 5T57A 4FFLA 3DR3A 1JHMA 1U99A 2CXUA 4LZZA 2WT4A 4YROA 2VHCA 1F2VA 5CW1A 3ZIAD 2ODWA 4IOLA 1CFJA 2E1RA 1HSOA 2QRGA 5C7YA 2HU8A 2CUZA 2HDWA 3D4IA 2BGTA 3B3FA 3DMPA 1Z4NA 4LY0A 1JR2A 4PAOA 1A3CA 4I1UA 4F71A 1G3IA 1JPVA 1XI2A 2YNMC 1H23A 1M7GA 1PJ4A 3AT1A 2W2KB 3K92A 5EKUA 2NU8B 4IJMA 3LX8A 2OZLB 3LOQA 3W9SA 3A3NA 1E3QA 4TSKA 3KYCB 3SR0A 4IFBA 2IC5A 1CUEA 2XKJE 3NUQA 3RABA 4WA8A 4AMZA 5FLKA 4MPRA 1R74A 4PVCA 5GVRA 1V3QE 1KZ9A 3IURA 1KK3A 3GT7A 3L0SA 3M9LA 4FR0A 1JHRA 4GM4A 3KB6A 5T6BA 4B8WA 2B92A 1ZGGA 2W83A 2AOXA 1JV2B 1L2TA 1HNWB 2J41A 4PLCA 1LQ2A 5JLJA 3TWOA 1M6VB 5DJ5A 2DBRA 4FKBA 3HACA 1PFVA 1X74A 2G6BA 2PUTA 4IHJB 4JL5A 4KXUA 4MKRA 4QTUB 1KZGB 3UBMA 5C37A 3V8BA 1D6SA 2FFAA 4FI3C 1U7PA 5IWCA 1H66A 3EPHA 3GEPA 2ISCA 1NAIA 4NCNA 1M8JA 1WVIA 1V96A 4MCIA 1GDDA 4PPGA 4JXJA 4QASA 3ZZUA 3NHUA 5D3KA 4YUXA 2AE1A 3WYEA 2YJTD 1XRSB 1LVGA 4KSYA 3RVDA 1XTQA 3MT9A 4REQB 3FCAA 3VYUB 1Z5OA 3ETDA 5IG2A 2Q6IA 5LP6B 1VOTA 3F3YA 4URVR 5BW5A 4DUZB 2RHBA 5CT4A 1MAUA 2ZB2A 4DCTA 2DECA 4A36A 1PFUA 2FX3A 1CUWA 1US8A 5K3SA 3VC3A 3WGKA 1MC1A 3KZCA 2JIOA 3KCQA 2XV1A 3HCBA 4MUBA 1BHJA 4RGYA 4AJOA 5AW6A 5F3WB 2PGAA 5JTUA 5KS2A 1E0DA 4GI7A 2WU8A 4JYCA 3ZWMA 2JGJA 5CCBA 3HB0A 4MRMA 3ZDQA 1DV1A 2P2DA 2PMBA 3O9VA 3DONA 3L77A 1PTJA 4W1RA 3Q0EA 3SWWA 1Z37A 3EUFA 2ZI4A 4NDNE 1UJMA 1KH2A 1KI9A 3RPEA 1UPTA 4EY5A 1D03A 1YRYE 1ZNYA 4I3HA 5A5VA 1GNRA 3ICEA 2JFYA 1F20A 4I9NA 2AJCA 1QX3A 2HA7A 1N78A 4QRDA 4KXXA 4AQ7A 3L6BA 2ZQ5A 1X8KA 1W35A 3TRHA 1JQKA 1WY5A 4EI2A 1GUYA 1E5LA 2OWEA 4R2WA 4KV7A 4IIEA 4BFYA 1KXZA 5A0TA 1HEUA 5AVUA 1U5BA 3V1MA 3HK2A 3RQSA 1USKA 3ZDCA 2P6OA 3K2IA 1HF3A 2BPOA 2GAJA 4P81A 3EFEA 5GTDA 1F06A 4FC6A 4H7EA 3TDMA 3UJDA 2Q8QA 2Z83A 2ABWA 2ESRA 1C4XA 3C5HA 2AT1A 1J25A 3GH3A 4PLTA 1QZXA 4ZVSA 2LCQA 2FRVA 3MMSA 3WYCA 3B2NA 5CFQA 3KALA 4KO2S 1JHQA 4FD3A 3D1LA 3N70A 1PZFA 2WAAA 1G55A 3V8PA 3CO0S 5IZCC 2LIVA 1MBZA 1NVKA 1TFRA 4N12A 1P29A 5JMWA 3PLNA 5LNK1 3D6AA 3ID6C 3G85A 1E64A 1JNYA 4C4OA 3MS4A 1LH0A 5KVSA 4KACA 2OHFA 3K16A 1KI8A 4GNRA 5TNXA 4E07A 2Z8YA 3LIPA 2X42A 2Q28A 3CLRC 4UHKA 5IJ0B 3FDFA 2OBMA 2X9GA 3ZXSA 3DDCA 4FYWA 1KI7A 4AB1A 1JAZA 2UZ1B 1QRAA 4HG2A 3TRIA 3VI3B 3ZU2A 4FYKA 5CDGA 1ZMTA 2C8KA 3QV1A 2VRWA 2CJYA 4RYDA 5FA8A 1YR8A 3KJQA 1DVRA 4NTZA 4BN4A 5L3VA 3KYDB 4MP8A 5CHYA 5I7VA 2JBWA 3MWJA 2MU1A 1QAQA 2WAYA 3BRSA 2O3SA 1N8KA 2BBSA 2ZCUA 4E13A 3DGFC 1VM6A 2NADA 3AGQA 4PYIA 2JCBA 3W7AA 2WU3A 3I2KA 4RELA 4YGYA 1IY8A 2ATEA 3AUUA 3AR3A 1P9RA 1PT5A 2OC9A 4PZPA 3BMXA 5JH7F 3VTFA 1DKQA 4BNUA 4RF5A 2YN0A 3S70A 4C22A 1R5BA 3CEHA 3GP3A 1A2BA 3L07A 2NAFA 2EFYA 2I7DA 3R9IA 3GZNB 2NYVA 1LNQA 2Z58A 4U5XA 1D0IA 1EP9A 2Y68A 3KB8A 3NT5A 2RSLA 5AMXA 3KQUA 4KHZA 1RT9A 1QBKC 1GNLA 4ND7A 4RXMA 2QJOA 4XARA 3ICWA 5F73A 1ND5A 1XTVA 2QVZX 1CUHA 1EFPA 2OV2A 5B6IA 5IS2A 1YH3A 1IVNA 2EW8A 4H9GA 3OOYA 2AA3A 3N0VA 2OYSA 4LZLA 3T4EA 3LWBA 4XR9A 1FJXA 1WW3A 2VH5R 3UJ3X 3R9XB 5COAA 1QDLB 3I72A 1L5QA 2H1CA 3IULA 2O4CA 2E89A 2QROA 2EP7A 3T5BA 4IZIA 3LRXA 1TF2A 3GT4A 4CTJA 4G36A 3CINA 3BVPA 1H0KA 3CC8A 4U7GA 4R71A 2UXCB 4WOCA 1N5LA 5K99A 3C3EA 3RYTC 3M4YA 2BD0A 1PT9A 1GLVA 1NRXA 3EDCA 5A4MS 3IV6A 2I9KA 1YOVB 2ZG6A 3CVXA 4P4GA 5FWNA 4BO4A 2Q5CA 1ONSA 1FZTA 1JDBC 1DLJA 4C1BA 5EJ8A 3KEMA 5ILOA 3UJAA 3ZVNA 4IHKA 1Z2OX 2XMCA 3L7NA 1TO2E 4GHWA 2IS1A 5DTEA 1ECBA 1PGNA 1NR7A 2B4TO 3GLFE 2GYYA 2P4QA 2Y0PA 4DDMA 3A4MA 1DIHA 1TMOA 4R83A 3DVSX 4Q7KA 1L4LA 2AQ8A 2HF7A 2W58A 4W8GA 1ZEMA 2YJ3A 2EP5A 2J45A 4BDTA 5DNUA 1WOYA 1HK7A 3PGKA 4OK5A 4DA0A 2LR0A 1CUYA 1GQOA 1SIBE 2DH6A 3V97A 3WYGA 3X3HA 1W5BA 3RNLA 3ZLUA 4AJ4A 3K4QA 3LY9A 2HX1A 1KYYA 4L0QA 3LHKA 3GUCA 2GRAA 3DE7X 3HJCA 2PZBA 3ZHCA 3V2IA 1FMLA 1RKBA 5DB4A 4C06A 2C4KA 2EAUA 1GU1A 2GN8A 2H07A 4ILEA 4UW9A 4PR3A 4EUEA 4WJLA 5KKCA 5C2JB 3OJWA 3WBBA 1W2HA 3R9XA 1MENA 2X4LA 1RYBA 1NF3A 2R00A 3QEMB 4PX9A 5EIAA 2QN7A 1JG2A 4BUCA 1HMYA 4MXDA 4QA9A 1G2PA 4EEKA 2GSWA 1X1DA 1MOPA 3AUKA 4R3WA 4C04A 3T5DA 3CRQA 1YUNA 4MS1B 1YULA 3DLTA 3U4QA 1M6VA 5K0FA 2PGIA 2AGVA 2PXAA 1LF5A 3EGXA 4DJTA 5F51A 3ONFA 5DM60 1XWWA 3UKJA 1QHEA 1NASA 4TV8B 1U0EA 1QUEA 2Q3EA 2K5UA 4EBBA 3C8HA 2R00C 4J0CA 821PA 1FS6A 1A0OA 1AO0A 5AJVB 4Q1BA 3E3OA 3MSCA 5AVYA 5HW0A 4Y2TA 4XSVA 3ZGVA 4JBNA 4UHEA 1ZK2A 3QX3A 1J2YA 1MJ5A 2D1YA 4HPWA 3KJFA 3TB4A 1BYIA 3FH0A 2VO1A 2ZBQA 2PZ8A 4L0DA 1MA3A 1U2RA 4ARUA 1G8KA 1TVMA 2CSUA 1NOIA 4DV2B 2BFFB 2QG4A 2ZJ0A 1OUMA 2EX1A 5TQ2A 3OETA 2VL7A 3EY9A 3I73A 1DX4A 2WMYA 3L7IA 4CYMA 2C7VA 1RIFA 3N6XA 1EBFA 5GZ1A 1X42A 2HREA 3OJFA 3FZEA 3OEED 4G24A 4HYEA 3TJRA 4K0RA 4JD5A 2J48A 4R54A 1JE0A 5IVIA 5HS4A 1SHZA 3QSYA 1K8XB 3H6GA 5KYWB 3GQBA 4DR5B 1Y98A 2QE7D 3N6VA 2HQ1A 3DTTA 3HY4A 4TMFA 4QSHA 4BLUA 1NXTA 4YMGA 3M5WA 3UFBA 1E6UA 4LJRA 4N0MA 1NTOA 2QM0A 3RAJA 4YRCA 5BUSA 5BN3A 1QVWA 1JFLA 2D62A 3U9LA 5K6TA 3L4KA 4C7XA 4P84A 1CIPA 1P75A 1EHCA 1XZPA 2YFQA 3CX3A 3NKFA 3QEKA 4GS5A 1QFSA 2C07A 2FFRA 4Q15A 1RZRD 1XGKA 4XVQA 1VHQA 2R87A 1XJCA 4AS2A 5IDVA 3A6HA 3IXLA 2IL1A 3UFXB 1YQQA 2F2TA 2H18A 4EWLA 1XZLA 1NX9A 4DV7B 3W3AH 3GPIA 1GPKA 1TZ2A 3MYYA 2VDNB 3OFKA 1CZHA 1TMKA 1AT1A 1YWGO 3ND5A 1FPQA 1WV1A 2F64A 1Z6GA 3GVHA 4U0JA 3ISJA 3C70A 2WIBA 5EZ5A 5F5XA 2XT9A 4BNIA 2FPOA 5H4GA 1O1YA 1NUHA 3MA0A 1JYEA 2I8CA 2AQKA 1U0FA 2CFCA 2QTVA 4X6XA 3V46A 4DDWA 1SBTA 2P7HA 1K6MA 1DT5A 5TMDA 2WTUA 3L04A 1VLLA 1LF0A 3AHIA 4Q18A 1X9IA 1CC1S 1PAUA 1Z2PX 2RDMA 2PGDA 3IHTA 4WY2A 4XXHA 3E5NA 1G42A 4DPKA 4RE6A 2QN2A 1X3SA 4N48A 1O96B 2BJHA 1VFPA 1QOPB 1A4RA 1DZ3A 2E5WA 4NCIA 3QJ5A 1RCTE 3W6OA 1VHJA 1BROA 1XD8A 1XMSA 3GO4A 4PAWA 4UUNA 1AA6A 2W22A 3A04A 3MWKA 4ZKEA 4C5BA 4RA6B 4ZK2A 1UBGA 1KC1A 2WWHA 3JYHA 3ZHYA 4FZVA 4EA7A 2W4MA 4AZTA 1VJTA 3MD9A 3I8XA 1Z0AA 1W5SA 3QXJA 3KKPA 3I05A 2PRJA 2I4OA 4DN6A 3QOWA 1ES9A 1WB6A 3NDBB 1B0ZA 5TMBA 1G5FA 2FPIA 3B3GA 4AMUA 2DFNA 1KGSA 4ND6A 4GYKA 3RKSA 1FJ2A 1ZR2A 4P4TA 1NMXA 2QQFA 3K5WA 3LUJA 4LVUA 1PLJA 1RHKA 4LRXA 1QVZA 3KWMA 1QF6A 3FLEA 4L9AA 2E6UX 3I37X 4G56A 2QMUA 1IUNA 1CU1A 1O6FA 4J2OA 4GX5A 3D9QX 2C59A 1EZ4A 1UZMA 3I9V1 1QHGA 2TRSB 1OZGA 3P9KA 4B7UA 4YMLA 1SCJA 1EX7A 4NE7A 4F0JA 5ICSA 3KLPX 1PK8A 1TJYA 3ONVA 4IWNA 4KIWA 1UAGA 2XXBA 4KLRA 2EG5A 2OHHA 2RGGA 1M34E 4ENWA 3PUWA 4EY7A 5C7IO 3EARA 4JYPA 4Y9RA 1PL8A 2YW2A 3F49S 4I36A 2H2HA 3IRVA 3S44A 2I62A 1NQOA 4YI3A 1SUDA 2B25A 1UBOS 4WKGA 2LUOA 1B16A 1MR3F 2HK9A 5AW2A 2HLNA 2ZU0C 4Y1FA 5CA1B 3HXLA 3L4BC 3NVKI 3U7EB 1C9KA 1E66A 4RX1A 4EA9A 4R9SA 3R74A 3EWAA 3CZPA 2Z2IA 2OUKA 2XY4A 3RIXA 3UK2A 3L7BA 4BLQA 2RCYA 1GGMA 5C8VA 3EPKA 5ALTA 3BB1A 3IKTA 1OYVA 3ZKWA 1C3EA 5KSOA 2H06A 1U4SA 3PB3A 2DUWA 4X20A 3A6EA 5BORA 1J2EA 1JG3A 3WK8A 4B3DA 5KINB 4LISA 5D3MB 5IAOA 4D0RA 4RTRA 1XQVA 3HL0A 4MUEA 3W06A 3ZWBA 1TEHA 1QV6A 2XMQA 3TX6A 4KLAA 1NPYA 3IDAA 3RRYA 5BQFA 1OR8A 2I67A 1E1LA 4IBOA 3M6FA 1I7NA 4P98A 2H6EA 5EMJA 4NU5A 3NLLA 4YRRA 5H16A 3A8TA 3MTEA 1Y1RA 2FEPA 4D98A 4JJFA 1J5PA 4KTVE 3RGWS 4AJIA 5KMGB 4J0EA 1P60A 5B3JC 1J0AA 1ZGBA 4JT8A 3SOPA 5BT8A 5LNK6 3DW3X 3U4IA 1VL8A 1RW4A 3K8ZA 5GADl 1OAOC 4RS4A 3IPXA 4WGFA 2W6MA 3L8GA 4LV8B 3O8RA 5ALRA 3HUFA 4WESA 2BZ0A 4YAEA 4E1BA 4EHIA 4ENSA 5LN1A 1Y8ZA 3FVRA 1XA0A 2VF5X 1THZA 3NHKA 1BE0A 3R0JA 4DA7A 2JH3A 1PSWA 3W8EA 4L3OA 1LQTA 1U65A 3IP5A 4MYUA 4NWIA 1VPVA 4CUKA 3NMUF 3HWRA 4PTZA 4V1CB 2YC4C 3P0IA 1UMCB 3WY9A 5KNBA 4DQDA 3QBJA 1U5BB 1RXEA 3NM6B 4GE0A 3X43A 4FDTA 1RCUA 4MV9A 1X1TA 5BSKA 1C8LA 2NTVA 3MJEA 5DOVA 3LY5A 2QDKA 1AKWA 3I9FA 1E3IA 3MLBA 3WFJA 4BV9A 3LRTA 4BX3A 2R8BA 4AKIA 4B3GA 4IX1A 1VYTA 3PJDA 4JUIA 4QSMA 2VPWA 1PEDA 4Q1AA 2H17A 4NAHA 1NXVA 2HN9A 3FOEC 4KREA 1UZUA 2ZJ8A 3LVFO 3ZWQA 2BMVA 1PU2A 3LAWA 4R05A 3LQYA 5DCYA 2IS2A 5DHAA 3OZTA 4K9KA 1Y5MA 1Y0BA 3STUA 2YJNA 4FFSA 3RANA 1N57A 5BN1A 2AL7A 2O2DA 1AKRA 1CR6A 1NJ5A 1TRHA 3MFQA 3Q98A 4IOKA 1N5IA 3RWOA 4UTXA 2BW0A 1VMIA 4RZXA 2GPBA 1P1KA 2PH3A 4TKZA 1SVMA 1K68A 1F8YA 3ZOKA 2AN9A 4WOBA 4WE3A 1OWLA 2NNLD 3GJTA 3LLCA 4DHEA 2IVZA 2PWYA 1LSOA 3FB4A 2H1FA 1XFDA 3IJEB 4QOHA 5T41A 2W0MA 3ZWVA 4EHBA 2OZLA 2WINI 3EPPA 5BR1A 1NMQA 5HQ3A 1N2EA 4ENQA 2DQYA 1A9SA 1O89A 4IQ4A 4OCZA 4IDOA 1FNCA 3DFFA 1N8SA 3RBAA 2EIHA 4OQMA 4TV9F 4F9TA 2RAFA 2WJIA 3FMGA 2YWGA 3KOXA 4EFDA 5A3QA 4NS1A 4D6XA 1DWOA 4U7JA 1KDVA 1ZIYA 1TZJA 1U2QA 3C8ZA 3GGCA 4YALA 3SIXA 1POWA 3SNKA 4I99A 2FW1A 2Q99A 5FX2A 1O4VA 4HQOA 3IDFA 4Y2JA 3EWSA 4M1YA 3RTGA 5FT9A 3SZLA 4ZHQB 5SYNA 3HCPA 1JJIA 1P2GA 3NO4A 4FXOA 2FZCA 4TN5A 5A4IS 4PZUA 3CX6A 2B37A 2QLFA 3CW2A 1YRHA 3OTHA 2WJ4A 5IVKA 1Z25A 3N9IA 4XIYA 4QOJA 3RG2A 4GZ6A 4HTFA 3QVOA 3W6NA 1P0MA 4NICA 2O14A 4KXLA 3IMFA 4GICA 2VUSA 3P4XA 2XCUA 1JAHA 2REBA 3K0KA 1O0CA 4IJVA 2FSVA 4I4TA 3H9GA 1KSGA 3BREA 2PT5A 4LHSA 2HRCA 4OP1A 2X0JA 1FSFA 1L5HA 3JARA 2HGSA 3PYLA 3FYSA 3P26A 1P1FA 4HPJB 4B6JA 4IDQA 3MTJA 3VZDA 1RAGA 3HV2A 1QLWA 3PFIA 5LUBA 5KX5A 1NFQA 1PZNA 3GJ8A 1YF3A 4BO1A 4GQBA 2NV6A 4YT5A 4A6DA 1BRTA 4HTAA 4XLZA 2BI8A 2QF7A 3EIHA 3OPYI 2OAGA 3LLMA 3H86A 4A23A 4AWAA 4RL4A 1OE0A 2DSNA 3TGLA 1LWNA 3VPAA 3EPJA 5EC8A 1AK9A 3MS7A 1ZKDA 3WOVA 3V7FA 5AESA 3SYRA 2O57A 1Z18A 3EUWA 4HDOB 1FFWA 1K98A 4US0R 2PS3A 3RI3A 3WGHA 1TE2A 2E9SA 3LP5A 4LE2A 4BMSA 4YCNA 4K46A 1QQBA 1OAKA 3ROZA 1PE0A 4DQKA 8AT1A 4WEOA 3SHQA 4HD8A 3L0ZA 3E7FA 4R6XA 3VZBA 2P8SA 3E9YA 1VI6A 1KEPA 1D4ZA 4D4GA 4CIWA 1G20E 4NMXB 3RK0A 4B3BA 1Y1LA 1I3MA 2MWMA 4LF5B 5A9TA 4CIAA 1B3BA 2W6NA 3QE3A 4PG6A 4EB6B 1J8YF 2HDHA 5E3IA 2UVQA 3A1EA 4G5OA 1G8PA 1JQAA 3OCZA 2GFIA 5LMNB 4QPPA 2G70A 1NFRA 5AI8A 2FUEA 2FJPA 2XVXA 4FGWA 4NG5A 1QFJA 4N39A 5ENVA 1MN6A 1BZYA 2J5QA 3VPGA 3BMNA 3WLRA 4S2EA 1IM2A 2XRMA 3GJ6A 3HP1A 2OCDA 1ULSA 3S1AA 3Q7SA 3S4YA 5G1OA 4B9AA 4NKRA 4YJ2B 3TOVA 1UL1X 3T4UA 3IGFA 4OJNA 2DOKA 3WQBA 3VC1A 1R9NA 2C8JA 4XFDA 4FINA 1QZ3A 1U8FO 2R5FA 3AR5A 3QG5A 1VP9A 5A4JA 3OQ1A 3AP1A 3KYDA 4WBNF 5FLYA 3TAUA 1HYEA 1MGPA 4DREA 2QR5A 1EWTA 1EA5A 3ANLA 1E6WA 4PN3A 5ITZA 1YBFA 2CDCA 3N8GA 1YDGA 1NIJA 1TQ8A 2P9FA 1MZPA 2B8NA 1IOZA 4YRSA 3K31A 4OQPA 5AOVA 4BKOA 3V32A 4Q03A 1RJDA 4DV6B 4P33A 2QI9F 1AKTA 3T3GA 4IM7A 3RU3A 1AGRA 2EDAA 4NNPA 3IQXA 3VJLA 1UKAA 3T52A 4H6VA 1Z0FA 2LKCA 3T0IA 3UJBA 4I6GA 1RPAA 5IVHA 2Y1XA 2ZBDA 1NY6A 4MEAA 4CDRA 1WZEA 3PC2A 5EJ4A 4P3OA 4NVRA 4EA6A 2AI2A 1KKMA 3LQ4A 1RDFA 1H85A 1RAIA 2IPAB 2IDMA 2ZYSA 4NFYA 1HTWA 4NJEB 4P32A 2XNSA 4D3DA 5KPJA 4FYIA 1KE2A 4HZIA 3VZSA 2A9KA 2C9CA 3CRZA 4WKOA 2PANA 2X8WA 1KIFA 4QPZA 4ZI5A 1NW4A 4MUMA 1U9IA 5J4KA 2FN8A 4HS4A 1XMIA 1EXNA 4J0HA 3EUAA 4RPLA 3MJDA 4U8HA 4AY6A 3AR6A 4KUEA 3O95A 4LOIA 1CYDA 1SU4A 3ZH2A 2NT3A 4OYLA 1GM5A 2J0UA 1RC8A 2H2WA 3PKIA 1OLSA 4JASB 4D9EA 1W4LA 1RHMA 1ZG3A 3KKOA 3F2IA 3S2IA 2D5AA 1W29A 5HFJA 4EJ0A 1KQFA 1G8MA 4P08A 4HX2A 1FQOA 1NR5A 4JSYA 1QBGA 4FB5A 2CT8A 1CEEA 4BVGA 1N5KA 5HJ2A 1OQAA 2FMHA 3LQRA 4WZBB 1XDSA 3S3TA 1HQCA 3L41A 3B5JA 4U6NA 4ZQEA 1OIWA 3EZ9A 4DSAA 4OU4A 2OORC 4TS4A 1PVDA 4UEWA 4EI8A 4P4LA 2I2DA 2HADA 4LYYA 2OYRA 3GK3A 1ISPA 4B40A 2Q5HA 1QK3A 2QSYA 1MC8A 4GECA 2Y1FA 5FWYB 3KKMA 1JDVA 3A1NA 3MPOA 4MVWA 5CJ2A 3VSDA 4MQEA 1NV8A 4BO3A 1NRIA 3DJFA 4D7AA 4I9FA 3ZHQA 3M33A 1PI3A 4R0MA 2FUG1 3DDUA 4MLDA 4RZ2A 2J9YB 5IX8A 3UKOA 4E4TA 1SVUA 2PBLA 2Z8YM 2CDRA 3I32A 3OD1A 1SVNA 2AG6A 1PHPA 3BFJA 4KR3A 4PXAA 5ALZA 4ARZB 5DOZA 5IJAA 2HQBA 3GYGA 2PUFA 1DG1G 2ZYVX 5CT9A 3WRYC 3B6EA 1B6GA 2VSNA 5L3RA 2X3UA 4CBVA 3KKKA 1P8AA 4G65A 1W59A 3EF0A 4NBLA 1VSBA 3PXCX 5CB8A 3A6PC 4HNRA 3NQ41 3PWSA 4MRRA 3ADPA 1QWSA 4N9QA 2OPBA 2E82A 2J3DA 3E9NA 4DGSA 4HVAA 1UIMA 4CTOA 2BKVA 2BHRA 4NZOA 3RH0A 3UWDA 4CDNA 1SR8A 1UC4B 3K0BA 1SKYB 4ZHQA 3G7NA 3E23A 2FQWA 3DAPA 1ADJA 1FYEA 2X22A 2PLWA 4QXPA 4CLRA 4X71A 3BBLA 3KUKA 4JC8A 4JAVC 3QHAA 3CEJA 3IKJA 3KUXA 3QYFA 1QZZA 1U0TA 3AETA 3MOIA 3O84A 4FZ3A 5JAQA 3WMFA 4EY8A 2FPKA 3DWFA 4PX2A 3I6QA 4LF6B 1ZD9A 1QH0A 2PYIA 4FJ1A 3UOWA 5KQRA 2K6GA 4U7FA 3SM9A 4RADA 2J59A 2R1TB 5AWFC 2ZRGA 3ROEA 3U1BA 3HJNA 2UYYA 3AERB 2HJSA 2ZJFA 5K0TA 5LZ4A 1U6IA 5DDIP 3WB9A 1L8OA 4I4LA 3E48A 1L3BA 3OECA 4U02A 5GOZA 3TZ6A 1BCRA 3DOCA 5JRJA 1NJ1A 1OW3B 3M6WA 3HRIA 4JJ6A 3GLFA 1XDGA 5EUBA 1E59A 5CVTA 1CJVC 2IH4A 2BE9A 2YYZA 4YJ3F 4AAYA 5EP3A 1Q0HA 3A1UA 2ZRLA 4FM9A 3EQ2A 2NQ8A 3MM4A 2XQFA 3M1AA 1SG9A 1Y5NA 4M38A 5FNVB 3UXYA 1QH8A 2QAGA 2BM1A 5BSWA 2HXSA 2J08A 4P34A 4FN4A 3T4PA 1F0YA 1MH1A 1QS0B 2WJPA 4GQAA 3AIIA 2WTXA 1T4GA 5HKKA 3ZTTA 4UVGA 2R6GA 3MB5A 4NV3A 1K08A 1P80A 5AR1A 2CV1A 3OQPA 4CM3A 3ZGXA 1T4CB 3NWEA 3O94A 4EZIA 4DBZA 3CLKA 1IUKA 4NYJR 3L1IA 4ZOEA 1IN4A 3I64A 3K0CC 5BNIA 2IY8A 3BWYA 3FSGD 4YFVA 3STHA 3BWBA 2XOXA 2J32A 2JS7A 3I9MA 3F4LA 1FX0A 3GRUA 1CUIA 4WX2B 4BXOB 1XEXB 3NVMB 1D1SA 4W82A 5KDDA 2MSCB 1L7OA 1T1GA 1UWKA 1GAQA 2CGEA 3B9BA 4NH4A 1NXXA 3H18A 3T9EA 3K9NA 1KYTA 1IWPB 2HHLA 2I7XA 3QJYA 1XMQB 2IEGA 3V7YA 4WBSA 1XCGB 4X92A 3HXQA 4M9XA 1BE1A 2IWHA 1Y3AA 1DAGA 2VRNA 3TKYA 1L4BA 1OXBB 1EP3B 2A78A 3QG1A 4AG5A 4IHAA 2NO6A 1FDTA 1G8JA 1BGWA 1DEHA 4KX5A 4E2FA 1WEHA 4MHSA 1A9YA 2ZE8A 3ZNNA 1MRSA 1ZMOA 4QLAA 3ZW7A 1XXHA 2I03A 3AEYA 5JCOC 1SC1A 1KNQA 2WKSA 2ZBEA 3UZUA 4U9IS 3RBXA 3RS2A 3QKRB 3QGMA 1M2WA 2VHVA 5ILGA 5CGZA 3SIRA 2PXHA 2YHAA 4UDXX 1LZKA 4MVCA 3W8NA 3W5BA 3QOYA 2AFIA 4S05A 2ZJ7A 3HJUA 3QFSA 3ZWWA 2E3JA 3TW8B 4L51A 1KWKA 4GZMA 2CUTA 1EKXA 1VKNA 1CR1A 3EGIA 4NS4A 3ZWDA 4GKJB 3FPBA 4C78A 1LNSA 3AXTA 1U1DA 1FSSA 1G6Q1 3GGJA 3I76A 1AGNA 2Q3JA 2FPWA 4LWPA 4RY9A 1NLUA 2V7GA 2JBAB 4FJ2A 1VBFA 3T1TA 1GTVA 4I5FA 3O8CA 3L5OA 3PD0A 1NNUA 3I3SR 7YASA 2BE7A 2BGUA 4DARA 5JPCA 1NZFA 2QW0X 1WW2A 3H99A 2PVSA 1EQUA 2A94A 2IQIA 4JBGA 1TQ6A 2BEVB 3FDZB 2C2OA 3IDZA 1H6DA 1YUMA 3GD7A 3HBAA 1JEQA 5GONB 4GYJA 3NHAA 3TLKA 3QF4A 1Y3FE 4A10A 1EFKA 3JU3A 4JEIA 3UJ9A 4WH0A 1RE1A 5FYQA 2GBIA 5E4FA 2ZREA 4B4VA 1PDVA 4Y2YA 2G88A 2UZ3A 2VDKB 5CCDA 3L06A 4EKYA 1G4UR 3RJ9A 3G2PA 1DXYA 3LYLA 3BJRA 1EJ0A 2J6CA 4R7GA 2V54A 1RFLA 1NW7A 4S3MA 1ADGA 4Z9AA 1V8OA 4CCSA 4HAVA 1EVYA 3HYSA 3QOXA 4CI9A 3I4CA 4EGCB 2HF9A 1ODTC 1GGVA 3OU6A 3PQDA 3PGMA 5FKJA 2DR3A 4B0OA 3PYMA 5FTMA 3VPBA 1KAEA 1UADA 3ANXA 3E2MA 2W90A 1MB2A 3B1WA 3F96A 3LF2A 2OXRA 1S2IA 2ZSHA 2LP4Y 3EDYA 3DZ8A 2R7MA 2C9ZA 3G0CA 2EGUA 4OJQA 1JIJA 2DETA 2Z6AA 4FPXA 1K27A 3SFVA 2XUGA 3U56A 2H5LA 1IN8A 1Z06A 4HWKA 3FPEA 2QW8A 2X6TA 3S28A 2A0WA 4D8UA 4GLLA 1JZTA 5KMGA 2D7DA 3WAKA 3MGAA 2WJJA 3OM1A 2F4VB 1XN1A 3EGVA 1O95A 2QTZA 2MYNA 3CHYA 4OBXA 1ZUD1 2QQ5A 4MUHA 5TQVA 4JJAA 3V2UA 5CITA 5JS6A 2V9ZA 4MEJA 2O0KA 1F2UB 1U11A 2PRYA 2F1OA 4EVSA 3T3OA 1PNQA 3OCVA 4C4YA 3VYTB 4BNYA 4FOSA 3OQOA 3AFHA 3IDOA 3PPYA 2ETVA 1X15A 2R8YA 1RC1A 2PUJA 4G63A 2GETA 1FMJA 3CRRA 4UM9D 3NGXA 1K2VN 4QNNA 2Q8NA 4L16A 2IWRA 5TF4A 2ZYIA 1ZVVA 3PFNA 5ALJA 3Q8XB 3WLJA 1IXRC 2FSPA 3AR9A 9LDBA 5LA6F 4BCBA 2FY8A 1L7DA 2HBQA 4OXIA 4XX0A 5AUQA 1T8PA 4PAQA 4KQ6A 1N4DA 3WSWA 4TL6A 4U9HS 1L7VC 2Z2JA 3GZNA 5AW7A 5DT9A 1X7YB 3UM9A 4AI6A 2BFCB 2NSLA 3OLYA 2B7CA 2NW6A 5U4QA 1JDJA 1PDOA 5TT0A 3Q11A 4JJGA 3CH7A 1R3DA 2B2CA 1IXKA 2GILA 3NOQA 3B9RA 3PNPA 4IGKA 4RY8A 5JARA 3WZLA 3EASA 4K86A 7AT1A 2FWMX 2ZYAA 4PFSA 1XPUA 1JEDA 2CHFA 1NSYA 2CB9A 2VT3A 1T3SA 3TPZA 2EL9A 1PYGA 3NXKA 1D9ZA 3GNSA 2BKAA 2BISA 4HGQA 1DC5A 1ECFA 1W94A 3KEFA 4UD2A 1OT3A 4Y0AA 5E4YA 4ZVPA 3UF0A 3ZEIA 2KBFA 4LZOA 1WO8A 1A8SA 1FYXA 4V03A 4WNAA 3UWOA 4ZK6A 4F2GA 5ECGC 2HF8A 3PXBA 5F9MA 2JJQA 1E1MA 1TC1A 3KXDA 1RWKA 4D41A 4I7EA 3NAGA 3PDIA 2PZEA 1WKVA 4WCDA 3SYLA 3NCTA 1XZBA 4EFNA 3TCNA 4HDMB 1MJGM 4W9NC 2HRBA 3TL6A 5DTRA 3H5VA 2PH1A 3NYIA 4EARA 3A06A 2HMVA 4LMBA 1VB5A 2IE8A 1VHTA 3LUBA 3ER6A 3ZOZA 1N9GB 4CLXA 3K4PA 2WW8A 1I01A 4K9DA 3ZBTA 2R86A 5F7OA 2HA2A 3LDHA 2QT1A 4NESA 2AX4A 3NH9A 2Z95A 3I1JA 4QATA 4E5KA 2I0FA 5CXQA 4X00A 5JPDA 4WSOA 2G4VA 1ZX1A 4NHOA 5F2KA 2HFKA 3NDPA 5AW4A 2IYFA 2HV9A 2WNIA 3IKMB 1SCIA 3K72B 4XLLA 4H0FA 3DZKA 3O47A 4GWGA 3KQYA 3C3DA 3WLPA 1YKFA 3GMDA 3DEFA 1CUUA 5AHKA 4L5JA 1VBNA 5REQB 4ZHQF 1WDWB 4JZYA 4YP5A 2ZK7A 2X2FA 4A6XA 1C7IA 1ZVKA 4I4NA 1JBEA 4Q4JA 3F3MA 4JLKA 1FFXA 2W2NA 1TAHA 3IP7A 2ZDHA 4PG8A 4LJLA 3DLPX 1M2JA 5K6AC 3CF2A 3V1KA 4G2TA 3WJ2A 5GGYA 4PF1A 4EI9A 2E4YA 3JVDA 4ZQHA 1WMEA 3E1KA 5EEGA 4CZ2A 3H97A 1DIOB 4O0MA 1L5RA 2ZYWX 5FYDA 2O8CA 3DZHA 3AVPA 3BQNB 1PIWA 5DLQC 3HWX1 4LOHA 3EVGA 2ERCA 4DIOA 2G5GX 1WZCA 1FY2A 1E3DA 4G1MB 1D0SA 3DT9A 4GPBA 1Z33A 2QE7A 1B93A 4MCJA 1H2ZA 5FF9A 5IYZF 2ZR0A 2HJRA 1HLDA 4YJ3A 3WR5A 2ZIXB 3KHUA 4R81A 2VZ0A 3DCYA 4DBLC 2XHZA 4MV0A 3VDXA 3IP9A 1CY0A 1QIEA 3HY3A 4FHDA 4YXWA 4KWHA 1A96A 4XDHA 3TBFA 3D7KA 5I48A 2VCEA 2XQKA 1UFQA 1Q1GA 2HHAA 1ODFA 2GOYA 3T5TA 4B2PA 4LECA 3GLHA 2H4WA 4FLFA 3P71T 5A02A 1Z82A 2EF1A 3CLSD 5E2BA 1EB9A 2J1LA 3ZHXA 4DQXA 5FR2A 4NAUA 4K6OA 4KYTA 3TQOA 4HF7A 3H1TA 4J8PA 4RM3A 5G53C 5H02A 2QTNA 5EUQB 1YFLA 1OYOA 1UM9A 1XL0A 2HJGA 2ZDQA 3H5TA 1X1QA 3FBTA 2EQ5A 3I5MA 3L4SO 1DC7A 1OWMA 3LXUX 4B8ZA 2FKNA 2W6JA 5IWAB 1GXSB 4UHHA 4TMTA 4X6UA 4L95C 2C83A 3EAQA 4CV0A 4YAUA 4DYDA 4IQGA 4RLHA 5F2NA 4LFAB 2H31A 1AUVA 2O5VA 2YXBA 3DBVO 3SYMA 4MS4A 5DE3A 4IX9A 3ER8A 1JLLA 1EX1A 1NPTO 3EXEB 5CVCA 3I12A 4EY6A 3CPSA 1OB5A 3GCDA 5B58C 1PKXA 3M4NA 4HNHA 4KQJA 4YI5A 5CD9A 1JIXA 4CV2A 5CA0B 1ZC3A 4JOCA 3I04M 5CM8B 3IALA 1GAWA 2CW5A 4BZPA 1OBFO 1PR1A 4BBAA 4LJ9A 1DIGA 2WYOA 2Z2KA 5D2CA 1ZRNA 5L7TA 4NARA 3FGZA 4B6QA 1JF8A 3QPWA 3OZIA 3PU6A 3P19A 5C1BA 3HO8A 3FDIA 5H80A 3CMCO 3WB0A 1KBOA 4ZQIA 2X2EA 3E3AA 5DLDA 4GPEA 4OHOA 2JGRA 3EK2A 1RM5A 4Z0NA 1SCUA 2IU3A 3EPLA 2J5XA 2O6LA 3HI4A 5CNJA 5AT1A 3WGUA 5D6NA 1NLZA 4CF6A 2OR3A 1ZI9A 4EATA 3AEQB 2RGWA 3L7KA 2IHYA 4Q3LA 3T5GA 5FH9A 4EJ6A 3VZPA 2FE4A 4G09A 1TK3A 2AE2A 1TIKA 3WADA 4CMBA 1HYHA 1S6YA 5HQ3B 4H1HA 1K6XA 4BNXA 3R9KA 1U2TA 3P4YA 4OMFG 1TM4E 3CF6R 3MAAC 4RS3A 2J5KA 3DHNA 2XYPA 1DFHA 1VYHA 2FRDC 2VYCA 4V0RA 3G9XA 3C24A 4B8YA 5BRAA 1V2HE 2GN1A 4RJTA 3GJ5A 4HXFB 1EDZA 5EERA 3B8HA 5C1PA 3V1TC 5I7WA 2I3ZA 5LJIA 3D2BA 1O6ZA 4PX5A 3EZXA 3VR6D 4MWBA 1G59A 2YNMA 3OQBA 2C00A 3O31A 4AMYA 1B4DA 2VP0A 3Q6NA 1WM1A 2NYUA 2VK4A 3FDJA 1ND6A 4IJQA 1QG6A 2BY4A 1J2UA 4S1PA 5LDGA 3DOUA 4G0UA 3LXMA 2C7BA 4L5CA 4DLAA 1FE8A 3GRPA 2WG2A 2NWQA 2ZI7A 4RSMA 5E7MA 4M87A 2HLDD 5AW8A 1F7VA 4CQMD 2J3QA 1B14A 2QUJA 4XM0A 4GPIB 4Z8YA 1D2EA 3ZXYA 4EFKA 3HTXA 1IY9A 1MIOA 4J9UE 4JLWA 2DMRA 2QZJA 4FS8A 4EYEA 1EFTA 4HNGA 3ZNOA 3I5AA 2VHXA 1T2EA 3FOBA 3UGQA 2BH2A 1NT2A 2Q5EA 3I9JA 4TXHA 2KLBA 4UBMA 4B87A 3B78A 1Y6FA 3WGGA 1MOQA 1H2AS 1FDWA 3M6MD 4JUBA 4IMRA 2TMKA 2ZVDA 5EZSA 1C1XB 1FMTA 4P7FA 4D0NA 4CG2A 5JS7A 3KD2A 5EL0A 1RQGA 2CUKA 3NAMA 1UBNA 1YR7A 3PGA1 5EXTA 1E2JA 3BTOA 3B52X 3CNQS 1WBDA 3T3NA 2J0QA 2XZDA 5EWJA 1B1CA 3SQOA 3TE6A 2R7KA 1T29A 4X3CA 3LPNA 4FNAA 4ZDJA 3ROKA 2WIJA 5AKYA 3UUWA 3W9BA 1OFTA 1UMBA 2V55B 2BUCA 3N7AA 4O2BA 4G0YA 4PO8A 4GH5A 4E32A 1E1RD 3FCOA 4WACA 1A1VA 1GPYA 3RSFA 2VZ8A 3Q7PA 1JUDA 1JJBA 1GKUB 1SIUA 2CJWB 2W98A 4DCMA 3FYUC 4OBBA 2Y6UA 5LLDA 3D3NA 3GUYA 4QGAA 5G41A 4R84A 4H0NA 3VSCA 5FWYA 3EQ7A 5F2OA 2HSEA 3N59A 4OPMA 4ZV9A 4A91A 4KPUA 1A5TA 1YQEA 5FPQA 2Z08A 5HBRA 5B7PA 3IBCA 5BR7A 4NJOA 4DLYA 1ISGA 1E2QA 1JTVA 2DVMA 3DBRA 4O3FA 1YBAA 2H2GA 4L8GA 1F17A 2VP5A 3GEMA 1PNTA 3JWPA 4JQOA 4CKEA 4N47A 2R3SA 4HQ6A 1XA4A 4TKLA 4A0FA 3LPCA 5FOTA 1JKFA 2LRHA 1KZYC 1CJSA 3CPHA 4IAOA 2AFVA 4QDXA 4RK5A 5FBRB 3WKDA 5JI2E 3PX7A 1RMQA 3G5AA 2HB6A 3EG9B 3QUAA 4ZTBA 5G1NA 2OKGA 2ZRDA 2OT3B 2JEYA 1Z6AA 5JCXA 4N65A 3KOUA 3LO8A 5HJEA 4FEEA 2V6MA 3KLBA 5JUWA 3QNUA 1V5IA 4MW5A 3KQMA 1RCFA 4URYR 3DW1X 2X1HA 1I4EB 3Q4GA 2J0VA 4M1WA 2FRDA 1RM4A 3F5DA 1KRHA 2ZJOA 5IUJC 2HA0A 3D8BA 3WQSB 1NV9A 2O5RA 5LQCA 4EKNB 2QP3A 1Z9BA 4LV6A 2FQQA 1TU3A 1SCKA 2E18A 2PSHA 721PA 2VXCA 2IS6A 3W5CA 5CB4B 3ILHA 4HAXA 2AXQA 2CJWA 3ABRB 3HDJA 3N2IA 4YMUA 2IYAA 4NR0A 1VRVA 2PWZA 4QDOA 2PN1A 2BKUA 3AH8A 4K6GA 3S99A 1X2BA 1K6EA 2GRUA 3IE0A 2IP4A 3H1GA 4H7IA 4MW0A 4BXOA 5L6MB 3UJNA 2KI5A 2H08A 1CIJA 2F1HA 2Z30A 1JKIA 3DUFB 1OAOA 4HDNA 3STWA 3C1AA 5IARA 1CRLA 4B7CA 2B6NA 4NU6A 1CY1A 3SEAA 1RAEA 3OLQA 3TOXA 3TTTA 4M99A 2AZXA 1LPOA 1XLVA 2JIBA 4D43A 3JQFA 4X91A 2D1RA 1DMRA 1KOJA 2DM6A 3HM2A 1BSVA 2PU7A 1JFRA 5BUQA 1NC1A 1G5IA 1YB6A 4OATA 4D57A 4H1TA 4RF2A 3K09C 2OO5A 4RZSA 2RCNA 2QR2A 5KNDA 3T1HB 3GN2A 4ZDWA 4AJPA 3KDSE 3KT3A 5FNZA 4CLOB 3VHXA 2NU9A 4LYAA 1QTIA 4ZU3A 1WNTA 4UE6A 4ZO6A 3WLEA 3K71B 2QV7A 2VP4A 2GTPA 4L2IA 4NDAA 4DSZA 2X6RA 4E15A 2QLNA 4JL8A 1RPNA 3L0YA 2A57A 3OM8A 4NQRA 1HOTA 1O9BA 2D13A 1ACLA 3MGCA 3OA0A 2E1PA 4MIEA 5A1TA 2C97A 3OPYA 4BQEA 1YD7A 2I4NA 4P4NA 1AD2A 1P6UA 3HR4A 4CTMA 1ZIXA 3H4IA 3X2FA 1U7XA 4JJIA 4QEZA 3Q9LA 4ZIRA 1O6CA 4GC5A 1RQLA 1JHDA 3HU1A 5DPMA 2PKQO 3GHYA 1VRWA 3KVOA 4FYPA 1LC3A 2AMLA 5FHQA 2FX5A 1GG8A 3THOA 3YASA 4EHLA 1GNQA 1R0CA 2A88A 1ONNA 1RP1A 3HB5X 1I80A 2PGJA 5JWOA 2BEUA 3PHJA 1BQ3A 3CSUA 1S9DA 5DSTA 4WK6A 1R4NB 4IIJA 3NP7A 2GFQA 1JG7A 4WJZA 4K0KB 4S1OA 5C31A 1JIQA 3C98A 4IS3A 4MR9B 2A9FA 4CQJA 4DCGA 1Z7YA 4DMHA 5CFMA 4O4IF 4P82A 3I01A 3IP3A 3WTBA 3SAJA 3FNRA 4NBWA 4AJNA 2VS1A 4QL3A 3NFRA 3QXXA 3RK4A 1KJZA 3SFZA 3DDHA 1GSAA 4TWJA 3CBQA 1Z15A 2B4QA 2J33A 4LNAA 4RQBA 5K3FB 1Y9ZA 2G9UA 4GM0A 1UBTS 1MORA 1XKXA 4WLNA 3KYBA 4NBVA 2YJ4A 2C96A 3TBKA 2GLXA 3FKJA 3FVQA 4I1IA 4YQEA 1AURA 1W1IA 2C2YA 1WBJB 1O5IA 4AD8A 3ZDFA 3PUIA 4O4HF 1QU2A 1AGPA 5AFSA 1KS9A 1FP7A 1XFAA 4DCJA 5EIEA 2DHQA 5BURA 1QG4A 4KZPA 5CURA 2GEKA 2I65A 3AHHA 4PR0A 2QGNA 5IJXA 1KYWA 1GFIA 3ILYA 5ANRB 4PLWA 1HE1C 1FRQA 1F8UA 1J42A 1FRNA 2G80A 2XMPA 2ZSDA 4FIDA 4J49A 3H1AA 3GUHA 4TS3A 2Z5GA 2D2VA 1ZSYA 4RMNA 4JI7B 2GN9A 5JEEA 2W2KA 1ETHA 1DX9A 1MHPA 3CFYA 2NU8A 2J3LA 1RWVA 2HK6A 1ICIA 4N8SA 4TTIA 5DXAA 4BB6A 5K8IA 5TY0A 3TQFA 3PQFA 3T3MB 4BMCA 1J7KA 1G63A 1ZCZA 3BIJA 5DGHA 3KX2A 4JSTA 4E2ZA 2XIQA 5FOWA 4Z53A 2PMEA 1C0PA 1VCOA 2BOVA 3AEKA 4W6QA 1FFXB 5JISA 2EBUA 3BGVA 2M6SA 3MWGA 4M7OA 4ML3A 1NGSA 1KY2A 2I55A 3FMPB 3O4VA 1B23P 5AJXA 2R85A 1ONBA 3L6RA 4E2WA 4EY4A 4ZMSA 3SKVA 2C5AA 2QYSA 4H4EA 1U28A 2QM7A 5DI3B 4YP0A 1DP4A 3A0RB 3KAPA 5FUQA 3K0SA 3BMQA 3EEIA 3IB6A 5D8DA 4JMPA 1WHTA 5FA6A 4BKRA 4P5PA 4ZVLA 3H2YA 3R1IA 2UUPA 4GR5A 4E22A 1P33A 2OSVA 2GAOA 5C46F 1DPGA 1OXKB 1TKBA 3FX2A 3BRCA 3NHSA 4MUAA 1I5RA 1W85A 2HKIA 3KTFA 2QVXX 1KSHA 3SG0A 3FF1A 4R7TA 5HGJA 1FUKA 1EUDA 1TUIA 2FTKE 3KFLA 4YDSA 3UT5A 4LI3X 2O0MA 2WUGA 2GAAA 1RLIA 2ODPA 3L0DA 1V7ZA 2WA1A 2NVBA 5DYWA 4B4KA 3QNWA 4BEJA 5A9SB 2ET6A 2YJ5A 2FHPA 2ZW9A 1GZ5A 4XE5A 4AF8A 4DM7A 3JQRA 1ZCJA 5CVEA 4WCFC 3PICA 3DOHA 3SMVA 4DMCA 2FGKA 1D9XA 1JG1A 3OPNA 3VO9A 2OVBA 4HNVA 1QQ6A 3EOZA 2NQTA 3VKWA 1K4YA 2WJGA 2WZQA 3HU5A 2HQRA 4MUGA 1CHDA 3WMWA 1J8QA 3WG9A 2C5BA 2Z5VA 2YHIB 3MTBA 4LY6A 3I0MA 5EZYB 3ZUGA 4RD2A 1E7RA 3SF8A 3SIWA 4Q37A 3B12A 5E9QA 3F78A 1AU9A 2WAMA 5CNMA 3UAYA 3GPDG 2D2IA 3AEKB 3H05A 2E0IA 5ALHA 3BFPA 4N0EA 3ANTA 4FFOA 1XL1A 3LT5A 4N3GA 2JDIA 2WWXA 1NXQA 3L8YA 2DGDA 4IVNA 4JQCA 3SGLA 1VHWA 4B76A 3KR2A 2O2YA 3GCWA 3P5SA 2PUVA 1HDXA 4UE2A 2OL4A 2E2WA 2AQHA 2OXCA 3H5WA 4ETMA 4NCBA 2ISQA 2JAHA 2O2SA 2C54A 1SURA 2NO9A 5B1HA 2DPXA 4B6PA 4CKCB 2EXXA 3QYJA 5B6JA 4ZGGA 3AESA 3VR2A 1JDZA 3GDFA 5IVDA 4PC1A 1EHYA 2J3EA 1O97C 2RAVA 3VR6A 3M4JA 1FFCA 5TF0A 5KTOA 2V1UA 3X1YA 1X6VA 2OHGA 1BAPA 1BKDR 1S7GA 2HV8A 4WINA 4OI1A 1ZGJA 1EGMB 4MWOA 4HXYA 3TSYA 4B71A 4EYOA 2CV2A 3PNLA 5HFAA 1E9EA 2VOEA 3X1MA 1YQUA 1KH3A 3ADKA 1RMYA 1Y89A 4LQLA 4CN8A 4UTVA 2A30A 3HA7A 5A03A 3DZGA 5KX5B 1JWLA 1NQVA 5BWLA 1XXHE 1FRZA 2X8LA 4IG9A 4QYTA 4TKMA 5EWLB 5IKMA 1GJRA 2RKWA 4JA0A 1YA6A 3IVCA 1PKEA 5IT0A 2M6KA 1RQPA 1VSTA 2HJ9A 4DRYA 1T9ZA 5AK4A 3ONEA 2HEIA 2VHUA 3ONDA 1I0ZA 3TSWA 4DCOA 1EGQA 1R6DA 3KPJA 4UE3S 2F1IA 4EFMA 3VDMA 5KJCA 3X1XA 1ZU4A 3GFVA 3BRWA 1XPRA 2M9MA 5BSHA 2Q3MA 4TTTS 3T61A 3GA7A 1KEZA 2YXNA 3H2KA 1HTBA 3KPYA 1PL6A 4TLMB 4A5OA 2JD2A 4IO1A 4KQ9A 4P8RA 2EP8A 5KKNB 1AV6A 4N01A 3K6JA 3R77A 1ZGZA 5EJ2A 3C8MA 1R10A 3CLSC 3NTLA 4Y18A 5FWDA 3TSAA 1CX9B 4IRXA 1OTXA 4JVLA 5JZ9A 3N28A 1IRIA 2QPTA 4Z4FA 2FRXA 2VDPB 4TROA 1YSCA 1Q44A 1TKCA 3NUGA 1EGHA 2M1XA 3I6MA 5FI1B 1QIDA 4TYPA 1IZZA 3FLBA 4D8XA 2R9VA 3TLCA 4GRAA 5F52A 2ZSAA 2GD2A 1ECLA 1OXSC 3N3BC 4IHJF 2XEDA 5GZ6A 1MO4A 1R0YA 2C2KA 2AMVA 3HYRA 3ITKA 1U3GA 2HWXA 3L0OA 4ID9A 3BK7A 1XKTA 1KZ7B 3K5HA 1P1IA 5C7OO 2IK8A 4JODA 1IBSA 2FPRA 2OKCA 4QD3A 2VIIA 4OSPA 4S35A 4RMHA 5I7HA 1T9KA 3CGGA 3NKLA 2IHBA 2OHJA 3AM5A 4KI7A 1KQ3A 3LCRA 3BE6A 2H1HA 2JLQA 3HZRA 5JSZA 2G9VA 2VSXA 2I6FA 3CNLA 1I4TD 3KIPA 1UXOA 2GM3A 2ZTVA 4K9MA 2EWWA 3BERA 4MNTA 4AECA 3X1ZA 2C7OA 5K3FA 3H9QA 3MJRA 3AOEA 1QONA 4UQPA 4KG7A 4WZ6A 4KL8S 3G2JA 2AK3A 3TLMA 1DC6A 4E46A 4MVJG 5LD2B 4DANA 1X9GA 4I2VA 5JYDA 3LL7A 2PUBA 2FPUA 3HVIA 5WRFA 1I4LD 4NEGA 5F7XA 1CUZA 5HP4A 4GLBA