4XM0A

N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
264
Chain Sequence
NVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 75
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm0A00
3WL4A 3DFIA 5CGZA 4XM0A 4XM1A 3DFKA 4XM2A 2IXDA 3WL3A 2XADA 1UANA 5BMOA 5B2FA 4XLZA 3WE7A 4EWLA 5B2EA 3DFFA 1Q74A 2X9LA 3DFMA 1Q7TA
chains in the Genus database with same CATH superfamily
2OORC 1VJGA 1ZUHA 1QE5A 5F2KA 3OA0A 2IC5A 4Y1EA 2C98A 3WLFA 1V39A 1T1GA 1HDXA 1ZNZA 1Z83A 1BXKA 2FSPA 2HRQA 5DM70 3J80A 3SGLA 4U9IS 2BOVA 2JFBA 3LUDA 3JV7A 3PTLA 1NDUA 3WLIA 4AY4A 3WAGA 2FPMA 2RD2A 3Q8MA 3UANA 2NZXA 1YTUA 4J16C 4M8KA 2R7NA 2RH4A 4DR5B 4J7XA 4YDHB 4Z99A 4ARAA 4HDKA 1KY2A 3A1FA 2FAXA 3RSQA 4DBVO 1FJXA 1DOHA 4K9SA 2AK3A 3VYSB 3L0IB 2FWBA 4B7UA 2GJSA 2C88A 2XNDD 2EP5A 3B1ZA 3HDVA 4B3JA 4UFPA 1OJ7A 2W6NA 2VQFB 2R2GA 1XAGA 2ZYRA 2GO1A 1T9KA 1W1WA 1D4OA 1SCAA 2GPWA 2ZTMA 1BGWA 1V8DA 2WAXA 2XQKA 3HDJA 3FMGA 3JW8A 5D3MB 5ECYA 1PGNA 1N0HA 2Z5LA 4TSFA 5FWDA 3WLSA 3JQRA 2IKSA 2IYQA 4CKBB 1W30A 1U8CB 5FBQB 5L7TA 2ZJ1A 1WXGA 2WIJA 3FTDA 3N8HA 4MR8A 3QBJA 5BQ3A 3A6ZA 1HT1E 3ERCA 1B0UA 2GF2A 4BVLA 2EQBA 4NYJR 1OSNA 3DO6A 3THXA 1DC6A 3PB3A 3VRHA 4QYXA 4GMGA 1V4NA 4QX6A 1QF9A 1N5JA 1C2TA 2RAUA 3F74A 4C0LA 1Z5OA 1BQ3A 2HA4A 2B78A 3AEYA 1Z5ZA 4KKVA 1KBZA 4TV8F 2NXEA 3ZVNA 2YJ4A 4P0QB 4GX0A 5IC4A 2JIBA 3K2EA 2GNAA 3Q41A 3S2ZA 2VXBA 1K66A 1ZUD1 2W6OA 3A1DA 3H0KA 1MW8X 1BGVA 2ZT5A 1BVRA 3CZ5A 2C7VA 2DFNA 2O8FB 1OFVA 1ZM7A 3IV9A 3RRYA 4EP1A 4UDOA 2RB4A 3WLJA 1WE2A 1FU8A 3D7NA 1LBHA 2ACKA 1VJCA 4C01A 1GKUB 4KQFA 4D46A 5HCNA 1BHO1 1X87A 3M83A 3OJ0A 2EJTA 3C1TA 1ML4A 1NOKA 1H2XA 2BGUA 3COPA 4V0QA 3RVMA 1EBFA 5HR5A 4YMIA 5HZHA 3ZJUA 2OCXA 1CR1A 4RZ2A 2Z4RA 4PWYA 4BAZA 2GZDA 1NR5A 1YBAA 1S3GA 4J8PA 2BR5A 2HRDA 5A71A 2PX6A 4EPVA 4LHXA 1JRLA 2JLVA 2D1QA 1MC8A 3M6LA 2NWQA 2X0KA 4HWRA 3DJYA 4Z2AA 1YOVA 2Q45A 4KAXA 2QRLA 5EKXA 1WF3A 3LUGA 4DV6B 3E9RA 4J03A 2PJRA 3R7NA 1R8SA 1RAHA 5KWEA 2JA1A 3V1YA 5DIFA 2DZDA 4OMDA 4M0LA 5TSDA 3VZRA 3GRRA 3IUJA 3LIIA 1M2GA 2YWCA 3RWOA 3QIVA 4PYIA 5DN9A 4D9GA 1TLFA 4KI7A 4Q4AA 3K6SB 1J7KA 1N1GA 4HDOB 1CJSA 2Q21A 1G9XA 3FUTA 3TLCA 3C7DB 3CEMA 1YQWA 5IZCC 5M34A 1GSIA 3OZFA 3SDBA 4Y2HA 1H4QA 2R8BA 2BMDA 3DD1A 1RD4A 1QWSA 4FGWA 4JEMA 3WICA 5LXTF 4RA6A 1L4HA 1FFSA 4YRBA 2J4FA 3OQJA 2VF7A 2VPWA 3GFRA 2Z3ZA 1KAQA 3QYFA 5TQ2A 5CFQA 2YKGA 3DDCA 4DM4A 1PZMA 1LPMA 4JLNA 4MWTA 2V7EA 2GBLA 5HBRA 4D25A 3AHHA 2P67A 3AFMA 3KOMA 4LTNA 5F76A 1PD0A 2G82A 3LF2A 1Q14A 3AU8A 4L7QA 4DA7A 3LS2A 1A4RA 2D5LA 1GYRA 4ZO7A 2XCRB 4L51A 1P44A 1RWBA 1RIFA 3R5TA 3I52A 4GZ3A 1XEWX 3MLAA 4ALJA 3NYIA 4NHEA 4CF3A 5J2UF 4JB2A 4O4HB 2H7XA 5CLGA 2CXHA 2I8AA 5EJIA 3UKDA 3EDOA 4CKYA 3KYDA 3LT4A 1EPUA 1EP2B 2AKYA 3E5RA 3QVGA 4XFKA 1VI2A 3FWYA 1KVSA 2FQQA 1R3UA 1L8XA 2VATA 5AKLA 1JHZA 2PL1A 4KVGA 3SR4A 1U0RA 4KN8A 1U98A 4MO2A 1QDLB 1DB3A 2DTEA 3CONA 1O96A 3I2KA 3H16A 2Q3JA 2X15A 3K2QA 4MWBA 3VR5H 4NJOA 2CN1A 4YRAA 5LYJA 3B1YA 4HAXA 1E3WB 4GZMA 3AF0A 1DHTA 5E4TA 3ROQA 5D84A 4CF6A 3VR4A 3CLHA 2DHCA 3OOEA 4C4OA 1ZM2A 3TM5A 1K8XB 3NP7A 3QKSB 1C8BA 4FYYA 4JOQA 2A0KA 1P31A 2HF7A 3CH7A 3ZWVA 3H5LA 4D8YA 4YP0A 3AFHA 1WBDA 2O20A 2IH5A 4ZZ1A 3OLWA 2JC3A 1DXOA 1N8SA 2QG6A 3A36A 2EOAA 4PZ9A 3N75A 4DRZA 3WLLA 4JMLA 4B34A 1UOQA 3N2NA 4ZDIA 2WWHA 4PXYA 4TZ0A 2PKCA 3H8SA 5EPEA 4BS9A 3E5NA 3BB1A 4YRDA 1IIBA 2W6MA 4MULA 3N8DA 4B5KA 4E30A 5J2TF 4ZYZA 2EFCB 3MOSA 5C8XA 1G8KA 2EF1A 2QUJA 1RRMA 1TW2A 1GITA 2YRXA 4YASA 5JCPA 5A3VA 4DV5B 3PHCA 1UK9A 2ZYUX 3KOXA 3PBKA 4FI3C 4DDMA 1JNXX 1FDOA 3H42B 4MCIA 3DDSA 3DLBA 2JHPA 5B1SA 4XX1A 3HVIA 3JWHA 4BE9A 1AD2A 4NABA 4AY5A 4CL2A 3W5BA 3MGKA 1FP1D 3DLHA 4YB8A 5KTTA 4LQLA 5CCEA 3H3XA 3Q3EA 1PJQA 1SBQA 4DE5A 1UJNA 1JTVA 1AKNA 1CJBA 2H1WA 3EBPA 3FN4A 3PJEA 3QA9A 4RANA 1SQ6A 2DLDA 4YUAA 2P35A 3S0JA 2JFXA 4BNLA 5C34B 3VZBA 1Q0ZA 3DAYA 1D6SA 1GUZA 4B3IA 2PJDA 4IR7A 4E88A 1G17A 1ZOPA 1E4VA 1PZGA 3O75A 1ZIDA 2ZAIA 4ZXPA 1L6IA 1O6ZA 3PQFA 1UIRA 3CV3A 3E9NA 5AM3A 1P5ZB 4IQGA 4ZYUA 2W2NA 3JZAA 4HNAB 1O6FA 4PPNA 3KL2A 4Y2SA 4MKFA 4TMKA 2GUGA 2I3ZA 5EN4A 1OFGA 1XZHA 3UQZA 1ZVVA 5K8JB 1X7XA 2QS9A 5JVDB 4G0WA 2ACVA 1SVNA 2JGDA 2WLTA 2HSEA 3O2JA 4LCBA 4D0LB 3K7EA 4A03A 4EG6A 5JD5A 1AO0A 5DXFA 3EMBA 1EKXA 1WEKA 3AEQB 1KZYC 2DT8A 1LSUA 3GJXC 3QI7A 4RDXA 5I9LA 2JLYA 4JUCA 2N1BA 3RSZA 5HNKA 1BDIA 3O1IC 4GI5A 5ALYA 1X15A 1L4BA 5DNAA 2YVAA 1R9JA 4WNAA 4C76A 1G20B 5BV7A 3AFOA 3K31A 2XUKA 3P9QA 4E51A 3WB1A 5K5EA 4YCJA 4EMTA 4Z1OA 1SQGA 1TTQB 4G5YA 2IYZA 3HDTA 3P97A 1NWCA 1EZ4A 1IRXA 3L6CA 2IOFA 5AKHA 4YMHA 4M1OA 3VGPA 4TWIA 1DQNA 2V3VA 3D1JA 3IPLA 3JQDA 5AICA 4GNRA 4OHPA 1KGDA 1T8UA 1YUMA 2BHSA 4AECA 4DG5A 2WSLA 2DBZA 3OHPA 1QVWA 3PQ6A 4KLRA 4Q4DA 1PVDA 1ZK0A 4KVFA 4URFA 3QE3A 4XQGA 3C3YA 5EP2A 3DXYA 4JR1A 1NU6A 1SKYE 3DM9B 3T06B 2XBMA 1PWHA 2AH5A 5K0SA 1TUGA 2J6IA 4FDUA 3UJ3X 1VP3A 4BQNA 5LQMA 4IDOA 1JIIA 3FOAA 4TQAA 2DQKA 3ZDCA 1ZUIA 5JAMA 3DNFA 4MRSA 1B0ZA 3KJEA 1Q15A 3L04A 3U4GA 1QIKA 2HN9A 2XI4A 3BJRA 1VCIA 2JS7A 4X8HA 2VQ3A 4AX8A 4Q7MB 3TG2A 3VBCA 5TLSA 4DEVA 1YDGA 1NUUA 3T3PB 2BGRA 5JSUA 1ENOA 1JBEA 3AETA 3CE6A 3SQOA 3TTUA 3REOA 3MHTA 4CKEA 4QDOA 4IH1A 5AKIA 3TLKA 2WV7A 3L4BC 1YQUA 4FXOA 2WF6A 2YMPA 5A4DA 2BT4A 3T7KA 3BEDA 2Q3BA 5DRTA 3ORYA 2CFOA 3TEFA 2LDXA 1WPGA 2PX0A 3G0CA 2GRJA 5JSHA 4X00A 4OD0A 4JVLA 5EMKA 3AM4A 3ORRA 1N6KA 4FFOA 5AW6A 2ORWA 5I48A 4MA5A 2YJGA 1NV9A 2QDXA 3C6YA 4Z9YA 1ECJA 3QX7A 3ROTA 3TB4A 4TZ6A 4I1IA 3IEPA 1OFIA 3HXQA 4XCVA 5K8CA 3QPUA 5G0WA 5LJIA 3IMCA 2EFEB 3PPYA 4KGXA 1F8YA 3ZI0A 2OBXA 1KQNA 4DFDA 4FFPA 1CYEA 1W36D 4TV8A 2IS2A 3ORFA 1TKBA 4ZKDA 1XMPA 3SZGA 4DA0A 2IHNA 4U9HS 4UNPA 2Q3FA 1O96B 4GM4A 4KTVE 2R4QA 1HEUA 3U7QA 1NG9A 1CUVA 5B1HA 1E2KA 5H68A 2O5CA 4F46A 1NONA 2XQFA 3AV0B 3RU7A 3BIWA 3MCWA 1KFCB 2KB0A 1JSLA 1CR4A 4O4JA 3GAAA 4HB0A 4JXXA 1EVZA 3PR3A 5AW5A 4U7HA 5E9WA 3T5BA 1DHRA 3WIVA 1ILEA 3Q15C 4ZZ2A 2EVWX 5D5QA 4CIVA 5DSXA 1E94E 1SBTA 5I7SA 1QHIA 1HT2E 1T13A 3G59A 4D9EA 2WP0A 3K16A 3RBVA 3OT1B 3AR9A 5DT9A 3EGIA 3SZUA 4RPLA 1W0KD 3DOJA 3AP1A 1QGUB 1VRVA 3SFZA 2DR0A 4PVCA 4WSOA 1CQIA 1GNLA 1KPGA 1QS0B 3GJ8A 3OQ1A 1BFKA 4OV6B 4B85A 2BM0A 4Y2PA 4BFCA 2IXFA 3EG9B 1WR8A 4Q9AA 1XMXA 4IMIB 1YDHA 4MGZR 4GBGA 4Y2VA 3CRNA 2AZTA 4GR4A 3TLGA 1XJQA 4S1NA 1ZGCA 4PTZA 3SN6A 1MEOA 3BRCA 3LVFO 4B2IA 5HWSA 1FFAA 4JY7A 4GD3Q 1Y5RA 4D98A 1CUEA 3KWMA 4LJ4A 1ONSA 2AOWA 2BFPA 4JP5A 3LZCA 2VPQA 4ZZIA 5LXTA 1JYEA 1ZNYA 4XVHA 2JFZA 4OO3A 3TBHA 2QSYA 3GPLA 1XVUA 3MCUA 3N2KB 3PT5A 5GZ6A 3S55A 5EZ6B 3ZLJA 1BA2A 3CLSD 3HNRA 3UJ7A 3DDZX 4XM0A 1W2WB 3HZRA 3KB8A 1R5JA 3HACA 3PFIA 2JRLA 2VBIA 1W76A 3A6KA 4IV0A 1CY2A 4MW2A 1YB1A 1R9NA 4PC6A 1NN3A 3KWFA 3MAJA 4DLBA 2BL4A 3NBQA 3JZDA 1SB8A 1TQ4A 2O7QA 2F8LA 4FFSA 5DGHA 3WGUA 4CCYA 4V1CA 1T5HX 2QG4A 3Q2OA 5GZ3A 4K6CA 1AJEA 1KRWA 1M1ZA 4HLUC 2PGLA 5J5VA 1PT5A 1T10A 3T1YB 1VE7A 3DB1A 3BILA 4IQ8A 3FWHA 1TVEA 2E55A 3OZ7A 5J2UA 1SELA 1W4CA 1F0YA 1YBHA 4HGQA 3WJ7A 1X8XA 2NVWA 2UVPA 3D43A 5H02A 4Y9TA 1X7XB 4A5SA 3S1AA 3UMMA 3STTA 1EGAA 1Y9ZA 4LS3A 2OXEA 1E0SA 1IN5A 2YXEA 3AUKA 4N7MA 3NUQA 4E6PA 3G79A 3NBMA 1LUAA 4D8UA 16PKA 5A6VA 3F46A 5B1YA 1QFZA 2A5LA 4ZYYA 1SZPA 3E8MA 1UM9A 3PEVA 2VJCA 2C31A 4ACAA 5BPFA 2Y27A 5BT8A 4QPPA 4RZQA 2XMSA 5FTKA 5AW7A 2NP7A 1HYEA 2QQGA 1B0AA 1RQ2A 3CT4A 1AMNA 1K27A 1ZPDA 3O3CA 1RWWA 4FFRA 4KRXA 1CEYA 3G2JA 5LZ2A 1YBMA 1EYZA 1AY0A 1MEEA 2VKQA 4XFJA 3EXEA 2H5EA 3G1TA 2JIDA 3N6RA 4H0CA 4OJQA 5IXJA 5HFAA 2PYZA 3LYHA 4UTZA 5HKAA 1B16A 1OZ0A 2EAUA 1IZYA 5HKKA 3IVGA 1CUXA 1Y4SA 1TK2A 1UKZA 2VP0A 2X8BA 5FA8A 3SJAA 1AMUA 2MMCA 4KFRA 1DAKA 4BCBA 1SHZA 3NBZC 4XIJA 1PFQA 1XU9A 4JOSA 4DCPA 1PWXA 4F4UA 5A1TA 1AQNA 3ICPA 4S1OA 2YZGA 1P2DA 3AW8A 4AKGA 1LLFA 2AEMA 2Q3EA 3KJZA 1Q0LA 4UUQA 3GZTB 1JEEA 2QGZA 5ALEA 1SOWA 2WFMA 2AXPA 1D9XA 2PSDA 1J97A 2H59A 3AETB 4JBWA 2W90A 2FR8C 3REQA 2OVBA 4P7BA 1PT6A 2EHJA 2XZTA 3LWBA 4Q19A 4YJKA 4NCKA 2NSYA 3JAKB 3PI6A 5MGBA 2IIVA 2J0QA 1M0WA 3B60A 3V5NA 4C88A 1S5PA 1G5TA 2NPOA 4ENVA 1O9BA 1W9HA 3ZXIA 1WZUA 2WM2A 4QPCA 1L8QA 4P53A 4O25A 4EJ6A 2AMVA 1KI3A 1CUGA 5A4JA 2JBHA 3KXDA 3PTAA 1HE2A 2JL1A 3SIWA 3ORQA 2QN8A 3L46A 1OF1A 4IJVA 1U3GA 1DV2A 1D5CA 3L8DA 2I3BA 4MIEA 4TV8B 3B1XA 1YS1X 1DIHA 4RW0A 4W1SA 2X86A 1G8SA 4GSYA 3RIHA 4YCMA 1NUPA 3WGIA 2H3HA 2OFOA 2A1IA 2XWQA 3SLKA 3ILYA 5JZSA 5CTAA 4V0NA 2O2GA 1V8BA 2WU4A 4WMLA 3GMIA 3MTJA 5IC5A 2GD6A 3W06A 4EB6A 3U44A 4WCFC 1YULA 3PJFA 2BFFA 3V80A 3B5IA 3FOEC 2HQSA 4FDVA 2W2LD 2V3CC 1JHXA 5A4MS 3FJYA 5CB0A 3LPLA 5CEEA 2P65A 3RAEC 1Q11A 3SEAA 3KQVA 1VYTA 1KWGA 4EB8A 3FJOA 1SOAA 4DIOA 3ZOZA 3WYFA 1RPAA 2DFKB 4RVDA 4WZBB 3DAGA 5AW4A 1GM5A 1NNUA 4PG4A 2KHZA 1URPA 4O4IF 4YNBA 2HPAA 1JXOA 4AZ3B 3TW8B 3T3EA 1FNCA 1QOQB 2VA8A 2QQEA 5H8WA 4GPZA 4FSXA 3MC1A 2D54A 2QXUA 2GERA 4PG7A 5CGZA 3G2PA 3SHOA 2HZ7A 3FYDA 1FK8A 3FCAA 3EODA 4HBGA 2O1SA 2AG5A 1E89A 4UPVA 1SKUA 1FF9A 1P2FA 3K0HA 3MWYW 2O4CA 4YR7A 2A9PA 1H3NA 1R6DA 3QW2A 3UK6A 2JIPA 1MJFA 3GZNA 1SXIA 3FVTA 3QKRB 5ENDA 3MJHA 4QYMA 5SV2A 3VO9A 1NLZA 1O3YA 5ENVA 1FNNA 5DSZA 4MQUA 4UZEA 721PA 4BFYA 2PX8A 3RB8A 2HPHA 5HK9A 5LXTB 2WDZA 1IXYA 2Q8QA 4JLVA 4MUXA 4EJSA 1PSZA 1U2GA 4DREA 3DOEA 5A5EA 2XXAA 1Q1GA 1QGYA 1Y7PA 4YLEA 3CE9A 1LLCA 1L4GA 3VAAA 3VDXA 1R0RE 1HV8A 3ROFA 4JV5B 4X61A 3DTTA 4DY4A 3CIOA 3KJQA 3E6AA 4ARBA 3ME5A 4FGLA 1A7KA 2QRJA 3OIUA 3UN1A 1KAOA 4RK7A 4NFSA 5DSTA 1Z0IA 2KBEA 1T3GA 2WFZA 5J2UB 2H0QA 3V4PB 4BASA 5D7NA 1JS1X 1P0IA 2R7KA 4AJ9A 1DWPA 4TKLA 2GN2A 2RHTA 3L7NA 1PNTA 1HYGA 5EJEA 4GOLD 4MGYR 3S1AB 3VVBA 5IJ0B 3HB1A 3UJ6A 2IYFA 3M6VA 3OZXA 3B7GA 1VIDA 2RGGA 3JAWA 3QLJA 4P4UA 4Q4JB 4YA6A 1LVGA 5FQOA 1JW9B 4GEKA 1CP3A 4MCAA 5AK0A 4Q05A 2P69A 4HGYA 4M4SA 3SVZA 3IBCA 1PU2A 3BBPA 5ESRA 1PEAA 3U26A 5LP1A 4DCGA 1PNRA 5EKUA 1L5YA 2AFIE 5CLJA 3KVNA 4WNYA 1DTWB 3A3NA 5CVJA 4RQTA 2HA5A 1N4AA 5SYAA 4DQKA 3DBRA 9ABPA 2XA9A 1WJGA 3NMUF 4CUKA 4YUYA 4TSRA 3UG6A 2W4MA 4BX8A 5KMGA 3G0HA 1P8JA 2MYNA 3S2UA 5KNBH 3B20A 4AXXA 1U9YA 2NUAA 2PEYA 1DUIA 5IU6A 2DWCA 2PZEA 3L0OA 4XJVA 4D5GA 3T1HB 3DXFA 3V8RA 5HJ5A 3EY9A 2GKOA 1WCWA 2CNLA 1CUSA 3L41A 2A67A 3ZX4A 1E2QA 3E7PA 3LG2A 3PXUA 5KB3A 1UT8A 4KFTA 1KVUA 2ZIFA 5H5JA 1PJRA 3LQQA 4QL3A 1ENPA 1KSFX 3UW1A 2X5NA 5J2TB 3VZSA 1GAQA 3DZCA 4AKTA 3JYNA 1ZL0A 1FSFA 1P4GA 4AD8A 3V4LA 2XZOA 5JHHB 1YR7A 5K3BA 1UBOS 3PPXA 2EIXA 3IUSA 2CL5A 1CQXA 3VA7A 1UR5A 1C0LA 1CWUA 1FDIA 1Q6ZA 3QEMA 3NM5A 3GNSA 3TFQA 4AN4A 5IVIA 1ABFA 2P2CA 2HWXA 5AM5A 4XOUA 4JLKA 4EO9A 3O92A 2E85A 3T7RA 1XTIA 1WB9A 3MTQA 2FH5B 4EHFA 3D6MA 2AG6A 5BR4A 4JFRA 4MVJD 1HURA 3F6CA 3VNRA 5FULA 2JLAA 2JVKA 1Q7RA 1KJ8A 1RJ9B 2JFFA 3N74A 2E4VA 3PNQA 5EG5A 3FSJX 1XG5A 1XLWA 2O4UX 4WBXC 5ED0A 1Y1QA 3RT1A 4IIVA 3A4NA 3VAYA 3ZWDA 3HK2A 1KL7A 2FOIA 4Q34A 2QORA 3C7AA 1MG0A 4EG1A 1BE0A 2VF5X 1VB5A 5LN1A 4BUCA 4GQIA 3ABZA 5FLKA 5E3JA 4TMZA 1L4LA 1U2SA 4CEHB 4BGIA 2UV8A 2CLEB 3FPKA 1A9SA 2ZTVA 3RUDA 4N4AA 4I66A 1UC8A 4UHHA 2CHUA 2NU7B 5G4LA 4BFVA 3IQFA 2EDAA 4CPDA 3TQFA 4C0HA 3C6KA 2L42A 4LGYA 4BE4A 1K8YB 2NIPA 3DMDA 4RHYA 4TMXA 3VO1A 3FRIA 4UXIA 3R3WA 4Q03A 1MRSA 2RIRA 4EB6B 3GMSA 5LP6F 1EWYA 3BYZA 5JBQA 1G8GA 1CIJA 5CH5A 3S2SA 4Z8XA 1SOMA 3FFAA 3CUVA 3USES 4DC1A 1ZHHA 2ZI5A 1PR1A 4W8GA 1F5SA 4N3BA 5C8DA 2X0NA 3T12A 3O93A 3DLTA 3LDHA 4COKA 4DMRA 1ZK4A 3U4CA 3CCCA 1Z45A 1XNJA 1Z6QA 2DPYA 2W6CX 3RW9A 3VSAA 1B73A 1PEDA 3BK1A 4JNKA 1XZFA 4JI5B 2SCUA 1GV0A 4F9TA 1QYVA 1YI0A 1KI8A 1LJ8A 4IDQA 4NX2A 4A6XA 4II7A 3HYSA 4G0YA 4ZARA 3IP1A 2LCIA 2OZLA 1K2WA 2BZ1A 2HIGA 2QP4A 2YNMD 3E58A 3JTMA 4FGZA 4BNXA 1KEWA 2PWZA 3K9GA 3DOIA 5LBUA 1E5QA 1JMVA 1GADO 1ZFNA 3STHA 5I3CA 5KYYA 4DWVA 1FBNA 2X8JA 4BU1A 5KVAA 4U39A 4Q48A 2D00A 2JI9A 1DC5A 2QYOA 3DOUA 4OGFA 4D57A 4RU1A 5DGIA 2ZSKA 3AL2A 3JWJA 3GZNB 2ZTLA 3WGTA 4JSYA 4OX9B 1Y5MA 4TYYA 4BNUA 3MTAA 2SNIE 3UMCA 4GQAA 3T1VA 3F47A 4HMQA 5HCIA 3AJEA 4O4LF 4EDFA 1P73A 4OLBA 1CQPA 4I5IA 3FLMA 2XAUA 5FI1B 2KX7A 2RCNA 1DXHA 4PTLA 1DKMA 1T1IA 2P5SA 4HNQA 3INYA 4MWZA 3UK0A 2JIRA 2B1IA 1JZQA 1L4KA 4D79A 2G4LA 3IHWA 4B6FA 4DNXA 4F4HA 3QNWA 3IMGA 4ZOAA 4M9CA 1QGZA 1YDWA 3K0AA 4KJZA 4S2UA 1DX6A 5IJ9A 2YASA 3IAXA 3CH4B 3F9RA 5G4KA 5IBQA 4PLZA 3T1NA 4QJ3A 3NWOA 4CT5A 3VNVA 1ZU4A 3EQ8A 3Q5GA 1P2TA 5ESDA 1GZDA 3SC2B 3VMMA 4D4KA 3CLKA 3EBOA 3PV0A 3BA6A 1AG9A 3DL2A 1L7EA 3D2LA 3HB4X 4OHKA 4Q9HA 1W46A 3BFJA 4LYDA 2P2LA 3A1CA 1DCMA 1CFJA 3KEMA 1QLWA 1CY8A 3W5SA 3OM9A 1R0KA 4CCAA 2GWHA 1L8LA 1CY4A 1P80A 1U94A 1HA3A 4EG4A 4ZHQF 3NVKI 1NT4A 3QXSA 1A9XB 3X43A 4GP7A 1G64A 1YQDA 4WCDA 3P5BA 2YHBA 4MWEA 1JDBC 1DBWA 1ZVKA 4PLVA 2RGBA 5AVJA 4R0NA 1NF2A 2IE0A 3BAZA 5F7XA 1VL8A 1VE9A 3HKBA 1U2DA 5MGNA 1EHCA 2YJNA 1W49A 2Q4RA 3HVHA 5E0OA 1KDOA 2YL2A 3AH8A 4IZHA 4UULA 4CU2A 4Q00A 1OYYA 3X1MA 4DPLA 3ZDEA 2MR5A 3TTSA 1G5HA 3GLFE 2VYND 4V03A 2NUAB 1XTKA 3THSA 2X4IA 4XR4A 1HF3A 1Z39A 4Y2YA 3MG9A 1Q7BA 4B45A 4F56A 2JJ1A 2Q5CA 3K1JA 1ZONA 4L6IA 2CSUA 2JCGA 2VCHA 2XYRA 1WDTA 2AJCA 3DEFA 4O4IA 5FBLB 3WK7A 2JCBA 3DBHA 1HK7A 1N2EA 1V7CA 3EARA 5C1IA 4CM9A 3ED1A 5JZBA 3R0IA 2P9TA 3QBTA 3CT6A 5L40A 1XNHA 2IYAA 4ER3A 4F60A 1OI2A 4AKEA 3NHWA 1RU3A 3I05A 2LR0A 4LA4A 5FQNA 1T2UA 2HSZA 2LP4Y 2E9SA 4R5MA 1CP2A 3HADA 4NCHA 2WTNA 4J29A 3RU2A 5T4EA 2W42A 1JHDA 3E61A 4DMHA 5B37A 3QEMB 3OOYA 4EM6A 2FUG6 3LOUA 4MQMA 4BYGA 4N3AA 4J0IA 1DG1G 4URVR 2I87A 4MVJF 4XVUA 3JARA 4UXJA 3CR8A 3KR0A 1HQCA 1SU7A 3BGSA 3ZZUA 1CX9B 1LV7A 5LCXA 4YAKA 3H19A 3V7FA 2XVXA 2YFHA 2XWBF 4II3A 3NZEA 4XKJA 4ZAVA 1UFOA 2FPPA 4XEHA 4OQZA 4PICA 5EFZA 3HXPA 4H15A 2D8AA 3STWA 1IY2A 4UBMA 4ROSA 1PUXA 2IDZA 1NWHA 2GTPA 3CGWA 4J4TA 5JJ5A 1TVKB 1NVUQ 1I24A 1R3DA 1SXQA 4L4SA 1E32A 1TCBA 4PGAA 1SEPA 2CLLB 3HI6A 4EYQA 5CNIA 1G2PA 3VU9B 4EY6A 1UK7A 1H2WA 1WV1A 2ONKA 4NJEB 4M99A 1PK8A 1T29A 1T24A 3HDYA 4BPRA 3B38A 4RHCA 1T6NA 3CY6A 1SULA 4XRGA 4KFCA 2FX2A 1L5SA 5KTRA 4Y9UA 2WMNB 4E0BA 3SJZA 5K03A 1G60A 1CIPA 1R16A 2DUJA 3AR2A 4TYPA 4FBGA 5KYUA 4Z51A 1KI4A 4YJ2A 2QIPA 4X7RA 4N49A 2ZSIA 1O5TA 3KNZA 4PZPA 3BKXA 3K5IA 4I1PA 1QQTA 3ZGLA 1CUJA 3K9QO 1F8XA 4JLPA 4RZUA 4MVXA 3RU9A 3OLVA 1UINA 4WZ6A 3TOSA 3HXOA 3GXBA 1J4AA 5ENZA 2EBUA 4YO7A 3SE7A 3O7MA 3OUZA 5FKJA 4G1UC 2ADFA 1Y8QA 3AJ8A 1Z0DA 3WNBA 4W5RA 3KDSE 1TJYA 4RVNA 4R9RA 5EYPA 1LBSA 4NPAA 3PXXA 3S4YA 1W7AA 1U0BB 1E60A 3OU2A 5FTLA 3M0EA 1A04A 4OHWA 1PBNA 5DEIA 5JASA 1A9YA 1FMCA 2XVZA 4QEZA 3CZ4A 4G5XA 4QRIA 1QH8B 3KE9A 2BFAA 3H97A 3WSTA 1XN1A 1KYIA 1V3TA 1T3LA 2H7VA 3GLQA 4FUTA 3D6TB 4AZVA 5A4IS 1GTJ1 1E7SA 2QL5A 3BWDD 1HFKA 2QXTA 1JQEA 1CHDA 4HYYA 4ZPXA 2ZYVX 4UBNA 1OI3A 3UWPA 4C7BA 5BN5A 1OXVA 3RTGA 1FFHA 1XTZA 3IESA 4B1FA 2O8DA 2A35A 4R3NA 3ZEAA 2Y99A 3WZ2A 5AOVA 4FPXA 5HE9A 1E9SA 5DNUA 2PSEA 4L8YA 1CF2O 3MWKA 1IRIA 1QF6A 2I1QA 4JVOA 4QFBA 3KDPA 5HF8A 3IL2A 4X85A 1NZFA 3QW4B 4NNPA 2V6GA 4ETMA 1WXQA 2ETVA 2IJGX 2Q3DA 1CETA 2ZI6A 3C87A 3ZUPA 2G83A 2YW2A 3KT0A 3O8NA 2W2KA 3TGPA 2GF9A 1D4FA 1DLIA 2O14A 4XQCA 1IXRC 3KYBA 1RMYA 3B89A 4RIFA 5BO5A 1G66A 2YUTA 2CBXA 2KM1A 1I2BA 3B3JA 1HNXB 4C7OB 1KO1A 3JD0A 2H1IA 2JLSA 5IJ9B 2HKIA 3WGJA 2Y0EA 3TTXA 1EXMA 3GVXA 1I7SB 2J1LA 1Z5WA 1RYDA 2CHEA 1SRRA 1DMRA 2VAXA 3B9QA 3MSXA 2GO7A 2RI0A 3I28A 1Z4NA 5FNVB 1ZLYA 3IEXA 3R3VA 1GPH1 3H2GA 4IGIA 4Q39A 5EOVA 5I45A 1QTQA 2H07A 3CUUA 3ZCTA 3A3PA 4L3VA 3TFWA 5B36A 4Q37A 4V0ME 5BVGA 3I4FA 3JYQA 3SLRA 4Z0TA 1XHLA 2ZCJA 1NVDA 3RS0A 4C6RA 2N1MA 1MX1A 2J9FB 3WXMA 3D8RA 1QTIA 5GY7A 4D9HA 1XRRA 3HN6A 3A4LA 5A1JA 3JRNA 1MDBA 3K9NA 1YXMA 3PWTA 1E9CA 2A78A 3OTWA 3VU3A 1OZHA 2PV7A 3T9FA 3TLZA 5ELXA 1AN9A 1TA0A 2FHPA 1G42A 5CIWA 4D97A 1T8SA 3KDAA 5LP6A 4MV5A 3NAZA 2GA9A 3PQ5A 4P92A 1J2JA 4G25A 4FW9A 5KQRA 3NVDA 5JD4A 1MOZA 2DY0A 4Q01A 3H9EO 5IEBA 4J1TA 3FETA 3H0EA 1TQ6A 4N9QA 2BY4A 3C8HA 2EJVA 5JSZB 4ER7A 4LZPA 1MIOB 1V16A 2I71A 3N6VA 1XZNA 5JC8A 3R3JA 2OENG 3K0CA 4O4IB 5GM2A 2WP8J 3G7NA 3C85A 2QRHA 3CZPA 3DHVA 1X7DA 2QUHA 1TD9A 1I1OA 2CNBA 2FPKA 3AEZA 3DBHB 4M53A 4PTYA 4WXEA 2O19A 4IX1A 1QCDA 1OILA 2GXAA 3DPUA 1X13A 4EYOA 4E3WA 1P7PA 1JFVA 4XI9A 5F7ZA 1BRTA 4IV5A 1L5VA 1C7EA 2BJWA 3QU7A 5C3UA 2BFWA 2AN5A 1IZ0A 2AYZA 3PD7A 3UGTA 3ZHZA 4K3VA 3U0BA 1SG6A 2GZRA 3HY4A 4LVCA 5UKDA 5FR1A 1L7QA 2CLHB 1ZBDA 3Q8WA 2VZEA 3QRWA 2GSWA 1DG9A 2PH5A 3JWEA 3L5KA 3HDGA 5DBHX 2FN7A 4GVXA 4NBSA 2OUKA 4AX4A 3AI7A 3HEBA 5KCMA 5HIKA 3K0KA 1RQLA 4L22A 2O2SA 5FUVA 2NUBA 4ASUD 4F86A 1R5OA 2R79A 3P2OA 3OZAA 1WHTB 4F12A 3WKDA 4R8RA 4K8OA 4R0VA 3F6YA 2HRCA 3OEEA 3PL1A 4J4HA 5CFLA 4H7FA 5BSGA 2FPPB 2V9PA 2CHVA 2Q6TA 5CK5A 1Z6TA 8AT1A 5K3EA 2AD5A 4ZT4A 1WQ3A 3X2SA 4I9NA 4AYTA 2GJKA 4ERXA 3EIUA 2CYCA 4LGCA 3W7BA 3HVJA 3TZEA 3LSYA 4Q9IA 2BDEA 5IPFA 1SK9A 1KMMA 4MQEA 3NTQA 2A4KA 4BNHA 4FCCA 4BB5A 2QYHA 3THRA 3A9UA 2MCFA 2WWVD 5L3QA 3HJRA 5JTUA 2OC9A 4D80A 1L7VC 2X4DA 3ESCA 3QKUA 1F8FA 3DWGA 1RWQA 3RM3A 2DFTA 5FNZA 1Y3IA 3T7EA 3R41A 3LOQA 4ZDKA 4MVYA 2DWPA 4MWSA 5CDTA 1T3TA 1PJ4A 2D7DA 2MSNA 1Q3KA 2SKDA 1YE5A 3FNRA 3ITEA 4IJKA 3MOIA 5IKOA 1A2BA 1LRLA 1QFMA 1NFFA 1Z37A 2HSGA 3RSSA 1SUFA 5GWXA 3NDRA 3ETLA 1E2GA 3AB7A 1D09A 3AK4A 3KQYA 4ESHA 4DYHA 1P29A 3FCYA 1Y89A 2H1VA 4O5AA 4DAEA 2I7CA 4CM7A 1QFSA 2BN4A 1LNSA 2J7PA 4LXQA 5T67A 2QE6A 1CULC 1DG3A 1I01A 3RJMA 4UTVA 1RAGA 3R7WA 5EYPB 5FLYA 3LP8A 1M1YB 1SUDA 3KP1A 1Z63A 1JDPA 3H2BA 1WB4A 2O2IA 4Q82A 2RHGB 4H1WA 4Q21A 3W1WA 4MDEA 1RTTA 2PS0A 4K7JA 1MJGA 2SKEA 1L1EA 3IQEA 1JTFA 2HREA 1YRLA 3STVA 3DGFC 3ZCSA 4UAVA 1E3JA 4QXAA 3GFOA 5IG2A 5BN5B 1QO0D 4X71A 1EUCA 3H99A 2O8DB 4UEKA 3KQSA 5JJCA 5AM1A 5L3RA 4DLKA 2RH9B 4FMPA 3CLTC 1QOZA 1G8FA 2PWPA 4BGDA 2PFSA 4LYHA 3ZE9A 3TNLA 5EZ5A 1GYQA 1M66A 1W96A 2EZUA 4MRAA 4D9BA 5TJ9A 1SXJD 4GXRA 1Y37A 2GMWA 4BP8A 4B6SA 1K8QA 1EFTA 2UYYA 3BZUA 1ZK2A 2X2OA 3PQCA 4Y1RA 4X7BA 1JDSA 1A76A 2I7TA 4FYIA 4H08A 3SBXA 4FS8A 1S1CA 1SC6A 2PYDA 4V2IA 3QLVA 4HQKA 4U2KA 3TINA 2ES4A 2XJ9A 1RQGA 2QNRA 2UZ0A 3D9QX 1JU3A 1H1LB 1TMOA 3ZGVA 3FPSA 4OA5A 1NP7A 3K4PA 5LLDA 1NP3A 3OJXA 4QDJA 2P27A 3CG0A 5LSAA 2UUCB 5AO9A 2P1ZA 3F3YA 3K9HA 2GM4A 1S02A 2WIDA 1ADGA 3BB4A 1FMLA 2HT1A 3O2SB 2VRNA 4M0PA 2J9GA 4B3XA 5B6JA 3AINA 4GUDA 4BKMA 2ZJAA 5JISA 1ISGA 2ZT7A 2XGGA 4Q7JB 2DXIA 2B37A 1ZK1A 1IN4A 1KYQA 3LVQE 2QLFA 4K6KA 1LFDB 5D51S 1LX7A 4TKVA 5JRJA 3IURA 2K5UA 2EIHA 3LC7O 3U3RA 3PFKA 4F97A 3MCVA 4TT8A 2Q0SA 2XV1A 1VJDA 2XVYA 3FYUA 3G0DA 2XT9A 3VC7A 3DDOA 1SZJG 1ZD3A 1XPUA 4Z1MD 3WWPA 5JYBA 2XTAA 1O6CA 1W0CA 4KC0A 1B00A 2OP0A 4G9GA 2PIAA 4PZCA 4UD6A 4RTRA 3O1LA 4WD3A 2AC7A 3ANNA 3HCAA 2FXVA 3KZXA 3M5CA 3PHIA 1C9KA 4N0DA 4MWDA 4XYGA 3MWEB 2JAWA 1YQ9A 3O74A 3WK9A 1C3XA 4JSRA 4BV3A 1N32B 3R75A 4PLHA 4YCLA 4A0FA 4N39A 4Q3AA 2Y4OA 1J8DA 3QHPA 2QGNA 2VK2A 4FONA 1AQJA 3K32A 3BRWA 2YMLA 1RHMA 3QVSA 3BIXA 4X1YA 4BNMA 5ALZA 4DG8A 4LFAB 4MJXA 3C45A 3E27A 1GPAA 1FS5A 1T9BA 2HFKA 3WGHA 3HSKA 1H6BA 1WUTA 1WETA 4YP5A 4QVKA 2J32A 4HFJA 1PN3A 5G3YA 1ZIXA 4OU5A 5FL7A 5IWAB 5JS2A 5ABPA 3AJ9A 3G7SA 2D1RA 1VL2A 1XMSA 3TZCA 1Z4JA 1E18A 4R8LA 4ZO9A 2ZRPA 5AIBA 3E2PA 4B3FX 3AQIA 3G9QA 4B43A 1RRVA 1N4DA 4MEBA 2OCDA 2PPLA 4O4LB 5D6OA 3ZHVA 4CV2A 1QHSA 2A3NA 1EB8A 2PRIA 4CM6A 3TMYA 2Z56A 3SF0A 2F67A 1TZCA 1H94A 3R7FA 3E9DA 3WNVA 4CUZA 4YRIA 2WHXA 3HYLA 4P4LA 1OH6A 2VDUE 4KDFA 3ZX5A 2GTIA 3K4QA 2G09A 3N2GB 3SEFA 4EHNA 2Z5GA 3DZGA 4GBED 4EGSA 1DIOB 3ECSA 3W4IA 1TJNA 2RGXA 3AUJB 4K05A 1GRQA 4MS3A 3OAAA 2B4TO 2EATA 4NEHB 4PX5A 4N41A 2H0RA 3ET5A 4GLJA 1VG8A 2JFVA 3LC2O 3BFKA 1S7CA 5JV5A 5LKAA 4PBTA 4HN4B 2J67A 3NOVA 1DX9A 4PAMA 1C3JA 1GHTA 3A9RA 1SIUA 4V0KA 1FXUA 2Z83A 5BT9A 1IHXA 1P3DA 1AN0A 1GGVA 4L2IA 3NASA 1T9HA 4HNRA 4LX0A 2IY7A 2IY8A 4UTPA 1IVYA 2YV1A 1N5DA 2N42A 3F7OA 3NDBB 2F64A 4WOKA 3ND6A 2OYCA 1BWSA 3S40A 3TEMA 3R5HA 4W5NA 4ZHQB 3ESYA 3IMFA 2B4RO 2WTEA 1DBQA 1ID1A 3BXGA 1ZLXA 3CF4A 4JEHA 5ARBA 1Z73A 1GARA 1RKBA 2FMHA 3R5XA 2GXSA 5HGJA 3Q3HA 4DMLA 2XGOA 3LA6A 4NCBA 1XZLA 1GFZA 3LO8A 2ZQZA 3V3TA 4EVSA 2EEPA 2W6ID 4NENB 3UT5A 3EULA 1PQWA 1YT5A 1M2OB 2WHEA 1Y33E 3KQTA 5ECDA 2PSFA 2MMGA 5F1KA 3R7WB 5BMVF 5JARA 1C9NA 1ANKA 1XC7A 3A8TA 5COBA 4UUOA 4CKCA 4QYTA 2BP7B 2PZFA 3EGXA 1E3QA 1AQUA 2CDNA 3FSGA 5AXBA 4KAJA 3P7MA 4XM2A 3U56A 5AHOA 1SM4A 1PAUA 4N6NA 1TYEB 2CMHA 3OESA 3S5UA 4JKOA 4N7BA 1B4DA 2HF2A 2JFHA 2Q3HA 1YTLA 1U4NA 2H00A 2FMUA 3GA5A 4XD2A 4XUCA 4ZYVA 4OF4A 3RS8A 1U7ZA 4HAWA 4V2UA 2WFLA 4UHCA 5KPJA 4CHGA 4H1TA 2J08A 1QB7A 1V48A 2VDLB 3FHOA 3KPJA 1MORA 4HQRA 4ZDWA 3CTMA 3UY4A 3CCFA 2X6TA 3R5KA 4PZZA 5JCOA 4DCCA 4X94A 4MR9B 1H4VB 4ZPJA 1LSJA 1JG6A 3PT9A 3VYUB 4JOBA 3VGJA 4DQLA 3R8FA 3BH6A 3AI2A 3I01A 4R1OA 4GZ5A 1JPVA 1ZCAA 1JUDA 2QX6A 4JJ8A 2AFIA 4JOCA 5COQA 2GZMA 1M8PA 2R6CA 1XSEA 3W04A 2REBA 4AJLA 2P3OA 2PU7A 4AUKA 3B9PA 2NAFA 4C7VA 1HT3A 1EXNA 2YYAA 2E3JA 3AC0A 4WDRA 4FINA 5J4VA 5K20A 2GEJA 4EUEA 2PNJA 1K86A 3FB1A 3SZOA 3ZYCA 5IJZA 1YU9A 4NZPA 3HUUA 1V1JA 4LRTB 2P79A 3W8EA 1JA9A 4O2AF 3WNZA 1DIGA 1E7WA 1R0XA 3FWZA 5C51B 5AIAA 4P38A 4YHBA 2LNDA 1Y1RA 1P2SA 1W5TA 4HMOA 3TQSA 3UMGA 3KQUA 2ZWMA 3HCDA 3ZXXA 3CW9A 3ZHSA 3HY3A 1POXA 1P2GA 3ZCQA 2A0UA 3F73A 5DFAA 2KWIA 2AE2A 2QAJA 2QPLA 3ENWA 3I2HA 1P2VA 1E2FA 3IQZA 4NBKA 4QQNA 4WERA 1IWBB 4ZVLA 5T6BA 4FI3F 4QUHA 1OC2A 1NW3A 1EFKA 1SZDA 3FYUB 4YMSA 2DX7A 1IEQA 3ROEA 4BMVA 4FZVA 2A9VA 4LJ9A 3FKSA 2JAXA 1CVLA 1I2AA 1J0AA 1QVZA 1ZIYA 1UIMA 2WR8A 3Q7PA 5F3RA 1IXKA 3RHSA 1Y6GA 1RRFA 1SNYA 1YCGA 2JIQA 4PXSA 3GRZA 2YVKA 3Q8XB 2AFHE 4MGEA 4P08A 2FWAA 2P68A 4D4HA 1T9DA 2DT5A 1X1RA 3VU8A 1Y48E 1QRUA 4I1VA 5A06A 5IS2A 3O4IA 4E1AA 4EBBA 4K9LA 4KQHA 1U8ZA 4WJKB 2V7XA 5FEUA 2OZVA 5KYGA 5K3DA 5EESA 5KKAA 1FFBA 4PFJA 3CH5A 3JALB 3LK6A 1YR3A 4J0HA 4KLAA 4QUEA 2PUDA 2FPIA 2YV3A 3AKYA 3FWPA 1HGXA 4JN6B 3ETGA 1BVHA 2WT9A 4P7GA 4DTIA 3ZE2B 5EWLB 3V8VA 1WY5A 1QIFA 1N1DA 1Q2UA 3CUSA 4JQCA 3AT1A 4L15A 3NHBA 1GCGA 4RFSB 4AG3A 5FV4A 3IIMA 4PQFA 3X2FA 1A2OA 3A4YA 3JQPA 3WJ1A 1QQ7A 2OLJA 1VI5A 1W52X 3EGVA 6Q21A 3JVUA 4R01A 2GN1A 1MAHA 2H06A 4U7WA 2NSJA 1ESMA 3GBPA 5CDUA 5AVYA 2IOHA 4OHMA 2Q1XA 2ZIUB 2ET6A 5H16A 1VLLA 4RD4A 2O48X 1FFCA 2Z30A 3S8MA 2NO4A 3I53A 3PVSA 4LEIA 1GVNB 4MUIA 3WTBA 1SU6A 4K28A 3HA7A 2BEVA 4OY3A 3KD3A 2IOQA 3W4KA 4X20A 4EQ6A 1JR3E 3U19A 1D9ZA 2BFCB 1XL0A 2OCAA 4G1MB 1E5LA 1V1MA 4HDMB 2VYCA 3ZJVA 4TVSA 3A9SA 2OORA 5LJLA 3HB5X 5HJ2A 2BBSA 5IDXA 1V2HE 3MOGA 1ORRA 1CPYA 4Q1FA 1GPUA 5B3JC 3GDHA 3NPMA 4ENRA 2Q9AA 1ZW6A 4UQOA 3UW3A 2H4JA 3WQRA 2A9QA 4RJLA 1OU4A 2ZK7A 3D2BA 4HDRA 1C9YA 1P1CA 1ZJ5A 3PVCA 4GRIA 4H3KB 4AO6A 2P91A 5AVVA 2R48A 4L2IB 2NNLD 3V4ZA 3W6NA 2GRAA 3ZZ1A 1WW8A 3K1AB 3RANA 4M98A 4J16A 2BWJA 2ZUBA 1YH3A 5I7OA 4BNNA 3MT0A 4TM8A 4AMYA 2C7GA 5EQJB 1UFRA 2IIBA 3AV3A 1FDTA 3ZQKA 1GAWA 1H8EA 4FIZA 1U6IA 3D0QA 3BERA 1IQPA 5BSRA 1BMFA 3GRYA 3AEUA 5DHFA 1EFPA 1YHYA 3MJRA 4NYIQ 4N3NA 4JI3B 1BDJA 2C8JA 4JP8A 3NI2A 2B1JA 2P0YA 4QRDA 5JSQA 2WTUA 2F3SA 2FFRA 3VR5D 1VJ5A 4TLBA 4H27A 1PNOA 4Z7QB 2GM5A 3ISVA 3Q85A 1WB6A 1YS6A 3JQ9C 3PQ8A 3WA7A 1V25A 5AOCA 4FWIB 1Y4DE 3DPIA 5J4KA 1P9WA 3DE2X 1MRZA 2PKYX 4GWKA 1RYBA 4KGZA 5ER6A 1X1EA 1F0NA 2A0WA 4XXHA 2QMUA 4DJJA 4J91A 1BFDA 3RRZA 2OPBA 3QQPA 4JIMA 3GF4A 5BNIA 5KVCA 4PBRA 1I10A 3FCXA 4HQNA 3KKMA 3SHTA 3E3NA 2FEAA 2M9MA 3GWZA 3KXKA 4LTDA 3VAZA 2YN0A 2LW7A 4CIWA 4OATA 4YIHA 1Q0PA 4YRRA 2AOVA 2Z57A 1JFRA 4NJMA 4U2BA 1YL5A 5J4YA 5JAPA 1KQGA 4B35A 1XZMA 4RL4A 1GR0A 2YQ4A 3MTGA 4FKBA 7REQA 4HXEB 1T43A 4LRSB 4N5NA 1PV4A 3CX8A 2IS4A 3C3XA 4K26A 2I9PA 1KY5A 3LRXA 2FMXA 4TZKA 1EP9A 4OI4A 3QKIA 2IX3A 1T6YA 2C2GA 4EG5A 1PFUA 1TKCA 2QTWB 3BG5A 4A23A 3PHHA 2WI8A 3PGVA 3ZE7A 3HKDA 4IVPA 1VG9B 4Q9DA 1WP9A 1J7JA 1HKUA 2XWJI 3DBLA 4RM3A 4YRPA 4CQMD 4W7HA 4F04A 5L4NA 3M7IA 4GP9A 2C2OA 5HIIA 4HRAA 5BQOA 4G1EB 5ALIA 4Q7QA 3GLFA 4LISA 3ISJA 3L77A 4H2DA 3IPYA 4Z2YA 1P7CA 2QX7A 2TMKA 3AJRA 4U7PB 7ABPA 3DBOB 3TRIA 2G1KA 3P9SA 4TUYF 4XYBA 5FI0B 1G9SA 4F5ZA 3ZIDA 5DLEA 1Y82A 2Y1WA 3EOBI 3K8OE 4CDGA 5A4AA 1W6RA 5LQCA 1OXTA 3KHUA 4GFDA 3V1KA 1WY7A 1XLVA 4FHEA 1J6UA 2RBKA 2QE7A 4G24A 1YMUA 3EXG1 4L28A 3TNDA 2P5TB 1DGQA 2EYUA 2BFDB 2DBQA 2NO1A 4LCJA 3LX5A 2QDKA 5K6AC 2XRZA 2OAQ1 1A5SB 5DO9A 1LSSA 3U7QB 2WD7B 3S99A 4TKVB 4RDCA 4JJKA 1EB9A 2DBYA 3T4PA 5C4IA 5IZCA 4GX1A 2EDCA 3PD0A 4BEJA 3LLSA 4IL5A 3B48A 4BLQA 4BZXA 2D1FA 3HGMA 4LXHA 4YACA 1J21A 3DDNA 3BHMA 3WL7A 1FS6A 5HK8A 3DFFA 3I04M 1ZAKA 2PX3A 1Z62A 3RK1A 4YTEA 4JDPA 4M37A 3T0IA 3UYKA 2NO0A 3GQBA 4E07A 5IAAA 2RHMA 1K6XA 5KSPA 3JCZA 4J9UE 1SN7A 3HFRA 4R7GA 5I9MA 5A2GA 1TC1A 1MJ5A 2QRPA 2ZAGA 5IDQA 5LMZA 4IIDA 2VUIB 4US1R 1PVOA 1YJCA 1R64A 2ZI3A 3ACCA 5JXIA 4N5IX 3NGXA 3TOZA 4ZU1X 4AMGA 4YMGA 5FO1A 4GKBA 3M4ZA 1N6RA 1X70A 2DQ4A 1R5BA 3T1TA 3QFTA 3ZGZA 1Z0UA 3MBKA 2IXTA 3HBMA 3ADDA 1X2EA 5ALLA 3WP1B 4ZI7A 5A04A 2IQ5A 5EKSA 5KKNB 4FNAA 1EFVA 4G8JA 4LBYA 1P9OA 2ZRIA 1ZHOA 4HYTA 1XV5A 3BCUA 4PYMA 3V55A 4B2PA 3AUTA 1I94B 2O8CA 1E4EB 2CK3A 3MRXA 4F6RB 4UNQA 4CFZA 1D4AA 1HPLA 4RULA 1Q77A 3AVWA 1HMYA 4OA8A 1KBQA 1PZEA 4S12A 3UOAB 4AN0A 2HUNA 2IS1A 2ZIZA 3EC2A 4MS4B 4QVIA 1QBKC 2QMEA 2BEVB 3LSTA 1XOIA 4J7AA 3KT3A 2AEEA 3W7VA 3VH3A 1Q7EA 2R1UA 1WXHA 3NLLA 4JWKA 4P84A 5EE9A 1J5PA 1N5IA 2BIFA 2ZANA 3OTOB 1T2EA 3WK6A 1WABA 1IQ0A 5C0OE 5ITZB 1TA4A 3O47A 1SHTX 3VPSA 5AK3A 3V4RA 3EB9A 3ZHRA 1JECA 5HMLA 3VYTB 1CLEA 1FUKA 2GPSA 3PDIA 2CVHA 4ZQHA 5E6SA 5JXGA 2JKVA 3FGNA 1XJCA 3Q88A 1YWGO 4OHVA 2BFEA 3WDMA 3Q40A 4KR7A 4DSNA 4G1FA 3WA6A 2VIIA 3G02A 3ZE1B 4R1UA 3KKLA 3UHOA 5LOVA 3BJIC 4OYHA 3IP8A 3GA7A 1E79A 2DGDA 1YB6A 1SVWA 5E6UA 1M72A 1VFPA 1RI4A 3EVGA 1Z4KA 1GNTA 5GOZA 3AEUB 1QQ6A 1EFPB 3AG6A 2BKVA 4MHSA 5NULA 3N2IA 3P20A 3WBFA 5ITWA 1LBTA 1MABB 1GXSB 1SA0B 2E37A 4R7ZA 5T3UA 5KS2A 2X8AA 2Z3VA 4RXMA 2AJTA 2C4UA 3C98A 2QD3A 4HNVA 1IB0A 1IJEA 1P18A 4YVFA 1N2CE 3B85A 5CD9A 2JI4A 5JSFA 4L5AA 1QP4A 1HM5A 1M83A 4CFSA 1XKXA 1IG0A 1PX0A 2OGZA 4JQZA 4KW7A 1B2LA 4HQ6A 2UAGA 1GGJA 3MLBA 3K05A 5EERA 3AY7A 2JGEA 3QEJA 3RLIA 3U48A 3TTYA 1FFEA 1NRWA 2ZW9A 5T6MA 4QXRA 3CRZA 2FSUA 1YDFA 2C1EA 1N78A 4FW8A 2ZYTX 3S29A 1XTQA 4IGEA 3CKLA 4JC5A 2O1XA 4P7FA 4N0PA 4QELA 5HM8A 2NTEA 4NJMB 1GTVA 3RF7A 3KZNA 5HQ3A 2E1PA 2O6HA 4Y6SA 4UCXA 5FWXA 3FRJA 1NRJB 1Z38A 2IUYA 2J33A 1AS2A 2YWFA 1K97A 4ML3A 1LFAA 2MYTA 3EXIB 1R8XA 5BWNA 1IM5A 2OV4A 2QMZA 2ZREA 3IP7A 2YWBA 2YHIA 3EQ7A 3EEBA 3IUMA 1OUMA 1GEEA 2CC2A 3IKJA 5EE5B 2A5DA 2WJAA 2ZRNA 3E22A 1IBKB 4V39A 3UT6A 2XXJA 3ORSA 4RTNA 1FP4A 1P5HA 2OT3B 3DEJA 5DYYA 4KQJA 3S44A 1XJWA 3DBLB 4KYIB 3IKLA 1N8TA 4G67A 2QNBA 4UE3S 3R7LA 3NHKA 1OHHA 1Y34E 4B3RB 4CM9D 2ZRGA 1M1XB 1UBNA 1NLMA 4GYKA 1FA9A 5TQJA 3RSLA 3RUPA 4J1QA 3OI7A 4D5EA 4EITA 4N76A 3BF8A 3FNFA 2RGYA 1SIBE 2P1RA 2X5XA 2V8OA 1UMBB 1XKLA 4L5IA 4I3GA 2Q2NA 4XTRA 1STOA 4S35A 1TCVA 4DQXA 3OQMA 3S5JA 4DV7B 4PM4A 5ICCA 1UMCA 2NZYA 2OE2A 3GEPA 3PGLA 4JQYA 1DKRA 1ETUA 4JA0A 3IIIA 5DTRA 4TL6A 4JJGA 3P8ZA 4RHFA 4BNWA 3A4MA 3TRFA 4AQ7A 2H4WA 2JGKA 3OE7D 3EGWA 2UZ1A 2FZWA 1YMVA 3ZU5A 5DVZA 3ZBUA 3HKCA 5AW2A 1LW6E 1H5QA 1BEEA 2GWRA 2WJWA 2WWGA 2W2QA 5BNFA 4I55F 5C46F 1GFSA 1LDBA 3NS7A 2W48A 2XB6A 3QX9A 4RF5A 4X45A 3NRCA 3EEOA 1Y1SA 4A2CA 4F3TA 1F60A 3L4BA 4WFKA 5L8VA 1C8LA 4UMEA 3RYFA 3U3OA 3SWWA 3M1LA 4ZVUA 4D8TA 3BMCA 4OREX 4XPZA 2WJJA 4NONA 5ALGA 5BMVB 2XIQA 1WVGA 2YXBA 1QHNA 1YJBA 2XYPA 4MRPA 3EFBA 5HM6A 1KDPA 2RGRA 1BKYA 2KPOA 1OA1A 2I6UA 2EKQA 5LNK1 4JJFA 1GLGA 5DK4A 4EHKA 2DRIA 3CNHA 1RPJA 3HYNA 3H1FA 1RFGE 3ZN2A 3PPIA 1VE6A 2BMVA 2W11A 1EQAA 1SCUB 2VT6A 3KE8A 3U7FB 3K8QA 2GF0A 5CVEA 1UC9A 3FNEA 3RNLA 3SF8B 3PENA 2WE7A 4G0PA 2NVUA 1Z28A 3L7YA 4JCOA 3V8QA 1I3MA 4PHTA 4WV3A 1L9XA 1O89A 4MYDA 5B55A 1XO1A 1VKHA 3LQ1A 4GOND 2JD1A 3V8BA 4B82A 2VP3A 1OX4A 1Y5NA 2XE8A 1LXCA 3H3JA 4G01B 1RZRA 1SQSA 4ZAGA 1MQ9A 3IUYA 3K09C 5EY5B 4DJTA 4YMVA 2C7QA 3OIFA 1VMDA 2XOKD 1CUDA 1QCYA 4HFRA 4IILA 5EE1A 3Q0EA 2AB0A 3DLPX 1BMDA 3COZA 3EVAA 3IPCA 3MPUA 4PC3A 2CYAA 4O2AB 2R6HA 1JBKA 2HWWA 4ZEOA 3FH0A 1DQRA 3H1BA 1RXIA 3BA1A 1UFQA 5LQUA 1NZJA 3JZMA 2E6UX 3G82C 4RD6A 2QTVB 3K0FA 3KLOA 4WKOA 3IJ5A 1PK9A 4D3FA 4YH1A 4A4DA 3PDIB 4GLBA 1GWNA 2QYTA 1Q7TA 2IUEA 1IUPA 2Z4SA 3IVMA 3JASB 5CLHA 1V4BA 1E69A 3QY0A 4BLUA 3OJEA 3QELB 1NXXA 4Z4FA 4URUR 1JPNA 1RWVA 2WJGA 3ZPXA 3E7FA 3GPIA 2EG5A 1ULUA 1QBGA 2FP3A 2HIAA 4E5KA 3DLAA 1ESZA 1EVJA 4G86A 4MVJP 5JZMA 1A77A 4WX2B 1KFBB 4DCNA 1T0UA 2IUTA 2B8TA 3GVHA 1V9CA 3HR4A 1EVQA 2QM8A 2Q4BA 1FOEB 3GLVA 3L0BA 3PDWA 2EKBA 1GUFA 1BU5A 4F6LA 1G7TA 1PZNA 1JR4A 5LA6A 5HF9A 2H1HA 5EXSA 3KXPA 3ADOA 5I7FA 4K1LA 4J75A 4DIUA 6CHYA 5IF9A 5B1IA 3UV3A 5BR7A 1NVVQ 3QITA 1V8ZA 3LXRA 3V2GA 4D99A 4GSKA 2B2XA 5K0GA 3BL8A 3W0LB 4TMYA 2FPSA 4HLUA 3L0SA 3BL5A 4K0RA 4BB0A 1PJ3A 3O21A 4JGGA 1P2UA 2XBLA 4EPYA 1UKBA 3DEKA 4ZZ0A 1HBJA 5HQ3B 4UJ3A 1ODSA 2ATCA 4P1ZA 3O4HA 1JBQA 4U2GA 5FWXB 1TJ5A 2ZVQX 3FVQA 1DJNA 3G68A 3ZU2A 5CNKA 5FFFA 1B26A 4C2AA 2D1SA 1RS0A 3OICA 1F2TB 4G0XA 4OAOA 1Z5PA 3ZV7A 3NEAA 1AUXA 3I45A 3AB3A 4R9SA 1KBOA 1NW6A 3SK0A 1FP4B 3BMNA 3HKEA 1HLGA 2I34A 4PHFA 4MUAA 2FLVA 3DCJA 1DJMA 2WJIA 3GRCA 4R3WA 1XVLA 4Y6LA 3PXGA 4IG4A 4YRCA 5KTNA 4LF7B 2A30A 1NJGA 4Z4HA 5JWOA 5DF1A 3HGTA 3MSCA 4KR2A 1XP8A 1DWOA 4NFYA 5FEMA 4DT1B 2AR7A 1C7QA 5FA5A 4ZQGA 3RFCA 1CUFA 1XZAA 2YYYA 3IE2A 4KIFA 1GAJA 2Z08A 4L9WA 2X0JA 2Z2XA 2AOTA 3C3JA 4DS3A 5BY2A 3M5DA 1UMCB 3CMCO 3O9ZA 4QUIA 2XX3A 3W5CA 3EVNA 3HRHA 2ODTX 2FOXA 1KZ6A 4OGGA 1HO3A 2FETA 4PO1A 2C5AA 2Q5FA 3GNTA 5FHRA 4EQZA 3MBOA 1H2AS 5FIUA 4RIGA 2OKCA 3MT7A 2QN1A 5FYDA 4AO8A 1ILWA 2Q28A 4L5YA 1ECPA 4K6OA 4PY2A 2B0JA 2FF7A 1XDZA 2ZE5A 3AVUA 3HKCB 4RGYA 3N53A 2QTRA 3M6FA 5DK6A 3PE4A 5HKOA 1APBA 1KZ9A 1VJTA 3OEED 2DQSA 4GOOD 4HWKA 4IZOA 1LPBB 3QSGA 1GAXA 2IHBA 5J2TA 4Q6BA 1EWQA 2H54A 4LVUA 4N82A 3ZS8A 1HEYA 3ASVA 3FPLA 4AB1A 2FR8A 3AJDA 4ID9A 4QO8A 3U4DA 2NVBA 5D7BA 1A4IA 3H4VA 3GOQA 5F77A 3U1BA 3S7ZA 1FUYB 3H5RA 1L5FA 3P2JA 3BMCB 1WZNA 4ZV4A 4FDMA 1W93A 4GMHA 1T9GR 2M1XA 2NPFA 3VJLA 4DYVA 5JQGB 4RK5A 4Q15A 1GP2A 4XDYA 1FSPA 4IFEA 5AKXA 1N5LA 2KE5A 1SHKA 3L7LA 3NV9A 4B80A 5BXQC 1IK4A 1DINA 1J0CA 2ZR0A 4DSZA 1G8JA 4L8FA 1O95D 3R6DA 3FPAA 4OVKA 3ZHQA 5KNBD 4DUYB 4AS1A 4G9EA 1NU8A 2FPRA 5FD8A 3R1IA 1JEOA 1Q1QA 5JLJA 3ZY3A 3MF4A 4NATA 4KIGA 4CU5A 3BWVA 3ITDA 1TO2E 2DWOA 2QD4A 3R76A 4ZJZA 2CMDA 5JNSA 1VXRA 4PAOA 4MAFA 1F9EA 1ISMA 2HOQA 2RDMA 1ORTA 3EAGA 4BX3A 3MCZA 3LHFA 1YZGA 4MQ4A 1BS1A 1OX4B 3MRVA 4W5JA 5K09A 2WB2A 3WG9A 4JIGA 1U6KA 3FZEA 4O8ZA 1E9FA 3RVPA 3CPSA 4WCFA 5ELMA 1Q74A 4A36A 1KK0A 2PBZA 2WUEA 1EINA 3G9ZA 2MHCA 2X0IA 3H9UA 1YKGA 2R2AA 3QYJA 4G85A 5H3CA 2VH1A 2VHJA 4WZZA 5JAQA 3CVVA 1VI6A 2JFUA 3DE7X 5FOUA 4F4IA 4Q24A 2HK8A 4Z4GA 1E92A 1XYVA 5SICE 1U7OA 4M1EA 4FT2A 4DHEA 3DT8A 4WW0A 4EI7A 5JPDA 1K9VF 3LFUA 2XWPA 1OI4A 3EPRA 5K0NA 1ICEA 1QVRA 2CBGA 4RNCA 5E6RA 4BMSA 1BE1A 2FK8A 1BN7A 1GO2A 1HI9A 1OBHA 4TUYB 5D5HA 4M9UA 3K0FB 5J40A 4EA7A 2W8ZA 2COKA 1L5QA 3DEYX 1KZ7B 3OIWA 2E6KA 2XVAA 1JDTA 2WT8A 4ZU3A 5HRAA 1C0IA 4AF8A 2OZKA 3DHYA 1CUBA 3U0VA 4E33A 2H2HA 2OC4A 4WLFA 1GCUA 2CJYA 2I4IA 1X6VA 4EYKA 1WBBA 3LU1A 4W1QA 4DMGA 4TYQA 2GJ8A 5GOTA 3ND5A 1M6HA 1M8GA 5DHUA 4Q3LA 3H5TA 3OPYA 4GBMA 4DIKA 1K63A 2DBRA 4C2UA 5AHRA 2AUTA 2QLJA 2CZGA 3H1PA 4PNHA 3Q8LA 3NALA 3VZDA 5LWHA 2V7GA 2VWGA 1PEYA 4KIUA 4M8LA 1Y8RA 1NBMA 5J63A 5CFOA 2G6TA 1BXRB 3BWEA 3OCYA 1M8KA 1REQA 4N3GA 4WXYB 3TQTA 1XAJA 3DP9A 4FOSA 3NVMB 1TO6A 4FR5A 5F1PA 1PE0A 1TMKA 3K20A 2JGFA 3ABRB 2BGTA 3C3CA 1XDSA 2VJKA 3H1GA 4HFNA 4UFNA 4AWAA 1VBNA 2FDXA 5F5NA 3ZLBA 1M0TA 1EEHA 1EH5A 13PKA 2AYYA 3DULA 3SJCA 3EK2A 2C2XA 1VHJA 1J07A 3NCHA 4LZJA 4P2BA 3BAFA 1GA1A 1W581 3A1EA 5KC9A 1ULBA 3MTBA 1C1XB 5LMNB 1UT6A 3O1JC 5IVKA 2DETA 1Z35A 1XCJA 2Z2KA 3U7HB 3DFIA 1JAHA 2WM8A 3GARA 4RUKA 2J9XB 3GBSA 2PL3A 1GG5A 2OMKA 4ZTUB 4BX2A 1NOJA 5A0VA 1R00A 5LMUB 3IOBA 4K46A 1SUPA 4JQOA 3SX0A 1Y3AA 4RH3A 4CG1A 5LDGA 5CT6A 1OXUA 2BM8A 1UK8A 3BSYA 4MYCA 5KYTA 5JBIA 4UNRA 5BNWA 1O7JA 5HBGA 2RK4A 5ILOA 2OCPA 2O8EA 3CPEA 4NZYA 4CHTA 3O83A 1Z6PA 2J4CA 3HKEB 1DJOA 4REQB 3KQNA 1JV2B 1S9DA 1K98A 2DECA 3ESRA 2W58A 2KS6A 5DCLA 2TYSB 4V0LA 5T8KC 3FMOB 3CR7A 4MW1A 4DNOA 5KOJA 1RXSA 3H8JA 1CD5A 2AFHA 2OYSA 2QT0A 4MI1A 2BMEA 3A70A 3JYPA 2HADA 4TL7A 2JANA 5CG1A 1YZKA 4FFBA 1DTEA 4F1KA 5IZ4A 1EGQA 2ZS8A 3L05A 1L7AA 1HTTA 2GFHA 2ZEJA 3BN3A 1TUBA 4JT2A 5T3YA 3L8CA 3V6LA 1JKFA 1GU0A 1MXHA 2O0HA 3R5JA 4LDNA 2IV3A 4AY2A 2RI6A 3BEOA 3QH4A 1TZBA 2IYSA 3L1IA 4GGPA 3N3AC 3KPUA 4KI0A 4TXNA 4BUJA 1MQAA 1N33B 3JWPA 3X2EA 2Y92A 2BUAA 3BE5A 1Z0ZA 2FFAA 4NBLA 4U63A 1XD8A 5AW8A 2ZJBA 3C4QA 1NVTA 5SZHB 3BWMA 1PTKA 2QL9A 2WYHA 1Z2AA 1NJ8A 2HV9A 3E2IA 2JJ2A 3PI7A 5F23A 1RLMA 1BKSB 1RI5A 4ESEA 3M6IA 2EL7A 1GZ6A 1C9MA 1YVUA 4FB4A 3OZBA 3T54A 3IYLW 3FNIA 4WJLA 4E21A 3OAAD 4XLLA 2O06A 3K4HA 2XRFA 2I6FA 4KBFA 4FKMA 4JBLA 4R2LA 5FCDA 2IZ1A 4EUSA 3KUUA 4ZCTA 5EP1A 1TK9A 3AHDA 2Q9CA 2A0YA 1S6YA 1YBFA 3TJRA 4I99A 5KOHA 3AVPA 2JKYA 1NPTO 1QHFA 2DEUA 3PWKA 5GONA 2R8PA 3BIOA 2IZOA 4M9XA 4HNUA 2CXPA 3I2FA 2IEDA 3I0NA 5ELLA 3M9LA 2K7FA 3LL7A 4ZA2A 3IT3A 1YA6A 3DAPA 4G2TA 3RTDA 2Q7XA 3OQIB 4UQPA 5E3HA 5HVNA 1LBEA 2GN9A 4X8OA 1O6GA 1VKRA 1H05A 4NOJA 4EW6A 1IPEA 3AQ4A 2IP2A 3VHXB 4A6PA 3R09A 4PFKA 3YASA 3TF5A 3DAFA 3DCIA 4YCDA 3FG9A 2DKFA 5HUHA 1BCSA 3RVQA 4N47A 2PCLA 2Y2UA 5G3ZA 2HRZA 4BNTA 4YRMA 1NUTA 3A31A 1YI8A 3GLUA 3L82B 4CQMB 5C1DA 5JEEA 5HRUA 1TF2A 3RHTA 2CSXA 3PL5A 4ZAZA 2X13A 3TSOA 5JS8A 3HJGA 2I6XA 3DEZA 1F2UA 1UJ6A 2YZMA 1KO4A 2YWDA 4G4JA 1IUKA 2X2PA 3HXTA 4RLSA 1D3AA 2AIRA 1K5DA 3M6MD 4D42A 4PG8A 4JP1A 1GY8A 3TI9A 3MB5A 3DL7A 4WHMA 2BEUB 3GROA 3A58B 3OLCX 3RAFC 1EQ2A 3ULKA 4U2CA 4RVOA 1E1MA 3UV7A 3ROGA 3PX7A 2H3EA 3W77A 4L1KA 5SY6A 1JHUA 2VZ9A 5BN1A 1QC5A 1YZHA 2I1VB 3WISA 3QFSA 2FN9A 5K8LA 1W5EA 5D2CA 4EFNA 4KXUA 1Z8HA 3CH6A 3QUSA 5IN4A 1ODLA 3MM4A 4GGMX 2Q2WA 1W73A 4IP0A 5AHWA 5FTWA 2A5GA 5FLXA 1IMOA 3KK0A 3LRTA 2C4TA 2HU5A 1RPTA 3C24A 3M4YA 4BVHA 5FUWA 1XTUA 1YRHA 5DNDA 1Z8DA 2PD3A 4BLTA 4I55B 4FE7A 1DDIA 4JK3A 3I8OA 4M9SA 4Y2RA 4YWJA 5TJHA 3EH1A 4B32A 1NW7A 3GAFA 3IQXA 1PT8A 1YZFA 3IP3A 3IDOA 3R5FA 3ZI4A 1XFAA 4Y0NA 5AOBA 4RYDA 4JJ6A 5JHGB 2EGUA 3WGVA 4XTCS 5CDSA 5KBYA 1Z2OX 3HBLA 1KXJA 3KWLA 4OLJA 1O87A 3UEOA 5BUCA 4LVNA 1YZQA 4DHWA 4AQYB 1KI6A 2H1FA 1CUAA 3SJ7A 3ENQA 4A27A 5A5FA 3AFNA 5C8ZA 3L6UA 3R0VA 2RAPA 1FYDA 4XQ9A 2H8KA 4JC0A 4ALKA 4A73A 5KWVA 3VC3A 3OX4A 2IOYA 3LBYA 2P3LA 5AJZA 3QOFA 3GT7A 4JMPA 1OMOA 4XD7A 1X7YA 3FKSD 3I8XA 4A0QA 4FOTA 5LWQA 4EG8A 4B4UA 4KB5A 3C74A 3THWA 4IDAA 2IPNA 1E8MA 2QUKA 2XGJA 1E1CA 1KOFA 3N0RA 4G36A 4TTQA 4IBOA 3GC6A 5FBZA 4MRMA 5CHEA 4ENUA 2A9OA 3AF4A 2O9JA 4CM4A 2A1UA 1DC4A 2C77A 3CX6A 2ZYDA 4DMCA 4RZIA 4JB3A 2Z0MA 5KOJB 2WABA 2NVOA 1AKYA 4J0CA 1UWKA 3BGVA 3G8DA 4BGEA 2BI7A 2OY0A 3GRUA 3VM6A 2X9LA 1CXZA 3TG8A 1AMOA 1HH4A 3GFTA 1BEZA 4U7DA 3ZBTA 1TJ3A 3TR0A 5EC8A 1EFDN 5JS1A 1KEEA 1E5VA 1JU9A 1TTPB 3U80A 3MJFA 4AZ0A 1DDOA 7MDHA 4C04A 3UKJA 4OL0A 2JLCA 3RS5A 3OP1A 4PQGA 1GEGA 3JQAA 4CM8A 5AFSA 4OQPA 3AOEC 2IS6A 3V1LA 4YRNA 1RXCA 2ZBQA 1HSZA 2N3ZA 2ZQ5A 1N77A 3VTFA 3D81A 2QLNA 3CN7A 3L02A 1M7GA 4BNFA 2WU1A 3OE1A 5J4LA 1IN6A 3IKTA 2UUPA 1MAAA 2GAOA 4HN2A 4IIXA 1H9AA 3IR5A 4L75A 4HYQA 1Y5LA 2Y66A 3HSYA 3ZWCA 2DWQA 1M75A 4CM5A 1DEHA 1IMJA 3U3MA 2AKEA 3CMMA 3IULA 1MNQA 3LOPA 4HBZA 3RDPA 3R5SA 2QX4A 3T15A 1Z4OA 5TDHA 4CETA 1ZC4A 2GYUA 4P36A 1XQ9A 3SQMA 3E9CA 4E11A 4YRLA 3VPXA 3JZIA 1E2NA 2Q9BA 2A7QA 3QI2A 4AY3A 4B3BA 5AJTA 4HDQB 3BDVA 1HEIA 3WL5A 4LDAA 4GYJA 3S2GA 3P9NA 2DBVO 1MC4A 3DVRX 1SKMA 1XXHB 2BGJA 3U4IA 4FFMA 2OTCA 1ST3A 3D3WA 4PX9A 5I7VA 3WO1A 5KOHB 4ATNA 4YT4A 3U2QA 2NADA 1I9CA 3OF2A 2P5UA 4QUJA 2IH4A 4CI0B 2ZPTX 2O5RA 3E81A 1PEKE 1KQFA 4I3FA 3HFJA 3WWYA 2PN1A 1AU9A 4TKMA 4OI1A 1BMFD 3CLRD 4W1RA 1HR0B 2JH8A 4EFKA 5TGDA 4M1QA 4RCYA 4ZEMA 2WK1A 4IZ6A 3MMZA 3MWDB 5AW1A 1VYVA 2J0UB 2AUNA 2ORED 5A3SA 2FEPA 3NHAA 1YQGA 2GM9A 3DVLA 1G1MA 1YIDA 1NQAO 2G9RA 5F4BA 3HL0A 3WL3A 3G8AA 3H83A 3UAZA 3DC2A 4X3PA 3LGAA 1XHEA 2CL7X 4TLDA 3D31A 5THQA 3QFFA 1AB5A 2AMFA 3D3EA 3DZFA 1RVV1 4QC2A 5K0FA 4K2AA 3DKRA 3DMRA 3LP6A 1F2UB 3P2YA 1N2CA 5KHAA 2P4HX 2LE0A 4H7PA 4BP3A 4YGXB 4YLYA 1YU6A 1ZJ4A 4XSGA 1SXGA 2C5HA 2OR3A 3FY4A 4RY2A 3OJWA 2NM0A 5FPPA 1CF9A 1R0CA 5LM3A 4A15A 2GN4A 4D02A 2ROQA 1DJLA 2R6JA 4I0WB 3D2AA 1JSXA 1I3LA 2IL1A 2LGJA 4TVOA 3P0JA 1ZGHA 4HGRA 2QQ5A 4BFUA 3IT1A 3R77A 1I30A 5TX7A 3RQIA 4AKHA 1Q0RA 4O2RA 3R3XA 4X6LA 5IK2A 1JP7A 5DXAA 1BN6A 3RJ9A 3USZA 1CC1S 4HH3C 4M46A 4NG5A 2DERA 1BJRE 4UVHA 3EASA 1HL7A 1GUBA 3UB4A 4B44A 1NSFA 1Z15A 4B6EA 5JEDA 1TEZA 2CF6A 3RSGA 1TQDA 8ADHA 2LKCA 3NEYA 4LZOA 4IJMA 2Q1YA 1NF9A 2IDKA 3FA2A 4B3MB 3G5UA 4XCXA 1AC5A 1I5RA 1HDZA 2VNAA 4HAIA 1VPWA 5L51A 4L85A 2QN3A 1WX1A 3A2NA 3CZRA 2GB4A 2EJCA 2C1ZA 3H1EA 4P0TA 1IUNA 4UEOA 3GOHA 4Y2GA 5THXA 4MIOA 4ZVNA 3SXJA 1B23P 1OH8A 1THZA 1RFLA 2VT3A 1YJ8A 4KSBA 1ICIA 1V45E 1WD5A 1GTZA 3NXSA 3TUJC 2FUNB 2X9GA 1B3RA 4GF5A 1G63A 3IP6A 2XECA 2VK4A 1QZXA 4OUDA 4DLTA 1E20A 1UFVA 5ILQA 2VH5R 3ET4A 1QVAA 2EQAA 2J5KA 3GLSA 1CS0B 5DN6A 4FS3A 5JS7A 1F5NA 2HW8A 3DL0A 4K6GA 3ODGA 4OOFA 4WIAA 2GLUA 3C6BA 1Y3DE 4DGSA 2Q1SA 4ANFA 4AJKA 1TJPB 2RKWA 3KJXA 4OFBA 2C04A 3SSOA 4K3UA 3A2LA 1RZUA 2VOJA 1E1CB 2IHVA 1U8EA 2VSXA 4LAFA 5GGYA 3VXKA 1W4ZA 4ZCPA 3E82A 4CMIA 5AW9A 3JXEA 4MRMB 5CR9A 1M34B 2NQTA 4KDCA 2HJRA 1MAWA 1M6VA 2A1UB 5AT1A 4MGKR 3WYBA 1OTHA 4Y9RA 3QOXA 4IUCS 5AVQA 3TDMA 4C14A 3SFTA 4RK4A 2YQ5A 2SBTA 1JQBA 1DAHA 3OLQA 2EGHA 4IRXA 2VPXA 2AA3A 1JF8A 5EINA 1T9ZA 4YJ3F 3HS3A 4IHJF 1EBUA 1M9NA 2QJWA 4KLCA 4EAAA 2BEWA 3UQYS 3M3PA 4EGJA 3GEIA 4YMLA 4D0SA 3B6KA 1HFJA 1KEEB 2VP2A 1P7VA 3JRWA 1XAHA 3DHNA 2IY9A 3O5AA 4MS1B 4QODA 5BRAA 3EFOA 3P45A 2C0CA 2XUAA 4G37A 2ZU6A 5JSYA 1GQYA 3B6JA 1KE1A 4U7GA 2WF9A 2PAAA 1ML3A 2OCGA 1R1DA 5CVUA 2V98A 2CK3D 1KYVA 4ZFNA 4FOOA 4E5DA 2TRSB 1LTKA 4A1OA 3JQGA 3ASUA 5DNWA 3DAHA 2J48A 2BBWA 1RXVA 2ABWA 2NTNA 1N9GA 3KPVA 2ID9A 3S2EA 3ZWNA 3VO2A 3DONA 3S1LA 2CJXA 3E3OA 5ER9A 2OBNA 2P0EA 3NBFA 4MR7B 1VGQA 3DPSA 3TCXB 4G0VA 5LKRA 1EE2A 2XUGA 1DEOA 4H16A 2ZJ3A 3BH0A 1BIFA 3C3WA 4KLNA 3AWDA 3OQ6A 4C4AA 2I5PO 2WWIA 2H17A 3AIKA 3UMRA 5GTDA 4HXGA 1FQJA 4MSUA 1JNYA 4DF3A 3NTVA 4F8EA 1AQLA 4NU6A 4A26A 2ID7A 4EI2A 1ZR2A 3CYFA 2WAMA 1ZX1A 2GK6A 3G2KA 3MD0A 5C32A 1MHPA 4BMXA 5JDIC 1M0EA 2FPOA 1TL7C 2GJ9A 3VR0A 1U8XX 3D3WB 1AOXA 3LDUA 4CMEA 4DSOA 1GGNA 3L8ZA 2GJ4A 3LE8A 5AP9A 3RAGA 3VSBA 4BO8A 1KDVA 1DIAA 2NU8A 3FW1A 1JHPA 5K2MA 4PCVA 5CA0F 1KI7A 4FILA 1CDZA 1OZGA 3FPJA 3UCXA 1RE0A 4MKRA 5DX0A 2NAPA 1R50A 4G89A 2W8BA 4LHVA 4N03A 3RC3A 1D8AA 5T41A 1N6PA 5BSEA 1HNWB 4NARA 3G6WA 4IQ4A 5EKTA 2ADMA 4FN4A 4KG7A 5MDHA 5TF0A 4EABA 1KRHA 4Y7CA 4D6PA 1EFCA 3N5KA 4R6WA 3VPBA 5I8PA 5AI9A 2UUAB 2RHHA 4DNPA 2DHDA 4B3TB 3OZWA 4RKEA 1KIFA 3CU5A 2WPDA 3BXFA 3G2HA 3U9SA 2CUTA 1Y42X 1CUWA 3PK0A 3AL0C 1G55A 3I1FA 3AYXB 3G89A 3QTBA 2SKCA 3KCQA 1M73E 3EZ2A 5ALNA 3GLGA 3MRSA 1YQXA 2XT0A 3F7TA 5KTKA 3UGQA 2ZKIA 3S8YA 3B6MA 4C08A 1RI1A 2W5UA 1ETHA 1HFEL 5KWIA 4D8VA 4CEJB 5GJWC 1PZFA 2C4WA 1TRKA 2DVMA 4FD2A 1CBUA 2QM7A 3EPPA 1X3LA 2B3DA 3GVPA 3LQRA 3L8FA 4KWHA 3DOFA 3PCXA 4TMFA 4BMOB 1JDNA 3U5TA 4TYMA 2CD9A 3K5HA 5JDCC 1VHDA 4A82A 4RMHA 4DWWA 2B3TA 3FVVA 4HAUA 4XRRA 1VDMA 2WD9A 2H9IA 4QIHA 2R1VA 4K87A 3UK7A 4M6WA 5KI6A 2IYWA 4RSMA 2P9QA 4WAUA 3W5HA 2R7AA 3L7JA 1Z6GA 1Z5VA 5JNTA 2GHTA 3ZDDA 1GUDA 1RRGA 3STYA 4JBXA 5CX4A 3CZ9A 2AI1A 4L02A 1T1JA 3FM9A 5CM9C 4YRFA 2X9QA 5FUBA 4GRDA 5G02A 4AIIA 4FZ5A 2BGNA 1E77A 4GI7A 3LFHA 1BCRA 4AMZA 2ZB3A 2V97A 2AD1A 4M38A 3LQFA 3GJ7A 4QARA 2CVPA 4J0JA 8GPBA 3FZQA 3O4JA 4IIYA 4LZAA 2XMDA 4EO7A 1GTMA 1K2VN 3ON5A 3E1KA 1ZD1A 3PU6A 3AP2A 1W19A 4M1WA 4AJ4A 1EX6A 3PQ3A 4QT0A 3JATB 3EHEA 1JJVA 3QE4A 2ZUVA 4BBJA 4QHSA 4CTKA 1JA0A 4R2XA 1EP3B 2I78A 2L0XA 1NVVR 4YT8A 3TQOA 2OHIA 4BQFA 2GDZA 5KYNA 1DBPA 2IYVA 1JYSA 2D8MA 2M6LA 2FVXA 2PUVA 4FC7A 3FF1A 3GL9A 3PNYA 4GMDA 3O7WA 2J8ZA 4YJFB 1FTWA 3HV0A 1RC8A 4YECA 4N3CA 1YRBA 3T3DA 1PCXA 4CMIB 1PYOA 1U2TA 1ZP6A 2C7BA 2D5BA 3NBUA 4GXTA 5CIYA 1B42A 1K8RA 3NCTA 4X1IA 1M6VB 3EZYA 3LC1O 4NMWA 2GN0A 4OXQA 3CEAA 4QJ4A 4ZV7A 3FFTA 5JG7A 2GFQA 4NCAA 1IN8A 1BSVA 1N57A 4R4JA 4JUFA 4H7IA 2Q29A 2M2IA 4FX5A 1NXVA 1W34A 1YR9A 3D7SA 4O8CA 1WUYA 4FMDB 3H2KA 1JFSA 4MW0A 5L3VA 5CU7A 4LX8A 1ELOA 1X1AA 3DOCA 4IXMA 1LRKA 3M1YA 1HKHA 3KV3O 4A8PA 2QJOA 2VQ6A 1T0PA 1F0PA 4YP1A 1IBCA 3F96A 1I5EA 3FMIA 3U1TA 4AC9A 1M5UA 2Z9BA 1PLKA 1R8YA 2H5IA 5G2OA 1KZHA 3OC0A 1CQJA 1R4NA 1G3QA 2FE4A 3RBXA 1KU6A 3NOXA 1UPBA 2HFJA 3W8DA 4OQYA 1OXSC 2ZM5A 1X94A 2AF3C 1MO4A 3L8EA 5EJ9A 4FLFA 3O26A 3WI7A 3TIFA 2ENUA 2QN6A 4B4WA 5LUAA 3HUEA 3HXMA 1J20A 3TAHA 4IAOA 1YE8A 1JMYA 1SC1A 2RGDA 5BOVA 4KH0A 3RNOA 3UAWA 3VFDA 3I23A 4HK4A 1E6WA 2P41A 4E2YA 4F9GA 5EQFA 1OKKD