4XM0A

N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
264
Chain Sequence
b'NVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Metal binding protein
source organism Pyrococcus furiosus
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
total genus 75
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm0A00
5B2EA 1Q74A 3DFKA 4EWLA 4XM1A 5B2FA 1UANA 4XM2A 3DFFA 5CGZA 2X9LA 3DFIA 2IXDA 1Q7TA 3WL3A 3WL4A 4XM0A 5BMOA 3DFMA 2XADA 4XLZA 3WE7A
chains in the Genus database with same CATH superfamily
1AGRA 1L3CA 2P4EA 1P6XA 4R7TA 4ZGBA 1XPJA 2ARKA 3LT0A 4M89A 2P30A 1AUXA 1Y89A 2D0IA 1BN6A 1A9QA 2Q5LA 3EMBA 5AQ1A 4W7SA 3M5WA 2VT6A 2YJNA 3AH8A 1JRLA 4HK4A 1XVTA 2QRMA 1RYDA 2UZ0A 3MELA 3IJ5A 4GLFA 2B3TA 2G3YA 4GC5A 3QELA 4AO7A 3K4QA 1M2OB 3MGAA 4FNOA 2EW2A 4HY3A 4Z2AA 2TRSB 2UZ3A 3B1XA 3Q2KA 1GPH1 3RH0A 4A8JB 1QOZA 4HAZA 1RJGA 1CSEE 1T24A 2FKNA 1XA0A 2C07A 4HEJA 3M6MD 3D6UA 1KJZA 1T9GR 2XADA 1HDRA 2YV1A 4FLMA 3ZCUA 1JFFA 2HTFA 3KZ1E 3EFOA 1U7UA 3D3KA 4RLQA 4CZ2A 4Y2XA 5INTA 4RVFA 3CRMA 4O0LA 2G1PA 3FNIA 2WAMA 2FWIA 4L22A 5KNDH 1E58A 3DEZA 4U02A 3TS1A 4L4UA 3NBYC 5T8KC 2Q2QA 4F2WA 1S2OA 3DFUA 1WDKA 2Y1OA 1QHIA 4JYPA 2YVUA 3CHYA 4N7JA 4OGLA 4TMYA 1YZTA 5FYDA 4B8YA 4EG0A 5KSOA 4PIMA 5DX1A 1NMZA 1EZ4A 2QL9A 2NP7A 4QEZA 4XQ0A 1KGDA 1KZ9A 5DGIA 4Y1RA 4JMPA 4KJXA 4GMDA 3IV6A 3B3QA 1IRXA 5JROA 2V0GA 2CXHA 4GL4A 4KX3A 1YL7A 3LFTA 2GN2A 1XRNA 1K75A 2Y6UA 3UK1A 2IF2A 4B4UA 3A4LA 3Q0TA 2AC4A 4OB7A 4JJAA 5J58A 4F6CA 3KPWA 3STUA 2CBZA 2Y1WA 3K09C 3ED1A 5DMXA 5LXTA 2FQ1A 5GV8A 1KMQA 1CRZA 1K4YA 3ZE2B 3HM2A 1QRTA 1KMHB 2HDOA 4PCLA 3B12A 4RL4A 4H1WA 2ZIZA 1TD1A 3PNKA 4QXQA 1E8NA 2F9LA 3F9CA 1AY0A 4V02A 1BWQA 4ZFNA 4KIWA 5BR1A 3R09A 3K71B 5E3HA 3VSCA 5KYKA 1ONNA 3W05A 2AK2A 3CRVA 3P45A 3SJAA 4YJ2F 5IAGA 2AZTA 2VNJA 3PS9A 1JALA 1SKAA 3NJ4A 4RZXA 2QBYA 4LXGA 1OH7A 1CUCA 1YVUA 4G0OA 4BX2A 2VNHA 3EAGA 3F7NA 5TIIA 4UFPA 1GEEA 5FHRA 1Q11A 4FR5A 2ZYWX 4TS3A 3N7UA 3EGDA 3BA6A 4EEKA 2D3TA 9LDTA 1UMCA 1JQEA 2WSYB 2D8MA 2RJOA 3V2GA 3GIWA 2BFEA 3L6UA 3OPYB 1XQ9A 2HLPA 3BXEA 4PLZA 4B6OA 4BNKA 5AICA 2IPMA 4RSHA 3B1YA 1UEXC 3SYKA 4Q6BA 4ARUA 1Z4NA 3M81A 4LHEA 5BURA 1CEEA 1NJSA 3DZGA 1DKRA 1H8HA 3TLJA 3L4SO 1U3GA 1QV6A 2QNRA 3AIMA 3WB0A 4ZGGA 4FFDA 1SC3A 4KBFA 4IRMA 5KCZA 3ZWYA 3PTZA 3ANSA 3E53A 4L0CA 1VYVA 2H1HA 1ADGA 4OUDA 5EWLA 4CKBA 4OXYA 5F77A 3W8NA 3HCWA 1WABA 2AFIB 2QN9A 3EXHB 1UK9A 3L5KA 1GQQA 4QAQA 2JLAA 3T7EA 1Z2PX 2IOHA 4CNBA 1MXFA 4MA4A 3B6KA 2QTCA 1M2JA 1AOXA 2PSJA 4I5FA 3FOBA 1RRMA 1JZTA 1U7ZA 4DBZA 2IKSA 2AI3A 3H6HA 2HIAA 1IN6A 4E6EA 3SZRA 1T36A 4IHJF 4MK4A 2NU9B 2N1BA 1SBCA 4D9GA 1W49A 1KY2A 3EIFA 3H4VA 4A92A 4EG6A 4PYIA 1KAHA 2WIDA 2ODPA 2NMVA 1DJNA 4BFSA 1JEEA 1YBFA 1XPOA 4BQQA 3VU8A 3KQLA 2BD0A 5K01A 3RU3A 2BTEA 4MDYA 1G42A 4DV3B 4URZR 4KUGA 4OY3A 1P75A 4G0YA 9ATCA 1G4HA 2IYRA 1KJWA 2YC4C 4R2HA 5IPFA 4N48A 2Y1DA 2WYHA 3P9SA 1V5FA 1BA3A 4I1UA 2BAGA 4R98A 3NV9A 5IXJA 2H2GA 4ZAFA 4B3FX 3K09A 3PGKA 3VH4A 2VKTA 4F2GA 5BVHB 2ZB7A 4Y2YA 4JB8A 3X2SA 2GAAA 2R6CA 2P62A 4O4IB 3B5IA 2G08A 4DRZA 2ZW9A 1NJ2A 2B78A 5G3YA 1UBUS 3DOOA 4IXNA 4AJIA 2D54A 4WK0B 3HB9A 3U62A 2LCIA 5I9NA 3EA5A 2IVFA 2Y9MB 4DWWA 2A14A 4WZ6A 2FF7A 3BIJA 1T1GA 3KKPA 1E5XA 5HG0A 1TO6A 3TLZA 1L7MA 4ZQGA 1WDLA 4HH1A 4J0DA 1B3RA 3C70A 3O8OB 2EFYA 4X8MA 3I2IA 3THRA 2OYSA 3C4JA 3VMFA 2NZVG 3EASA 2QOEA 4AY3A 3UKJA 2BMAA 5AKIA 2O3UA 2V6BA 3UTCA 5BQ3A 5ENVA 3L02A 5CK5A 2LCQA 3PWKA 3QIAA 1K8YB 2P2DA 3FSGA 5KNDD 1JR3D 1DMRA 3OT4A 3FCYA 1C1HA 2FW7A 3NRCA 5EWMA 3V4FA 2D7DA 1PFQA 4NMMA 1TW2A 1VSUA 2EP7A 3B7GA 3EVFA 4FEAA 4IQ4A 1RZVA 4M1OA 3VHXA 1LDMA 4D92A 1J2RA 1F14A 1K2WA 4XM0A 1QP0A 1FF9A 4Q39A 3WJ1A 4WA8A 3ZDEA 2IY8A 5FAXA 1W2WB 4TMFA 2HUPA 5AW1A 3THXA 1I94B 1C5KA 5KUTA 3FR8A 1E2JA 1K6MA 5DBIA 4CTNA 3S81A 2XBMA 2NO7A 2ZSKA 2IXAA 3UCXA 4PLCA 2JLUA 2EX1A 3I8SA 4TLLB 3S2YA 2CLMB 3E9DA 1PNOA 3RTBA 3M3PA 2QTVA 3TLEA 1PSZA 1YS2X 4UKDA 1OU4A 4HPJB 3BRQA 1A98A 5C8XA 2WRZA 5AVQA 2WAAA 4PZ0A 2BHTA 1WBBA 5D5HA 1ZI8A 1YQUA 4HWPA 5DNYB 1LVUA 2I7CA 3GEPA 2GEJA 3ONDA 4JCCA 4O2LA 3NYWA 2JGRA 2OCIA 3CE6A 3A31A 1MDFA 1LBQA 4X1KA 3P9YA 3V8QA 5LMZA 1AHHA 3LF2A 2JAHA 4BZZA 1SULA 1SXGA 2ATXA 2C3MA 2V6GA 4I9NA 1Z0KA 4I4TB 4Q3NA 4GZMA 4RPGA 3SGLA 3O2SB 4E2XA 3A8TA 1X92A 2RI0A 3LHFA 1E6WA 1Z36A 4OFBA 4X5OA 2GI4A 1E92A 1TFUA 2NO0A 2I6XA 3GT0A 1PD0A 1THTA 2QRJA 2X2PA 1IJFA 3MTGA 1QVRA 4HLUA 4KQ2A 1ZITA 2HSZA 3W6UA 3D7NA 5JSQA 1LPPA 2QGFA 4MR7B 4YMTA 5MF6A 3GLIE 1FB5A 4ERXA 2Q5QA 2RH9B 1EVZA 4ZT6A 4YLYA 4CIVA 1JW9B 3EISA 1LDEA 1H4VB 4LDJA 2HYDA 4WKCA 1IY1A 5B2ZA 2BJHA 1QRSA 3RK4A 1FC0A 4PAMA 5DMHA 4B44A 1SCUA 5DBEX 1O4WA 2K4MA 1URPA 3JTEA 3LBAA 4OMDA 3PFBA 2OA0A 3U4MA 1O94C 1CB0A 3DHNA 5EE1A 1CUSA 1CUHA 4QGHA 3IJPA 1XOIA 2AWNA 2W2OA 4H1UA 5EGSA 4EGFA 3ORQA 4D9EA 1V25A 2VK4A 1IBCA 2QY9A 3KTOA 1LPSA 3NM6B 2DHCA 4FE3A 3B20A 3FFWA 1VL8A 1PFUA 1W9MA 4FMBB 2YIJA 1DP4A 3TNJA 4H2DA 5M29A 5KSWB 1YBHA 2COEA 3UPTA 4JI4B 3OEYA 2YHIB 2HW8A 4CWAA 4FOOA 5TQ2A 4F9EA 5E3IA 1NDHA 3RU7A 3SDSA 1YVDA 1LS6A 1MVOA 1X2BA 1UPCA 2CXOA 2W5UA 3L0OA 1D2RA 2J31A 1IB0A 3AETA 3IOYA 4UNQA 1S1CA 3KM0A 4JLNA 2PZGA 2IOFK 4M8NE 5BOSA 1KMNA 1JB9A 4U7FA 3OJXA 1D04A 1ZSNA 2HJWA 4RW0A 4ZARA 4JGBA 2GAIA 1EVKA 5G1PA 1ICEA 3DR5A 5LQNA 4XM1A 1GD1O 2XZTA 1KAGA 1SWVA 3TOVA 2QJTA 1T8WA 4IMPA 3WL7A 1L8XA 4Q0MA 1D09A 2H16A 3FUXA 4FIDA 1FFEA 4MDHA 3TR6A 2IS1A 3GGDA 2ZR0A 3RPEA 5DNVA 3TG8A 4Y6QA 2Q2WA 4FB5A 5I7RA 1CIVA 4UPVA 2FEOA 4BVEA 2AC2A 4DMFA 3NDPA 3MT8A 3SC4A 4NOKA 3KLBA 2B1JA 2ZUVA 4I2NA 3NDIA 4LISA 5CT6A 4BP9A 5EUCA 2OHHA 1F1BA 4PYQA 3VKFA 5CU7A 1VLMA 4LGCA 2VF2A 1PJRA 2QVXX 5F33A 4F8YA 1DQPA 1II9A 3U13A 1ZXBA 3P96A 5MGBA 2IYOA 4RVNA 3GLFE 3RREA 2OK7A 1X8JA 1DBSA 4MLPA 1JFLA 3ENNA 4IIEA 3VI3B 4YJGA 3JVEA 4OJNA 2IHBA 4LHZA 2E4VA 4CIXA 5J59A 1MEOA 2NYAA 1TQ8A 4P81A 1PK8A 5DU2A 3G9XA 4F8EA 1FDIA 4CCAA 3NHRA 4K7JA 5A5VA 4Q4LA 4F92B 2HMWA 2HMAA 2C77A 1KRWA 1MO5A 5IFLA 1GPNA 2CYAA 4YHHB 3JSAA 4QICA 4G3XA 1XROA 1ZIXA 2YX1A 1NW5A 3IT0A 1ZN2A 2ZWIA 4LK2A 1KMHA 1QUEA 3Q88A 1TU4A 3NIFB 5JCXA 2EGHA 4MWGA 1H9AA 2VKQA 2W2KB 3I9MA 2ZJFA 2AEFA 3CWZA 3NONA 2ZJZA 5DGTA 3IEUA 1LPOA 4H4EA 4RENA 2YOFA 2RFLA 1I8TA 1K08A 3EC7A 3I28A 5DH9A 3ZS8A 1TIPA 4GH5A 4EH1A 3OFVA 1M34E 4N5IX 4I9FA 4R1UA 1VSQA 2D06A 2Z5GA 1WBJB 3VR4H 1ENYA 4GX5A 4KPUA 2R00A 3C4VA 3LT4A 1UCFA 1EGQA 1R37A 5AXCA 4FHFA 4YPFA 3VKUA 4U7GA 3N7AA 4M1SA 3BQ9A 3KSBC 1TF5A 3W5AA 5JJIA 2W70A 1YZVA 1CEXA 5I7UA 1M6VB 4G85A 3CUEF 1CUJA 1EUDA 4JX9A 4LG1A 1GM5A 1M6VA 1XEFA 2FN9A 5JCJA 1NXVA 3PDIB 1OGJA 1N0WA 2GZRA 3BMXA 4KWIA 2V45A 1RLJA 4A1OA 1KC3A 3H0EA 4O5OA 3NUGA 2A7XA 1Z75A 4O8CA 5HYVA 2X4IA 4KXVA 4W1SA 3W8FA 1GUZA 3WL8A 4ZI2A 1J2TA 4CI0B 5I47A 2OEPA 4UBOA 1FVOA 1M7GA 4PTZA 1B74A 3CUUA 2PS0A 2J6BA 3HRKA 3I2FA 5IVDA 1KOLA 3R3VA 1KJ8A 4HFMA 1ZI6A 3DBRB 4TTIA 3ZBPA 3T1YB 4K87A 3ELWA 4EAAA 1Q1BA 5ADUS 2ORWA 5EJ8A 1DNPA 1D2GA 1T0PA 2HT6A 3CEHA 2PGIA 1G2QA 3MERA 4K81B 4N39A 3WWDA 4ZYZA 4MVJF 4C14A 5FTWA 1Q7TA 3DBOB 2CXXA 4JLMA 1ZOIA 4MYTA 3UCFA 2F1KA 3LVBA 5M34A 3UXHA 1IU9A 3DZBA 2JLRA 2I80A 2FMTA 4JJZA 5AHXA 4WK6A 1Q0HA 1XU4A 1SU6A 2D1QA 2IW3A 2VT3A 3C5VA 5L6MB 1JPJA 3VPDA 1YRLA 1VSBA 4MGEA 4HNVA 4AX8A 4L5IA 3M6LA 4M0KA 3M6AA 1DAGA 2GN8A 1YR2A 4QYWA 1EFPA 4TLMB 2VG8A 2IYZA 2H4ZA 1A69A 2JJQA 1RMYA 1KTIA 4EMBA 1FW8A 1H4SA 2C3UA 1RPNA 4KFRA 1C29B 2R6JA 1ZHFA 2NUBA 3MA0A 3TL2A 1PQ4A 4AQYB 2B7BA 1AHIA 5EVCA 5EY5B 5HVNA 3R0ZA 1J0BA 1E61A 2JD2A 2DWQA 2B1QA 3D6TB 4MR8B 4DG9A 3ZDDA 2OXRA 1M1XB 3PFKA 1GR1A 1U2SA 3OMXA 5JYEA 4I4IA 4ZXFA 2CUKA 3K70C 3UV6A 2WUFA 1T5OA 1QJ4A 5JDCC 3ZE8A 4QOHA 1IQRA 1EXNA 1PQPA 1DAFA 3OQOA 3HY3A 1EYZA 3HCPA 4XX0B 2CVZA 3LP6A 1ZQ9A 4H0CA 3AF2A 2Q9BA 4K9KA 2BFWA 4DG5A 2D59A 1DBVO 1DUSA 1WB5A 2H0RA 2Y4NA 2EX4A 4WLOA 4AUNA 3O73A 3R7NA 3VO2A 5BYKA 3MS7A 1NUHA 3EZNA 3O1LA 4DA8A 1I6WA 1YCGA 2BV3A 2ZLBA 4B3XA 1T8PA 5H3CA 2OP0A 1KDTA 1LWOA 2DQYA 2UYOA 3Q8LA 1EFAA 2O8DA 3HYCA 4EG3A 1K7XB 2GDZA 2GBCA 4M8SA 5EIAA 4CMJA 3D3JA 1BJKA 1G3UA 2P2NA 3G0BA 3DFMA 2OD2A 1GY8A 3MVEA 5G02A 2QYHA 3TLGA 3VHQA 2GO1A 3HKCA 1B3BA 3CEAA 1AJEA 2KJQA 821PA 2AJBA 4EX7A 3JRNA 4QNNA 2ZJ7A 1QDLB 3UA3A 5B1DA 3VGJA 1OASA 2VBGA 4GS5A 3NO4A 3GGJA 2PU7A 1EGVB 2GSDA 3ZCXA 4A3SA 4ER3A 5KQMA 5I7OA 2PCLA 2ONKA 4QQFA 4LE2A 5FULA 2X4LA 3LW8A 3OP4A 1GTRA 4ABTA 3JATA 4Y1GA 1DB3A 5IYZF 2HBYA 5JNVA 1PJCA 2ZBEA 1EP9A 2SBTA 1KU6A 1PI3A 3GT3A 2QMOA 3UYKA 5LQUA 3F49S 4CF5A 3S6JA 4X1IB 1AKVA 1GPYA 3B1ZA 3KCNA 2BGGA 4P35A 1A4UA 3E3LA 3S5JA 4YV1A 1T0BA 1T9ZA 5FWNA 4MA0A 2GASA 2EF0A 3C6KA 4ND5A 4PSVA 2QPLA 1PSWA 3RFFA 4J4BA 3A6JA 2W2VA 1E6KA 3KYDB 3SQOA 4RKRA 3TRDA 3RYTC 1N6NA 1V8DA 1GPJA 1XQ1A 2P77A 3TUIC 4GBMA 1UT6A 1XLTC 2R8BA 3LBIA 4LRYA 2QM3A 4MUAA 3EYWA 3PL1A 4OHBA 1WF6A 3MJCA 4X1KB 3VX4A 3DAGA 1M10A 1YB5A 4PTLA 4YJFB 1V16A 3MWEA 5COAA 3LGXA 3TPZA 5KPJA 1XA3A 2Z6AA 3LUGA 5F23A 1XAJA 3WNQA 1EE2A 3W7AA 1GU1A 3EGDB 3LPAA 5HZMA 2XT0A 2I55A 3PC8C 2CJWA 3HYSA 2OORA 3PUWA 2VNKA 3FYTA 3JQBA 3IAEA 4JJ6A 3DFZA 1V96A 1IZZA 1YD7A 4F6RB 3SR0A 2YZMA 2GAFA 2YXNA 3INTA 4YRAA 1EFHA 3L0PA 3VPCA 2D1RA 3B48A 3L0ZA 1OYWA 4I6GA 3VYTB 1JA1A 1Y63A 3CINA 3ROZA 3PJRA 1UFRA 2IS4A 3EPJA 3KQYA 2XIJA 3QX3A 1U6KA 3O3OB 3D1JA 3JAKB 3OPYI 3THOA 2F59A 4MQEB 3VNRA 4F1JA 1EFKA 4X00A 4Z0PA 4PLVA 5ALXA 4HZIA 1I14A 4EVQA 1OFUX 1V5GA 4GOXA 3PUIA 3KJZA 2J7PD 2QSZA 1SVSA 2V5VA 3GFQA 5HZKA 5H8WA 3FA2A 2CXRA 1GZ5A 1NYRA 3FRIA 5AUNB 4PFSA 2P3QA 3H87A 4MS4A 4CQNA 2BF7A 1Q12A 3A26A 3CFYA 3JVUA 2RAPA 3KL4A 3L6RA 4KZPA 4QOEA 3WJ2A 2DH6A 4HI0E 3FYDA 3F9IA 3JY6A 1J23A 3U40A 3VC3A 4KDEA 5DSTA 5AM3A 5TLSA 3U61B 5TGTA 1MABA 2ET6A 2EW1A 2I2FA 3IJRA 3OQPA 1ZVKA 1KE1A 1RXWA 2BR5A 4RZQA 3KPYA 4Y2SA 3WDKA 4CDGA 1KO1A 4EABA 1AB6A 1SQFA 1RRVA 4YS6A 2ZTUA 5HKBA 2B98A 4HKTA 2R1ZA 5FBVB 3COJA 4RSRA 2WI8A 1PR0A 1Y8AA 4HHEA 5HCIA 2GVZC 2RSLA 3ZWDA 4GO1A 1XCLA 1MC8A 4LDQA 4X3OA 4REQB 1ECJA 1NUAA 2QLFA 3I2GA 2ZBUA 3SU8A 1WEHA 5E6RA 5E9WA 3SXUB 2QAGB 1RYEA 2A1UB 1ZIYA 1K5PA 3FZGA 4B2LA 5IAKA 4AY2A 4J9VA 4RY9A 2Q0QA 1XZEA 4FYIA 4ALMA 2AG8A 4HS4A 4ONEA 3PWTA 1BZYA 4G5GA 4PLWA 3F78A 3TZKA 1T9AA 1K4MA 2WM3A 1RXSA 1V9SA 4R1QA 5C8YA 5AM4A 3OIDA 3WIDA 3BSYA 3ETNA 2P2YA 4YV2A 1J2JA 4ZT2A 4I55B 4OHUA 4KDRA 1N34B 2FPGA 1M1NB 3HBNA 1R0LA 4J2OA 5D6NA 5HZGA 2C5LA 4Q12A 4Q01A 4ZDWA 2RHBA 2FRDA 3CEMA 1XCOA 1P2VA 3C0KA 4RC9A 4LDNA 3ZLVA 2DZDA 4KIUA 3FOFC 2RHWA 4PW0A 1QH0A 3BVPA 3EZYA 4G09A 4J0GA 3KXDA 1XD2B 2VPYA 4RXMA 3CH6A 4NPAA 2B8TA 2Z98A 3DMHA 1M3SA 1FJXA 1WW8A 4RFSA 3U7QA 4U7HA 2YMMA 5EWMB 4KGDA 4KYUA 1UOOA 4P4NA 3U1VA 3GJ4A 1CZUA 1N5JA 1PFVA 2VJKA 1QHFA 2N42A 3RIEA 4YP7A 4BFVA 1WF3A 1PR1A 5D01A 3AK4A 1U2GA 3ASZA 3QSGA 4EVIA 7REQB 3ETGA 4LJRA 4H7IA 3BFKA 3C5WP 1XRJA 4WZBB 4R54A 3M6WA 2J3LA 2CL7X 3BJZA 3LC0A 4BQPA 1K8RA 1MUUA 1DAPA 1DDIA 2XBLA 4Q1AA 5J2TF 4LFBB 1JPVA 2EU8A 3DOCA 4GUAA 3RVQA 4DRXB 1JF8A 1C0LA 2GK6A 4UJ3A 4C03A 3TKAA 2BFBA 1W5EA 1G21A 1GGEA 2PEZA 2EC5A 2CY0A 2WAYA 2WPNA 3HN2A 1T5IA 4C0WA 1SBHA 4DUPA 1EUYA 3TVYA 2R8EA 4P7BA 3B3FA 5D3QA 1TF2A 1US8A 3RVNA 3IHLA 5A5DA 1NKVA 3GF4A 3QUTA 3BWEA 1GAWA 3L8GA 4JI8B 1OREA 4JZKA 2P7IA 4BFYA 1B41A 1N9GB 1X7XB 2P9CA 3TKYA 3LJKA 1YVEI 3I0ZA 4Z0NA 1RIFA 1JKIA 2WYWA 4HVCA 2D0PB 1UFOA 2E85A 1JEJA 2DF8A 4EKDA 2I4LA 2PA0A 2W6OA 1P0QA 1FP7A 1W4ZA 1WO8A 2AN3A 4X8LA 5I4KA 1KQFA 3K4HA 2POQX 5B7GA 1MKYA 4RZSA 1IZ7A 1EWYA 1Z68A 3OZXA 4J1TC 1U9ZA 5FUWA 1DBRA 4MWSA 1SK8A 5IYZB 3FIUA 2Z5LA 3UG7A 3I62A 1A5ZA 1CY8A 4LC1A 5GVSA 1T8RA 5DI3A 3HZZA 3JQRA 4EGSA 3G8YA 5A3JA 4J0JA 2N1MA 2ONYA 2W9XA 4AO8A 1L4NA 3LC1O 3KIPA 5CNJA 4JA2A 4M0MA 4BMCA 1RABA 4GVXA 4IEFB 4JT8A 2PQ0A 1EDZA 3ZQJA 2YVKA 4Z3KA 4D6XA 2BE9A 3U4QB 1SXHA 3WVNA 3AGQA 2W42A 2PYDA 5ALTA 3V6LA 3HKEB 4BV2A 4EI9A 2J7KA 2QTZA 5BOVA 5EXEA 3PKJA 2OO3A 1M2NA 3C3JA 1ATZA 5CM8B 1XDBA 4TTAA 4U6NA 3U5ZB 1ML4A 4ER7A 3KYIB 5AHKA 3QOYA 2ZAYA 5I8ZA 2H3HA 4JYMA 5AWFC 1H5QA 4DXAA 2VWQA 1CE8A 4CE6A 4RPLA 2IWHA 3RKSA 4PG8A 1L9KA 3L4KA 3TW4A 2Z95A 3L7DA 2C29D 1DKMA 1GUBA 3F46A 2D4HA 3ZU3A 1GFIA 1Y5IA 3AZQA 4JLPA 2PZKA 5BSGA 4JEUA 2ISSD 4G37A 4P7JA 5AR1A 1PWYE 1T2NA 3F4BA 3OJOA 3PPVA 4GLBA 3HDHA 5AUQA 4RULA 2E6UX 4CLDA 5LP6C 2XUJA 1J2EA 1JSZA 5IF3A 3NNSA 2OZLB 1X8LA 1FXWF 3CZMA 4AVYA 4LOIA 3HSSA 3ER8A 1W9HA 3OO0A 3SBDA 4A0GA 3RGWS 3F5QA 4TV9F 4PAQA 4YP1A 3U0VA 1DRVA 2UAGA 3N8KA 4KE9A 3UIEA 4AIIA 4H1TA 3WLSA 2H1LA 2CF6A 4HAVA 3WMGA 5LYJF 3DEAA 1NLYA 2WJ4A 2I6UA 4QUKA 3JAWA 5DX0A 1WUKS 4DKXA 4P4SA 4HOYA 2OVFA 2XJ9A 2GKOA 3B9RA 2YV4A 4KUHA 4QJ5A 3G5LA 5IJXA 4RKWA 1FEZA 2M6LA 2P4HX 1Y1TA 4NHEA 4ZANA 5HZHA 4WFJA 4IDOA 4XJSA 3D9QX 1XIVA 2JGIA 4KU4A 5MFZA 4M2LA 3IX7A 3M49A 3L1VA 2G63A 3MOGA 4BNUA 4N0MA 1S9DA 2AFHE 3ZDRA 2P5UA 3EYAA 1M6WA 3I9V1 4CT5A 1H0RA 4PRYA 2HCRA 2JHPA 2VYCA 2IU0A 3LTEA 5LDHA 3AEYA 1KQOA 5D3KA 3MXTA 4ENPA 1IXKA 1NNI1 3OFJA 2RC5A 3EW9A 4MKGA 3VKGA 1JQDA 1J97A 3QKRB 4JB0A 5CA1A 4FDVA 4HO1X 4EWLA 5EHXA 3EQ9A 3U37A 3DEKA 4O29A 3JQFA 5U4XA 3BHNA 2VZEA 3A1CA 3L0DA 3P5BA 2XQFA 5B64A 1AURA 2QRHA 3OCZA 4C6HA 3PQFA 2J9RA 3CZAA 1CZOA 1EWQA 4PYMA 2ZAIA 3N9IA 5TQ0B 2B69A 1HDEA 3I23A 1W1IA 5FRDA 1P7ZA 1G18A 4F85A 4JB2A 3QH4A 1HC7A 3E4CA 3BB1A 4RTQA 5BV8A 4RPHA 1AKNA 1ZK2A 5LD2B 1GNVA 4CM3A 4GPEA 1WVIA 4JXXA 3SYRA 5FI5A 1FSFA 5LQDA 4B7AA 2QLLA 5K99A 5FWAA 1MGPA 3QOXA 3O75A 4QTXA 3V48A 5F1YA 5DBHX 3RS9A 3URMA 3WK9A 1NMEA 1XWFA 1XTIA 2XNKA 4TV8A 5CEFA 1YB7A 2QVGA 1XQXA 4QVKA 3FMIA 5J63A 4JYZA 3ND8A 3ISJA 4IDHA 1CC1S 2V6MA 2P2ZA 3M4XA 4NENB 4O4LB 2GN1A 2WQ6A 3R9XA 5IAJA 2PWYA 5C31A 3NRBA 1S9HA 3SQDA 5C4GB 4YLEA 1B23P 3UXEA 1HL7A 5EPUA 4ZICA 2V4UA 1A7AA 3B78A 3ZI4A 2DUMA 5JQGF 1YKGA 4QYMA 2FMUA 3B6IA 4MCHA 4MZDA 5KDLA 2QLJA 3ZE0B 2IZ6A 3KJNA 4U00A 1V2HE 1EWRA 5AT1A 1E1CA 3WLMA 3PDHA 5K0LA 2G0NA 3U3RA 3QYPA 2YOHA 4MYDA 3K1TA 1L8QA 2I1QA 3KJQA 4NYJQ 5CTAA 5EXPA 5IHXA 2OV4A 3NZEA 3QRWA 4LC9A 5ALSA 1U2DA 5GPBA 3RS7A 1G0OA 2BZGA 4N18A 2YJZA 1PX2A 5CDHA 1GU0A 1D8AA 2ZPTX 1SA0A 1RI5A 3GUUA 4CV3A 2EHDA 3CSUA 3HDYA 4MLCA 4EEZA 2B82A 3UT5B 1UC4B 4GLJA 1P6UA 1PKXA 1N2CA 2LP4Y 2JJYA 2Q9CA 4JKIA 3DMYA 2ODBA 4R5MA 3WI7A 4DMGA 5NLLA 5FORA 3QUBA 4BBPA 5IC5A 4NNOA 1SZJG 1L9XA 3UICA 5JZSA 2WVAA 5D85A 1JR2A 1V8PA 3K1YA 1ZAYA 2GR9A 5JO9A 5I6DA 4AQDA 4OK3A 5REQB 4UOZA 3EVCA 3CVXA 3ND6A 4I7EA 4ZZ1A 4TXHA 4FIZA 1I6KA 4QVGA 2GEBA 3F67A 4O4IA 2YN0A 1E3IA 4F97A 4TKVB 1AD2A 2DHDA 3BXOA 1D8TA 1TB4A 3GLSA 4TLDA 2IL1A 4RM2A 3KOXA 3TAUA 4YAOA 1GOTA 3NNNA 3OCCA 1OB2A 2HN9A 1YBVA 4IIBA 3VV2A 5DBOA 1NR5A 4B6GA 1C8KA 5B53A 2Y67A 4Q4CA 4OLBA 1XCMA 4E94A 1CB7A 4URVR 1Z18A 3OQVA 4V39A 4WLFA 3ZHOA 4IIJF 4U0KA 1RQ7A 5K51A 5JBQA 1M2VB 3L04A 2QTTA 1Y7PA 2OFWA 4ZJYA 3H5RA 4A73A 3DHVA 3QA3E 3PL5A 2GRAA 1NF2A 4PN7A 1ZK3A 2YVLA 3OHPA 2JIMA 1RE1A 2V0NA 1G2PA 1TM1E 3MOIA 4JLWA 4Y67A 5CW2A 3UJAA 3WKDA 3WWYA 5BNTA 1JLRA 1HPLA 1BH6A 3QM1A 4RMNA 2G6TA 3T1QA 3RADC 3FETA 3HA2A 4P9NA 4MUKA 4PANA 4WI1A 2WMYA 2VF8A 3DCIA 3Q40A 1RJDA 4W5WA 1JH8A 1QRAA 4DMLA 5JECA 5JASA 1QGED 4L4XA 5JAPA 5U9CA 4Z4GA 1UXKA 3COWA 3WK5A 2E55A 3PU6A 3I6YA 4P3OA 1GA6A 2YZGA 4UHJA 5M3BA 5B55A 1K6XA 3BIFA 4CM8A 1I13A 4IMRA 1X1CA 1INLA 4EHHA 3KQKA 4FWIB 2QE7D 3GJ6A 3HLTA 3SQLA 2NACA 4XQ9A 4Z53A 3MTQA 1XDUA 5AFSA 1JI3A 3FMFA 2JHFA 3N0XA 4ES6A 1JIJA 3F6RA 2ZQYA 1HE8B 1KC1A 2BTQA 1CUZA 2J3HA 3Q0IA 2VCHA 4I4TF 4OL0A 2NZXA 3VR1A 4DVGA 2EP5A 3DNMA 1QZTA 1S02A 4TPKA 5TDHA 1NBME 1R0WA 1CBUA 4ZVTA 1TTTA 4GYYA 2WNSA 3RI3A 2OCGA 5EKDA 1P7VA 3ZCSA 1P7CA 1T43A 4XWYA 1XTQA 1X1RA 3QEBZ 4C04A 4LBZA 1ZIDA 2ECOA 5I4CA 3A11A 1QP8A 3BBPA 1XZDA 3P7MA 3DZHA 4BN4A 5HUJA 1JG1A 3K9NA 5DXJA 3Q98A 1NHWA 4B6QA 1Z6XA 1L7RA 2CD7A 3IHKA 1WXWA 2YMPA 3EXAA 3W78A 1B26A 2EZ4A 3MW8A 3JWJA 1JA0A 1VL5A 5ICFA 1NIJA 1ZJ6A 2ZDHA 3PXAA 4IY1A 4FEGA 5D3MB 2Z30A 2Y1LA 3NATA 1IDN1 4GX0A 4YP6A 3UB4A 4NABA 4M7OA 1YI1A 4IIUA 3GLGA 5BRNA 5HIMA 3V42A 3F7OA 1OXKB 3IERA 3K2IA 2C2ZA 1F5NA 3MOSA 3CR8A 2J3MA 4XDYA 4B9EA 1N6IA 3T3GA 2DR2A 1ZU5A 2P65A 1J0DA 4I19A 4NV1A 4MUMA 1NBHA 2QJRA 2XA9A 2CJXA 3LCMA 1CUGA 1N75A 3OFSA 1CZNA 5A3SA 3TBFA 3UK7A 4G5HA 1AVTA 2UZ1B 3CLKA 3NXSA 4DIBA 4DDUA 1MB0A 1RZUA 3ZKWB 3CNLA 3IUBA 5CPBA 2ZR8A 4M1QA 2G82A 2RH4A 1O58A 4O4LF 4CM1A 5EXDA 1NE2A 4IKPA 3G2QA 1TJ4A 4PZLA 3GELA 4RWZA 4GPTA 2H7YA 2ZJ8A 4BBJA 4PLTA 2YN2A 2NUPB 3BYZA 3PEWA 1MRSA 1QE3A 4F72A 1Z12A 2VWHA 5A4KA 2YRXA 3H2GA 4BVLA 1IFXA 5EINA 1HZZA 4S2UA 3T5AA 3HEAA 2XGSA 2PRJA 2EATA 2J6HA 4MUEA 5EGNA 4MJ7A 3UEOA 1TECE 3R3ZA 4A0RA 5C7OO 4FNMA 1WBDA 4BC1A 3KQNA 1Q44A 3ZX4A 2JFPA 1A9XB 2ZB4A 3OJEA 4R3UC 3TJRA 3CLUC 1WP4A 2ZTLA 2P91A 1TK3A 4GFDA 4L02A 3WYFA 4ZVLA 2AG0A 3GDHA 3HH8A 1W5FA 2QMYA 4BFLA 5JG7A 2BMDA 3EFEA 4H0NA 3OE7D 6AT1A 1LEHA 5FX2A 1JVSA 2C7OA 2YV5A 4G86A 4DSAA 5CH5A 5AOAA 2GFHA 1C0KA 5JS7A 1QH8B 4QZVA 1K7FB 1KJQA 5LBTA 3NDBB 3NHMA 3OLZA 1DGQA 1GGNA 1MD9A 1MMFB 2XLCA 3N8IA 3IIKA 4PAGA 5AKJA 2DB3A 4JJ7A 1F4LA 2HRCA 2BDUA 3NW9A 4RADA 4BGUA 5DB4A 1ATIA 3DAFA 5AOCA 4PZ9A 1HE3A 1Q1EA 1S5PA 3PUHA 1C9NA 3JS5A 2EVWX 2AMYA 4CEIA 1ZHHA 2KM1A 1DRJA 4AP5A 3N74A 3S40A 3WNVA 1G38A 5MHTA 5EJ7A 3O4JA 4HD8A 1UZUA 1J25A 1AUOA 1ZR4A 1Z9BA 4DR7B 1L5ZA 4IIVA 4LZNA 5K4AA 5JD5A 2HK6A 5ARCA 1RWQA 1N2ZA 3NCTA 1ZLXA 3KJGA 4QD3A 3N2GA 4R9RA 3ZHZA 1AXRA 4DGQA 4Q18A 2YS6A 1JSLA 3PQDA 4LJ6A 5TARA 1B43A 1R5NA 1TMKA 3KJIA 5DGHA 1VBKA 4BNYA 5L3VA 3Q7RA 2FFRA 4TVKA 3VSBA 1GZ7A 1XV5A 3AHIA 4J07A 2EZTA 4L4ZA 1J5EB 1IY8A 3O9MA 4ZT7A 1DOHA 2FWAA 3CF4G 4PC2A 4ZMRA 8GPBA 5ADWA 4DV4B 3Q5DA 3LK7A 4KQMA 2FR0A 1KJNA 2C4VA 2BM9A 3JWGA 3ZG6A 1Z6YA 3MAGA 1RCUA 2NW6A 5BQ5A 3TIVA 1XMPA 4RIHA 1FMLA 1LBEA 2NV2B 2B94A 3L6OO 5BVHA 3FNFA 1HFEL 4M88A 3KYBA 2R9VA 4F84A 1GTVA 1C0IA 1IPEA 3OHSX 3IDFA 1DEAA 1NWHA 1T9DA 2QTRA 4DVJA 2QPTA 1D2NA 2MSCB 2XYHA 3DO5A 4M55A 4Z54A 1SU8A 1WUHS 3HJAA 2J9ZB 4GVPA 4WACA 2H18A 1UZNA 2C4TA 3Q7SA 4JHLA 2G28A 1F8GA 1NBIA 3TNDA 4KXMA 1OE0A 4BCDA 2ZUEA 1HYEA 3OE7A 2JAWA 3D2AA 3P9CA 3UH0A 1CW2B 2X42A 1CUBA 2GZSA 2ZIEA 4OVKA 3LA6A 4OYHA 1YC5A 2DOKA 3WLQA 4YDRA 4P2GA 2ZSJA 3IXLA 1Z13A 2OZVA 4PG4A 4DC0A 4JNKA 5G1NA 3UAOA 4AN1A 3G13A 3IQXA 4M1KA 4X63A 5LQCA 2NLOA 3W6NA 4RH3A 2JCVA 1GG2A 4DQ0A 2JBWA 3BWMA 4F7DA 4CCYB 4F3KA 3DR3A 3A7DA 3QU7A 1H5UA 5BW6B 5FA5A 2XGMA 4EYSA 4DPKA 1RXEA 3TOSA 1MA0A 2GPSA 4P92A 2C00A 2HXSA 1BMDA 3IEPA 4RA6A 4CKBB 1AMUA 2PUHA 5J23A 4GBGA 4LYDA 5E1DA 4L73A 1OWPA 4YCCA 1NNSA 3RR2A 1EGAA 1QPGA 1G2IA 2GWHA 4HDMA 1ZL2A 4F8JA 2VJOA 2ZROA 4FFRA 3TBKA 5ICMA 1UT5A 4RZ2A 2ZXUA 5DX8A 1QQTA 1Z45A 1L4GA 3CRQA 4Q9HA 4DCUA 1TEZA 2JIQA 2OCPA 2QQ5A 3ON5A 5KWEA 2X7JA 4ROTA 4TLAA 1E3SA 2FWJA 1U1IA 5DWQA 4B4VA 1AM4D 3JU3A 2RHGB 3HPQA 1EFPB 4HNAA 3A04A 1ZBDA 2PA3A 3N3AC 2OM6A 3ZLUA 4S05A 2C9BA 1K0UA 2JI6A 2YWGA 4JC5A 2V7VA 4L3WA 1ABBA 4FXOA 4HUTA 2QV7A 4LAFA 2OXIA 3ZWCA 2QU7A 3VR6H 4KNVA 1PNTA 3KX2A 1E98A 3A1SA 3IDSA 3KJXA 2B35A 2FJUA 1ZH2A 4K03A 2C97A 4E33A 2A5LA 2BFFB 4XLLA 3WGJA 2C20A 1O95D 3TAHA 3GDFA 3Q3GE 1PG2A 4WXMA 4B35A 1GRCA 4BYGA 2QR3A 3KC2A 1JHUA 1A4RA 4EFMA 3KSRA 2PANA 2XKBA 3QITA 2PD4A 1E9FA 2VTBB 1P9LA 3JR3A 2PBFA 5HQ3A 2VQSA 4DMHA 3VSEA 3ZEIA 3CIOA 3JD1A 3TVTA 1EDBA 1O0SA 3K0BA 2WTNA 3ROMA 4L2IB 4WA7A 1OBHA 3KSUA 3INYA 1W4CA 1WL8A 2B1GA 3HY6A 4V0LA 1V8FA 5MN5A 4OSPA 1P1CA 5E7MA 1LS1A 4UJ5A 3A10A 1X80B 2X19A 1YKFA 4WKNA 1CF4A 5B7QA 3E1KA 3MPUA 1DWOA 3KSDO 4L4RA 4E46A 2PX0A 4MQ6A 3OWXA 1XC7A 2HTEA 3RC8A 3GVCA 3LNTA 4BB6A 3PVCA 1HKHA 2YDYA 4KGZA 1VL2A 4RORA 3B9BA 1KVQA 4BWFB 1VCMA 1L7VC 3N87A 5BSVA 3GZTB 4PHTA 2A1UA 4EPXA 5HPYB 4KR2A 4P0QB 1QGOA 3HU5A 1LDBA 2HK8A 2GM4A 1XN4A 4Q37A 1Z38A 3DNFA 3SKXA 3NIGB 2WKPA 1CP3A 1IXZA 3OQJA 3CNNA 3PJDA 4MV0A 3N7TA 3P9PA 1G3RA 4JMLA 4II7A 1NN3A 1Q2XA 1X9HA 4LCBA 3UFXB 4PN3A 2P1ZA 4EJ6A 1IMJA 5CB0A 4GECA 1RWKA 3LT1A 5K0TA 4CIYA 3CLRC 2JFNA 2IODA 3HCRA 2E21A 4XVUA 4OBWA 3TVDA 1C4OA 3RNOA 2R7LA 3UAWA 3AM5A 2G5PA 3P19A 3UJDA 4PWZA 1P1RA 1QX3A 5PGMA 4WNYA 4BB5A 4DSNA 2NADA 5JFOA 1UFQA 2GNPA 3QJ5A 4DC9A 2WNHA 3DNPA 121PA 2VJYA 1G6KA 1TTPB 4BQRA 3JQDA 3O3CA 2WYIA 5CXQA 3PF8A 4EB0A 2Q07A 3ZYCA 5BN1A 2DLNA 4RJJA 4HG2A 3AR2A 2D5IA 3ZN2A 2J4CA 2GH1A 3GL9A 3SHOA 2HREA 3ADKA 5AJZA 1LI7A 1YUBA 2ODNA 3J7AC 2O7SA 2JGFA 3QWIA 4ITVA 3P9XA 3W2IA 1SVLA 1U2PA 4NDNE 3ZI0A 3ZWPA 4DMCA 1QP4A 4FYHA 2FKAA 4GDFA 5EA2A 2WVHA 3H7IA 2HLNA 5AM2A 1SM4A 3IH5A 4LZLA 3FHOA 1DAIA 3T7CA 4TRRA 4IXWA 6LDHA 1UMDA 1W7AA 1CTQA 4DARA 1ZFNA 3D6FA 3HXMA 1GFZA 4EENA 4LXXA 4PR3A 2BP7A 2B36A 1P5RA 4WJKB 4UVGA 1F17A 4NHOA 4DANA 5GY7A 2R8PA 3ZVRA 3FPJA 4R8LA 1LBSA 2DKNA 4JT4A 2PUBA 3M9XA 3W1WA 4QWWA 4LDZA 2DSTA 5LQMA 4CLEA 4DWJA 1OLUA 3RFTA 2D5AA 3DMGA 4KXWA 4U63A 2CLCX 1T4CA 2EYQA 1VGRA 4A2QA 4BV9A 4W9NA 3OE4A 5G3ZA 1EX6A 8MHTA 4YRIA 1OCEA 1DC6A 4L1KA 4BX9A 3E81A 3LY5A 4ZMSA 5CT5A 1S89A 3MJSA 3UPUA 2C42A 3OJWA 4FZVA 2DCMA 1KMCA 2BL4A 1RI1A 1KJ9A 1X7YA 1VIMA 1OXMA 4NDAA 1CFZA 3ZX5A 3EFHA 4X3PA 5E4TA 5AW6A 2G76A 1E59A 4UBMA 4YH1A 3UC9A 1XLUA 4U4AA 5BXYA 3FOCA 1S3SA 3R5KA 1KXZA 2AZ4A 3P2OA 4ZU3A 1DWUA 5JD3A 5K0NA 1QCZA 3UVEA 4FVTA 2XB6A 3QU9A 4B3JA 1QYCA 1IQPA 1Z6TA 2MWMA 3H1FA 3QFCA 3ADPA 3MJ4A 3ILYA 3U0BA 2EQBA 5GADl 2CNKA 1UDAA 3L41A 3ESCA 4H59A 2BBTA 4CHTA 3EOZA 2HHJA 3TOZA 1J49A 4CTJA 2BKEA 1K86A 3OSZA 4D2IA 2DLDA 5HF9A 3GFGA 3LKZA 3LT5A 2YHAA 4LRTB 4QT0A 2EQAA 1NN0A 1U0LA 2XVAA 2CXNA 2XPCA 3KSZO 1T5DX 1RQXA 4I55A 1WVGA 2VIIA 3ECAA 5G0TA 1OZGA 3B6EA 3DOFA 1YCHA 2GXQA 5DGXA 4DQDA 1BE1A 4OX9Y 3GEBA 3U3MA 4DHEA 4HH0A 4HTFA 3FYCA 4MAFA 2OUKA 3GMTA 4YTEA 1BTOA 1P2DA 1IHDA 4NBUA 5HKLA 3L9XA 4L8YA 1E3EA 3R1IA 1LF0A 3Q8XB 1AKWA 2VP9A 4YASA 4YCSA 3GLGE 1E3WA 5GJCA 5L4SA 4OHMA 1QGUB 2OQ2A 3KSMA 1DADA 2CLLB 2C5HA 3M9LA 1XSEA 4XTRA 3NIBA 1XMIA 4EY4A 1HLPA 2BZ0A 4RK5A 3RFVA 4ID3A 4GEKA 2HSWA 3E2IA 3O1JC 3RF7A 1WP9A 4BMNA 3PXDA 4CR6A 4L16A 3OZUA 1G5PA 4MV8A 5KAMA 1JHMA 3DKIA 3VJMA 5BWBA 3L7BA 3MTIA 1O4VA 1VKOA 3VVCA 3VNAA 1E5QA 4R1LA 1R3DA 1QO0A 4EJSC 4DV0B 2XDYA 1OI3A 4YUXA 4ND4A 2HCBA 4WQMA 4AL4A 5K3CA 1EHCA 1WU8A 4G8BA 4PVDA 4QYXA 4F11A 5JD6A 1E9VA 1DEKA 5JCOC 1WXIA 1J5XA 4Q1DA 5KOHA 3ENWA 5L45A 3QVGB 4QBGB 3RWBA 3K6KA 2Z83A 3KALA 2PRZA 3RVOA 2WQ7A 4CUZA 1RZRA 4YEDA 3M1YA 1FPMA 4UBJA 1DI0A 5DK4A 2Q50A 2Q5CA 4N0EA 1JMVA 4R41A 4DADA 1I4DD 1T6BY 2TECE 2W93A 1BVRA 1NSYA 3OSUA 4PGAA 1RPAA 2IV3A 1MTOA 2A5GA 4XE5A 1E5DA 2OESA 1ORHA 1JZSA 4N6OA 4A6XA 5FL3A 1S2DA 1Q0UA 2PSDA 3AEXA 3RIMA 4ZRDA 3VKVA 3N2LA 2GNAA 1PW7A 4GD3Q 1C7RA 3NKVA 5IBPA 1FNMA 2GJ9A 2F9MA 2VOJA 4KQXA 2ZTSA 3L7OA 3EXIB 3KPVA 3BH6A 3OX3A 4P93A 3RJ5A 1L8AA 1USVA 1KOGA 4QAJA 1YRHA 5JD4A 2C2KA 2KPOA 3OIFA 4TYWA 1ZCBA 1NXXA 1X7WB 1GA1A 1XRMA 2GZAA 2RG7A 5JZMA 3IXMA 1UDBA 2HSDA 4FSXA 4ZC8A 2P41A 1Y6FA 1TCAA 2AT1A 2FN4A 2GM9A 3MMZA 4O59O 3AVOA 4MXDA 1Y9EA 4YRTA 3KQHA 2WIGA 4AZWA 4PYKA 4E15A 3A9CA 3AOEA 4HNAB 4P3KA 2XJ4A 2NAPA 3AHGA 1YJ5A 3MMSA 3NBAA 3OQIB 1IK4A 5AIBA 2OORC 3FKJA 2I33A 2M6KA 3FG9A 1X2EA 3ZYZA 3PHBE 4GRAA 1FCJA 1ZWLA 3I3OA 2ECPA 2CNWA 2KLHA 5IUJC 3MNFA 3C1TA 4XCQA 4RD0A 1XI2A 2ZAOA 2EOAA 1CE8B 1GJRA 4KWTA 5BR7A 4JA0A 2G06A 1FFWA 3AOGA 3RASA 3U9SA 4CIDA 3IIJA 3CG4A 3CH4B 2FEAA 2XMDA 3QOWA 1RACA 4WCFA 1RM3A 1HSZA 2D1YA 2Q6OA 3QLJA 3QTTA 2PSEA 5I48A 2GHQA 3VSAA 5TVGA 1T6YA 4YRCA 3PNQA 2ZTHA 1JDTA 3EXHA 3PHJA 3CZPA 3OCJA 5HQ3B 4JJ8A 1SCUB 5KYTA 4H77A 1R10A 4GX1A 1WZUA 5HILA 3HTXA 1ZH0A 4AY4A 3TO5A 3GFTA 1RI3A 4MPRA 2QMHA 4GOJA 1YGPA 1MG0A 2O6HA 5JS8A 3IEMA 2FJPA 3LPMA 4Q48A 5FYQA 3E9ZA 2YHSA 2O20A 3ZD8A 2H5LA 2C5GA 3MBOA 3K2EA 4HPWA 5DCUA 3SQMA 2C2GA 3X1MA 4BNMA 4EGCB 2O48X 3KKQA 3CVWA 2ESRA 1MX3A 1C9DB 1AXGA 3BTSA 3M6VA 1ECPA 4GPZA 3SIRA 3UUGA 1GTSA 2UUAB 1JYSA 1H85A 4S1WA 2WZQA 3KKZA 2CLHB 5BSEA 4K9OA 3E1SA 3BH0A 1ZCZA 4M0CA 4AS2A 3STYA 4LMAA 1W52X 3DEIA 3ESBA 3HJGA 2NQTA 1U80A 4KFUA 5AVJA 4E2ZA 4Z4FA 5HE9A 1IPHA 4K8RB 2ZS9A 3AU9A 4WH0A 1H9BA 3EVTA 4QM7A 4MULA 2B8EA 2VBIA 3K0KA 1L4MA 4INAA 4E3WA 2ZJ6A 3UOGA 3BK7A 3OQ1A 5A4DA 4PLFA 5I9IA 1OLOA 1FFCA 3TF5A 3M5DA 2XUKA 4J49A 1F0PA 4KH1A 3OKFA 4WBXC 3V8MA 2X1LA 4UD2A 4ERNA 2G04A 3AUJB 3D31A 1GITA 4Q7MB 4HXYA 4RH0A 2XTNA 1YTUA 3BEOA 2WWWA 5CITA 3SR3A 1GL6A 2AXQA 1Y3HA 3AO0B 4XGQA 2ZRFA 1YQWA 3E23A 3DV9A 5ERYA 3QU4A 3AI3A 1MAUA 3PNPA 2OMEA 4U3JB 3E9MA 4Z8XA 3GG9A 3WO1A 5GGXA 4FYKA 3HYRA 4K26A 3ASUA 2HJSA 2WDZA 4J0CA 3IE2A 3ILSA 4TQGA 1S4MA 3BXZA 2WD7A 2XNHA 3U7FB 1R00A 1OC2A 2ZJ3A 4LRQA 4OHCA 4PAWA 1RPJA 2WK1A 2XE8A 3U39A 1NXOA 1EUCB 1KETA 1L5QA 1RD4A 1V3TA 2P9TA 5AJWA 3SI7A 2H54A 1NNLA 4DA7A 3VGPA 3UQYS 2DYKA 3HSYA 3QPBA 4II2A 4WERA 2HMUA 1C3XA 1VBFA 5ILGA 1RS0A 2W2XA 3UB2A 3L8YA 4WJZA 5H3HA 1FQOA 4ZQEA 1O03A 3KEGA 4GOMD 1R0CA 1L5NA 3GY0A 1R6BX 4LKOA 5K7SA 1Y80A 1N33B 2AIRA 3AXSA 1D0VA 3KAKA 4HGQA 2HCTA 3ACCA 4JBLA 4NPCA 3TCXB 4X90A 3NBUA 1XD2A 1BAPA 4MQ4A 4PSAA 4EI8A 3UUEA 3ME5A 1DAHA 1ARZA 3QBEA 1PHPA 1AKMA 1YDGA 3UXYA 2ZE8A 4U2BA 2QJWA 3GXOA 3VJKA 3H1GA 1UBEA 5GONF 1A77A 2ZI9A 3GFRA 3USES 1J0CA 3IDZA 3RS4A 5FFNA 2X0RA 3BPSA 2HAEA 3WE7A 3FKSD 3OO1A 2YJGA 2IX3A 2FY8A 1SUAA 3C6MA 3OF3A 2D0DA 4LZWA 5C1OA 4FP9A 5JCJD 3EIHA 4ZQCB 5B2EA 1PJ2A 4Z4IA 1I7LA 1JJ7A 3GJXC 1TQ6A 4XUGB 1MJ5A 1N9KA 1Z82A 4HDAA 4O4HF 1YTLA 3ZJ5A 3V7YA 4DIFA 1PT7A 2ZBVA 3B51X 3GNQA 3WGVA 1W85A 1QYIA 1E1CB 2I3AA 1JYEA 2EKBA 1UUFA 3NAMA 2ILVA 3S28A 1MRZA 1TXGA 1SB8A 2PFSA 5AKLA 1YS9A 2E4XA 1U04A 2WBLC 2WG0A 3BBLA 4GMGA 1V6AA 1YB4A 1LSSA 3FPGA 5L7YA 4EY7A 1F3OA 1OYOA 2FX5A 4IIGA 1LTKA 1RCTE 3KDSE 4C1BA 4A15A 1V9CA 1L7XA 2Y0BA 4BNVA 4W4TA 3IOBA 4W5OA 4GBED 2AJLI 2CVOA 3ROTA 2HJ9A 5JEEA 2W6ZA 4PSDA 4IILA 1YFZA 5I9MA 1ML3A 1GQSA 1WKBA 3C98A 4U7DA 2A0YA 2A94A 3PDUA 1OFUA 4PC6A 1MT0A 4L5AA 4C5BA 1DINA 1JIXA 1RKQA 2O0LA 4P54A 3T94A 4XR9A 3CONA 1WLYA 1ZJJA 1M0SA 3E18A 5FXMA 4AN4A 3ZDBA 3D6HA 4MWEA 1PV1A 5FT9A 3HJHA 1ZJYA 4UM9B 5DZSA 2JNWA 3LQKA 4RGVA 1E3LA 4COKA 5LN1A 3KRTA 1KO8A 4N47A 4Q3EA 5B3KA 1EK1A 2QXYA 3GJQA 4MO9A 2FTKE 2WUGA 1VLJA 2YJTD 1UL1X 2NG1A 4FLFA 5CLGA 3F5DA 1J8FA 3O8OA 3OM8A 1KI1A 4N0QA 1LCIA 5KYVA 3D3WA 4EY5A 3HV2A 5JI3E 3I1YA 1NHGA 1TJPB 3C7TA 1XXLA 3HXLA 4LHYA 1J00A 3S2ZA 4C3ZA 5LZ2A 2WD9A 3DUFA 3DBLB 1I4LD 4P36A 4UUOA 4DN6A 1CUDA 2G8LA 1SUWA 3LW7A 5BT8A 3CLTD 2PGJA 3RODA 1NX6A 1YFLA 4KSYA 3H2YA 4I46A 3KVRA 4OXRA 1GSOA 3L18A 1IXSB 2ZM6B 4GRDA 4OB8A 1HE5A 5DHSA 3G5UA 3OFKA 3OZGA 2HQBA 1K68A 4F2PA 3LXMA 1YHYA 2I6FA 4TTJA 4LX8A 1CY2A 3DJYA 2AEJA 4JKYA 1K27A 4ZCLA 1JAIA 3A9RA 3K9BA 3W6PA 2PXCA 4ZO8A 3VZRA 4GR4A 4ADSG 4CM8B 3TQOA 3Q6MA 1C8VB 3F1KA 3OF5A 4E22A 1QVZA 4MWDA 3DOJA 3TJMA 1G9SA 3OQ6A 1IOVA 1O8BA 3A3PA 3PHHA 4XFDA 3ZIAA 3S5UA 5DO9A 4LF4B 1CR6A 1C7IA 3CISA 3K0AA 3MLAA 5ER6A 3H4TA 2R00C 2AEMA 2HLDD 2V7PA 1L7EA 3TDMA 2WNIA 2J0UA 3DTYA 1E3DA 3E3AA 4KWHA 4V03A 2VFAA 4DBLE 4DCPA 3G8BA 5BWMA 2CC2A 4FMCF 3PGA1 3GAAA 5EOVA 3NHUA 2JFYA 3QENA 1CJVC 3DO6A 3X43A 2WKQA 1OIWA 3A37A 3LLSA 4DQKA 3DOIA 1FTNA 2QMEA 3WRYA 1ZY2A 3TQHA 3E61A 1NF8A 2AVDA 3SJUA 3LRPA 1ODTC 3GRPA 1UBMS 4OV6B 1O3YA 2NO4A 3G5MA 1JLHA 1VDZA 2VK2A 2Y0EA 1LK7A 4HCJA 3AC0A 4C4TA 4IZ6A 5JC1A 1NI4B 2DPMA 3QXXA 3R5XA 2ZRMA 3S1LA 3QPWA 3Q9SA 5CHEA 4TYMA 3K8QA 4EUNA 2NPFA 4AAYA 4BE4A 2I7VA 3HUEA 2GA8A 3IVGA 1CZKA 4S35A 4JCOA 4C4PA 2HK7A 1TYZA 4DAOA 5IC4A 1UJ4A 4AS1A 3R3XA 4OHOA 3LVFO 5IEBA 1X7WA 2PJRA 3IFSA 1Y1LA 2O0JA 2H2AA 3V80A 4F9GA 4B09A 4GUDA 3CLSC 1UQUA 4WLEA 3G2PA 2AW5A 3JQCA 4OREX 5DISB 4TXMA 1VRVA 3PICA 1D5WA 1IM2A 2AQHA 4H16A 5K20A 1C30B 1X7ZB 3TCKA 5GZ1A 3M34A 2JJ1A 1YVRA 1A8QA 5BQXA 2CJYA 1KK1A 1MA3A 3T1OA 1N8NA 2Z08A 4UDXX 1OAOC 5FBWB 1ESMA 5F2NA 2B4QA 4MQFB 1U2QA 2YRFA 3QMPA 4N7BA 4Y2GA 1J70A 1FL9A 4XWWA 2ZRBA 4B34A 2GTIA 4MIOA 1ZKMA 1CZRA 1QORA 5K6TA 4EO9A 1VBMA 1M1YE 3HBJA 4G89A 3HBFA 2ZJ1A 3AUAA 1AN0A 4A9AA 3F96A 2AHOA 2Z4SA 3AY7A 1QCCA 1FX0B 3WGNA 4OJMX 2QPAA 3PDJA 4DOMA 3U3JA 4A5OA 3U44B 4FJ0A 1I4WA 4WCVA 2EW8A 1NBMA 3W06A 4F93B 2P69A 4YECA 2YNMC 1YZHA 3IP6A 1JNYA 4LGYA 4RABA 2H0AA 2H00A 2AE2A 3LZCA 4O4LA 4NENA 4BRZA 4F5DA 4I1IA 4QLBA 5C4MA 5DDIP 3KVVA 3WB1A 2QTFA 2HJVA 5ETJA 1XNGA 1YDFA 3WL5A 1R64A 2N9UA 2DECA 5IT9A 1D7AA 1FW6A 2QTWB 3V46A 2NYVA 1N6KA 4NG4A 4BFUA 1XHFA 4LJ5A 5BUCA 1QLHA 3AEQA 1QVWA 1RRKA 4MHSA 4ZHQB 2V4ZA 3AMVA 3RSOA 1I3NA 5E6SB 4PFKA 3VPFA 4DNPA 6PFKA 2FZCA 2NZUG 2O07A 1ZC3A 2MSDB 3LSTA 2JL1A 1W73A 4L9AA 4N7MA 4DYVA 1MR3F 2FPGB 3WYCA 2OYRA 4B32A 3Q1KA 3DGFC 3RE1A 4EGAA 1MXHA 3C8DA 3DEHA 2VDUE 4KLRA 5CNKA 5IJAA 3GHHA 2CFIA 3FM9A 5AOVA 4MVJI 3WYNA 3GRCA 3KUCA 2IYLD 4UTVA 1P7PA 1TVCA 3AF4A 3GJ0A 2VJQA 3RRMA 4BQIA 5BV1A 2HX1A 5L3QB 3OOSA 2VS1A 3KQPA 2JA1A 3HVJA 3QKRA 2F00A 3ZZ0A 4U2KA 3BHJA 4YUVA 4AULA 3U6BA 4J7CA 1R8YA 3MSXA 3ZCVA 3LPLA 3HKBB 3OM1A 4JSYA 3E48A 1VKHA 1R0SA 1RQGA 3S2UA 3AYZB 1KRHA 4HATA 5FOTA 4Q1BA 4XLZA 5A7GA 2MOKA 5G2OA 4KHPB 3UAVA 4P5PA 1IAQA 3QHQA 1Y48E 1ZRMA 5H5JA 4FYWA 2AKYA 5FP0A 3LNCA 4WOPA 1KWKA 1MIOB 1SC6A 2AJ8A 4OTZA 1VG8A 3HKCB 1AQ6A 5A0VA 4DWOA 3TZBA 1QLWA 3CKLA 1DRKA 4R1SA 1KVUA 3WB9A 2WHPA 3FB4A 1CDOA 4CM7A 1QMGA 2NZJA 1BCSA 2BSQA 4GKVA 1D6SA 3H13A 2ZS8A 2R8YA 3K0SA 1LDGA 3FTQA 3OQNA 3T7IA 5E4FA 2ZT8A 4FHDA 4GICA 2O0KA 4M7PA 2W8ZA 2INGX 4L8VA 4HYQA 3TLBA 3ZGXA 7AT1A 1SEVA 1OR8A 4TTQA 4JC0A 4IV5A 2J9XB 4DXDA 4FFOA 4F56A 5E9JA 4CLOA 4A26A 1IWBB 3KPUA 2YV2A 1VP3A 1KOJA 4KZKA 4RGYA 4TKUA 3WWEA 1ICIA 3RT7A 3PQ5A 1DDOA 4EY8A 4B7UA 5IJ9B 1UWKA 2NZYA 1EFUA 3KFXA 1QCDA 5C34B 1J39A 4I1SA 1XEXA 4AIRA 3R6TA 5J1TB 3FAZA 2MMGA 4YIKA 2VXBA 5EMNA 3KQSA 4LSGA 4DUGD 3QX9A 2CWDA 3GFOA 3O8DA 3IIEA 5BSUA 4I81A 4E03A 2QA5A 5IAOA 2YVAA 1TU0A 3C48A 2QP9X 3C85A 3KUDA 3A14A 1B93A 3DVAB 4RKEA 3WNCA 1E6LA 5JSYA 1BXZA 3JZFA 2J8ZA 4TV9A 4ER0A 3QFHA 3ZJ4A 4Z4CA 1NRXA 4Z7NB 5A6VA 4MLZA 1O5TA 3FFAA 3KXLA 4J7AA 5BN4B 4N8DA 2VRWA 5A05A 3D6MA 3HL4A 1JG3A 1QIFA 2TS1A 3UT5A 3V1KA 1P5ZB 2PLFA 3FWPA 1RKUA 5ALHA 1PZGA 3AF3A 3PRKE 4WOJA 1Z39A 2C7QA 4J16A 1UBKS 1MOQA 1MQ9A 1IEXA 1V37A 1X39A 2GK4A 2QW8A 3EF1A 4NONA 5CVEA 2F55A 4MMZB 1U3WA 4P98A 5DTJA 1JHVA 1I3KA 3HY4A 2OBFA 1T3SA 3ADDA 1R15A 1E1RD 4G67A 4CETA 3L0YA 1UJ5A 2Y93A 3HHEA 3NASA 5HCNA 4OP3A 2V9PA 3E5RA 2WT8A 3DCYA 3T34A 4D3XA 3U7JA 4IINA 2FSVC 1Q77A 1TF7A 1E18A 4UE3S 1XF9A 2BH2A 2XXAA 2XZDA 2DM6A 5IKPA 1L5GB 1EVYA 2FK8A 4Q9NA 3OZWA 4DUZB 3GFPA 3C7AA 3KLNA 3MCUA 3OECA 1RVDA 1G0NA 3D2CA 3MGBA 4ICIA 4Y2PA 1JHPA 3X1JA 1SHKA 1JKJA 1VA4A 2XUPA 1MVNA 1JQLB 2JGDB 2W6PA 3ENVA 2GBPA 3GROA 3K9GA 2WWIA 3ONVA 3PQ8A 4JGIA 5FCDA 1RFLA 1UFKA 2YZ2A 3L7LA 3SZ3A 4R2LA 3WYAA 1B6RA 2Y71A 2ECQA 3OEED 1GL9B 3MJDA 1BGXT 3QJYA 4INOA 4UNRA 5EIWA 3ANXA 4KOAA 4RD3A 1P44A 4PONA 3OHMA 2AB0A 2AW3A 5CXXA 3MK31 3NT2A 5FUBA 3DB1A 4BU0A 1RC0A 1SOVA 1T4GA 4ABYA 1SIUA 2L19A 5LA6B 4D3YA 4IDGA 2QT0A 1EXWA 2Q3EA 3BGVA 3LQFA 1OWMA 2QTLA 4JZYA 4QYIB 3AVXA 3P0RA 1NBEA 4TXNA 2GBGA 5DBFA 4AZTA 3WQRA 1GGHA 2WWGA 4F3TA 3O4RA 2XWSA 3T06B 1QBGA 3QELB 3A06A 3QLTA 4Q82A 3OX2A 4WINA 3VC2A 3SBEA 4KRFA 1AUQA 4IIJB 1EK0A 1XZPA 5EQTA 3I04A 4HNRA 1QG6A 2GWRA 1YI0A 4IOMA 4WKGA 4BGIA 1L1QA 1IOZA 5FKJA 3RSSA 4YC7A 1OJLA 1JEDA 5CIQA 1XDWA 7ADHA 2WIFA 5K5EA 4KPYA 3QVMA 4B84A 3PE6A 3W9BA 4RTLA 1J1ZA 4MRMA 1CQJA 4E7PA 1O57A 5IXSA 3D0KA 2Q62A 2QUBA 3MRXA 4ROSA 1YAHA 2FJ0A 4BRWA 3BDVA 2NU9A 2V0CA 3TGLA 4TUYB 1YMVA 1HXHA 2BI7A 1QX4A 1HDYA 3O8CA 4O1IA 1HETA 5T4BA 2ZBGA 1SB9A 4BIIA 4I9HA 5EERA 5C53B 4V2UA 2GCIA 2OLJA 3M6XA 4X94A 2I2CA 3H6GA 4B75A 5ESXA 4CNQA 1FZTA 2BN4A 1SFRA 3ZBUA 4A4DA 4C7MA 4YRNA 4P1ZA 3EQ8A 2QE7A 4CKEA 1Z0IA 3STWA 1DQZA 1CUVA 3QOFA 1T5SA 2KBFA 1YKSA 2V6IA 1NOKA 4TRNA 3V9AA 3RYHA 4B0OA 4D96A 1T3GA 3PK0A 2CXUA 5TQJA 2HSGA 3DEFA 4WDQA 1BKSB 2NSLA 3I9NA 3VYVA 1LU9A 2V1UA 5BNFA 3GA7A 4DRXA 3AJ8A 3RHTA 5GJWC 2XUFA 3OPQA 4N1AA 1KFEB 1S2GA 3PX7A 2J85A 1X19A 2YJ3A 3ISVA 1PYOA 1YDMA 1U2EA 4KIJA 1QYVA 4RACA 5LP1A 2UVPA 2JK0A 1PJAA 2KI5A 3U3KA 4CF3A 4CBVA 5LNK1 2PKQO 3M2TA 5TPWB 1QM5A 3UV3A 1Z5OA 5HJ2A 3KU4A 1Y8ZA 2XMZA 4L9RA 2Z4RA 3ZZMA 2HF9A 2ILTA 1JR4A 2H63A 2OQVA 4ENRA 4R8VA 3WWPA 2FUEA 1XEAA 1GXSA 2FE1A 3Q3EA 5JH7F 1A9SA 3BL6A 4S1NA 5KIAA 4L0MA 4JI2B 4NJMB 5MFPA 1CNFA 3VR3D 1NOIA 3DE2X 3GPDG 4LJLA 3ZD6A 5ITZB 1TZJA 3I32A 4P32A 4M86A 2PNJA 2HNBA 1G7RA 2F3SA 5AKYA 4C87A 5CFOA 3MB8A 2WYOA 3H11A 3OWOA 4ZRNA 4ESOA 2C4WA 1GILA 2F3PA 2PD6A 5FA8A 3LHDA 5CVJA 2RGNA 2DWPA 2VHXA 2EARA 2XMSA 4U2DA 4XR4A 1RWXA 2B9VA 3GAMA 3C8ZA 5KHAA 2NX2A 5HIAA 2C2MA 3DF7A 4UAVA 3QVLA 1HE2A 1XVUA 3TRFA 1EQUA 1VLZA 4G0XA 1D2CA 1HMYA 5BORA 5EJ6A 4BO6A 4EY3A 2H4XA 3H3JA 4YJ3F 3T1NA 1X8KA 1ETHA 2ONCA 3JYHA 3L8HA 2X4DA 3M6FA 3MN1A 1TLTA 5ILQA 4K0RA 3TRHA 1LKZA 4O4JA 1DX6A 3SKVA 1XMSA 2ZSBA 5LXTF 4D4IA 5CAEA 2FR8A 2F2TA 2RGUA 4YAJA 2WWYA 4M60A 1P91A 4R8MA 4ZYTA 1NVKA 4J90A 2WE7A 3G59A 2O7VA 3IP3A 4Q66C 2AN4A 2H4WA 3R7SA 1CZLA 4DLKA 4Q6WA 3GFSA 2H2HA 2XWJI 3VOBA 1E2KA 2G9QA 5A3RA 3K5PA 1TQDA 4E4YA 4KYIB 3T52A 4AKGA 4ZKEA 3AVQA 4CQLB 5JR3A 2XOEA 4MX8A 4OMCA 5K3FB 2NSJA 5FAKA 1EBFA 1YQDA 3LVQE 1PR5A 5EKTA 5FL7A 4F3NA 5HS4A 1IZYA 3C1UA 3OCUA 2FGKA 5BSKA 2JPDA 3DFKA 4D1YA 2VTVA 4ISCA 2IIBA 2GCGA 2WZBA 5EMLA 4JDPA 3SSOA 4HDQB 3WOHA 1CYDA 1Z3IX 1I32A 1KAMA 4BTVA 2CVFA 1RDFA 3JQEA 1TZ2A 2K87A 2OG1A 1LPAB 2OK8A 3KLMX 3OH8A 3OZBA 1OT3A 3IP1A 3BE4A 3L3BA 4FFMA 1V6SA 4MQLA 4P4SB 2YUIA 4R7GA 4ZV9A 4E5UA 3B9PA 1ST2A 1SVNA 1W2HA 5TF0A 1EM8B 5FOQA 3BMCB 1OGYA 5EJ5A 3D1LA 4W99A 4G9BA 3ENKA 3TXXA 4KX5A 1EQ2A 2G70A 3EN0A 3QBTA 2VPTA 4FZ3A 1G4UR 1TIBA 1P6QA 1Q84A 2VEDA 1VKZA 4JH0A 4RPJA 1LB1B 2AUTA 3SWWA 2I91A 1RXVA 1FDTA 3CVJA 2AH5A 5AESA 2DC1A 4DEVA 3DOEA 1GRVA 1XLVA 3HR8A 2NVOA 3RSLA 2AFHB 2PMDA 3UUFA 5IVHA 2REQA 4FOSA 3N53A 1I33A 2ZVQX 2G83A 3UH1A 2Q1WA 1O96A 1CRQA 2DFKB 2YY5A 3RKRA 1O5OA 5A5GA 4RVHA 4FXPA 3IODA 5FHQA 3ZDYB 4DKJA 1ULTA 3EXEA 4F4UA 5L8VA 2QR5A 4R68A 5KQLA 2AEEA 4DPLA 5LQJA 1DL5A 4NBWA 1L7PA 3AFIA 3QI7A 1R6AA 1LD3A 2QRLA 3GD5A 4KG7A 1OGIA 3HP1A 4XFKA 5KTOA 1RYNA 4KR7A 3B5JA 4MS3B 4EYEA 3EH2A 1VRCA 4CDMA 5IKXA 1NQUA 2JZOA 2C2YA 3N2ZB 4D0NA 4B3SB 5FBRB 3GZJA 1ITZA 1N0UA 1S8FA 2W98A 2G4CA 3ABQB 2A5YB 4OKNA 4GYKA 3T9EA 4RJTA 3O2QB 2AZMA 3NX4A 3L4BC 3OC6A 1QKIA 1K9SA 3KT6A 3ONFA 1P4RA 3GH1A 2UYYA 3HCEA 4LMBA 4NNJA 5ALQA 5KAPA 1E9RA 4WXHA 5FL7D 1XEWX 1G59A 1NDQA 1YNOA 3V7UA 1L5MA 2VDKB 1C1DB 4G0ZA 4IH1A 4ITUA 1DPGA 2VH2A 3GMSA 1QHEA 5LR6A 1TZKA 3HJTA 4BFWA 4I08A 1F2TB 1K6EA 1Z4PX 4CG1A 3E5NA 1RE0A 5ANRB 4Q4AB 2VDWA 3ZY4A 3AVYA 2PUFA 2X0KA 3V7FA 4Q4AA 2PUGA 2YZNA 2Z09A 5EP4A 3D8UA 1L8LA 3ZY2A 2IBSA 2PL5A 1W2GA 3UW3A 3MQ4A 3MJVA 4BB0A 1RVV1 2ZCJA 4B7CA 2V58A 2AA3A 1TKCA 1KDZA 1NZJA 3R4CA 3IQEA 3TRKA 5C81A 1DIBA 1C7JA 1TCUA 1TT5A 4M1WA 2IV7A 3DHWC 5JW6A 1JLLA 2Q4EA 4L07A 1E4YA 1G20A 3JVVA 3ML1A 4H7PA 2RAFA 2HRBA 3R7LA 1AV7A 1SU4A 4FWBA 5JDCA 4BAZA 2X6RA 3KZKA 3S2GA 3E7XA 2GARA 3WKEA 4RQUA 4DZTA 2DKFA 2I6SA 2JHCA 2C4UA 2ON6A 3HNOA 3MPOA 5JXWA 3EVEA 2H65A 1OWNA 1MN6A 4V3CA 3W5SA 4D8YA 4D9IA 2VAWA 1BW9A 4OJYA 3F98A 1BW9B 2JLSA 3WIOA 4OHYA 2XODA 3D4NA 2H3EA 4E09A 1OZFA 4ZI7B 3UBTA 4UTNA 2FWBA 4JV5B 2VDPB 3WIBA 1EUQA 3N75A 4YV0A 1CX9B 4OQMA 4HN2A 5LA6A 1UEJA 1SPBS 2B61A 1VMAA 3OQBA 3W1EA 3REGA 1VYHA 1AHPA 4NZOA 4PX3A 4OLHA 1ZLYA 2I9KA 2BE7A 1UKZA 1XTTA 4Q1EA 1DOZA 1K3TA 1PFYA 1I7PA 1PTJC 2FPRA 3DWGA 1DCKA 5IARA 3SN6A 3AHEA 1YRYE 5CFQA 1FFXB 3ZGOA 3ZBQA 3BD9A 2WU1A 3MTBA 4KRXA 1QHNA 1RYFA 1Z29A 2GEUA 3B5EA 5H68A 4F60A 2QIOA 3SC2B 1TRKA 2B25A 2AKAB 4GWKA 5SYAA 4G26A 2P0EA 2ANCA 2A2ZA 3H5VA 4OXQA 3DSRA 4MI1A 3OA0A 2D2XA 4YCBA 1C2YA 1T5LA 2ZIUB 3V33A 3Q3VA 5C7IO 2YYYA 2BR4A 5KWSA 2HHLA 1A8IA 1XYVA 1RQLA 2FFQA 4KGXA 4LOKA 4C3VA 3LI2A 2I4NA 1U2ZA 3LUDA 5CFRA 1F6WA 2MJLA 3DVLA 2QM7A 2WJWA 4IS2A 4KYVA 4NMXB 4YCAA 3WLKX 4DHWA 4DRYA 1VJGA 4BLWA 1ZUD1 1QU3A 4A03A 5TGZA 1OXUA 3LPCA 1CERA 2QTAA 4MW7A 3UCEA 4FYYA 3UKDA 2Q8PA 4TMTA 1NZDA 3KKLA 3AW9A 3HV0A 4H3HB 1N8KA 2QN3A 3EDCA 3DAPA 3OTQA 4QA9A 4C0KA 2EFEB 4WVFA 4CLHA 1TQ2A 1U5BB 1YR1A 1VI2A 4NZNA 4HJRA 4UHBA 1M66A 2RB4A 3C6XA 4I99A 2VHTA 2WUDA 4HTFB 1F0NA 1PLJA 3L49A 4G84A 4RA9A 3TFQA 3H83A 5IDWA 4O1HA 4HH3C 4QPPA 2BRUA 5ESDA 5C4IA 5EUBA 2FN7A 2CEKA 2OQIA 2XCUA 1BN7A 2GN4A 3JD3A 3G3EA 4MVJA 2DU8A 4BO1A 4G4JA 1W5SA 1FJHA 1G63A 2IS6A 2ISQA 1KI8A 3NWOA 4IVRA 4MQBA 1MPXA 5FPPA 2GEFA 1L5HA 5B1YA 3D4IA 1E1MA 3O4VA 4I4CA 4UMVA 5AOBA 1ZOOA 1TKAA 4FGLA 1FFYA 2IYWA 2OG2A 4PTYA 3DVRX 2WILA 4GOKA 4NZ9A 5HTKA 4A8JC 1JH9A 4CQJA 3PJFA 4EA8A 3JWHA 2Q28A 4LEIA 1C50A 1K63A 1N6OA 2ZETA 1PW5A 3R4VA 3SX0A 3V4OA 5JNSA 1DZIA 4MJLA 4MQMA 3TX6A 3T1VA 1QPZA 5DCYA 3K73O 2QT1A 1KFKB 4PG7A 3ROFA 3O92A 1L3IA 4RZUA 3UENA 2MU1A 3EZLA 4A5SA 4ND3A 4B45A 3KJHA 2VP6A 1YU6A 2O9JA 1F7UA 1P9NA 3DLIA 3PHGA 4H6XA 1CQIA 4MWBA 1BCRA 3HUUA 3S8YA 5LQKA 1NL3A 4YB8A 3M6UA 1N6RA 3IEXA 3JR7A 4FC7A 1P4GA 3DM9B 1PR3A 5JJCA 2H4FA 3ZGYA 1A8SA 1YOVA 1KH1A 1Y5RA 1NVAA 1U81A 3HS3A 3I0NA 5COQA 1N2SA 2I03A 3U49A 4RD4A 3VDXA 1OFIA 1FX1A 3JQ7A 2OHJA 3WYGA 4DGSA 1M0EA 2O0HA 2X14A 2G7ZA 1ECGA 2VATA 3QF4A 2DCUA 2WP0A 3VYUB 2N0SA 1PTKA 3VNSA 4QHTA 1FLAA 4MW2A 4B3BA 3LH5A 2RGXA 3H0CA 2A9QA 1YR7A 4IXTA 4BLRA 2REOA 2XEXA 2ZATA 3UNXA 5K2OA 5DF1A 3E9CA 1W8DA 2FDRA 3VZSA 1FVFA 2FVXA 1FPQA 3SHTA 4HB4A 2ZQZA 5CAEB 1NU8A 3MCAA 4TLBA 4YX9A 4M3NA 4NJEA 2BVNA 4FILA 1SKBA 4G4IA 1GN8A 4XYEA 2JKYA 3PGXA 3RRFA 4RS3A 2UXBB 4P84A 5K3AA 2C1XA 1EA5A 1XPRA 1BHJA 4KQKA 4OQ4A 3IKVA 3AESB 1V45E 1CUXA 2OAQ1 4TS1A 4GSYA 3QKTA 3DL4A 2G40A 3F6CA 1VHLA 2DQ4A 1P73A 4A27A 3IV9A 3K9WA 3FI9A 2EFDB 1XZIA 2WU0A 4NV0A 1I0IA 4OD0A 4LPSA 1KBQA 1DZ3A 2QZ4A 3KKKA 1T0JB 4PX5A 2D13A 3AL3A 4N5LA 3W3AD 2NUPA 1WUYA 4H7EA 4C4RA 1QH1B 1U28A 4J7UA 5A71A 4I0WB 2CZGA 5DRTA 3TPCA 4QC2A 2R1VB 5F3RA 2D3WA 4NCAA 2O50A 3HHPA 3IUPA 4I50A 4JIGA 4Z1OA 2G8NA 1IZ9A 3A6ZA 4LX0A 4UTZA 2X5XA 3N0RA 3RJ9A 3VISA 5I7VA 3D8BA 4ECEA 4JUIA 5AKGA 1FTGA 1FMTA 1QNFA 2BFMA 1G8AA 5SY9A 1UJ6A 4FMCB 1E9AA 3VTZA 1Y8RB 1Q3TA 3DMFA 1Y8RA 621PA 1SOWA 2KYRA 1YRAA 3V1TC 4BZXA 3RSZA 2C58A 1Y8QA 1YR3A 4L3OA 5AW4A 4NSNA 1YRBA 2R6DA 1O6GA 4D4MA 1UBFA 1NUTA 1FTSA 4MH0R 2VJCA 4DIDA 3DL2A 4IDAA 1SOAA 1KZ1A 5DT9A 3W77A 2MIIA 4MR9B 1JXMA 2H07A 5EIXA 4J3JA 5EJMA 1MX1A 5D1NA 1NYTA 2PBRA 4CL2A 1TZCA 3K6JA 1E62A 5FOXA 5KVAA 1VZ3A 4C0SA 2H1CA 1LY1A 3MZ0A 3UJ6A 1LK0A 4MUFA 4ISBA 4BJ3A 3AF6A 2HLDA 4ZAZA 1W76A 2OL4A 1EXMA 1IHYA 3FHCB 3H9GA 3TTWA 4AY5A 1ZH6A 2C84A 2LTAA 3JASB 3GJSA 4DIKA 5BN3A 2F4VB 3U6KA 2ZT6A 3GLHE 2BHNA 4GI5A 1ONPA 3DFFA 3H65A 4RK7A 1B0PA 3W2GA 1X1SA 1XN1A 2H17A 2CMGA 2PTGA 3IIIA 3LCUA 4EYOA 3J7TA 3WB2A 1KXJA 3R7WB 4E88A 1GKKA 1NBAA 3DXFA 3M7IA 2VNIA 2NZWA 3CE9A 4WNIA 5CA1B 2R6AA 3AVUA 1FNDA 1U9IC 4XVQA 4DNQA 4D4HA 2G1UA 2WDPA 1QZXA 1Y9JA 2PK3A 2XI4A 2FOIA 4KPUB 4RIFA 3UWPA 4WLVA 4AYWA 2CGEA 2RK3A 1Q1NA 1TA9A 3KWLA 3W3AA 3CX3A 5A4IS 1LNQA 2W83A 3NLLA 4V0KA 2H8GA 3GYBA 3PZRA 3R40A 1TM5E 3R0QA 3R7FA 1EG7A 1ODSA 4KL8S 1CJMA 5F21A 2HCJB 2XQKA 3DDZX 2VCYA 1VG1A 3FN4A 3BD6A 3VO8A 5FUMA 4NFHA 4C2UA 1A50B 4LK3A 2RJ3A 3JWEA 1D6NA 1YIOA 2PR2A 1OAKA 4KACA 1UJMA 5FH9A 1ZHOA 3GN1A 2R5WA 3EHDA 3JZAA 3NQ41 3ZE1B 1KDVA 2C4HA 3E8SA 3AY3A 3HP4A 2HPZA 4C06A 3A58B 2JJ1D 2E0IA 4PHCA 3UMYA 1EFVB 5DOVA 1JILA 3HXPA 1QK5A 4G1MB 4DJEC 5CXSA 1I9CA 1LSJA 3I1FA 4XGRA 4PLYA 3GLTA 2CDCA 1ZXLA 1SUPA 3EW7A 2PQMA 1F60A 5JANA 2DFPA 2RCYA 3QBJA 5JQGA 1EFRA 4QX6A 3P0IA 4U6SA 1ZH4A 3WLFA 1GGFA 4OI4A 1P39A 1EGMB 2PZEA 4HDRB 3ELUA 5DHTA 2BMEA 5ESRA 5E1BA 3ZDAA 3FY4A 3F9RA 1VJRA 2KLBA 4G4GA 3VR0A 2Q99A 1IG3A 3LDGA 3GR6A 5A6SB 1ZRHA 1E69A 1L4KA 3BD7A 1GZ4A 5K03A 4BGEA 2CKDA 1W93A 1Z07A 5EYPB 1SBYA 3IYLW 7MDHA 4D98A 1SJ9A 2Z2XA 1UC9A 2JGKA 4Y3UA 3BMOB 3WMFA 1HH4A 3D4BA 1G8GA 3LKBA 2WAOA 3GK3A 4ZVPA 8LDHA 3PKZA 2GF9A 2Q6IA 3PGMA 1G1MA 2O3RA 3C15C 1E4EA 3DYIA 1Q74A 2X0NA 1U1GA 2PKXA 4Y1EA 3UHPA 2XZOA 3ER9A 3A6HA 4TOIA 1USUA 3JQAA 2F8MA 1HEYA 3TYXA 3BM5A 4FR0A 5GWXA 1TVKB 3RYCA 3W6OA 1V7PC 1SCQA 3DQZA 4Y7CA 5D5QA 3HJFA 3KD2A 3GLQA 4RPCA 2CLOB 1XD8A 2GBLC 2DUWA 2OILA 4N5MA 2QDKA 1ZISA 1W87A 1UBTS 2JRCA 1P8JA 3C87A 5A1TA 1N77A 1M1YB 5KQSA 3A9UA 4YAKA 3DT8A 3HJNA 3WK4A 1GZHB 3NEJA 4FN5A 1TD9A 2JC3A 5FTJA 3SDBA 4JLAA 3ZXIA 2Q5HA 2HH9A 1N5LA 4D46A 2JIPA 4HWGA 2DPLA 4GGOA 3FBGA 2O3QA 3PENA 1U0OC 4PF1A 2BBOA 3JQPA 1ACMA 4MOWA 4JLOA 2HA2A 4MI9A 2EKDA 3GLKA 4A0SA 2VUTA 2D2EA 3QE4A 1QF9A 3C41J 5L53A 4ALLA 5H9WA 1P81A 1IUKA 1RAGA 2JHAA 4JOSA 2BHRA 3IQDB 3R44A 1WTCA 2IBMA 3ESYA 4KI7A 3SJZA 1EP3B 2EL9A 3KJEA 2JVJA 5BNZA 2GZHA 4G5XA 3NT4A 1P0PA 1UWCA 1E1KA 5SYNA 1GCIA 3ZXXA 4DV7B 3T54A 1W4LA 1P17A 3WGKA 4RNDB 1TO2E 1Y4SA 5FLEX 1XTKA 3S7TA 3TK1A 4DL9A 1N9ZA 4EMSA 2OXFA 5IUNC 3T3NA 4B85A 1S01A 3H97A 1EPUA 4XA8A 1A5BB 1IUPA 1U0RA 4KXUA 5K8IA 1DCTA 4BFXA 5T57A 4BNZA 1E79D 1DQNA 1T34A 2X2OA 1KBZA 4IKOA 2JD0A 4NECA 5TV2A 3T7RA 3Q3JB 2M2IA 5I8PA 3N8DA 4IGKA 4XCXA 2QG4A 4HH4A 3KSAC 2C94A 3MYYA 2JCSA 1VHTA 3IESA 4PZUA 5A9RA 2HNAA 4JVMA 2VYVD 2IJGX 2C5FA 1ZEMA