4XM2A

N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the absence of cadmium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
b'FENVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 95
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm2A00
3DFIA 3DFMA 4EWLA 5BMOA 3WE7A 2XADA 5B2FA 1Q7TA 2X9LA 1UANA 5CGZA 2IXDA 3WL3A 3DFFA 4XM2A 4XLZA 3WL4A 3DFKA 5B2EA 4XM0A 4XM1A 1Q74A
chains in the Genus database with same CATH superfamily
5GPBA 4OAQA 3RO7A 1F2VA 4LTNA 3A6ZA 2VRCD 1SVKA 2FSSA 1R15A 5FH9A 3U3DA 1JSXA 3NBMA 2DTDA 2NU9A 2ZRJA 4PLFA 2BUAA 1B42A 3BRWD 3ZY5A 1I80A 5JNUA 3K1AB 1CS0A 4U5XA 4KQJA 5HK9A 3F4BA 1GTVA 2BUCA 2IGBA 3OU7A 2H51A 3PNMA 1QAOA 3SXJA 2HC9A 3MB8A 1C7RA 3TXYA 3ADDA 4BRSA 4G56A 9LDBA 2IYWA 3T9CA 4OJKA 3DZIA 1P2BA 1O9BA 2PG3A 3MJEA 3EZLA 2AZ4A 3BGVA 1EIWA 3VZCA 3IP1A 2FN9A 3ZQ4A 4KLZA 3T7KA 3GLHE 3PEUA 3PQ4A 1LS6A 1R1DA 2NSJA 3BZWA 3NP9A 3MM4A 4P92A 4WNAA 3WDSA 3DGFC 3CEAA 1T6NA 2UXCB 2G5TA 1GL6A 3CN7A 2QZ4A 4L27A 3S5UA 3W5JA 2BPOA 1N7HA 2G6TA 3G2JA 5J4HA 4WOKA 1CD5A 3GLRA 3K8YA 4PSUA 3FTFA 1KK2A 4OLAA 3LK6A 3DFUA 3RK1A 5B58T 3INTA 2INGX 4G86A 4DM7A 5KYWB 3K5IA 3C8DA 3HZZA 4Q37A 3USZA 3VU9A 5B7GA 3HABA 3VPBA 3KVRA 4IDFA 4XQEA 4EPYA 1YMVA 1WB4A 4OXIA 4XA8A 4X6LA 4FKBA 3U5TA 3O83A 2HFJA 3NPAA 4WBNA 1YR6A 4OIFA 2H9YA 4R68A 4FCCA 4EZIA 3R5FA 3ZOKA 5HQ3B 3GBVA 3R6DA 1NRXA 2JJ1D 5FV7A 1DZ3A 5HILA 2GEBA 5ALPA 1OWMA 1TCVA 2QT0A 4N0PA 3BX1A 3PVZA 5A6SB 3TGPA 4TS4A 3TLGB 1GKUB 1MJGA 3NBYC 1RWNA 1IBCA 3RVBA 1WUYA 1JQLB 1R5OA 1C41A 1Y5RA 3LQQA 5LD2B 3SZRA 2CLOB 3QG5A 4TLDA 1RXWA 4I81A 3SAJA 3QVWA 1IUNA 5LB2A 2ZVQX 5BQ5A 2ZFUA 2BCGY 2QZJA 1T1RA 3UHJA 5DFAA 1AMNA 5LQDA 3IRVA 2QW0X 4G81A 5KINB 4PHCA 2BFEB 1P5ZB 4DHEA 3V00A 1XCBA 2H52A 3BPSA 5C81A 1RXEA 3KWFA 1XZQA 4EFMA 4NWIA 5ESRA 5I7OA 1K66A 3KZCA 3QPUA 1TMKA 3TRJA 5IZ4A 2DFTA 3DV0B 3KQTA 1Z38A 5L7YA 4XSHA 1XQXA 1ZY2A 2XI4A 4UDOA 4A2WA 2XT9A 4LBZA 3G2HA 1E4YA 1QVZA 1U0OC 2JIZD 2Q5CA 3EGCA 4W7IA 1EH5A 4LHSA 4N3CA 2V4MA 3I2JA 2BC9A 3WSVA 4F1WA 4K86A 5KTPA 2VYQA 3AG6A 5F9MA 2ZITA 4S05A 1OPRA 2CCJA 3COSA 4E2YA 4ZTUB 1SCDA 2Q4BA 4O4JA 5CCBA 1QBKC 4N5DA 1IE3A 3HUTA 3UB3A 3KQWA 3PRJA 3UCFA 1JR6A 4DTCA 1D9XA 4A2PA 3TIFA 3CJTA 1AT1A 4GZ6A 2LKDA 2CJYA 5A9SA 1U0FA 1R27A 4QXOA 4JYBA 5G02A 3WX0A 1AXRA 1SR8A 4YJ3A 2IIVA 3KLBA 3UV3A 1C8VB 2NUPA 5ALUA 3L4KA 2DY0A 2YL2A 1FC0A 3C5EA 3ICPA 3ICEA 4FLEA 5EP3A 5ESDA 3BQMB 2JFYA 1TQ6A 2AUTA 2C95A 3BMOA 4XYLA 4XVHA 1XHLA 2J4DA 3E9ZA 2V6JA 2M98A 2OMEA 3H83A 4K9SA 4HYTA 3OKAA 2VT7A 5AM4A 1DZIA 1T9AA 3HO6A 1FOEB 4ZVMA 1E2PA 4MZDA 4DRXA 4M3NA 3KAPA 2FN8A 1FW8A 2DQSA 2QV0A 2J33A 4R8SA 5H3HA 1CF4A 4WI1A 5KCMA 2WM3A 3DAOA 2IXEA 5CEFA 1K4YA 3R8CA 1WNTA 3L6CA 1UCFA 3IKTA 3HDQA 3KWMA 4ZFNA 4C0WA 4HHEA 4OJTA 5IC6A 3C87A 4HGYA 1YBMA 1S2MA 4L3WA 3VOSA 4CI0B 3MJHA 1BHJA 2GBLC 5ESWA 2QL9A 3BXFA 1ZCJA 4FMPA 1U9IC 2X0KA 3F2IA 3V33A 2EKDA 3K30A 5B12A 3C3YA 1ILEA 3KSBC 4P53A 1H9CA 2FHSA 5CBPA 4KDCA 1Y4SA 1B3RA 5CTJA 1GR1A 1T3GA 3O1HB 3OX3A 3E9CA 3KZMA 4RVHA 1E9BA 4OJMX 2FRXA 1MOQA 4Y2RA 4BKRA 3AINA 5JXWA 2UZ4A 2B37A 2IX9A 5I4IA 1I3MA 1OB2A 2QAGB 3USCS 2F9MA 5KYUB 3GFFA 1N4AA 3FNRA 4HOYA 3AIKA 3S2UA 2QD3A 4WW0A 3DAHA 1IG3A 5SZKB 1KTIA 1YWGO 5K3AA 4CL2A 2EG5A 4LIPD 5KQLA 1TADA 4L6CA 1KI7A 1YZVA 4KZKA 1JR2A 2ZI7A 4P33A 1ESNA 1UH5A 1U0HC 4JP5A 4YNBA 4NBUA 3ZIUA 2VRBA 1SBIA 2VG8A 2QE7D 1PFVA 5EHXA 1PZNA 2PLRA 5FQNA 3VKFA 1A7UA 2ZAGA 3AERB 2WHPB 1QP0A 1Z6ZA 4XX0B 2QW8A 4XEHA 2F9FA 1FNBA 1QYDA 4R9SA 2G72A 5JNTA 4F3NA 1O8CA 3NRBA 2XWPA 1XU4A 5CR9A 1FDOA 1PGNA 2NAPA 3BD6A 3E2PA 3GJYA 2YWDA 3PR2B 2OSVA 2H2AA 3K31A 4YVFA 5F7ZA 3G68A 2ZANA 1H23A 2R96A 1LZLA 2PKXA 4FZ3A 4QOFA 1YQXA 2O4CA 3ILXA 1ND5A 3AHFA 3QA3E 4UZFA 1FDIA 3RSGA 3ZXXA 5BQXA 1OHHD 2YHUA 4KQXA 5CLGA 5J5VA 3TPZA 3HO1A 3WGJA 1J5PA 1Z8NA 3KUDA 2OECA 3D59A 1GPWB 4O2BB 5G0UA 4PY2A 5LSAA 1US8A 3PKZA 4QFBA 1RDFA 3EW7A 3HGTA 3RARA 3QY0A 2IIPA 4R9NA 5I7AA 5DLQC 3C7KA 3FBWA 1BDIA 1UEIA 4NBLA 2OKGA 2QTVA 1Y48E 5DM1A 5DTEA 3NEAA 1QOPB 4O02B 4CLRA 4OGLA 3HWSA 5EZQA 5I9TA 3GK3A 3EBLA 1P33A 4F2HA 3CLSC 1F0KA 4RZ2A 3U7QB 3O2JA 2V8OA 2KW5A 4FINA 2VHYA 4QBKA 3UXYA 3DCJA 3WL6A 2EQ5A 3GCGA 2O8EA 4EA8A 4H1VA 5CEJA 5KC8A 2PQ6A 2Y1OA 4I50B 3KQSA 3ICOA 5TC4A 4EL0A 1QLHA 2GXSA 3I39X 3TEJA 3BHJA 3NFYA 1ONNA 4MTCA 1P2DA 3K05A 3SMVA 1L5SA 2X0JA 1N92A 2OBBA 4NCNA 4E5SA 2GCNA 1FFWA 1WUKS 2QUKA 4Z9AA 4C0QC 4I4TF 5IN4A 2JK1A 5E0KB 4HDMA 3UM9A 4TT3A 4EI7A 1P4GA 4YECA 2Z95A 2K2WA 3LH5A 4RPHA 3T9FA 5B4VA 2VHWA 4KRFA 2V3WA 3K96A 4N5LA 2J85A 3EGXA 3H0KA 3TZKA 1GQRA 1SXJB 3MLBA 1E66A 4JP2A 4M8SA 3N76A 1KSGA 5DYTA 3UGKA 4IUBS 3EIFA 2ZATA 1W75A 3OZSA 4K40A 2BFFB 4NE2A 4ZOCA 3VZPA 4E5MA 1QS0A 4L8WB 4QARA 4ARZA 1V1RB 1N6HA 3L7OA 4YAWA 4JXJA 4G5OA 4BASA 4UFPA 5J4VA 3HXQA 2O8BB 1HZZC 1CZHA 1LDBA 2PFGA 5KYGA 2GGSA 2Q07A 1MRNA 3CVWA 1BWSA 2FWPA 4B3GA 2C5GA 2H63A 2VYCA 4XZ3A 3JVVA 2MINA 3CLTD 3AUUA 4QNNA 2OBLA 5J40A 1HM5A 1E5VA 1W2HA 3A1WA 2ZUBA 2QMZA 2PBZA 1AVTA 4YPVA 1RYZA 4IUCS 3UAOA 5LN1A 1SQ5A 2ZPUA 4C2TA 1NMSA 1NVMB 3ACBA 3GL9A 3UKOA 4I19A 3ZV5A 2R1TA 4ESOA 2ZRBA 2Z2IA 5AT1A 1DFGA 1WCYA 4G1FA 4NI5A 3IOBA 3W2IA 2RSLA 2BZSA 2PUJA 5KTKA 3N6RA 2IEIA 1U11A 4QU8A 2BJHA 4CR8A 2MSWA 5GOZA 5LP6A 3DNMA 1OAKA 1XD2A 3HU3A 4X1IA 1XCGB 3VR2D 2H7CA 3O8OB 4X00A 1Z2EA 2RMKA 2AN1A 2J5XA 5DLPA 2WOOA 3R3VA 3QX3A 4LFBB 1ZONA 2ZWIA 4NU0A 3NWJA 4UCFA 4XWAA 1QCZA 1VTKA 1ZN2A 4A16A 3CKMA 1N1MA 3VVCA 3JVIA 4DARA 1M34E 1ZM7A 4JT2A 5LLDA 3A26A 4M6WA 3W78A 3FCEA 1XRRA 1GPH1 3WLMA 3ZDRA 3O8QB 4H7EA 3NWPA 1ZJYA 4UHDA 2NTEA 1YAHA 2YJ6A 3EX7C 1H9AA 1ZOOA 3PVCA 4A5SA 1NRWA 2HGZA 4J1TA 3VTKA 1OXBB 2GHIA 2I54A 4PYMA 2WUDA 4AX4A 2BW0A 1RLJA 3IIJA 3N58A 3EZNA 3IE0A 2J9FB 4JBIA 4RF5A 3RC1A 1MTOA 4QXRA 4D81A 2RAFA 2A7XA 2DBRA 3B9QA 3EYAA 1DC6A 3GT7A 2BAGA 2D1YA 2FNAA 3KTAB 3TQFA 4HY3A 3LC0A 5D6NA 5HKLA 4QM6A 3K35A 2FR8C 1L8AA 2FZCA 1G55A 3I6BA 1IZ0A 3UOAB 3UBTA 2L19A 2O0KA 3HCDA 4RMHA 2OXIA 2WTUA 3GRYA 1OI7A 3S2YA 1ATIA 3CE6A 3FNQA 1MJHA 2DFNA 2GNPA 3MS7A 2O2DA 1KY4A 3LQRA 2MSNA 4LFCB 3NNSA 4A9AA 1NWHA 1MAUA 2CBZA 2E3JA 3S44A 5AVWA 3TIGA 1HTBA 4BNDB 5JANA 2YZMA 4IZOA 3ZV7A 1NJ1A 4RDHA 2PL5A 3TB4A 2EFDB 4M1YA 3GT0A 2J9ZB 1KERA 4EJSB 3L6DA 1RQNA 3CNHA 2OYCA 4PV7A 1N2XA 3CRQA 5GM1A 1ESZA 1JZQA 2JKYA 3UICA 2LVBA 3DAGA 2PBLA 1Z0ZA 3VDNB 2PUVA 2QR2A 1O89A 3IBGA 2O2XA 3OBBA 4MP8A 1NXVA 1Q2UA 2GAAA 2WJ3A 3E3LA 2NZ8A 1AG9A 2F6RA 1E1MA 3W3ZB 4YRNA 1IQPA 3TM5A 4ENTA 5KQMA 1NQVA 4GDFA 4QXAA 4BBJA 3I05A 4EHIA 2BSQA 3PFGA 3S55A 3DOEA 1QKJA 4HGOA 2PXAA 3KJGA 1TUEA 2AIRA 2WSSD 1P7YA 1E79A 2BEWB 4GT1A 5CDFA 4R7ZA 5HHTA 1VB5A 3DBRA 2ID7A 2X58A 2WF6A 3GUCA 3KHKA 5H68A 4A03A 2JGDB 3IEXA 4F7DA 3ZDBA 4RY2A 1ECLA 1WHSB 3O90A 3SIXA 1AQLA 2GQ0A 1STOA 3TMYA 2NX2A 2X4DA 1LQTA 4U6NA 4ARAA 1BH2A 621PA 4Z7QB 3LPMA 3MMXA 4L22A 4YCDA 1A8UA 3KXDA 5IKXA 1Z29A 3OHSX 4G01B 1CVRA 1XR3A 2QIOA 3PHBE 2QNBA 1CFJA 4KG7A 2CLDX 4DMUB 1SVMA 4QRIA 3HDVA 3FJOA 3AU8A 4HC4A 4RD0A 3NH6A 4FHFA 5C1DA 2MSEB 3BF7A 4UFOA 3QWIA 4LJKA 3F98A 3AEKA 3E35A 3OQIB 4OHUA 5BN5A 5E7QA 2EZ8A 3D81A 3JASA 5J58A 1D6MA 4L5BA 3LNTA 1W36D 4GUDA 1LTQA 2DG2A 2QT9A 4DMFA 2XAUA 3L84A 4ASUA 4HCJA 3FRIA 3NT5A 1USVA 4QGGA 3ND6A 1BDJA 2JH3A 3HEMA 5E4TA 3ZNNA 4KBYA 2PKCA 4AB1A 4L02A 5L45A 1NJ2A 2P5TB 3PQ2A 1RRMA 4ZT2A 5JY1A 1PV4A 4JZYA 4UD6A 5EIOA 1B0UA 1U3FA 3T3HA 1JV2B 2OCIA 3LVBA 1OZ0A 3LHSA 3P71T 2F1RA 3EC2A 4OQZA 4R0VA 5REQB 3ZTYA 5I4KA 1FYXA 2GD6A 4YFYA 3WI7A 4KO1S 4PBSA 3VSDA 5FHRA 3WWPA 2EJUA 1FVOA 2CWDA 2HA3A 2B0JA 2FX3A 2YVQA 4JC4A 2ECKA 1KGSA 3PUKA 4QHYA 4TLBA 2DPMA 5HF8A 2PGAA 2GA8A 4RKYA 4WY8A 2HJWA 3PE3A 3EPJA 1SVWA 4MQBA 2JFQA 3ANLA 3MOGA 2FPIA 1FFGA 4HNSA 2REQA 1KU6A 4FFWA 4EGSA 2O3JA 3A0UA 1GSOA 1HFJA 1XZGA 4H0NA 4NBSA 4S2EA 4DNFA 5GONF 2X4LA 4DV6B 1IOZA 3A4MA 1NBHA 3AZPA 1JL3A 4FX2A 2FWIA 3FHJA 3SJZA 1CF9A 2C7QA 4AVYA 3S1LA 3M2PA 4D8VA 4KE8A 1RKQA 4A6XA 3U7GA 2GNOA 3UMMA 1RD4A 4HBGA 1UPBA 1SOVA 1O5OA 2I2WA 3LY5A 1F0YA 2HQ1A 4Q3LA 3T9AA 1TQDA 3HUFA 1W0JA 3LBIA 3LUBA 3ZE9A 1EWQA 3MJFA 3UA4A 3DLCA 3MJTA 1Q77A 3HWRA 2BE9A 1PRYA 3AY3A 2C4VA 1HY3A 1SU7A 3AFGA 4HNQA 1GAEO 4MKIA 1CQWA 1LK0A 3QPBA 4ITVA 4G1VA 1NBIA 1VKRA 2A0FA 5JCPA 4XGQA 2I76A 4HYYA 3WQRA 1CUZA 1VE7A 3CF4G 3KBBA 3WLTA 3R9XB 1BHO1 5LBUA 1P4JA 4EITA 1ZHOA 1E5XA 4LRYA 4NEQA 3C98A 1RAEA 4ZHSA 1IIRA 1N9GA 3DVLA 2QSYA 2Z30A 2HA6A 1W4CA 2I78A 1Q44A 2IYNA 2HLHA 2Q4TA 3Q12A 3OAAA 3PFCA 1GYPA 4ENPA 4U2KA 4M1MA 1TM1E 7YASA 1SOMA 5B1IA 1WD7A 4KR0A 2ZRLA 3IYLW 4MUMA 4YJFB 3H6KA 2PL3A 2BEVB 2XUPA 3C6MA 3L8CA 1T2EA 3RC7A 4ZD6A 3MRXA 4XD7A 3EPHA 4BJ5A 3UPDA 1H4SA 3IGFA 3PFWO 2GKGA 3C97A 3ANTA 2PANA 1O9HA 4B87A 4MHTA 2AX3A 2WUGA 2I3GA 4N0MA 4IJ6A 5IVIA 4BO1A 4AFNA 1XFDA 1OB5A 2ZQZA 3PQ3A 5HDBB 4PHHA 3ZOZA 3TZHA 3ACDA 4IFEA 2XB6A 2O3UA 2C98A 3MAJA 4U9HS 3G8CA 3AFNA 3U39A 4O1HA 3RYIB 3FYCA 3KQLA 3WGIA 1J9EA 4FYKA 1MAAA 3NHPA 2ZRKA 1X3SA 4P7BA 2ACVA 4RYLA 3QBVA 2KHZA 4C0BA 3A06A 2D2IA 1V7QA 2IEBA 5E6SA 1PE0A 4KE7A 3DQQA 3OUTA 3RS5A 1BJRE 4CIWA 5K6TA 1DDOA 1SCUB 5FUQA 2XQKA 3RAPR 5ITVA 3WIEA 2GPSA 4I36A 4HX2A 4JBXA 4DIMA 2ZULA 3JAWB 1PHPA 5I7FA 4PPQA 4EF6A 1TFUA 2PX3A 2R8ZA 3LMKA 4MEJA 2Y68A 3NKVA 2Q5QA 4PYLA 3SX4A 4EK9A 2Q45A 3KHUA 4J90A 1ZBDA 4J1SA 1Q7RA 5A0FA 1SVLA 3T1VA 1EVJA 3VR4D 1EB9A 3PD1A 4FB5A 2TECE 1ZN9A 3HR4A 3RAGA 2IUYA 1RWBA 3FPFA 3HBMA 3BOSA 2OQ2A 3ZVLA 1UC9A 2R1UA 1ZNQO 4BNYA 4R71A 3ER8A 1MABA 3IBCA 3TB6A 4Q9IA 1CKEA 1Z22A 3C3BA 1KJWA 3FYHA 4I3FA 3S0JA 5IRCD 5IAAA 1LVUA 1PFKA 1P6UA 5DO9A 1V5IA 2AEMA 5I4CA 1DC5A 1E9CA 3AP2A 2ASEA 1P3JA 3MT0A 3IT0A 3L8DA 3WNZA 4EYKA 3BB1A 2DHRA 1R4MB 4K2HA 4PX3A 1QWOA 2ONJA 4A92A 4I55B 2ERXA 3VHXB 3GZNB 2GRJA 1BNCA 3I3SR 3KJHA 1IHXA 4DLAA 2V7TA 1TU4A 4G9GA 3QV1A 1Z5WA 5JYDA 1OKKD 4DWVA 4DDTA 5D6OA 3A4NA 4QL3A 4OREX 1JEDA 5HS4A 5HW0A 2VF7A 3B52X 2WAXA 3B3AA 4Y2XA 1C1XA 1ZOPA 4CEHB 4OHZA 3FCUB 1IZZA 4RE5A 3DCYA 2W00A 1M5TA 1CRQA 2IYTA 4LWOA 3SXUB 3UGQA 2GVDC 3CUUA 3PJDA 3CJQA 1CUJA 2H2GA 2FVXA 1RWQA 2XEDA 2IP2A 3DHEA 3EIEA 1EINA 3GJ3A 4GPBA 4MV7A 4WXEA 1XZDA 3RR2A 1OLXB 2Q2QA 3MUOA 1FFSA 1L4HA 5EE0A 1QOQB 1TM2A 4P83A 3WA7A 1DE0A 4TWIA 4R2IA 1E6EA 5JROA 1EJBA 2Z09A 3KRTA 3S2ZA 5SY9A 5FTNA 1YDFA 2JFNA 4LV5B 2NAFA 4XIGS 3JZIA 4XE5A 2IYEA 4QPJC 4F9TA 1G1AA 1R37A 1YB1A 4J4TA 1RI1A 1LLUA 4BVKA 3KQNA 1O87A 2YYZA 4E5DA 1ZUHA 3A2NA 3A6GA 3EJWA 3N8KA 4KYTA 5EXPA 1PKEA 4U7WA 1Y4DE 3FYUA 4O25A 1KVSA 3COVA 3ZCTA 1ZD8A 5DTIA 3F9RA 5DP2A 1QGOA 2J5KA 1A3CA 1B0AA 2D1FA 3N7TA 4BU1A 1MB2A 2BJVA 2O5CA 2YCLA 3X1DA 2QMQA 1J7JA 2HWKA 2QM3A 4D46A 3OIGA 5KJFA 3IP5A 3GVPA 2FR0A 2DM6A 4TKZA 3I6MA 4YCJA 4JCOA 3NTRA 3HKCA 5IJ0B 1JFTA 3MEQA 3LUFA 3SU8A 5FI3A 4TWRA 4YPOA 1Y8QA 2P6UA 3KOMA 1CLEA 1AS0A 4RH0A 4IYJA 4RZ3A 4UQLA 1R9NA 4BVBA 5K9ZA 4RTKA 5FD8A 2I2DA 5FL7D 3F5QA 4Q7JB 5F7OA 1UIRA 1B8VA 4II2A 4HGNA 3AHIA 3THXB 4XWTA 4WOPA 5DW3A 3KKOA 3QLUC 5LXTB 3NETA 2AW5A 2J3HA 3BFKA 2R3SA 5EQFA 3S1AB 2ZUEA 3B12A 1G60A 1EX1A 4Y67A 5JHGB 3O31A 4ZCLA 3CEHA 1XQYA 2GESA 4HGPA 2J41A 3AUAA 2E5FA 1BMDA 4US1R 1NVVR 4WFIA 2VJAA 4Y2VA 2O6LA 5EC8A 5EPUA 3CPJB 4KXUA 2X8AA 2ZI5A 4H6VA 4MR8A 4X93A 4MWCA 3WBKA 5K0CA 4IQ8A 4PYKA 3R5JA 1U7ZA 1FP6A 2IYAA 3SIWA 4K3VA 1WBBA 1T1IA 3ZV3A 2LDXA 1BW9A 1E4EA 2I6XA 1UK7A 2A8YA 3MTIA 1JI3A 1Z45A 1IVNA 1GDHA 1KSHA 1DHTA 2H0AA 1JPVA 2IYOA 2JFOA 3WQQA 4JI4B 2H8GA 1H05A 5BUQA 4CLOB 4DG5A 5IF3A 1WDTA 1N6RA 3RFCA 2AJDA 2P3QA 1HYEA 3F90A 1ODIA 4FMDB 1D07A 3OESA 1FFDA 5ALYA 3VYVA 3BXEA 1SUDA 1D1TA 2WU4A 1CY2A 3M81A 2XJ9A 2OFFA 4D3XA 5KVVA 4IGFA 2VQ3A 2AI2A 1PJ3A 2AI1A 3AB3A 3HB5X 2WFLB 3SC3A 4LJRA 4HAIA 4OLFA 2IA5A 1T1GA 2Z6UA 3THSA 4MHSA 2G5PA 1C7JA 3LYUA 3E5MA 2ZJ3A 1W4RA 4YRLA 5EJMA 3RUAA 4ZAXA 3RJMA 3W4JA 4DXHA 2JARA 3KU4A 4Y2QA 1YU9A 1DS6A 4MUAA 5EQDA 1CEQA 1LDMA 2JCXA 4X61A 2LCIA 3N70A 4Y2HA 3W77A 1U9CA 2BH9A 3RTGA 1CZLA 2FDRA 3NBZC 1F3OA 3JW8A 3A04A 4JP1A 3ZDAA 3EXHC 3IMKA 1OGYA 1CP2A 2E18A 2J31A 3WRVA 3FI9A 2IRWA 3OWOA 3K20A 4L85A 1M1YE 3K9FC 4XSVA 4L15A 1XLUA 4RBNA 3AIOA 4PQFA 4X94A 5K4AA 1K5HA 1SVSA 1XNJA 3HDGA 2XAAA 4IIYA 3FCSB 4NYJR 4CKBA 2Y0EA 4YP0A 5AD1A 1Z13A 5EIWA 5DASA 2C96A 4R83A 5JMOA 3VJKA 4Q02A 3VC3A 4AK9A 1T2FA 4G9BA 2IHUA 3EQ2A 4X3OA 3FYTA 4M8KA 2IU3A 2NT4A 3E3OA 2ORED 4DM3A 3WBJA 5JW6A 1ZMTA 3O3NB 4QU5A 3SNKA 3R6TA 1U7WA 2GWRA 4UE3S 2OAEA 2WKPA 5FOSA 4PHGA 1M74A 1ONBA 3K4QA 3JD3A 1WOYA 4II3A 5EWLA 5AO9A 1Z4PX 1CUHA 1HURA 2Q5HA 1NJ5A 2XVYA 5JFTA 4KJXA 1YKSA 2P2GA 3SZGA 1DAOA 2QKYA 3CH5A 1M1NB 2DBZA 2NIPA 1F9EA 4MPDA 1A50B 4JP8A 4FJ0A 1I36A 1U0JA 1JDNA 3GMSA 1LW7A 2WF7A 4IMPA 1ODCA 1IDOA 5K3DA 4B6FA 1U0EA 1PT6A 1ZQ1A 2Y93A 1DWOA 2WJGA 4M2LA 3IMFA 5J2TF 1TCBA 2X9GA 3D8RA 4H4CA 3HR8A 3GGCA 3I52A 1Z7EA 1AC5A 3LZDA 4IDQA 2QD4A 4CNQA 4EEXA 4RCYA 1OTXA 2WV9A 4LJ4A 4XYEA 3V7NA 5CDFE 3WGQA 4UUAA 1QCCA 1L7AA 2GTPA 4GPD1 3RRJA 1WMEA 4NENA 3A6LA 2IT1A 2PT6A 5A71A 5CA1A 2GZ3A 1C2TA 3MRTA 4M0DA 1A2OA 1KJQA 3I04A 2PUDA 2XECA 3DL0A 3U16A 1IZ8A 3ER9A 1JEYA 2B1RA 4H7IA 2D7CA 1ZGBA 1IXSB 3DE3X 3HP7A 2O3RA 5FPYA 4NHOA 5DCYA 2RIPA 1C3OA 2VNIA 3DT9A 3NIGB 2WC1A 3LC7O 3IO5A 2OFPA 4U3JA 3E27A 4F6RA 3G2LA 1I0ZA 4M46A 3PICA 2XMPA 3L9XA 4KRGA 2ZJ1A 2H1WA 4R8KA 1IN1A 2Y1XA 3CCBA 4YT2A 5EAIA 4G0QA 2VI5A 8LDHA 3V6LA 4JV5B 3QKSA 5BT9A 2DCMA 4R8LA 2BKLA 3LC1O 1BGVA 1S3GA 1XLTC 3OX2A 1E0DA 3O38A 5KYKA 1EBUA 5GQSA 4RADA 2R8YA 1DBSA 1W6RA 1XZ8A 2PU7A 1SK8A 1B1CA 2EFYA 4KO4S 2P9FA 1JP7A 1EK1A 2NO7A 3GZTB 4QPPA 3O0TA 4M8NE 2Q3LA 2QRLA 3OQOA 4NESA 2KBEA 3JQ8A 4LOLA 3LBAA 1VMDA 3HU2A 3OCXA 2A84A 4RV4A 2FQYA 1E2QA 1MENA 1JHQA 5AK4A 5JH7B 1EA5A 3ZD6A 1OTHA 1Z5GA 3IIIA 1N4DA 4F4FA 5E6UB 4JDPA 1JT2A 1U90A 4O4JF 2F62A 1PZMA 1QIJA 2CLLB 1QHSA 2L42A 2Y1WA 3HCBA 4HWPA 4MUYA 4OYLA 5AM5A 1PJSA 1GGKA 5HBRA 4D98A 4WLNA 3DMRA 5AVQA 5F2EA 1E6WA 1NFFA 2BMDA 4Y2GA 5AK3A 1G41A 5GTDA 4JI7B 3GRFA 3TDMA 1KMQA 2HCJB 2OCKA 2OCLA 4C88A 1QK4A 4MJ7A 4YJ3F 2GRUA 3WWYA 4B35A 2WM9B 2H1LA 2WHYA 5AOBA 3A1VA 4NMMA 2IHYA 4C43A 2R00C 3E9EA 3EXFB 4LZNA 3KB6A 1UBUS 4BFZA 5KNCD 5ENZA 3R4VA 4MI1A 4WTOA 4IDEA 1BWQA 3WXMA 2G28A 2WF5A 3GQBB 4PXYA 1VPLA 3I5YA 1VJ5A 4A0HA 2FSVA 4B81A 2VZ8A 1BX0A 2OGSA 2YWGA 4HXGA 5L6MB 1DT5A 5CFRA 2G8LA 3NHKA 1SELA 3JQEA 4HMQA 4GPAA 5FLYA 1BKDR 4OPMA 4RL4A 2FEKA 2QJRA 2XDAA 3SQMA 1N25A 3WLEA 3HYLA 3OTOB 2JJQA 5EJ5A 1GFZA 3DWIA 4MVJM 1A27A 4EELA 1FLAA 4C2UA 3VVBA 1PQPA 3GDGA 2HRQA 4IRUB 1BE1A 2H4YA 1P81A 4QBHA 4WLEA 2BHNA 3W5CA 1JX6A 4G63A 4LDJA 5F9HA 1SBYA 1ABBA 4ZVPA 2BTQB 4Y0AA 1FTGA 1R88A 5KQPA 4XDZA 3OFVA 1J42A 3RCBA 5TVKA 5JRZA 1WZNA 4KTTE 2EFGA 3UWKA 2ZZKA 2D2XA 3SPXA 1W88A 4TPKA 1RXUA 2WYVA 5C31A 1ZEMA 2IDKA 2YBEA 1J5XA 1DBWA 3QELA 1BH6A 4XDYA 4NU5A 4XFKA 3GP3A 2RHLA 3GT3A 5AK0A 5DLEA 1YA6A 3CVVA 2HMAA 3UMVA 5TQ2B 4JAVC 4TS3A 1ZH6A 4CYMA 3MJ4A 5JUWA 4FD2A 4QQFA 5KMGB 1KAMA 4HUJA 1L9KA 4CL3A 4EOGA 2PUWA 2PEZA 5FA8A 3RVJA 1BFDA 1ZUNA 5FWAA 1OXUA 1ZQ9A 3O7MA 3D1LA 5B3JA 3X1ZA 3FVVA 3JYOA 2AMVA 4XR9A 5AVRA 3LX5A 3OJCA 2ZAOA 1NE7A 1AKMA 1I7LA 1QONA 2O3QA 3BXZA 3WTBA 4N47A 2Y4OA 5IJXA 3MBOA 1YV9A 3E7XA 3B6IA 4YXWD 4AZTA 4DLTA 1JFRA 5BYKA 2AC2A 1X1DA 2CUTA 1GOTA 3ZZNA 4ETWA 4R2WA 4IGIA 1I6WA 3FLBA 2IWHA 4LQLA 1F38A 2QRVA 3OQBA 4CIXA 4YJGB 2G7ZA 4BAGA 4KMOA 5BNIA 3NHWA 2QUJA 4DR6B 4TLAA 3JARA 2B1GA 2I91A 1IUOA 3PEVA 5ALGA 2A57A 3FWYA 3ESZA 3WICA 1HT3A 3PHCA 1VDMA 2GBCA 4OBXA 3ROPA 5IAOA 4BX8A 4CT5A 1Y63A 3LOUA 4B8YA 2GVNA 1E0SA 1L7QA 5LOVA 1PDWA 2BR3A 3VC2A 4CUKA 1U8YA 3CKYA 2FWAA 2OAP1 4K8RB 3Q88A 3E82A 4IHJB 4RS4A 4CCYA 2OBXA 4UHBA 4UHHA 5CIQA 3IQWA 2O0JA 3IUQA 1CZUA 1YC5A 1ZI6A 4WY2A 4YTEA 3SQXA 1RFGE 1V26A 5AJHA 3D6JA 2ISSD 5J23A 4YP6A 4Q1VA 3NC4A 1EP2B 1QRDA 3R75A 5JAHA 1AKNA 3H5VA 4M37A 4LRWA 5LM3A 3PYXA 1U2GA 4F60A 1V35A 1VQ1A 3ITKA 4HWGA 5EPOA 5FPKA 5CVUA 1UPCA 5BNWA 3OCVA 3ZGZA 2A9JA 3WRXC 3ANXA 4OXQA 2DQYA 4YALA 2JGNA 4RJ2A 2OG2A 2O3SA 3WNQA 3Q7SA 5KWIA 6ABPA 1R00A 1J8FA 1OQAA 3W5DA 2PX2A 1IL0A 1BX1A 1Q7EA 3WYEA 4FS3A 4I1PA 3D7RA 2QPAA 3UFBA 3GGPA 3CEJA 2ZRAA 1TZ2A 1WA5A 3QE9Y 2WPNA 2X0FA 4XAQA 3HUUA 5EKUA 1XLWA 1C80A 4J4HA 4U6SA 1I7DA 3UH0A 1N6PA 1TT7A 1Z37A 1IBRA 1OZFA 3ROKA 1L4FA 4BTVA 2EP8A 2XZOA 3TW8A 3K0SA 4J43A 2Q9UA 4HDKB 3Q1KA 4KN6A 3AYXB 1M7HA 3QUCA 4NECA 4XCVA 4AW9A 4DCOA 2WV7A 4A6PA 4JBLA 1B2LA 1BE0A 3B6ZA 1NUSA 3T3IA 2P2SA 3FZEA 1OMOA 2CV2A 3K9HA 3NDPA 3C41J 3PXGA 2BFBA 1D0IA 3JWHA 4GR4A 4GEGA 4PFJA 4D42A 1C9MA 3O2SB 4Q9AA 1W4BA 4YYZA 2UZAA 3IQXA 1LJ8A 2RFLA 1WP4A 5D01A 5EJIA 1KH1A 2X8BA 3QBDA 4LRXA 3SF8A 4N03A 2ODTX 4CN8A 2VAPA 4BXOA 3RVLA 5JSUA 1LLQA 2HPZA 1JA0A 1U6IA 3OUUA 5GV8A 5SZIA 3WDMA 4KFUA 1Z2DA 1GILA 1EIZA 1GUAA 5JARA 3KAJA 1YDMA 1RQGA 4R2JA 3OT4A 2PUCA 5LMZA 2PX5A 1H2HA 2DU8A 3TCNA 1C4WA 2P9CA 3OLXA 1PG5A 1D5CA 2E55A 2ZWVA 2Q5FA 1OBCA 2IZ0A 2Y4NA 1YS2X 4Q7KA 2WAOA 5KVAA 3JRWA 4MQEA 3LFUA 2VTBA 4M38A 2QBYB 2I66A 4MRRA 2NYUA 4BX9A 4R1MA 5KVCA 5LP6F 1H1DA 2XD9A 3M9XA 2FSGA 1ZOIA 3CCFA 3QFCA 1JLLB 4TYPA 1GUFA 1IH8A 1A98A 3MCUA 4KWIA 5FNZA 1LJUA 2NQTA 4KK3A 4G84A 4DMGA 4EF5A 3H2BA 2RCNA 3ECAA 4WPGA 4PZUA 3C6XA 4E21A 4EBBA 4RZIA 3U80A 4FJ1A 3K94A 2NO4A 1DIAA 1ZDMA 5KO2A 2PA0A 1OXXK 2I5PO 2R4TA 2WD9A 4IIEA 3UB2A 3BSSA 2G83A 4P3KA 3IEPA 1G66A 2C0QA 4E2ZA 5EOVA 3LA6A 5T8KA 1FLNA 4RZXA 4URWR 3IQFA 1TEVA 2OLKA 3EFEA 5EE3A 5FUYA 5JV5A 4ISCA 1E79D 3ED5A 3P0RA 4E2FA 3I01M 3NANA 3CIOA 2BFDB 3KP1A 4J7CA 3EQZA 1IOWA 3V4ZA 4KXQA 5C5CA 1DXQA 2XCIA 1AUXA 3TTUA 3O8BA 3BERA 3RS7A 3S6JA 1ULZA 5FBWB 3PEYA 2X77A 4YMHA 3WZMA 4D56A 5DH9A 1Y37A 1NBWB 2C99A 2HJVA 1YZTA 4A1FA 1RBQA 1GUZA 1GZ7A 2O2ZA 3N7AA 5IH3A 2WJPA 2I6UA 3JWIA 3V1YA 4P3PA 4JLSA 3QHAA 4C04A 4CCWA 2IODA 2EP5A 5JY6A 4MA4A 4EB6B 1YIOA 2OFWA 1RMTA 3KB1A 2XTAA 5BQFA 2FPRA 4MR7A 3IXQA 4Y1RA 2WWVD 4PO8A 3E23A 2EJVA 3DXXA 2JLYA 5BYAA 1AMUA 3ROXA 1RADA 4HWRA 1IUKA 3N0TA 1TL7C 1PZGA 2IWRA 1L3IA 4P80A 3C43A 5FAXA 3N53A 2OXEA 1TQ2A 2QTZA 2W8BA 5AJWA 2FUG1 1ESMA 5IYZA 3IAM6 1E60A 1QKIA 3D6UA 1B0ZA 4ETNA 5KZMB 3OF2A 4MLZA 1GYQA 5KNBA 1YR7A 3OKCA 1GZDA 2ZSUA 1M8PA 2J0UA 5DBGA 3ZDZB 3DMPA 3FAZA 3GJ4A 3KVNA 4UU0A 5I9BA 3PJRA 1VJTA 1C9JA 2IEDA 3I72A 1ECBA 3OICA 1WZ2A 3TEFA 1GZ3A 3CNEA 3EXIB 2A33A 5D3KA 9LDTA 2DLNA 3LQ1A 1NKTA 1LSOA 5ADWA 4ZK2A 1YDWA 1AQUA 5ALKA 3EZYA 2IE8A 1BEEA 2PTHA 3L1IA 1EGMB 2VXCA 4YRBA 4A36A 2PSJA 4Z0TA 1JFFB 2VZ9A 1USGA 1TPYA 5E9JA 1M54A 1Y5IA 4ND7A 4WBXC 2DRIA 4J0KA 2F3SA 2W0SA 3M49A 2HYDA 2W6PA 4W63A 4KZPA 5BVGA 2J6HA 3WC4A 2FPUA 1QTNA 1V7CA 1NDUA 2EDCA 1JU4A 1NF2A 2P0YA 2V4ZA 1EGVB 3K0HA 3MA0A 3QBJA 4GQIA 4PZEA 4RHEA 1VL6A 3P9KA 1N1DA 4PX9A 1CFZA 3QLEA 2WMDA 1XRQA 2J59A 2GPAA 2YMMA 5E2BA 1U0TA 4R01A 2AV6A 4IQFA 2QQFA 3PG5A 1MMFB 3UGTA 4RTSA 3OTHA 2GHRA 4WLVA 3WGLA 1H65A 2GD0A 4I5DA 3X43A 5IZCA 1NVUQ 1OYWA 5L3SB 4MWGA 4I5FA 1J7KA 1T0IA 3LXRA 5CX1B 4UU8A 2C04A 2C2ZA 1S7CA 2ZDHA 3FB4A 4IL5A 1Z5PA 5BSRA 1GKYA 2A67A 2R60A 4BDTA 2O2JA 5LR6A 2XNSA 2ATXA 2QSUA 2O5EA 4KH1A 1HBJA 1CXZA 3TSYA 5EP4A 2BFOA 2ZBDA 2YHBA 4GX0A 1NMXA 4GO1A 1ZRHA 1HI9A 4CMIB 2ONZA 4LJAA 5KHOC 3B6JA 1TA4A 1QH0A 2WJWA 3A4LA 1M2WA 3ZGVA 1LXCA 3E5NA 5CG2A 5K2OA 1E7RA 2V7EA 1DQZA 3CR8A 1CE8A 1KAGA 3HB0A 3KKQA 3R6WA 1KI4A 5A02A 6YASA 3DT6A 3CRZA 2FG7C 2B2NA 5AW3A 3LT5A 4I46A 4D3SA 2WT9A 1KEKA 1F2UB 2EWWA 2UZIR 1XF9A 1Z68A 2LZ0A 2WMOB 1XTKA 1V1MA 4HDSA 4WXMA 4X97A 4F8JA 3BFVA 3DAYA 1P9RA 2IP4A 4KIGA 3TW6A 4EX6A 2JAUA 4ZCRA 1ZR2A 4NE7A 1SHKA 3G7NA 3DDSA 4FFVA 4QPZA 4ZU3A 3Q1LA 4Y1FA 4XCXA 1DX4A 1NBOA 3JATA 4FZJA 4JOCA 4YMTA 1EXDA 3ULKA 3ND9A 4DRZA 1QFZA 4IQGA 1QH8B 4QYWA 4MWDA 1R16A 2ZXUA 4NFYA 1EUCA 3P2YA 1YXMA 4QBIA 3PNLA 5KSPA 2FW9A 1NRIA 2AUNA 4F2WA 2ZWOA 1J8QA 4EQ6B 3QKRB 4ZGBA 4D25A 3GLFA 4QICA 3B78A 2PKRA 2E0IA 2VTKA 3FSJX 4KGXA 2FQXA 4REOA 3THRA 2BM8A 2AOTB 5HFJA 2LDBA 2VJNA 4JBHA 2JBAB 4EDHA 2NQ2C 3A1SA 1N0UA 1ZD2P 1GSAA 5U1PA 2GBPA 1V11A 4XTRA 2DPYA 2HIGA 1JPUA 1C7QA 2NYRA 3IEUA 4NP6A 4BIIA 4AYXA 4LCBA 1QSGA 3AFOA 3HMQA 1RHJA 1TI7A 2GKOA 3CE9A 1YUNA 1YE3A 2F67A 3QOXA 1Z2PX 1JQ3A 4RF4A 1RYEA 5FPPA 4FOTA 4I9FA 3X1WA 3M2TA 4FUQA 3B1YA 4IW3B 4AL4A 2QAJA 4FYXA 1Y8RB 3ZVKA 1E2HA 2G7MC 3ONWA 4S1PA 3WHIA 3ZIAA 3OQJA 5D7BA 4R5HA 2OSBA 3U1VA 2ZJBA 3WXBA 4K9DA 4J1NA 1JXQA 1I4OA 1QHIA 4FCWA 3U7EB 5LIPA 2IC5A 1BFKA 1H0RA 1WTAA 2FVYA 3N1UA 3QPAA 4KE9A 4BFYA 1N0WA 4GZ3A 1N2JA 3INGA 5EJEA 1HR0B 4M22A 2E4YA 3LO8A 1NKSA 5CA0F 1H3NA 3ABRB 1N78A 1D5WA 2JEZA 4ILKA 1APBA 2I7VA 1WEKA 4WWHA 1SC3A 4Y18A 4K05A 3V48A 2Z3VA 3GLSA 3O8LA 2J67A 4UBNA 3EDYA 4E6EA 4HAVA 1TYCA 3OOHA 2A0XA 3MFQA 5KPDA 1NW4A 2B9VA 2M6RA 3ZBTA 2AXPA 1NLYA 2TRSB 3UAWA 3OMLA 2RG1A 1CX9B 1TVKA 1KIFA 2RONA 4A0GA 3RHSA 1WF3A 3OFKA 2K7FA 1WXWA 1C7IA 1T2CA 3C8MA 4FQ5A 3AONB 1CW2B 4I4TB 1H85A 4WNYA 4AZWA 3GGSA 1DXHA 3TOSA 1UEJA 4FW9A 1CR4A 3PNOA 1XRPA 1SOAA 5CK5A 1GZ6A 2ZVJA 2BDEA 5DN9A 3V4RA 2JH8A 5JWOA 3FCAA 3QXXA 3I4CA 3R3UA 4M0UA 1WXQA 1VRCA 2LUOA 4AUEA 1SUBA 4OQNA 1IBSA 1LCIA 1NI5A 2QTRA 3HP1A 4Y2UA 3SIPA 4CM8B 2QQ5A 3VPHA 1R2QA 3ZWKA 4ENRA 1F6BA 4YRDA 3ZCUA 4NATA 4GH5A 2QF7A 5FNVF 5HF5A 3GLGA 2Q3HA 3O6VA 3AC0A 3O8DA 3QE3A 5FB3A 3TTVA 1ZNYA 3VPXA 3V6MA 1DSSG 2KLBA 4B2PA 3LQYA 3DD5A 3IVRA 1X1QA 1JWBB 1P1CA 1Q74A 1F9AA 5HKBA 1K6IA 1U3WA 4ER6A 5C8YA 2R4QA 5ENDA 4XJTA 1FS4A 3I1YA 3W5AA 2HKIA 3VO2A 3A9UA 3QENA 3NPMA 1FYVA 3FTNA 3O3OB 2MSCB 3CLUD 4YMGA 1N33B 1I2ZA 5KKAA 4KTVE 4F4UA 5AQEA 3KB2A 4MV6A 2HNAA 3SZLA 3ZWXA 1N34B 4DC1A 1CR0A 2EOAA 4G89A 3H5AA 3FF1A 4PFSA 2M2IA 2CJFA 2E4ZA 1E0AA 2GYWA 3LO5A 1FCJA 3HFRA 4MRAA 3U2QA 4ENVA 2Q2OA 3NOXA 4YCSA 4TKVB 2PL1A 4X6XA 5KVQA 4M9CA 3GJTA 5LP6C 1IZYA 2GDZA 2M1ZA 4PN3A 4EUSA 1KOJA 4FW8A 1FP7A 4DDHA 4NJEA 2Q0QA 3FGZA 3QXGA 4PAOA 2XMRA 1GQQA 4QXPA 5FFFA 3AR5A 4QOJA 1BYUA 3EIQA 5EWJA 1JH8A 3TTXA 4ANFA 3MTEA 2PUAA 4QGFA 4M83A 3K32A 2AN4A 5JBQA 2QJOA 1XZBA 2LV8A 2H06A 4C6SA 3OQPA 1GG8A 3OQVA 3ZHQA 2OMKA 2ACWA 2NPOA 4KE6A 4QEKA 3T7AA 5I9LA 4HAYA 4QLOA 4CMGA 1Q1EA 3PUYA 3QI7A 5H59A 2NUAB 2JJ2A 5FBRB 3TG2A 1V48A 3K8ZA 2CNDA 1WRBA 2IUEA 5CXSA 5BV2P 1RKXA 3IAAA 4RVOA 3AEYA 5FT9A 2W0MA 4CTMA 5GOTA 2GO1A 2X5JO 3B9RA 3WAJA 1M2HA 3UG7A 2HT6A 4BNMA 1K8RA 4W7HA 2AN5A 3N5KA 3NWEA 2VPPA 3TAUA 4AIRA 3CPSA 4F72A 3Q6IA 1C9KA 2XRYA 3E2MA 3HYTA 4LY3A 2PD4A 1X94A 2IEGA 4QDOA 5EEHA 1HC7A 3H0EA 3GQVA 2RI0A 1QU2A 3MGAA 3TRHA 2X23A 3NBKA 3VZDA 2XDQB 4XEUA 3FBGA 5CHEA 1D1PA 3HJHA 1JQBA 4CM1A 2PFKA 3V2UA 2WP8J 4QUAA 2AKYA 1UMCB 3GELA 4ZP1A 3R6GA 3ER6A 2C9YA 1DTEA 4JLPA 2RHRA 5BT8A 4W1QA 5DTJA 3RS8A 1YCHA 3DE6X 1KF0A 3D6NB 1FTNA 3HCEA 3JVDA 3UW3A 2PLFA 3VPGA 4ZEVA 2ZRGA 2WIFA 2XXBA 3RYCB 2OCPA 4L5YA 2MDTA 4RXUA 2F8TA 1WMFA 5F3DA 3R3ZA 4DIDA 3K0FA 4KXMA 1EQAA 3FPSA 4MJXA 4OSPA 1TM7E 4UAUA 2MMCA 3N07A 4XUEA 2Z1DA 1M6YA 5DTMA 1IQRA 2VA8A 3LFHA 1P7PA 1FFAA 1VCIA 3T3DA 4OXKA 1SWVA 2B99A 2OVBA 2EZ4A 4Q3BA 1VKJA 5DP1A 5G1PA 3ZU5A 5KYWA 3HBAA 2WYOA 5DNWA 3BK1A 4E4RA 2AJCA 2J9XB 3PQEA 3U5ZB 3BXPA 1COWA 2OZLB 1V3QE 3KL2A 1Z0AA 4FMBB 4PYQA 1G8PA 4BX0A 1I01A 3HCNA 3P9IA 4DT1B 4WECA 1S4QA 3DTVD 1OW3B 2GK3A 5HQ3A 3ONEA 3G9ZA 4A8JC 4YWHA 4YAJA 1T8PA 4H1UA 5CT4A 1KO7A 1S0UA 4R51A 1QIHA 5LC1A 2NO6A 1KL7A 1UMDB 3TLGA 4ZQEA 1H1TA 3AR6A 2HR1A 2WWGA 1H69A 1W25A 3ISTA 3EGOA 3ENQA 3ILHA 3PDIB 3O2NA 1J1UA 2K6GA 4QTUB 1REQB 4GX2A 4AM8A 1QVVA 4BGEA 4CHTA 3INNA 3M3DA 4E2XA 5ELLA 1QR6A 3BWDD 2OV1A 3PXXA 4QYTA 2ZB3A 5CFMA 4GOXA 3CVUA 3C1UA 5E3JA 3VSEA 4BLOA 1JG4A 3ZXYA 1EX7A 1UDRA 1LVGA 2GFHA 3CZ9A 4X90A 3VC7A 3H2SA 2ZM5A 2BFEA 4FX5A 1MW9X 3THWB 4JX8A 2FQQA 1YBHA 1PW5A 2JBHA 5I8PA 3OUZA 1A7KA 3M6LA 4H7JA 4U2BA 3VAZA 4EG6A 3TIVA 4PQYA 5KB3A 2YYAA 2AFHB 1XL1A 3DV0A 2FSHA 5GJWC 1O4VA 4CWAA 1X7ZB 4LZPA 2XODA 1CUUA 3B7WA 2JH9A 3L18A 5I9NA 4JJ4A 4AU1A 2G1PA 3H1BA 2DJIA 4ZYTA 1LJLA 5BV0A 3QU9A 3BGOS 4AJLA 3JAKB 1EXVA 2CYCA 3LCMA 1O6GA 1ZVJA 3GHYA 2YJGA 3AV0B 4CFZA 5E9QA 2VWQA 3IEIA 1Q15A 3V8VA 3WQHA 5JD5A 2VQ6A 3R3YA 2J5QA 1XWIA 4HB0A 4LNAA 4ZQFA 1HE3A 5TIIA 2FN4A 2B61A 1J39A 2AR7A 1T3HA 2FW1A 3GEGA 2DFLA 4MZXA 4D99A 5EPEA 4ETIA 5FORA 2O1WA 1WJGA 3O4VA 4U8HA 1IWOA 5GONB 4G4SO 4BAUA 5FOQA 2YVLA 2GJ8A 4LTMA 4UM9D 3UMCA 4XR4A 5BNFA 1XJCA 2XB9A 1WUTA 2XF8A 3M6UA 5L95A 4NPCA 3UHAA 1OPXA 2OO5C 3EVFA 3SOPA 2FFBA 3UN1A 3PNPA 5ILOA 4N6NA 4GP7A 4KQEA 4ZU6X 2XZPA 3MWEB 3SEAA 1B23P 5H8WA 1LBSA 3K0BA 2OOSA 2WJVA 5C3UA 3EZ9A 1QVAA 4F96A 1G8FA 1NYRA 3MQ4A 4GYJA 4WACA 4GKJB 1W30A 2C2YA 4LBYA 5F77A 4PAQA 3G0GA 2W6JA 3DJFA 1KMMA 1PLLA 3N8DA 2HU2A 4IXTA 2RGNA 4RD1A 3TR5A 3F8TA 2YQ5A 1UAGA 4AWAA 3L2OB 2WYIA 3FUWA 1V5EA 1EDBA 3HCWA 4TL8A 1WZUA 1X7XA 3PFIA 3IULA 4YDQA 1W36B 1G38A 2F3PA 1QP8A 3IA2A 2AOUB 1ONPA 4KW7A 2R48A 1OH6A 2ZZNA 3HJNA 3VQTA 4F0JA 1I1HA 2GSWA 4ESVA 3AW9A 1NP7A 2HK6A 3AJEA 1R0KA 4NZOA 2A9FA 4OXYA 4WFQA 5DTQA 4RZUA 4UUOA 3UATA 1Q91A 3KJQA 5CURA 5ELXA 2NV2B 3KKPA 5BV7A 2DERA 4S04A 3KFXA 4P4UA 4P31A 1Y6FA 3W9SA 3LTNC 2J0SA 5EP2A 5ESXA 1T0BA 3RRZA 1NUAA 1FMFA 1YI0A 4EBFA 1LF0A 5KNDA 2EATA 4IBOA 1XRLA 1KC1A 3WYGA 1S1CA 2MCFA 4N12A 1PIWA 1VL2A 5GGXA 4G0ZA 4QVKA 1WIWA 2V45A 3TZQA 2IYUA 1Y4AE 2VPQA 4BNGA 2HHHB 2I6TA 4IM7A 1J5EB 1GM5A 1ISSA 1PQUA 3EGWA 2NP6A 2RI1A 3K72B 5AK6A 2QAGA 5KYUA 1JBQA 1NTRA 2D2EA 4H4EA 2H2DA 1T9DA 4E14A 1T5LA 2OHXA 3IVAA 2E4UA 4JZKA 4J2OA 4WERA 3VKVA 3IUYA 3SHOA 3PLRA 4CF4A 2JGRA 5TMBA 1Y4UA 4BGUA 3MCVA 5FFNA 1HXHA 2B21A 2Z4TA 2R6FA 2B36A 1WCWA 4GGPA 2ONCA 4JASB 4XB2A 5F1KA 5JOQA 3EDCA 1DEXA 2JD2A 2V7BA 4L9SA 2WHPA 1QYCA 2FJUA 3HRIA 5EKTA 4ZCPA 2BGUA 4XX0A 1ACLA 1I3KA 2DBQA 3CTMA 3NC1C 5BRAA 4H0FA 5JC1A 2P65A 2Q4RA 3Q0TA 3SYRA 2AEFA 5KAPA 4LV8B 4NARA 4D4JA 1JVBA 2AC4A 3WWDA 4Q1FA 5JE8A 2ZU0C 3HN2A 1I4EB 5UKDA 3N0VA 1PVVA 4MI3A 1BD3A 2R85A 4O5OA 3GGGA 2E4VA 4MMZB 4OMFG 1QF6A 3G0DA 1AUQA 1SUWA 3IIKA 2ZRFA 4JLOA 4KGZA 4V0SA 5EJ8A 3GAZA 1WXDA 3GUUA 1X0VA 4AZVA 1ZGHA 3P2KA 4RC9A 5CFPA 4RVCA 4O2BA 3FUTA 3RRYA 1GIAA 2O2HA 1KI2A 4M54A 4DJJA 1K4KA 2J9YB 3WP1B 5ICSA 4W4TA 3HDTA 4G26A 2JIMA 3FX2A 1JR3D 2HA5A 4O8ZA 3COPA 1JDPA 2Y66A 4PO9A 4YRSA 5CCXA 5CIWA 5CB4F 1OFIA 1YGYA 4EMUA 2GM4A 3GA0A 2WUWE 4TMWA 4ZRNA 2NNWB 3DZCA 1W9HA 1QPGA 5AI5A 3UWMA 4BRZA 1MB3A 1EPUA 4K88A 3BKXA 1QIDA 4QDXA 3USES 1WOMA 3GLFE 1NYLA 1I6KA 3ZNPA 4HH1A 3U7QA 2XADA 5C5DA 2OV2A 3V8BA 5BWBA 2D59A 4DIOA 4Q03A 2O57A 4HDNB 1QF7A 4I50A 2JLQA 5LZ8A 5K0JA 3BWYA 3EY9A 1WXFA 3L8ZA 3QNMA 1XZLA 2N46A 4I6GA 2WPDA 4W8HA 5TPWA 1HE1C 3NEJA 5CDGA 1MGOA 5LZ7A 1RM4A 3IAS1 2X0DA 1XMQB 3SS7X 2EW1A 4HNTA 3JWPA 3K6KA 3WYBA 3GFVA 4HAWA 3K0AB 1QGZA 3LWBA 5ALNA 3CMCO 5DVZA 4AZ0B 2HQSA 4ZI3A 3HCPA 1KPIA 1ZISA 2DQKA 3D7NA 4M0CA 3BWEA 3FOEC 1JLMA 5FWXB 3N2LA 4DSTA 4BU0A 1SXJA 3VYUB 1IPEA 2N1MA 3W5HA 3IPRA 3CURA 4FN4A 2EZ9A 2BFFA 5D86A 9GPBA 1R9GA 2WKRA 3TL3A 1IN7A 1V1RA 4DZZA 2O8BA 3QTTA 1M0TA 2FWJA 4XCQA 3M4YA 2BFCB 2BGJA 2I2CA 2QNIA 4KPUB 3FYUC 1XCLA 2PGJA 3LYHA 1OH5A 2ZSJA 1WR8A 2BUBA 2ZIVB 4WV3A 1ZXBA 3DZDA 1KPGA 2Z1NA 1OWOA 3LC2O 1JB1A 5T3UA 5IXSA 1ZVVA 4HEJA 2WUEA 2PFSA 3ZHVA 3L7MA 1NW5A 5KTSA 4CBVA 1QZTA 1JSCA 1FTYA 3H9JA 3VX3A 5DGXA 1SKYB 2EIXA 3JCZA 3LWNA 5PGMA 3SHFA 2ZT6A 2Q5LA 5D7NA 5KTOA 1SWWA 2JLUA 2JHFA 1DDIA 2OE2A 3CLUC 5DIFA 1KYWA 4KUGA 1P8AA 1LRKA 3K9CA 2JAOA 3PFKA 4PZLA 4C5CA 4EPRA 2PJUA 5GZ6A 3QMMA 4QDTA 5JT1A 4OQYA 3TXAA 1S2IA 4F56A 2EKZA 1NC3A 3RV3A 1AXGA 1L3CA 1V5GA 1Y1SA 2GPWA 4G0OA 2VPZA 4X6YA 3KCQA 4ARCA 5DISB 1O0SA 5J2UF 1DNPA 2FR1A 5BSWA 2BF4A 4KOAA 5F78A 3ZY6A 4AY5A 1H2WA 2I7TA 1EBBA 4LNHA 5AUOB 3CH7A 5IVPA 3GLGE 1UBSB 1QUFA 1PR6A 4DNXA 1GG9A 3OE1A 2PD3A 2XRFA 2BZ1A 4MQFB 4ZJYA 3Q3JB 2C0PA 2XVXA 1EVLA 3B1JA 2ONYA 1Z26A 2BKEA 1EUQA 3ELYA 2JI8A 4CQLB 5DJ5A 1XGKA 2HBZA 1M76A 4Q47A 3O8QA 5TS2A 1LC3A 3AO0B 4KXNA 5DM70 4V39A 2J0VA 3R77A 1P45A 1CIJA 3CU5A 1D4FA 2GM5A 4KV7A 4JU9A 1PG0A 1TJNA 3DXZA 1UKVY 1Z28A 1ULAA 1AHIA 3P97A 4Q3CA 3RFVA 1LEHA 3MPUA 4Z7JA 2ATCA 3D43A 2J9FA 1UUFA 1Y7PA 4L08A 4O2LA 4WSOA 5M04A 1NQOA 3PWZA 4JQOA 5EXSA 2JJMA 3KTAA 2YXDA 1ISGA 1FDTA 4M1OA 3OETA 4BO7A 4HN2A 1NF3A 1PJ2A 2OA0A 4WUVA 4NZ9A 1GGVA 1UBMS 3ZKAA 5CRIA 5H3CA 3WYAA 1VCHA 2D4HA 4LK3A 2QN8A 4LQCA 5SZJA 1DG1G 4KWEA 3GJZA 2ETVA 3ICWA 1ZEJA 1Y3IA 5LBIA 4DADA 1P60A 1LBHA 1N2BA 1IM5A 1P44A 3B1ZA 3I5AA 3CJRA 3NALA 5AKXA 3GEHA 1SURA 1C0KA 4FZRA 2QVZX 3BWBA 4MGEA 2RC6A 2JIPA 3S3TA 5EMLA 2FOLA 1M2JA 2HRZA 4HB3A 5DNUA 4BNDA 5JQWA 1BFUA 2IS2A 1QDLB 2JZCA 3P0FA 5ADVA 3ZVNA 3AHCA 3CO0S 3DTYA 3VDMA 4RX1A 1NBMD 3FFXA 1RRVA 5BSUA 4MS4B 3RG8A 1KP2A 2BN4A 2XMGA 4E08A 4EJSA 4GM0A 2VDOB 1P1RA 3LXXA 2A0KA 2HAEA 3ESBA 2UYYA 3OPXA 1GY8A 3K09A 1TKAA 4BP8A 4IQ0A 2O0MA 5LMUB 1LF5A 5ICGA 1EDOA 3GRPA 1Z74A 2ZROA 1DAMA 5D1HA 2R86A 1U2PA 2GN4A 2BGIA 4TXJA 2C9BA 5LDDC 1AU9A 1H0HA 2Y3IA 3EVEA 3Q40A 4KP7A 2ORWA 3MHPA 3OIWA 1VHJA 3SOZA 1VMAA 3EMVA 5WRFA 1YCDA 1OAAA 13PKA 2D1QA 4TMXA 4KIWA 5FPTA 3SM3A 5C5IA 5M5BA 3M6IA 3N9IA 3RRFA 1KBZA 3BC1A 2CEKA 2JGDA 3MAAC 1L4MA 2CXNA 1WHSA 2ECPA 2Y1DA 4ED9A 4JUCA 4A8PA 1EP3B 2IZOA 3PFBA 4M8LA 3SHQA 1RRCA 1QRTA 2AYYA 2FJPA 2QQ0A 1BSVA 1JECA 3H3XA 5DI9A 3WLKX 2OGZA 3MGCA 3R41A 2R6HA 4IX1A 1VIDA 3ESRA 4Q6BA 4DJFC 3THYB 5IEBA 2GZHA 8GPBA 5B1YA 1CQJB 3HADA 5BMVF 3BS4A 2JLAA 4N9WA 4H3KB 1F5SA 5DGTA 1M6VB 1ST2A 4PG8A 5AVSA 5K8LA 4I08A 4LOAA 3ZW7A 3SEZA 4YUYA 3T1QA 2AZMA 2ZDGA 3OQIA 3ETDA 4PVDA 3TOXA 1ADFA 5JDCA 1V8ZA 1N5JA 2J8ZA 3LUAA 3SVZA 5J2TB 2VWHA 2ZKLA 2OD9A 2JL1A 2ECFA 2CK3D 1Z25A 4I7EA 4AMUA 1UDCA 4Z4CA 4BWGA 1ZM9A 4HS4A 4HRXA 1P4SA 2IDZA 2WQ7A 5CHYA 2JLBA 1W8DA 2RGBA 5DM0A 4B2YA 5CXUA 5REQA 4UAGA 1P77A 4ZXFA 3TLMA 3ZY4A 4JEUA 4QREA 4KFSA 3TTWA 2V0NA 3P0EA 1T6XA 5AIBA 3A4VA 1SHTX 3OQMA 4PQEA 5IJAA 5AJVB 2NXNA 2ID4A 3THOA 2CNWD 5BVHB 1YS7A 4N49A 2W2MA 3CZAA 3KHSA 4BE4A 4RZSA 4KFTA 3ZNQA 1XTPA 2IUUA 2LTAA 1YL6A 3ZIDA 3E3MA 4BS9A 1DAKA 3WGUA 2EDAA 4PM4A 4IKEA 2J7PA 4G5HA 4QQKA 5IYZF 1H8HA 2A59A 4ND2A 4QBTA 4K28A 2BMEA 2CV0A 4PQRA 1LPPA 1T6BY 1ULBA 4H6XA 1NM5C 2WJHA 1K6MA 1KMHB 4FIZA 4YY3B 2RCYA 2PA3A 5DYYA 4RK1A 3WO1A 4RULA 2XVZA 3HJTA 4B40A 5C4IA 1RWWA 4AIIA 1JHZA 1RW4A 2ZP1A 4RW0A 1KDZA 3T5PA 3KYIB 1N6OA 4FVTA 3Q8LA 1U98A 2ENUA 4E11A 3A4IA 2DPLA 3ADBA 4LRQA 1N5IA 4JEHA 1EFTA 3RANA 4LSMA 3KKEA 2GR9A 3KVVA 3QPDA 1KAQA 1ZHFA 1SBQA 3T4EA 4BKOA 3R9XA 4ER5A 3R20A 4DR5B 1XJ0A 2VP3A 4O4JB 4IHAA 3TLZA 2EKQA 2I67A 4B32A 3U3XA 4IVRA 3G13A 4CV2A 2CWWA 5AVZA 1S1MA 1A8PA 3TNFA 1E3JA 3D4IA 2AOVA 4FTWA 1MCZA 3WNCA 2VDQB 3RU2A 1PV2A 3LWDA 4YJ3B 3W8EA 1BAPA 4KDRA 4OEHA 2YJ4A 4A82A 1L1RA 3HMKA 4QAJA 2WHRA 4YLYA 4PG7A 4H7HA 2V54A 5D00A 4YJFA 1PWZA 1WLYA 3MLAA 4GYWA 2BEVA 3S4YA 2F55A 3A4YA 4NFLA 4IYRA 3ST7A 1E5TA 2O7QA 2YNMA 3T0GA 1EE1A 2PZLA 5ED0A 4D74A 3U7HB 5JJKA 4UM8B 2A1IA 1COZA 5D5HA 1KORA 4B74A 1KK3A 3K1TA 4MROA 2PDAA 2SCUA 1IRIA 3FKSA 2BTEA 2Q5OA 1D03A 1XYYA 4DRXB 1JQAA 2HIHA 4E33A 4NOJA 1N57A 2OHJA 5GP1A 3X1JA 4DVJA 5JASA 3S27A 3VR6A 3TVYA 4PONA 3RYIA 2V5VA 3W1EA 4ALIA 3IUJA 2IPAB 2D0PB 1JG3A 1LSJA 1XC7A 3CZQA 5CXQA 3B53X 1DRKA 4D0RA 4DCVA 1T3LA 4DJTA 2NV6A 5TDHA 2XGJA 2UZ1B 1M6NA 2FE1A 2NPFA 1J07A 4E4YA 2NP7A 4H6WA 3AHGA 4PZCA 4UBIA 5FHQA 1SCUA 1GLNA 1RE0A 1I7SB 1KA9H 4JJKA 1ZGJA 2A3NA 2WJAA 2XNJA 3B8EA 4XIFA 3JAWA 3JAMA 3I2GA 4OX9Y 3EUEA 3QWFA 1BXGB 1LV8A 5CBPB 4UZEA 4X24A 3FPJA 3QOWA 2J48A 4Y2PA 2X19A 4HPXB 4DIFA 4O1IA 4WA7A 5JZ9A 1GQFA 2J1LA 2VHXA 1YIAA 3LVRE 4EIWA 3N2ZB 3DV2A 3KKMA 2ZIZA 3Q7TA 4L8YA 1CK4A 1E8DA 1G5PA 1DJNA 2BI8A 4HMPA 4JGBA 1N1GA 4MEBA 4MVJI 1OVGA 3OZEA 3SIRA 1JBEA 3ZWOA 1QV7A 1TYZA 2FG5A 3IXLA 2CJPA 3GGDA 3U3JA 3OD5A 1DUIA 1F2TB 1GQ2A 3W2EA 1P2VA 3DAFA 1K7SN 2OCDA 1KH3A 4R6WA 4B4UA 4JUDX 2OTCA 4UNNA 1S8NA 5HOQA 3SWWA 1QYXA 1AUPA 1G19A 1V4NA 2V98A 2F8MA 3A6HA 3LAWA 3S40A 1CZOA 4EKEA 1H66A 1II0A 2HJ9A 3N7UA 3QJGA 1MW8X 3FSRA 3ORQA 2ZYGA 2R6ZA 3RRXA 5HIAA 3BD9A 4FE3A 3GFPA 5AVYA 5AHOA 3VHXA 3WWEA 2V97A 1L8QA 3DLPX 2ZT5A 3F46A 1FRZA 2WOJA 2IHJA 3ZXUB 1U28A 5BSEA 3HCCA 5HM6A 2EX0A 3IIEA 4FD3A 5BO5A 3UENA 4ERXA 4PGFA 4RPJA 3A9VA 2VCEA 2WVJA 2JKVA 4MRPA 4LSWA 4RABA 1CY7A 2GASA 2YVUA 1B4DA 3OZGA 1E2BA 2E4AA 1U0NA 2DH6A 1LW6E 1P7CA 3SXUA 2VJQA 3IMGA 1EXWA 3QFHA 5SICE 5IW8A 5TT1A 3GF4A 3KZXA 2Y77A 1T1SA 3IDQA 2AOXA 4ID3A 1WMDA 2XCTB 4EJMA 1OLXA 2ZR7A 4D8XA 2OQRA 1Q3HA 4B4OA 1E3IA 2ADOA 2B8WA 3GB9A 4G67A 3ZEAA 2B25A 2NMVA 3TZBA 4ZRMA 1GFWA 3FAKA 1U2GC 4NFSA 2GAIA 5H4HA 5TXGA 3W4KA 3Q0EA 2VZLA 2OCYC 2UZ3A 3R5XA 2P9JA 3OPYI 1CEYA 2WYHA 4LHWA 1P7ZA 1U8UA 4M55A 3U56A 3SX2A 1BMQA 1CUFA 4I1IA 4YV2A 2V7QA 4M87A 4TSFA 3QUTA 2ORVA 3WYDA 4RF3A 6REQB 2OZKA 3HB9A 5K6AC 1T13A 2J3MA 3WLLA 2YXPX 4ACBA 5I9IA 2PPVA 1BDHA 3H42B 1HEUA 3FNIA 4EARA 2RBEA 3KXIA 2XCOA 4LWPA 1I6MA 1JR4A 2J3JA 1GZ4A 1QCYA 2EJWA 3EMBA 2C4WA 3AI2A 1PL0A 4DV1B 3P9RA 3WBBA 1MP0A 3TUIC 4M1SA 5BUCA 1DUVG 1C0IA 2O8FB 2VDPB 5IJ0A 2O2GA 2ZS9A 3D7SA 5A9TA 4E13A 4G0UA 1TW3A 1ZH2A 5C80A 1ESCA 3PT5A 4INAA 4NCIA 5BR4A 1SXJE 1N5RA 2XNDD 1BHQ1 4X3CA 3STWA 4ABYA 4XWWA 2VK1A 4HJXA 2W43A 4IOLA 1A7AA 1THTA 2BTOA 2G70A 3W2HA 3THXA 1EK0A 1THZA 3CISA 3DLBA 3G9QA 4GZ5A 1M6HA 5LXTA 3S1AA 3BT7A 1U7UA 2B92A 1JMVA 1N2CA 2Y27A 1XVTA 2ZE5A 3CINA 4XLZA 4K8OA 4QPCA 1I2AA 4D5EA 2MINB 4F1KA 1CUYA 3M4XA 2EWVA 1EHCA 1L5QA 4H35A 1JLKA 4ZVTA 2A5YB 4H4DA 2GEUA 2XTNA 3OECA 3O8NA 1K7YA 1AS2A 1Q6YA 4RHXA 2OYSA 2XQVA 5TGZA 3IQGX 1SBCA 1N7GA 5AJZA 2YZKA 1OROA 4WFKA 1HDIA 5CIYA 4EGFA 3Q5GA 3TD2A 1OFTA 5TGTA 3HCOA 4NIMA 2VHEA 3AWDA 4WOBA 2BFPA 3UUWA 3GJ5A 3D02A 3L7AA 4IF6A 3JQGB 4LYAA 3OJOA 2HLDD 3IEVA 1EAYA 2I4NA 2VDNB 2CYAA 1ODSA 2B4KA 2FRVA 4M7WA 4YRAA 4ZV9A 3CUSA 2EGGA 4YRRA 4CLOA 2PT7A 3DLTA 1CBUA 1KYZA 2IKSA 1CSEE 2V7XA 2RAVA 2J4CA 1L5VA 4KQMA 5HXAA 1TAQA 4ZQIA 3HFJA 1LLDA 2FX5A 5CUQA 2CZGA 2GZRA 1HL7A 3FUVA 5LKRA 4ZCTA 1QK5A 3O95A 1RQPA 2PH3A 3OJXA 3RREA 4RIGA 3UXMA 3WE7A 2WT8A 1OE0A 3QXJA 1S9DA 1UKZA 1T8RA 5BV8A 2C7RA 2GHQA 1VCNA 2FLWA 4G5FA 3S2SA 2W2LA 1AKTA 5T8KC 3JQ7B 4H7DA 2A86A 3UJ9A 4OTZA 5IH7A 4AYWA 2XOXA 5IT5A 1SUFA 2LCQA 3AM5A 2OXRA 3GRVA 4JI0B 4Z49A 3PGA1 5JXJA 1MNQA 3QA9A 2QOEA 4L6IA 1UPAA 2W6MA 3FZYA 4UCWA 3VBCA 3T1TA 3EVCA 5MFZA 4M99A 3O5AA 3OPQA 2BY4A 1M2KA 2ZSDA 1HFWA 1GDDA 4AJ2A 3MBIA 4N6OA 3KM0A 1YQGA 4JLAA 4QTZA 5G40A 2VT2A 3BFPA 2C29D 3CS3A 3SVTA 3MTGA 3HVJA 4FSDA 3RG2A 5ICMA 2IOFK 1AD2A 5D3MA 3PS9A 3UMGA 1WQ1R 2NW6A 3PJFA 3AY6A 3DBHB 4KAAA 4BZQA 4LEIA 2OHGA 4C76A 1UC5B 1BX3A 1GPBA 5ICEA 3OHPA 1FSPA 1VYHA 2EFJA 4BE7B 3SY8A 2VHUA 3R7DA 2OYRA 3VVMA 4GXRA 1H2XA 3HBFA 2GPTA 3C1AA 3W4IA 2W5UA 2XGOA 2R97A 2B34A 3B60A 4FBGA 1N2GA 3I0NA 4MULA 4KN8A 5H16A 3U61B 4XWKA 5ABPA 1YL5A 1Q0SA 1M1NA 3JD0A 2ACKA 4OB8A 4Q7MB 4L1KA 3L1KA 1NASA 2PZGA 2ZRQA 1YZGA 1D04A 1MGPA 5HF6A 4K9MA 1QV6A 3CGWA 3VPAA 1ZAKA 2QB5A 1YHNA 3OTWA 4LBVA 2NSYA 2H00A 3BWCA 3LPDA 2WAYA 4KVAA 2F00A 1DC8A 1N5MA 4FLFA 5KUTA 3BZUA 3N8GA 4WL0A 5NULA 3DPIA 5FPQA 4D82A 2FP3A 1G3QA 1C8KA 1VJRA 3ZHRA 2R0QC 4NG5A 1RAIA 2EW8A 2Q6LA 2JI4A 1LK5A 3DBRB 2CVPA 3NHLA 4UDXX 1GNLA 5MFPA 2VT6A 2IQIA 4MJLA 3PHHA 4RSGA 3TD6A 2UXDB 1PR4A 1L7DA 4TM7A 4F2GA 1PW7A 3EISA 2XMSA 1QYIA 2OO7A 4O08A 5A05A 1PTJC 3WKCA 4A8JB 4BX2A 1MTZA 2IK8A 2WNSA 2RK4A 4EG3A 5A5DA 1KYVA 1O54A 3DM5A 1FUUA 1Z4LA 4LPSA 1P3Y1 4B2LA 4FU0A 1GARA 1U3TA 3FRHA 2V8BA 5BSFA 2RH9B 2VJMB 4NH0A 1TF7A 1L5ZA 1E4OA 1RHQA 2GERA 4OHMA 3RIYA 4GECA 5CLLA 3NNNA 4AG6A 3IQZA 3RFXA 3SEFA 3WTCA 4DZTA 2BGWA 5IABA 4MEAA 4D9EA 2W6JD 1CUBA 1WVMA 3EGDB 3O21A 3RSHA 4YS6A 1L3BA 2WB2A 1CEXA 1EFRD 1UK9A 2V7VA 3FNFA 5B3LA 1R0RE 1VSBA 1PJCA 4NH4A 2I4MA 2ID9A 4J16A 1DOAA 4TTQA 3K15A 5C34B 4AMGA 4J7AA 3HQ4O 5JD3A 3CXUA 3F3SA 4YBRA 1GNTA 3C70A 1D8TA 4D1YA 1FQKA 4MGKR 4I9UA 3R7AA 2VNSA 1SAYA 4DG9A 2AXNA 1Z4IA 3GW8A 3O92A 1ITZA 2ZJYA 4EAQA 2XBMA 4U9IS 2EQAA 1L1FA 2CF5A 5AM0A 1WM1A 4IJWA 5JH7A 1XT6A 3GJQA 3LD9A 1PHRA 1RYHA 4IRXA 3WP0A 4Z4HA 4KYIB 4V02A 5DXAA 2QZPA 1L5RA 5A7HA 2N47A 2OM6A 2FMKA 2XKAA 3LXUX 4RL6A 2C0CA 1V8BA 2I71A 1YMUA 2W6NA 2JGJA 2RGXA 4NR0A 3TSOA 4QQ8A 3HKDB 3ETCA 4ONEA 1ID1A 4LI3X 2GF2A 5JNLA 5DWVA 1SXGA 5G4KB 1XMOB 4MLPA 3ZBQA 1KK1A 3ZHTA 4FGSA 1GLGA 3EC7A 1T29A 1AM4D 4IEEA 1O9GA 2RD2A 4GL4A 3EXFA 2AHOA 3ZLBA 4LDRA 2GXAA 3DHYA 4IX9A 4RTMA 1TZMA 2Z98A 5AMXA 5AVJA 2Z2XA 4PLWA 4W5TA 1ADJA 3GQBA 2HSDA 1E3MA 4MVJH 1JIKA 4P2BA 1DB3A 2QMUA 4H18A 1TM3E 1DX6A 1Z5OA 3AOGA 3D8TA 4KGDA 4TLMB 2WYWA 4ZKDA 2VOEA 4TRRA 5LWHA 1ZJWA 1CQXA 3R44A 5C0OE 1PJQA 1Z0IA 5DM4A 4UU7A 2WIDA 3SSOA 3WHKA 1OILA 4LBWA 3HH8A 1QB7A 2XRZA 2C2KA 3ONVA 1VRVA 4ZAWA 1H2EA 1HNNA 4FCVA 1FEZA 4L9WA 4Y2TA 3EAQA 5AK5A 3GDOA 5IAEA 5BPFA 4WN9B 3MK31 1KE2A 1NHGA 1WNFA 3DVRX 4OHFA 3WV5A 4O63O 4KNYA 4UMEA 5ERGB 1YH3A 5AVKA 1KEEA 3HDJA 4PGMA 3L5KA 2BTQA 4JQZA 2BEUB 3CT4A 3UK2A 4LQDA 4B3IA 1A96A 4RA6A 3OFND 4NBKA 3MS2A 2RKBA 3EG9B 4OBEA 1XUOA 3DO8A 3EJ6A 4H9GA 1U9IA 4NQRA 1DKUA 5JYEA 2ABWA 2PJDA 4JB2A 2IVFA 2CZCA 2DTEA 3HA7A 1JNXX 3P96A 4XASA 1HT1E 2Z3WA 3IIMA 5ES4B 1UBHS 1DCKA 2IPNA 5FLEX 1Y4ZA 1KQGA 1PU2A 2V9PA 1MJGM 1Y0BA 3INRA 4LSZA 3ZHZA 4C01A 4N3GA 2R7LA 4JQSA 3WMXA 2QL5A 3B3GA 3AR9A 1EZ1A 2J3IA 4JUBA 4QDUA 5TQ2A 3TINA 4YR7A 5CJPA 5KIAA 1GNSA 3KV3O 2IF0A 3H1EA 1IXKA 2DVMA 3LU1A 1Q3KA 4OFWA 4BFLA 3EGEA 1KHTA 2R7AA 3NT4A 1PK8A 4M0FA 1G2OA 1B41A 2PKQO 4LY9A 4HB2A 3TK1A 4F9GA 5CA0B 4YMLA 3EDOA 3RTCA 1YB4A 2ERYA 1ODTC 2R1VB 3HU5A 5CNMA 5IT0A 4Q6WA 3BDVA 1FRVA 4OU5A 3X2SA 5FX2A 3HTXA 5J4YA 1UJNA 2P75A 1K8QA 1YU6A 5ALWA 2CJXA 2JD0A 4ZWNA 4IXWA 1EG7A 2QVXX 4NZNA 4QVIA 1PQ4A 2XYGA 4HZIA 1BG6A 1MA0A 2YV2A 4BZXA 3F97A 3OEHA 2VDVE 1Q7GA 2QVLA 4DC9A 2EEPA 3HHEA 1NZFA 1WKCA 4JD5A 3W9YA 3MSCA 2UUCB 4W9NC 1AB5A 2Z6QA 3NHYA 1X7WB 2HV9A 2HU5A 1K0UA 3CIFA 2UV8A 4P82A 4R69A 1J2UA 2A78A 2DWOA 3SFVA 1PNOA 1N36B 4ERNA 2HA2A 3VGPA 1PLKA 1WPXA 2ZETA 1JHAA 4RJJA 3SBDA 2P2CA 2R8EA 5ERYA 4NPAA 2YHSA 1MABB 1Z7YA 2Z2KA 2XUZA 4PTLA 3FE2A 2CD7A 1AY0A 1T5OA 1RP7A 4JEMA 1TJ4A 2GYVA 3ED1A 4GKAA 4IHJA 1N8TA 1JHYA 1E1QA 3E0QA 4H27A 3GUZA 5FNVB 4Q18A 1QQ6A 2AE2A 4DPKA 3ZW9A 3D3WA 4BQIA 1K88A 1SHJA 4H7KA 1GTG1 1VGRA 4AUKA 4BQPA 1W0CA 3NLLA 5K0SA 2F8SA 1ZIDA 1VBFA 1FQWA 2C58A 3GO4A 3RM3A 1VPEA 3V42A 3N2YA 3JV7A 4HI0E 4I9NA 3LWZA 1U2ZA 2A4MA 5E3IA 4B3JA 4TLEA 1YZFA 3C7CB 4ZVSA 3WJ7A 4LTDA 4FFLA 4IEFB 3HUEA 1ANKA 1RRFA 4XDGA 2ZE6A 4OYHA 4KQGA 3IVCA 2I4LA 4OAOA 4PICA 1TUBA 4XVRA 4U00A 3K0CC 4B3RB 4C22A 4Y6GB 5FWDA 4RSMA 2KWIA 4BQOA 5CB6A 5ADHA 5FBLB 4IPTA 1NVAA 4P22A 4PSDA 4BNNA 2BI7A 1S2NA 3L3BA 1GU0A 3ZJVA 1EUDB 4NEHB 4HNVA 1Y42X 4HXYA 4XFJA 4HDKA 1WBJB 3ZQ6A 3O3CA 2QTWB 2P2LA 4HWOA 3UVEA 2OUIA 3CUWA 1WMBA 2GPYA 1FQJA 1UZNA 1QIFA 1XMPA 3OZIA 5I9SA 4PPNA 1POXA 3NBUA 2XCRB 4MV5A 4R2KA 4AUNA 2JIDA 3QMPA 2X6RA 4JMLA 2HEGA 3N2EA 1XTIA 2AN9A 3ZJYA 5T4EA 2OGTA 3LCJA 1HZZA 4KDFA 1EFPB 4CJXA 3IOMA 5LYJA 1FRNA 3FYUB 4C0XA 3U0BA 1X0XA 5D51S 1AKRA 3DEHA 5IMBA 1RPAA 1SD2A 3L7LA 1KWGA 1FS6A 2GCIA 1DQNA 2N75A 2PGXA 2NPIA 3B70A 2QE6A 4LXTA 5ECGC 2IXAA 4F5YA 3L7IA 2WMYA 4AMVA 4UMDA 1XQVA 4II7A 4V2UA 3ZNOA 3WMRA 1XP5A 1P31A 2OQVA 1M66A 3BSWA 4PRYA 3E84A 4CM4B 3YASA 3NM4A 3H4MA 3QYAA 1P91A 1R9JA 4M0MA 1JA1A 2IOFA 2WFZA 4R1LA 4RVGA 3KOWA 4ZPXA 4LDPA 2QBYA 1QX4A 3U13A 2HLPA 1R4NB 1ZU5A 5HBGA 1Q16A 4G1CA 3I1IA 5EYPB 2I2XB 3COWA 5LUAA 4JL6A 2CUKA 1WB9A 1P39A 1OA1A 1U0SY 3TM4A 3ZGXA 5F98A 3RWMB 4BNLA 1ORIA 1KY2A 4MCIA 2PQMA 2PQ2A 4HTFB 3VTAA 4CXMA 4B75A 2H3HA 2VNHA 4KVFA 2I33A 2CMFA 2V3VA 3VNQA 2FTKE 1NY6A 5E1MA 3K2QA 4E0BA 2HRRA 3WAGA 3CMMA 4QATA 1JIVA 4JN6B 3FROA 4P3YA 4WCFC 1NVXQ 3ORSA 5IXYA 3OA2A 2B30A 4FC7A 1YK0A 2X1MA 4TKLA 4RY9A 4Z1MA 3VDRA 1I3LA 2D5BA 1NW6A 2RHGB 3ZI7A 2XW6A 4HLDA 1GWNA 1X1SA 4GYYA 1E9SA 4BO8A 4DSNA 2ZREA 3IUBA 2QORA 3ZWBA 4DFDA 2X3FA 4ETMA 3EIWA 1DJPA 3GVIA 4PNHA 1JDBB 1JS1X 3OI7A 3MC1A 1PWYE 2RH8A 1VPDA 5HEKA 1ZD1A 4AF7A 4N41A 3VX4A 2VP0A 3KUXA 2VS1A 3O0DA 4MVWA 4N4AA 3S5JA 5K20A 4WLUA 1AO0A 1I7NA 4G0YA 4M9QA 3ZCVA 5E3HA 1SVUA 4B73A 2XBLA 4HR7A 2X8LA 1F0PA 3RIGA 3ZDEA 2DX7A 4O6VA 1QFXA 2FYTA 1KZ9A 2NTVA 2R5FA 3BJIC 3FOBA 3E9RA 5AKJA 3RS4A 1UKYA 5LQUA 3I6QA 2FUCA 1SCBA 3HY6A 5I3CA 2WAAA 2Y9MB 5GVSA 2VRCA 5IDWA 3A6PC 4YQZA 4EYOA 1BZYA 1P75A 3K9LA 3M6WA 2ILVA 4FB4A 3BRWA 4J7XA 4PAMA 4RENA 4QLAA 2NXEA 3PDHA 4ALLA 1FUYB 3JWGA 2LIPA 1KR5A 4PBTA 4PR0A 4RO0A 4TYMA 4EB6A 1RC0A 5JLJA 2PRZA 1INLA 2A9VA 2BKVA 3NXSA 4HG2A 1SCKA 5DOVA 3MT8A 3QQPA 2H1VA 5KYTA 3Q5DA 3LUPA 4LC1A 4HATA 2NACA 1MZVA 3NYWA 4G5RA 3W6PA 1TD1A 1XEWY 4YMVA 3EZGA 3AFIA 2FP4B 5ALRA 4R1QA 1PR2A 4XSGA 3F6SA 4HADA 5EVJA 1VI6A 1RJ9B 3DKKA 4KQIA 3RGWS 4N7MA 3R8XA 2PS9A 1VLZA 3CNQS 2ZJOA 3IAM1 4JJ6A 4F9FA 4C7OA 4HEQA 4YV0A 3LK7A 4V1CB 4BJ3A 4OM8A 4CKEB 5LU9A 4UCQA 3HR7A 4OHCA 3Q7RA 1JH9A 3UYLA 2NSHA 2QY6A 1QHYA 2AJBA 4HDAA 2X2OA 4POAA 2H4XA 4D79A 2AMYA 2W98A 2YFKA 4UNRA 4P9NA 2O07A 4JC8A 4OJYA 3EXIA 1JQEA 1WSBA 1FXUA 1ONSA 3R74A 4E32A 5AFSA 4FM9A 2Q4OA 2IUSA 1Z6GA 2PWZA 3F6EX 4HZGA 5G53C