4XM3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xm3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xm3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xm3A02
4URRA 2VJJA 1AIRA 3GQ7A 4XOTA 4Z03A 4XQFA 1O8KA 1RU4A 4XONA 3KRGA 1DBGA 4W8QA 2X85A 4U49A 3GQ9A 4XKWA 4OZYA 2VBEA 4W8SA 3EQNA 1IDJA 3WWGA 2NT6A 4OJ6A 2O04A 1OGOX 4MR0A 5C1EA 2UVFA 4YZXA 3B4NA 4MXNA 1OGMX 4XOPA 3VSUA 2EWEA 2O17A 1O8IA 3ZSCA 4C2LA 2PYGA 4XLFA 4AVZA 4W8TA 1DBOA 1VBLA 3T9GA 1KCCA 2X3HA 2Z8GA 3LMWA 4XN3A 4HWVA 2NTPA 4OJOA 2PECA 1EE6A 3VMWA 1H80A 4YEJA 1RMGA 1O8DA 2NT9A 2X6YA 4OJLA 4XNFA 5AMVA 4XLCA 3SUCA 4YZQA 2X6XA 4U4BA 1O8EA 1OFMA 2INVA 1BN8A 2QY1A 4PMHA 1OOCA 2O0WA 4YZ0A 1PXZA 2VJIA 1NHCA 1O8HA 4XR6A 4XORA 1QCXA 2UVEA 1XG2A 2ODLA 3EQOA 1BHEA 4XM3A 1CZFA 1HG8A 1O8MA 4YZAA 2NTQA 1WMRA 1O8LA 4W8RA 1GQ8A 2BSPA 4OZZA 2NSTA 3VSTA 1K5CA 2O0VA 3VSVA 2QXZA 2VBKA 1KTWA 4NK6A 4XLHA 2VBMA 4XMYA 1O8JA 1JTAA 1PLUA 3GQ8A 4I84A 4OJPA 3ZPPA 2NTBA 2NZMA 2IQ7A 4Z06A 1JRGA 1IA5A 4XL9A 1X0CA 4XN0A 2INUA 2O1DA 3JURA 3UW0A 4EW9A 1KCDA 5C1CA 1PE9A 3B90A 4OJ5A 2QX3A 3B8YA 1OFLA 1QJVA 4XLEA 1RWRA 4XKVA 2PYHA 1IB4A 1O88A 2NSPA 4Z05A 4YELA 3GQAA 4NK8A 1IDKA 3GRHA 1O8FA 3VMVA 1O8GA 3FY3A 2X6WA 4XLAA
chains in the Genus database with same CATH superfamily
1Z3YA 2DA3A 1T6SA 1D8JA 3V8LA 1J9IA 2E19A 4Y3OA 5FLMJ 3T5XA 3S93A 1OPCA 1FX0A 2D74A 2V1XA 4ZC3A 3KRGA 2LFBA 5CLSA 3S2WA 2L01A 4TMZA 4KN7X 3ZQLA 2EK5A 2ACJA 1MBFA 2IEKA 3FPKA 3D5LA 3VR6A 1S9HA 1YS7A 3CF2A 3U21A 1K4TA 2KP6A 1V0FA 1QA2A 2VQHA 2XTXA 4TT3A 1N78A 1WJDA 2CO5A 2OUMA 3HEFA 4ZDPA 3D26A 4RD3A 4O6JA 3AVWA 2LOOA 3T1BA 4MGRA 5HXBA 4MR0A 2O61A 2XC1A 2KFDA 2KMUA 3OAAA 5DNSA 3BZCA 3OIOA 1N0UA 2HPIA 1DP7P 2V1NA 2EV6A 1WPKA 2Y69H 2WJYA 2YX4A 4CZZA 4B4DA 3M1CA 5B5EC 2ZMEA 3GXOA 2Q6IA 3A8KA 4RS8A 2BV6A 3A4CA 2XF7A 2D45A 2B0RA 3GX4X 1I5ZA 2E5NA 3LSJA 4PDKA 2GZWA 2XB5A 1XSVA 1O8DA 3OYFA 1AA7A 3ASSA 4CYCA 2K27A 2NVQJ 4MIMA 3CPXA 3ABKH 4Y17A 1TT5B 3LAPA 4P3IA 2GWRA 1LUJB 2L2OA 4B43A 3AGPA 1MW7A 3OYGA 2J7KA 1AMOA 3OR1C 2E1MC 3QSYA 1PDNC 2C5BA 3SZEA 5EDNA 3DTEA 3CMYA 3KLOA 4E7ZA 4Z4TA 4EJOA 1YX5A 4CCJA 3K70C 2VOPA 2M1BA 4RD6A 1SMYF 1JUPA 1UELB 3CC7B 1SC7A 4OIQF 4AIKA 3C7JA 1PJRA 5CYVA 4BQQA 1Y0RA 4C3JJ 3D1NI 3BTJA 4FTHA 3F9KA 1TQIA 1A6IA 2MYSA 1OGIA 3WNDA 4RBOA 1AU7A 3HOSA 3BPXA 3Q0WA 4FN5A 1T56A 4A0YA 4C3HJ 3S17J 3HOTA 2GIZA 4BBRJ 4V19K 3K4MA 5E20A 3I0TA 2PQ8A 1MBHA 1FLIA 2RC4A 2E1CA 4WXCA 3PA2A 1F43A 3FXOA 4Z4SA 3ML6A 2F5DA 6PAXA 2DOGA 4YHBA 4Z06A 3JSPA 4QUZA 1Z3XA 1OISA 2JTVA 1T95A 3CCJB 4HX8A 3JQPA 3ZN1A 2CG4A 2EWNA 3D5SC 5LRRA 1PJ5A 1TUIA 4CCOA 2XB0X 4FCYA 2O1DA 2RDPA 4IHXA 3HSFA 4ON0A 3OS2A 4L18B 4XSXF 2HMAA 4U87A 1RZ4A 2M34A 4RMNA 4XKVA 2LVSA 3PENA 2OZUA 2NSPA 2PLYA 2Y75A 1D0YA 5FO1A 4LC0A 1K78A 4I98B 3A0BC 4LGWA 4TV7A 1RNLA 1YJNI 1V5VA 1DDIA 3DV8A 2EIJH 3P9IA 5LGNA 4M1KA 2DMPA 2LRDA 5D8LB 2X3UA 4ZCMA 2WYRA 1SFKA 2R0QC 5IYRA 1W35A 4BUPA 1FIAA 3I59A 1GHCA 1WJEA 1W5TA 2R7QA 1Y56A 3WG9A 4B8XA 5BPDA 1EF4A 3CDHA 3SJPA 2V5IA 4I0AA 3V7AA 1UG0A 1QA6A 4ROXA 1I1GA 5F0FA 3K4BA 2ZJRF 2GXBA 4JOMA 4DZPA 2DXIA 3SJZA 3G1OA 2MC3A 3BG7A 1R5NA 3FIWA 2VBTA 2K86A 3DLAA 2CV0A 2BMWA 2L4AA 3BR0A 3PNTA 4HE6A 2A5WA 5FKOA 2V7QA 2WADA 4O5VA 1LLZA 1N08A 3F8BA 2KIFA 5E1XA 4CDGA 1GVDA 2CC2A 4AVZA 4HNTA 2ZMEC 2KT0A 4LLNA 3S1QJ 1W7PD 1LE8A 2OCEA 3MZHA 2ISZA 1ETKA 3J81Z 3ASPA 1IDYA 1X1DA 2VBYA 4I2OA 3GQBA 2A5YB 1I3AA 2CGPA 3HOWJ 3S2DJ 4YEJA 1H80A 1RMGA 3AG3H 1AWCA 1ZRDA 4M6VA 4LBYA 4WZLA 2DYIA 1F4KA 1MGTA 3VB2A 5BQTA 4I09A 1SM4A 3U6KA 4WZTA 2LKPA 3CP8A 1KQ8A 3OYKA 1IUFA 1K6YA 1YLFA 1TWGJ 2K85A 2KJCA 1XDUA 3HRSA 4PFPA 3ZCOA 4XRSA 4QTRA 5H5JA 4FHTA 1D0XA 1GVHA 3J7AY 3JRBA 4RAZA 3LQEA 2RVCA 4BNCA 2IVMA 4GYGA 2Y31A 1A31A 1IV6A 1W9XA 3HPGA 3PM1A 5DD8A 3T8TA 4E7HA 4P12A 1QRYA 4EEFG 3F6OA 3K7AJ 2M4KA 1S4MA 2Z99A 5HOOA 3HOYJ 2EBIA 4RB0A 4UUSB 2GK6A 2BHZA 1WI3A 4U7BA 3MCAA 3H5NA 4XM3A 4BEHB 1R1TA 3I71A 4MFDA 4Z4RA 1ZM3A 1H89C 1WMRA 1R1VA 2P8TA 5IYCJ 2X53S 4HIZA 4PCQA 1B4AA 4Y7CA 2XGEA 4OOXA 4WXHA 3VDXA 5LD2C 5IK2A 2G0EA 2KJBA 1BBYA 1KMHA 1BR2A 1XGOA 1JTAA 3SDBA 2NNYA 1SAXA 2JN9A 2YWGA 4WZKA 2ZL6A 2I10A 2JDIA 1U6GA 2C4TA 3PUMA 1QVGB 3JQQA 3V7CA 2RNGA 4PFOA 1L0OC 5DYMA 2ZNZA 4JYKA 1R7JA 1D5YA 1YX2A 1IUYA 1TL8A 3IL2A 4G7ZF 2EA4A 1C0WA 2NT9A 2JA6J 5C4XJ 3Q6RA 1WGXA 2W25A 2WAEA 5GP9A 3ELKA 1D3YA 4TMWA 1W5CC 1TYWA 3QFRA 1I7PA 5EG0B 3N6ZA 4X07A 3BWGA 2X0LA 4UV9A 1G8XA 1X1CA 1FOYA 2NYXA 1RWRA 4R79A 2XPVA 2GA1A 3E3VA 3HUGB 1BR1A 1MBJA 1H0MA 2ZZGA 5TY0A 4L5EA 1X1AA 3RPQA 3BZ6A 2HVRA 2W6JA 3CC4B 1IDKA 1GLNA 3B6CA 3FY3A 3QQAA 2EFGA 4HRIA 3LSTA 2VUMJ 5DUKA 2ID3A 2MSYA 1IRFA 3OW7A 3WY9A 3OEHA 1E3OC 4BH9A 5GPAA 3JAMK 1DBGA 2JSCA 2Z1DA 4RM0A 1I39A 5J1YA 1N25A 1G3WA 3Q0UA 3VYUB 3QYBA 3CDIA 2HNHA 5CVVA 1JJ2B 2LSOA 5D5UB 5FLVA 2MH2A 2DAOA 1MJ9A 3TQNA 1HDDC 3RKQA 4O3MA 2DCUA 2FUG2 5AONA 4G7XA 4MQ9F 2O04A 5IYNA 5LEKA 5CQEA 2A6HF 2LREA 4IHSA 2TRTA 1R1UA 1WRJA 4XOPA 2O17A 1YW8A 3HHGA 2F48A 3E20A 2JJ1A 1O7LA 1KJZA 3DF8A 1SVMA 4DK0A 3T9GA 4G8XA 1DPUA 5HDKA 1MDMA 5J3LA 2GOXB 2NTPA 2EINH 1IJEA 3SFIA 2JVGA 1F1ZA 3I9V2 5J4YA 2STWA 3GVLA 4YAOA 2DLLA 3CD6I 3QP6A 1E2XA 1ZR4A 5K7FA 2XNJA 2DA5A 3KL9A 1I27A 1KU9A 1WCMJ 1LVAA 2NS0A 2XF5A 1MSEC 3U9GA 4OJ6A 3BR6A 2AXTC 2M45A 2VBWA 2ZMEB 3FXJA 3W2WA 1YJ9B 3A03A 1OCTC 2X6XA 3L2QA 5LFAA 3VPRA 2Z2SB 2MH9A 5ED4A 3W2AA 5LGUA 4NUBA 3DU1X 3CLQA 3FKJA 3DEWA 1QPIA 2STTA 2BV3A 2F1LA 2M5SA 3CMAB 1TWAJ 4JP0A 1PXZA 3EUKL 2JVHA 2CBXA 3DPTA 3K4KA 2DFFA 5TGTA 4R8HA 4A3IJ 1TBXA 1XG2A 2F5CA 1IF1A 2ME6A 4EH1A 2JA5J 1TSPA 3HIFA 4NQWA 1Q1VA 4R71A 3RDIA 1SVLA 3V4GA 3J80K 1B8IB 3MZYA 3TL4X 1ZG1A 4IKFA 3G4SI 4FX0A 3OYEA 3Q3AA 3FM3A 2Z6BD 2F5FA 5D4RA 1I1SA 3D5RC 2XKPA 1RR8C 3BJ6A 2VFOA 4KIBA 4KIFA 4Y7NJ 4KIGA 1OYIA 1LVKA 3EETA 5K5RA 1K7AA 2GXGA 3GZ5A 4IRIA 2IJLA 4M3GA 2O8KA 1ZH5A 1AKHA 1FNCA 3WBKA 1FBUA 1FY7A 2VIXA 4P9FA 1WDTA 4P6YA 5FD5A 4HOBA 1YTYA 3NAWA 1ZLJA 4EW9A 1KCDA 2FEZA 4GXOA 2W7ZA 3LSKA 3PUBA 2VASA 2V31A 2QX3A 1QJVA 3B8YA 2I8DA 4UUTA 1BIBA 4UZEA 1VF7A 4Z1MA 3FKSA 1VQLB 3BH6B 2QZAA 1STZA 4AVPA 3P4GA 2QDXA 2WJVA 1U3EM 4F7ZA 4UVBA 5L3GA 2XC7A 5DD4A 4LJZF 1IAWA 4CCNA 1MDMB 1D1BA 3FXUA 3CCSI 1O8FA 1VJSA 3CMMA 3OKXA 2X6WA 2Y0SN 4PJ0C 2Z9OA 3BP8A 4AC9A 5DS0A 4WQMA 1BC7C 1VQNI 4I01A 3S1NJ 3JRCA 1T6ZA 2Y0MA 2PMZN 2K3FA 3KYLA 3WBJA 2V79A 1IV8A 1X4OA 2WAQN 1JKPC 3BNWA 5HNFA 2DQRA 2F4OB 2XPWA 1R5ID 2ZXJA 3VYSB 1MJAA 4E7IA 2ZZEA 1ETQA 1SD4A 2P5KA 1XE1A 4P25A 2V6EA 1KQSB 1SVOA 2VKEA 3RJPA 2DDAA 4HV5A 1FRNA 4K1XA 3WGHA 2HXOA 2QWWA 1ONVA 2O6WA 3BR5A 1KRHA 3C18A 3ZQGA 1YX3A 4MXNA 1RKWA 2HOSA 1TWFJ 5EZHA 4J19A 4RD1A 3L2CA 2BY1A 4M6XA 4C2LA 1B8IA 2E1OA 4UZFA 5LHHA 3S3MA 2IGNA 1Z1DA 1O3RA 1YG2A 2ZJPF 3GTPJ 3ABUA 5E3MA 3CCMI 3LMWA 4YG2F 3KP7A 2WB1A 1JGGA 4KDPA 1QUEA 2OBSA 1DDGA 3MZ8A 3CESA 1A04A 3OYDA 3RQIA 2ZO4A 1N07A 4MYUA 5KVRA 3I4MJ 3PUNA 1D8KA 1VHEA 2CQ7A 3PA1A 1DP3A 5IPAA 3VFZA 5ERIA 5IYBJ 4XD7A 2J8KA 4Z4YA 2QE7A 3F3XA 3ONYA 3U2QA 3CJQB 3C2HA 3OYIA 2PE3A 3H36A 4PGGA 3ROUA 1Y0NA 4A5MA 1I18A 5GV7A 2QQAA 1RPWA 3RPUA 3ASRA 1T38A 1QNTA 1H85A 4UNOA 2B7BA 2XZOA 3G3ZA 4A12A 4KITB 1PP8F 2R6HA 4XORA 1MMDA 4S0HB 1VQ6I 2XROA 2IRFG 1NK2P 1XGNA 3G71I 1YQAA 3VODA 2V6CA 3T51B 2L54A 1I50J 4OM9A 3FJOA 2GQFA 2Z5UA 2ZXHA 2BXYA 4W8RA 4X7DA 2VC0A 3G6EI 2VKDA 4ESJA 2V7FA 2WBMA 3RTRA 2HTSA 3ZR8X 1BMFA 3A1PA 5JVTA 5HDGA 3H1CA 4BEHA 4MYTA 1MMSA 3HL2A 1TNSA 4KJZA 3W5VA 3VNVA 1U5TB 2INUA 1S3JA 1YJWI 1EP3B 3CCLB 4N9HA 1YHQB 3W2HA 2DIEA 4DYRA 3QE2A 1OFEA 3W2EA 1UB9A 2O03A 5GAHJ 3G73A 1PP7U 5F04A 3JRFA 2HKOA 1V3FA 1HZEA 1BR4A 2XVCA 3GTGJ 2XRLA 3NAUA 3OYBA 3WHCA 1EH8A 1IG7A 5BPIA 5H20A 1EA3A 2GJKA 1GV5A 2HDWA 3DDYA 4Z03A 4W1UA 1MSFC 3ZGKA 2D3LA 3M8FA 2DJIA 3ZMTA 4ZYGA 3OOCA 3SFZA 1FBSA 5M5WJ 2QBYA 2R7OA 4XRMA 1NJID 5BSXA 2HOAA 5JLWA 2DN0A 4IEJA 2XZLA 4W8QA 2XGCA 3BROA 3OSGA 1KTVA 4U49A 1OYYA 3KZIC 1W2BB 3S16J 3LMMA 3FPPA 2AQEA 5A88A 2E7XA 1MNMC 4IHTA 1T6YA 3BPVA 2O7OA 4KICA 3A1YA 5J8CA 2E2IJ 4NCNA 3SLNA 5DSZA 1HQCA 1IDZA 3KEYA 3TH0A 4QVAA 5C1EA 4Y13A 4OPVA 2F3LA 3E5XA 3LSIA 1U9NA 4D7MA 3CCRB 1FYLA 3FDYA 3Q9SA 3WHBA 5FKNA 3K4CA 1SAUA 3E5UA 1EH7A 2LY2A 1BJZA 2R7ZJ 2X3HA 2MD0A 1EFTA 5C3EJ 4TSFA 1Z21A 5DCMA 1WZ2A 4YIFA 2PX9A 1JJ8C 3ZOBA 2PECA 3L2RA 2XAFA 1K8FA 4XRFA 2IS6A 2EIMH 1NB0A 4A3LJ 2KLOA 2LKSA 3H5RA 3ZP5A 1ZAOA 4TMTA 2ZBKA 3HRTA 1O7FA 2JRTA 4BL0B 2NV4A 3TDZC 4LIVA 2RN7A 2R5YB 1TP4A 4M74A 4Q47A 3PL8A 3VNUA 3V76A 4AUXA 1UD8A 1Q7YD 3FHNA 4X7CA 4HA8A 1XGSA 2IAIA 2VE8A 3HXLA 3Q6QA 2HTJA 3PNVA 4WZEA 4NB5A 5EMNA 4N9IA 3I5UA 2W00A 4OPSA 1EFRA 3DBLB 4L9NA 4G6DA 4M9ZA 5E1WA 1X19A 1BHEA 4QIWN 3I58A 4P55A 2LLKA 2C77A 1A8PA 3T0YA 5K7HA 3F22A 2R7VA 1BI2A 4B47A 2F4IA 3NWSA 2QF7A 2X51A 3O2PE 2LNBA 2IT0A 5DM6F 2QBYB 2XTYA 3NARA 3ZQ7A 2NSTA 3ASOH 5IYPA 2O0VA 2M9HA 2QXZA 4NQWB 1USSA 4A3FJ 3L2UA 4MLOA 4WK8F 3GQ8A 3CO6C 1Z05A 3H0DA 2R7WA 1VQKI 2NZMA 1FC3A 4BE2A 4OIOF 3ZBTA 3P9CA 4M9XA 1JT0A 1VQ6B 1X0CA 2XHKA 4HDVA 2QLZA 1K6OA 1QHHD 4IW3B 4YXWA 3BCAA 4DNCA 1J5YA 3ONQA 2WAFA 5FKKA 3S1RJ 4RGSA 1M1EB 2KKOA 1MBGA 1VQPI 1DU6A 1QH0A 1HVXA 3HAGA 4FQGA 3LYCA 4AIDA 4BYYA 3CF5F 1P7JA 2PYHA 3EUHA 4BJ6C 3JR9A 2MABA 3KYDB 1AKHB 3GTLJ 2XEXA 3B6AA 4BE1A 1FEXA 3A3GA 1SD5A 1Y6IA 3HOXJ 3HZJA 4YAFA 3DTIA 2ZFUA 2MD5A 4TMVA 2VB6A 3F72A 3NWTA 4UAJA 3RI4A 4QFMA 3B8HA 2MC4A 3BY6A 2LDUA 4ZYAA 4ZGQB 2QN6A 1JE8A 3GQ9A 4OZYA 5F64A 1ZELA 2Y9YA 4HPQA 4HX4A 2DCEA 4ZYHA 4KNYA 4JMQA 2DFIA 3N97A 2OYNA 5FRNA 2X1EA 4HF0A 1WH5A 1XMXA 1W36C 4KYWA 3TBIA 2WZNA 2YWFA 4G6QA 4NC6A 3WWGA 3L7WA 3SYJA 3RZDJ 1S29A 2FMLA 1S5LC 2WY8Q 5J6XA 2BY3A 3DBRB 2JJ2A 2X0KA 5FA6A 2JUGA 2P6TA 2R93J 5F0HA 3IRRA 2NS8A 1Z7LA 3KP3A 3AL0C 2P6SA 2Z16A 1T33A 3R61A 3ABLH 4EM2A 4G6TB 3ULQB 1TYXA 2ISYA 4L9TA 3ZMSA 4QV2A 2QUFA 2JSPA 2Z8GA 3SYTA 1BLIA 1R00A 3WYAA 2QKLB 3P9KA 1YIJI 1APLC 2ZL5A 1J75A 1T2KA 5H6QA 4DNTB 3VMWA 1SANA 2AXLA 1FSEA 5TRDA 1E3PA 2VQGA 1GO2A 3KP6A 5L3FA 4X0CA 4X7FA 2L7ZA 5AMVA 1E1QA 3JREA 3HRMA 2ZB9A 3BG5A 2HVSA 1J09A 4QPQA 5TISC 2BY0A 2HPMA 1E0EA 1B9NA 1WOPA 4LBWA 1WH7A 2Y2ZA 4AIHA 1T39A 5GTIC 3ZIAA 3WTUC 2INVA 1QVFB 2Z33A 4N0BA 2H8WA 4A3JJ 2WAQA 2R3SA 1BA5A 1BQEA 1UHWA 4RB2C 2COMA 3PNYA 4L9VA 4XR6A 4CO8A 4GDFA 4HF1A 4LBZA 5GAEJ 2E1NA 4V2FA 1QCXA 4YFOA 2P7CB 2E34A 4FETA 3AL0B 2OTJI 4P9UA 2D9RA 3OOUA 1OB0A 4ZZLA 5AN9A 3F21A 3DBHB 3CQZJ 4MEXF 2QYUA 5ILSA 5LBQA 3S3OA 3G4SB 4OZZA 4KISA 3ESWB 3KPHA 3CLOA 3OZWA 3OMYA 4M9SA 4IRHA 1UJ8A 1Y1VJ 4LD5A 1PJ7A 2HYGD 4QLCU 1FNMA 1Z7UA 2BXZA 3GTJJ 3BR2A 2LC2A 4G1VA 1EJ9A 3TOBA 2V7TA 2IQ7A 3SQNA 1X1BA 2OJED 1Z77A 2FOWA 4OINF 2G7HA 4XN0A 1EP1B 4MEYF 2YUHA 4BPRA 3LJYA 1UZCA 3CUQC 1JJ6C 2L4MA 3WODF 4AF6A 1PE9A 2NVTJ 4IQ4A 1OFLA 3I3LA 1QUFA 3TO9A 3S8PA 2FQ3A 1LLWA 2MW8A 4H9GA 1XGMA 1BL0A 1Z6TA 1G7RA 4ACAA 4BHPA 2XAJA 1U8BA 2GBYA 2YSRA 4HV6A 3B82A 2PJRA 4WF2A 1ZTRA 2GK7A 2DYSH 5B1BH 3ZBUA 2QSGX 2BVMA 2KRFA 3GFMA 2NVUB 4F92B 2IGKA 4XONA 5FFZA 1BI0A 4IJAA 3QFTA 4ZYDA 1X3UA 1XS9A 2K4JA 4C2UA 1CGPA 1YRNB 3HTUA 1ON1A 1V54H 2ZSHB 1W0KA 2YUSA 5LMZA 2A69F 4FXUA 4X0GA 2VBSA 3ECOA 3IUOA 3KIOA 3S32A 1Q9SA 3K6GA 2UXXA 4GFBA 3HGGA 2K9MA 4RAGA 1MMAA 2CMPA 3FWEA 2QEXB 4LIUA 1G4DA 2I1LA 4ZV4A 4EGZA 3RKWA 1I3QJ 1BI1A 1A5JA 1OFDA 2LK2A 3GO5A 1YO5C 2F6CA 5CVIA 4BAYA 2WWYA 3J80Z 2Q0OA 4II3A 1IXCA 2VQCA 3LVBA 5BNGA 1N06A 4P1WA 1GDTA 1VQMB 1X3WB 2W57A 4RLFA 3ZPNA 3SY2A 4OJOA 3CC4I 4EJWA 2PMDA 3GWZA 2VZLA 4MTEA 5HZAA 2BHYA 3LA2A 1ZREA 5FROA 2DYRH 1EE6A 4UY8I 2G9WA 4XKCA 3MEXA 5FKLA 1JXSA 4XNFA 3LNNA 4UB6C 2Y30A 4KT5C 4WWCA 2GOMA 2Q2EB 2QMUA 3FXLA 3SKBA 4W97A 5JMCB 1KYWA 1OFMA 2LR8A 4GRIA 1ODDA 5GPCA 3PJRA 1T6XA 4P6VF 5L46A 3RQ4A 3CB4A 2VJIA 2VBXA 4C2TA 1GAWA 1DPRA 1V5GA 3VWBA 2BW3A 3WTTC 3JRHA 5C4JJ 2UWMA 3H9QA 3CC2I 2ECBA 2RGVA 1B72A 3JSOA 1TC3C 2IS4A 1RRJA 3V42A 4NHJA 4D5FA 1CZFA 4NNJA 4ENNA 4MHGA 1O3TA 4P22A 3LSRA 2BSPA 1BM9A 1K5CA 4RGUA 1UG2A 3ZQHA 4C3IJ 2R7XA 3K10A 4YCQA 4LG0A 1SFEA 4XMYA 2DA2A 1TW3A 3MKLA 1LM1A 1W4MA 2R92J 4B3GA 2VPLA 4PJLA 1FTZA 4ZYEA 3ZQCA 2VT2A 5GTHC 3B78A 5KHDA 2BZTA 2LYCA 3PSSA 3H9NA 2WV0A 1V5FA 3SDGA 2X1DA 1Y8RB 4RD2A 1B23P 3JTGA 3OOPA 4XLPF 3GLXA 2ELHA 2CSOA 2EB7A 2V7XA 1MJBA 2B0LA 4P5OA 2VPRA 1XN7A 2AS5F 2VODA 1NTCA 4HE5A 3BH7B 4ENJA 2GAUA 4QSHA 1NK3P 2PMUA 4IOAF 1IRZA 4F93B 2L9RA 2ZTGA 3TDUC 5E3LA 4EMSA 4KKTA 4AF7A 3UR3C 4OIPF 1IB4A 1LDJA 1G7TA 3CCYA 5EEGA 1WI9A 3E0JB 4Z2YA 5BS6A 5GAGJ 1NH3A 3R6JA 3L9FA 2HS5A 4B3XA 4BXFA 3WTZA 2KIMA 4IQJA 2OCCH 3MMYB 4PC2A 3W5HA 4MO7A 1W0UA 3WXMA 1O57A 3BTIA 3DEUA 1IGNA 4OOSA 1D2EA 2PI0A 4PUSA 3K4NA 1VQPB 4YEIA 2LTPA 3KZYA 4XKWA 1BIAA 5JHUA 2ZJQF 2LY1A 5FRMA 2KVOA 3MMPA 5GADJ 2DA1A 3BC9A 4Z4ZA 3EQNA 3MQ0A 2HFHA 1ETWA 3IKTA 3HOVJ 2OBPA 4PC3A 2KRHA 2MFZA 2RKHA 3A2KA 1LEAA 2XAHA 3IH4A 3WU0A 1J9ZA 1GR1A 1OGOX 3WGIA 2CJJA 1LFUP 5KW9A 3J7ZI 2EFWA 1B72B 3BJOA 2W24A 2ZC2A 4D5CA 2R7RA 2ZCWA 4M53A 5A2QZ 3M3YJ 1O3QA 3PFIA 4ENKA 5F4JA 3ZUGA 1QG0A 2FJ1A 1TLLA 3ECHA 2NVYJ 3T56B 3QODA 4DBQA 2O9LA 1Y0UA 3C2BA 3PO2J 2VFQA 1RQPA 1QHGA 2V1UA 3HM5A 2JJ7A 2H27A 1IN8A 4LG0B 2JK3A 1HSJA 3LO8A 2BYVE 2DPDA 2W84A 2D1VA 3OYCA 2BVNA 4RCYA 2EA2A 4DOZA 1FPQA 3J81K 4BGDA 3Q5FA 1ZGWA 4UZUA 1YJNB 2OTJB 1BW5A 1M1KD 2KIUA 3EYIA 1FOKA 4HX7A 3K1PA 2L9VA 4U4BA 1ZARA 3IC7A 3ZMUA 2PG4A 4D1QA 1RQRA 2HI3A 4DBRA 3OWTA 4C2MJ 3D0SA 2P5VA 1U78A 1N75A 3IH2A 1LEBA 2RAEA 2M87A 5E3OA 1KZHA 3V8JA 4I02A 3IWFA 4R1HA 1MMNA 1VQ4B 1PVEA 3OSFA 5HLHA 1RIOH 3GTMJ 1YIJB 1JTYA 3LSHA 5HLGA 1W87A 2VQLA 1ZM2A 2HOEA 4FK8A 1O8MA 1P7IA 2A3SA 1OYWA 3N90A 4OOVA 5A89A 1EV7A 2K9LA 4QPOA 5LHIA 3DEEA 1QVUA 2KZVA 3JTHA 1P6RA 2E36A 3CCRI 2JZYA 4G5GA 3UKGA 4B09A 2G0YA 3JU4A 3HPHA 1PLUA 2CFXA 5LEJA 2B7CA 3IRQA 2PLFA 4KFCA 2HCJB 1WJAA 2H6CA 2XDVA 4PGHA 1V0EA 3ZPPA 1VQ8B 2PN6A 3K69A 4C0SA 1QFZA 1OQYA 1WSVA 2DFHA 3TOAA 3E1SA 3MKZA 3SZTA 2BM1A 2Q8KA 2CW0F 1DDNA 2DETA 1FNNA 4AIJA 1EWYA 1W7PA 1D8TA 5A2QK 3K2ZA 1PUEE 1Q81D 1KQ5A 1O3SA 3S3NA 4PAAA 4TKOB 1O4XA 2TCTA 3ZC3A 2DDBA 3MWMA 5GV8A 1W34A 2FOKA 1UMKA 1F9NA 4DJAA 4ZDOA 2VXZA 2JWTA 2K9SA 1QZZA 4URRA 3M8EA 5EG0A 3ZQFA 1KK0A 3GQ7A 4A3MJ 4E4HA 3S15J 2QA4I 1TWCJ 1X2MA 5D5XB 3CMAI 2NRAC 1QRCA 3G1LA 3MHPA 2CQXA 3HOZJ 5HDNA 2V1DA 1POGA 2VBEA 3OR2C 3X2QH 3AVUA 3U1KA 5CPRB 4W8SA 4RGRA 2R7FA 3BJAA 1VQKB 4ZCLA 2UUZA 3GTOJ 2CYYA 1R5OA 1HKSA 2GIVA 2J5OA 4FT8A 3BTLA 3BR1A 2Y0SA 3LFKA 3QPLA 4M71A 5F27A 2UVFA 2DY1A 3GF2A 4WXDA 2GLOA 1MRZA 2X4HA 1JI8A 3R6SA 3K0LA 1O8IA 5CJ9A 2KQRA 2DA7A 1FZPB 2XGXA 1XC5A 4RLZA 3HRUA 3M8JA 4B3AA 2DOAA 3ERED 2JN6A 1KZLA 2KL4A 2N8GA 1D1CA 2QQBA 3RCOA 3LNQA 2GA2A 1H8EA 2FBKA 2CS3A 1H9GA 2CWEA 4DYCA 4A3CJ 5M5XJ 3E6BA 1ULYA 1OFCX 3FMRA 5M3MJ 3OYJA 1DABA 3G05A 5J40A 5C44J 3PIPF 1VLYA 1A6QA 3Q39A 1TTYA 1F36A 5FB2A 1G59A 4UVAA 5IT3A 5JVGF 1H42A 4PJNA 3UNGC 5B1AH 1QA1A 1H88C 2E2JJ 2DEUA 3P5JA 2O0WA 4YRVA 2F4NA 3HYIA 4ANJA 2L7KA 2DI3A 4A3BJ 4B4CA 4FE7A 3EUHC 5EJCA 2PMZA 3GFLA 3OJXA 2EPFA 1R5BA 3OS0A 1ZM4A 3WU1B 1DU0A 2BF4A 3MN2A 4MTDA 3OL3A 5DN6A 3DU6A 2BGIA 2Q6KA 5ICFA 1OCPA 4HG2A 1O8LA 1HW1A 1UD4A 2CRGA 4D7NA 2KRCA 3CP2A 3I56I 3WGGA 4P1VA 3CRZA 3WTYC 4BXUA 1W1WE 2XAUA 2VNHA 3QFSA 2Q6OA 5F1RA 1HBXG 5CDFA 5B6IA 1KTWA 1OR7A 1W36D 4YIRX 3U2RA 5BSYA 5HZBA 4PJMA 2VN2A 3BZKA 4M73A 1Q82D 2WV1A 5IOYA 4YFNF 1ELOA 2JPBA 5EEAA 3OYMA 1HKQA 2EFOA 3ZQQA 3OJWA 4U9UA 4Y33A 4CCKA 2X6OA 2K9QA 3DP7A 3QPHA 1VLOA 1WORA 2X1CA 3DLLF 3COAC 1KK2A 2V4JC 3R4KA 3GTQJ 4RDLA 3JRIA 1YFHA 1FBQA 4I99C 4XLEA 1ZUNB 1G7SA 4BQAA 3RZOJ 1VQNB 4HQMA 1DGWY 2FQ4A 1YRNA 2P4WA 5IY5H 3DFGA 5JR3A 3GQAA 1F20A 2WC2A 1PJ6A 3GMEA 2RQPA 4M3FA 4A0XA 5BMZA 1S6LA 2B9SA 1UD3A 1OCZH 4BY7J 1QGZA 1VQOB 2BBYA 4ZGNB 3OW2B 2HOTA 5E1ZB 2GJRA 3PFYA 1MH4A 2MGQA 2UZKA 1MBEA 4XBFA 5EF6A 1HA3A 3DU5A 1QFJA 3ASQA 4N3NA 1CQTA 1RI7A 2OK7A 4CHUA 1BX0A 4HEA2 2GPJA 1OKRA 5KK1A 4IX7A 1TW2A 1CF7B 1D1AA 2E1MB 3MKYB 3H3ZA 4PSXA 1ZR2A 4G1BA 1U9OA 2J5PA 4IL6C 2ZXIA 5IP9J 4RAFA 1LDDA 2EJRA 3TP3A 1YI2I 1EFUA 1QFYA 2MLGA 4BACA 4CZCA 1MH3A 1Y39A 1FOXA 2FBIA 3MCZA 3K70D 2LMDA 2M5WA 1EKEA 1N77A 2M7BA 1OGMX 3GBGA 1ZG5A 2EWEA 2KDOA 4AD9A 2LF7A 5D5VB 5M3FJ 4XRSG 3WG7H 2CW5A 3A01B 4PC6A 4YAUA 2L7FP 1AOYA 4X05A 2F5EA 1QGYA 1IN5A 2RNJA 2VJ5A 4B44A 3ZPLA 2IBDA 4WWVA 5E18F 4XN3A 3W6JB 5TJJA 3HGYA 4A5NA 2XSDC 2KISA 4EQQA 4E7KA 1QU3A 1D5VA 4J0QA 4ETSA 4UUVA 4CQJA 3T8RA 5K5QA 1K79A 3JQRA 1GUUA 4BBSJ 1ZG3A 2CV1A 3KYCB 4XLCA 1XB2A 3FXMA 4NBSA 3O6BB 4RDJA 1P4WA 2XRNA 4CUGA 5IYQA 2R4GA 3BTCA 3MD2A 2HWVA 1G7CA 3WNCA 1RR7A 1XMKA 2D1HA 2FF4A 4HLXA 4DYQA 3GZ6A 4HF2A 1E63A 3KP4A 5L3EA 3KEQA 4FISA 3K9TA 2BM4A 1MD0A 1JHHA 4G7WA 1J7KA 4IO9F 4EM0B 4RCZA 4OWRB 3WQZA 4BY1J 1R5HA 2M4GA 1X4PA 2RV8A 5E8GA 2BE5F 2JQ7A 1NBMA 2VKHA 4JRAC 3L09A 4V2GA 1IC8A 1QO0D 3LL7A 4YFXF 2E7WA 3CCVI 1G2HA 2M2EA 2VNIA 2ELJA 4DNRB 2EV5A 1T08B 2O3FA 3K2AA 3M07A 3JW4A 4IRGA 2CW7A 2XV4S 1DUXC 1IB0A 2GM4A 1OHHA 1HSTA 4HSTA 3W2IA 3W5UA 3ABTA 4UB8C 3AKZA 4KKSA 2VBMA 1EH6A 1JKQC 1D0ZA 2COBA 3JRDA 5F4OA 1O8JA 1MIJA 2DMQA 3C3WA 1RKTA 4I84A 2YS9A 1P4XA 4PGOA 1Q86D 3BY2A 1G3SA 2XNCA 1X2NA 2B5OA 3LA3A 1OGJA 2BM7A 3JCUC 3OS1A 3QYEA 2WSSA 5AIQA 2XGJA 1TQPA 4ASNA 2DBBA 5C1CA 1VQ7I 4B48A 2E60A 2LKXA 3CUQB 1TYUA 3A8IA 5AIPA 1JNYA 4HYEA 1Z67A 3A01A 4LG3A 5FIUA 2KIQA 4AC0A 3W2FA 1O88A 1OB2A 3CCQI 4WCGA 4Z05A 2JA2A 4G12A 3CCJI 4HBLA 3A3BA 1ZLKA 5A8AA 3ABMH 3CC2B 3KP5A 4XLAA 3E97A 3MFKA 1T0FA 1EP2B 4J00A 2VI6A 4GO1A 4RAYA 1T0FC 1L1IA 3B73A 3WE2A 3BQZA 4KA4A 1QBJA 1K83J 2OBRA 4MNUA 3B02A 3PIOF 3K1MA 4IF4A 2E1BA 3IAM2 2ETHA 3L2VA 1REPC 2DERA 2K3PA 2V7UA 4P9SA 4RPBA 3RIQA 1VZ0A 2W7NA 3CMEI 2R9VA 2H1KA 3F23A 1EA0A 5J1RA 4FX4A 3K1NA 2H8RA 2X9DA 3OY9A 3ZZ0A 2NT6A 3HDDA 2ZTNA 5EYRA 3GUDA 3CC7I 3LQ6A 1WOSA 3B4NA 4D9JA 1VQMI 2ZZQA 2AQFA 3HKZA 5CVUA 2LD5A 2L9SA 3BG6A 4XK4A 4X7EA 2HVQA 3TO6A 4XLFA 4W8TA 2W4SA 2R5ZA 3Q3SA 2VJ4A 2KDZA 1MBKA 1VBLA 1WQ2A 4DQKA 2DMTA 4F55A 4ASUA 5F6FA 1IO2A 4P3YA 1OR7C 4N4NB 3I56B 4HWVA 3J7AO 5E6TA 4HZFA 5FLXZ 3QRFF 2IA0A 2C5HA 2QTZA 1UD5A 2LBFB 1FTTA 5L3CA 4OJLA 2OU2A 5FJ8J 3BY1A 3WNBA 1LB2A 3PSZA 2CNDA 1TVCA 3NQOA 5DCMB 1JGSA 1CNEA 3BQJA 1V55H 4BKXA 3CCUB 2QY1A 1IZ1A 2FXAA 4I7HA 3J7YJ 1ITYA 2OA4A 2P81A 1IXSB 3IH3A 4A2UA 3BLYA 3LQQA 1S72I 3GCMA 1FMVA 2ZSIB 3ISPA 5LRSA 4Q4ZF 2WTEA 5DM7F 3TGNA 2A07F 3LA7A 1EFCA 5FL7A 1XDSA 4M4SA 2M7AA 3QYFA 4U0YA 1GT0C 2VFNA 3A0HC 3F8FA 1R4NB 4BHBA 2L5QA 3TEDA 1SD7A 4Y9RA 2NTQA 4A6EA 1E64A 1VNDA 3H3VK 3GZNB 4MFEA 4EATA 2V4DA 2OZ6A 3LSGA 1HDPA 3TP0A 3SJMA 4CSWA 2VE9A 4RM3A 5DV5A 2VL8A 4I76A 5D8KB 5LGTA 1HOMA 4NK6A 4GGGA 2IW5A 2ZXWH 4G7OF 2TDXA 4ZZDA 5JI6A 2JPCA 1QVTA 5ILVA 4BE0A 4L8JA 1R6RA 2BGCA 4OAZA 3H09A 1RUOA 3MAJA 3FF5A 1SFUA 1K78B 3VEPA 2EFPA 3CCQB 4GCVA 2FRHA 2QQ8A 3QOPA 4HW0A 2QM3A 3OV8A 4AWXB 5HS7A 3SEZA 1FYMA 1KD1D 2XT4A 3UW0A 1P92A 3QAHA 4KT6A 5DDGA 2GXAA 1ZRFA 5EEHA 1WXRA 1E17A 2FE3A 3BG3A 2P3MA 1DGRM 3VO1A 4CGZA 2PMHA 3QPTA 3OZVA 4BDZA 2EIXA 3EPZA 1BX1A 4RB1A 2H94A 4FE4A 1QGPA 4YFKF 3E7LA 2I5UA 4LMYA 1ZKGA 2EZLA 3LSMA 3I4NJ 4AYBA 1XSXA 2YX7A 4E7JA 4E7LA 4EGYA 1SKQA 4KUMA 1AIRA 1P9QC 3OYNA 1R36A 3FBIB 5THXA 2NXNB 1R4MB 2VT3A 3VSKA 1WHUA 1ZK8A 2EIKH 3CCMB 1IRGA 4EJTA 2RC6A 3DQVC 5M5YJ 2XKOA 4WX9A 3SEJA 2IA1A 4NDLA 1LE8B 4A93J 5HS9A 2YWHA 5J35A 1IDJA 1OJLA 1LDKB 1X1PA 3E5QA 2YPRA 3VOEA 3RSNA 2P7VB 3AVVA 4F52A 4Q7JB 2WY7Q 4DQ2A 1B59A 1ZHFA 1VQ5B 4OAYA 4BJ5C 3QOEA 1HC8A 4CCLA 1J2XA 3GEZA 5EGOA 3C2GA 4JX5A 1E3XA 1N05A 1XX5A 5ICGA 2D5VA 1OLTA 1XG1A 2CUEA 2EV0A 5D6EA 1R9TJ 3NB2A 4V02C 3M9AA 4E7SA 3I54A 4I6ZA 3QWLA 3BCBA 5J3OA 5HODA 4IOCF 1QA3A 1UD2A 4QHYA 1P4AA 1S72B 3H92A 1F60A 5DUIA 4JQFA 3W2VA 2K5CA 1A36A 1W0JA 1YYVA 1EZGA 1OMIA 4NC8A 1WOOA 4H0EA 3PQKA 2DMUA 4YZQA 3F0CA 3GFJA 5B66C 5E79C 2M30A 1O8EA 3IKVA 1NHAA 1I6HJ 5DEQA 2X8KA 4RDUA 1JA0A 1BI3A 3OEEA 4OMZA 2QGUA 1JTXA 3CZ6A 1IXRC 2JUCA 1XFOA 3GIRA 1FMWA 1R5GA 1SKYB 3LWFA 4XSZF 1YI2B 3O3KA 1KQ9A 2DOEA 1EXMA 2ODLA 3EQOA 1LNWA 4K2EA 1FJLA 2VKVA 1K8AD 3IWZA 5LLQA 5HS8A 2BGJA 2HDNB 1HG8A 4OPWA 3W2GA 1E43A 4YZAA 5FO0A 2J8IA 4EVIA 3CJNA 3MVPA 3JRGA 3E1YE 3G1MA 2B7EA 3KLNA 2HZDA 1IHMA 3KEWA 4RDKA 3VSTA 3DPUA 1QX4A 1ZYRF 1HW5A 1Q1HA 4RJLA 2FD5A 4LLLA 2QGGA 4LOCA 4GYIA 3G71B 4Z6YA 4BQNA 2OBTA 3AK5A 2ZNYA 3FXQA 3FM5A 2VBVA 3DKYA 2IS2A 2XIGA 2FU4A 1ZM9A 1D1NA 4PC1A 2VFPA 2QQ9A 3A02A 3HC7A 2NAZA 4NBQA 4EJVA 2BSAA 4P96A 3TKYA 1BC8C 3B90A 3L2WA 5JLXA 3SLDA 2A61A 3NEUA 3S14J 3BG9A 2ZJ2A 5EGOB 3GVKA 4NC7A 1FDRA 5FGMA 1JHFA 4YELA 2AHOA 2LH9A 1BOAA 2IGOA 3CDLA 3JAMZ 3WTXC 1E3ZA 3OP1A 3S1MJ 3ASTA 1NRKA 1NDHA 1XCBA 3E6DA 2VJJA 3CUQA 1LPQA 1R22A 2FSWA 4L0ZB 5E8IA 1O8KA 2A05A 4YAWA 3CCEB 3AFHA 3W3CA 2DA6A 2PJRB 2HXIA 4A6DA 4M0LA 1IW7F 3MKWB 3U6BA 3SZPA 2JA8J 1KQ0A 2AHQA 1E3HA 3IP4B 4BJTA 3PO3J 2HLDA 3BCFA 3P27A 3FKIJ 3QU3A 2CQKA 2IGMA 1G3TA 1ORKA 1WKMA 2W48A 3CJTB 4LK1F 3OE7A 3SXYA 1G6NA 3FMSA 3ZN0A 4E70A 3CCEI 2E1RA 2GJPA 2L9NA 4YDTA 2E35A 3GSIA 2PYGA 1T8IA 4CCMA 4OPOA 1DBOA 3RYRA 3AG1H 1FWZA 3CTAA 2CUZA 3I4PA 2HYFA 4RPDA 1OCRH 3V8KA 4EJUA 2O5RA 2UV1A 1U8RA 3I64A 2ZBUA 3RYPA 4JX4A 1KK3A 1QGAA 2K9NA 3ZXSA 4HAMA 4TMXA 1MZBA 2EZHA 2K4BA 2VONA 2R5ZB 3I59B 3SUCA 3CW2A 3H35A 3DXJF 1U2WA 2ME0A 3EQLF 4U0VA 4HLYA 4OMYA 2VBZA 1UHMA 3KEOA 2WPDA 4XKBA 2C6YA 1OCCH 3QPSA 4L9JA 3KX2A 5F08A 1TTTA 3FXKA 2VC1A 5DCFA 1VQLI 2GQQA 4IHYA 2UXNA 1BJKA 2LBFA 1IN4A 3U1DA 3FHZA 4YZ0A 1W7PB 2OTLI 3AVTA 1NHCA 2NOJB 4Q48A 4A3GJ 1U2RA 2OK8A 5HLIA 2WA0A 1Z9CA 2VNJA 4RD4A 4U0WA 5HKKA 1W0TA 1DQUA 1S7OA 2Q2EA 4F91B 2XOKA 1BPLA 4RA2A 2CU7A 5HLTA 1E62A 4OU0A 2A68F 3BDDA 2M8EA 4OOIA 1GXPA 4ZTFA 2HDDA 3I55B 1WJFA 3A8JA 3AGQA 2BW3B 4N3GA 5CQGA 1FIPA 4Q5SF 4Y9UA 1ETVA 1JKRC 3SQVA 1U0JA 2ESNA 2LP0A 3M1EA 4XLHA 3H9GA 5FO5A 3A35A 2QSHX 3FISA 2C4UA 2M0CA 5IP6A 2E2HJ 2NTBA 1XPXA 1Y0YA 1QQ1A 4UXNA 4UV8A 4G7HF 3CMEB 2KHMA 3EUAA 1R23A 3CJRB 1KONA 2G7UA 3OIPA 5TV2A 3VMFA 4IVNA 5K5OA 1Z6RA 3AG4H 2JMWA 2V26A 3GYHX 1A35A 4S04A 1LJ9A 1XCVA 2HQRA 3ES9A 2XNDA 2QCOA 4ZJZA 1IJFA 1S0UA 4B3FX 2DK5A 4M2LA 2HU9A 1H8AC 2R7TA 4NK8A 3BH4A 3OZUA 4LK0F 4RB3C 2ADUA 1JUSA 2HDCA 5CVJA 1VFCA 4ZTJA 4XQFA 4DQLA 1RU4A 2P0WA 2HQ5A 1HF0A 2WR8A 1VQ7B 2BM5A 4RGXA 1QZEA 3TW6A 5ICEA 3E6CC 1SFOJ 2FVGA 3N4MA 2CF4A 2V7VA 2VNKA 1M90D 2RC5A 2QYOA 3QP5A 3L00A 1TYVA 2QZ8A 4U88A 5CKTA 3DWLE 1NB9A 3ZZUA 1UFMA 2NS7A 3Q38A 2D2WA 2IPQX 3C1DA 2CW8A 1RC9A 3HSEA 1IN6A 1VQ4I 4C43A 4Z4VA 3LOCA 1HW2A 4LITA 2LF8A 2A6EF 1ZQ3P 1FYKA 2EFNA 3RIRA 2W1OA 3FMQA 5ICCA 1X58A 4XLNF 4UHTA 3AVXA 1R71A 1JB9A 2JIZA 1Y1WJ 1VQ9B 5D5WB 4HQEA 4L5IA 1ERDA 2CUJA 4S05A 1IJWC 2CRVA 3G2BA 2JT1A 3ASNH 3GW2A 1AHDP 2K40A 3JX8A 1VTNC 1RESA 3BR3A 2ZL7A 3R6KA 2V7WA 3HTSB 1WTHD 2V9KA 3HSRA 3KE2A 3CXCB 2EQRA 2XPUA 2EFQA 2CV2A 1ETXA 1P2FA 2CUFA 1WPCA 5ILUA 1WFXA 5IP7J 4Y15A 4ZCIA 3OFNA 2XGDA 4Y52J 3RY8A 1JUMA 3ML3A 1PUFB 3M7GA 1BW6A 4ESFA 1KU3A 1K28D 2F5VA 2DPUA 1LQ1A 3I53A 4X1EA 2YWEA 2UVEA 2ZITA 3CCSB 4A69C 5FFXA 2FNAA 1RUNA 5L3DA 1LFBA 4BHCA 1WSUA 4P26A 4ESBA 2O6GE 2FMYA 2OF7A 1SFXA 1XD7A 5BOXA 3DCFA 2B63J 3VO2A 4BQOA 1UMQA 2ZFWA 1JT6A 2FX3A 3W6KB 2XUBA 2L02A 2FX0A 1V5EA 1PKVA 1BN5A 1N0VC 2A6TA 1CF7A 1XMAA 2DODA 1KYZA 1K73D 4X06A 5F1JA 3O8HA 3BOQA 2EILH 3OIQA 1KK1A 2K02A 1L3LA 2Z3YA 3GVJA 3OYHA 4QWQA 1FOWA 1MMGA 3KZZA 2VLAA 1KU2A 3DPLC 2CFOA 4C30A 4JBAA 1I8DA 1HLVA 3JURA 2XAQA 4CICA 3V7RA 2HGCA 3F8CA 4EV0A 1ON2A 4PSWA 3LSPA 3OL4A 5FKMA 2DT6A 1ZN2A 2QKMB 1HXDA 4PZJA 4HNVA 2QA4B 2P5LC 1ZRCA 4IXAA 4X6AJ 1B2RA 1VI0A 3BQYA 5D4SA 3L1PA 2FNPA 4XICA 4AM3A 2EZIA 4YIIA 2XASA 4G6IA 3GRHA 2ZZFA 4PC7A 3ZMZA 5FNZA 1O8GA 1SMTA 2FA5A 2DK8A 2R7UA 5FLXK 1E1RA 3KETA 3H5AA 2MBFA 4A0ZA 3P26A 2AO9A 2WB1N 4ZDLA 2PIAA 2X85A 4RM2A 2L3DA 3EDPA 1JA1A 2F2EA 1BJAA 2QENA 2VXDA 5DTDA 5J4VA 1YJ9I 3WE3A 2ZBVA 3NE5B 3M4OJ 1GJRA 1VQ8I 4F3QA 2OQRA 1TZLA 4LFUA 1PUFA 3K4JA 2O8XA 1E79A 4DW6A 3LQRA 3Q0VA 1LKXA 2ZKZA 4YALA 1NG7A 2DFEA 2IA2A 5HNHA 2Y9ZA 2HYJA 3WU2C 4XIDA 2BPOA 3Q9VA 2BOLA 4II2A 4YZXA 1SEUA 5J1UA 5IT9Z 4ABZA 3ZSCA 5F4MA 2BX6A 3HJEA 2HKXA 2L0KA 2C2WA 1KCCA 3FXRA 1CLWA 2BM0A 3LAJA 5K7ZA 3W6VA 4JK1X 1JKOC 4M3EA 2X48A 5TR9A 2DJNA 2KZGA 1GV2A 5IYDJ 1MKMA 2O0YA 4LLGF 3HOUJ 1FRQA 1WJ5A 4KMFA 3HB9A 1H9TA 3BCDA 1MABA 2VOOA 2X6YA 4E0FA 3RPUD 1NG6A 1TWHJ 5DS9A 2D3NA 3TW7A 1WWXA 3HBLA 5FD6A 3GTKJ 1DARA 1X3ZB 2CQNA 2PEXA 1GVJA 1YOVB 3KP2A 2FBHA 3R60A 1ETOA 1FP2A 1YE9A 3CCLI 2DT7B 1TQMA 4N4OB 1QQIA 4PJJA 4BS9A 1UAAA 2DQLA 2CQQA 2NNNA 4RD0A 4X8IA 3PVDA 1FSHA 4M3BA 4RLQA 1OOCA 2NVXJ 1KGSA 4EM1A 1USTA 1ETYA 4Z4UA 1O8HA 3CUOA 3VYRB 1YIOA 4FWTA 1QZYA 2M0MA 1F5TA 2H6BA 5H59A 4IHVA 2GREA 3P7NA 3R0AA 4CXFA 2XZPA 5KCMA 1XTAA 3J81k 1MNEA 2DU9A 5KNLA 1H8HA 2MG4A 3F8NA 2OC6A 3ZMVA 4U7DA 1LFPA 1Z0XA 3QFCA 1BOBA 3BT9A 2M3AA 2MLKA 3DTKA 3VSLA 3PETA 1T5EA 1GQ8A 1B1BA 3VSVA 1J59A 9ANTA 4QVJA 3FK6A 4HNUA 2Q6LA 2K7LA 2EZKA 1HKTA 1COWA 3AVYA 1K4ZA 4BU2A 1TT0A 2IS1A 3TMOA 4IZZA 1HA8A 3IAS2 1JRGA 2YU3A 4XL9A 1GAQA 2OQGA 2F4MB 5KSWB 1ZGAA 4L0YB 2QSFX 3I1FA 5KAFC 1W5SA 3CO7C 4M3DA 2DTRA 3BC8A 3FBNB 4HSRA 1K61A 2CK3A 4KKUA 3IHUA 2XAGA 4OJ5A 5IYWA 3CCUI 4ACBA 2ICWG 2LZJA 3ZZTA 3GVAA 1IRXA 4B1RA 5IT9K 1HF2A 3ZRGA 1I6XA 4L5JA 4GQNA 3QU6A 1YW9A 4CYDA 4HDUA 4ENMA 1K4SA 2HEOA 3DKWA 5J8FA 1WJCA 2W82A 1V4RA 2H09A 4IPAA 4CH7A 4ZH4F 2RQQA 2PJPA 1WSRA 3VMVA 2PFBA 1MNDA 4PABA 3ONUA 3RKYA 1WP6A 1YITB 3O8GA 2DA4A 5LHGA 4XOTA 5HVQC 2IP2A 1FX7A 4DGWB 3LFUA 4I0BA 2BVLA 3PSIA 5D6FA 2ID6A 1FT9A 2OD5A 3HHHA 1FNBA 4LB6B 1T98A 3H94A 2WZPP 5JLVC 2Y48A 2PBIA 5CVRA 4AYBN 2RREA 4C9YA 1R58A 1IN7A 4UVCA 5J47A 3E6MA 3EYYA 1YHQI 5EZGA 4CA0A 1ACIA 3FX3A 3H3UA 2LY9A 4G9YA 1YJWB 1U5TA 2MA3A 3ERMA 4H4KC 1KA8A 5H6RA 3FZVA 1OB5A 1KC8D 3AAFA 2BEOA 2EH3A 2JRMA 4M6YA 5B3SH 1R49A 3TO7A 5JFRA 4D0PA 3RKXA 1G3YA 2HQNA 3VSUA 1XB4A 5E3NA 4PK4A 4G94A 2F43A 4J01A 1TNTA 1S7EA 2DMNA 1CNFA 5JBQA 3I55I 2DT5A 1XQBA 2ELKA 2DW4A 2XT2A 2W6IA 1B9MA 2Q1ZB 1AIPA 1RETA 3G6EB 3REOA 1WJBA 1YLOA 5L3BA 2BY2A 3ZQIA 1Z91A 1PYVA 1YW7A 4E6KG 4AU7A 1YITI 3H9JA 1VQOI 3OYLA 4MQVA 2OTLB 2W85A 5E17F 4F7DA 2IOUG 3GLLA 1FP1D 1S7AA 2XF6A 4KMUX 2OPTA 3H0GJ 4YC5A 4UUSA 1KU7A 2HR3A 3K4LA 5K1YA 2DTZA 4M72A 1CQXA 2BM6A 5JHFA 2E71A 4LB5A 2ECCA 1YS6A 1BN8A 4A3DJ 3JRAA 4Z4WA 2ESHA 3DKXA 3WTWC 1P4MA 3T53B 4PMHA 4OP7A 2H1LA 4P2NA 1J0RA 1S8NA 3OYAA 3ZMDA 1VQ5I 2VBUA 1UHSA 2XSJC 4A3EJ 1HCRA 2L7MP 3PSFA 2F1MA 2CH0A 2QTLA 3ISXA 4DIQA 1ENHA 4BXXJ 3WTVC 4IHWA 4DK1A 5F0CA 3KCCA 2KPMA 3CPWB 3R0JA 2DOFA 3FK7A 1FNDA 2DO7A 1UD6A 2BN4A 2NOGA 4KN4X 2R7DA 4LBVA 1UCRA 2V9PA 3F6VA 2XTWA 2IXSA 4FASD 2VBKA 2V9VA 4OIRF 1WU8A 3PQJA 1VQ9I 2QEXI 3VYTB 2YU9J 3HG9A 2JA7J 2R7SA 3CCVB 1OCOH 2YR2A 4ITVA 4CYCB 4JX6A 3OPOA 4OJPA 1Y8QB 1K9MD 1QRBA 2OV7A 1U5TC 1VHOA 2C78A 2HZTA 5H2FC 2R5YA 1IA5A 3HUGA 1VF9A 2M8GX 1DG1G 1ZGJA 1B6AA 3V7SA 2OAZA 5IOZA 2LG4A 1WVRA 4A3KJ 3N05A 3PUFA 3GFIA 3KFWX 1GXQA 1N8RD 1XSDA 3SHFA 3HKZN 2HQAA 3AG2H 4DZJA 4TN1A 1QPMA 2QVOA 3S2HJ 1SD6A 2VYQA 3SEQA 3CD6B 2VFMA 3IV5A 2NPFA 2E5ZA 1TLHB 3F8MA 5KAIC 3SZGA 4BDYA 3WTSC 3NRVA 4Y4RA 4KH3A
chains in the Genus database with same CATH topology
1Z3YA 2DJIA 3OOCA 4URRA 2VJJA 3GQ7A 2R7OA 4E4HA 4Y3OA 1FX0A 3S93A 1O8KA 4ZC3A 2XZLA 3KRGA 4W8QA 4U49A 3AFHA 3W3CA 2PJRB 3LMMA 3FPPA 3MKWB 2AQEA 2VBEA 3D5LA 3VR6A 1S9HA 3CF2A 3OR2C 3U21A 1V0FA 2KP6A 5CPRB 4W8SA 2VQHA 3A1YA 4TT3A 2HLDA 2UUZA 3IP4B 4BJTA 1N78A 1WJDA 3BCFA 2OUMA 4ZDPA 3KEYA 2IGMA 2LOOA 2Y0SA 4MR0A 5C1EA 3OE7A 2UVFA 2KMUA 3LSIA 3OAAA 2GJPA 2L9NA 1JI8A 1O8IA 2HPIA 2V1NA 3FDYA 2PYGA 2WJYA 4CCMA 3K4CA 2KQRA 1SAUA 1DBOA 3M1CA 2LY2A 2CUZA 3M8JA 2X3HA 2DOAA 2MD0A 3A4CA 4TSFA 2XF7A 1KZLA 1Z21A 2KL4A 1D1CA 2O5RA 2UV1A 3RCOA 1H8EA 2PECA 3L2RA 2CS3A 2E5NA 2IS6A 1O8DA 3OYFA 2KLOA 1AA7A 3H5RA 3OYJA 2NT9A 3ZXSA 3G05A 4BL0B 3SUCA 3H35A 4LIVA 1VLYA 2L2OA 4B43A 3PL8A 2WPDA 1MW7A 4XKBA 3OYGA 3KX2A 1G59A 3FHNA 3OR1C 2E1MC 1UD8A 4PJNA 3UNGC 3DTEA 4E7ZA 2LBFA 3HXLA 4YRVA 2O0WA 4YZ0A 1YX5A 3PNVA 4CCJA 3K70C 4ANJA 2L7KA 2NOJB 1NHCA 3EUHC 1UELB 2WA0A 2PMZA 2W00A 5HKKA 1EFRA 1DQUA 3OS0A 4F91B 2XOKA 1PJRA 4BQQA 1X19A 1BPLA 1BHEA 3OL3A 5HLTA 3F9KA 5DN6A 2MYSA 3DU6A 2R7VA 4B47A 3HOSA 2F4IA 3NWSA 4HG2A 1O8LA 2X51A 4ZTFA 1UD4A 1WJFA 2KRCA 3CP2A 2NSTA 2BW3B 3HOTA 2O0VA 5CQGA 3K4MA 2QXZA 2XAUA 1KTWA 1U0JA 5CDFA 4XLHA 4NQWB 3H9GA 3L2UA 3A35A 1W36D 4MLOA 3GQ8A 4PJMA 2NTBA 3H0DA 2R7WA 2NZMA 4Z06A 4BE2A 1Z3XA 3OYMA 3ZQQA 1X0CA 1T95A 4Y33A 4CCKA 2KHMA 3EUAA 4YXWA 1QHHD 3CJRB 1KONA 3D5SC 3BCAA 3OIPA 4CCOA 2O1DA 3ONQA 2WAFA 2X1CA 2V4JC 3OS2A 4U87A 2V26A 1HVXA 4RMNA 3HAGA 4XLEA 4XKVA 2PYHA 4BJ6C 1DGWY 2XNDA 4B3FX 2MABA 4ZJZA 2NSPA 4BE1A 1D0YA 2HU9A 3GQAA 2R7TA 4NK8A 3BH4A 3A3GA 1UD3A 1Y6IA 2LRDA 2GJRA 3DTIA 2ZFUA 1SFKA 3PFYA 4ZTJA 4XQFA 4BUPA 1WJEA 2VB6A 2R7QA 1Y56A 2P0WA 3DU5A 3NWTA 1RU4A 2MC4A 1UG0A 4ZYAA 3GQ9A 3K4BA 4HEA2 4OZYA 1ZELA 4JOMA 4IX7A 2DXIA 4JMQA 4HPQA 2DCEA 1D1AA 2E1MB 3MKYB 3BG7A 4PSXA 5CKTA 3DWLE 3DLAA 5FRNA 2X1EA 2ZXIA 1W36C 2CV0A 3PNTA 3WWGA 3TBIA 2CW8A 2A5WA 4BACA 4CZCA 2V7QA 2WADA 4LITA 3K70D 2WY8Q 1N77A 2JJ2A 2M7BA 2JUGA 3GBGA 1OGMX 2W1OA 2EWEA 2KDOA 1Z7LA 3AL0C 4AVZA 4HNTA 2Z16A 2JIZA 4G6TB 1ERDA 2VJ5A 4B44A 2CUJA 2JSPA 2Z8GA 3SYTA 1BLIA 2QKLB 1X1DA 3GQBA 4XN3A 3G2BA 4E7KA 1QU3A 4DNTB 3VMWA 1H80A 4YEJA 1RMGA 2VQGA 2CV1A 1WTHD 5AMVA 4XLCA 2V9KA 1E1QA 3CP8A 2HVSA 1J09A 4CUGA 3OYKA 1K6YA 4PFPA 2R4GA 4QPQA 2HPMA 1E0EA 3ZCOA 2CV2A 3MD2A 1WPCA 1D0XA 3ZIAA 1WFXA 3J7AY 3OFNA 2INVA 2WAQA 4G7WA 1W9XA 3PNYA 3HPGA 4OWRB 4XR6A 1K28D 4E7HA 2F5VA 3WQZA 2M4KA 2M4GA 1QCXA 5HOOA 2UVEA 1X4PA 4FETA 3AL0B 2GK6A 1NBMA 4U7BA 2VKHA 2D3LA 3OOUA 3H5NA 4XM3A 4BEHB 3LL7A 1OB0A 1WMRA 2X53S 4HIZA 2ELJA 4DNRB 3S3OA 2CW7A 4OZZA 4KISA 4BQOA 1OHHA 3VDXA 4HSTA 3OMYA 3AKZA 5LD2C 4KKSA 5IK2A 1KMHA 1BR2A 2VBMA 1V5EA 1D0ZA 1PKVA 1JTAA 3SDBA 1O8JA 2LC2A 2A6TA 2JDIA 4I84A 2RNGA 2IQ7A 4PFOA 1X1BA 3OIQA 4XN0A 3GVJA 3OS1A 3OYHA 3QYEA 1MMGA 2WSSA 2VLAA 2XGJA 2CFOA 3DPLC 4C30A 3JURA 2WAEA 5C1CA 1PE9A 4IQ4A 4B48A 2E60A 1I8DA 1OFLA 4PSWA 3OL4A 2DT6A 2QKMB 3I3LA 3S8PA 1G8XA 1X1CA 4LG3A 1RWRA 4R79A 1O88A 3HUGB 4Z05A 1BR1A 2JA2A 2ZZGA 4G6IA 3A3BA 1X1AA 2HVRA 2PJRA 2ZZFA 2W6JA 1IDKA 1O8GA 3GRHA 1GLNA 3FY3A 4XLAA 4HRIA 2R7UA 4J00A 2GK7A 1T0FC 3OW7A 2BVMA 1E1RA 3DDYA 4Z03A 3H5AA 2E1BA 3IAM2 4ZDLA 3OEHA 4F92B 2IGKA 4XONA 3L2VA 1DBGA 2X85A 2K3PA 2Z1DA 4RM2A 1VZ0A 2W7NA 2R9VA 3VYUB 4C2UA 2VXDA 3QYBA 2HNHA 2ZSHB 1W0KA 3NE5B 4F3QA 3OY9A 1TZLA 4FXUA 4X0GA 3IUOA 3K4JA 3S32A 3K6GA 1E79A 4G7XA 2NT6A 2FUG2 2K9MA 2ZTNA 1LKXA 1MMAA 1NG7A 2CMPA 2O04A 5HNHA 5CQEA 4LIUA 4YZXA 2BOLA 2LREA 4II2A 4D9JA 2ZZQA 3B4NA 2AQFA 3HKZA 4XOPA 2O17A 2L9SA 3BG6A 3ZSCA 2HVQA 4W8TA 4XLFA 2F6CA 2W4SA 2JJ1A 1VBLA 2VJ4A 4DK0A 4II3A 3T9GA 1KCCA 2VQCA 4F55A 4P1WA 4ASUA 1OR7C 2GOXB 4N4NB 4HWVA 4RLFA 3ZPNA 2NTPA 4OJOA 1EE6A 2JVGA 3I9V2 5FROA 3GVLA 1WJ5A 4XKCA 2LBFB 1UD5A 3BCDA 1MABA 2X6YA 4OJLA 4XNFA 3LNNA 3RPUD 4E0FA 1NG6A 2XF5A 4BDYA 3W2WA 2D3NA 2GOMA 2Q2EB 2X6XA 3L2QA 5LFAA 1YE9A 2DT7B 2Z2SB 4N4OB 4PJJA 4BS9A 1UAAA 4NUBA 3W2AA 1OFMA 3FKJA 4GRIA 2QY1A 2M5SA 4RLQA 3PJRA 1OOCA 1PXZA 3RQ4A 3EUKL 2JVHA 2VJIA 1O8HA 4C2TA 1V5GA 3DPTA 3VYRB 2BW3A 3VWBA 3K4KA 3BLYA 5TGTA 2UWMA 3H9QA 1FMVA 2ZSIB 1XG2A 2M0MA 2IS4A 5FL7A 3V42A 2XZPA 5KCMA 2M7AA 3QYFA 1CZFA 1MNEA 5KNLA 4IKFA 1H8HA 3TL4X 2L5QA 4NNJA 2NTQA 3OYEA 2OC6A 1LFPA 2Z6BD 1BOBA 4P22A 3DTKA 2M3AA 3D5RC 3VSLA 4EATA 2V4DA 1T5EA 1GQ8A 3LSGA 2BSPA 1K5CA 3VSVA 2R7XA 4CSWA 1LVKA 3K10A 4RM3A 2VL8A 4HNUA 4NK6A 4XMYA 1COWA 4B3GA 4BU2A 1TT0A 4PJLA 4BE0A 2VPLA 2IS1A 3TMOA 4IZZA 1HA8A 3IAS2 1R6RA 4L8JA 5KHDA 4OAZA 2LYCA 1JRGA 2VIXA 4XL9A 1V5FA 2X1DA 2CK3A 3BC8A 3FBNB 4HSRA 4KKUA 3UW0A 4EW9A 1KCDA 4P5OA 3SEZA 3LSKA 4OJ5A 3PUBA 2VASA 2V31A 2QX3A 1QJVA 3B8YA 2I8DA 4KT6A 4Z1MA 1VF7A 2LZJA 3FKSA 1IRXA 4F93B 2ZTGA 4KKTA 3ZRGA 4GQNA 2WJVA 1DGRM 3UR3C 1IB4A 2XC7A 3E0JB 4BDZA 1WJCA 2W82A 4CCNA 3EPZA 4CH7A 1D1BA 2RQQA 3VMVA 4B3XA 4BXFA 1VJSA 3CMMA 1O8FA 2X6WA 1MNDA 4IQJA 3LSMA 3MMYB 4AYBA 4E7JA 4E7LA 1WP6A 1AIRA 1P9QC 4XOTA 5HVQC 3OYNA 3FBIB 4DGWB 3LFUA 4PUSA 2BVLA 3VSKA 3K4NA 3PSIA 3KYLA 4XKWA 1X4OA 3H94A 3DQVC 2WZPP 2LY1A 5HNFA 5FRMA 2KVOA 4C9YA 2RREA 3VYSB 3BC9A 4E7IA 2ZZEA 3EQNA 1IDJA 1LDKB 4CA0A 2KRHA 2MFZA 2V6EA 3A2KA 3RSNA 4OJ6A 4H4KC 4F52A 1OGOX 2WY7Q 4MXNA 1YX3A 2R7RA 4OAYA 4BJ5C 3VSUA 3QOEA 4PK4A 2F43A 4C2LA 4CCLA 4J01A 3C2GA 3S3MA 1E3XA 2IGNA 1OLTA 2W6IA 2Q1ZB 3T56B 3QODA 4DBQA 4E7SA 3LMWA 2WB1A 1WJBA 3BCBA 1QHGA 3CESA 3OYDA 1UD2A 1PYVA 4E6KG 4AU7A 4JQFA 3W2VA 2K5CA 3H9JA 1W0JA 3OYCA 1DP3A 4DOZA 3OYLA 4BGDA 4UZUA 4NC8A 4XD7A 2QE7A 4YZQA 2XF6A 3CJQB 3C2HA 3OYIA 3K4LA 4U4BA 5JHFA 1O8EA 4D1QA 1I18A 1BN8A 4DBRA 3DKXA 4PMHA 3OWTA 3T53B 2X8KA 3OYAA 3OEEA 1N75A 3CZ6A 2XZOA 2XSJC 4KITB 1FMWA 1SKYB 4XORA 3PSFA 1MMDA 2CH0A 2F1MA 1MMNA 2ODLA 4DIQA 3EQOA 4DK1A 1HG8A 3LSHA 2VQLA 2KPMA 3T51B 1E43A 1O8MA 4YZAA 1UD6A 2ZXHA 4W8RA 2K9LA 4QPOA 2HZDA 3DEEA 3KEWA 3VSTA 2IXSA 2VKDA 4FASD 2KZVA 2V7FA 3DPUA 2WBMA 2VBKA 3RTRA 3ZR8X 1BMFA 3JU4A 3HPHA 3VYTB 1PLUA 3HG9A 2R7SA 4BEHA 4ITVA 3OPOA 4OJPA 3ZPPA 4BQNA 1WJAA 2XDVA 2OV7A 3HL2A 1V0EA 4KJZA 1IA5A 3DKYA 2IS2A 3MKZA 3E1SA 2INUA 2LG4A 3HC7A 3N05A 3B90A 3L2WA 2DIEA 2HQAA 3GVKA 4NC7A 1HZEA 3S3NA 1BR4A 4TKOB 3SEQA 4YELA 2LH9A 2IGOA 3OYBA 2E5ZA 1E3ZA 3SZGA 1EA3A 1NRKA 2GJKA 2HDWA 4DJAA 4ZDOA 2VXZA 4Y4RA 3ZGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URR A;  2VJJ A;  1AIR A;  3GQ7 A;  4XOT A;  4Z03 A;  4XQF A;  1O8K A;  1RU4 A;  4XON A;  3KRG A;  1DBG A;  4W8Q A;  2X85 A;  4U49 A;  3GQ9 A;  4XKW A;  4OZY A;  2VBE A;  4W8S A;  3EQN A;  1IDJ A;  3WWG A;  2NT6 A;  4OJ6 A;  2O04 A;  1OGO X;  4MR0 A;  5C1E A;  2UVF A;  4YZX A;  3B4N A;  4MXN A;  1OGM X;  4XOP A;  3VSU A;  2EWE A;  2O17 A;  1O8I A;  3ZSC A;  4C2L A;  2PYG A;  4XLF A;  4AVZ A;  4W8T A;  1DBO A;  1VBL A;  3T9G A;  1KCC A;  2X3H A;  2Z8G A;  3LMW A;  4XN3 A;  4HWV A;  2NTP A;  4OJO A;  2PEC A;  1EE6 A;  3VMW A;  1H80 A;  4YEJ A;  1RMG A;  1O8D A;  2NT9 A;  2X6Y A;  4OJL A;  4XNF A;  5AMV A;  4XLC A;  3SUC A;  4YZQ A;  2X6X A;  4U4B A;  1O8E A;  1OFM A;  2INV A;  1BN8 A;  2QY1 A;  4PMH A;  1OOC A;  2O0W A;  4YZ0 A;  1PXZ A;  2VJI A;  1NHC A;  1O8H A;  4XR6 A;  4XOR A;  1QCX A;  2UVE A;  1XG2 A;  2ODL A;  3EQO A;  1BHE A;  4XM3 A;  1CZF A;  1HG8 A;  1O8M A;  4YZA A;  2NTQ A;  1WMR A;  1O8L A;  4W8R A;  1GQ8 A;  2BSP A;  4OZZ A;  2NST A;  3VST A;  1K5C A;  2O0V A;  3VSV A;  2QXZ A;  2VBK A;  1KTW A;  4NK6 A;  4XLH A;  2VBM A;  4XMY A;  1O8J A;  1JTA A;  1PLU A;  3GQ8 A;  4I84 A;  4OJP A;  3ZPP A;  2NTB A;  2NZM A;  2IQ7 A;  4Z06 A;  1JRG A;  1IA5 A;  4XL9 A;  1X0C A;  4XN0 A;  2INU A;  2O1D A;  3JUR A;  3UW0 A;  4EW9 A;  1KCD A;  5C1C A;  1PE9 A;  3B90 A;  4OJ5 A;  2QX3 A;  3B8Y A;  1OFL A;  1QJV A;  4XLE A;  1RWR A;  4XKV A;  2PYH A;  1IB4 A;  1O88 A;  2NSP A;  4Z05 A;  4YEL A;  3GQA A;  4NK8 A;  1IDK A;  3GRH A;  1O8F A;  3VMV A;  1O8G A;  3FY3 A;  2X6W A;  4XLA A; 
#chains in the Genus database with same CATH topology
 1Z3Y A;  2DA3 A;  1T6S A;  1D8J A;  3V8L A;  1J9I A;  2E19 A;  4Y3O A;  5FLM J;  3T5X A;  3S93 A;  1OPC A;  1FX0 A;  2D74 A;  2V1X A;  4ZC3 A;  3KRG A;  2LFB A;  5CLS A;  3S2W A;  2L01 A;  4TMZ A;  4KN7 X;  3ZQL A;  2EK5 A;  2ACJ A;  1MBF A;  2IEK A;  3FPK A;  3D5L A;  3VR6 A;  1S9H A;  1YS7 A;  3CF2 A;  3U21 A;  1K4T A;  2KP6 A;  1V0F A;  1QA2 A;  2VQH A;  2XTX A;  4TT3 A;  1N78 A;  1WJD A;  2CO5 A;  2OUM A;  3HEF A;  4ZDP A;  3D26 A;  4RD3 A;  4O6J A;  3AVW A;  2LOO A;  3T1B A;  4MGR A;  5HXB A;  4MR0 A;  2O61 A;  2XC1 A;  2KFD A;  2KMU A;  3OAA A;  5DNS A;  3BZC A;  3OIO A;  1N0U A;  2HPI A;  1DP7 P;  2V1N A;  2EV6 A;  1WPK A;  2Y69 H;  2WJY A;  2YX4 A;  4CZZ A;  4B4D A;  3M1C A;  5B5E C;  2ZME A;  3GXO A;  2Q6I A;  3A8K A;  4RS8 A;  2BV6 A;  3A4C A;  2XF7 A;  2D45 A;  2B0R A;  3GX4 X;  1I5Z A;  2E5N A;  3LSJ A;  4PDK A;  2GZW A;  2XB5 A;  1XSV A;  1O8D A;  3OYF A;  1AA7 A;  3ASS A;  4CYC A;  2K27 A;  2NVQ J;  4MIM A;  3CPX A;  3ABK H;  4Y17 A;  1TT5 B;  3LAP A;  4P3I A;  2GWR A;  1LUJ B;  2L2O A;  4B43 A;  3AGP A;  1MW7 A;  3OYG A;  2J7K A;  1AMO A;  3OR1 C;  2E1M C;  3QSY A;  1PDN C;  2C5B A;  3SZE A;  5EDN A;  3DTE A;  3CMY A;  3KLO A;  4E7Z A;  4Z4T A;  4EJO A;  1YX5 A;  4CCJ A;  3K70 C;  2VOP A;  2M1B A;  4RD6 A;  1SMY F;  1JUP A;  1UEL B;  3CC7 B;  1SC7 A;  4OIQ F;  4AIK A;  3C7J A;  1PJR A;  5CYV A;  4BQQ A;  1Y0R A;  4C3J J;  3D1N I;  3BTJ A;  4FTH A;  3F9K A;  1TQI A;  1A6I A;  2MYS A;  1OGI A;  3WND A;  4RBO A;  1AU7 A;  3HOS A;  3BPX A;  3Q0W A;  4FN5 A;  1T56 A;  4A0Y A;  4C3H J;  3S17 J;  3HOT A;  2GIZ A;  4BBR J;  4V19 K;  3K4M A;  5E20 A;  3I0T A;  2PQ8 A;  1MBH A;  1FLI A;  2RC4 A;  2E1C A;  4WXC A;  3PA2 A;  1F43 A;  3FXO A;  4Z4S A;  3ML6 A;  2F5D A;  6PAX A;  2DOG A;  4YHB A;  4Z06 A;  3JSP A;  4QUZ A;  1Z3X A;  1OIS A;  2JTV A;  1T95 A;  3CCJ B;  4HX8 A;  3JQP A;  3ZN1 A;  2CG4 A;  2EWN A;  3D5S C;  5LRR A;  1PJ5 A;  1TUI A;  4CCO A;  2XB0 X;  4FCY A;  2O1D A;  2RDP A;  4IHX A;  3HSF A;  4ON0 A;  3OS2 A;  4L18 B;  4XSX F;  2HMA A;  4U87 A;  1RZ4 A;  2M34 A;  4RMN A;  4XKV A;  2LVS A;  3PEN A;  2OZU A;  2NSP A;  2PLY A;  2Y75 A;  1D0Y A;  5FO1 A;  4LC0 A;  1K78 A;  4I98 B;  3A0B C;  4LGW A;  4TV7 A;  1RNL A;  1YJN I;  1V5V A;  1DDI A;  3DV8 A;  2EIJ H;  3P9I A;  5LGN A;  4M1K A;  2DMP A;  2LRD A;  5D8L B;  2X3U A;  4ZCM A;  2WYR A;  1SFK A;  2R0Q C;  5IYR A;  1W35 A;  4BUP A;  1FIA A;  3I59 A;  1GHC A;  1WJE A;  1W5T A;  2R7Q A;  1Y56 A;  3WG9 A;  4B8X A;  5BPD A;  1EF4 A;  3CDH A;  3SJP A;  2V5I A;  4I0A A;  3V7A A;  1UG0 A;  1QA6 A;  4ROX A;  1I1G A;  5F0F A;  3K4B A;  2ZJR F;  2GXB A;  4JOM A;  4DZP A;  2DXI A;  3SJZ A;  3G1O A;  2MC3 A;  3BG7 A;  1R5N A;  3FIW A;  2VBT A;  2K86 A;  3DLA A;  2CV0 A;  2BMW A;  2L4A A;  3BR0 A;  3PNT A;  4HE6 A;  2A5W A;  5FKO A;  2V7Q A;  2WAD A;  4O5V A;  1LLZ A;  1N08 A;  3F8B A;  2KIF A;  5E1X A;  4CDG A;  1GVD A;  2CC2 A;  4AVZ A;  4HNT A;  2ZME C;  2KT0 A;  4LLN A;  3S1Q J;  1W7P D;  1LE8 A;  2OCE A;  3MZH A;  2ISZ A;  1ETK A;  3J81 Z;  3ASP A;  1IDY A;  1X1D A;  2VBY A;  4I2O A;  3GQB A;  2A5Y B;  1I3A A;  2CGP A;  3HOW J;  3S2D J;  4YEJ A;  1H80 A;  1RMG A;  3AG3 H;  1AWC A;  1ZRD A;  4M6V A;  4LBY A;  4WZL A;  2DYI A;  1F4K A;  1MGT A;  3VB2 A;  5BQT A;  4I09 A;  1SM4 A;  3U6K A;  4WZT A;  2LKP A;  3CP8 A;  1KQ8 A;  3OYK A;  1IUF A;  1K6Y A;  1YLF A;  1TWG J;  2K85 A;  2KJC A;  1XDU A;  3HRS A;  4PFP A;  3ZCO A;  4XRS A;  4QTR A;  5H5J A;  4FHT A;  1D0X A;  1GVH A;  3J7A Y;  3JRB A;  4RAZ A;  3LQE A;  2RVC A;  4BNC A;  2IVM A;  4GYG A;  2Y31 A;  1A31 A;  1IV6 A;  1W9X A;  3HPG A;  3PM1 A;  5DD8 A;  3T8T A;  4E7H A;  4P12 A;  1QRY A;  4EEF G;  3F6O A;  3K7A J;  2M4K A;  1S4M A;  2Z99 A;  5HOO A;  3HOY J;  2EBI A;  4RB0 A;  4UUS B;  2GK6 A;  2BHZ A;  1WI3 A;  4U7B A;  3MCA A;  3H5N A;  4XM3 A;  4BEH B;  1R1T A;  3I71 A;  4MFD A;  4Z4R A;  1ZM3 A;  1H89 C;  1WMR A;  1R1V A;  2P8T A;  5IYC J;  2X53 S;  4HIZ A;  4PCQ A;  1B4A A;  4Y7C A;  2XGE A;  4OOX A;  4WXH A;  3VDX A;  5LD2 C;  5IK2 A;  2G0E A;  2KJB A;  1BBY A;  1KMH A;  1BR2 A;  1XGO A;  1JTA A;  3SDB A;  2NNY A;  1SAX A;  2JN9 A;  2YWG A;  4WZK A;  2ZL6 A;  2I10 A;  2JDI A;  1U6G A;  2C4T A;  3PUM A;  1QVG B;  3JQQ A;  3V7C A;  2RNG A;  4PFO A;  1L0O C;  5DYM A;  2ZNZ A;  4JYK A;  1R7J A;  1D5Y A;  1YX2 A;  1IUY A;  1TL8 A;  3IL2 A;  4G7Z F;  2EA4 A;  1C0W A;  2NT9 A;  2JA6 J;  5C4X J;  3Q6R A;  1WGX A;  2W25 A;  2WAE A;  5GP9 A;  3ELK A;  1D3Y A;  4TMW A;  1W5C C;  1TYW A;  3QFR A;  1I7P A;  5EG0 B;  3N6Z A;  4X07 A;  3BWG A;  2X0L A;  4UV9 A;  1G8X A;  1X1C A;  1FOY A;  2NYX A;  1RWR A;  4R79 A;  2XPV A;  2GA1 A;  3E3V A;  3HUG B;  1BR1 A;  1MBJ A;  1H0M A;  2ZZG A;  5TY0 A;  4L5E A;  1X1A A;  3RPQ A;  3BZ6 A;  2HVR A;  2W6J A;  3CC4 B;  1IDK A;  1GLN A;  3B6C A;  3FY3 A;  3QQA A;  2EFG A;  4HRI A;  3LST A;  2VUM J;  5DUK A;  2ID3 A;  2MSY A;  1IRF A;  3OW7 A;  3WY9 A;  3OEH A;  1E3O C;  4BH9 A;  5GPA A;  3JAM K;  1DBG A;  2JSC A;  2Z1D A;  4RM0 A;  1I39 A;  5J1Y A;  1N25 A;  1G3W A;  3Q0U A;  3VYU B;  3QYB A;  3CDI A;  2HNH A;  5CVV A;  1JJ2 B;  2LSO A;  5D5U B;  5FLV A;  2MH2 A;  2DAO A;  1MJ9 A;  3TQN A;  1HDD C;  3RKQ A;  4O3M A;  2DCU A;  2FUG 2;  5AON A;  4G7X A;  4MQ9 F;  2O04 A;  5IYN A;  5LEK A;  5CQE A;  2A6H F;  2LRE A;  4IHS A;  2TRT A;  1R1U A;  1WRJ A;  4XOP A;  2O17 A;  1YW8 A;  3HHG A;  2F48 A;  3E20 A;  2JJ1 A;  1O7L A;  1KJZ A;  3DF8 A;  1SVM A;  4DK0 A;  3T9G A;  4G8X A;  1DPU A;  5HDK A;  1MDM A;  5J3L A;  2GOX B;  2NTP A;  2EIN H;  1IJE A;  3SFI A;  2JVG A;  1F1Z A;  3I9V 2;  5J4Y A;  2STW A;  3GVL A;  4YAO A;  2DLL A;  3CD6 I;  3QP6 A;  1E2X A;  1ZR4 A;  5K7F A;  2XNJ A;  2DA5 A;  3KL9 A;  1I27 A;  1KU9 A;  1WCM J;  1LVA A;  2NS0 A;  2XF5 A;  1MSE C;  3U9G A;  4OJ6 A;  3BR6 A;  2AXT C;  2M45 A;  2VBW A;  2ZME B;  3FXJ A;  3W2W A;  1YJ9 B;  3A03 A;  1OCT C;  2X6X A;  3L2Q A;  5LFA A;  3VPR A;  2Z2S B;  2MH9 A;  5ED4 A;  3W2A A;  5LGU A;  4NUB A;  3DU1 X;  3CLQ A;  3FKJ A;  3DEW A;  1QPI A;  2STT A;  2BV3 A;  2F1L A;  2M5S A;  3CMA B;  1TWA J;  4JP0 A;  1PXZ A;  3EUK L;  2JVH A;  2CBX A;  3DPT A;  3K4K A;  2DFF A;  5TGT A;  4R8H A;  4A3I J;  1TBX A;  1XG2 A;  2F5C A;  1IF1 A;  2ME6 A;  4EH1 A;  2JA5 J;  1TSP A;  3HIF A;  4NQW A;  1Q1V A;  4R71 A;  3RDI A;  1SVL A;  3V4G A;  3J80 K;  1B8I B;  3MZY A;  3TL4 X;  1ZG1 A;  4IKF A;  3G4S I;  4FX0 A;  3OYE A;  3Q3A A;  3FM3 A;  2Z6B D;  2F5F A;  5D4R A;  1I1S A;  3D5R C;  2XKP A;  1RR8 C;  3BJ6 A;  2VFO A;  4KIB A;  4KIF A;  4Y7N J;  4KIG A;  1OYI A;  1LVK A;  3EET A;  5K5R A;  1K7A A;  2GXG A;  3GZ5 A;  4IRI A;  2IJL A;  4M3G A;  2O8K A;  1ZH5 A;  1AKH A;  1FNC A;  3WBK A;  1FBU A;  1FY7 A;  2VIX A;  4P9F A;  1WDT A;  4P6Y A;  5FD5 A;  4HOB A;  1YTY A;  3NAW A;  1ZLJ A;  4EW9 A;  1KCD A;  2FEZ A;  4GXO A;  2W7Z A;  3LSK A;  3PUB A;  2VAS A;  2V31 A;  2QX3 A;  1QJV A;  3B8Y A;  2I8D A;  4UUT A;  1BIB A;  4UZE A;  1VF7 A;  4Z1M A;  3FKS A;  1VQL B;  3BH6 B;  2QZA A;  1STZ A;  4AVP A;  3P4G A;  2QDX A;  2WJV A;  1U3E M;  4F7Z A;  4UVB A;  5L3G A;  2XC7 A;  5DD4 A;  4LJZ F;  1IAW A;  4CCN A;  1MDM B;  1D1B A;  3FXU A;  3CCS I;  1O8F A;  1VJS A;  3CMM A;  3OKX A;  2X6W A;  2Y0S N;  4PJ0 C;  2Z9O A;  3BP8 A;  4AC9 A;  5DS0 A;  4WQM A;  1BC7 C;  1VQN I;  4I01 A;  3S1N J;  3JRC A;  1T6Z A;  2Y0M A;  2PMZ N;  2K3F A;  3KYL A;  3WBJ A;  2V79 A;  1IV8 A;  1X4O A;  2WAQ N;  1JKP C;  3BNW A;  5HNF A;  2DQR A;  2F4O B;  2XPW A;  1R5I D;  2ZXJ A;  3VYS B;  1MJA A;  4E7I A;  2ZZE A;  1ETQ A;  1SD4 A;  2P5K A;  1XE1 A;  4P25 A;  2V6E A;  1KQS B;  1SVO A;  2VKE A;  3RJP A;  2DDA A;  4HV5 A;  1FRN A;  4K1X A;  3WGH A;  2HXO A;  2QWW A;  1ONV A;  2O6W A;  3BR5 A;  1KRH A;  3C18 A;  3ZQG A;  1YX3 A;  4MXN A;  1RKW A;  2HOS A;  1TWF J;  5EZH A;  4J19 A;  4RD1 A;  3L2C A;  2BY1 A;  4M6X A;  4C2L A;  1B8I A;  2E1O A;  4UZF A;  5LHH A;  3S3M A;  2IGN A;  1Z1D A;  1O3R A;  1YG2 A;  2ZJP F;  3GTP J;  3ABU A;  5E3M A;  3CCM I;  3LMW A;  4YG2 F;  3KP7 A;  2WB1 A;  1JGG A;  4KDP A;  1QUE A;  2OBS A;  1DDG A;  3MZ8 A;  3CES A;  1A04 A;  3OYD A;  3RQI A;  2ZO4 A;  1N07 A;  4MYU A;  5KVR A;  3I4M J;  3PUN A;  1D8K A;  1VHE A;  2CQ7 A;  3PA1 A;  1DP3 A;  5IPA A;  3VFZ A;  5ERI A;  5IYB J;  4XD7 A;  2J8K A;  4Z4Y A;  2QE7 A;  3F3X A;  3ONY A;  3U2Q A;  3CJQ B;  3C2H A;  3OYI A;  2PE3 A;  3H36 A;  4PGG A;  3ROU A;  1Y0N A;  4A5M A;  1I18 A;  5GV7 A;  2QQA A;  1RPW A;  3RPU A;  3ASR A;  1T38 A;  1QNT A;  1H85 A;  4UNO A;  2B7B A;  2XZO A;  3G3Z A;  4A12 A;  4KIT B;  1PP8 F;  2R6H A;  4XOR A;  1MMD A;  4S0H B;  1VQ6 I;  2XRO A;  2IRF G;  1NK2 P;  1XGN A;  3G71 I;  1YQA A;  3VOD A;  2V6C A;  3T51 B;  2L54 A;  1I50 J;  4OM9 A;  3FJO A;  2GQF A;  2Z5U A;  2ZXH A;  2BXY A;  4W8R A;  4X7D A;  2VC0 A;  3G6E I;  2VKD A;  4ESJ A;  2V7F A;  2WBM A;  3RTR A;  2HTS A;  3ZR8 X;  1BMF A;  3A1P A;  5JVT A;  5HDG A;  3H1C A;  4BEH A;  4MYT A;  1MMS A;  3HL2 A;  1TNS A;  4KJZ A;  3W5V A;  3VNV A;  1U5T B;  2INU A;  1S3J A;  1YJW I;  1EP3 B;  3CCL B;  4N9H A;  1YHQ B;  3W2H A;  2DIE A;  4DYR A;  3QE2 A;  1OFE A;  3W2E A;  1UB9 A;  2O03 A;  5GAH J;  3G73 A;  1PP7 U;  5F04 A;  3JRF A;  2HKO A;  1V3F A;  1HZE A;  1BR4 A;  2XVC A;  3GTG J;  2XRL A;  3NAU A;  3OYB A;  3WHC A;  1EH8 A;  1IG7 A;  5BPI A;  5H20 A;  1EA3 A;  2GJK A;  1GV5 A;  2HDW A;  3DDY A;  4Z03 A;  4W1U A;  1MSF C;  3ZGK A;  2D3L A;  3M8F A;  2DJI A;  3ZMT A;  4ZYG A;  3OOC A;  3SFZ A;  1FBS A;  5M5W J;  2QBY A;  2R7O A;  4XRM A;  1NJI D;  5BSX A;  2HOA A;  5JLW A;  2DN0 A;  4IEJ A;  2XZL A;  4W8Q A;  2XGC A;  3BRO A;  3OSG A;  1KTV A;  4U49 A;  1OYY A;  3KZI C;  1W2B B;  3S16 J;  3LMM A;  3FPP A;  2AQE A;  5A88 A;  2E7X A;  1MNM C;  4IHT A;  1T6Y A;  3BPV A;  2O7O A;  4KIC A;  3A1Y A;  5J8C A;  2E2I J;  4NCN A;  3SLN A;  5DSZ A;  1HQC A;  1IDZ A;  3KEY A;  3TH0 A;  4QVA A;  5C1E A;  4Y13 A;  4OPV A;  2F3L A;  3E5X A;  3LSI A;  1U9N A;  4D7M A;  3CCR B;  1FYL A;  3FDY A;  3Q9S A;  3WHB A;  5FKN A;  3K4C A;  1SAU A;  3E5U A;  1EH7 A;  2LY2 A;  1BJZ A;  2R7Z J;  2X3H A;  2MD0 A;  1EFT A;  5C3E J;  4TSF A;  1Z21 A;  5DCM A;  1WZ2 A;  4YIF A;  2PX9 A;  1JJ8 C;  3ZOB A;  2PEC A;  3L2R A;  2XAF A;  1K8F A;  4XRF A;  2IS6 A;  2EIM H;  1NB0 A;  4A3L J;  2KLO A;  2LKS A;  3H5R A;  3ZP5 A;  1ZAO A;  4TMT A;  2ZBK A;  3HRT A;  1O7F A;  2JRT A;  4BL0 B;  2NV4 A;  3TDZ C;  4LIV A;  2RN7 A;  2R5Y B;  1TP4 A;  4M74 A;  4Q47 A;  3PL8 A;  3VNU A;  3V76 A;  4AUX A;  1UD8 A;  1Q7Y D;  3FHN A;  4X7C A;  4HA8 A;  1XGS A;  2IAI A;  2VE8 A;  3HXL A;  3Q6Q A;  2HTJ A;  3PNV A;  4WZE A;  4NB5 A;  5EMN A;  4N9I A;  3I5U A;  2W00 A;  4OPS A;  1EFR A;  3DBL B;  4L9N A;  4G6D A;  4M9Z A;  5E1W A;  1X19 A;  1BHE A;  4QIW N;  3I58 A;  4P55 A;  2LLK A;  2C77 A;  1A8P A;  3T0Y A;  5K7H A;  3F22 A;  2R7V A;  1BI2 A;  4B47 A;  2F4I A;  3NWS A;  2QF7 A;  2X51 A;  3O2P E;  2LNB A;  2IT0 A;  5DM6 F;  2QBY B;  2XTY A;  3NAR A;  3ZQ7 A;  2NST A;  3ASO H;  5IYP A;  2O0V A;  2M9H A;  2QXZ A;  4NQW B;  1USS A;  4A3F J;  3L2U A;  4MLO A;  4WK8 F;  3GQ8 A;  3CO6 C;  1Z05 A;  3H0D A;  2R7W A;  1VQK I;  2NZM A;  1FC3 A;  4BE2 A;  4OIO F;  3ZBT A;  3P9C A;  4M9X A;  1JT0 A;  1VQ6 B;  1X0C A;  2XHK A;  4HDV A;  2QLZ A;  1K6O A;  1QHH D;  4IW3 B;  4YXW A;  3BCA A;  4DNC A;  1J5Y A;  3ONQ A;  2WAF A;  5FKK A;  3S1R J;  4RGS A;  1M1E B;  2KKO A;  1MBG A;  1VQP I;  1DU6 A;  1QH0 A;  1HVX A;  3HAG A;  4FQG A;  3LYC A;  4AID A;  4BYY A;  3CF5 F;  1P7J A;  2PYH A;  3EUH A;  4BJ6 C;  3JR9 A;  2MAB A;  3KYD B;  1AKH B;  3GTL J;  2XEX A;  3B6A A;  4BE1 A;  1FEX A;  3A3G A;  1SD5 A;  1Y6I A;  3HOX J;  3HZJ A;  4YAF A;  3DTI A;  2ZFU A;  2MD5 A;  4TMV A;  2VB6 A;  3F72 A;  3NWT A;  4UAJ A;  3RI4 A;  4QFM A;  3B8H A;  2MC4 A;  3BY6 A;  2LDU A;  4ZYA A;  4ZGQ B;  2QN6 A;  1JE8 A;  3GQ9 A;  4OZY A;  5F64 A;  1ZEL A;  2Y9Y A;  4HPQ A;  4HX4 A;  2DCE A;  4ZYH A;  4KNY A;  4JMQ A;  2DFI A;  3N97 A;  2OYN A;  5FRN A;  2X1E A;  4HF0 A;  1WH5 A;  1XMX A;  1W36 C;  4KYW A;  3TBI A;  2WZN A;  2YWF A;  4G6Q A;  4NC6 A;  3WWG A;  3L7W A;  3SYJ A;  3RZD J;  1S29 A;  2FML A;  1S5L C;  2WY8 Q;  5J6X A;  2BY3 A;  3DBR B;  2JJ2 A;  2X0K A;  5FA6 A;  2JUG A;  2P6T A;  2R93 J;  5F0H A;  3IRR A;  2NS8 A;  1Z7L A;  3KP3 A;  3AL0 C;  2P6S A;  2Z16 A;  1T33 A;  3R61 A;  3ABL H;  4EM2 A;  4G6T B;  3ULQ B;  1TYX A;  2ISY A;  4L9T A;  3ZMS A;  4QV2 A;  2QUF A;  2JSP A;  2Z8G A;  3SYT A;  1BLI A;  1R00 A;  3WYA A;  2QKL B;  3P9K A;  1YIJ I;  1APL C;  2ZL5 A;  1J75 A;  1T2K A;  5H6Q A;  4DNT B;  3VMW A;  1SAN A;  2AXL A;  1FSE A;  5TRD A;  1E3P A;  2VQG A;  1GO2 A;  3KP6 A;  5L3F A;  4X0C A;  4X7F A;  2L7Z A;  5AMV A;  1E1Q A;  3JRE A;  3HRM A;  2ZB9 A;  3BG5 A;  2HVS A;  1J09 A;  4QPQ A;  5TIS C;  2BY0 A;  2HPM A;  1E0E A;  1B9N A;  1WOP A;  4LBW A;  1WH7 A;  2Y2Z A;  4AIH A;  1T39 A;  5GTI C;  3ZIA A;  3WTU C;  2INV A;  1QVF B;  2Z33 A;  4N0B A;  2H8W A;  4A3J J;  2WAQ A;  2R3S A;  1BA5 A;  1BQE A;  1UHW A;  4RB2 C;  2COM A;  3PNY A;  4L9V A;  4XR6 A;  4CO8 A;  4GDF A;  4HF1 A;  4LBZ A;  5GAE J;  2E1N A;  4V2F A;  1QCX A;  4YFO A;  2P7C B;  2E34 A;  4FET A;  3AL0 B;  2OTJ I;  4P9U A;  2D9R A;  3OOU A;  1OB0 A;  4ZZL A;  5AN9 A;  3F21 A;  3DBH B;  3CQZ J;  4MEX F;  2QYU A;  5ILS A;  5LBQ A;  3S3O A;  3G4S B;  4OZZ A;  4KIS A;  3ESW B;  3KPH A;  3CLO A;  3OZW A;  3OMY A;  4M9S A;  4IRH A;  1UJ8 A;  1Y1V J;  4LD5 A;  1PJ7 A;  2HYG D;  4QLC U;  1FNM A;  1Z7U A;  2BXZ A;  3GTJ J;  3BR2 A;  2LC2 A;  4G1V A;  1EJ9 A;  3TOB A;  2V7T A;  2IQ7 A;  3SQN A;  1X1B A;  2OJE D;  1Z77 A;  2FOW A;  4OIN F;  2G7H A;  4XN0 A;  1EP1 B;  4MEY F;  2YUH A;  4BPR A;  3LJY A;  1UZC A;  3CUQ C;  1JJ6 C;  2L4M A;  3WOD F;  4AF6 A;  1PE9 A;  2NVT J;  4IQ4 A;  1OFL A;  3I3L A;  1QUF A;  3TO9 A;  3S8P A;  2FQ3 A;  1LLW A;  2MW8 A;  4H9G A;  1XGM A;  1BL0 A;  1Z6T A;  1G7R A;  4ACA A;  4BHP A;  2XAJ A;  1U8B A;  2GBY A;  2YSR A;  4HV6 A;  3B82 A;  2PJR A;  4WF2 A;  1ZTR A;  2GK7 A;  2DYS H;  5B1B H;  3ZBU A;  2QSG X;  2BVM A;  2KRF A;  3GFM A;  2NVU B;  4F92 B;  2IGK A;  4XON A;  5FFZ A;  1BI0 A;  4IJA A;  3QFT A;  4ZYD A;  1X3U A;  1XS9 A;  2K4J A;  4C2U A;  1CGP A;  1YRN B;  3HTU A;  1ON1 A;  1V54 H;  2ZSH B;  1W0K A;  2YUS A;  5LMZ A;  2A69 F;  4FXU A;  4X0G A;  2VBS A;  3ECO A;  3IUO A;  3KIO A;  3S32 A;  1Q9S A;  3K6G A;  2UXX A;  4GFB A;  3HGG A;  2K9M A;  4RAG A;  1MMA A;  2CMP A;  3FWE A;  2QEX B;  4LIU A;  1G4D A;  2I1L A;  4ZV4 A;  4EGZ A;  3RKW A;  1I3Q J;  1BI1 A;  1A5J A;  1OFD A;  2LK2 A;  3GO5 A;  1YO5 C;  2F6C A;  5CVI A;  4BAY A;  2WWY A;  3J80 Z;  2Q0O A;  4II3 A;  1IXC A;  2VQC A;  3LVB A;  5BNG A;  1N06 A;  4P1W A;  1GDT A;  1VQM B;  1X3W B;  2W57 A;  4RLF A;  3ZPN A;  3SY2 A;  4OJO A;  3CC4 I;  4EJW A;  2PMD A;  3GWZ A;  2VZL A;  4MTE A;  5HZA A;  2BHY A;  3LA2 A;  1ZRE A;  5FRO A;  2DYR H;  1EE6 A;  4UY8 I;  2G9W A;  4XKC A;  3MEX A;  5FKL A;  1JXS A;  4XNF A;  3LNN A;  4UB6 C;  2Y30 A;  4KT5 C;  4WWC A;  2GOM A;  2Q2E B;  2QMU A;  3FXL A;  3SKB A;  4W97 A;  5JMC B;  1KYW A;  1OFM A;  2LR8 A;  4GRI A;  1ODD A;  5GPC A;  3PJR A;  1T6X A;  4P6V F;  5L46 A;  3RQ4 A;  3CB4 A;  2VJI A;  2VBX A;  4C2T A;  1GAW A;  1DPR A;  1V5G A;  3VWB A;  2BW3 A;  3WTT C;  3JRH A;  5C4J J;  2UWM A;  3H9Q A;  3CC2 I;  2ECB A;  2RGV A;  1B72 A;  3JSO A;  1TC3 C;  2IS4 A;  1RRJ A;  3V42 A;  4NHJ A;  4D5F A;  1CZF A;  4NNJ A;  4ENN A;  4MHG A;  1O3T A;  4P22 A;  3LSR A;  2BSP A;  1BM9 A;  1K5C A;  4RGU A;  1UG2 A;  3ZQH A;  4C3I J;  2R7X A;  3K10 A;  4YCQ A;  4LG0 A;  1SFE A;  4XMY A;  2DA2 A;  1TW3 A;  3MKL A;  1LM1 A;  1W4M A;  2R92 J;  4B3G A;  2VPL A;  4PJL A;  1FTZ A;  4ZYE A;  3ZQC A;  2VT2 A;  5GTH C;  3B78 A;  5KHD A;  2BZT A;  2LYC A;  3PSS A;  3H9N A;  2WV0 A;  1V5F A;  3SDG A;  2X1D A;  1Y8R B;  4RD2 A;  1B23 P;  3JTG A;  3OOP A;  4XLP F;  3GLX A;  2ELH A;  2CSO A;  2EB7 A;  2V7X A;  1MJB A;  2B0L A;  4P5O A;  2VPR A;  1XN7 A;  2AS5 F;  2VOD A;  1NTC A;  4HE5 A;  3BH7 B;  4ENJ A;  2GAU A;  4QSH A;  1NK3 P;  2PMU A;  4IOA F;  1IRZ A;  4F93 B;  2L9R A;  2ZTG A;  3TDU C;  5E3L A;  4EMS A;  4KKT A;  4AF7 A;  3UR3 C;  4OIP F;  1IB4 A;  1LDJ A;  1G7T A;  3CCY A;  5EEG A;  1WI9 A;  3E0J B;  4Z2Y A;  5BS6 A;  5GAG J;  1NH3 A;  3R6J A;  3L9F A;  2HS5 A;  4B3X A;  4BXF A;  3WTZ A;  2KIM A;  4IQJ A;  2OCC H;  3MMY B;  4PC2 A;  3W5H A;  4MO7 A;  1W0U A;  3WXM A;  1O57 A;  3BTI A;  3DEU A;  1IGN A;  4OOS A;  1D2E A;  2PI0 A;  4PUS A;  3K4N A;  1VQP B;  4YEI A;  2LTP A;  3KZY A;  4XKW A;  1BIA A;  5JHU A;  2ZJQ F;  2LY1 A;  5FRM A;  2KVO A;  3MMP A;  5GAD J;  2DA1 A;  3BC9 A;  4Z4Z A;  3EQN A;  3MQ0 A;  2HFH A;  1ETW A;  3IKT A;  3HOV J;  2OBP A;  4PC3 A;  2KRH A;  2MFZ A;  2RKH A;  3A2K A;  1LEA A;  2XAH A;  3IH4 A;  3WU0 A;  1J9Z A;  1GR1 A;  1OGO X;  3WGI A;  2CJJ A;  1LFU P;  5KW9 A;  3J7Z I;  2EFW A;  1B72 B;  3BJO A;  2W24 A;  2ZC2 A;  4D5C A;  2R7R A;  2ZCW A;  4M53 A;  5A2Q Z;  3M3Y J;  1O3Q A;  3PFI A;  4ENK A;  5F4J A;  3ZUG A;  1QG0 A;  2FJ1 A;  1TLL A;  3ECH A;  2NVY J;  3T56 B;  3QOD A;  4DBQ A;  2O9L A;  1Y0U A;  3C2B A;  3PO2 J;  2VFQ A;  1RQP A;  1QHG A;  2V1U A;  3HM5 A;  2JJ7 A;  2H27 A;  1IN8 A;  4LG0 B;  2JK3 A;  1HSJ A;  3LO8 A;  2BYV E;  2DPD A;  2W84 A;  2D1V A;  3OYC A;  2BVN A;  4RCY A;  2EA2 A;  4DOZ A;  1FPQ A;  3J81 K;  4BGD A;  3Q5F A;  1ZGW A;  4UZU A;  1YJN B;  2OTJ B;  1BW5 A;  1M1K D;  2KIU A;  3EYI A;  1FOK A;  4HX7 A;  3K1P A;  2L9V A;  4U4B A;  1ZAR A;  3IC7 A;  3ZMU A;  2PG4 A;  4D1Q A;  1RQR A;  2HI3 A;  4DBR A;  3OWT A;  4C2M J;  3D0S A;  2P5V A;  1U78 A;  1N75 A;  3IH2 A;  1LEB A;  2RAE A;  2M87 A;  5E3O A;  1KZH A;  3V8J A;  4I02 A;  3IWF A;  4R1H A;  1MMN A;  1VQ4 B;  1PVE A;  3OSF A;  5HLH A;  1RIO H;  3GTM J;  1YIJ B;  1JTY A;  3LSH A;  5HLG A;  1W87 A;  2VQL A;  1ZM2 A;  2HOE A;  4FK8 A;  1O8M A;  1P7I A;  2A3S A;  1OYW A;  3N90 A;  4OOV A;  5A89 A;  1EV7 A;  2K9L A;  4QPO A;  5LHI A;  3DEE A;  1QVU A;  2KZV A;  3JTH A;  1P6R A;  2E36 A;  3CCR I;  2JZY A;  4G5G A;  3UKG A;  4B09 A;  2G0Y A;  3JU4 A;  3HPH A;  1PLU A;  2CFX A;  5LEJ A;  2B7C A;  3IRQ A;  2PLF A;  4KFC A;  2HCJ B;  1WJA A;  2H6C A;  2XDV A;  4PGH A;  1V0E A;  3ZPP A;  1VQ8 B;  2PN6 A;  3K69 A;  4C0S A;  1QFZ A;  1OQY A;  1WSV A;  2DFH A;  3TOA A;  3E1S A;  3MKZ A;  3SZT A;  2BM1 A;  2Q8K A;  2CW0 F;  1DDN A;  2DET A;  1FNN A;  4AIJ A;  1EWY A;  1W7P A;  1D8T A;  5A2Q K;  3K2Z A;  1PUE E;  1Q81 D;  1KQ5 A;  1O3S A;  3S3N A;  4PAA A;  4TKO B;  1O4X A;  2TCT A;  3ZC3 A;  2DDB A;  3MWM A;  5GV8 A;  1W34 A;  2FOK A;  1UMK A;  1F9N A;  4DJA A;  4ZDO A;  2VXZ A;  2JWT A;  2K9S A;  1QZZ A;  4URR A;  3M8E A;  5EG0 A;  3ZQF A;  1KK0 A;  3GQ7 A;  4A3M J;  4E4H A;  3S15 J;  2QA4 I;  1TWC J;  1X2M A;  5D5X B;  3CMA I;  2NRA C;  1QRC A;  3G1L A;  3MHP A;  2CQX A;  3HOZ J;  5HDN A;  2V1D A;  1POG A;  2VBE A;  3OR2 C;  3X2Q H;  3AVU A;  3U1K A;  5CPR B;  4W8S A;  4RGR A;  2R7F A;  3BJA A;  1VQK B;  4ZCL A;  2UUZ A;  3GTO J;  2CYY A;  1R5O A;  1HKS A;  2GIV A;  2J5O A;  4FT8 A;  3BTL A;  3BR1 A;  2Y0S A;  3LFK A;  3QPL A;  4M71 A;  5F27 A;  2UVF A;  2DY1 A;  3GF2 A;  4WXD A;  2GLO A;  1MRZ A;  2X4H A;  1JI8 A;  3R6S A;  3K0L A;  1O8I A;  5CJ9 A;  2KQR A;  2DA7 A;  1FZP B;  2XGX A;  1XC5 A;  4RLZ A;  3HRU A;  3M8J A;  4B3A A;  2DOA A;  3ERE D;  2JN6 A;  1KZL A;  2KL4 A;  2N8G A;  1D1C A;  2QQB A;  3RCO A;  3LNQ A;  2GA2 A;  1H8E A;  2FBK A;  2CS3 A;  1H9G A;  2CWE A;  4DYC A;  4A3C J;  5M5X J;  3E6B A;  1ULY A;  1OFC X;  3FMR A;  5M3M J;  3OYJ A;  1DAB A;  3G05 A;  5J40 A;  5C44 J;  3PIP F;  1VLY A;  1A6Q A;  3Q39 A;  1TTY A;  1F36 A;  5FB2 A;  1G59 A;  4UVA A;  5IT3 A;  5JVG F;  1H42 A;  4PJN A;  3UNG C;  5B1A H;  1QA1 A;  1H88 C;  2E2J J;  2DEU A;  3P5J A;  2O0W A;  4YRV A;  2F4N A;  3HYI A;  4ANJ A;  2L7K A;  2DI3 A;  4A3B J;  4B4C A;  4FE7 A;  3EUH C;  5EJC A;  2PMZ A;  3GFL A;  3OJX A;  2EPF A;  1R5B A;  3OS0 A;  1ZM4 A;  3WU1 B;  1DU0 A;  2BF4 A;  3MN2 A;  4MTD A;  3OL3 A;  5DN6 A;  3DU6 A;  2BGI A;  2Q6K A;  5ICF A;  1OCP A;  4HG2 A;  1O8L A;  1HW1 A;  1UD4 A;  2CRG A;  4D7N A;  2KRC A;  3CP2 A;  3I56 I;  3WGG A;  4P1V A;  3CRZ A;  3WTY C;  4BXU A;  1W1W E;  2XAU A;  2VNH A;  3QFS A;  2Q6O A;  5F1R A;  1HBX G;  5CDF A;  5B6I A;  1KTW A;  1OR7 A;  1W36 D;  4YIR X;  3U2R A;  5BSY A;  5HZB A;  4PJM A;  2VN2 A;  3BZK A;  4M73 A;  1Q82 D;  2WV1 A;  5IOY A;  4YFN F;  1ELO A;  2JPB A;  5EEA A;  3OYM A;  1HKQ A;  2EFO A;  3ZQQ A;  3OJW A;  4U9U A;  4Y33 A;  4CCK A;  2X6O A;  2K9Q A;  3DP7 A;  3QPH A;  1VLO A;  1WOR A;  2X1C A;  3DLL F;  3COA C;  1KK2 A;  2V4J C;  3R4K A;  3GTQ J;  4RDL A;  3JRI A;  1YFH A;  1FBQ A;  4I99 C;  4XLE A;  1ZUN B;  1G7S A;  4BQA A;  3RZO J;  1VQN B;  4HQM A;  1DGW Y;  2FQ4 A;  1YRN A;  2P4W A;  5IY5 H;  3DFG A;  5JR3 A;  3GQA A;  1F20 A;  2WC2 A;  1PJ6 A;  3GME A;  2RQP A;  4M3F A;  4A0X A;  5BMZ A;  1S6L A;  2B9S A;  1UD3 A;  1OCZ H;  4BY7 J;  1QGZ A;  1VQO B;  2BBY A;  4ZGN B;  3OW2 B;  2HOT A;  5E1Z B;  2GJR A;  3PFY A;  1MH4 A;  2MGQ A;  2UZK A;  1MBE A;  4XBF A;  5EF6 A;  1HA3 A;  3DU5 A;  1QFJ A;  3ASQ A;  4N3N A;  1CQT A;  1RI7 A;  2OK7 A;  4CHU A;  1BX0 A;  4HEA 2;  2GPJ A;  1OKR A;  5KK1 A;  4IX7 A;  1TW2 A;  1CF7 B;  1D1A A;  2E1M B;  3MKY B;  3H3Z A;  4PSX A;  1ZR2 A;  4G1B A;  1U9O A;  2J5P A;  4IL6 C;  2ZXI A;  5IP9 J;  4RAF A;  1LDD A;  2EJR A;  3TP3 A;  1YI2 I;  1EFU A;  1QFY A;  2MLG A;  4BAC A;  4CZC A;  1MH3 A;  1Y39 A;  1FOX A;  2FBI A;  3MCZ A;  3K70 D;  2LMD A;  2M5W A;  1EKE A;  1N77 A;  2M7B A;  1OGM X;  3GBG A;  1ZG5 A;  2EWE A;  2KDO A;  4AD9 A;  2LF7 A;  5D5V B;  5M3F J;  4XRS G;  3WG7 H;  2CW5 A;  3A01 B;  4PC6 A;  4YAU A;  2L7F P;  1AOY A;  4X05 A;  2F5E A;  1QGY A;  1IN5 A;  2RNJ A;  2VJ5 A;  4B44 A;  3ZPL A;  2IBD A;  4WWV A;  5E18 F;  4XN3 A;  3W6J B;  5TJJ A;  3HGY A;  4A5N A;  2XSD C;  2KIS A;  4EQQ A;  4E7K A;  1QU3 A;  1D5V A;  4J0Q A;  4ETS A;  4UUV A;  4CQJ A;  3T8R A;  5K5Q A;  1K79 A;  3JQR A;  1GUU A;  4BBS J;  1ZG3 A;  2CV1 A;  3KYC B;  4XLC A;  1XB2 A;  3FXM A;  4NBS A;  3O6B B;  4RDJ A;  1P4W A;  2XRN A;  4CUG A;  5IYQ A;  2R4G A;  3BTC A;  3MD2 A;  2HWV A;  1G7C A;  3WNC A;  1RR7 A;  1XMK A;  2D1H A;  2FF4 A;  4HLX A;  4DYQ A;  3GZ6 A;  4HF2 A;  1E63 A;  3KP4 A;  5L3E A;  3KEQ A;  4FIS A;  3K9T A;  2BM4 A;  1MD0 A;  1JHH A;  4G7W A;  1J7K A;  4IO9 F;  4EM0 B;  4RCZ A;  4OWR B;  3WQZ A;  4BY1 J;  1R5H A;  2M4G A;  1X4P A;  2RV8 A;  5E8G A;  2BE5 F;  2JQ7 A;  1NBM A;  2VKH A;  4JRA C;  3L09 A;  4V2G A;  1IC8 A;  1QO0 D;  3LL7 A;  4YFX F;  2E7W A;  3CCV I;  1G2H A;  2M2E A;  2VNI A;  2ELJ A;  4DNR B;  2EV5 A;  1T08 B;  2O3F A;  3K2A A;  3M07 A;  3JW4 A;  4IRG A;  2CW7 A;  2XV4 S;  1DUX C;  1IB0 A;  2GM4 A;  1OHH A;  1HST A;  4HST A;  3W2I A;  3W5U A;  3ABT A;  4UB8 C;  3AKZ A;  4KKS A;  2VBM A;  1EH6 A;  1JKQ C;  1D0Z A;  2COB A;  3JRD A;  5F4O A;  1O8J A;  1MIJ A;  2DMQ A;  3C3W A;  1RKT A;  4I84 A;  2YS9 A;  1P4X A;  4PGO A;  1Q86 D;  3BY2 A;  1G3S A;  2XNC A;  1X2N A;  2B5O A;  3LA3 A;  1OGJ A;  2BM7 A;  3JCU C;  3OS1 A;  3QYE A;  2WSS A;  5AIQ A;  2XGJ A;  1TQP A;  4ASN A;  2DBB A;  5C1C A;  1VQ7 I;  4B48 A;  2E60 A;  2LKX A;  3CUQ B;  1TYU A;  3A8I A;  5AIP A;  1JNY A;  4HYE A;  1Z67 A;  3A01 A;  4LG3 A;  5FIU A;  2KIQ A;  4AC0 A;  3W2F A;  1O88 A;  1OB2 A;  3CCQ I;  4WCG A;  4Z05 A;  2JA2 A;  4G12 A;  3CCJ I;  4HBL A;  3A3B A;  1ZLK A;  5A8A A;  3ABM H;  3CC2 B;  3KP5 A;  4XLA A;  3E97 A;  3MFK A;  1T0F A;  1EP2 B;  4J00 A;  2VI6 A;  4GO1 A;  4RAY A;  1T0F C;  1L1I A;  3B73 A;  3WE2 A;  3BQZ A;  4KA4 A;  1QBJ A;  1K83 J;  2OBR A;  4MNU A;  3B02 A;  3PIO F;  3K1M A;  4IF4 A;  2E1B A;  3IAM 2;  2ETH A;  3L2V A;  1REP C;  2DER A;  2K3P A;  2V7U A;  4P9S A;  4RPB A;  3RIQ A;  1VZ0 A;  2W7N A;  3CME I;  2R9V A;  2H1K A;  3F23 A;  1EA0 A;  5J1R A;  4FX4 A;  3K1N A;  2H8R A;  2X9D A;  3OY9 A;  3ZZ0 A;  2NT6 A;  3HDD A;  2ZTN A;  5EYR A;  3GUD A;  3CC7 I;  3LQ6 A;  1WOS A;  3B4N A;  4D9J A;  1VQM I;  2ZZQ A;  2AQF A;  3HKZ A;  5CVU A;  2LD5 A;  2L9S A;  3BG6 A;  4XK4 A;  4X7E A;  2HVQ A;  3TO6 A;  4XLF A;  4W8T A;  2W4S A;  2R5Z A;  3Q3S A;  2VJ4 A;  2KDZ A;  1MBK A;  1VBL A;  1WQ2 A;  4DQK A;  2DMT A;  4F55 A;  4ASU A;  5F6F A;  1IO2 A;  4P3Y A;  1OR7 C;  4N4N B;  3I56 B;  4HWV A;  3J7A O;  5E6T A;  4HZF A;  5FLX Z;  3QRF F;  2IA0 A;  2C5H A;  2QTZ A;  1UD5 A;  2LBF B;  1FTT A;  5L3C A;  4OJL A;  2OU2 A;  5FJ8 J;  3BY1 A;  3WNB A;  1LB2 A;  3PSZ A;  2CND A;  1TVC A;  3NQO A;  5DCM B;  1JGS A;  1CNE A;  3BQJ A;  1V55 H;  4BKX A;  3CCU B;  2QY1 A;  1IZ1 A;  2FXA A;  4I7H A;  3J7Y J;  1ITY A;  2OA4 A;  2P81 A;  1IXS B;  3IH3 A;  4A2U A;  3BLY A;  3LQQ A;  1S72 I;  3GCM A;  1FMV A;  2ZSI B;  3ISP A;  5LRS A;  4Q4Z F;  2WTE A;  5DM7 F;  3TGN A;  2A07 F;  3LA7 A;  1EFC A;  5FL7 A;  1XDS A;  4M4S A;  2M7A A;  3QYF A;  4U0Y A;  1GT0 C;  2VFN A;  3A0H C;  3F8F A;  1R4N B;  4BHB A;  2L5Q A;  3TED A;  1SD7 A;  4Y9R A;  2NTQ A;  4A6E A;  1E64 A;  1VND A;  3H3V K;  3GZN B;  4MFE A;  4EAT A;  2V4D A;  2OZ6 A;  3LSG A;  1HDP A;  3TP0 A;  3SJM A;  4CSW A;  2VE9 A;  4RM3 A;  5DV5 A;  2VL8 A;  4I76 A;  5D8K B;  5LGT A;  1HOM A;  4NK6 A;  4GGG A;  2IW5 A;  2ZXW H;  4G7O F;  2TDX A;  4ZZD A;  5JI6 A;  2JPC A;  1QVT A;  5ILV A;  4BE0 A;  4L8J A;  1R6R A;  2BGC A;  4OAZ A;  3H09 A;  1RUO A;  3MAJ A;  3FF5 A;  1SFU A;  1K78 B;  3VEP A;  2EFP A;  3CCQ B;  4GCV A;  2FRH A;  2QQ8 A;  3QOP A;  4HW0 A;  2QM3 A;  3OV8 A;  4AWX B;  5HS7 A;  3SEZ A;  1FYM A;  1KD1 D;  2XT4 A;  3UW0 A;  1P92 A;  3QAH A;  4KT6 A;  5DDG A;  2GXA A;  1ZRF A;  5EEH A;  1WXR A;  1E17 A;  2FE3 A;  3BG3 A;  2P3M A;  1DGR M;  3VO1 A;  4CGZ A;  2PMH A;  3QPT A;  3OZV A;  4BDZ A;  2EIX A;  3EPZ A;  1BX1 A;  4RB1 A;  2H94 A;  4FE4 A;  1QGP A;  4YFK F;  3E7L A;  2I5U A;  4LMY A;  1ZKG A;  2EZL A;  3LSM A;  3I4N J;  4AYB A;  1XSX A;  2YX7 A;  4E7J A;  4E7L A;  4EGY A;  1SKQ A;  4KUM A;  1AIR A;  1P9Q C;  3OYN A;  1R36 A;  3FBI B;  5THX A;  2NXN B;  1R4M B;  2VT3 A;  3VSK A;  1WHU A;  1ZK8 A;  2EIK H;  3CCM B;  1IRG A;  4EJT A;  2RC6 A;  3DQV C;  5M5Y J;  2XKO A;  4WX9 A;  3SEJ A;  2IA1 A;  4NDL A;  1LE8 B;  4A93 J;  5HS9 A;  2YWH A;  5J35 A;  1IDJ A;  1OJL A;  1LDK B;  1X1P A;  3E5Q A;  2YPR A;  3VOE A;  3RSN A;  2P7V B;  3AVV A;  4F52 A;  4Q7J B;  2WY7 Q;  4DQ2 A;  1B59 A;  1ZHF A;  1VQ5 B;  4OAY A;  4BJ5 C;  3QOE A;  1HC8 A;  4CCL A;  1J2X A;  3GEZ A;  5EGO A;  3C2G A;  4JX5 A;  1E3X A;  1N05 A;  1XX5 A;  5ICG A;  2D5V A;  1OLT A;  1XG1 A;  2CUE A;  2EV0 A;  5D6E A;  1R9T J;  3NB2 A;  4V02 C;  3M9A A;  4E7S A;  3I54 A;  4I6Z A;  3QWL A;  3BCB A;  5J3O A;  5HOD A;  4IOC F;  1QA3 A;  1UD2 A;  4QHY A;  1P4A A;  1S72 B;  3H92 A;  1F60 A;  5DUI A;  4JQF A;  3W2V A;  2K5C A;  1A36 A;  1W0J A;  1YYV A;  1EZG A;  1OMI A;  4NC8 A;  1WOO A;  4H0E A;  3PQK A;  2DMU A;  4YZQ A;  3F0C A;  3GFJ A;  5B66 C;  5E79 C;  2M30 A;  1O8E A;  3IKV A;  1NHA A;  1I6H J;  5DEQ A;  2X8K A;  4RDU A;  1JA0 A;  1BI3 A;  3OEE A;  4OMZ A;  2QGU A;  1JTX A;  3CZ6 A;  1IXR C;  2JUC A;  1XFO A;  3GIR A;  1FMW A;  1R5G A;  1SKY B;  3LWF A;  4XSZ F;  1YI2 B;  3O3K A;  1KQ9 A;  2DOE A;  1EXM A;  2ODL A;  3EQO A;  1LNW A;  4K2E A;  1FJL A;  2VKV A;  1K8A D;  3IWZ A;  5LLQ A;  5HS8 A;  2BGJ A;  2HDN B;  1HG8 A;  4OPW A;  3W2G A;  1E43 A;  4YZA A;  5FO0 A;  2J8I A;  4EVI A;  3CJN A;  3MVP A;  3JRG A;  3E1Y E;  3G1M A;  2B7E A;  3KLN A;  2HZD A;  1IHM A;  3KEW A;  4RDK A;  3VST A;  3DPU A;  1QX4 A;  1ZYR F;  1HW5 A;  1Q1H A;  4RJL A;  2FD5 A;  4LLL A;  2QGG A;  4LOC A;  4GYI A;  3G71 B;  4Z6Y A;  4BQN A;  2OBT A;  3AK5 A;  2ZNY A;  3FXQ A;  3FM5 A;  2VBV A;  3DKY A;  2IS2 A;  2XIG A;  2FU4 A;  1ZM9 A;  1D1N A;  4PC1 A;  2VFP A;  2QQ9 A;  3A02 A;  3HC7 A;  2NAZ A;  4NBQ A;  4EJV A;  2BSA A;  4P96 A;  3TKY A;  1BC8 C;  3B90 A;  3L2W A;  5JLX A;  3SLD A;  2A61 A;  3NEU A;  3S14 J;  3BG9 A;  2ZJ2 A;  5EGO B;  3GVK A;  4NC7 A;  1FDR A;  5FGM A;  1JHF A;  4YEL A;  2AHO A;  2LH9 A;  1BOA A;  2IGO A;  3CDL A;  3JAM Z;  3WTX C;  1E3Z A;  3OP1 A;  3S1M J;  3AST A;  1NRK A;  1NDH A;  1XCB A;  3E6D A;  2VJJ A;  3CUQ A;  1LPQ A;  1R22 A;  2FSW A;  4L0Z B;  5E8I A;  1O8K A;  2A05 A;  4YAW A;  3CCE B;  3AFH A;  3W3C A;  2DA6 A;  2PJR B;  2HXI A;  4A6D A;  4M0L A;  1IW7 F;  3MKW B;  3U6B A;  3SZP A;  2JA8 J;  1KQ0 A;  2AHQ A;  1E3H A;  3IP4 B;  4BJT A;  3PO3 J;  2HLD A;  3BCF A;  3P27 A;  3FKI J;  3QU3 A;  2CQK A;  2IGM A;  1G3T A;  1ORK A;  1WKM A;  2W48 A;  3CJT B;  4LK1 F;  3OE7 A;  3SXY A;  1G6N A;  3FMS A;  3ZN0 A;  4E70 A;  3CCE I;  2E1R A;  2GJP A;  2L9N A;  4YDT A;  2E35 A;  3GSI A;  2PYG A;  1T8I A;  4CCM A;  4OPO A;  1DBO A;  3RYR A;  3AG1 H;  1FWZ A;  3CTA A;  2CUZ A;  3I4P A;  2HYF A;  4RPD A;  1OCR H;  3V8K A;  4EJU A;  2O5R A;  2UV1 A;  1U8R A;  3I64 A;  2ZBU A;  3RYP A;  4JX4 A;  1KK3 A;  1QGA A;  2K9N A;  3ZXS A;  4HAM A;  4TMX A;  1MZB A;  2EZH A;  2K4B A;  2VON A;  2R5Z B;  3I59 B;  3SUC A;  3CW2 A;  3H35 A;  3DXJ F;  1U2W A;  2ME0 A;  3EQL F;  4U0V A;  4HLY A;  4OMY A;  2VBZ A;  1UHM A;  3KEO A;  2WPD A;  4XKB A;  2C6Y A;  1OCC H;  3QPS A;  4L9J A;  3KX2 A;  5F08 A;  1TTT A;  3FXK A;  2VC1 A;  5DCF A;  1VQL I;  2GQQ A;  4IHY A;  2UXN A;  1BJK A;  2LBF A;  1IN4 A;  3U1D A;  3FHZ A;  4YZ0 A;  1W7P B;  2OTL I;  3AVT A;  1NHC A;  2NOJ B;  4Q48 A;  4A3G J;  1U2R A;  2OK8 A;  5HLI A;  2WA0 A;  1Z9C A;  2VNJ A;  4RD4 A;  4U0W A;  5HKK A;  1W0T A;  1DQU A;  1S7O A;  2Q2E A;  4F91 B;  2XOK A;  1BPL A;  4RA2 A;  2CU7 A;  5HLT A;  1E62 A;  4OU0 A;  2A68 F;  3BDD A;  2M8E A;  4OOI A;  1GXP A;  4ZTF A;  2HDD A;  3I55 B;  1WJF A;  3A8J A;  3AGQ A;  2BW3 B;  4N3G A;  5CQG A;  1FIP A;  4Q5S F;  4Y9U A;  1ETV A;  1JKR C;  3SQV A;  1U0J A;  2ESN A;  2LP0 A;  3M1E A;  4XLH A;  3H9G A;  5FO5 A;  3A35 A;  2QSH X;  3FIS A;  2C4U A;  2M0C A;  5IP6 A;  2E2H J;  2NTB A;  1XPX A;  1Y0Y A;  1QQ1 A;  4UXN A;  4UV8 A;  4G7H F;  3CME B;  2KHM A;  3EUA A;  1R23 A;  3CJR B;  1KON A;  2G7U A;  3OIP A;  5TV2 A;  3VMF A;  4IVN A;  5K5O A;  1Z6R A;  3AG4 H;  2JMW A;  2V26 A;  3GYH X;  1A35 A;  4S04 A;  1LJ9 A;  1XCV A;  2HQR A;  3ES9 A;  2XND A;  2QCO A;  4ZJZ A;  1IJF A;  1S0U A;  4B3F X;  2DK5 A;  4M2L A;  2HU9 A;  1H8A C;  2R7T A;  4NK8 A;  3BH4 A;  3OZU A;  4LK0 F;  4RB3 C;  2ADU A;  1JUS A;  2HDC A;  5CVJ A;  1VFC A;  4ZTJ A;  4XQF A;  4DQL A;  1RU4 A;  2P0W A;  2HQ5 A;  1HF0 A;  2WR8 A;  1VQ7 B;  2BM5 A;  4RGX A;  1QZE A;  3TW6 A;  5ICE A;  3E6C C;  1SFO J;  2FVG A;  3N4M A;  2CF4 A;  2V7V A;  2VNK A;  1M90 D;  2RC5 A;  2QYO A;  3QP5 A;  3L00 A;  1TYV A;  2QZ8 A;  4U88 A;  5CKT A;  3DWL E;  1NB9 A;  3ZZU A;  1UFM A;  2NS7 A;  3Q38 A;  2D2W A;  2IPQ X;  3C1D A;  2CW8 A;  1RC9 A;  3HSE A;  1IN6 A;  1VQ4 I;  4C43 A;  4Z4V A;  3LOC A;  1HW2 A;  4LIT A;  2LF8 A;  2A6E F;  1ZQ3 P;  1FYK A;  2EFN A;  3RIR A;  2W1O A;  3FMQ A;  5ICC A;  1X58 A;  4XLN F;  4UHT A;  3AVX A;  1R71 A;  1JB9 A;  2JIZ A;  1Y1W J;  1VQ9 B;  5D5W B;  4HQE A;  4L5I A;  1ERD A;  2CUJ A;  4S05 A;  1IJW C;  2CRV A;  3G2B A;  2JT1 A;  3ASN H;  3GW2 A;  1AHD P;  2K40 A;  3JX8 A;  1VTN C;  1RES A;  3BR3 A;  2ZL7 A;  3R6K A;  2V7W A;  3HTS B;  1WTH D;  2V9K A;  3HSR A;  3KE2 A;  3CXC B;  2EQR A;  2XPU A;  2EFQ A;  2CV2 A;  1ETX A;  1P2F A;  2CUF A;  1WPC A;  5ILU A;  1WFX A;  5IP7 J;  4Y15 A;  4ZCI A;  3OFN A;  2XGD A;  4Y52 J;  3RY8 A;  1JUM A;  3ML3 A;  1PUF B;  3M7G A;  1BW6 A;  4ESF A;  1KU3 A;  1K28 D;  2F5V A;  2DPU A;  1LQ1 A;  3I53 A;  4X1E A;  2YWE A;  2UVE A;  2ZIT A;  3CCS B;  4A69 C;  5FFX A;  2FNA A;  1RUN A;  5L3D A;  1LFB A;  4BHC A;  1WSU A;  4P26 A;  4ESB A;  2O6G E;  2FMY A;  2OF7 A;  1SFX A;  1XD7 A;  5BOX A;  3DCF A;  2B63 J;  3VO2 A;  4BQO A;  1UMQ A;  2ZFW A;  1JT6 A;  2FX3 A;  3W6K B;  2XUB A;  2L02 A;  2FX0 A;  1V5E A;  1PKV A;  1BN5 A;  1N0V C;  2A6T A;  1CF7 A;  1XMA A;  2DOD A;  1KYZ A;  1K73 D;  4X06 A;  5F1J A;  3O8H A;  3BOQ A;  2EIL H;  3OIQ A;  1KK1 A;  2K02 A;  1L3L A;  2Z3Y A;  3GVJ A;  3OYH A;  4QWQ A;  1FOW A;  1MMG A;  3KZZ A;  2VLA A;  1KU2 A;  3DPL C;  2CFO A;  4C30 A;  4JBA A;  1I8D A;  1HLV A;  3JUR A;  2XAQ A;  4CIC A;  3V7R A;  2HGC A;  3F8C A;  4EV0 A;  1ON2 A;  4PSW A;  3LSP A;  3OL4 A;  5FKM A;  2DT6 A;  1ZN2 A;  2QKM B;  1HXD A;  4PZJ A;  4HNV A;  2QA4 B;  2P5L C;  1ZRC A;  4IXA A;  4X6A J;  1B2R A;  1VI0 A;  3BQY A;  5D4S A;  3L1P A;  2FNP A;  4XIC A;  4AM3 A;  2EZI A;  4YII A;  2XAS A;  4G6I A;  3GRH A;  2ZZF A;  4PC7 A;  3ZMZ A;  5FNZ A;  1O8G A;  1SMT A;  2FA5 A;  2DK8 A;  2R7U A;  5FLX K;  1E1R A;  3KET A;  3H5A A;  2MBF A;  4A0Z A;  3P26 A;  2AO9 A;  2WB1 N;  4ZDL A;  2PIA A;  2X85 A;  4RM2 A;  2L3D A;  3EDP A;  1JA1 A;  2F2E A;  1BJA A;  2QEN A;  2VXD A;  5DTD A;  5J4V A;  1YJ9 I;  3WE3 A;  2ZBV A;  3NE5 B;  3M4O J;  1GJR A;  1VQ8 I;  4F3Q A;  2OQR A;  1TZL A;  4LFU A;  1PUF A;  3K4J A;  2O8X A;  1E79 A;  4DW6 A;  3LQR A;  3Q0V A;  1LKX A;  2ZKZ A;  4YAL A;  1NG7 A;  2DFE A;  2IA2 A;  5HNH A;  2Y9Z A;  2HYJ A;  3WU2 C;  4XID A;  2BPO A;  3Q9V A;  2BOL A;  4II2 A;  4YZX A;  1SEU A;  5J1U A;  5IT9 Z;  4ABZ A;  3ZSC A;  5F4M A;  2BX6 A;  3HJE A;  2HKX A;  2L0K A;  2C2W A;  1KCC A;  3FXR A;  1CLW A;  2BM0 A;  3LAJ A;  5K7Z A;  3W6V A;  4JK1 X;  1JKO C;  4M3E A;  2X48 A;  5TR9 A;  2DJN A;  2KZG A;  1GV2 A;  5IYD J;  1MKM A;  2O0Y A;  4LLG F;  3HOU J;  1FRQ A;  1WJ5 A;  4KMF A;  3HB9 A;  1H9T A;  3BCD A;  1MAB A;  2VOO A;  2X6Y A;  4E0F A;  3RPU D;  1NG6 A;  1TWH J;  5DS9 A;  2D3N A;  3TW7 A;  1WWX A;  3HBL A;  5FD6 A;  3GTK J;  1DAR A;  1X3Z B;  2CQN A;  2PEX A;  1GVJ A;  1YOV B;  3KP2 A;  2FBH A;  3R60 A;  1ETO A;  1FP2 A;  1YE9 A;  3CCL I;  2DT7 B;  1TQM A;  4N4O B;  1QQI A;  4PJJ A;  4BS9 A;  1UAA A;  2DQL A;  2CQQ A;  2NNN A;  4RD0 A;  4X8I A;  3PVD A;  1FSH A;  4M3B A;  4RLQ A;  1OOC A;  2NVX J;  1KGS A;  4EM1 A;  1UST A;  1ETY A;  4Z4U A;  1O8H A;  3CUO A;  3VYR B;  1YIO A;  4FWT A;  1QZY A;  2M0M A;  1F5T A;  2H6B A;  5H59 A;  4IHV A;  2GRE A;  3P7N A;  3R0A A;  4CXF A;  2XZP A;  5KCM A;  1XTA A;  3J81 k;  1MNE A;  2DU9 A;  5KNL A;  1H8H A;  2MG4 A;  3F8N A;  2OC6 A;  3ZMV A;  4U7D A;  1LFP A;  1Z0X A;  3QFC A;  1BOB A;  3BT9 A;  2M3A A;  2MLK A;  3DTK A;  3VSL A;  3PET A;  1T5E A;  1GQ8 A;  1B1B A;  3VSV A;  1J59 A;  9ANT A;  4QVJ A;  3FK6 A;  4HNU A;  2Q6L A;  2K7L A;  2EZK A;  1HKT A;  1COW A;  3AVY A;  1K4Z A;  4BU2 A;  1TT0 A;  2IS1 A;  3TMO A;  4IZZ A;  1HA8 A;  3IAS 2;  1JRG A;  2YU3 A;  4XL9 A;  1GAQ A;  2OQG A;  2F4M B;  5KSW B;  1ZGA A;  4L0Y B;  2QSF X;  3I1F A;  5KAF C;  1W5S A;  3CO7 C;  4M3D A;  2DTR A;  3BC8 A;  3FBN B;  4HSR A;  1K61 A;  2CK3 A;  4KKU A;  3IHU A;  2XAG A;  4OJ5 A;  5IYW A;  3CCU I;  4ACB A;  2ICW G;  2LZJ A;  3ZZT A;  3GVA A;  1IRX A;  4B1R A;  5IT9 K;  1HF2 A;  3ZRG A;  1I6X A;  4L5J A;  4GQN A;  3QU6 A;  1YW9 A;  4CYD A;  4HDU A;  4ENM A;  1K4S A;  2HEO A;  3DKW A;  5J8F A;  1WJC A;  2W82 A;  1V4R A;  2H09 A;  4IPA A;  4CH7 A;  4ZH4 F;  2RQQ A;  2PJP A;  1WSR A;  3VMV A;  2PFB A;  1MND A;  4PAB A;  3ONU A;  3RKY A;  1WP6 A;  1YIT B;  3O8G A;  2DA4 A;  5LHG A;  4XOT A;  5HVQ C;  2IP2 A;  1FX7 A;  4DGW B;  3LFU A;  4I0B A;  2BVL A;  3PSI A;  5D6F A;  2ID6 A;  1FT9 A;  2OD5 A;  3HHH A;  1FNB A;  4LB6 B;  1T98 A;  3H94 A;  2WZP P;  5JLV C;  2Y48 A;  2PBI A;  5CVR A;  4AYB N;  2RRE A;  4C9Y A;  1R58 A;  1IN7 A;  4UVC A;  5J47 A;  3E6M A;  3EYY A;  1YHQ I;  5EZG A;  4CA0 A;  1ACI A;  3FX3 A;  3H3U A;  2LY9 A;  4G9Y A;  1YJW B;  1U5T A;  2MA3 A;  3ERM A;  4H4K C;  1KA8 A;  5H6R A;  3FZV A;  1OB5 A;  1KC8 D;  3AAF A;  2BEO A;  2EH3 A;  2JRM A;  4M6Y A;  5B3S H;  1R49 A;  3TO7 A;  5JFR A;  4D0P A;  3RKX A;  1G3Y A;  2HQN A;  3VSU A;  1XB4 A;  5E3N A;  4PK4 A;  4G94 A;  2F43 A;  4J01 A;  1TNT A;  1S7E A;  2DMN A;  1CNF A;  5JBQ A;  3I55 I;  2DT5 A;  1XQB A;  2ELK A;  2DW4 A;  2XT2 A;  2W6I A;  1B9M A;  2Q1Z B;  1AIP A;  1RET A;  3G6E B;  3REO A;  1WJB A;  1YLO A;  5L3B A;  2BY2 A;  3ZQI A;  1Z91 A;  1PYV A;  1YW7 A;  4E6K G;  4AU7 A;  1YIT I;  3H9J A;  1VQO I;  3OYL A;  4MQV A;  2OTL B;  2W85 A;  5E17 F;  4F7D A;  2IOU G;  3GLL A;  1FP1 D;  1S7A A;  2XF6 A;  4KMU X;  2OPT A;  3H0G J;  4YC5 A;  4UUS A;  1KU7 A;  2HR3 A;  3K4L A;  5K1Y A;  2DTZ A;  4M72 A;  1CQX A;  2BM6 A;  5JHF A;  2E71 A;  4LB5 A;  2ECC A;  1YS6 A;  1BN8 A;  4A3D J;  3JRA A;  4Z4W A;  2ESH A;  3DKX A;  3WTW C;  1P4M A;  3T53 B;  4PMH A;  4OP7 A;  2H1L A;  4P2N A;  1J0R A;  1S8N A;  3OYA A;  3ZMD A;  1VQ5 I;  2VBU A;  1UHS A;  2XSJ C;  4A3E J;  1HCR A;  2L7M P;  3PSF A;  2F1M A;  2CH0 A;  2QTL A;  3ISX A;  4DIQ A;  1ENH A;  4BXX J;  3WTV C;  4IHW A;  4DK1 A;  5F0C A;  3KCC A;  2KPM A;  3CPW B;  3R0J A;  2DOF A;  3FK7 A;  1FND A;  2DO7 A;  1UD6 A;  2BN4 A;  2NOG A;  4KN4 X;  2R7D A;  4LBV A;  1UCR A;  2V9P A;  3F6V A;  2XTW A;  2IXS A;  4FAS D;  2VBK A;  2V9V A;  4OIR F;  1WU8 A;  3PQJ A;  1VQ9 I;  2QEX I;  3VYT B;  2YU9 J;  3HG9 A;  2JA7 J;  2R7S A;  3CCV B;  1OCO H;  2YR2 A;  4ITV A;  4CYC B;  4JX6 A;  3OPO A;  4OJP A;  1Y8Q B;  1K9M D;  1QRB A;  2OV7 A;  1U5T C;  1VHO A;  2C78 A;  2HZT A;  5H2F C;  2R5Y A;  1IA5 A;  3HUG A;  1VF9 A;  2M8G X;  1DG1 G;  1ZGJ A;  1B6A A;  3V7S A;  2OAZ A;  5IOZ A;  2LG4 A;  1WVR A;  4A3K J;  3N05 A;  3PUF A;  3GFI A;  3KFW X;  1GXQ A;  1N8R D;  1XSD A;  3SHF A;  3HKZ N;  2HQA A;  3AG2 H;  4DZJ A;  4TN1 A;  1QPM A;  2QVO A;  3S2H J;  1SD6 A;  2VYQ A;  3SEQ A;  3CD6 B;  2VFM A;  3IV5 A;  2NPF A;  2E5Z A;  1TLH B;  3F8M A;  5KAI C;  3SZG A;  4BDY A;  3WTS C;  3NRV A;  4Y4R A;  4KH3 A; 
#chains in the Genus database with same CATH homology
 1Z3Y A;  2DJI A;  3OOC A;  4URR A;  2VJJ A;  3GQ7 A;  2R7O A;  4E4H A;  4Y3O A;  1FX0 A;  3S93 A;  1O8K A;  4ZC3 A;  2XZL A;  3KRG A;  4W8Q A;  4U49 A;  3AFH A;  3W3C A;  2PJR B;  3LMM A;  3FPP A;  3MKW B;  2AQE A;  2VBE A;  3D5L A;  3VR6 A;  1S9H A;  3CF2 A;  3OR2 C;  3U21 A;  1V0F A;  2KP6 A;  5CPR B;  4W8S A;  2VQH A;  3A1Y A;  4TT3 A;  2HLD A;  2UUZ A;  3IP4 B;  4BJT A;  1N78 A;  1WJD A;  3BCF A;  2OUM A;  4ZDP A;  3KEY A;  2IGM A;  2LOO A;  2Y0S A;  4MR0 A;  5C1E A;  3OE7 A;  2UVF A;  2KMU A;  3LSI A;  3OAA A;  2GJP A;  2L9N A;  1JI8 A;  1O8I A;  2HPI A;  2V1N A;  3FDY A;  2PYG A;  2WJY A;  4CCM A;  3K4C A;  2KQR A;  1SAU A;  1DBO A;  3M1C A;  2LY2 A;  2CUZ A;  3M8J A;  2X3H A;  2DOA A;  2MD0 A;  3A4C A;  4TSF A;  2XF7 A;  1KZL A;  1Z21 A;  2KL4 A;  1D1C A;  2O5R A;  2UV1 A;  3RCO A;  1H8E A;  2PEC A;  3L2R A;  2CS3 A;  2E5N A;  2IS6 A;  1O8D A;  3OYF A;  2KLO A;  1AA7 A;  3H5R A;  3OYJ A;  2NT9 A;  3ZXS A;  3G05 A;  4BL0 B;  3SUC A;  3H35 A;  4LIV A;  1VLY A;  2L2O A;  4B43 A;  3PL8 A;  2WPD A;  1MW7 A;  4XKB A;  3OYG A;  3KX2 A;  1G59 A;  3FHN A;  3OR1 C;  2E1M C;  1UD8 A;  4PJN A;  3UNG C;  3DTE A;  4E7Z A;  2LBF A;  3HXL A;  4YRV A;  2O0W A;  4YZ0 A;  1YX5 A;  3PNV A;  4CCJ A;  3K70 C;  4ANJ A;  2L7K A;  2NOJ B;  1NHC A;  3EUH C;  1UEL B;  2WA0 A;  2PMZ A;  2W00 A;  5HKK A;  1EFR A;  1DQU A;  3OS0 A;  4F91 B;  2XOK A;  1PJR A;  4BQQ A;  1X19 A;  1BPL A;  1BHE A;  3OL3 A;  5HLT A;  3F9K A;  5DN6 A;  2MYS A;  3DU6 A;  2R7V A;  4B47 A;  3HOS A;  2F4I A;  3NWS A;  4HG2 A;  1O8L A;  2X51 A;  4ZTF A;  1UD4 A;  1WJF A;  2KRC A;  3CP2 A;  2NST A;  2BW3 B;  3HOT A;  2O0V A;  5CQG A;  3K4M A;  2QXZ A;  2XAU A;  1KTW A;  1U0J A;  5CDF A;  4XLH A;  4NQW B;  3H9G A;  3L2U A;  3A35 A;  1W36 D;  4MLO A;  3GQ8 A;  4PJM A;  2NTB A;  3H0D A;  2R7W A;  2NZM A;  4Z06 A;  4BE2 A;  1Z3X A;  3OYM A;  3ZQQ A;  1X0C A;  1T95 A;  4Y33 A;  4CCK A;  2KHM A;  3EUA A;  4YXW A;  1QHH D;  3CJR B;  1KON A;  3D5S C;  3BCA A;  3OIP A;  4CCO A;  2O1D A;  3ONQ A;  2WAF A;  2X1C A;  2V4J C;  3OS2 A;  4U87 A;  2V26 A;  1HVX A;  4RMN A;  3HAG A;  4XLE A;  4XKV A;  2PYH A;  4BJ6 C;  1DGW Y;  2XND A;  4B3F X;  2MAB A;  4ZJZ A;  2NSP A;  4BE1 A;  1D0Y A;  2HU9 A;  3GQA A;  2R7T A;  4NK8 A;  3BH4 A;  3A3G A;  1UD3 A;  1Y6I A;  2LRD A;  2GJR A;  3DTI A;  2ZFU A;  1SFK A;  3PFY A;  4ZTJ A;  4XQF A;  4BUP A;  1WJE A;  2VB6 A;  2R7Q A;  1Y56 A;  2P0W A;  3DU5 A;  3NWT A;  1RU4 A;  2MC4 A;  1UG0 A;  4ZYA A;  3GQ9 A;  3K4B A;  4HEA 2;  4OZY A;  1ZEL A;  4JOM A;  4IX7 A;  2DXI A;  4JMQ A;  4HPQ A;  2DCE A;  1D1A A;  2E1M B;  3MKY B;  3BG7 A;  4PSX A;  5CKT A;  3DWL E;  3DLA A;  5FRN A;  2X1E A;  2ZXI A;  1W36 C;  2CV0 A;  3PNT A;  3WWG A;  3TBI A;  2CW8 A;  2A5W A;  4BAC A;  4CZC A;  2V7Q A;  2WAD A;  4LIT A;  3K70 D;  2WY8 Q;  1N77 A;  2JJ2 A;  2M7B A;  2JUG A;  3GBG A;  1OGM X;  2W1O A;  2EWE A;  2KDO A;  1Z7L A;  3AL0 C;  4AVZ A;  4HNT A;  2Z16 A;  2JIZ A;  4G6T B;  1ERD A;  2VJ5 A;  4B44 A;  2CUJ A;  2JSP A;  2Z8G A;  3SYT A;  1BLI A;  2QKL B;  1X1D A;  3GQB A;  4XN3 A;  3G2B A;  4E7K A;  1QU3 A;  4DNT B;  3VMW A;  1H80 A;  4YEJ A;  1RMG A;  2VQG A;  2CV1 A;  1WTH D;  5AMV A;  4XLC A;  2V9K A;  1E1Q A;  3CP8 A;  2HVS A;  1J09 A;  4CUG A;  3OYK A;  1K6Y A;  4PFP A;  2R4G A;  4QPQ A;  2HPM A;  1E0E A;  3ZCO A;  2CV2 A;  3MD2 A;  1WPC A;  1D0X A;  3ZIA A;  1WFX A;  3J7A Y;  3OFN A;  2INV A;  2WAQ A;  4G7W A;  1W9X A;  3PNY A;  3HPG A;  4OWR B;  4XR6 A;  1K28 D;  4E7H A;  2F5V A;  3WQZ A;  2M4K A;  2M4G A;  1QCX A;  5HOO A;  2UVE A;  1X4P A;  4FET A;  3AL0 B;  2GK6 A;  1NBM A;  4U7B A;  2VKH A;  2D3L A;  3OOU A;  3H5N A;  4XM3 A;  4BEH B;  3LL7 A;  1OB0 A;  1WMR A;  2X53 S;  4HIZ A;  2ELJ A;  4DNR B;  3S3O A;  2CW7 A;  4OZZ A;  4KIS A;  4BQO A;  1OHH A;  3VDX A;  4HST A;  3OMY A;  3AKZ A;  5LD2 C;  4KKS A;  5IK2 A;  1KMH A;  1BR2 A;  2VBM A;  1V5E A;  1D0Z A;  1PKV A;  1JTA A;  3SDB A;  1O8J A;  2LC2 A;  2A6T A;  2JDI A;  4I84 A;  2RNG A;  2IQ7 A;  4PFO A;  1X1B A;  3OIQ A;  4XN0 A;  3GVJ A;  3OS1 A;  3OYH A;  3QYE A;  1MMG A;  2WSS A;  2VLA A;  2XGJ A;  2CFO A;  3DPL C;  4C30 A;  3JUR A;  2WAE A;  5C1C A;  1PE9 A;  4IQ4 A;  4B48 A;  2E60 A;  1I8D A;  1OFL A;  4PSW A;  3OL4 A;  2DT6 A;  2QKM B;  3I3L A;  3S8P A;  1G8X A;  1X1C A;  4LG3 A;  1RWR A;  4R79 A;  1O88 A;  3HUG B;  4Z05 A;  1BR1 A;  2JA2 A;  2ZZG A;  4G6I A;  3A3B A;  1X1A A;  2HVR A;  2PJR A;  2ZZF A;  2W6J A;  1IDK A;  1O8G A;  3GRH A;  1GLN A;  3FY3 A;  4XLA A;  4HRI A;  2R7U A;  4J00 A;  2GK7 A;  1T0F C;  3OW7 A;  2BVM A;  1E1R A;  3DDY A;  4Z03 A;  3H5A A;  2E1B A;  3IAM 2;  4ZDL A;  3OEH A;  4F92 B;  2IGK A;  4XON A;  3L2V A;  1DBG A;  2X85 A;  2K3P A;  2Z1D A;  4RM2 A;  1VZ0 A;  2W7N A;  2R9V A;  3VYU B;  4C2U A;  2VXD A;  3QYB A;  2HNH A;  2ZSH B;  1W0K A;  3NE5 B;  4F3Q A;  3OY9 A;  1TZL A;  4FXU A;  4X0G A;  3IUO A;  3K4J A;  3S32 A;  3K6G A;  1E79 A;  4G7X A;  2NT6 A;  2FUG 2;  2K9M A;  2ZTN A;  1LKX A;  1MMA A;  1NG7 A;  2CMP A;  2O04 A;  5HNH A;  5CQE A;  4LIU A;  4YZX A;  2BOL A;  2LRE A;  4II2 A;  4D9J A;  2ZZQ A;  3B4N A;  2AQF A;  3HKZ A;  4XOP A;  2O17 A;  2L9S A;  3BG6 A;  3ZSC A;  2HVQ A;  4W8T A;  4XLF A;  2F6C A;  2W4S A;  2JJ1 A;  1VBL A;  2VJ4 A;  4DK0 A;  4II3 A;  3T9G A;  1KCC A;  2VQC A;  4F55 A;  4P1W A;  4ASU A;  1OR7 C;  2GOX B;  4N4N B;  4HWV A;  4RLF A;  3ZPN A;  2NTP A;  4OJO A;  1EE6 A;  2JVG A;  3I9V 2;  5FRO A;  3GVL A;  1WJ5 A;  4XKC A;  2LBF B;  1UD5 A;  3BCD A;  1MAB A;  2X6Y A;  4OJL A;  4XNF A;  3LNN A;  3RPU D;  4E0F A;  1NG6 A;  2XF5 A;  4BDY A;  3W2W A;  2D3N A;  2GOM A;  2Q2E B;  2X6X A;  3L2Q A;  5LFA A;  1YE9 A;  2DT7 B;  2Z2S B;  4N4O B;  4PJJ A;  4BS9 A;  1UAA A;  4NUB A;  3W2A A;  1OFM A;  3FKJ A;  4GRI A;  2QY1 A;  2M5S A;  4RLQ A;  3PJR A;  1OOC A;  1PXZ A;  3RQ4 A;  3EUK L;  2JVH A;  2VJI A;  1O8H A;  4C2T A;  1V5G A;  3DPT A;  3VYR B;  2BW3 A;  3VWB A;  3K4K A;  3BLY A;  5TGT A;  2UWM A;  3H9Q A;  1FMV A;  2ZSI B;  1XG2 A;  2M0M A;  2IS4 A;  5FL7 A;  3V42 A;  2XZP A;  5KCM A;  2M7A A;  3QYF A;  1CZF A;  1MNE A;  5KNL A;  4IKF A;  1H8H A;  3TL4 X;  2L5Q A;  4NNJ A;  2NTQ A;  3OYE A;  2OC6 A;  1LFP A;  2Z6B D;  1BOB A;  4P22 A;  3DTK A;  2M3A A;  3D5R C;  3VSL A;  4EAT A;  2V4D A;  1T5E A;  1GQ8 A;  3LSG A;  2BSP A;  1K5C A;  3VSV A;  2R7X A;  4CSW A;  1LVK A;  3K10 A;  4RM3 A;  2VL8 A;  4HNU A;  4NK6 A;  4XMY A;  1COW A;  4B3G A;  4BU2 A;  1TT0 A;  4PJL A;  4BE0 A;  2VPL A;  2IS1 A;  3TMO A;  4IZZ A;  1HA8 A;  3IAS 2;  1R6R A;  4L8J A;  5KHD A;  4OAZ A;  2LYC A;  1JRG A;  2VIX A;  4XL9 A;  1V5F A;  2X1D A;  2CK3 A;  3BC8 A;  3FBN B;  4HSR A;  4KKU A;  3UW0 A;  4EW9 A;  1KCD A;  4P5O A;  3SEZ A;  3LSK A;  4OJ5 A;  3PUB A;  2VAS A;  2V31 A;  2QX3 A;  1QJV A;  3B8Y A;  2I8D A;  4KT6 A;  4Z1M A;  1VF7 A;  2LZJ A;  3FKS A;  1IRX A;  4F93 B;  2ZTG A;  4KKT A;  3ZRG A;  4GQN A;  2WJV A;  1DGR M;  3UR3 C;  1IB4 A;  2XC7 A;  3E0J B;  4BDZ A;  1WJC A;  2W82 A;  4CCN A;  3EPZ A;  4CH7 A;  1D1B A;  2RQQ A;  3VMV A;  4B3X A;  4BXF A;  1VJS A;  3CMM A;  1O8F A;  2X6W A;  1MND A;  4IQJ A;  3LSM A;  3MMY B;  4AYB A;  4E7J A;  4E7L A;  1WP6 A;  1AIR A;  1P9Q C;  4XOT A;  5HVQ C;  3OYN A;  3FBI B;  4DGW B;  3LFU A;  4PUS A;  2BVL A;  3VSK A;  3K4N A;  3PSI A;  3KYL A;  4XKW A;  1X4O A;  3H94 A;  3DQV C;  2WZP P;  2LY1 A;  5HNF A;  5FRM A;  2KVO A;  4C9Y A;  2RRE A;  3VYS B;  3BC9 A;  4E7I A;  2ZZE A;  3EQN A;  1IDJ A;  1LDK B;  4CA0 A;  2KRH A;  2MFZ A;  2V6E A;  3A2K A;  3RSN A;  4OJ6 A;  4H4K C;  4F52 A;  1OGO X;  2WY7 Q;  4MXN A;  1YX3 A;  2R7R A;  4OAY A;  4BJ5 C;  3VSU A;  3QOE A;  4PK4 A;  2F43 A;  4C2L A;  4CCL A;  4J01 A;  3C2G A;  3S3M A;  1E3X A;  2IGN A;  1OLT A;  2W6I A;  2Q1Z B;  3T56 B;  3QOD A;  4DBQ A;  4E7S A;  3LMW A;  2WB1 A;  1WJB A;  3BCB A;  1QHG A;  3CES A;  3OYD A;  1UD2 A;  1PYV A;  4E6K G;  4AU7 A;  4JQF A;  3W2V A;  2K5C A;  3H9J A;  1W0J A;  3OYC A;  1DP3 A;  4DOZ A;  3OYL A;  4BGD A;  4UZU A;  4NC8 A;  4XD7 A;  2QE7 A;  4YZQ A;  2XF6 A;  3CJQ B;  3C2H A;  3OYI A;  3K4L A;  4U4B A;  5JHF A;  1O8E A;  4D1Q A;  1I18 A;  1BN8 A;  4DBR A;  3DKX A;  4PMH A;  3OWT A;  3T53 B;  2X8K A;  3OYA A;  3OEE A;  1N75 A;  3CZ6 A;  2XZO A;  2XSJ C;  4KIT B;  1FMW A;  1SKY B;  4XOR A;  3PSF A;  1MMD A;  2CH0 A;  2F1M A;  1MMN A;  2ODL A;  4DIQ A;  3EQO A;  4DK1 A;  1HG8 A;  3LSH A;  2VQL A;  2KPM A;  3T51 B;  1E43 A;  1O8M A;  4YZA A;  1UD6 A;  2ZXH A;  4W8R A;  2K9L A;  4QPO A;  2HZD A;  3DEE A;  3KEW A;  3VST A;  2IXS A;  2VKD A;  4FAS D;  2KZV A;  2V7F A;  3DPU A;  2WBM A;  2VBK A;  3RTR A;  3ZR8 X;  1BMF A;  3JU4 A;  3HPH A;  3VYT B;  1PLU A;  3HG9 A;  2R7S A;  4BEH A;  4ITV A;  3OPO A;  4OJP A;  3ZPP A;  4BQN A;  1WJA A;  2XDV A;  2OV7 A;  3HL2 A;  1V0E A;  4KJZ A;  1IA5 A;  3DKY A;  2IS2 A;  3MKZ A;  3E1S A;  2INU A;  2LG4 A;  3HC7 A;  3N05 A;  3B90 A;  3L2W A;  2DIE A;  2HQA A;  3GVK A;  4NC7 A;  1HZE A;  3S3N A;  1BR4 A;  4TKO B;  3SEQ A;  4YEL A;  2LH9 A;  2IGO A;  3OYB A;  2E5Z A;  1E3Z A;  3SZG A;  1EA3 A;  1NRK A;  2GJK A;  2HDW A;  4DJA A;  4ZDO A;  2VXZ A;  4Y4R A;  3ZGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...