4XM3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xm3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xm3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xm3A02
4XNFA 4AVZA 4OJLA 1OGMX 1KTWA 2X85A 2NTQA 2EWEA 4XLAA 4XLEA 1OFLA 2O0VA 1O8KA 3T9GA 3SUCA 1JRGA 1O8IA 2X6WA 5AMVA 3GQ8A 3VSTA 4MR0A 1QCXA 1PXZA 5C1EA 4HWVA 1OOCA 1DBOA 5C1CA 2X6YA 4XLFA 1OFMA 4W8RA 1XG2A 4YZXA 1KCCA 2O0WA 2X6XA 4XQFA 1DBGA 4U4BA 4XONA 4XKVA 3LMWA 1H80A 4OJ5A 1IB4A 1EE6A 1BN8A 3VMWA 1KCDA 4NK6A 1NHCA 1RMGA 2INUA 2NSPA 2O17A 4YZ0A 4Z03A 2INVA 4I84A 2QY1A 3VSUA 4EW9A 1WMRA 2O04A 1QJVA 4XN0A 2BSPA 2VBMA 4YZAA 4U49A 1O88A 4OZYA 4XORA 1O8JA 2Z8GA 1JTAA 4XOTA 1O8LA 1O8DA 2UVFA 3B90A 4YELA 2VBKA 4XM3A 4OJPA 2O1DA 3EQNA 3WWGA 4YZQA 1PLUA 4NK8A 4OJ6A 1O8MA 1VBLA 4XR6A 3ZSCA 3GQAA 2VJJA 3B4NA 1IA5A 3JURA 2NTBA 1K5CA 1IDKA 2NZMA 1BHEA 2NT9A 2QXZA 4C2LA 2NT6A 2PYHA 4W8QA 3ZPPA 4URRA 3GRHA 4PMHA 1O8FA 3FY3A 1CZFA 4XLCA 1PE9A 1O8EA 2QX3A 4XMYA 2VBEA 4W8SA 2NTPA 2VJIA 4XN3A 1RWRA 2ODLA 1O8GA 1O8HA 2NSTA 4XKWA 2X3HA 4MXNA 4XL9A 4Z05A 3GQ7A 1IDJA 3EQOA 1AIRA 2PECA 3B8YA 1GQ8A 4OZZA 3VSVA 4XOPA 4W8TA 3GQ9A 2UVEA 3VMVA 1RU4A 4Z06A 4XLHA 1HG8A 2PYGA 4YEJA 1X0CA 4OJOA 3KRGA 2IQ7A 3UW0A 1OGOX
chains in the Genus database with same CATH superfamily
4CUGA 1G2HA 4IPAA 4IHWA 3QU3A 1KTWA 3GIRA 1A35A 3N05A 2RN7A 4XLAA 3IRRA 3S8PA 3H3VK 2DDAA 2XVCA 4NQWA 4BQOA 3OYJA 1YJWI 3ZPLA 3ASRA 4KDPA 1VQMI 1KU7A 2GJKA 5C4JJ 3SQNA 5HNFA 1O8IA 2KIUA 4I0AA 1TC3C 3Q3AA 3I55I 1UD8A 1WDTA 4UHTA 1ZM9A 2V79A 2WWYA 3RPQA 5KHDA 2H27A 4J0QA 5F1JA 1GUUA 2EA2A 3QP6A 1YTYA 2HVQA 4E4HA 2MLGA 1GT0C 2K3PA 1QGZA 3PUFA 4ESBA 2DA6A 2NNYA 3GTLJ 3DTIA 3CB4A 5FKKA 3G71I 2KJBA 3P9CA 3GLLA 3HRMA 1YJNI 1BM9A 1D1BA 1WI3A 1PUFB 1N0VC 1W9XA 4XRMA 3JTGA 3CCSB 4OJ5A 1MNDA 1MIJA 4HF0A 1MKMA 1I39A 4IL6C 1YJ9I 2AS5F 5DTDA 2OAZA 3MAJA 2WR8A 4IXAA 1FMVA 5KAIC 4WXCA 4FE7A 4XN0A 2G7UA 3A0HC 2WJVA 3PETA 5JVGF 5D6FA 1WJCA 1JT0A 3CD6I 4CH7A 2DQRA 3W5VA 1O8LA 1VQ4I 1BPLA 2E1OA 2O61A 2UVFA 2V1NA 4EJVA 2PJRA 1KQSB 1LFBA 3M7GA 4PAAA 3GSIA 5E18F 2HR3A 2GK7A 3WODF 3O8HA 1WGXA 1T6ZA 4WXDA 2I5UA 2LC2A 4R8HA 3C18A 1LPQA 4LG0B 4XR6A 1J5YA 2ZL5A 2H6CA 4RDUA 3H9JA 4E7ZA 2XZPA 5IP9J 1SVOA 1D3YA 2GIZA 4UY8I 3JQPA 1WJFA 4M53A 2VNHA 5DSZA 5IYBJ 5EEHA 1S9HA 2NRAC 1VF7A 1BHEA 3BH6B 4ON0A 3UKGA 4BJ5C 4PJ0C 3JRGA 2ZZEA 5ICGA 3ZBUA 4KT5C 1H8HA 1EP2B 4PMHA 1QA1A 1IN8A 5E3LA 5LEKA 1K61A 5D5UB 1VQMB 2VC0A 1D0ZA 3QFTA 1YRNA 2BOLA 2R7UA 1P4MA 4O5VA 1O57A 3LNQA 2DY1A 2OQRA 1SFEA 3CCUI 3WNDA 5ILSA 3CC4B 1WOPA 4D9JA 3FHZA 3W6VA 3MKWB 2LF8A 1EFUA 4B4DA 3CPWB 1QX4A 3IH2A 4B3GA 2YS9A 3OIOA 3KETA 1EA0A 4H4KC 3Q39A 5EEGA 3A03A 3BG6A 2FNPA 5LRRA 1AOYA 4BHBA 3IH3A 1TZLA 1SFXA 4QHYA 2ZFUA 4W97A 1K4SA 2UVEA 3LAJA 3K10A 1I27A 2EZHA 2WC2A 4X6AJ 3CCSI 3Q0VA 3PL8A 4HDUA 2JJ1A 3BY2A 4BEHA 2EJRA 1L0OC 1KYZA 4ZTFA 1MMGA 5AONA 3RQ4A 1VQKI 2HQRA 4CHUA 2HZTA 3HL2A 1K8AD 3OS2A 4AF7A 5K7HA 5BOXA 3FXJA 4AVZA 1HF0A 1FBUA 4P3YA 4FE4A 3E5QA 4YAUA 3TGNA 2GOMA 3BR1A 5IOYA 2OBTA 2HDNB 4CA0A 1WI9A 2E1RA 2XAUA 4E70A 3OP1A 4OOIA 1JRGA 4YG2F 5FO5A 4RD4A 1E64A 3SZEA 1EXMA 2ZL6A 2VYQA 4LBVA 1ETVA 2LK2A 2MD0A 2XGEA 3D5RC 3JRAA 3ABUA 3EUKL 1DARA 3PJRA 1R4NB 3K4CA 2YX4A 3H3UA 4WZLA 4IKFA 5FO1A 4ZCIA 4MFEA 5M5YJ 3BC8A 3ES9A 5CVJA 4BUPA 3QYEA 1K6OA 1JUMA 3ZQLA 1LEBA 2NS8A 4AC0A 3MWMA 3ABTA 3I0TA 1RR8C 2JPCA 2BN4A 2NS7A 1O3TA 4F7DA 4Z4UA 5DD4A 1ZM4A 1YI2I 3RY8A 1RETA 5CJ9A 4BU2A 3CW2A 1NHCA 3I53A 1ZR4A 1LDKB 2OZ6A 4WZEA 1Y6IA 4IHYA 1BI2A 1XSVA 1E62A 5ED4A 2VBUA 3U21A 1R1TA 5J47A 1VQOB 2Y31A 3W2HA 1QG0A 4RGUA 3W2WA 2QBYA 1VJSA 2OD5A 2VFPA 1UAAA 1IXSB 3BY1A 3KYCB 1ACIA 2JT1A 1QVGB 2Q2EA 1YX3A 3WHBA 1POGA 4YCQA 3DLLF 4XLNF 3ASOH 3WU1B 4E0FA 1G3WA 2NVQJ 1UHWA 4LITA 1KYWA 1HW1A 4U7BA 3LMMA 2DODA 2OQGA 5LLQA 1DQUA 3AAFA 2HDWA 4PJJA 4M3BA 3OL4A 2E34A 4BACA 1ERDA 3FXMA 1VQKB 3I59A 3T53B 2K9MA 4X1EA 3OOUA 1RI7A 1IJWC 1BJZA 3DXJF 4JOMA 2XASA 4AD9A 2OYNA 4FN5A 2MC4A 4ACBA 4O3MA 2NOJB 2LRDA 1N06A 3JU4A 3SZPA 3OYLA 3F3XA 1HQCA 1OGIA 4W8SA 2EB7A 3CUQB 3ZRGA 2VBSA 2X0KA 1ZK8A 4FISA 2Y9YA 1HOMA 2AHOA 3ZMZA 3T0YA 3H35A 2JZYA 2ESHA 3CDIA 2X3HA 4LJZF 1KGSA 4IQJA 4CCMA 1OCRH 1IDJA 4D5FA 2VNJA 3PFYA 2IAIA 1ON1A 4F7ZA 4KH3A 2W85A 4BYYA 1R23A 2PE3A 1W1WE 2ZXJA 3ZPNA 1R1VA 3G6EB 3QPTA 3A02A 2DI3A 3CMEI 2O5RA 1VQ5B 2M7BA 2NYXA 2Z6BD 4QV2A 4M72A 1JE8A 2NS0A 3HPHA 3O6BB 2W6IA 3CF2A 3QYFA 5CVVA 3IAM2 2UXXA 3I55B 2CO5A 4YIFA 3BCBA 3WU0A 4KKTA 1P2FA 1IDZA 3U6KA 2X4HA 2XTXA 1I6XA 1USTA 5M3MJ 3UW0A 5LGTA 2V1DA 2V9VA 3GFIA 1D5VA 1NDHA 1VTNC 3V7RA 1SAUA 3FBNB 3I1FA 1FLIA 3HTUA 1CF7A 3F0CA 5BPDA 1O3RA 1GV2A 3WTUC 2DK5A 2A3SA 2DAOA 3K4BA 1G7CA 1XQBA 1YHQB 1TWHJ 1P7IA 2HEOA 3CCJI 4UUSA 5CQEA 3D26A 1FC3A 2OTLB 2M2EA 5GPCA 3VO2A 1U8RA 5GAEJ 3OIPA 2GBYA 2XDVA 4YFKF 4GYGA 5CVIA 3ZOBA 1LVAA 4D5CA 4KYWA 1KTVA 1SD5A 1VQ8B 1OCOH 1BW5A 4EJWA 4MEXF 2FRHA 2QCOA 4YZXA 1VHOA 2DJIA 1RQRA 3WE2A 4DOZA 4MTDA 2L4AA 2VXZA 1DBGA 3HJEA 3H5AA 1E3OC 1GDTA 4GFBA 2QGGA 2XNCA 1P4XA 1WOSA 3MKYB 3LJYA 1BN8A 2HOAA 2Q1ZB 3DU5A 3PSZA 5HS7A 1BW6A 4D7MA 1WJ5A 4MEYF 5CDFA 4QLCU 4IOAF 3K4MA 2INUA 1AU7A 5FKOA 3GXOA 2VQCA 3V8JA 1ZM2A 3OYMA 4I84A 4I01A 1RQPA 3ESWB 3DTKA 3N4MA 2O04A 4PJNA 1JJ2B 1UB9A 4JYKA 3RIRA 1FP2A 4F91B 2NPFA 1UCRA 3ZMVA 1QA3A 2HPIA 2KRFA 1TBXA 3BP8A 1KD1D 1T0FC 2LOOA 3SJMA 3G6EI 2V7VA 5EYRA 1T8IA 1N77A 2F48A 4KITB 2VNKA 1FTZA 2IPQX 3GVAA 2QUFA 4C3HJ 1F4KA 2Q2EB 2W4SA 4CCKA 2CV1A 1FX0A 3J7YJ 3FXLA 4YZQA 1ETQA 2E2JJ 1R22A 2FUG2 2KISA 2M4KA 3ZSCA 3AVWA 1R5NA 4DQLA 2RVCA 4A2UA 3WTYC 3TL4X 1T6XA 5IT9K 3L2WA 1DU6A 3HSFA 1W34A 2QMUA 1YLFA 1S72B 1JB9A 2X53S 3R0JA 3A35A 1YIJB 4L9NA 1IDKA 5D5WB 3IKVA 1X1CA 1MMNA 2A6EF 4M3GA 3GTJJ 4LOCA 1WP6A 1ON2A 3SDBA 1JKRC 1BI1A 4RM0A 1LQ1A 5AIQA 3HBLA 3MKZA 1Z9CA 1RKWA 1Z3XA 5DCFA 4HDVA 4XLCA 5FFXA 3ONUA 1O8FA 3ERMA 3LA3A 4XMYA 2XAJA 5F27A 3S1QJ 3CCJB 2BV3A 5F4JA 5KAFC 3TO7A 3A0BC 4L0YB 3GVKA 4OPSA 5KSWB 3CCQB 5A2QZ 4KKUA 2IJLA 3I54A 4ABZA 4CCNA 2QKMB 3SHFA 3JAMZ 2XROA 4XRSA 1IG7A 5GP9A 5HLGA 4J01A 1R5HA 3KZZA 4DIQA 3GFLA 3PVDA 5KCMA 4RD0A 2WAQN 1ZG1A 5FNZA 3Q6QA 4IO9F 1J7KA 4RGRA 2DOFA 1REPC 2Y75A 2HCJB 1LKXA 2XAHA 1B59A 2VKVA 2ADUA 2YPRA 1DUXC 1IV6A 1EF4A 4OPWA 5JR3A 1BR1A 2M8EA 3H3ZA 3SQVA 4RD1A 3OAAA 1J2XA 1XDSA 3PA1A 4JMQA 2QZAA 4L9VA 3ZR8X 3GQBA 3RDIA 3HOWJ 4LGWA 2K4BA 5M3FJ 2DA7A 3FXQA 1OKRA 3TMOA 2O0VA 2KFDA 1O8KA 1GVDA 2ZBKA 3M8EA 3MVPA 3PNTA 2W7NA 5JFRA 4Z4TA 2DYRH 4ITVA 1X1DA 2V7UA 2J5OA 2DDBA 4RDLA 1S5LC 2W1OA 2LSOA 4A3DJ 3L2CA 4MR0A 3T56B 3U2QA 1TLHB 3W3CA 1R49A 1PYVA 2CH0A 2BYVE 2OU2A 2ZXHA 1JGSA 4L0ZB 2V7TA 2K86A 4R71A 1PXZA 4G7OF 1UHMA 5E1ZB 2HVRA 4ROXA 2X6YA 2XTWA 3OIQA 2Y30A 1F1ZA 1LE8A 3OYBA 2OF7A 4KT6A 5ICFA 1BL0A 1KCCA 1RNLA 1UG2A 2FQ4A 2VXDA 2XC7A 4BQAA 2HPMA 3ZBTA 2XT4A 4HF1A 2EIJH 1R7JA 3EDPA 1W7PA 5L3FA 3GVJA 4P6YA 3Q9SA 4ZV4A 4RCYA 1VQLB 3E6MA 3AG2H 4Q47A 2IRFG 1TWFJ 1PJ6A 3OYNA 1E0EA 2CJJA 1FYLA 5THXA 2F5VA 2X1EA 4BY7J 1IN4A 3BR6A 2GLOA 4OOVA 1S4MA 1A36A 2YWHA 4IOCF 1ZLKA 4GDFA 4UNOA 4S0HB 2L2OA 2QDXA 1WKMA 3CCMB 2CFOA 1FBSA 2EZKA 3B90A 2XOKA 4BAYA 1XMKA 3MZYA 3VYUB 3AVTA 3IWZA 1OR7C 3M9AA 3RJPA 5HXBA 1MBKA 2P3MA 1PLUA 4DNCA 4AYBA 3WYAA 4OJ6A 3AGPA 4TMTA 3C2BA 5IP6A 5DS0A 3BTLA 2OUMA 1TW3A 4MQ9F 3J81K 1XN7A 1QFJA 5LFAA 2GXGA 3BR5A 2MA3A 4J00A 2F3LA 4WQMA 2LVSA 5B1BH 1HZEA 3DKXA 2K27A 4MO7A 1P7JA 3JTHA 2HDCA 5K1YA 4RLQA 2IGNA 1MMSA 3CMEB 3FWEA 2QTLA 1CZFA 3FY3A 3R0AA 2QX3A 1ETXA 1MD0A 1FSEA 2JN6A 3DU6A 2LKPA 3RYRA 1W5CC 1T39A 1P92A 4EVIA 1ZELA 4RAFA 1Y1WJ 2NSTA 1SFUA 3F6VA 3OYHA 2FOWA 5J1RA 4XICA 4MNUA 2QE7A 2XPVA 3BH4A 1OISA 3EQOA 3Q6RA 2J8IA 1AIRA 5HS9A 4MGRA 4U0VA 3JQRA 2FEZA 4NQWB 2NV4A 3BH7B 4L8JA 1WXRA 5JBQA 2BE5F 5DNSA 1SMTA 4W8TA 4QIWN 2DCUA 3E1YE 1ZRCA 1FSHA 5EJCA 3JR9A 2XGJA 5F0HA 1DPUA 1V0EA 3ONQA 3KRGA 2AXLA 3GUDA 2EFQA 1PJ7A 2HQ5A 3KLOA 5HVQC 2DOAA 4EQQA 1K78B 3O3KA 1OHHA 3L00A 2XAFA 3M3YJ 2IW5A 2VT2A 2X85A 2EWEA 1SD6A 3BY6A 3MMPA 1UG0A 2LG4A 4NC6A 4F55A 2DMQA 1YE9A 1TTYA 3HAGA 2VUMJ 4NB5A 2V1UA 3D0SA 4RM3A 2HQNA 2EH3A 2V7XA 1QHGA 5CKTA 4UZFA 2LKXA 2QA4B 3N90A 4RGXA 3LVBA 2ZB9A 1Q1HA 3FF5A 4U87A 1JA1A 3WBJA 2XF7A 1DP7P 1FX7A 2M30A 1YQAA 1EZGA 2WTEA 1LE8B 2B7CA 5LGNA 1MZBA 2CYYA 3CTAA 3KYDB 2QENA 2D3NA 4P96A 3BQZA 3PNYA 2PLYA 2DMUA 1MBFA 2AQFA 1QRBA 3QOPA 3ZQHA 4FTHA 4X7CA 4NK6A 1XCVA 1JXSA 2EILH 3HKZN 4P9UA 1YW9A 1T95A 3L2RA 2X6OA 2A5YB 2O17A 2N8GA 1HLVA 2NVUB 2QVOA 1ZH5A 3GFJA 4L9TA 2R7DA 2LFBA 4IJAA 2QTZA 2WBMA 3I3LA 1EKEA 1RUNA 1R5GA 3QQAA 1SANA 2MABA 2FBHA 2MGQA 2YWEA 1F5TA 3GZ6A 4XM3A 3KFWX 1J75A 3E5UA 4UUVA 5HNHA 1N25A 3L2QA 5J35A 2LP0A 4NK8A 1PKVA 3GWZA 2E7XA 1O8MA 1MH3A 2YWFA 2R9VA 3IV5A 2BZTA 1X1BA 4P26A 3QPSA 5C4XJ 1Q7YD 1APLC 2AHQA 2X48A 3MZHA 3GTKJ 1T6SA 2ZTGA 1OFDA 4BKXA 3H09A 2XKPA 2VKDA 2HOEA 3ZPPA 5ILVA 2QLZA 3SDGA 4YEIA 1GJRA 1U5TB 4Z4SA 4XBFA 2EFOA 4BDZA 2DTRA 3ISPA 4OP7A 1FNCA 4JRAC 3EUAA 3F8MA 3FXRA 3TQNA 2XGXA 2XAGA 1W35A 2QEXB 1KQ9A 2KIFA 1OCCH 2KT0A 2R7SA 1N8RD 2WSSA 5BMZA 3A4CA 3CJRB 5E8IA 4E7SA 1RUOA 2O8KA 4IHTA 2CQQA 2E2HJ 3OYFA 4ESJA 3WQZA 1R1UA 3KP4A 4PGHA 1IJFA 3ASPA 3J81k 4HA8A 2P5LC 4RDKA 3DPLC 5BSYA 3ZQ7A 1GQ8A 3C7JA 3LO8A 5HKKA 3GQ9A 1TT5B 3ECHA 4EJUA 4OOXA 4G6IA 2C4TA 4OM9A 1E3XA 4TMVA 3H94A 3G1OA 2ZKZA 1OYIA 2JVHA 1HKSA 4EM1A 3HM5A 4BNCA 1D1NA 2PYGA 1G7SA 3K4NA 3ZXSA 3G73A 3B82A 2DK8A 3OKXA 2KDZA 1HBXG 2F4NA 3X2QH 2ELJA 3EETA 5D6EA 5LHHA 3DPTA 1G3TA 1SM4A 1GXQA 3SXYA 2DEUA 1OGMX 2YSRA 4A6EA 1R6RA 3FM3A 4I98B 4CYDA 2XUBA 4C0SA 3LL7A 4HSTA 4RM2A 4E7HA 3C2HA 2BGJA 3CCRB 3V8KA 2GK6A 4NHJA 3SEQA 3L9FA 2BV6A 3VMFA 2L9RA 3E5XA 1KZLA 1G6NA 2COMA 1SVLA 2DT5A 2GA2A 2A05A 1N78A 1AKHB 3BLYA 3QSYA 3GZ5A 4IHXA 2FA5A 3WGHA 1OFMA 1WCMJ 1WU8A 1NH3A 3WY9A 3RZOJ 3GW2A 4FQGA 4N4OB 4ANJA 2V9KA 2ZITA 5HS8A 2DFEA 1I6HJ 2L5QA 3VB2A 3BWGA 2Z99A 5LGUA 3LSTA 3AGQA 1YFHA 1I7PA 2L9NA 3UR3C 3ZN1A 3LQQA 2L4MA 4BE1A 2C5HA 4LBWA 3M1EA 2ZC2A 4BGDA 2PMZN 1I18A 4WX9A 4YRVA 3ISXA 1X2NA 1IO2A 3HHHA 1VQOI 1QJVA 2KPMA 3H9GA 5ICEA 2PMHA 2XB0X 4N3GA 3WG9A 2BSPA 1FMWA 3A1YA 4E6KG 1OR7A 3AKZA 3T51B 1SD4A 2WAEA 4ZDLA 1IAWA 3HOZJ 3S93A 3BCFA 4A3JJ 3A01A 4OJPA 1WH7A 3M4OJ 4QSHA 1NTCA 4U0WA 3TBIA 2VL8A 3FK7A 5FD6A 1AA7A 4FK8A 1QUEA 4AC9A 1QZEA 2LKSA 2CQNA 2E19A 2FF4A 3DLAA 3HOVJ 4IHVA 3E20A 2K9NA 5F6FA 2DA1A 2I10A 5J4YA 2R7WA 3RKXA 5K5QA 3OJWA 4AU7A 1U0JA 3WTVC 4EJTA 4FX0A 4G7WA 1MBJA 5J6XA 2L3DA 4ZZLA 9ANTA 2DYIA 2V4JC 4BQQA 3R6KA 4HLYA 2VB6A 5JLVC 3OOPA 5IYRA 2KHMA 5CVUA 4XN3A 4M2LA 2XTYA 2IA2A 2F5CA 4LLNA 2CUFA 3A3GA 2XGCA 3HUGA 3H36A 2ZSHB 2ZXIA 3I4MJ 3ABLH 2EV5A 3LWFA 2BPOA 2LH9A 1K6YA 2DLLA 1D5YA 1NBMA 4OIOF 3HOSA 3AG1H 3F22A 1WFXA 1QZZA 2DPDA 4X0CA 1QZYA 1X1PA 5FLVA 3BROA 4EEFG 3VMVA 3NRVA 1RESA 3CMMA 1KC8D 1V0FA 2HYFA 4RAZA 4YEJA 5FRNA 1K9MD 1OPCA 1NB0A 3MFKA 3BZKA 5CPRB 3A1PA 4IQ4A 1QGPA 5IY5H 2MLKA 1OGOX 2ISYA 4CDGA 4XNFA 4B47A 3L7WA 2OK8A 1U2WA 5TGTA 3SZTA 3SLDA 4MLOA 2RAEA 1ETYA 3J7AO 2ZZGA 2AO9A 2QYOA 3EPZA 4KFCA 2V26A 4G12A 3T9GA 1X2MA 3HGYA 5L3BA 5LMZA 1W87A 3V7AA 1B1BA 4G6TB 1N07A 5LHGA 1XGOA 4HV6A 1ZGJA 1ZYRF 5HLTA 3K2ZA 4ASUA 5J8FA 1S7AA 4Q4ZF 1O4XA 3U2RA 2CWEA 4ETSA 1E3PA 3K6GA 2R7TA 3FMRA 4W1UA 1HDPA 4KN7X 3LSHA 2A68F 2RQQA 2HTSA 3TOBA 2B0RA 3ONYA 3CC7I 3DTEA 1ZAOA 3LSPA 1O3QA 4XKVA 2E35A 4PC6A 1WJAA 5JLXA 1UD2A 3CCLI 2ZL7A 1KQ5A 1KCDA 2FX0A 2HQAA 3K4KA 2MG4A 3BC9A 2C5BA 3UNGC 5A2QK 3BZ6A 4Y3OA 2NSPA 1ZRDA 2BMWA 3JQQA 4HQEA 4AWXB 3U1KA 1TQPA 2JA6J 2PBIA 3CF5F 4IZZA 5D5VB 1Z77A 2UXNA 1KQ0A 1XSXA 5L3EA 1U3EM 3OZUA 4LC0A 3LMWA 4OZYA 1X19A 1JTAA 4FT8A 1FOXA 3BTIA 4BHCA 1GR1A 5TY0A 4YFXF 3S1MJ 2LYCA 3VYTB 3EQNA 3HOTA 2CMPA 3WWGA 4HQMA 5F04A 3ZQIA 1QA2A 2RNGA 1PP8F 3GBGA 1RPWA 2NXNB 2NOGA 1E2XA 1TNSA 2M9HA 3LSGA 2C77A 4ZGNB 1DGRM 4C3JJ 1W2BB 2WZNA 2GOXB 2H8WA 4BQNA 1WJDA 1EV7A 3A3BA 1QFYA 1D0YA 3GO5A 2E1BA 4C2LA 4UB8C 5KVRA 4LFUA 2IGOA 3QU6A 3QWLA 4P9FA 2VQHA 3S3OA 2B7BA 3OWTA 2EV6A 3FXUA 2KQRA 1K8FA 3SYJA 4KJZA 4ASNA 3KPHA 1TWGJ 4I6ZA 2OTJI 3LA7A 4BEHB 4EGZA 2HTJA 4M3DA 2F5FA 3WE3A 5HZBA 3TW7A 1W7PB 3FKSA 1RWRA 1TTTA 2E36A 2YR2A 1IRXA 5FKMA 1KK0A 1XMAA 3OYIA 3BNWA 1JUSA 4ZCMA 4P6VF 1UZCA 1VQNB 3AG3H 1MJBA 3CJNA 2ZZQA 3JX8A 5A89A 3S3MA 3QE2A 3J7AY 4I02A 1H85A 4A3CJ 2JQ7A 3W2GA 1ONVA 2DN0A 1IN5A 3H1CA 3KEOA 2VFNA 1XG1A 2ME0A 2E60A 4Z06A 1G3YA 2WADA 3ZQQA 1EP3B 2C6YA 2BXYA 2VOPA 1VLYA 2Z1DA 5HODA 3PO3J 4G9YA 2HVSA 2BM6A 4YIRX 2ID3A 4DYQA 1ORKA 2KZVA 1Y8QB 2L7KA 5B6IA 2PMUA 4NCNA 2Y48A 5GAGJ 1ZR2A 4UAJA 4CICA 1AKHA 3KZYA 4AIHA 2E2IJ 1K79A 4F93B 4FETA 3G4SI 1JKQC 2X6WA 1TW2A 2JK3A 1L1IA 2E5NA 1AHDP 2AQEA 4HSRA 3JCUC 5F0CA 2JMWA 3E1SA 2FD5A 3NWSA 3GTOJ 2DT7B 3FIWA 2KIQA 3GMEA 4HLXA 4U9UA 3O2PE 2QGUA 3LSMA 3OMYA 1TVCA 4K2EA 2VPLA 1X4PA 4FASD 2STTA 2X9DA 2GXAA 4W8RA 1XFOA 1W36C 2VE8A 4S04A 3DEWA 1EA3A 3VFZA 3C3WA 4G6QA 1VFCA 4RLFA 3TKYA 4XONA 2P5VA 1B9MA 3PENA 5E1XA 1HSTA 3P7NA 3LQEA 3VSLA 1GAWA 4TKOB 1SVMA 3HYIA 3FJOA 1XC5A 1SKQA 4RD3A 3C1DA 1U6GA 2QQAA 1N08A 1WTHD 3RPUA 3HHGA 1MNEA 5LRSA 5E1WA 2CW0F 3VWBA 5KW9A 1RMGA 3FMSA 3HOUJ 5FLXZ 4GYIA 5DDGA 4EW9A 3CJQB 3EYIA 2DMTA 2NVTJ 1WMRA 3TO9A 5GV7A 2ZXWH 2PX9A 2LTPA 3G3ZA 3WHCA 3JRHA 3IC7A 2L54A 1S0UA 1W7PD 2RKHA 2KLOA 2VJ4A 3BCDA 3B6CA 3BOQA 1T08B 2D3LA 1O8DA 3FK6A 2LLKA 3ZUGA 5EDNA 4I09A 1DU0A 2KVOA 3BQYA 4QWQA 1S3JA 3I59B 3RKWA 1MDMA 1QH0A 1G4DA 4D1QA 4CCJA 1I1GA 1IB0A 5F64A 3VOEA 2ZMEC 3WNCA 3U6BA 1ZG3A 2G7HA 4B48A 1W4MA 2FSWA 2RC6A 4HF2A 2IBDA 4WK8F 3CC2B 2R7RA 1QPMA 5EZHA 1MJAA 1OYYA 4TT3A 2NT6A 1J9IA 5KNLA 1HSJA 4ENMA 1V5VA 2VKHA 1DP3A 4GQNA 1QVUA 1STZA 3FMQA 3JRBA 5B5EC 5IYCJ 5B1AH 1E17A 1Q82D 3VDXA 3S2DJ 2F1LA 3LQ6A 3IUOA 2P4WA 1O8GA 2BM4A 1MJ9A 3ZZTA 1SMYF 3P5JA 3OEHA 1TT0A 5DCMB 4XL9A 4BL0B 2EQRA 3WTTC 4EMSA 1ZKGA 4A0YA 2QSFX 2YWGA 3RKQA 2Q8KA 5L3DA 1W36D 3AL0C 5E17F 4P2NA 2IS1A 1ZGAA 1HCRA 5TISC 1LLZA 2V5IA 3DQVC 1XDUA 1DABA 5L3GA 2GXBA 2IS4A 1VQ6B 4PC3A 4BBRJ 1KK2A 4MHGA 2HFHA 2ZFWA 2LBFA 2JDIA 4II3A 4PSXA 1OLTA 2K9LA 2M87A 1LFPA 2B0LA 3MD2A 3QAHA 5GADJ 1CF7B 2V7QA 2XNJA 3CMAB 2BHZA 4A3KJ 2QZ8A 3Q0WA 2KDOA 4HX8A 2XIGA 2FU4A 4OOSA 2E7WA 3HRUA 2CV0A 5GAHJ 3A8JA 4HE5A 1ZRFA 4QFMA 2R5ZA 1BI0A 3OR1C 4RD6A 2BY0A 2X1DA 3PQKA 1V54H 5J8CA 1XB2A 3WXMA 2VFOA 2V4DA 4WWVA 3PSSA 4M73A 5FFZA 3OY9A 3AFHA 2ZNYA 4PCQA 1HW2A 5K7ZA 3OYDA 4Y52J 4AIDA 4NUBA 2XAQA 2UWMA 5FA6A 3AK5A 1HA3A 2WB1N 1UMKA 2MD5A 4G1BA 1MGTA 4BJTA 1LB2A 3G2BA 4HBLA 2PLFA 4XLFA 4B09A 1JTXA 1K73D 4Z1MA 2R3SA 1EFRA 1P4WA 4OPOA 4P3IA 5FROA 3G71B 3E6DA 4PSWA 4EJOA 4HNUA 1IN7A 2K3FA 1X3ZB 4HPQA 4WXHA 3JRDA 1FYKA 1AWCA 1H80A 1WHUA 2H6BA 2Y69H 1R36A 1T56A 2H8RA 4Y9RA 2JRTA 2WV1A 3NB2A 2MH9A 3EYYA 4A3IJ 3OOCA 4TMXA 3MKLA 5JMCB 2OBPA 3LAPA 1TYXA 3J81Z 1IXRC 3SFIA 5E6TA 3D5LA 5AN9A 2QQ8A 2R7FA 3E6BA 1WVRA 4G8XA 4XK4A 2P6SA 3PUBA 5J3LA 5DM7F 1B8IA 4DQKA 2XZOA 3AVUA 2ZMEA 4M71A 1S72I 1B72A 2VBMA 4U49A 1F20A 1KMHA 1XGNA 4Y4RA 2Z8GA 1XMXA 4XOTA 4Y17A 5LHIA 1MSEC 2O03A 3B73A 5CYVA 3HB9A 3GTGJ 1XD7A 2F1MA 3K0LA 5IT3A 2DIEA 4KMUX 5C3EJ 2XNDA 3KZIC 1EWYA 4LK0F 4FHTA 2OTJB 1B4AA 3TOAA 2XRLA 1V5FA 4QVJA 1DDNA 4UZEA 5DM6F 3ML6A 1HDDC 3TW6A 4IHSA 2DQLA 4G5GA 1AIPA 3CDLA 1IA5A 1EH8A 4RS8A 4BBSJ 4UVAA 2IEKA 3E6CC 1WOOA 3JURA 1FJLA 1PUEE 1VQNI 1F60A 2BBYA 1VQ8I 3MZ8A 4M3EA 2NT9A 4HEA2 1CGPA 1FOKA 5A8AA 1IUFA 4ZYAA 1O8EA 4F3QA 4KIFA 3SLNA 2OPTA 4Y7CA 1IN6A 4GRIA 4C30A 5AIPA 1S7OA 5HDGA 5H6RA 4XRSG 2F5DA 4MXNA 3CCUB 5GV8A 3GLXA 4A5MA 2E5ZA 5H59A 3IHUA 2BHYA 1V5GA 2GM4A 3OYAA 1IF1A 3BG5A 2XPUA 3J80K 1J9ZA 2IXSA 3CDHA 3B8YA 3H0GJ 2D1HA 2BY1A 4RMNA 5JHUA 4HOBA 4QPQA 2VT3A 1GV5A 2F5EA 1H88C 2ZNZA 5DN6A 1Z7UA 4A3MJ 1RU4A 2EZIA 4EV0A 4XLHA 1Z6TA 1FOWA 3CLQA 4XRFA 4DZPA 4E7IA 4L5JA 1JNYA 3RCOA 4PGOA 2HXIA 1OCZH 4ZDPA 2LBFB 3KYLA 3BPVA 2Q0OA 3G1LA 4XD7A 4G7XA 2DFFA 3ROUA 4XKBA 1MSFC 2HZDA 4ZH4F 5EF6A 1TLLA 2BSAA 4N0BA 3REOA 5J1YA 2LY2A 1ZG5A 2Y0SA 1XTAA 2MYSA 4A5NA 1BJKA 2YUSA 3SJZA 1K4TA 3SEJA 2AXTC 2WB1A 4C2TA 4B8XA 4U7DA 4GXOA 3S1RJ 4XKCA 2C2WA 4IRHA 2K02A 2DT6A 4ACAA 3ABKH 3AVVA 2XKOA 4RB2C 4F92B 2OZUA 5EG0B 3L09A 3MCZA 1E3ZA 1HKQA 3TP0A 1LEAA 2F2EA 2KMUA 2NNNA 4YFOA 3IL2A 4IF4A 2CG4A 1KK3A 1RR7A 5H5JA 2DCEA 1BOAA 4RB1A 1Q81D 4OINF 1G7TA 1R9TJ 1TL8A 4MIMA 1IRZA 3NEUA 3J80Z 5FKNA 1NG7A 2VI6A 3ZQGA 2KP6A 3DEEA 1XPXA 1ZQ3P 1KRHA 4ZGQB 2VPRA 1MDMB 1IB4A 3KP2A 4PZJA 2QF7A 1BJAA 2WV0A 4M9XA 4X07A 3A8KA 2XHKA 2ISZA 1ETWA 1W0UA 3CUQC 2X51A 1BOBA 4YHBA 5F4MA 2CK3A 3B8HA 2M8GX 1ETOA 4JK1X 2HGCA 1OB2A 2RGVA 3ERED 3SEZA 1T6YA 3ASNH 4FX4A 4Z4ZA 2J5PA 1CNFA 2JPBA 1O8JA 3I5UA 2TCTA 1D8KA 3DP7A 3W2VA 3S17J 4DYRA 3MN2A 2XF6A 3AVXA 4PGGA 4ZDOA 1TSPA 1DDIA 1IXCA 2EFWA 1YS7A 4N9HA 3TO6A 2BGCA 3R6SA 4I76A 3I4PA 5D5XB 4G6DA 4L5IA 3LQRA 3WBKA 3GQAA 4P1WA 3F6OA 3VYRB 4KIBA 2G0YA 3RTRA 2W57A 1K5CA 1SFOJ 1J59A 2EPFA 4G94A 1UJ8A 4CCLA 2DA2A 4CZCA 1LFUP 3CMYA 4LB6B 1ITYA 4YXWA 3BCAA 1BIBA 2PIAA 1Y0RA 5FGMA 5DCMA 1IJEA 1W5SA 3HDDA 4ZYEA 1E1QA 2WJYA 2A07F 3WTSC 2CV2A 2DETA 3NAUA 3WU2C 5ILUA 1W0JA 3J7ZI 1FNDA 1A04A 1QVTA 3CCVB 4HIZA 4UB6C 2K9QA 2WAQA 4C2UA 2ELKA 4G1VA 4MFDA 4B3FX 4PJLA 1GAQA 2EFGA 2DERA 3OW7A 4L18B 2Z9OA 2PMZA 3V76A 3DWLE 1TYVA 2NAZA 5IPAA 2HI3A 2LY9A 3ELKA 1HW5A 3P27A 1KU9A 4DYCA 5H2FC 1JUPA 5D8LB 2GJRA 1N0UA 4LBZA 4RJLA 5EMNA 1Z21A 3WGGA 3LNNA 1V3FA 3PIPF 2CF4A 2C78A 1YITB 4DW6A 4XIDA 1KU2A 3FPKA 2F4MB 1V55H 2M0CA 5J3OA 2ZCWA 1VZ0A 5LEJA 3S3NA 4DNTB 1UMQA 5IYQA 1JI8A 4GO1A 5LBQA 2LD5A 4EH1A 2M45A 1G59A 5J40A 3IH4A 4PC2A 3LSJA 1Y56A 2EV0A 3PSIA 2CSOA 4BHPA 1ENHA 5B3SH 3ASSA 2PJPA 5ICCA 4H9GA 2DBBA 4ZCLA 2CUEA 3BJ6A 3KIOA 3HRTA 2XPWA 2JSCA 3OSGA 2W84A 3KX2A 2WA0A 1YHQI 1G3SA 3BJAA 3OYCA 1H8AC 3OE7A 3S14J 2V1XA 1R71A 1FDRA 5IK2A 3OL3A 5FB2A 2M0MA 4H0EA 1P6RA 1P4AA 1IRFA 1LNWA 1KU3A 3SYTA 4ENJA 2V9PA 1LM1A 2TRTA 1IZ1A 2O8XA 2EA4A 4C43A 1QRCA 1I3AA 4A3GJ 4IW3B 4PABA 2B7EA 1MH4A 2ZJ2A 4Z4RA 3K70C 2O7OA 1YLOA 3AL0B 1F9NA 1M1EB 2BM5A 3DBHB 4TN1A 2XB5A 3I9V2 2QEXI 2CQXA 3QOEA 4UUSB 4A3BJ 5K7FA 3VMWA 4CQJA 3HRSA 4PJMA 4C2MJ 1SD7A 4CYCA 1P9QC 1HXDA 1PJ5A 2FQ3A 5F08A 4OAYA 3BR2A 2OBSA 3VSUA 3CCVI 1A31A 3KEWA 1CLWA 1OYWA 2BM7A 2BXZA 4AVPA 4BH9A 2EIXA 2XC1A 2MW8A 2BVNA 3LYCA 1YW8A 2HU9A 4WZTA 4BPRA 1QO0D 4M9ZA 1NJID 3G4SB 4RB3C 4FCYA 2KKOA 3TDUC 5JVTA 5GPAA 1NB9A 2CRVA 2DA5A 1MBEA 2ZMEB 1U78A 1W0KA 1G8XA 4F52A 1ETKA 1VBLA 2K85A 3CQZJ 1LDDA 2A6TA 3S2WA 2FOKA 2R4GA 1WJBA 1R00A 2A5WA 2GA1A 3ZMSA 2L7ZA 3FBIB 4TMZA 1U9NA 1PJRA 4JBAA 1UD3A 1E1RA 5FLXK 4LLLA 2UZKA 1YO5C 2R92J 4RPDA 2F4OB 2FMYA 1UD5A 2PYHA 2DPUA 4RA2A 5E3NA 2IT0A 4KNYA 2W82A 2ZZFA 1JT6A 1YS6A 2P81A 2FJ1A 2X0LA 4DK1A 3KP7A 3BPXA 3R61A 3T8TA 4YDTA 4R79A 4A0ZA 5C44J 2JA7J 2VJIA 1U8BA 4A69C 4RLZA 3HPGA 3ZIAA 1Z67A 3LFUA 3PUNA 2YU9J 3GF2A 2DXIA 3IKTA 3OJXA 4OAZA 3QFSA 2VFQA 4Z05A 3QP5A 1YX5A 1M1KD 3AG4H 4LBYA 1E43A 2RNJA 2XEXA 3BJOA 3PQJA 4II2A 4PC1A 3V7CA 1W0TA 3KP5A 1X58A 3GX4X 1X4OA 2Q6LA 3VSVA 1MRZA 3HKZA 2FXAA 3CCRI 4IRIA 1I8DA 2OBRA 3MHPA 2GZWA 2K9SA 3CD6B 3SKBA 2HOSA 1VQPB 2IGKA 3M8JA 3OS1A 2J7KA 1J0RA 4IX7A 3BR3A 2OC6A 1X0CA 5DUIA 4B1RA 4A3EJ 2H09A 3PUMA 3TH0A 2GPJA 1QGYA 1COWA 2YUHA 1ZN2A 3BG3A 1BC8C 2EIKH 4P25A 2EINH 3B6AA 4RAGA 1EP1B 1EH6A 3ABMH 4P5OA 3JREA 4ZC3A 1XGSA 3D1NI 1YIOA 2R93J 2JN9A 2Y2ZA 1SEUA 2QN6A 5BSXA 3SUCA 2WAFA 3BTJA 2P8TA 2CUJA 1T0FA 1QNTA 5EGOB 5DS9A 4N3NA 2JUGA 1JHFA 2LF7A 2QSGX 2ME6A 2XV4S 2Y0SN 4X0GA 2WPDA 1Z05A 5IYDJ 2EK5A 3G1MA 1NRKA 2QKLB 4X7EA 5DV5A 2JTVA 2P5KA 2Z33A 1SKYB 3HGGA 1D1AA 3R4KA 2L02A 5F0FA 4G7ZF 3NWTA 1BX1A 1HKTA 4YAFA 1VQ9I 3SFZA 1QFZA 2X6XA 3AVYA 2L9SA 2KL4A 2ZTNA 3A2KA 2V6CA 1XB4A 3M1CA 5F1RA 1EE6A 3TP3A 1ZARA 3V42A 1A5JA 2FE3A 2L9VA 1VQLI 5HDKA 4BE2A 3WTXC 4HE6A 2BY2A 4BJ6C 1NK2P 1OJLA 2MH2A 2V31A 2CBXA 2DO7A 2BM1A 1N05A 3A01B 4KIGA 2JSPA 1OB5A 1VQ5I 3CCMI 3BR0A 4BS9A 5EEAA 2OCCH 3Q38A 1FZPB 1FIAA 2VASA 4D7NA 3QPHA 4G7HF 3Q5FA 3ZZUA 1DGWY 2EFPA 2PN6A 1V5EA 4EM2A 1VQ7B 4ZJZA 4BDYA 4LIUA 3OW2B 4M4SA 1I50J 1TYWA 4E7LA 2E1CA 4OMZA 5BQTA 3M8FA 5M5WJ 5E3OA 1X1AA 3K2AA 1MMDA 3B4NA 1GLNA 1YX2A 3E97A 1RRJA 4OU0A 2M34A 3W6KB 1B6AA 2M1BA 1XX5A 3H5RA 1EFTA 1R5ID 1HVXA 1OFCX 5FJ8J 1T2KA 1IC8A 2ELHA 1QRYA 4ENNA 3V4GA 4URRA 5IOZA 2OTLI 4RD2A 3BTCA 1FNNA 3K7AJ 1PP7U 3F23A 3BT9A 4ZTJA 2CRGA 3MMYB 4U88A 3JRIA 2GQFA 1PE9A 1ZHFA 4QTRA 2VLAA 2ODLA 2JA5J 3RIQA 4LD5A 1K28D 2ZJRF 3TEDA 4N9IA 3WG7H 4BXXJ 2WY8Q 1Z91A 2P7VB 3H92A 3I71A 5EGOA 2VBVA 3FX3A 3RYPA 4JP0A 3H9NA 1BA5A 1KA8A 4E7KA 3VSKA 2F6CA 1Z1DA 3WGIA 4FXUA 2PECA 2ID6A 3PFIA 1IW7F 2H94A 1BR2A 1FY7A 2TDXA 4KMFA 5JI6A 1B72B 1VI0A 4OIQF 4M3FA 4N4NB 2IOUG 1OFEA 4PDKA 4OIRF 1X3UA 4OJOA 2IQ7A 3CUQA 2BVLA 4B44A 2IS6A 2BF4A 2FVGA 2I1LA 3GRHA 4B3XA 3PSFA 1Y1VJ 5BS6A 4WCGA 2FBIA 3K1NA 4A0XA 3GEZA 2XSJC 1PUFA 4E7JA 4QVAA 4YALA 4P55A 3HOXJ 2X1CA 3CO6C 3CC7B 1YJWB 1Q1VA 2IA1A 3DKWA 2GREA 2QYUA 1L3LA 4DJAA 1ODDA 3K9TA 4P1VA 3GQ8A 3F9KA 3LFKA 2V7WA 3CCLB 4Y13A 1QCXA 1WSVA 3QRFF 5IYNA 1S7EA 2QA4I 3DBLB 1VQ7I 2G0EA 5C1EA 2OCEA 2STWA 3NARA 4HWVA 1H0MA 3WNBA 4HW0A 4LG3A 3S32A 4KISA 2OA4A 5E20A 2RREA 5M5XJ 1B8IB 3NE5B 4DBRA 4DBQA 4S05A 3IRQA 3CLOA 1XG2A 4XLPF 1QPIA 1SAXA 1EJ9A 2M7AA 2FBKA 5JLWA 2PI0A 1WSRA 1OMIA 2JA8J 2HS5A 2LDUA 1YJNB 4QUZA 2DA4A 2JUCA 2VIXA 1IHMA 3F21A 1PVEA 2VQGA 3FPPA 5FL7A 3OFNA 5FD5A 1YJ9B 4UV8A 1NHAA 4Z03A 4NBSA 3D5SC 4YZ0A 1Q86D 2QY1A 3ECOA 3K69A 2A61A 4ZYHA 1TQMA 3HG9A 3H5NA 5HDNA 4HAMA 2D5VA 2CQ7A 5FIUA 3W2FA 3BG9A 3ZN0A 1ZLJA 4IEJA 2R7XA 1F43A 3GYHX 3CCYA 1BBYA 4FWTA 5CVRA 2EBIA 2ZJQF 1JJ8C 1DDGA 4PFOA 1KZHA 3W5HA 3FHNA 2K5CA 2R7ZJ 1RKTA 2CW8A 1S29A 4EM0B 4ENKA 3OZVA 2QM3A 4C9YA 1B2RA 3C2GA 3CUOA 2OV7A 1WWXA 3DDYA 1WH5A 1ULYA 1OB0A 3VNUA 5JHFA 4NDLA 2VJ5A 4JX5A 3BZCA 2FMLA 3DCFA 1B9NA 3EQLF 1IV8A 3SZGA 2EIMH 2WYRA 3KE2A 4AF6A 1UD4A 1QU3A 5H6QA 2LR8A 4XKWA 1IRGA 3I64A 5HLHA 4A3LJ 3SJPA 4NBQA 1YIJI 3CC4I 4RCZA 5A88A 3S2HJ 2K40A 2O9LA 2ZSIB 2GIVA 2O3FA 1KONA 3KP6A 5DEQA 2DOGA 1AMOA 1MBGA 1R58A 3OS0A 3N97A 1JKPC 2DA3A 3T1BA 4Y15A 4OZZA 1R4MB 2BW3A 2Z3YA 4XOPA 1D8TA 4I0BA 1T33A 3GVLA 3VPRA 1WJEA 4Z2YA 2QBYB 2O6WA 3ZC3A 4JQFA 3COAC 2CQKA 2VBZA 1FWZA 3LOCA 3F8NA 3W2EA 1WZ2A 2RDPA 3I56B 3HIFA 2E71A 5TJJA 3ASQA 3BQJA 2D45A 4YAOA 1JJ6C 1F36A 4A93J 1SFKA 2A6HF 3FKJA 4MTEA 1N75A 1E63A 5H20A 3P4GA 4CGZA 2DU9A 4WF2A 4Q7JB 3MQ0A 1OFLA 3JAMK 1U5TC 2EZLA 1RC9A 2DTZA 3L2UA 2NVXJ 4OMYA 1QUFA 1VQ9B 1QQ1A 2COBA 4KKSA 1CQXA 1VQ4B 4L5EA 5AMVA 5DUKA 5BNGA 2G9WA 3JW4A 3VSTA 5IYWA 1YW7A 5FO0A 4JX4A 3LSIA 4XSXF 2R5YA 4RBOA 2XF5A 5IT9Z 4V2GA 2VOOA 2DMNA 3GTPJ 4M1KA 4Z4YA 5D4SA 3QFCA 2LZJA 2M3AA 3ZZ0A 1ZM3A 1R5OA 1DBOA 4R1HA 1R5BA 2EFNA 2C4UA 3P9KA 5GTIC 2VN2A 3HSEA 2LREA 3HUGB 4MYUA 3DPUA 2MFZA 4XQFA 1UD6A 2X3UA 1NG6A 3OV8A 2Z16A 2RC5A 3N6ZA 4P12A 2VC1A 2D9RA 3GTMJ 4KN4X 5L3CA 3KL9A 4RPBA 2KJCA 2HNHA 2JIZA 2E1NA 4J19A 1YI2B 4X05A 2WZPP 2R5ZB 4HNTA 1IUYA 3ZMDA 1VHEA 2CS3A 3EUHA 5KK1A 5IYPA 3Q9VA 4LIVA 1SC7A 1FNMA 1LVKA 3Q0UA 4HNVA 3GFMA 1ZREA 1H8EA 2JA2A 5E8GA 1Z7LA 1K78A 2PEXA 1FOYA 2Z5UA 1OGJA 2HKXA 5DD8A 1BQEA 4B4CA 4RB0A 1XS9A 2WY7Q 4GCVA 4AUXA 4EATA 1JGGA 1K4ZA 2VBXA 2BY3A 1Y8RB 1FEXA 3CXCB 1LLWA 3IWFA 3VYSB 2XT2A 4YC5A 2VODA 3CO7C 3CMAI 4X8IA 1M90D 4B3AA 3DV8A 1VNDA 1TUIA 2R6HA 1JHHA 1O7LA 4UV9A 3I56I 1MBHA 4I7HA 2JWTA 1K7AA 1A6IA 1EFCA 1GO2A 4UUTA 1TP4A 1A8PA 1QVFB 2JVGA 2HLDA 1TNTA 4AYBN 2VQLA 1W5TA 3B02A 3CJTB 3WTWC 3JSOA 2KRCA 2HDDA 4PC7A 2QXZA 1H9TA 2D1VA 3ULQB 3B78A 3DF8A 4K1XA 3R60A 1E3HA 2R5YB 1GXPA 4DNRB 1A6QA 2L7FP 4Q48A 3BDDA 3RI4A 5J4VA 1KQ8A 3F72A 2VE9A 2ETHA 3CESA 2JRMA 3W2IA 1VQ6I 2Q6OA 2DW4A 2XSDC 4AIJA 1O8HA 4V02C 5HZAA 1D2EA 4A3FJ 2V7FA 4HG2A 3PNVA 2A69F 2ZJPF 4KA4A 4GGGA 4BE0A 4IVNA 4OPVA 2X8KA 2VNIA 5ERIA 1T38A 3CCEB 4YFNF 4X06A 2J8KA 1LUJB 1IDYA 4BXUA 2XRNA 1FRQA 2NVYJ 2R7QA 4DZJA 2CGPA 1ZUNB 1YITI 1FP1D 4Y7NJ 3HSRA 2HKOA 4Q5SF 2BM0A 2B9SA 4KUMA 5TR9A 1JTYA 2Q6IA 4O6JA 4X7FA 2IP2A 5FRMA 2BVMA 3V7SA 2UUZA 5B66C 1Y0NA 1Z3YA 1FPQA 1FRNA 1FYMA 2HYJA 1UHSA 5LD2C 4AIKA 4TMWA 2GAUA 2XZLA 2Y0MA 4Z4VA 2HWVA 4OJLA 2L0KA 1WRJA 3EUHC 3KEYA 3T5XA 2NTQA 4BY1J 3QYBA 1ZTRA 4XLEA 3DKYA 1FBQA 1YG2A 4P9SA 3CC2I 2L7MP 5E3MA 2ESNA 1C0WA 1Y39A 1I5ZA 3OR2C 3QFRA 3E0JB 4DK0A 4RAYA 3S15J 6PAXA 3FISA 5HLIA 1UFMA 2GWRA 2VKEA 1BIAA 1BC7C 2DMPA 2K4JA 3VODA 1QGAA 3RQIA 4DGWB 1FIPA 2DYSH 3PM1A 3OYGA 5DYMA 2DJNA 3H0DA 3SY2A 5C1CA 1Q9SA 2BX6A 3KCCA 4UXNA 3GTQJ 1VF9A 3W6JB 2GJPA 3FZVA 1O3SA 2I8DA 1BR4A 3DFGA 3PO2J 3LSKA 4HYEA 1H42A 4U4BA 2HXOA 4CZZA 3L2VA 4BXFA 3FXOA 5K5OA 1E79A 4DQ2A 4EGYA 3ASTA 2P0WA 4OIPF 1BLIA 2YU3A 2JJ2A 1WORA 2W24A 3ZQFA 3KEQA 3A8IA 4UZUA 4Y9UA 1HC8A 2LMDA 4LMYA 1MNMC 4V19K 3E3VA 3OZWA 3ZGKA 2CW7A 2ZBVA 3HXLA 2PFBA 3VNVA 4KICA 1WSUA 3L1PA 3HOYJ 4YZAA 1O88A 4XORA 3S1NJ 2R7OA 2W25A 1QBJA 3P26A 1MMAA 2E1MC 1D0XA 5EG0A 3LSRA 1FNBA 2VBKA 2P7CB 5FLMJ 1U9OA 2W7ZA 2HOTA 2YX7A 1HA8A 1OCTC 1Y0UA 2Z2SB 1GVJA 1DG1G 3OYEA 1CNEA 4V2FA 3I4NJ 1OCPA 2W48A 3LA2A 3P9IA 2F43A 2Q6KA 5GTHC 2CNDA 1ELOA 2CC2A 3S16J 3CP2A 2ICWG 2R7VA 2MC3A 1XGMA 3MCAA 2VJJA 1RIOH 2L01A 4CCOA 1H9GA 1X3WB 4M6XA 3RPUD 1NK3P 4HRIA 2NZMA 2PG4A 1DPRA 1WPCA 2ECBA 2B5OA 2IVMA 3DEUA 4X7DA 1LJ9A 2XGDA 1B23P 4NC8A 3VO1A 4ZYDA 2DFHA 4IRGA 1FT9A 3GQ7A 4LG0A 4ESFA 1HF2A 5IP7J 2Y9ZA 1YYVA 2M4GA 5EZGA 1XE1A 3G05A 2B63J 4RDJA 3F8CA 3K1PA 3ML3A 1Y0YA 3JSPA 4HX7A 2FNAA 3Q3SA 2M5SA 1I1SA 4WZKA 2IGMA 4HV5A 2R0QC 1IGNA 1VQPI 2K7LA 3IAS2 2CW5A 4MYTA 4CSWA 1KJZA 1UELB 2DFIA 1HG8A 1LDJA 3K4LA 2W00A 1QQIA 1BI3A 3FKIJ 2KZGA 2UV1A 4CXFA 2QQBA 2HYGD 3ZP5A 2QSHX 4Z6YA 5E79C 1WQ2A 3QODA 3FDYA 2ECCA 5TV2A 4LK1F 4YIIA 3GCMA 5BPIA 1D8JA 4Z4WA 4A6DA 1MABA 3T8RA 1S8NA 1K83J 1WPKA 2F4IA 3HEFA 3K1MA 3IP4B 3PIOF 4U0YA 4XSZF 3CRZA 3HTSB 3JRFA 2KRHA 1TWCJ 2PMDA 3KLNA 3U9GA 4M6YA 3GZNB 2GQQA 3W5UA 3VEPA 4A12A 4NNJA 1USSA 3M07A 3R6JA 1XSDA 2O6GE 4JX6A 3FXKA 3ZMTA 1FTTA 1OOCA 4CO8A 3F8BA 1BX0A 2LY1A 5J1UA 2V6EA 4TV7A 4I99C 5D4RA 1Z0XA 2ACJA 4PFPA 4M0LA 1MW7A 4ZYGA 2EWNA 2OJED 2O0WA 1RZ4A 4M74A 4PUSA 4HX4A 2IA0A 3DBRB 4L9JA 3U1DA 4D0PA 4OWRB 1QA6A 2VBTA 2PQ8A 1YRNB 3CP8A 2RC4A 3RKYA 2RQPA 3W2AA 3O8GA 1U5TA 2QQ9A 3DU1X 2VZLA 4B43A 3BG7A 3K4JA 2INVA 1GVHA 4LLGF 3HC7A 2D2WA 4Y33A 3CCQI 5F4OA 2DOEA 4PK4A 3OEEA 3I58A 2LNBA 4QPOA 2HMAA 3OPOA 3K70D 5CLSA 4P22A 4I2OA 3NQOA 3RSNA 2PJRB 1EH7A 4YELA 1CQTA 1JKOC 2BGIA 1YOVB 4AM3A 1OQYA 2O1DA 2M5WA 2BW3B 3OYKA 2ZBUA 4HZFA 1VLOA 4M6VA 5TRDA 1H89C 4YAWA 2VFMA 3V8LA 4WWCA 1I3QJ 2O0YA 1J09A 2H1LA 3H9QA 2CFXA 2NTBA 5L46A 3OSFA 1BMFA 3CZ6A 5K5RA 3JRCA 2IS2A 2RV8A 1TYUA 4W8QA 1D1CA 4ZZDA 2MBFA 4C3IJ 3ZQCA 3TDZC 4CYCB 2W6JA 3PA2A 3ZCOA 1KK1A 2FX3A 2VONA 1QHHD 4UVCA 3VR6A 2VBEA 3NAWA 1V4RA 2NTPA 1U2RA 3HZJA 2JJ7A 4NC7A 3F8FA 1O7FA 1TQIA 2MSYA 3E7LA 4TSFA 1Z6RA 5CQGA 2CUZA 2QWWA 2KIMA 5D8KB 2VBYA 3WTZA 3RZDJ 1XCBA 3FM5A 2OK7A 1ZGWA 1T98A 1T5EA 1GHCA 2CU7A 4LB5A 5FKLA 2D74A 3KP3A 1BN5A 3CPXA 2E1MB 5HOOA 3ZMUA 3CCEI 1PDNC 3QPLA 2H1KA 1JA0A 4M9SA 3MEXA 4UVBA 1S6LA 1TWAJ 2BEOA 2VBWA 4MQVA 2ZO4A 1G7RA 2P6TA 4RGSA
chains in the Genus database with same CATH topology
4CUGA 2DOAA 3PSFA 1OHHA 2CV0A 1KTWA 2X85A 3N05A 3OR1C 2EWEA 4XLAA 2X1DA 1UG0A 2LG4A 2XSJC 3S8PA 4BQOA 3OYJA 4E7JA 2X1CA 5HVQC 4F55A 2GJKA 2V4DA 5HNFA 1O8IA 1YE9A 4DJAA 3OY9A 3AFHA 3HAGA 1UD8A 3GQ8A 3OYDA 3F9KA 4RM3A 1QCXA 1QHGA 5CKTA 4NUBA 5KHDA 2UWMA 5C1EA 4HWVA 4U87A 4BJTA 3G2BA 2XF7A 4LG3A 4XLFA 3S32A 4KISA 2RREA 4Z1MA 2HVQA 1EFRA 4DBRA 4DBQA 3NE5B 4E4HA 1XG2A 2K3PA 2M7AA 5FROA 2D3NA 4PSWA 3DTIA 4HNUA 3PNYA 4HPQA 1D1BA 1W9XA 2AQFA 1H80A 3WWGA 4OJ5A 2VIXA 1MNDA 2VQGA 3FPPA 4NK6A 5FL7A 3OFNA 1T95A 3OOCA 3L2RA 2O17A 4YZ0A 4Z03A 3D5SC 2QY1A 3D5LA 1FMVA 3HG9A 3H5NA 4XN0A 2WJVA 3PUBA 2XZOA 2VBMA 1WJCA 4U49A 2WBMA 3I3LA 4CH7A 1KMHA 4Y4RA 2R7XA 1O8LA 4XOTA 2Z8GA 1BPLA 2UVFA 2MABA 2F1MA 2V1NA 2PJRA 4XM3A 2DIEA 2GK7A 2XNDA 5HNHA 3L2QA 4PFOA 4NK8A 1PKVA 2LC2A 1O8MA 3FHNA 2K5CA 4XR6A 1V5FA 2CW8A 2R9VA 3H9JA 4E7ZA 2XZPA 1X1BA 1WJFA 1IA5A 4C9YA 3C2GA 3JURA 2ZTGA 2OV7A 1S9HA 3DDYA 1OB0A 2VKDA 1VF7A 1BHEA 2NT9A 4HEA2 3ZPPA 4BJ5C 5JHFA 2ZZEA 2VJ5A 4BDZA 1H8HA 4PMHA 4ZYAA 1O8EA 4F3QA 3SZGA 3EUAA 1D0ZA 4GRIA 4C30A 1UD4A 2BOLA 2R7UA 1QU3A 2R7SA 3EQNA 2WSSA 4XKWA 3A4CA 3CJRB 4E7SA 4MXNA 3WQZA 3OYFA 4D9JA 2E5ZA 3MKWB 1V5GA 3OYAA 2ZSIB 4B3GA 1KONA 2IXSA 3DPLC 4H4KC 3OS0A 4RMNA 3B8YA 1GQ8A 4OZZA 3BG6A 4QPQA 2BW3A 4XOPA 5HKKA 1TZLA 5DN6A 3GQ9A 2ZFUA 3GVLA 2UVEA 4G6IA 1WJEA 3K10A 1RU4A 4JQFA 4E7IA 4XLHA 1E3XA 3H94A 3PL8A 2PYGA 2JVHA 2JJ1A 3RCOA 4BEHA 3K4NA 3ZXSA 4ZDPA 2LBFB 4ZTFA 3KYLA 1MMGA 3RQ4A 4XD7A 1SFKA 4G7XA 3HL2A 3OS2A 2ELJA 3FKJA 3DPTA 1N75A 2HZDA 4XKBA 4AVZA 1OGMX 1R6RA 2GOMA 2LY2A 3LL7A 2Y0SA 4HSTA 4RM2A 3C2HA 4CA0A 2MYSA 4E7HA 1OFLA 2XAUA 3L2UA 2GK6A 2WB1A 1JRGA 4C2TA 4KKSA 3SEQA 4XKCA 5AMVA 1KZLA 2DT6A 3VSTA 4F92B 3LSIA 3D5RC 2MD0A 1N78A 3EUKL 2XF5A 3BLYA 3PJRA 3K4CA 1E3ZA 2LZJA 2KMUA 2M3AA 1DBOA 1OFMA 4IKFA 3BC8A 2DCEA 3HUGB 2LREA 3QYEA 4BUPA 3DPUA 2MFZA 4XQFA 1UD6A 1NG7A 2KP6A 1NG6A 3DEEA 4N4OB 2V9KA 4ANJA 2Z16A 1IB4A 2L5QA 2HNHA 2JIZA 4BU2A 1NHCA 2L9NA 3UR3C 4BE1A 2X51A 1LDKB 1BOBA 4BGDA 2WZPP 1I18A 1Y6IA 4HNTA 4YRVA 2CS3A 2CK3A 4LIVA 1QJVA 2KPMA 3H9GA 1LVKA 3U21A 1H8EA 2BSPA 3SEZA 1FMWA 2JA2A 1Z7LA 3W2WA 3A1YA 4E6KG 3AKZA 1VJSA 1O8JA 3T51B 3W2VA 2WAEA 4ZDLA 1UAAA 2XF6A 3BCFA 3S93A 2WY7Q 4EATA 4ZDOA 4OJPA 1YX3A 3VYSB 3TBIA 4E0FA 2VL8A 1AA7A 4LITA 4U7BA 3LMMA 3DLAA 1DQUA 3GQAA 2HDWA 4PJJA 4P1WA 3VYRB 3OL4A 4BACA 1ERDA 2R7WA 2JVGA 3RTRA 3T53B 2K9MA 4AU7A 1U0JA 2HLDA 1K5CA 2VQLA 4CCLA 4CZCA 4G7WA 3OOUA 2QXZA 2KRCA 4YXWA 3BCAA 4JOMA 2MC4A 4DNRB 2V4JC 2NOJB 2LRDA 4BQQA 1E1QA 2WJYA 2VB6A 2CV2A 3JU4A 3OYLA 2KHMA 4W8SA 3CESA 1W0JA 3ZRGA 4XN3A 1O8HA 3H35A 4HIZA 2X3HA 3A3GA 2WAQA 4IQJA 2V7FA 4CCMA 4C2UA 2ZSHB 4B3FX 4PJLA 1IDJA 2ZXIA 3PFYA 3PNVA 4HG2A 3OW7A 4BE0A 2LH9A 2X8KA 1K6YA 2PMZA 3DWLE 1NBMA 3ZPNA 3HOSA 1WFXA 2O5RA 2R7QA 2M7BA 2GJRA 2Z6BD 1Z21A 3LNNA 3VMVA 3CMMA 3HPHA 2W6IA 3CF2A 1V0FA 3QYFA 4YEJA 3IAM2 5FRNA 3BCBA 1VZ0A 3S3NA 4KKTA 4DNTB 5FRMA 2BVMA 5CPRB 1JI8A 4IQ4A 2UUZA 1Z3YA 1G59A 3UW0A 1OGOX 5LD2C 2XZLA 1Y56A 3PSIA 4XNFA 4B47A 4OJLA 5TGTA 3EUHC 1SAUA 3KEYA 4MLOA 3FBNB 2NTQA 3QYBA 4XLEA 3DKYA 2ZZGA 3K4BA 3EPZA 2V26A 3T9GA 3KX2A 2WA0A 3OYCA 3OE7A 5CQEA 4G6TB 5IK2A 3OL3A 3OR2C 2M0MA 3E0JB 5HLTA 4DK0A 4ASUA 3SYTA 3OIPA 2XDVA 4DGWB 3H0DA 3K6GA 3OYGA 2R7TA 5C1CA 3LSHA 2RQQA 2GJPA 4YZXA 3K70C 2I8DA 2DJIA 1BR4A 3DTEA 4DOZA 3AL0B 2VXZA 3LSKA 1DBGA 4U4BA 3H5AA 4XKVA 4BXFA 3L2VA 3LMWA 1WJAA 3I9V2 3MKYB 1E79A 1UD2A 1BN8A 2Q1ZB 3DU5A 3QOEA 2HQAA 3VMWA 1KCDA 3K4KA 1WJ5A 2P0WA 4PJMA 3UNGC 3BC9A 5CDFA 3K4MA 1P9QC 1BLIA 2JJ2A 2INUA 2VQCA 4Y3OA 4OAYA 3OYMA 2NSPA 4I84A 4UZUA 3VSUA 3DTKA 3KEWA 2O04A 4PJNA 3ZGKA 2CW7A 4IZZA 4F91B 3HXLA 4YZAA 2HU9A 1O88A 2HPIA 4OZYA 4XORA 2R7OA 1X19A 1JTAA 1T0FC 2LOOA 1MMAA 2E1MC 1D0XA 1N77A 2VBKA 4KITB 2LYCA 3VYTB 1FX0A 2Q2EB 2W4SA 4CCKA 2CMPA 3HOTA 1G8XA 2CV1A 1HA8A 1W0KA 2Z2SB 4F52A 2RNGA 4YZQA 3OYEA 3GBGA 2FUG2 1VBLA 2M4KA 3ZSCA 2F43A 2A6TA 3LSGA 1DGRM 2R4GA 1WJBA 2A5WA 3CP2A 2R7VA 2GOXB 3TL4X 3FBIB 2VJJA 4BQNA 3L2WA 1WJDA 1UD3A 1PJRA 4CCOA 1E1RA 3RPUD 2X53S 3A35A 3A3BA 1IDKA 4HRIA 2NZMA 1D0YA 1X1CA 1MMNA 2E1BA 4C2LA 1UD5A 1WP6A 3S3OA 2IGOA 2PYHA 3SDBA 2VQHA 1WPCA 3OWTA 2KQRA 3MKZA 2ZZFA 1Z3XA 2W82A 4KJZA 1O8FA 4XLCA 3GRHA 4BEHB 4DK1A 4XMYA 4R79A 2VJIA 4NC8A 3FKSA 1RWRA 3HPGA 3GVKA 3ZIAA 3LFUA 1IRXA 3OYIA 2DXIA 4Z05A 4OAZA 4KKUA 3GQ7A 2M4GA 1YX5A 4CCNA 2QKMB 1E43A 3G05A 4II2A 2ZZQA 3S3MA 3J7AY 4J01A 1X4OA 4DIQA 5KCMA 2M5SA 3VSVA 2IGMA 3HKZA 1I8DA 3IAS2 2IGKA 4CSWA 2E60A 3M8JA 1UELB 1LKXA 3OS1A 1HG8A 4IX7A 3K4LA 4Z06A 2W00A 2OC6A 2WADA 1X0CA 3ZQQA 2UV1A 1VLYA 2Z1DA 1BR1A 3QODA 3FDYA 2HVSA 1COWA 3OAAA 2KZVA 4JMQA 3ZR8X 3GQBA 2L7KA 4P5OA 4ZC3A 1MABA 2O0VA 3TMOA 2F4IA 1O8KA 3IP4B 3PNTA 2W7NA 3SUCA 4ITVA 2KRHA 1X1DA 2WAFA 4FETA 4F93B 2CUJA 2X6WA 2W1OA 2JUGA 2E5NA 2AQEA 4HSRA 4MR0A 4X0GA 2WPDA 3T56B 4NNJA 1NRKA 3E1SA 2QKLB 3W3CA 1PYVA 2CH0A 3NWSA 2DT7B 2ZXHA 1PXZA 1SKYB 1OOCA 2HVRA 1D1AA 2LY1A 3LSMA 2X6YA 3OMYA 2VPLA 2V6EA 1X4PA 3OIQA 3NWTA 4FASD 3OYBA 4W8RA 4KT6A 4PFPA 1W36C 1MW7A 1EA3A 1KCCA 2XC7A 2VXDA 2O0WA 2X6XA 2HPMA 4PUSA 2L9SA 2KL4A 4RLFA 2ZTNA 4XONA 3A2KA 4OWRB 3VSLA 4TKOB 3M1CA 3CP8A 3GVJA 1EE6A 3W2AA 3V42A 1WTHD 1MNEA 3VWBA 1RMGA 4B43A 3BG7A 3OYNA 4BE2A 1E0EA 3K4JA 2INVA 4BJ6C 2F5VA 2X1EA 3CJQB 3HC7A 1WMRA 2V31A 4EW9A 4Y33A 2JSPA 4PK4A 3OEEA 2L2OA 4QPOA 3OPOA 2KLOA 2VJ4A 3BCDA 4BS9A 2CFOA 3K70D 4P22A 2D3LA 3RSNA 2PJRB 1O8DA 3B90A 2XOKA 4YELA 2VASA 3VYUB 2KVOA 2O1DA 1DGWY 1OR7C 1PLUA 1V5EA 4ZJZA 2BW3B 3OYKA 4BDYA 4LIUA 4OJ6A 4AYBA 4E7LA 4D1QA 4CCJA 1X1AA 1J09A 1MMDA 3B4NA 1GLNA 2OUMA 3H9QA 4B48A 2NTBA 1BMFA 3CZ6A 5LFAA 2R7RA 3H5RA 4J00A 4TT3A 2IS2A 1HVXA 2NT6A 5KNLA 4W8QA 1D1CA 1HZEA 3DKXA 4URRA 2W6JA 2VKHA 1DP3A 4GQNA 3ZCOA 3FY3A 4RLQA 2IGNA 1CZFA 4ZTJA 1PE9A 1QHHD 3MMYB 2QX3A 3VDXA 3VR6A 2VBEA 2NTPA 3DU6A 2VLAA 3IUOA 2ODLA 4NC7A 1O8GA 4TSFA 3OEHA 1K28D 1ZELA 1TT0A 2NSTA 5CQGA 2CUZA 4XL9A 3OYHA 2WY8Q 4BL0B 2QE7A 3BH4A 3EQOA 4E7KA 1AIRA 3VSKA 2F6CA 2PECA 1W36D 4FXUA 4NQWB 4L8JA 3AL0C 1T5EA 2IS1A 1BR2A 3DQVC 4W8TA 2IS4A 2E1MB 4N4NB 5HOOA 2JDIA 2LBFA 2XGJA 1V0EA 4II3A 3ONQA 1OLTA 2K9LA 4PSXA 1LFPA 3MD2A 2V7QA 2IQ7A 3KRGA 4OJOA 2BVLA 4B44A 2IS6A 4B3XA 2KDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  4AVZ A;  4OJL A;  1OGM X;  1KTW A;  2X85 A;  2NTQ A;  2EWE A;  4XLA A;  4XLE A;  1OFL A;  2O0V A;  1O8K A;  3T9G A;  3SUC A;  1JRG A;  1O8I A;  2X6W A;  5AMV A;  3GQ8 A;  3VST A;  4MR0 A;  1QCX A;  1PXZ A;  5C1E A;  4HWV A;  1OOC A;  1DBO A;  5C1C A;  2X6Y A;  4XLF A;  1OFM A;  4W8R A;  1XG2 A;  4YZX A;  1KCC A;  2O0W A;  2X6X A;  4XQF A;  1DBG A;  4U4B A;  4XON A;  4XKV A;  3LMW A;  1H80 A;  4OJ5 A;  1IB4 A;  1EE6 A;  1BN8 A;  3VMW A;  1KCD A;  4NK6 A;  1NHC A;  1RMG A;  2INU A;  2NSP A;  2O17 A;  4YZ0 A;  4Z03 A;  2INV A;  4I84 A;  2QY1 A;  3VSU A;  4EW9 A;  1WMR A;  2O04 A;  1QJV A;  4XN0 A;  2BSP A;  2VBM A;  4YZA A;  4U49 A;  1O88 A;  4OZY A;  4XOR A;  1O8J A;  2Z8G A;  1JTA A;  4XOT A;  1O8L A;  1O8D A;  2UVF A;  3B90 A;  4YEL A;  2VBK A;  4XM3 A;  4OJP A;  2O1D A;  3EQN A;  3WWG A;  4YZQ A;  1PLU A;  4NK8 A;  4OJ6 A;  1O8M A;  1VBL A;  4XR6 A;  3ZSC A;  3GQA A;  2VJJ A;  3B4N A;  1IA5 A;  3JUR A;  2NTB A;  1K5C A;  1IDK A;  2NZM A;  1BHE A;  2NT9 A;  2QXZ A;  4C2L A;  2NT6 A;  2PYH A;  4W8Q A;  3ZPP A;  4URR A;  3GRH A;  4PMH A;  1O8F A;  3FY3 A;  1CZF A;  4XLC A;  1PE9 A;  1O8E A;  2QX3 A;  4XMY A;  2VBE A;  4W8S A;  2NTP A;  2VJI A;  4XN3 A;  1RWR A;  2ODL A;  1O8G A;  1O8H A;  2NST A;  4XKW A;  2X3H A;  4MXN A;  4XL9 A;  4Z05 A;  3GQ7 A;  1IDJ A;  3EQO A;  1AIR A;  2PEC A;  3B8Y A;  1GQ8 A;  4OZZ A;  3VSV A;  4XOP A;  4W8T A;  3GQ9 A;  2UVE A;  3VMV A;  1RU4 A;  4Z06 A;  4XLH A;  1HG8 A;  2PYG A;  4YEJ A;  1X0C A;  4OJO A;  3KRG A;  2IQ7 A;  3UW0 A;  1OGO X; 
#chains in the Genus database with same CATH topology
 4CUG A;  1G2H A;  4IPA A;  4IHW A;  3QU3 A;  1KTW A;  3GIR A;  1A35 A;  3N05 A;  2RN7 A;  4XLA A;  3IRR A;  3S8P A;  3H3V K;  2DDA A;  2XVC A;  4NQW A;  4BQO A;  3OYJ A;  1YJW I;  3ZPL A;  3ASR A;  4KDP A;  1VQM I;  1KU7 A;  2GJK A;  5C4J J;  3SQN A;  5HNF A;  1O8I A;  2KIU A;  4I0A A;  1TC3 C;  3Q3A A;  3I55 I;  1UD8 A;  1WDT A;  4UHT A;  1ZM9 A;  2V79 A;  2WWY A;  3RPQ A;  5KHD A;  2H27 A;  4J0Q A;  5F1J A;  1GUU A;  2EA2 A;  3QP6 A;  1YTY A;  2HVQ A;  4E4H A;  2MLG A;  1GT0 C;  2K3P A;  1QGZ A;  3PUF A;  4ESB A;  2DA6 A;  2NNY A;  3GTL J;  3DTI A;  3CB4 A;  5FKK A;  3G71 I;  2KJB A;  3P9C A;  3GLL A;  3HRM A;  1YJN I;  1BM9 A;  1D1B A;  1WI3 A;  1PUF B;  1N0V C;  1W9X A;  4XRM A;  3JTG A;  3CCS B;  4OJ5 A;  1MND A;  1MIJ A;  4HF0 A;  1MKM A;  1I39 A;  4IL6 C;  1YJ9 I;  2AS5 F;  5DTD A;  2OAZ A;  3MAJ A;  2WR8 A;  4IXA A;  1FMV A;  5KAI C;  4WXC A;  4FE7 A;  4XN0 A;  2G7U A;  3A0H C;  2WJV A;  3PET A;  5JVG F;  5D6F A;  1WJC A;  1JT0 A;  3CD6 I;  4CH7 A;  2DQR A;  3W5V A;  1O8L A;  1VQ4 I;  1BPL A;  2E1O A;  2O61 A;  2UVF A;  2V1N A;  4EJV A;  2PJR A;  1KQS B;  1LFB A;  3M7G A;  4PAA A;  3GSI A;  5E18 F;  2HR3 A;  2GK7 A;  3WOD F;  3O8H A;  1WGX A;  1T6Z A;  4WXD A;  2I5U A;  2LC2 A;  4R8H A;  3C18 A;  1LPQ A;  4LG0 B;  4XR6 A;  1J5Y A;  2ZL5 A;  2H6C A;  4RDU A;  3H9J A;  4E7Z A;  2XZP A;  5IP9 J;  1SVO A;  1D3Y A;  2GIZ A;  4UY8 I;  3JQP A;  1WJF A;  4M53 A;  2VNH A;  5DSZ A;  5IYB J;  5EEH A;  1S9H A;  2NRA C;  1VF7 A;  1BHE A;  3BH6 B;  4ON0 A;  3UKG A;  4BJ5 C;  4PJ0 C;  3JRG A;  2ZZE A;  5ICG A;  3ZBU A;  4KT5 C;  1H8H A;  1EP2 B;  4PMH A;  1QA1 A;  1IN8 A;  5E3L A;  5LEK A;  1K61 A;  5D5U B;  1VQM B;  2VC0 A;  1D0Z A;  3QFT A;  1YRN A;  2BOL A;  2R7U A;  1P4M A;  4O5V A;  1O57 A;  3LNQ A;  2DY1 A;  2OQR A;  1SFE A;  3CCU I;  3WND A;  5ILS A;  3CC4 B;  1WOP A;  4D9J A;  3FHZ A;  3W6V A;  3MKW B;  2LF8 A;  1EFU A;  4B4D A;  3CPW B;  1QX4 A;  3IH2 A;  4B3G A;  2YS9 A;  3OIO A;  3KET A;  1EA0 A;  4H4K C;  3Q39 A;  5EEG A;  3A03 A;  3BG6 A;  2FNP A;  5LRR A;  1AOY A;  4BHB A;  3IH3 A;  1TZL A;  1SFX A;  4QHY A;  2ZFU A;  4W97 A;  1K4S A;  2UVE A;  3LAJ A;  3K10 A;  1I27 A;  2EZH A;  2WC2 A;  4X6A J;  3CCS I;  3Q0V A;  3PL8 A;  4HDU A;  2JJ1 A;  3BY2 A;  4BEH A;  2EJR A;  1L0O C;  1KYZ A;  4ZTF A;  1MMG A;  5AON A;  3RQ4 A;  1VQK I;  2HQR A;  4CHU A;  2HZT A;  3HL2 A;  1K8A D;  3OS2 A;  4AF7 A;  5K7H A;  5BOX A;  3FXJ A;  4AVZ A;  1HF0 A;  1FBU A;  4P3Y A;  4FE4 A;  3E5Q A;  4YAU A;  3TGN A;  2GOM A;  3BR1 A;  5IOY A;  2OBT A;  2HDN B;  4CA0 A;  1WI9 A;  2E1R A;  2XAU A;  4E70 A;  3OP1 A;  4OOI A;  1JRG A;  4YG2 F;  5FO5 A;  4RD4 A;  1E64 A;  3SZE A;  1EXM A;  2ZL6 A;  2VYQ A;  4LBV A;  1ETV A;  2LK2 A;  2MD0 A;  2XGE A;  3D5R C;  3JRA A;  3ABU A;  3EUK L;  1DAR A;  3PJR A;  1R4N B;  3K4C A;  2YX4 A;  3H3U A;  4WZL A;  4IKF A;  5FO1 A;  4ZCI A;  4MFE A;  5M5Y J;  3BC8 A;  3ES9 A;  5CVJ A;  4BUP A;  3QYE A;  1K6O A;  1JUM A;  3ZQL A;  1LEB A;  2NS8 A;  4AC0 A;  3MWM A;  3ABT A;  3I0T A;  1RR8 C;  2JPC A;  2BN4 A;  2NS7 A;  1O3T A;  4F7D A;  4Z4U A;  5DD4 A;  1ZM4 A;  1YI2 I;  3RY8 A;  1RET A;  5CJ9 A;  4BU2 A;  3CW2 A;  1NHC A;  3I53 A;  1ZR4 A;  1LDK B;  2OZ6 A;  4WZE A;  1Y6I A;  4IHY A;  1BI2 A;  1XSV A;  1E62 A;  5ED4 A;  2VBU A;  3U21 A;  1R1T A;  5J47 A;  1VQO B;  2Y31 A;  3W2H A;  1QG0 A;  4RGU A;  3W2W A;  2QBY A;  1VJS A;  2OD5 A;  2VFP A;  1UAA A;  1IXS B;  3BY1 A;  3KYC B;  1ACI A;  2JT1 A;  1QVG B;  2Q2E A;  1YX3 A;  3WHB A;  1POG A;  4YCQ A;  3DLL F;  4XLN F;  3ASO H;  3WU1 B;  4E0F A;  1G3W A;  2NVQ J;  1UHW A;  4LIT A;  1KYW A;  1HW1 A;  4U7B A;  3LMM A;  2DOD A;  2OQG A;  5LLQ A;  1DQU A;  3AAF A;  2HDW A;  4PJJ A;  4M3B A;  3OL4 A;  2E34 A;  4BAC A;  1ERD A;  3FXM A;  1VQK B;  3I59 A;  3T53 B;  2K9M A;  4X1E A;  3OOU A;  1RI7 A;  1IJW C;  1BJZ A;  3DXJ F;  4JOM A;  2XAS A;  4AD9 A;  2OYN A;  4FN5 A;  2MC4 A;  4ACB A;  4O3M A;  2NOJ B;  2LRD A;  1N06 A;  3JU4 A;  3SZP A;  3OYL A;  3F3X A;  1HQC A;  1OGI A;  4W8S A;  2EB7 A;  3CUQ B;  3ZRG A;  2VBS A;  2X0K A;  1ZK8 A;  4FIS A;  2Y9Y A;  1HOM A;  2AHO A;  3ZMZ A;  3T0Y A;  3H35 A;  2JZY A;  2ESH A;  3CDI A;  2X3H A;  4LJZ F;  1KGS A;  4IQJ A;  4CCM A;  1OCR H;  1IDJ A;  4D5F A;  2VNJ A;  3PFY A;  2IAI A;  1ON1 A;  4F7Z A;  4KH3 A;  2W85 A;  4BYY A;  1R23 A;  2PE3 A;  1W1W E;  2ZXJ A;  3ZPN A;  1R1V A;  3G6E B;  3QPT A;  3A02 A;  2DI3 A;  3CME I;  2O5R A;  1VQ5 B;  2M7B A;  2NYX A;  2Z6B D;  4QV2 A;  4M72 A;  1JE8 A;  2NS0 A;  3HPH A;  3O6B B;  2W6I A;  3CF2 A;  3QYF A;  5CVV A;  3IAM 2;  2UXX A;  3I55 B;  2CO5 A;  4YIF A;  3BCB A;  3WU0 A;  4KKT A;  1P2F A;  1IDZ A;  3U6K A;  2X4H A;  2XTX A;  1I6X A;  1UST A;  5M3M J;  3UW0 A;  5LGT A;  2V1D A;  2V9V A;  3GFI A;  1D5V A;  1NDH A;  1VTN C;  3V7R A;  1SAU A;  3FBN B;  3I1F A;  1FLI A;  3HTU A;  1CF7 A;  3F0C A;  5BPD A;  1O3R A;  1GV2 A;  3WTU C;  2DK5 A;  2A3S A;  2DAO A;  3K4B A;  1G7C A;  1XQB A;  1YHQ B;  1TWH J;  1P7I A;  2HEO A;  3CCJ I;  4UUS A;  5CQE A;  3D26 A;  1FC3 A;  2OTL B;  2M2E A;  5GPC A;  3VO2 A;  1U8R A;  5GAE J;  3OIP A;  2GBY A;  2XDV A;  4YFK F;  4GYG A;  5CVI A;  3ZOB A;  1LVA A;  4D5C A;  4KYW A;  1KTV A;  1SD5 A;  1VQ8 B;  1OCO H;  1BW5 A;  4EJW A;  4MEX F;  2FRH A;  2QCO A;  4YZX A;  1VHO A;  2DJI A;  1RQR A;  3WE2 A;  4DOZ A;  4MTD A;  2L4A A;  2VXZ A;  1DBG A;  3HJE A;  3H5A A;  1E3O C;  1GDT A;  4GFB A;  2QGG A;  2XNC A;  1P4X A;  1WOS A;  3MKY B;  3LJY A;  1BN8 A;  2HOA A;  2Q1Z B;  3DU5 A;  3PSZ A;  5HS7 A;  1BW6 A;  4D7M A;  1WJ5 A;  4MEY F;  5CDF A;  4QLC U;  4IOA F;  3K4M A;  2INU A;  1AU7 A;  5FKO A;  3GXO A;  2VQC A;  3V8J A;  1ZM2 A;  3OYM A;  4I84 A;  4I01 A;  1RQP A;  3ESW B;  3DTK A;  3N4M A;  2O04 A;  4PJN A;  1JJ2 B;  1UB9 A;  4JYK A;  3RIR A;  1FP2 A;  4F91 B;  2NPF A;  1UCR A;  3ZMV A;  1QA3 A;  2HPI A;  2KRF A;  1TBX A;  3BP8 A;  1KD1 D;  1T0F C;  2LOO A;  3SJM A;  3G6E I;  2V7V A;  5EYR A;  1T8I A;  1N77 A;  2F48 A;  4KIT B;  2VNK A;  1FTZ A;  2IPQ X;  3GVA A;  2QUF A;  4C3H J;  1F4K A;  2Q2E B;  2W4S A;  4CCK A;  2CV1 A;  1FX0 A;  3J7Y J;  3FXL A;  4YZQ A;  1ETQ A;  2E2J J;  1R22 A;  2FUG 2;  2KIS A;  2M4K A;  3ZSC A;  3AVW A;  1R5N A;  4DQL A;  2RVC A;  4A2U A;  3WTY C;  3TL4 X;  1T6X A;  5IT9 K;  3L2W A;  1DU6 A;  3HSF A;  1W34 A;  2QMU A;  1YLF A;  1S72 B;  1JB9 A;  2X53 S;  3R0J A;  3A35 A;  1YIJ B;  4L9N A;  1IDK A;  5D5W B;  3IKV A;  1X1C A;  1MMN A;  2A6E F;  4M3G A;  3GTJ J;  4LOC A;  1WP6 A;  1ON2 A;  3SDB A;  1JKR C;  1BI1 A;  4RM0 A;  1LQ1 A;  5AIQ A;  3HBL A;  3MKZ A;  1Z9C A;  1RKW A;  1Z3X A;  5DCF A;  4HDV A;  4XLC A;  5FFX A;  3ONU A;  1O8F A;  3ERM A;  3LA3 A;  4XMY A;  2XAJ A;  5F27 A;  3S1Q J;  3CCJ B;  2BV3 A;  5F4J A;  5KAF C;  3TO7 A;  3A0B C;  4L0Y B;  3GVK A;  4OPS A;  5KSW B;  3CCQ B;  5A2Q Z;  4KKU A;  2IJL A;  3I54 A;  4ABZ A;  4CCN A;  2QKM B;  3SHF A;  3JAM Z;  2XRO A;  4XRS A;  1IG7 A;  5GP9 A;  5HLG A;  4J01 A;  1R5H A;  3KZZ A;  4DIQ A;  3GFL A;  3PVD A;  5KCM A;  4RD0 A;  2WAQ N;  1ZG1 A;  5FNZ A;  3Q6Q A;  4IO9 F;  1J7K A;  4RGR A;  2DOF A;  1REP C;  2Y75 A;  2HCJ B;  1LKX A;  2XAH A;  1B59 A;  2VKV A;  2ADU A;  2YPR A;  1DUX C;  1IV6 A;  1EF4 A;  4OPW A;  5JR3 A;  1BR1 A;  2M8E A;  3H3Z A;  3SQV A;  4RD1 A;  3OAA A;  1J2X A;  1XDS A;  3PA1 A;  4JMQ A;  2QZA A;  4L9V A;  3ZR8 X;  3GQB A;  3RDI A;  3HOW J;  4LGW A;  2K4B A;  5M3F J;  2DA7 A;  3FXQ A;  1OKR A;  3TMO A;  2O0V A;  2KFD A;  1O8K A;  1GVD A;  2ZBK A;  3M8E A;  3MVP A;  3PNT A;  2W7N A;  5JFR A;  4Z4T A;  2DYR H;  4ITV A;  1X1D A;  2V7U A;  2J5O A;  2DDB A;  4RDL A;  1S5L C;  2W1O A;  2LSO A;  4A3D J;  3L2C A;  4MR0 A;  3T56 B;  3U2Q A;  1TLH B;  3W3C A;  1R49 A;  1PYV A;  2CH0 A;  2BYV E;  2OU2 A;  2ZXH A;  1JGS A;  4L0Z B;  2V7T A;  2K86 A;  4R71 A;  1PXZ A;  4G7O F;  1UHM A;  5E1Z B;  2HVR A;  4ROX A;  2X6Y A;  2XTW A;  3OIQ A;  2Y30 A;  1F1Z A;  1LE8 A;  3OYB A;  2OF7 A;  4KT6 A;  5ICF A;  1BL0 A;  1KCC A;  1RNL A;  1UG2 A;  2FQ4 A;  2VXD A;  2XC7 A;  4BQA A;  2HPM A;  3ZBT A;  2XT4 A;  4HF1 A;  2EIJ H;  1R7J A;  3EDP A;  1W7P A;  5L3F A;  3GVJ A;  4P6Y A;  3Q9S A;  4ZV4 A;  4RCY A;  1VQL B;  3E6M A;  3AG2 H;  4Q47 A;  2IRF G;  1TWF J;  1PJ6 A;  3OYN A;  1E0E A;  2CJJ A;  1FYL A;  5THX A;  2F5V A;  2X1E A;  4BY7 J;  1IN4 A;  3BR6 A;  2GLO A;  4OOV A;  1S4M A;  1A36 A;  2YWH A;  4IOC F;  1ZLK A;  4GDF A;  4UNO A;  4S0H B;  2L2O A;  2QDX A;  1WKM A;  3CCM B;  2CFO A;  1FBS A;  2EZK A;  3B90 A;  2XOK A;  4BAY A;  1XMK A;  3MZY A;  3VYU B;  3AVT A;  3IWZ A;  1OR7 C;  3M9A A;  3RJP A;  5HXB A;  1MBK A;  2P3M A;  1PLU A;  4DNC A;  4AYB A;  3WYA A;  4OJ6 A;  3AGP A;  4TMT A;  3C2B A;  5IP6 A;  5DS0 A;  3BTL A;  2OUM A;  1TW3 A;  4MQ9 F;  3J81 K;  1XN7 A;  1QFJ A;  5LFA A;  2GXG A;  3BR5 A;  2MA3 A;  4J00 A;  2F3L A;  4WQM A;  2LVS A;  5B1B H;  1HZE A;  3DKX A;  2K27 A;  4MO7 A;  1P7J A;  3JTH A;  2HDC A;  5K1Y A;  4RLQ A;  2IGN A;  1MMS A;  3CME B;  3FWE A;  2QTL A;  1CZF A;  3FY3 A;  3R0A A;  2QX3 A;  1ETX A;  1MD0 A;  1FSE A;  2JN6 A;  3DU6 A;  2LKP A;  3RYR A;  1W5C C;  1T39 A;  1P92 A;  4EVI A;  1ZEL A;  4RAF A;  1Y1W J;  2NST A;  1SFU A;  3F6V A;  3OYH A;  2FOW A;  5J1R A;  4XIC A;  4MNU A;  2QE7 A;  2XPV A;  3BH4 A;  1OIS A;  3EQO A;  3Q6R A;  2J8I A;  1AIR A;  5HS9 A;  4MGR A;  4U0V A;  3JQR A;  2FEZ A;  4NQW B;  2NV4 A;  3BH7 B;  4L8J A;  1WXR A;  5JBQ A;  2BE5 F;  5DNS A;  1SMT A;  4W8T A;  4QIW N;  2DCU A;  3E1Y E;  1ZRC A;  1FSH A;  5EJC A;  3JR9 A;  2XGJ A;  5F0H A;  1DPU A;  1V0E A;  3ONQ A;  3KRG A;  2AXL A;  3GUD A;  2EFQ A;  1PJ7 A;  2HQ5 A;  3KLO A;  5HVQ C;  2DOA A;  4EQQ A;  1K78 B;  3O3K A;  1OHH A;  3L00 A;  2XAF A;  3M3Y J;  2IW5 A;  2VT2 A;  2X85 A;  2EWE A;  1SD6 A;  3BY6 A;  3MMP A;  1UG0 A;  2LG4 A;  4NC6 A;  4F55 A;  2DMQ A;  1YE9 A;  1TTY A;  3HAG A;  2VUM J;  4NB5 A;  2V1U A;  3D0S A;  4RM3 A;  2HQN A;  2EH3 A;  2V7X A;  1QHG A;  5CKT A;  4UZF A;  2LKX A;  2QA4 B;  3N90 A;  4RGX A;  3LVB A;  2ZB9 A;  1Q1H A;  3FF5 A;  4U87 A;  1JA1 A;  3WBJ A;  2XF7 A;  1DP7 P;  1FX7 A;  2M30 A;  1YQA A;  1EZG A;  2WTE A;  1LE8 B;  2B7C A;  5LGN A;  1MZB A;  2CYY A;  3CTA A;  3KYD B;  2QEN A;  2D3N A;  4P96 A;  3BQZ A;  3PNY A;  2PLY A;  2DMU A;  1MBF A;  2AQF A;  1QRB A;  3QOP A;  3ZQH A;  4FTH A;  4X7C A;  4NK6 A;  1XCV A;  1JXS A;  2EIL H;  3HKZ N;  4P9U A;  1YW9 A;  1T95 A;  3L2R A;  2X6O A;  2A5Y B;  2O17 A;  2N8G A;  1HLV A;  2NVU B;  2QVO A;  1ZH5 A;  3GFJ A;  4L9T A;  2R7D A;  2LFB A;  4IJA A;  2QTZ A;  2WBM A;  3I3L A;  1EKE A;  1RUN A;  1R5G A;  3QQA A;  1SAN A;  2MAB A;  2FBH A;  2MGQ A;  2YWE A;  1F5T A;  3GZ6 A;  4XM3 A;  3KFW X;  1J75 A;  3E5U A;  4UUV A;  5HNH A;  1N25 A;  3L2Q A;  5J35 A;  2LP0 A;  4NK8 A;  1PKV A;  3GWZ A;  2E7X A;  1O8M A;  1MH3 A;  2YWF A;  2R9V A;  3IV5 A;  2BZT A;  1X1B A;  4P26 A;  3QPS A;  5C4X J;  1Q7Y D;  1APL C;  2AHQ A;  2X48 A;  3MZH A;  3GTK J;  1T6S A;  2ZTG A;  1OFD A;  4BKX A;  3H09 A;  2XKP A;  2VKD A;  2HOE A;  3ZPP A;  5ILV A;  2QLZ A;  3SDG A;  4YEI A;  1GJR A;  1U5T B;  4Z4S A;  4XBF A;  2EFO A;  4BDZ A;  2DTR A;  3ISP A;  4OP7 A;  1FNC A;  4JRA C;  3EUA A;  3F8M A;  3FXR A;  3TQN A;  2XGX A;  2XAG A;  1W35 A;  2QEX B;  1KQ9 A;  2KIF A;  1OCC H;  2KT0 A;  2R7S A;  1N8R D;  2WSS A;  5BMZ A;  3A4C A;  3CJR B;  5E8I A;  4E7S A;  1RUO A;  2O8K A;  4IHT A;  2CQQ A;  2E2H J;  3OYF A;  4ESJ A;  3WQZ A;  1R1U A;  3KP4 A;  4PGH A;  1IJF A;  3ASP A;  3J81 k;  4HA8 A;  2P5L C;  4RDK A;  3DPL C;  5BSY A;  3ZQ7 A;  1GQ8 A;  3C7J A;  3LO8 A;  5HKK A;  3GQ9 A;  1TT5 B;  3ECH A;  4EJU A;  4OOX A;  4G6I A;  2C4T A;  4OM9 A;  1E3X A;  4TMV A;  3H94 A;  3G1O A;  2ZKZ A;  1OYI A;  2JVH A;  1HKS A;  4EM1 A;  3HM5 A;  4BNC A;  1D1N A;  2PYG A;  1G7S A;  3K4N A;  3ZXS A;  3G73 A;  3B82 A;  2DK8 A;  3OKX A;  2KDZ A;  1HBX G;  2F4N A;  3X2Q H;  2ELJ A;  3EET A;  5D6E A;  5LHH A;  3DPT A;  1G3T A;  1SM4 A;  1GXQ A;  3SXY A;  2DEU A;  1OGM X;  2YSR A;  4A6E A;  1R6R A;  3FM3 A;  4I98 B;  4CYD A;  2XUB A;  4C0S A;  3LL7 A;  4HST A;  4RM2 A;  4E7H A;  3C2H A;  2BGJ A;  3CCR B;  3V8K A;  2GK6 A;  4NHJ A;  3SEQ A;  3L9F A;  2BV6 A;  3VMF A;  2L9R A;  3E5X A;  1KZL A;  1G6N A;  2COM A;  1SVL A;  2DT5 A;  2GA2 A;  2A05 A;  1N78 A;  1AKH B;  3BLY A;  3QSY A;  3GZ5 A;  4IHX A;  2FA5 A;  3WGH A;  1OFM A;  1WCM J;  1WU8 A;  1NH3 A;  3WY9 A;  3RZO J;  3GW2 A;  4FQG A;  4N4O B;  4ANJ A;  2V9K A;  2ZIT A;  5HS8 A;  2DFE A;  1I6H J;  2L5Q A;  3VB2 A;  3BWG A;  2Z99 A;  5LGU A;  3LST A;  3AGQ A;  1YFH A;  1I7P A;  2L9N A;  3UR3 C;  3ZN1 A;  3LQQ A;  2L4M A;  4BE1 A;  2C5H A;  4LBW A;  3M1E A;  2ZC2 A;  4BGD A;  2PMZ N;  1I18 A;  4WX9 A;  4YRV A;  3ISX A;  1X2N A;  1IO2 A;  3HHH A;  1VQO I;  1QJV A;  2KPM A;  3H9G A;  5ICE A;  2PMH A;  2XB0 X;  4N3G A;  3WG9 A;  2BSP A;  1FMW A;  3A1Y A;  4E6K G;  1OR7 A;  3AKZ A;  3T51 B;  1SD4 A;  2WAE A;  4ZDL A;  1IAW A;  3HOZ J;  3S93 A;  3BCF A;  4A3J J;  3A01 A;  4OJP A;  1WH7 A;  3M4O J;  4QSH A;  1NTC A;  4U0W A;  3TBI A;  2VL8 A;  3FK7 A;  5FD6 A;  1AA7 A;  4FK8 A;  1QUE A;  4AC9 A;  1QZE A;  2LKS A;  2CQN A;  2E19 A;  2FF4 A;  3DLA A;  3HOV J;  4IHV A;  3E20 A;  2K9N A;  5F6F A;  2DA1 A;  2I10 A;  5J4Y A;  2R7W A;  3RKX A;  5K5Q A;  3OJW A;  4AU7 A;  1U0J A;  3WTV C;  4EJT A;  4FX0 A;  4G7W A;  1MBJ A;  5J6X A;  2L3D A;  4ZZL A;  9ANT A;  2DYI A;  2V4J C;  4BQQ A;  3R6K A;  4HLY A;  2VB6 A;  5JLV C;  3OOP A;  5IYR A;  2KHM A;  5CVU A;  4XN3 A;  4M2L A;  2XTY A;  2IA2 A;  2F5C A;  4LLN A;  2CUF A;  3A3G A;  2XGC A;  3HUG A;  3H36 A;  2ZSH B;  2ZXI A;  3I4M J;  3ABL H;  2EV5 A;  3LWF A;  2BPO A;  2LH9 A;  1K6Y A;  2DLL A;  1D5Y A;  1NBM A;  4OIO F;  3HOS A;  3AG1 H;  3F22 A;  1WFX A;  1QZZ A;  2DPD A;  4X0C A;  1QZY A;  1X1P A;  5FLV A;  3BRO A;  4EEF G;  3VMV A;  3NRV A;  1RES A;  3CMM A;  1KC8 D;  1V0F A;  2HYF A;  4RAZ A;  4YEJ A;  5FRN A;  1K9M D;  1OPC A;  1NB0 A;  3MFK A;  3BZK A;  5CPR B;  3A1P A;  4IQ4 A;  1QGP A;  5IY5 H;  2MLK A;  1OGO X;  2ISY A;  4CDG A;  4XNF A;  4B47 A;  3L7W A;  2OK8 A;  1U2W A;  5TGT A;  3SZT A;  3SLD A;  4MLO A;  2RAE A;  1ETY A;  3J7A O;  2ZZG A;  2AO9 A;  2QYO A;  3EPZ A;  4KFC A;  2V26 A;  4G12 A;  3T9G A;  1X2M A;  3HGY A;  5L3B A;  5LMZ A;  1W87 A;  3V7A A;  1B1B A;  4G6T B;  1N07 A;  5LHG A;  1XGO A;  4HV6 A;  1ZGJ A;  1ZYR F;  5HLT A;  3K2Z A;  4ASU A;  5J8F A;  1S7A A;  4Q4Z F;  1O4X A;  3U2R A;  2CWE A;  4ETS A;  1E3P A;  3K6G A;  2R7T A;  3FMR A;  4W1U A;  1HDP A;  4KN7 X;  3LSH A;  2A68 F;  2RQQ A;  2HTS A;  3TOB A;  2B0R A;  3ONY A;  3CC7 I;  3DTE A;  1ZAO A;  3LSP A;  1O3Q A;  4XKV A;  2E35 A;  4PC6 A;  1WJA A;  5JLX A;  1UD2 A;  3CCL I;  2ZL7 A;  1KQ5 A;  1KCD A;  2FX0 A;  2HQA A;  3K4K A;  2MG4 A;  3BC9 A;  2C5B A;  3UNG C;  5A2Q K;  3BZ6 A;  4Y3O A;  2NSP A;  1ZRD A;  2BMW A;  3JQQ A;  4HQE A;  4AWX B;  3U1K A;  1TQP A;  2JA6 J;  2PBI A;  3CF5 F;  4IZZ A;  5D5V B;  1Z77 A;  2UXN A;  1KQ0 A;  1XSX A;  5L3E A;  1U3E M;  3OZU A;  4LC0 A;  3LMW A;  4OZY A;  1X19 A;  1JTA A;  4FT8 A;  1FOX A;  3BTI A;  4BHC A;  1GR1 A;  5TY0 A;  4YFX F;  3S1M J;  2LYC A;  3VYT B;  3EQN A;  3HOT A;  2CMP A;  3WWG A;  4HQM A;  5F04 A;  3ZQI A;  1QA2 A;  2RNG A;  1PP8 F;  3GBG A;  1RPW A;  2NXN B;  2NOG A;  1E2X A;  1TNS A;  2M9H A;  3LSG A;  2C77 A;  4ZGN B;  1DGR M;  4C3J J;  1W2B B;  2WZN A;  2GOX B;  2H8W A;  4BQN A;  1WJD A;  1EV7 A;  3A3B A;  1QFY A;  1D0Y A;  3GO5 A;  2E1B A;  4C2L A;  4UB8 C;  5KVR A;  4LFU A;  2IGO A;  3QU6 A;  3QWL A;  4P9F A;  2VQH A;  3S3O A;  2B7B A;  3OWT A;  2EV6 A;  3FXU A;  2KQR A;  1K8F A;  3SYJ A;  4KJZ A;  4ASN A;  3KPH A;  1TWG J;  4I6Z A;  2OTJ I;  3LA7 A;  4BEH B;  4EGZ A;  2HTJ A;  4M3D A;  2F5F A;  3WE3 A;  5HZB A;  3TW7 A;  1W7P B;  3FKS A;  1RWR A;  1TTT A;  2E36 A;  2YR2 A;  1IRX A;  5FKM A;  1KK0 A;  1XMA A;  3OYI A;  3BNW A;  1JUS A;  4ZCM A;  4P6V F;  1UZC A;  1VQN B;  3AG3 H;  1MJB A;  3CJN A;  2ZZQ A;  3JX8 A;  5A89 A;  3S3M A;  3QE2 A;  3J7A Y;  4I02 A;  1H85 A;  4A3C J;  2JQ7 A;  3W2G A;  1ONV A;  2DN0 A;  1IN5 A;  3H1C A;  3KEO A;  2VFN A;  1XG1 A;  2ME0 A;  2E60 A;  4Z06 A;  1G3Y A;  2WAD A;  3ZQQ A;  1EP3 B;  2C6Y A;  2BXY A;  2VOP A;  1VLY A;  2Z1D A;  5HOD A;  3PO3 J;  4G9Y A;  2HVS A;  2BM6 A;  4YIR X;  2ID3 A;  4DYQ A;  1ORK A;  2KZV A;  1Y8Q B;  2L7K A;  5B6I A;  2PMU A;  4NCN A;  2Y48 A;  5GAG J;  1ZR2 A;  4UAJ A;  4CIC A;  1AKH A;  3KZY A;  4AIH A;  2E2I J;  1K79 A;  4F93 B;  4FET A;  3G4S I;  1JKQ C;  2X6W A;  1TW2 A;  2JK3 A;  1L1I A;  2E5N A;  1AHD P;  2AQE A;  4HSR A;  3JCU C;  5F0C A;  2JMW A;  3E1S A;  2FD5 A;  3NWS A;  3GTO J;  2DT7 B;  3FIW A;  2KIQ A;  3GME A;  4HLX A;  4U9U A;  3O2P E;  2QGU A;  3LSM A;  3OMY A;  1TVC A;  4K2E A;  2VPL A;  1X4P A;  4FAS D;  2STT A;  2X9D A;  2GXA A;  4W8R A;  1XFO A;  1W36 C;  2VE8 A;  4S04 A;  3DEW A;  1EA3 A;  3VFZ A;  3C3W A;  4G6Q A;  1VFC A;  4RLF A;  3TKY A;  4XON A;  2P5V A;  1B9M A;  3PEN A;  5E1X A;  1HST A;  3P7N A;  3LQE A;  3VSL A;  1GAW A;  4TKO B;  1SVM A;  3HYI A;  3FJO A;  1XC5 A;  1SKQ A;  4RD3 A;  3C1D A;  1U6G A;  2QQA A;  1N08 A;  1WTH D;  3RPU A;  3HHG A;  1MNE A;  5LRS A;  5E1W A;  2CW0 F;  3VWB A;  5KW9 A;  1RMG A;  3FMS A;  3HOU J;  5FLX Z;  4GYI A;  5DDG A;  4EW9 A;  3CJQ B;  3EYI A;  2DMT A;  2NVT J;  1WMR A;  3TO9 A;  5GV7 A;  2ZXW H;  2PX9 A;  2LTP A;  3G3Z A;  3WHC A;  3JRH A;  3IC7 A;  2L54 A;  1S0U A;  1W7P D;  2RKH A;  2KLO A;  2VJ4 A;  3BCD A;  3B6C A;  3BOQ A;  1T08 B;  2D3L A;  1O8D A;  3FK6 A;  2LLK A;  3ZUG A;  5EDN A;  4I09 A;  1DU0 A;  2KVO A;  3BQY A;  4QWQ A;  1S3J A;  3I59 B;  3RKW A;  1MDM A;  1QH0 A;  1G4D A;  4D1Q A;  4CCJ A;  1I1G A;  1IB0 A;  5F64 A;  3VOE A;  2ZME C;  3WNC A;  3U6B A;  1ZG3 A;  2G7H A;  4B48 A;  1W4M A;  2FSW A;  2RC6 A;  4HF2 A;  2IBD A;  4WK8 F;  3CC2 B;  2R7R A;  1QPM A;  5EZH A;  1MJA A;  1OYY A;  4TT3 A;  2NT6 A;  1J9I A;  5KNL A;  1HSJ A;  4ENM A;  1V5V A;  2VKH A;  1DP3 A;  4GQN A;  1QVU A;  1STZ A;  3FMQ A;  3JRB A;  5B5E C;  5IYC J;  5B1A H;  1E17 A;  1Q82 D;  3VDX A;  3S2D J;  2F1L A;  3LQ6 A;  3IUO A;  2P4W A;  1O8G A;  2BM4 A;  1MJ9 A;  3ZZT A;  1SMY F;  3P5J A;  3OEH A;  1TT0 A;  5DCM B;  4XL9 A;  4BL0 B;  2EQR A;  3WTT C;  4EMS A;  1ZKG A;  4A0Y A;  2QSF X;  2YWG A;  3RKQ A;  2Q8K A;  5L3D A;  1W36 D;  3AL0 C;  5E17 F;  4P2N A;  2IS1 A;  1ZGA A;  1HCR A;  5TIS C;  1LLZ A;  2V5I A;  3DQV C;  1XDU A;  1DAB A;  5L3G A;  2GXB A;  2IS4 A;  1VQ6 B;  4PC3 A;  4BBR J;  1KK2 A;  4MHG A;  2HFH A;  2ZFW A;  2LBF A;  2JDI A;  4II3 A;  4PSX A;  1OLT A;  2K9L A;  2M87 A;  1LFP A;  2B0L A;  3MD2 A;  3QAH A;  5GAD J;  1CF7 B;  2V7Q A;  2XNJ A;  3CMA B;  2BHZ A;  4A3K J;  2QZ8 A;  3Q0W A;  2KDO A;  4HX8 A;  2XIG A;  2FU4 A;  4OOS A;  2E7W A;  3HRU A;  2CV0 A;  5GAH J;  3A8J A;  4HE5 A;  1ZRF A;  4QFM A;  2R5Z A;  1BI0 A;  3OR1 C;  4RD6 A;  2BY0 A;  2X1D A;  3PQK A;  1V54 H;  5J8C A;  1XB2 A;  3WXM A;  2VFO A;  2V4D A;  4WWV A;  3PSS A;  4M73 A;  5FFZ A;  3OY9 A;  3AFH A;  2ZNY A;  4PCQ A;  1HW2 A;  5K7Z A;  3OYD A;  4Y52 J;  4AID A;  4NUB A;  2XAQ A;  2UWM A;  5FA6 A;  3AK5 A;  1HA3 A;  2WB1 N;  1UMK A;  2MD5 A;  4G1B A;  1MGT A;  4BJT A;  1LB2 A;  3G2B A;  4HBL A;  2PLF A;  4XLF A;  4B09 A;  1JTX A;  1K73 D;  4Z1M A;  2R3S A;  1EFR A;  1P4W A;  4OPO A;  4P3I A;  5FRO A;  3G71 B;  3E6D A;  4PSW A;  4EJO A;  4HNU A;  1IN7 A;  2K3F A;  1X3Z B;  4HPQ A;  4WXH A;  3JRD A;  1FYK A;  1AWC A;  1H80 A;  1WHU A;  2H6B A;  2Y69 H;  1R36 A;  1T56 A;  2H8R A;  4Y9R A;  2JRT A;  2WV1 A;  3NB2 A;  2MH9 A;  3EYY A;  4A3I J;  3OOC A;  4TMX A;  3MKL A;  5JMC B;  2OBP A;  3LAP A;  1TYX A;  3J81 Z;  1IXR C;  3SFI A;  5E6T A;  3D5L A;  5AN9 A;  2QQ8 A;  2R7F A;  3E6B A;  1WVR A;  4G8X A;  4XK4 A;  2P6S A;  3PUB A;  5J3L A;  5DM7 F;  1B8I A;  4DQK A;  2XZO A;  3AVU A;  2ZME A;  4M71 A;  1S72 I;  1B72 A;  2VBM A;  4U49 A;  1F20 A;  1KMH A;  1XGN A;  4Y4R A;  2Z8G A;  1XMX A;  4XOT A;  4Y17 A;  5LHI A;  1MSE C;  2O03 A;  3B73 A;  5CYV A;  3HB9 A;  3GTG J;  1XD7 A;  2F1M A;  3K0L A;  5IT3 A;  2DIE A;  4KMU X;  5C3E J;  2XND A;  3KZI C;  1EWY A;  4LK0 F;  4FHT A;  2OTJ B;  1B4A A;  3TOA A;  2XRL A;  1V5F A;  4QVJ A;  1DDN A;  4UZE A;  5DM6 F;  3ML6 A;  1HDD C;  3TW6 A;  4IHS A;  2DQL A;  4G5G A;  1AIP A;  3CDL A;  1IA5 A;  1EH8 A;  4RS8 A;  4BBS J;  4UVA A;  2IEK A;  3E6C C;  1WOO A;  3JUR A;  1FJL A;  1PUE E;  1VQN I;  1F60 A;  2BBY A;  1VQ8 I;  3MZ8 A;  4M3E A;  2NT9 A;  4HEA 2;  1CGP A;  1FOK A;  5A8A A;  1IUF A;  4ZYA A;  1O8E A;  4F3Q A;  4KIF A;  3SLN A;  2OPT A;  4Y7C A;  1IN6 A;  4GRI A;  4C30 A;  5AIP A;  1S7O A;  5HDG A;  5H6R A;  4XRS G;  2F5D A;  4MXN A;  3CCU B;  5GV8 A;  3GLX A;  4A5M A;  2E5Z A;  5H59 A;  3IHU A;  2BHY A;  1V5G A;  2GM4 A;  3OYA A;  1IF1 A;  3BG5 A;  2XPU A;  3J80 K;  1J9Z A;  2IXS A;  3CDH A;  3B8Y A;  3H0G J;  2D1H A;  2BY1 A;  4RMN A;  5JHU A;  4HOB A;  4QPQ A;  2VT3 A;  1GV5 A;  2F5E A;  1H88 C;  2ZNZ A;  5DN6 A;  1Z7U A;  4A3M J;  1RU4 A;  2EZI A;  4EV0 A;  4XLH A;  1Z6T A;  1FOW A;  3CLQ A;  4XRF A;  4DZP A;  4E7I A;  4L5J A;  1JNY A;  3RCO A;  4PGO A;  2HXI A;  1OCZ H;  4ZDP A;  2LBF B;  3KYL A;  3BPV A;  2Q0O A;  3G1L A;  4XD7 A;  4G7X A;  2DFF A;  3ROU A;  4XKB A;  1MSF C;  2HZD A;  4ZH4 F;  5EF6 A;  1TLL A;  2BSA A;  4N0B A;  3REO A;  5J1Y A;  2LY2 A;  1ZG5 A;  2Y0S A;  1XTA A;  2MYS A;  4A5N A;  1BJK A;  2YUS A;  3SJZ A;  1K4T A;  3SEJ A;  2AXT C;  2WB1 A;  4C2T A;  4B8X A;  4U7D A;  4GXO A;  3S1R J;  4XKC A;  2C2W A;  4IRH A;  2K02 A;  2DT6 A;  4ACA A;  3ABK H;  3AVV A;  2XKO A;  4RB2 C;  4F92 B;  2OZU A;  5EG0 B;  3L09 A;  3MCZ A;  1E3Z A;  1HKQ A;  3TP0 A;  1LEA A;  2F2E A;  2KMU A;  2NNN A;  4YFO A;  3IL2 A;  4IF4 A;  2CG4 A;  1KK3 A;  1RR7 A;  5H5J A;  2DCE A;  1BOA A;  4RB1 A;  1Q81 D;  4OIN F;  1G7T A;  1R9T J;  1TL8 A;  4MIM A;  1IRZ A;  3NEU A;  3J80 Z;  5FKN A;  1NG7 A;  2VI6 A;  3ZQG A;  2KP6 A;  3DEE A;  1XPX A;  1ZQ3 P;  1KRH A;  4ZGQ B;  2VPR A;  1MDM B;  1IB4 A;  3KP2 A;  4PZJ A;  2QF7 A;  1BJA A;  2WV0 A;  4M9X A;  4X07 A;  3A8K A;  2XHK A;  2ISZ A;  1ETW A;  1W0U A;  3CUQ C;  2X51 A;  1BOB A;  4YHB A;  5F4M A;  2CK3 A;  3B8H A;  2M8G X;  1ETO A;  4JK1 X;  2HGC A;  1OB2 A;  2RGV A;  3ERE D;  3SEZ A;  1T6Y A;  3ASN H;  4FX4 A;  4Z4Z A;  2J5P A;  1CNF A;  2JPB A;  1O8J A;  3I5U A;  2TCT A;  1D8K A;  3DP7 A;  3W2V A;  3S17 J;  4DYR A;  3MN2 A;  2XF6 A;  3AVX A;  4PGG A;  4ZDO A;  1TSP A;  1DDI A;  1IXC A;  2EFW A;  1YS7 A;  4N9H A;  3TO6 A;  2BGC A;  3R6S A;  4I76 A;  3I4P A;  5D5X B;  4G6D A;  4L5I A;  3LQR A;  3WBK A;  3GQA A;  4P1W A;  3F6O A;  3VYR B;  4KIB A;  2G0Y A;  3RTR A;  2W57 A;  1K5C A;  1SFO J;  1J59 A;  2EPF A;  4G94 A;  1UJ8 A;  4CCL A;  2DA2 A;  4CZC A;  1LFU P;  3CMY A;  4LB6 B;  1ITY A;  4YXW A;  3BCA A;  1BIB A;  2PIA A;  1Y0R A;  5FGM A;  5DCM A;  1IJE A;  1W5S A;  3HDD A;  4ZYE A;  1E1Q A;  2WJY A;  2A07 F;  3WTS C;  2CV2 A;  2DET A;  3NAU A;  3WU2 C;  5ILU A;  1W0J A;  3J7Z I;  1FND A;  1A04 A;  1QVT A;  3CCV B;  4HIZ A;  4UB6 C;  2K9Q A;  2WAQ A;  4C2U A;  2ELK A;  4G1V A;  4MFD A;  4B3F X;  4PJL A;  1GAQ A;  2EFG A;  2DER A;  3OW7 A;  4L18 B;  2Z9O A;  2PMZ A;  3V76 A;  3DWL E;  1TYV A;  2NAZ A;  5IPA A;  2HI3 A;  2LY9 A;  3ELK A;  1HW5 A;  3P27 A;  1KU9 A;  4DYC A;  5H2F C;  1JUP A;  5D8L B;  2GJR A;  1N0U A;  4LBZ A;  4RJL A;  5EMN A;  1Z21 A;  3WGG A;  3LNN A;  1V3F A;  3PIP F;  2CF4 A;  2C78 A;  1YIT B;  4DW6 A;  4XID A;  1KU2 A;  3FPK A;  2F4M B;  1V55 H;  2M0C A;  5J3O A;  2ZCW A;  1VZ0 A;  5LEJ A;  3S3N A;  4DNT B;  1UMQ A;  5IYQ A;  1JI8 A;  4GO1 A;  5LBQ A;  2LD5 A;  4EH1 A;  2M45 A;  1G59 A;  5J40 A;  3IH4 A;  4PC2 A;  3LSJ A;  1Y56 A;  2EV0 A;  3PSI A;  2CSO A;  4BHP A;  1ENH A;  5B3S H;  3ASS A;  2PJP A;  5ICC A;  4H9G A;  2DBB A;  4ZCL A;  2CUE A;  3BJ6 A;  3KIO A;  3HRT A;  2XPW A;  2JSC A;  3OSG A;  2W84 A;  3KX2 A;  2WA0 A;  1YHQ I;  1G3S A;  3BJA A;  3OYC A;  1H8A C;  3OE7 A;  3S14 J;  2V1X A;  1R71 A;  1FDR A;  5IK2 A;  3OL3 A;  5FB2 A;  2M0M A;  4H0E A;  1P6R A;  1P4A A;  1IRF A;  1LNW A;  1KU3 A;  3SYT A;  4ENJ A;  2V9P A;  1LM1 A;  2TRT A;  1IZ1 A;  2O8X A;  2EA4 A;  4C43 A;  1QRC A;  1I3A A;  4A3G J;  4IW3 B;  4PAB A;  2B7E A;  1MH4 A;  2ZJ2 A;  4Z4R A;  3K70 C;  2O7O A;  1YLO A;  3AL0 B;  1F9N A;  1M1E B;  2BM5 A;  3DBH B;  4TN1 A;  2XB5 A;  3I9V 2;  2QEX I;  2CQX A;  3QOE A;  4UUS B;  4A3B J;  5K7F A;  3VMW A;  4CQJ A;  3HRS A;  4PJM A;  4C2M J;  1SD7 A;  4CYC A;  1P9Q C;  1HXD A;  1PJ5 A;  2FQ3 A;  5F08 A;  4OAY A;  3BR2 A;  2OBS A;  3VSU A;  3CCV I;  1A31 A;  3KEW A;  1CLW A;  1OYW A;  2BM7 A;  2BXZ A;  4AVP A;  4BH9 A;  2EIX A;  2XC1 A;  2MW8 A;  2BVN A;  3LYC A;  1YW8 A;  2HU9 A;  4WZT A;  4BPR A;  1QO0 D;  4M9Z A;  1NJI D;  3G4S B;  4RB3 C;  4FCY A;  2KKO A;  3TDU C;  5JVT A;  5GPA A;  1NB9 A;  2CRV A;  2DA5 A;  1MBE A;  2ZME B;  1U78 A;  1W0K A;  1G8X A;  4F52 A;  1ETK A;  1VBL A;  2K85 A;  3CQZ J;  1LDD A;  2A6T A;  3S2W A;  2FOK A;  2R4G A;  1WJB A;  1R00 A;  2A5W A;  2GA1 A;  3ZMS A;  2L7Z A;  3FBI B;  4TMZ A;  1U9N A;  1PJR A;  4JBA A;  1UD3 A;  1E1R A;  5FLX K;  4LLL A;  2UZK A;  1YO5 C;  2R92 J;  4RPD A;  2F4O B;  2FMY A;  1UD5 A;  2PYH A;  2DPU A;  4RA2 A;  5E3N A;  2IT0 A;  4KNY A;  2W82 A;  2ZZF A;  1JT6 A;  1YS6 A;  2P81 A;  2FJ1 A;  2X0L A;  4DK1 A;  3KP7 A;  3BPX A;  3R61 A;  3T8T A;  4YDT A;  4R79 A;  4A0Z A;  5C44 J;  2JA7 J;  2VJI A;  1U8B A;  4A69 C;  4RLZ A;  3HPG A;  3ZIA A;  1Z67 A;  3LFU A;  3PUN A;  2YU9 J;  3GF2 A;  2DXI A;  3IKT A;  3OJX A;  4OAZ A;  3QFS A;  2VFQ A;  4Z05 A;  3QP5 A;  1YX5 A;  1M1K D;  3AG4 H;  4LBY A;  1E43 A;  2RNJ A;  2XEX A;  3BJO A;  3PQJ A;  4II2 A;  4PC1 A;  3V7C A;  1W0T A;  3KP5 A;  1X58 A;  3GX4 X;  1X4O A;  2Q6L A;  3VSV A;  1MRZ A;  3HKZ A;  2FXA A;  3CCR I;  4IRI A;  1I8D A;  2OBR A;  3MHP A;  2GZW A;  2K9S A;  3CD6 B;  3SKB A;  2HOS A;  1VQP B;  2IGK A;  3M8J A;  3OS1 A;  2J7K A;  1J0R A;  4IX7 A;  3BR3 A;  2OC6 A;  1X0C A;  5DUI A;  4B1R A;  4A3E J;  2H09 A;  3PUM A;  3TH0 A;  2GPJ A;  1QGY A;  1COW A;  2YUH A;  1ZN2 A;  3BG3 A;  1BC8 C;  2EIK H;  4P25 A;  2EIN H;  3B6A A;  4RAG A;  1EP1 B;  1EH6 A;  3ABM H;  4P5O A;  3JRE A;  4ZC3 A;  1XGS A;  3D1N I;  1YIO A;  2R93 J;  2JN9 A;  2Y2Z A;  1SEU A;  2QN6 A;  5BSX A;  3SUC A;  2WAF A;  3BTJ A;  2P8T A;  2CUJ A;  1T0F A;  1QNT A;  5EGO B;  5DS9 A;  4N3N A;  2JUG A;  1JHF A;  2LF7 A;  2QSG X;  2ME6 A;  2XV4 S;  2Y0S N;  4X0G A;  2WPD A;  1Z05 A;  5IYD J;  2EK5 A;  3G1M A;  1NRK A;  2QKL B;  4X7E A;  5DV5 A;  2JTV A;  2P5K A;  2Z33 A;  1SKY B;  3HGG A;  1D1A A;  3R4K A;  2L02 A;  5F0F A;  4G7Z F;  3NWT A;  1BX1 A;  1HKT A;  4YAF A;  1VQ9 I;  3SFZ A;  1QFZ A;  2X6X A;  3AVY A;  2L9S A;  2KL4 A;  2ZTN A;  3A2K A;  2V6C A;  1XB4 A;  3M1C A;  5F1R A;  1EE6 A;  3TP3 A;  1ZAR A;  3V42 A;  1A5J A;  2FE3 A;  2L9V A;  1VQL I;  5HDK A;  4BE2 A;  3WTX C;  4HE6 A;  2BY2 A;  4BJ6 C;  1NK2 P;  1OJL A;  2MH2 A;  2V31 A;  2CBX A;  2DO7 A;  2BM1 A;  1N05 A;  3A01 B;  4KIG A;  2JSP A;  1OB5 A;  1VQ5 I;  3CCM I;  3BR0 A;  4BS9 A;  5EEA A;  2OCC H;  3Q38 A;  1FZP B;  1FIA A;  2VAS A;  4D7N A;  3QPH A;  4G7H F;  3Q5F A;  3ZZU A;  1DGW Y;  2EFP A;  2PN6 A;  1V5E A;  4EM2 A;  1VQ7 B;  4ZJZ A;  4BDY A;  4LIU A;  3OW2 B;  4M4S A;  1I50 J;  1TYW A;  4E7L A;  2E1C A;  4OMZ A;  5BQT A;  3M8F A;  5M5W J;  5E3O A;  1X1A A;  3K2A A;  1MMD A;  3B4N A;  1GLN A;  1YX2 A;  3E97 A;  1RRJ A;  4OU0 A;  2M34 A;  3W6K B;  1B6A A;  2M1B A;  1XX5 A;  3H5R A;  1EFT A;  1R5I D;  1HVX A;  1OFC X;  5FJ8 J;  1T2K A;  1IC8 A;  2ELH A;  1QRY A;  4ENN A;  3V4G A;  4URR A;  5IOZ A;  2OTL I;  4RD2 A;  3BTC A;  1FNN A;  3K7A J;  1PP7 U;  3F23 A;  3BT9 A;  4ZTJ A;  2CRG A;  3MMY B;  4U88 A;  3JRI A;  2GQF A;  1PE9 A;  1ZHF A;  4QTR A;  2VLA A;  2ODL A;  2JA5 J;  3RIQ A;  4LD5 A;  1K28 D;  2ZJR F;  3TED A;  4N9I A;  3WG7 H;  4BXX J;  2WY8 Q;  1Z91 A;  2P7V B;  3H92 A;  3I71 A;  5EGO A;  2VBV A;  3FX3 A;  3RYP A;  4JP0 A;  3H9N A;  1BA5 A;  1KA8 A;  4E7K A;  3VSK A;  2F6C A;  1Z1D A;  3WGI A;  4FXU A;  2PEC A;  2ID6 A;  3PFI A;  1IW7 F;  2H94 A;  1BR2 A;  1FY7 A;  2TDX A;  4KMF A;  5JI6 A;  1B72 B;  1VI0 A;  4OIQ F;  4M3F A;  4N4N B;  2IOU G;  1OFE A;  4PDK A;  4OIR F;  1X3U A;  4OJO A;  2IQ7 A;  3CUQ A;  2BVL A;  4B44 A;  2IS6 A;  2BF4 A;  2FVG A;  2I1L A;  3GRH A;  4B3X A;  3PSF A;  1Y1V J;  5BS6 A;  4WCG A;  2FBI A;  3K1N A;  4A0X A;  3GEZ A;  2XSJ C;  1PUF A;  4E7J A;  4QVA A;  4YAL A;  4P55 A;  3HOX J;  2X1C A;  3CO6 C;  3CC7 B;  1YJW B;  1Q1V A;  2IA1 A;  3DKW A;  2GRE A;  2QYU A;  1L3L A;  4DJA A;  1ODD A;  3K9T A;  4P1V A;  3GQ8 A;  3F9K A;  3LFK A;  2V7W A;  3CCL B;  4Y13 A;  1QCX A;  1WSV A;  3QRF F;  5IYN A;  1S7E A;  2QA4 I;  3DBL B;  1VQ7 I;  2G0E A;  5C1E A;  2OCE A;  2STW A;  3NAR A;  4HWV A;  1H0M A;  3WNB A;  4HW0 A;  4LG3 A;  3S32 A;  4KIS A;  2OA4 A;  5E20 A;  2RRE A;  5M5X J;  1B8I B;  3NE5 B;  4DBR A;  4DBQ A;  4S05 A;  3IRQ A;  3CLO A;  1XG2 A;  4XLP F;  1QPI A;  1SAX A;  1EJ9 A;  2M7A A;  2FBK A;  5JLW A;  2PI0 A;  1WSR A;  1OMI A;  2JA8 J;  2HS5 A;  2LDU A;  1YJN B;  4QUZ A;  2DA4 A;  2JUC A;  2VIX A;  1IHM A;  3F21 A;  1PVE A;  2VQG A;  3FPP A;  5FL7 A;  3OFN A;  5FD5 A;  1YJ9 B;  4UV8 A;  1NHA A;  4Z03 A;  4NBS A;  3D5S C;  4YZ0 A;  1Q86 D;  2QY1 A;  3ECO A;  3K69 A;  2A61 A;  4ZYH A;  1TQM A;  3HG9 A;  3H5N A;  5HDN A;  4HAM A;  2D5V A;  2CQ7 A;  5FIU A;  3W2F A;  3BG9 A;  3ZN0 A;  1ZLJ A;  4IEJ A;  2R7X A;  1F43 A;  3GYH X;  3CCY A;  1BBY A;  4FWT A;  5CVR A;  2EBI A;  2ZJQ F;  1JJ8 C;  1DDG A;  4PFO A;  1KZH A;  3W5H A;  3FHN A;  2K5C A;  2R7Z J;  1RKT A;  2CW8 A;  1S29 A;  4EM0 B;  4ENK A;  3OZV A;  2QM3 A;  4C9Y A;  1B2R A;  3C2G A;  3CUO A;  2OV7 A;  1WWX A;  3DDY A;  1WH5 A;  1ULY A;  1OB0 A;  3VNU A;  5JHF A;  4NDL A;  2VJ5 A;  4JX5 A;  3BZC A;  2FML A;  3DCF A;  1B9N A;  3EQL F;  1IV8 A;  3SZG A;  2EIM H;  2WYR A;  3KE2 A;  4AF6 A;  1UD4 A;  1QU3 A;  5H6Q A;  2LR8 A;  4XKW A;  1IRG A;  3I64 A;  5HLH A;  4A3L J;  3SJP A;  4NBQ A;  1YIJ I;  3CC4 I;  4RCZ A;  5A88 A;  3S2H J;  2K40 A;  2O9L A;  2ZSI B;  2GIV A;  2O3F A;  1KON A;  3KP6 A;  5DEQ A;  2DOG A;  1AMO A;  1MBG A;  1R58 A;  3OS0 A;  3N97 A;  1JKP C;  2DA3 A;  3T1B A;  4Y15 A;  4OZZ A;  1R4M B;  2BW3 A;  2Z3Y A;  4XOP A;  1D8T A;  4I0B A;  1T33 A;  3GVL A;  3VPR A;  1WJE A;  4Z2Y A;  2QBY B;  2O6W A;  3ZC3 A;  4JQF A;  3COA C;  2CQK A;  2VBZ A;  1FWZ A;  3LOC A;  3F8N A;  3W2E A;  1WZ2 A;  2RDP A;  3I56 B;  3HIF A;  2E71 A;  5TJJ A;  3ASQ A;  3BQJ A;  2D45 A;  4YAO A;  1JJ6 C;  1F36 A;  4A93 J;  1SFK A;  2A6H F;  3FKJ A;  4MTE A;  1N75 A;  1E63 A;  5H20 A;  3P4G A;  4CGZ A;  2DU9 A;  4WF2 A;  4Q7J B;  3MQ0 A;  1OFL A;  3JAM K;  1U5T C;  2EZL A;  1RC9 A;  2DTZ A;  3L2U A;  2NVX J;  4OMY A;  1QUF A;  1VQ9 B;  1QQ1 A;  2COB A;  4KKS A;  1CQX A;  1VQ4 B;  4L5E A;  5AMV A;  5DUK A;  5BNG A;  2G9W A;  3JW4 A;  3VST A;  5IYW A;  1YW7 A;  5FO0 A;  4JX4 A;  3LSI A;  4XSX F;  2R5Y A;  4RBO A;  2XF5 A;  5IT9 Z;  4V2G A;  2VOO A;  2DMN A;  3GTP J;  4M1K A;  4Z4Y A;  5D4S A;  3QFC A;  2LZJ A;  2M3A A;  3ZZ0 A;  1ZM3 A;  1R5O A;  1DBO A;  4R1H A;  1R5B A;  2EFN A;  2C4U A;  3P9K A;  5GTI C;  2VN2 A;  3HSE A;  2LRE A;  3HUG B;  4MYU A;  3DPU A;  2MFZ A;  4XQF A;  1UD6 A;  2X3U A;  1NG6 A;  3OV8 A;  2Z16 A;  2RC5 A;  3N6Z A;  4P12 A;  2VC1 A;  2D9R A;  3GTM J;  4KN4 X;  5L3C A;  3KL9 A;  4RPB A;  2KJC A;  2HNH A;  2JIZ A;  2E1N A;  4J19 A;  1YI2 B;  4X05 A;  2WZP P;  2R5Z B;  4HNT A;  1IUY A;  3ZMD A;  1VHE A;  2CS3 A;  3EUH A;  5KK1 A;  5IYP A;  3Q9V A;  4LIV A;  1SC7 A;  1FNM A;  1LVK A;  3Q0U A;  4HNV A;  3GFM A;  1ZRE A;  1H8E A;  2JA2 A;  5E8G A;  1Z7L A;  1K78 A;  2PEX A;  1FOY A;  2Z5U A;  1OGJ A;  2HKX A;  5DD8 A;  1BQE A;  4B4C A;  4RB0 A;  1XS9 A;  2WY7 Q;  4GCV A;  4AUX A;  4EAT A;  1JGG A;  1K4Z A;  2VBX A;  2BY3 A;  1Y8R B;  1FEX A;  3CXC B;  1LLW A;  3IWF A;  3VYS B;  2XT2 A;  4YC5 A;  2VOD A;  3CO7 C;  3CMA I;  4X8I A;  1M90 D;  4B3A A;  3DV8 A;  1VND A;  1TUI A;  2R6H A;  1JHH A;  1O7L A;  4UV9 A;  3I56 I;  1MBH A;  4I7H A;  2JWT A;  1K7A A;  1A6I A;  1EFC A;  1GO2 A;  4UUT A;  1TP4 A;  1A8P A;  1QVF B;  2JVG A;  2HLD A;  1TNT A;  4AYB N;  2VQL A;  1W5T A;  3B02 A;  3CJT B;  3WTW C;  3JSO A;  2KRC A;  2HDD A;  4PC7 A;  2QXZ A;  1H9T A;  2D1V A;  3ULQ B;  3B78 A;  3DF8 A;  4K1X A;  3R60 A;  1E3H A;  2R5Y B;  1GXP A;  4DNR B;  1A6Q A;  2L7F P;  4Q48 A;  3BDD A;  3RI4 A;  5J4V A;  1KQ8 A;  3F72 A;  2VE9 A;  2ETH A;  3CES A;  2JRM A;  3W2I A;  1VQ6 I;  2Q6O A;  2DW4 A;  2XSD C;  4AIJ A;  1O8H A;  4V02 C;  5HZA A;  1D2E A;  4A3F J;  2V7F A;  4HG2 A;  3PNV A;  2A69 F;  2ZJP F;  4KA4 A;  4GGG A;  4BE0 A;  4IVN A;  4OPV A;  2X8K A;  2VNI A;  5ERI A;  1T38 A;  3CCE B;  4YFN F;  4X06 A;  2J8K A;  1LUJ B;  1IDY A;  4BXU A;  2XRN A;  1FRQ A;  2NVY J;  2R7Q A;  4DZJ A;  2CGP A;  1ZUN B;  1YIT I;  1FP1 D;  4Y7N J;  3HSR A;  2HKO A;  4Q5S F;  2BM0 A;  2B9S A;  4KUM A;  5TR9 A;  1JTY A;  2Q6I A;  4O6J A;  4X7F A;  2IP2 A;  5FRM A;  2BVM A;  3V7S A;  2UUZ A;  5B66 C;  1Y0N A;  1Z3Y A;  1FPQ A;  1FRN A;  1FYM A;  2HYJ A;  1UHS A;  5LD2 C;  4AIK A;  4TMW A;  2GAU A;  2XZL A;  2Y0M A;  4Z4V A;  2HWV A;  4OJL A;  2L0K A;  1WRJ A;  3EUH C;  3KEY A;  3T5X A;  2NTQ A;  4BY1 J;  3QYB A;  1ZTR A;  4XLE A;  3DKY A;  1FBQ A;  1YG2 A;  4P9S A;  3CC2 I;  2L7M P;  5E3M A;  2ESN A;  1C0W A;  1Y39 A;  1I5Z A;  3OR2 C;  3QFR A;  3E0J B;  4DK0 A;  4RAY A;  3S15 J;  6PAX A;  3FIS A;  5HLI A;  1UFM A;  2GWR A;  2VKE A;  1BIA A;  1BC7 C;  2DMP A;  2K4J A;  3VOD A;  1QGA A;  3RQI A;  4DGW B;  1FIP A;  2DYS H;  3PM1 A;  3OYG A;  5DYM A;  2DJN A;  3H0D A;  3SY2 A;  5C1C A;  1Q9S A;  2BX6 A;  3KCC A;  4UXN A;  3GTQ J;  1VF9 A;  3W6J B;  2GJP A;  3FZV A;  1O3S A;  2I8D A;  1BR4 A;  3DFG A;  3PO2 J;  3LSK A;  4HYE A;  1H42 A;  4U4B A;  2HXO A;  4CZZ A;  3L2V A;  4BXF A;  3FXO A;  5K5O A;  1E79 A;  4DQ2 A;  4EGY A;  3AST A;  2P0W A;  4OIP F;  1BLI A;  2YU3 A;  2JJ2 A;  1WOR A;  2W24 A;  3ZQF A;  3KEQ A;  3A8I A;  4UZU A;  4Y9U A;  1HC8 A;  2LMD A;  4LMY A;  1MNM C;  4V19 K;  3E3V A;  3OZW A;  3ZGK A;  2CW7 A;  2ZBV A;  3HXL A;  2PFB A;  3VNV A;  4KIC A;  1WSU A;  3L1P A;  3HOY J;  4YZA A;  1O88 A;  4XOR A;  3S1N J;  2R7O A;  2W25 A;  1QBJ A;  3P26 A;  1MMA A;  2E1M C;  1D0X A;  5EG0 A;  3LSR A;  1FNB A;  2VBK A;  2P7C B;  5FLM J;  1U9O A;  2W7Z A;  2HOT A;  2YX7 A;  1HA8 A;  1OCT C;  1Y0U A;  2Z2S B;  1GVJ A;  1DG1 G;  3OYE A;  1CNE A;  4V2F A;  3I4N J;  1OCP A;  2W48 A;  3LA2 A;  3P9I A;  2F43 A;  2Q6K A;  5GTH C;  2CND A;  1ELO A;  2CC2 A;  3S16 J;  3CP2 A;  2ICW G;  2R7V A;  2MC3 A;  1XGM A;  3MCA A;  2VJJ A;  1RIO H;  2L01 A;  4CCO A;  1H9G A;  1X3W B;  4M6X A;  3RPU D;  1NK3 P;  4HRI A;  2NZM A;  2PG4 A;  1DPR A;  1WPC A;  2ECB A;  2B5O A;  2IVM A;  3DEU A;  4X7D A;  1LJ9 A;  2XGD A;  1B23 P;  4NC8 A;  3VO1 A;  4ZYD A;  2DFH A;  4IRG A;  1FT9 A;  3GQ7 A;  4LG0 A;  4ESF A;  1HF2 A;  5IP7 J;  2Y9Z A;  1YYV A;  2M4G A;  5EZG A;  1XE1 A;  3G05 A;  2B63 J;  4RDJ A;  3F8C A;  3K1P A;  3ML3 A;  1Y0Y A;  3JSP A;  4HX7 A;  2FNA A;  3Q3S A;  2M5S A;  1I1S A;  4WZK A;  2IGM A;  4HV5 A;  2R0Q C;  1IGN A;  1VQP I;  2K7L A;  3IAS 2;  2CW5 A;  4MYT A;  4CSW A;  1KJZ A;  1UEL B;  2DFI A;  1HG8 A;  1LDJ A;  3K4L A;  2W00 A;  1QQI A;  1BI3 A;  3FKI J;  2KZG A;  2UV1 A;  4CXF A;  2QQB A;  2HYG D;  3ZP5 A;  2QSH X;  4Z6Y A;  5E79 C;  1WQ2 A;  3QOD A;  3FDY A;  2ECC A;  5TV2 A;  4LK1 F;  4YII A;  3GCM A;  5BPI A;  1D8J A;  4Z4W A;  4A6D A;  1MAB A;  3T8R A;  1S8N A;  1K83 J;  1WPK A;  2F4I A;  3HEF A;  3K1M A;  3IP4 B;  3PIO F;  4U0Y A;  4XSZ F;  3CRZ A;  3HTS B;  3JRF A;  2KRH A;  1TWC J;  2PMD A;  3KLN A;  3U9G A;  4M6Y A;  3GZN B;  2GQQ A;  3W5U A;  3VEP A;  4A12 A;  4NNJ A;  1USS A;  3M07 A;  3R6J A;  1XSD A;  2O6G E;  4JX6 A;  3FXK A;  3ZMT A;  1FTT A;  1OOC A;  4CO8 A;  3F8B A;  1BX0 A;  2LY1 A;  5J1U A;  2V6E A;  4TV7 A;  4I99 C;  5D4R A;  1Z0X A;  2ACJ A;  4PFP A;  4M0L A;  1MW7 A;  4ZYG A;  2EWN A;  2OJE D;  2O0W A;  1RZ4 A;  4M74 A;  4PUS A;  4HX4 A;  2IA0 A;  3DBR B;  4L9J A;  3U1D A;  4D0P A;  4OWR B;  1QA6 A;  2VBT A;  2PQ8 A;  1YRN B;  3CP8 A;  2RC4 A;  3RKY A;  2RQP A;  3W2A A;  3O8G A;  1U5T A;  2QQ9 A;  3DU1 X;  2VZL A;  4B43 A;  3BG7 A;  3K4J A;  2INV A;  1GVH A;  4LLG F;  3HC7 A;  2D2W A;  4Y33 A;  3CCQ I;  5F4O A;  2DOE A;  4PK4 A;  3OEE A;  3I58 A;  2LNB A;  4QPO A;  2HMA A;  3OPO A;  3K70 D;  5CLS A;  4P22 A;  4I2O A;  3NQO A;  3RSN A;  2PJR B;  1EH7 A;  4YEL A;  1CQT A;  1JKO C;  2BGI A;  1YOV B;  4AM3 A;  1OQY A;  2O1D A;  2M5W A;  2BW3 B;  3OYK A;  2ZBU A;  4HZF A;  1VLO A;  4M6V A;  5TRD A;  1H89 C;  4YAW A;  2VFM A;  3V8L A;  4WWC A;  1I3Q J;  2O0Y A;  1J09 A;  2H1L A;  3H9Q A;  2CFX A;  2NTB A;  5L46 A;  3OSF A;  1BMF A;  3CZ6 A;  5K5R A;  3JRC A;  2IS2 A;  2RV8 A;  1TYU A;  4W8Q A;  1D1C A;  4ZZD A;  2MBF A;  4C3I J;  3ZQC A;  3TDZ C;  4CYC B;  2W6J A;  3PA2 A;  3ZCO A;  1KK1 A;  2FX3 A;  2VON A;  1QHH D;  4UVC A;  3VR6 A;  2VBE A;  3NAW A;  1V4R A;  2NTP A;  1U2R A;  3HZJ A;  2JJ7 A;  4NC7 A;  3F8F A;  1O7F A;  1TQI A;  2MSY A;  3E7L A;  4TSF A;  1Z6R A;  5CQG A;  2CUZ A;  2QWW A;  2KIM A;  5D8K B;  2VBY A;  3WTZ A;  3RZD J;  1XCB A;  3FM5 A;  2OK7 A;  1ZGW A;  1T98 A;  1T5E A;  1GHC A;  2CU7 A;  4LB5 A;  5FKL A;  2D74 A;  3KP3 A;  1BN5 A;  3CPX A;  2E1M B;  5HOO A;  3ZMU A;  3CCE I;  1PDN C;  3QPL A;  2H1K A;  1JA0 A;  4M9S A;  3MEX A;  4UVB A;  1S6L A;  1TWA J;  2BEO A;  2VBW A;  4MQV A;  2ZO4 A;  1G7R A;  2P6T A;  4RGS A; 
#chains in the Genus database with same CATH homology
 4CUG A;  2DOA A;  3PSF A;  1OHH A;  2CV0 A;  1KTW A;  2X85 A;  3N05 A;  3OR1 C;  2EWE A;  4XLA A;  2X1D A;  1UG0 A;  2LG4 A;  2XSJ C;  3S8P A;  4BQO A;  3OYJ A;  4E7J A;  2X1C A;  5HVQ C;  4F55 A;  2GJK A;  2V4D A;  5HNF A;  1O8I A;  1YE9 A;  4DJA A;  3OY9 A;  3AFH A;  3HAG A;  1UD8 A;  3GQ8 A;  3OYD A;  3F9K A;  4RM3 A;  1QCX A;  1QHG A;  5CKT A;  4NUB A;  5KHD A;  2UWM A;  5C1E A;  4HWV A;  4U87 A;  4BJT A;  3G2B A;  2XF7 A;  4LG3 A;  4XLF A;  3S32 A;  4KIS A;  2RRE A;  4Z1M A;  2HVQ A;  1EFR A;  4DBR A;  4DBQ A;  3NE5 B;  4E4H A;  1XG2 A;  2K3P A;  2M7A A;  5FRO A;  2D3N A;  4PSW A;  3DTI A;  4HNU A;  3PNY A;  4HPQ A;  1D1B A;  1W9X A;  2AQF A;  1H80 A;  3WWG A;  4OJ5 A;  2VIX A;  1MND A;  2VQG A;  3FPP A;  4NK6 A;  5FL7 A;  3OFN A;  1T95 A;  3OOC A;  3L2R A;  2O17 A;  4YZ0 A;  4Z03 A;  3D5S C;  2QY1 A;  3D5L A;  1FMV A;  3HG9 A;  3H5N A;  4XN0 A;  2WJV A;  3PUB A;  2XZO A;  2VBM A;  1WJC A;  4U49 A;  2WBM A;  3I3L A;  4CH7 A;  1KMH A;  4Y4R A;  2R7X A;  1O8L A;  4XOT A;  2Z8G A;  1BPL A;  2UVF A;  2MAB A;  2F1M A;  2V1N A;  2PJR A;  4XM3 A;  2DIE A;  2GK7 A;  2XND A;  5HNH A;  3L2Q A;  4PFO A;  4NK8 A;  1PKV A;  2LC2 A;  1O8M A;  3FHN A;  2K5C A;  4XR6 A;  1V5F A;  2CW8 A;  2R9V A;  3H9J A;  4E7Z A;  2XZP A;  1X1B A;  1WJF A;  1IA5 A;  4C9Y A;  3C2G A;  3JUR A;  2ZTG A;  2OV7 A;  1S9H A;  3DDY A;  1OB0 A;  2VKD A;  1VF7 A;  1BHE A;  2NT9 A;  4HEA 2;  3ZPP A;  4BJ5 C;  5JHF A;  2ZZE A;  2VJ5 A;  4BDZ A;  1H8H A;  4PMH A;  4ZYA A;  1O8E A;  4F3Q A;  3SZG A;  3EUA A;  1D0Z A;  4GRI A;  4C30 A;  1UD4 A;  2BOL A;  2R7U A;  1QU3 A;  2R7S A;  3EQN A;  2WSS A;  4XKW A;  3A4C A;  3CJR B;  4E7S A;  4MXN A;  3WQZ A;  3OYF A;  4D9J A;  2E5Z A;  3MKW B;  1V5G A;  3OYA A;  2ZSI B;  4B3G A;  1KON A;  2IXS A;  3DPL C;  4H4K C;  3OS0 A;  4RMN A;  3B8Y A;  1GQ8 A;  4OZZ A;  3BG6 A;  4QPQ A;  2BW3 A;  4XOP A;  5HKK A;  1TZL A;  5DN6 A;  3GQ9 A;  2ZFU A;  3GVL A;  2UVE A;  4G6I A;  1WJE A;  3K10 A;  1RU4 A;  4JQF A;  4E7I A;  4XLH A;  1E3X A;  3H94 A;  3PL8 A;  2PYG A;  2JVH A;  2JJ1 A;  3RCO A;  4BEH A;  3K4N A;  3ZXS A;  4ZDP A;  2LBF B;  4ZTF A;  3KYL A;  1MMG A;  3RQ4 A;  4XD7 A;  1SFK A;  4G7X A;  3HL2 A;  3OS2 A;  2ELJ A;  3FKJ A;  3DPT A;  1N75 A;  2HZD A;  4XKB A;  4AVZ A;  1OGM X;  1R6R A;  2GOM A;  2LY2 A;  3LL7 A;  2Y0S A;  4HST A;  4RM2 A;  3C2H A;  4CA0 A;  2MYS A;  4E7H A;  1OFL A;  2XAU A;  3L2U A;  2GK6 A;  2WB1 A;  1JRG A;  4C2T A;  4KKS A;  3SEQ A;  4XKC A;  5AMV A;  1KZL A;  2DT6 A;  3VST A;  4F92 B;  3LSI A;  3D5R C;  2MD0 A;  1N78 A;  3EUK L;  2XF5 A;  3BLY A;  3PJR A;  3K4C A;  1E3Z A;  2LZJ A;  2KMU A;  2M3A A;  1DBO A;  1OFM A;  4IKF A;  3BC8 A;  2DCE A;  3HUG B;  2LRE A;  3QYE A;  4BUP A;  3DPU A;  2MFZ A;  4XQF A;  1UD6 A;  1NG7 A;  2KP6 A;  1NG6 A;  3DEE A;  4N4O B;  2V9K A;  4ANJ A;  2Z16 A;  1IB4 A;  2L5Q A;  2HNH A;  2JIZ A;  4BU2 A;  1NHC A;  2L9N A;  3UR3 C;  4BE1 A;  2X51 A;  1LDK B;  1BOB A;  4BGD A;  2WZP P;  1I18 A;  1Y6I A;  4HNT A;  4YRV A;  2CS3 A;  2CK3 A;  4LIV A;  1QJV A;  2KPM A;  3H9G A;  1LVK A;  3U21 A;  1H8E A;  2BSP A;  3SEZ A;  1FMW A;  2JA2 A;  1Z7L A;  3W2W A;  3A1Y A;  4E6K G;  3AKZ A;  1VJS A;  1O8J A;  3T51 B;  3W2V A;  2WAE A;  4ZDL A;  1UAA A;  2XF6 A;  3BCF A;  3S93 A;  2WY7 Q;  4EAT A;  4ZDO A;  4OJP A;  1YX3 A;  3VYS B;  3TBI A;  4E0F A;  2VL8 A;  1AA7 A;  4LIT A;  4U7B A;  3LMM A;  3DLA A;  1DQU A;  3GQA A;  2HDW A;  4PJJ A;  4P1W A;  3VYR B;  3OL4 A;  4BAC A;  1ERD A;  2R7W A;  2JVG A;  3RTR A;  3T53 B;  2K9M A;  4AU7 A;  1U0J A;  2HLD A;  1K5C A;  2VQL A;  4CCL A;  4CZC A;  4G7W A;  3OOU A;  2QXZ A;  2KRC A;  4YXW A;  3BCA A;  4JOM A;  2MC4 A;  4DNR B;  2V4J C;  2NOJ B;  2LRD A;  4BQQ A;  1E1Q A;  2WJY A;  2VB6 A;  2CV2 A;  3JU4 A;  3OYL A;  2KHM A;  4W8S A;  3CES A;  1W0J A;  3ZRG A;  4XN3 A;  1O8H A;  3H35 A;  4HIZ A;  2X3H A;  3A3G A;  2WAQ A;  4IQJ A;  2V7F A;  4CCM A;  4C2U A;  2ZSH B;  4B3F X;  4PJL A;  1IDJ A;  2ZXI A;  3PFY A;  3PNV A;  4HG2 A;  3OW7 A;  4BE0 A;  2LH9 A;  2X8K A;  1K6Y A;  2PMZ A;  3DWL E;  1NBM A;  3ZPN A;  3HOS A;  1WFX A;  2O5R A;  2R7Q A;  2M7B A;  2GJR A;  2Z6B D;  1Z21 A;  3LNN A;  3VMV A;  3CMM A;  3HPH A;  2W6I A;  3CF2 A;  1V0F A;  3QYF A;  4YEJ A;  3IAM 2;  5FRN A;  3BCB A;  1VZ0 A;  3S3N A;  4KKT A;  4DNT B;  5FRM A;  2BVM A;  5CPR B;  1JI8 A;  4IQ4 A;  2UUZ A;  1Z3Y A;  1G59 A;  3UW0 A;  1OGO X;  5LD2 C;  2XZL A;  1Y56 A;  3PSI A;  4XNF A;  4B47 A;  4OJL A;  5TGT A;  3EUH C;  1SAU A;  3KEY A;  4MLO A;  3FBN B;  2NTQ A;  3QYB A;  4XLE A;  3DKY A;  2ZZG A;  3K4B A;  3EPZ A;  2V26 A;  3T9G A;  3KX2 A;  2WA0 A;  3OYC A;  3OE7 A;  5CQE A;  4G6T B;  5IK2 A;  3OL3 A;  3OR2 C;  2M0M A;  3E0J B;  5HLT A;  4DK0 A;  4ASU A;  3SYT A;  3OIP A;  2XDV A;  4DGW B;  3H0D A;  3K6G A;  3OYG A;  2R7T A;  5C1C A;  3LSH A;  2RQQ A;  2GJP A;  4YZX A;  3K70 C;  2I8D A;  2DJI A;  1BR4 A;  3DTE A;  4DOZ A;  3AL0 B;  2VXZ A;  3LSK A;  1DBG A;  4U4B A;  3H5A A;  4XKV A;  4BXF A;  3L2V A;  3LMW A;  1WJA A;  3I9V 2;  3MKY B;  1E79 A;  1UD2 A;  1BN8 A;  2Q1Z B;  3DU5 A;  3QOE A;  2HQA A;  3VMW A;  1KCD A;  3K4K A;  1WJ5 A;  2P0W A;  4PJM A;  3UNG C;  3BC9 A;  5CDF A;  3K4M A;  1P9Q C;  1BLI A;  2JJ2 A;  2INU A;  2VQC A;  4Y3O A;  4OAY A;  3OYM A;  2NSP A;  4I84 A;  4UZU A;  3VSU A;  3DTK A;  3KEW A;  2O04 A;  4PJN A;  3ZGK A;  2CW7 A;  4IZZ A;  4F91 B;  3HXL A;  4YZA A;  2HU9 A;  1O88 A;  2HPI A;  4OZY A;  4XOR A;  2R7O A;  1X19 A;  1JTA A;  1T0F C;  2LOO A;  1MMA A;  2E1M C;  1D0X A;  1N77 A;  2VBK A;  4KIT B;  2LYC A;  3VYT B;  1FX0 A;  2Q2E B;  2W4S A;  4CCK A;  2CMP A;  3HOT A;  1G8X A;  2CV1 A;  1HA8 A;  1W0K A;  2Z2S B;  4F52 A;  2RNG A;  4YZQ A;  3OYE A;  3GBG A;  2FUG 2;  1VBL A;  2M4K A;  3ZSC A;  2F43 A;  2A6T A;  3LSG A;  1DGR M;  2R4G A;  1WJB A;  2A5W A;  3CP2 A;  2R7V A;  2GOX B;  3TL4 X;  3FBI B;  2VJJ A;  4BQN A;  3L2W A;  1WJD A;  1UD3 A;  1PJR A;  4CCO A;  1E1R A;  3RPU D;  2X53 S;  3A35 A;  3A3B A;  1IDK A;  4HRI A;  2NZM A;  1D0Y A;  1X1C A;  1MMN A;  2E1B A;  4C2L A;  1UD5 A;  1WP6 A;  3S3O A;  2IGO A;  2PYH A;  3SDB A;  2VQH A;  1WPC A;  3OWT A;  2KQR A;  3MKZ A;  2ZZF A;  1Z3X A;  2W82 A;  4KJZ A;  1O8F A;  4XLC A;  3GRH A;  4BEH B;  4DK1 A;  4XMY A;  4R79 A;  2VJI A;  4NC8 A;  3FKS A;  1RWR A;  3HPG A;  3GVK A;  3ZIA A;  3LFU A;  1IRX A;  3OYI A;  2DXI A;  4Z05 A;  4OAZ A;  4KKU A;  3GQ7 A;  2M4G A;  1YX5 A;  4CCN A;  2QKM B;  1E43 A;  3G05 A;  4II2 A;  2ZZQ A;  3S3M A;  3J7A Y;  4J01 A;  1X4O A;  4DIQ A;  5KCM A;  2M5S A;  3VSV A;  2IGM A;  3HKZ A;  1I8D A;  3IAS 2;  2IGK A;  4CSW A;  2E60 A;  3M8J A;  1UEL B;  1LKX A;  3OS1 A;  1HG8 A;  4IX7 A;  3K4L A;  4Z06 A;  2W00 A;  2OC6 A;  2WAD A;  1X0C A;  3ZQQ A;  2UV1 A;  1VLY A;  2Z1D A;  1BR1 A;  3QOD A;  3FDY A;  2HVS A;  1COW A;  3OAA A;  2KZV A;  4JMQ A;  3ZR8 X;  3GQB A;  2L7K A;  4P5O A;  4ZC3 A;  1MAB A;  2O0V A;  3TMO A;  2F4I A;  1O8K A;  3IP4 B;  3PNT A;  2W7N A;  3SUC A;  4ITV A;  2KRH A;  1X1D A;  2WAF A;  4FET A;  4F93 B;  2CUJ A;  2X6W A;  2W1O A;  2JUG A;  2E5N A;  2AQE A;  4HSR A;  4MR0 A;  4X0G A;  2WPD A;  3T56 B;  4NNJ A;  1NRK A;  3E1S A;  2QKL B;  3W3C A;  1PYV A;  2CH0 A;  3NWS A;  2DT7 B;  2ZXH A;  1PXZ A;  1SKY B;  1OOC A;  2HVR A;  1D1A A;  2LY1 A;  3LSM A;  2X6Y A;  3OMY A;  2VPL A;  2V6E A;  1X4P A;  3OIQ A;  3NWT A;  4FAS D;  3OYB A;  4W8R A;  4KT6 A;  4PFP A;  1W36 C;  1MW7 A;  1EA3 A;  1KCC A;  2XC7 A;  2VXD A;  2O0W A;  2X6X A;  2HPM A;  4PUS A;  2L9S A;  2KL4 A;  4RLF A;  2ZTN A;  4XON A;  3A2K A;  4OWR B;  3VSL A;  4TKO B;  3M1C A;  3CP8 A;  3GVJ A;  1EE6 A;  3W2A A;  3V42 A;  1WTH D;  1MNE A;  3VWB A;  1RMG A;  4B43 A;  3BG7 A;  3OYN A;  4BE2 A;  1E0E A;  3K4J A;  2INV A;  4BJ6 C;  2F5V A;  2X1E A;  3CJQ B;  3HC7 A;  1WMR A;  2V31 A;  4EW9 A;  4Y33 A;  2JSP A;  4PK4 A;  3OEE A;  2L2O A;  4QPO A;  3OPO A;  2KLO A;  2VJ4 A;  3BCD A;  4BS9 A;  2CFO A;  3K70 D;  4P22 A;  2D3L A;  3RSN A;  2PJR B;  1O8D A;  3B90 A;  2XOK A;  4YEL A;  2VAS A;  3VYU B;  2KVO A;  2O1D A;  1DGW Y;  1OR7 C;  1PLU A;  1V5E A;  4ZJZ A;  2BW3 B;  3OYK A;  4BDY A;  4LIU A;  4OJ6 A;  4AYB A;  4E7L A;  4D1Q A;  4CCJ A;  1X1A A;  1J09 A;  1MMD A;  3B4N A;  1GLN A;  2OUM A;  3H9Q A;  4B48 A;  2NTB A;  1BMF A;  3CZ6 A;  5LFA A;  2R7R A;  3H5R A;  4J00 A;  4TT3 A;  2IS2 A;  1HVX A;  2NT6 A;  5KNL A;  4W8Q A;  1D1C A;  1HZE A;  3DKX A;  4URR A;  2W6J A;  2VKH A;  1DP3 A;  4GQN A;  3ZCO A;  3FY3 A;  4RLQ A;  2IGN A;  1CZF A;  4ZTJ A;  1PE9 A;  1QHH D;  3MMY B;  2QX3 A;  3VDX A;  3VR6 A;  2VBE A;  2NTP A;  3DU6 A;  2VLA A;  3IUO A;  2ODL A;  4NC7 A;  1O8G A;  4TSF A;  3OEH A;  1K28 D;  1ZEL A;  1TT0 A;  2NST A;  5CQG A;  2CUZ A;  4XL9 A;  3OYH A;  2WY8 Q;  4BL0 B;  2QE7 A;  3BH4 A;  3EQO A;  4E7K A;  1AIR A;  3VSK A;  2F6C A;  2PEC A;  1W36 D;  4FXU A;  4NQW B;  4L8J A;  3AL0 C;  1T5E A;  2IS1 A;  1BR2 A;  3DQV C;  4W8T A;  2IS4 A;  2E1M B;  4N4N B;  5HOO A;  2JDI A;  2LBF A;  2XGJ A;  1V0E A;  4II3 A;  3ONQ A;  1OLT A;  2K9L A;  4PSX A;  1LFP A;  3MD2 A;  2V7Q A;  2IQ7 A;  3KRG A;  4OJO A;  2BVL A;  4B44 A;  2IS6 A;  4B3X A;  2KDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...