4XM3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xm3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xm3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xm3A02
3B4NA 2ODLA 4XLAA 2O0VA 2O17A 1OFLA 1QJVA 1IDJA 1KCDA 4XMYA 2O04A 2X3HA 2VJIA 1O8HA 2VBKA 4XL9A 4U4BA 4URRA 1OGMX 4OJLA 1O8MA 4OZZA 4Z03A 4OZYA 4XOPA 1RMGA 1CZFA 1O88A 3JURA 3WWGA 2QY1A 1H80A 1O8LA 2NSPA 2VBEA 4U49A 4OJPA 1RWRA 2NZMA 4Z05A 3B90A 2X6YA 1X0CA 2NSTA 4XN3A 1JRGA 4XM3A 4XORA 4W8RA 1BHEA 1O8IA 4YELA 1QCXA 1HG8A 2NT6A 4AVZA 3GRHA 1DBOA 4YZAA 1EE6A 1DBGA 1O8KA 4OJOA 4MXNA 1O8DA 1PE9A 4XNFA 4YZXA 1OFMA 3VMVA 1XG2A 4HWVA 3VSUA 4YZ0A 3ZSCA 3ZPPA 4XN0A 4NK6A 1IB4A 1BN8A 4XLEA 2PYGA 4YZQA 2VJJA 2X6XA 1O8FA 2NT9A 4OJ6A 2QXZA 1JTAA 3EQOA 4XLFA 4I84A 5C1EA 4EW9A 3T9GA 2UVEA 2X85A 3EQNA 3SUCA 2QX3A 3VSVA 2NTQA 1PXZA 3GQ8A 2PECA 4W8QA 1OGOX 4W8SA 3UW0A 5AMVA 2X6WA 3GQAA 2INVA 3LMWA 2INUA 1O8EA 1PLUA 4XONA 4OJ5A 3VMWA 4NK8A 4XR6A 2UVFA 4XLCA 4Z06A 4MR0A 4XLHA 1IA5A 4XQFA 2NTPA 1GQ8A 2IQ7A 3FY3A 3GQ9A 1WMRA 1KTWA 1K5CA 4XOTA 1NHCA 2BSPA 1O8JA 2O0WA 4W8TA 1KCCA 4C2LA 2PYHA 4YEJA 2O1DA 1IDKA 4PMHA 4XKVA 2VBMA 2EWEA 5C1CA 1VBLA 3KRGA 2NTBA 3GQ7A 3VSTA 3B8YA 1OOCA 1O8GA 4XKWA 1AIRA 1RU4A 2Z8GA
chains in the Genus database with same CATH superfamily
4L9NA 1FPQA 4MHGA 3JSPA 2JRMA 3ULQB 2R5YA 1SKYB 1QRYA 2HFHA 2XAFA 1BIAA 4LITA 3J81K 1QFZA 2B0LA 3ISPA 4FXUA 2R3SA 3F3XA 4E7JA 1AIPA 1S7OA 4U87A 4PC1A 1OGMX 1EV7A 4RM2A 2V9KA 4BNCA 2AO9A 2G0YA 2F4NA 2NVXJ 4A69C 1BX1A 2JPCA 4I98B 3HRSA 4AM3A 4LFUA 2LYCA 1USTA 2CQXA 3C2BA 3FXLA 3U21A 1JUSA 1LVAA 1LFPA 4MFDA 4JX5A 1SANA 2XDVA 4Z4WA 3PNTA 3A01A 3W6KB 4ENJA 2R4GA 2PBIA 2BY3A 3K4JA 1P6RA 3R4KA 4HX8A 1OQYA 4BAYA 1G7CA 1G7TA 2VNJA 1OCTC 1LDJA 4KIBA 1NK3P 2LSOA 3HOTA 2KKOA 2ZZEA 4RB1A 3VYUB 3S3OA 2NT6A 5D8KB 1QZYA 2EA4A 2XF5A 3BQZA 1FOXA 4HNUA 3GFMA 4NC7A 4PZJA 2XF7A 1WDTA 2RDPA 1UHMA 5KW9A 4ON0A 3ZPNA 2VB6A 3S1QJ 2D1HA 3VSUA 1WZ2A 4OU0A 2GJKA 4RLZA 2K40A 3F6VA 2XT2A 1RQPA 3QSYA 1R5NA 1FP2A 2L2OA 4IQJA 4YZQA 2Z2SB 4BHCA 4IHTA 3OYDA 1Y56A 1G2HA 3T9GA 4ESBA 4LBYA 1S8NA 2NVYJ 4BDZA 1OCCH 4BDYA 2PLFA 2PECA 1JTYA 3LSIA 1TNSA 5KVRA 2CC2A 2LK2A 1RETA 1P4AA 2EFPA 2MABA 3AG4H 3G1LA 3MD2A 4A3KJ 1GDTA 1ZH5A 4EGZA 4ESFA 3I4PA 3L2WA 3QFRA 3QFSA 1O3RA 3WU2C 2C5BA 1JKRC 3CMMA 2KT0A 3HOSA 2QE7A 3R61A 1H9TA 1JXSA 1WP6A 2NTPA 1Y6IA 2B5OA 1KZLA 1T95A 1ZK8A 3DWLE 4PFPA 3O6BB 4Z6YA 3ZN1A 1U2WA 2WAFA 2QKMB 3SDGA 2O3FA 1K79A 1K83J 1RUOA 4I76A 5EEHA 4HX7A 3BTJA 1KK0A 5DM6F 4G6QA 4ETSA 1T33A 3ZMSA 3WTVC 1QQ1A 2JWTA 2XVCA 2XOKA 4RBOA 3RDIA 2ZBUA 4DIQA 1SD7A 1IDYA 3GTQJ 4S04A 2PYHA 5FJ8J 4II2A 5BS6A 2Z9OA 3PQJA 1C0WA 3JRDA 2AQEA 4G12A 2ZZGA 2K85A 2DLLA 2VBMA 1T08B 3SZEA 1SVMA 3HSRA 4BEHB 1VQ6I 4QIWN 2R5ZB 3K4NA 3BPVA 2BEOA 4KT6A 3VR6A 2VFQA 4GCVA 2WR8A 2EZKA 1B2RA 1TLHB 2F5FA 1FT9A 3NWTA 1K9MD 2Y0SA 1G7RA 4RA2A 5BSYA 4Q5SF 2CUFA 1QJVA 1SD6A 1YJNI 1XN7A 1TLLA 2LFBA 3KFWX 2AS5F 3K2AA 3ZMUA 3OEEA 3CCVB 3CCRI 3GSIA 4NCNA 4CSWA 3JCUC 1GV5A 4HDVA 1FBUA 1OCOH 1IB0A 3R0AA 2A3SA 2K4BA 3A8IA 1TWAJ 5FRNA 4X6AJ 3PSFA 1CNFA 3ZP5A 5B6IA 3I56I 5CDFA 4KIGA 3ASPA 5IYPA 3LQEA 4ZGNB 2KIUA 2DODA 1RWRA 3F8BA 5F08A 1O7LA 1TT0A 2QKLB 5IYBJ 1ZTRA 3W2EA 2WB1A 1FBQA 2IEKA 1HC8A 1DPUA 4JQFA 4KFCA 4J0QA 4FK8A 1FX7A 2DYIA 2UV1A 3DBHB 3ECHA 3IUOA 1PP7U 2PMZA 3E0JB 2IGMA 4JMQA 2YWEA 3BH7B 3BPXA 3VDXA 2EILH 3N90A 1QNTA 2GXAA 2ZNZA 3WY9A 3M8FA 4E7IA 2HLDA 2VNHA 3M7GA 5F1RA 1I50J 3MKZA 4UXNA 3GXOA 2HVQA 3SZPA 2W6IA 2MH2A 2FNAA 4NK6A 1F9NA 3IHUA 5LHHA 4B09A 5ICFA 4BXFA 3CLQA 5JLVC 3GIRA 2LBFA 3D1NI 3T51B 4W1UA 3HDDA 4I84A 1OKRA 1ODDA 5FLVA 3SUCA 2X0LA 3G1MA 2VBWA 4KNYA 1HKQA 2VNKA 1S6LA 4M3FA 5TGTA 2PI0A 3GTMJ 3BZ6A 3OYAA 4LMYA 1ZM3A 2JDIA 3G71I 2X53S 3ZQFA 1YI2I 4DQLA 3DEUA 4QVJA 3W2FA 3CCSB 1PVEA 2CMPA 2E1CA 4F92B 1QA3A 4MO7A 4IPAA 3R0JA 2PJRA 1EA0A 2FQ4A 4CCOA 4L0ZB 3TEDA 3BR3A 3LOCA 4DNCA 5M3MJ 3JRAA 3CCUI 2IS1A 2R7DA 3V8LA 2K9LA 4MR0A 1MZBA 3H92A 2OZ6A 2EFGA 3CDHA 3CCQI 1MNMC 4XQFA 3GTGJ 3NE5B 2OC6A 1MMGA 2FF4A 4M72A 3BC9A 2ID6A 2VUMJ 4IRGA 1WMRA 2HNHA 3AAFA 4C9YA 5TV2A 1S9HA 4KT5C 2ELHA 3JTHA 4B44A 3UKGA 1R6RA 3ASNH 1KU2A 1E3HA 1OB0A 1O8JA 3I0TA 4U0WA 2HDDA 1NTCA 5FNZA 2V31A 1WI9A 1ZG3A 4UV9A 2BX6A 3ZN0A 2HXIA 3JREA 4MQVA 1YE9A 1R5GA 1RESA 2E2JJ 1YOVB 3EETA 2BPOA 5HLHA 4IZZA 3OOCA 4DK1A 2EPFA 1VTNC 4E7KA 5C4JJ 1GLNA 3OL4A 4YRVA 2M30A 4RPDA 4PMHA 1A6QA 2DTRA 1XMAA 3A3GA 2ZCWA 2VKDA 3F8CA 4QPQA 4YHBA 3KRGA 2VQGA 4N4NB 5GP9A 5IP6A 1G3YA 4AIKA 1L3LA 5CVRA 4Y7CA 2LVSA 3T0YA 1FMVA 4HW0A 3CCMB 1K8AD 4F52A 3S14J 3A03A 4PDKA 1EZGA 3H3ZA 2BV3A 3B4NA 5FRMA 4RCZA 2WWYA 2JJ7A 4KMUX 1BQEA 1COWA 1N77A 1JT0A 2R7SA 3JW4A 2FJ1A 4ZDLA 1QX4A 5K7ZA 2VJIA 2VBKA 4A93J 1DDNA 1XCBA 1N75A 4ITVA 4XRFA 3A01B 3U6BA 2YU3A 1GVDA 3I3LA 4OZZA 2H1KA 1VQ5B 2XPWA 3CCYA 5DD8A 1BW6A 2MC4A 5FROA 1TYVA 1H80A 3HB9A 2HYFA 2VT3A 5ICCA 1VQ7B 2NXNB 1P4WA 2M0MA 2DXIA 3QQAA 4M74A 1RIOH 3U2RA 1KONA 3ABLH 1JGGA 4HX4A 1QA6A 1VQ8I 3S2DJ 2YWGA 3GUDA 4Z4VA 1QGPA 4M3GA 1J9ZA 1UHSA 1VQMB 5CVUA 2JA6J 4KUMA 3QU3A 3OAAA 4WZKA 2M5WA 2VQCA 1KK2A 2M1BA 1WTHD 4YZAA 3ZZUA 4HE6A 4RDLA 4HYEA 2NVUB 4G1VA 2KPMA 1CF7A 2Q2EA 2GJRA 2W57A 3JQRA 1G4DA 2VN2A 4S05A 3N97A 4HWVA 4PC3A 3CO6C 3M07A 4AVPA 1DP3A 1QGAA 4OINF 4M53A 2FA5A 1SMTA 3BJAA 2Q6LA 3ABUA 3QFCA 2ETHA 5IT3A 4HRIA 5E3MA 3RSNA 4CO8A 3SJPA 2QVOA 2FEZA 4QWQA 1B23P 4IW3B 4RD2A 3PIOF 5DS0A 1F5TA 1YJ9I 4HIZA 3KIOA 2P6TA 1HOMA 2C2WA 3G6EB 1K61A 3GW2A 3WTYC 1WSRA 2Z5UA 1QA1A 2OTJB 5M3FJ 4XR6A 3PSIA 1B1BA 2KRFA 3RZOJ 2D74A 1HXDA 2GZWA 1O3TA 6PAXA 4OIOF 1GO2A 2EFOA 4Z1MA 4G94A 3LSJA 5GAEJ 4NHJA 4JP0A 2JN9A 2ZC2A 3C18A 4PSWA 3WU0A 2LDUA 1QRBA 2IRFG 2YWFA 2XZLA 4QFMA 3V42A 4BGDA 1HDDC 3ZQ7A 2IGOA 3KYCB 3K4CA 3ONQA 3WXMA 4KJZA 2OK8A 2R7OA 1R1TA 2XIGA 4UVCA 1F1ZA 2QGUA 1SEUA 1YIJI 2Q0OA 4ESJA 4C2LA 2HPIA 2YX4A 1PKVA 3I55I 5CQEA 1R36A 1PUFA 1G3SA 1ZRFA 2V4JC 2VZLA 2Z16A 4LK1F 3PQKA 2HI3A 3OE7A 1WH5A 3CP8A 3TO6A 4P3IA 1MD0A 2K02A 2NS0A 4RMNA 4EMSA 1EH6A 1GV2A 4D5CA 1X58A 4RB3C 3MVPA 4U7DA 3GLLA 2V7XA 2XAJA 3H35A 4I02A 4A3BJ 1ZYRF 1SVLA 1R23A 5EJCA 4HA8A 3C1DA 3RIRA 1MDMA 1IAWA 2CF4A 3BP8A 3G4SB 2OTLB 2L7ZA 3DU6A 1R1UA 4A0XA 2Y0MA 1TYUA 2BVLA 1I3AA 1OMIA 3SDBA 1D1NA 4URRA 4A3IJ 1I27A 2RNJA 1EJ9A 2M8GX 4ZTFA 3LQ6A 2M45A 3ZMDA 3TW7A 1TT5B 2R9VA 2NSTA 2IBDA 3FZVA 1A5JA 2A5YB 5A2QK 4HLYA 3H94A 4IKFA 4YXWA 2PFBA 1IDKA 4IHVA 2COMA 1BW5A 2E35A 4UUTA 2XAHA 4B48A 3LSTA 4B3FX 2P5LC 2YX7A 3JRGA 2JA2A 1Y0RA 2FBKA 4ASNA 2X1DA 3K0LA 3B82A 3HOUJ 3TO9A 1W5TA 3HGYA 3CC7I 3HOYJ 4B4CA 4YG2F 1AWCA 1RQRA 1QO0D 2PN6A 5EEGA 1JTXA 4G1BA 2H8WA 1TQPA 1QZZA 3G1OA 2YS9A 3RPUD 1YJWI 3A8JA 2I8DA 5EEAA 3CCLI 2DFFA 2LBFB 1PE9A 4L18B 5KSWB 1WGXA 2FSWA 1ON1A 3J80K 3ESWB 1M1EB 1TTYA 4LB5A 2PJPA 2NPFA 4NDLA 4XN0A 2DFHA 2MLKA 2BGIA 1R58A 4ZCIA 5HLTA 1TWHJ 1N0VC 5E3NA 3ZBUA 2D3LA 2EQRA 1FDRA 2ZTNA 2GWRA 2Z33A 2JA8J 3UW0A 3ZZTA 2F5EA 2ZFWA 2X0KA 3ABMH 2BF4A 3VO1A 2QYUA 2IVMA 3TH0A 3PFIA 5KAIC 1S5LC 2JUGA 2VJ4A 3HRUA 3P9KA 4BJTA 2ZTGA 2LLKA 4CCJA 2UVFA 1ZGAA 2Y31A 3HHGA 3AVTA 1IA5A 2F5CA 2HEOA 4ZDOA 5E20A 2OZUA 3VSLA 5LBQA 4RGRA 4V2GA 3S3MA 2JQ7A 4X1EA 9ANTA 1IJFA 2CK3A 1XGOA 3ZIAA 3PVDA 3PNVA 1X4OA 1UD3A 1YHQB 3CP2A 2HDNB 3KP7A 1MBGA 5F6FA 4O5VA 1QVTA 3MCZA 2ZSIB 1JUPA 2X51A 4XBFA 4CA0A 1QUFA 2OBSA 1DARA 4QVAA 2O1DA 3K70D 1T8IA 3X2QH 3OP1A 1K4SA 2BYVE 3CMEB 1BIBA 3LSRA 1KQ0A 3B73A 2GBYA 3OPOA 3ZBTA 4XRMA 5HS8A 1Y8QB 2CW0F 2DCUA 2K9MA 4UVBA 3HRMA 5H2FC 5JLWA 5DSZA 1N8RD 1WPKA 3RKXA 3JRFA 1W2BB 3HC7A 4LD5A 1VQ9B 5ICGA 1S72I 4WK8F 1JJ6C 1TC3C 4P22A 3DLLF 3P27A 5EDNA 4FN5A 1W1WE 5J35A 2DA1A 2V4DA 3HOZJ 2FNPA 1U3EM 1LFUP 5GTHC 4DBQA 4HF2A 1BJZA 1B8IB 2BMWA 3L09A 5GV8A 2CUJA 4LJZF 3K4MA 4GYIA 3WGIA 2X3HA 4X7CA 3GFJA 5A89A 3SFIA 5D5WB 1MIJA 3T8TA 3CD6B 2BHZA 3CDLA 1HSTA 2H6BA 5FA6A 4XOPA 1TBXA 1YX5A 2ESHA 3ZOBA 1DABA 2Z3YA 1HW2A 1POGA 2L9SA 1O8LA 1UFMA 1PP8F 1W9XA 3KP3A 1VQPB 3O2PE 3E6CC 2B0RA 1K78B 4ZV4A 1IO2A 4UUSA 2RGVA 3BJ6A 4EV0A 3GX4X 4FQGA 2QEXB 3VFZA 4FT8A 3BH4A 2GLOA 2Q2EB 5FD6A 5C3EJ 1J7KA 2HOSA 2O03A 4U0YA 3ABTA 2ZZFA 4BEHA 3SFZA 5IP7J 4BL0B 5FFZA 4XRSG 2G7HA 3GRHA 1MJAA 3DF8A 4AIDA 1XSXA 4F3QA 3HG9A 1SD5A 3VEPA 5EGOB 3MKYB 4R8HA 4V19K 4D0PA 1IUYA 1KMHA 4G6TB 1XG2A 1KQSB 1IN7A 2CBXA 4YZ0A 1X1DA 3TDZC 1VHOA 5FKNA 3KPHA 3FMQA 4LIVA 5LHIA 4P96A 3PENA 1IB4A 4ZC3A 1FYMA 1K7AA 3AVVA 1GUUA 3SJMA 2VKEA 4ENMA 3ZZ0A 2QM3A 4LB6B 4EH1A 2ISYA 1VQOB 4W8QA 5KK1A 3K2ZA 3GLXA 2F5VA 2XGEA 1XC5A 3F72A 2WJYA 5D5VB 5LGTA 2EZLA 3A35A 1FNNA 2EFQA 1GT0C 1KQ8A 1HA3A 4HLXA 3UNGC 2DT7B 4ACBA 1LJ9A 1MH3A 3FK6A 3OYNA 3HPHA 2DBBA 2BVNA 2XEXA 2RVCA 1GQ8A 1IXSB 3ECOA 2CRVA 2V7FA 5FKOA 3C2GA 3AVUA 2Q6OA 2QZ8A 3CTAA 3FXRA 2FD5A 4JBAA 3RQ4A 2CH0A 3PNYA 1KU7A 3S1NJ 4UB6C 1Q82D 4W8TA 4CH7A 5J6XA 2W24A 2PE3A 1NK2P 2IA1A 1BI3A 1J0RA 1FY7A 1QFYA 4ZYHA 1ZM4A 3V76A 3H9QA 1QG0A 1W5CC 5DTDA 3RYRA 4EATA 1MDMB 1FSHA 2A68F 4OOIA 2OPTA 3ZCOA 1ETYA 4P25A 1N25A 2XPVA 5TR9A 4YAWA 1MBJA 1IC8A 2HZTA 3GMEA 3SZGA 3W6JB 5JR3A 5FLMJ 4NBQA 4HV5A 5D8LB 1OGJA 1VHEA 3OYJA 3OKXA 1Y0YA 3BCBA 2QQBA 4PJNA 1W0UA 4IF4A 2GM4A 1U6GA 1IN8A 2JRTA 2QGGA 1MBEA 3WE3A 1O8HA 2DAOA 1BJAA 2ZXHA 3G73A 4JX6A 1Q9SA 3GZ5A 4KN7X 4OJLA 2IA0A 4P3YA 4BPRA 1VLYA 4UHTA 4RB2C 2CQQA 3F9KA 2VBXA 3HEFA 4IQ4A 4XIDA 3CCEI 5M5WJ 1A35A 2KVOA 1IN6A 3ONUA 1R00A 5FFXA 4KN4X 2CYYA 3E6MA 3S2WA 3MHPA 2CFXA 3WODF 4RCYA 1IUFA 3ASSA 3W5HA 3RYPA 3CC4B 1T2KA 2VFMA 3RIQA 3OW7A 1KC8D 3FJOA 4XN3A 1BC8C 2ZXWH 3GO5A 3WTWC 3COAC 3RI4A 3F8MA 4XM3A 1A31A 4OPWA 4W8RA 4IJAA 1QCXA 2FE3A 4AD9A 3QP5A 4Y15A 4MQ9F 2DETA 2DYRH 4RS8A 4OJOA 3LMMA 1D1BA 1R71A 3ZMTA 3QYFA 2IJLA 2WBMA 3CMAI 3WG9A 4C2MJ 3M4OJ 1FTZA 5EYRA 1UCRA 3ZRGA 1FIAA 4DOZA 4YIFA 2VE9A 4PABA 3S1MJ 2E5ZA 2K3FA 4M9ZA 4MTDA 4DYQA 2L7FP 3KZZA 3H0GJ 5HKKA 2LH9A 1O8FA 1RUNA 1F60A 4GQNA 1W0KA 3G6EI 3G3ZA 4A0YA 2H27A 1E63A 3GQ8A 1FZPB 1KZHA 2O5RA 2B7BA 2MA3A 1ETQA 2LC2A 3IC7A 1WVRA 3OS0A 2COBA 3FIWA 1WOSA 4C43A 3VB2A 4J00A 1WJFA 2XGCA 1Z21A 2XTXA 1RI7A 2H6CA 5IPAA 5C44J 2QA4I 2L9RA 4Q48A 2E2IJ 3QE2A 2E60A 3Q9VA 4BY1J 2RREA 3HSEA 3M9AA 3SLDA 2E1OA 1QVUA 3HM5A 3E7LA 3FM3A 2BZTA 3IKVA 2R7FA 3QYBA 2R7WA 4BACA 4IHSA 4CQJA 3W5VA 3OW2B 2VJ5A 3HUGB 5IT9K 2GXGA 2M5SA 5ICEA 2WYRA 1YW9A 2QQ8A 2X9DA 2DDBA 3HOVJ 2FX3A 1KTWA 4PFOA 1WJAA 2OAZA 5IYDJ 4Y52J 2BSPA 4UB8C 1T0FA 2F43A 3BTLA 2HQRA 2PQ8A 4HG2A 3K4KA 1WU8A 1K4ZA 1U5TA 4Y4RA 4F91B 1LLZA 4F93B 2KJBA 3LSHA 1F43A 4CYCA 3W2IA 4PGHA 1CQTA 2BGCA 2O0YA 4ZGQB 3FKSA 4XKVA 3ZQGA 4G6IA 1ORKA 3NEUA 4S0HB 3QAHA 4PJMA 2LF7A 4BE1A 1Y0UA 2JSCA 3T8RA 1KK3A 5CVJA 3E1YE 2VFNA 2PLYA 3OYKA 4A3MJ 3J7AO 3CXCB 4CCNA 1W0JA 4HNTA 3C7JA 2JA5J 2C5HA 2HTJA 4BU2A 4M6YA 2PG4A 4YIIA 2QTZA 3TW6A 1GAQA 1Y0NA 2X48A 2H8RA 4WZTA 1TSPA 5J4VA 3D5LA 1J59A 1O57A 3KLOA 2EIXA 5IYNA 5J1RA 4WXHA 4UUVA 4I2OA 4Y13A 1ELOA 1MH4A 4ANJA 3T1BA 1F4KA 2JVGA 3WE2A 4UUSB 5BMZA 2WV0A 1SFOJ 3JRBA 1KJZA 2RV8A 3WWGA 2QSFX 4DJAA 2D45A 2ECCA 4OJPA 4P1VA 4HF0A 3FMRA 2ZITA 4KISA 2DOEA 3S2HJ 1YW8A 3SY2A 2E1MB 2XRLA 2RC5A 3GVLA 4FE4A 3CJQB 2P4WA 1DDGA 3BR1A 3QPLA 3I59A 2V1UA 5IYQA 1HG8A 1LDDA 2O8XA 3JRIA 5L3DA 4AF6A 4CYDA 1W7PA 4A5NA 1FOYA 1EE6A 3E5UA 5BPIA 2XSJC 4MXNA 1QUEA 3HJEA 2QQAA 3CCJB 1VZ0A 1LM1A 1Y8RB 2W7ZA 4CZZA 3OYCA 5KNLA 3LSPA 1EP3B 1TVCA 2C78A 3HZJA 4EEFG 2WPDA 2J8IA 3C2HA 1IXRC 2DA5A 3M8EA 2R7ZJ 2ZFUA 4DGWB 2R7TA 4XLEA 1NB0A 3FK7A 4E7HA 1UMKA 1E3XA 1X2NA 2CG4A 2ZXJA 2W7NA 4DQKA 4A3JJ 2W4SA 3EQOA 3D0SA 4PSXA 5KAFC 2R7UA 1ERDA 1PXZA 2DMQA 4W8SA 3VYRB 1ZLJA 3S8PA 1I8DA 2XTWA 1IRFA 3K1NA 3IWFA 3IWZA 1KA8A 1WWXA 3SXYA 4BH9A 4D5FA 5EZHA 4G7ZF 3K1MA 3AL0B 3KEQA 3GVJA 2INUA 2W6JA 1B9MA 4PC6A 2A5WA 4TMVA 1SFUA 3A8KA 4EJOA 1D1AA 4BHPA 2VYQA 5LEKA 1EH7A 4OPOA 3DXJF 5LFAA 4B3GA 4BY7J 3A0BC 3J7ZI 4OIQF 4DK0A 1VF9A 5DS9A 1YQAA 3QPSA 2DQRA 2XROA 3LNQA 1EP2B 2DN0A 4PJJA 1V5VA 2DA4A 2DY1A 4BKXA 2W48A 5CPRB 2J8KA 4OOXA 4MTEA 2L9VA 3J7AY 4ZTJA 1WQ2A 2HKOA 5J1YA 3L2VA 1JE8A 2VXDA 1BR4A 5FKLA 2KRHA 3OYFA 2CW5A 2KZGA 2LRDA 2P0WA 2J7KA 3SYJA 3HGGA 2IS2A 3VODA 3FPKA 1EWYA 2A61A 1YX2A 4EJUA 2FBIA 3FF5A 3RKWA 1KQ9A 2AXTC 1AMOA 2TDXA 5J8CA 2ZXIA 4JX4A 1VQKI 4AC9A 1X1CA 3E5XA 3LA2A 4GYGA 4Y33A 1UD8A 1VBLA 1JI8A 3DP7A 3AG2H 1DQUA 2RAEA 1E3OC 4N4OB 1MMSA 3OIQA 5K5OA 5HODA 4L0YB 3Q3AA 2Y69H 4MGRA 2M7AA 5HDGA 1LDKB 1YRNB 2R7QA 3FKJA 1DUXC 1IRXA 4H9GA 1OCRH 1OR7A 1B6AA 2F2EA 3DTKA 5AIPA 3IL2A 2KDOA 5H20A 1Q81D 1IF1A 5LMZA 1LB2A 4Z4RA 1SM4A 2V1XA 2ZSHB 3A0HC 4RM3A 2GK7A 4U4BA 3M8JA 3LQQA 2YU9J 3PM1A 3DKYA 3OYBA 1K8FA 2A6EF 2K7LA 1TZLA 3OZUA 1TW3A 2BY2A 3JURA 3BY6A 4UZUA 1Z7UA 4I0AA 3W2VA 1B9NA 1BR1A 2VBEA 3H3UA 2ACJA 1BM9A 3AG3H 4BQAA 3WHBA 5IYWA 4ENNA 2F3LA 3B90A 5IOZA 3H5AA 2V79A 1FNBA 2UXNA 3JQQA 1LLWA 1S3JA 2IT0A 1DP7P 1GJRA 2F1MA 2I1LA 1APLC 2XNCA 4LG0B 2GJPA 3ML3A 2LP0A 1YITI 2RQQA 1TTTA 2GIZA 4IL6C 2L02A 2M3AA 1BHEA 1DGRM 3JX8A 2Y30A 1B4AA 2RC4A 1V3FA 3I64A 4AF7A 3H9NA 5E6TA 2ELJA 4ZCMA 2OQGA 5F27A 5EG0B 3VMVA 4FX0A 4M71A 4PJ0C 1U9OA 2P6SA 1B8IA 2Y48A 3HXLA 3Q0WA 3HBLA 2LR8A 3QOEA 1EFTA 4ROXA 2V26A 4AU7A 4Z2YA 5E1WA 3HL2A 1JHHA 2W25A 3SQNA 1ZQ3P 1FP1D 1W36C 5FLXK 4K2EA 2LKSA 4HQEA 1GVHA 2VKHA 3SZTA 1ZHFA 2NVTJ 2FMLA 4YCQA 1JKOC 5E79C 1OGOX 2CWEA 2BN4A 3FXKA 4ZYGA 1VQLB 4Y9RA 5D4RA 2BM4A 1BI1A 3H1CA 3Q9SA 3I71A 1EFUA 4R1HA 1NRKA 2INVA 3AVWA 1T0FC 3PUBA 3HAGA 1ZGJA 1K78A 1O8EA 2CRGA 2KIFA 3DPTA 1X3ZB 2R6HA 4OJ5A 4LLLA 1LE8B 5J3LA 3V8JA 4MNUA 2K9QA 3WGGA 3DU5A 4KMFA 2VBVA 3AK5A 2JZYA 1T6XA 1E64A 1I39A 2FVGA 1VQ4I 2OK7A 2EIMH 4OAZA 4GDFA 3PSZA 1LEBA 2IGKA 4WWCA 1QHGA 3JRCA 2RN7A 4UNOA 1BOBA 4KITB 1FNDA 1KYZA 1U5TB 4WZEA 1EA3A 2WADA 3BT9A 3QWLA 3W3CA 3D26A 5EGOA 4CYCB 2XV4S 3I58A 3DKWA 5L3BA 5LLQA 2EK5A 5THXA 2EV5A 5DCFA 4AYBA 1GHCA 4YC5A 4BBSJ 2WAQN 2E19A 2C6YA 1D1CA 2I10A 4XLPF 2OD5A 2E36A 2W85A 2QTLA 4EM2A 1CLWA 5B3SH 1HA8A 4RD1A 3QP6A 3VOEA 3RCOA 3K69A 2FBHA 2HS5A 1X19A 1IXCA 3ZMZA 1D2EA 4KKUA 4M4SA 2UUZA 1W5SA 1Z0XA 4P2NA 4EQQA 3OR1C 2ZMEB 1UG2A 5F4OA 3KEOA 1P92A 2W00A 3IH4A 5K1YA 2V7VA 5B5EC 1WOOA 2WY8Q 4RLQA 2BM1A 4ZYEA 2V1NA 3FBNB 2WJVA 4G7WA 4KKSA 5D5UB 1ZKGA 1OYWA 4HZFA 4QTRA 3RKQA 1JHFA 1MJBA 2D2WA 2Y9ZA 3ES9A 1VJSA 1OFLA 4RM0A 4TT3A 4KIFA 4OMYA 2QSHX 3K1PA 2XT4A 1J75A 5K5RA 4E4HA 4NNJA 3CRZA 3OS2A 4XSZF 2STWA 3H0DA 4Z03A 3OV8A 1TW2A 2E7WA 2HQ5A 3I59B 4A6EA 1N78A 1T6ZA 2NZMA 2IAIA 3JR9A 2HU9A 1T6YA 4X7FA 1W7PB 4G7HF 2MW8A 5BNGA 4QLCU 1X0CA 1MBFA 1ZARA 2PEXA 2GA2A 2GAUA 1YS6A 3OYEA 4PJLA 2QUFA 4B8XA 3MKLA 3AG1H 3Q6QA 3D5RC 3CZ6A 4IHWA 1DBOA 1RMGA 2HXOA 5HLGA 1O8DA 4N9IA 3GTJJ 4CUGA 5HVQC 2XF6A 1D8TA 3VMFA 3BZCA 4HSRA 2ID3A 2VFOA 1R49A 3BJOA 2JMWA 2HPMA 5FGMA 3BWGA 4KA4A 1FOKA 3SJZA 4UAJA 2TRTA 5GV7A 2YWHA 4OJ6A 2MC3A 4GFBA 1R5HA 4LGWA 4E7SA 2D5VA 3I1FA 4ACAA 4FWTA 1I6XA 1UELB 2HYGD 1Y1WJ 2BHYA 1HCRA 2JIZA 1N08A 4UVAA 4P5OA 3DDYA 3H9JA 4GGGA 4RPBA 1D8JA 2GPJA 3HKZN 3JQPA 1PUEE 4M6VA 4OPVA 3CJRB 2LY9A 1IGNA 1D0YA 3J81Z 1PJ6A 3NB2A 3WGHA 2DI3A 3VMWA 2VASA 1EXMA 2FOKA 3GZNB 5ILSA 1FRNA 4YAUA 3UR3C 1XDUA 3DEWA 3R6JA 4U9UA 1TWFJ 2VQLA 3SHFA 2DQLA 4PK4A 4DZPA 4LBZA 1DU6A 4OWRB 4LG3A 2MGQA 5K5QA 4IHYA 1I6HJ 3GQBA 3IAM2 3LL7A 3F6OA 1WRJA 5LHGA 3ONYA 3F23A 1NJID 1TYWA 3HYIA 1DGWY 4GXOA 1X1BA 1T98A 2L9NA 3RJPA 5JMCB 3LA3A 1OR7C 2CS3A 2F5DA 1QVFB 1XDSA 3AGPA 1N07A 2DERA 3RQIA 2XPUA 5FD5A 4NC8A 4A3GJ 2AHOA 1YJNB 3U1DA 3BZKA 1B59A 4HDUA 2X3UA 3CCRB 2M4GA 3ABKH 2YR2A 3ROUA 4YAOA 3DQVC 4RGXA 2YUSA 2NTBA 4KH3A 3H5RA 5IT9Z 1CQXA 2LMDA 1DG1G 1HLVA 2DPUA 4M3DA 3SKBA 3A1YA 4WX9A 2XGJA 1XX5A 4L5IA 1XMKA 2KMUA 2E2HJ 3I56B 3TDUC 2XGDA 1OB5A 4B1RA 3BR2A 2IW5A 3SYTA 2Q1ZB 1Z05A 3JAMK 2KJCA 5FB2A 3HUGA 3SEQA 3V4GA 3GBGA 5ILVA 3KZIC 4TMZA 1UMQA 1G6NA 4NBSA 3PIPF 4C2UA 2A69F 2E34A 2OUMA 3TQNA 3HTSB 3A4CA 5IY5H 2L4AA 3ELKA 4YFKF 4Y17A 5F04A 2ME6A 1MMNA 2BVMA 1QPIA 1EF4A 2F48A 3E6BA 3FWEA 1RC9A 2ZKZA 4PC2A 2WC2A 2EH3A 3V7CA 2X1EA 2X6YA 2Z1DA 5GTIC 3ASRA 1J2XA 3VO2A 5DV5A 5H6RA 3CCVI 1U0JA 2EINH 3KP4A 1BMFA 3KZYA 4BS9A 3BG5A 1UD4A 1O8IA 5J4YA 4RAYA 1XFOA 2B7CA 1N06A 2L01A 4XSXF 2YSRA 2QZAA 3TL4X 2OF7A 1YG2A 4Q7JB 5F4JA 2KRCA 1TWGJ 3WYAA 3G71B 1O3SA 1YI2B 1N0UA 5KCMA 4XNFA 3WTTC 1VLOA 5B1AH 1SAUA 1SD4A 3ZQQA 4AUXA 4IOCF 4AIHA 1FYLA 1VNDA 4KICA 1O4XA 3LAJA 5FL7A 3CCUB 1K28D 5EMNA 4LBVA 3GFLA 3ZQLA 2F4IA 3V8KA 4M73A 2VJJA 5TY0A 3CCQB 1RRJA 4BBRJ 5F1JA 4N0BA 1E43A 1EFCA 2X85A 4YDTA 2XKOA 1Q1VA 1HZEA 3BY2A 1QFJA 2BM6A 2HZDA 2DA2A 5E3OA 1FNMA 3H09A 3F0CA 1B72A 3OJXA 3DTIA 4PGOA 1T56A 4TMTA 4C3IJ 4UV8A 3O3KA 1UD2A 4HAMA 4M3BA 2V6CA 2EIJH 2CV1A 1KQ5A 2F6CA 1IG7A 2DMTA 2G7UA 2IQ7A 1ZG1A 4X7DA 2O6WA 3FISA 3I5UA 4TN1A 2RNGA 2NS7A 3CDIA 2JJ2A 1X2MA 4XOTA 4LK0F 3CCSI 1XGSA 4P6YA 4OOSA 1Y39A 1XS9A 2QF7A 2O0WA 1KCCA 3NARA 2OCEA 3JU4A 1UHWA 3KETA 2IGNA 2JN6A 1KGSA 3AVXA 1BBYA 4CGZA 1YIOA 5GPCA 2ECBA 4CHUA 2VBTA 1ZLKA 5FO0A 2OCCH 1HKSA 5F4MA 1UG0A 1KU3A 1H89C 1HBXG 2IA2A 1NH3A 3FPPA 4A12A 1Z7LA 1XTAA 5F64A 2HR3A 1OCPA 4DBRA 1Z67A 1GXPA 2JVHA 4KDPA 1H85A 3K4BA 3CC2B 1DU0A 1P4MA 1WKMA 3P9CA 4OAYA 1U78A 3VNUA 2DU9A 4A3FJ 1ZREA 1FYKA 1OB2A 1D5YA 2DA3A 2ZL5A 5J47A 5LEJA 3K10A 3L2RA 4XKWA 2VXZA 2ZB9A 1UD6A 1WJDA 3OL3A 3TMOA 2LNBA 1PJ7A 1WOPA 2VC0A 2MBFA 3CUQB 1Z3XA 2HDWA 3A1PA 3BG6A 1RU4A 4FX4A 3U9GA 2K27A 1VQ8B 2Q8KA 3Q39A 1Z6RA 4NUBA 5L3FA 2WZNA 3S15J 4X7EA 2LREA 5JBQA 1V54H 2X6OA 5L3GA 3DTEA 1Q86D 1A36A 2HDCA 3L7WA 1D3YA 3U6KA 2CU7A 4ZH4F 2I5UA 2BSAA 3CCMI 5ERIA 2BM5A 1JB9A 4LLGF 1LEAA 2QMUA 1QHHD 5B66C 1S7AA 3BROA 2KQRA 1KYWA 5HDNA 5LRSA 1I3QJ 2K86A 4QPOA 1E1QA 2CJJA 3ASTA 1YLOA 4FETA 2VI6A 3S93A 1DDIA 3OMYA 2DOGA 3BG3A 1ULYA 2JSPA 5IYRA 2WV1A 2A6TA 1OFEA 2EIKH 4PGGA 4EM1A 3KYDB 1H42A 3MEXA 2KFDA 4HEA2 3G05A 3OEHA 3FKIJ 2LTPA 3BH6B 4BYYA 1VQ5I 3GFIA 4IVNA 1ZRDA 2X8KA 1YRNA 2LD5A 2WAQA 1YJ9B 1STZA 2DMPA 4YFXF 2VODA 1VQ7I 4YZXA 2K9SA 2DPDA 3QYEA 4IEJA 3J7YJ 3W5UA 2DA6A 2DJNA 2OBRA 3MAJA 4XLNF 1Z9CA 4WCGA 1N05A 1R5BA 4RD3A 4XRSA 1WJEA 3I54A 2JUCA 3F8FA 4IOAF 3IKTA 3ZC3A 1WJ5A 1HF0A 1MW7A 2F4MB 1VQMI 2A6HF 1AKHB 2ZJ2A 2NT9A 4P1WA 4A0ZA 4P9SA 3RPUA 2OBPA 3BY1A 3PO2J 3PUFA 3LSGA 4X05A 1FEXA 2D1VA 1TQMA 1D0XA 2ZO4A 5J8FA 3AGQA 4MYUA 5E8GA 1RR7A 1ZR2A 3LMWA 4ENKA 2ELKA 4RDUA 3LSMA 4FCYA 4EJVA 2QQ9A 2HOTA 4BHBA 1FSEA 1D5VA 1YIJB 1JJ8C 5DCMB 1BL0A 4RDKA 1ETOA 3E6DA 4LG0A 2PMDA 3I55B 4AC0A 4E7LA 3KEWA 2V1DA 4FASD 2VPRA 2PMUA 3GF2A 1MSEC 1FX0A 1F20A 5TISC 4X0GA 2CNDA 2KDZA 5AN9A 1ONVA 1MMDA 5BPDA 3E20A 5FLXZ 1K6OA 1K5CA 1G8XA 2DFEA 1WSVA 1FBSA 5EG0A 1S0UA 4Z4SA 5DN6A 1GR1A 3KP6A 2M4KA 2LG4A 4B3XA 2OTJI 2MG4A 2CUZA 2V7UA 2XGXA 3LNNA 1IW7F 2BXZA 4KYWA 1A8PA 4M3EA 3TKYA 2O8KA 2FUG2 1S4MA 5E1XA 3FXMA 3CJNA 2OBTA 1KTVA 1SFEA 4M9SA 3GQ7A 4B4DA 2VBSA 4B3AA 3B6AA 1LE8A 1ETXA 2M0CA 2ISZA 1X1PA 4QSHA 2P3MA 1CGPA 4HNVA 1AIRA 2Z8GA 1O7FA 1YLFA 3IV5A 4IRIA 4XLAA 2XZOA 1ITYA 3RZDJ 5JHUA 3B02A 1TWCJ 5CJ9A 5BSXA 1QZEA 3DCFA 4A6DA 1KCDA 2ZJQF 1IV6A 4OMZA 2O04A 3CC7B 3N4MA 4G6DA 2VLAA 4RAGA 3DU1X 2XASA 3LFUA 2AQFA 4YEIA 1IN4A 5LGNA 2KP6A 2VC1A 4MYTA 3HKZA 2EV6A 1O88A 1FC3A 1H9GA 1YJWB 1NB9A 1R5ID 2AHQA 2ZL6A 3CCLB 3BNWA 2V6EA 5CKTA 4C3JJ 2E71A 3CUOA 3PUMA 2CV0A 3J81k 2K9NA 1ZN2A 3Q0VA 3K7AJ 2CQ7A 2BM7A 5KHDA 3G4SI 2OTLI 4MIMA 3MN2A 4DQ2A 3A3BA 3BCFA 1OISA 4N3GA 3ZQCA 4K1XA 2RC6A 3CF5F 2BM0A 2ESNA 2P7CB 1S7EA 2L54A 1KD1D 2P5KA 4TMXA 2ZMEA 3WNBA 1TYXA 1SMYF 3MZYA 2BW3B 2EZHA 4P9UA 1O3QA 3OYIA 4QHYA 5HNHA 4D1QA 4HPQA 2K5CA 2BGJA 3HOWJ 4WZLA 3W2GA 1V0EA 2O7OA 3LAPA 4BE0A 2C4TA 1IRGA 1MRZA 5FIUA 2BXYA 2E1MC 5FO5A 3TP3A 2WZPP 4A5MA 4LOCA 2WSSA 4YFOA 2IXSA 1EKEA 1T5EA 5HOOA 2FOWA 3H36A 4ZZDA 1BN8A 1B72B 2PYGA 1E3PA 1SAXA 2QXZA 2VL8A 2XC1A 3S32A 4Y3OA 3FMSA 1IN5A 5HS7A 4ASUA 2UVEA 3EQNA 3OOPA 1IV8A 4IO9F 3AFHA 4A3CJ 4M6XA 2X6WA 3GQAA 1XMXA 2OQRA 4EJTA 1Z91A 2O9LA 1UD5A 1XB4A 3MZ8A 2B7EA 4XONA 5L3CA 1XB2A 1S29A 2VFPA 3GYHX 2A07F 5A8AA 1U8BA 4XLCA 3L1PA 2ZNYA 1UJ8A 2BOLA 5LD2C 3QFTA 1BI0A 2ZBKA 2DYSH 1FOWA 4BE2A 4QUZA 2NNNA 5A2QZ 5B1BH 5CQGA 2J5PA 3AL0C 4QV2A 1A6IA 2GREA 3KP2A 4P6VF 2HVRA 1RPWA 2EFNA 2VBUA 1WHUA 4TSFA 1S72B 4HQMA 2R7VA 2DEUA 1WORA 3GZ6A 4I6ZA 2JT1A 2J5OA 4D7NA 3H3VK 4JK1X 5BOXA 2V5IA 4TKOB 5AONA 3FHNA 1Z3YA 3BOQA 1BLIA 1QH0A 1R5OA 4X0CA 4CXFA 1MSFC 1R7JA 3KLNA 2LKPA 1OLTA 2EWEA 1JJ2B 2DIEA 1I5ZA 3J80Z 2VBYA 3FXUA 1IJEA 4IXAA 3WTZA 3ZMVA 3LFKA 3QOPA 4ZYDA 1K4TA 1YHQI 1TUIA 3W2HA 1MNEA 1OOCA 5CVVA 3GTOJ 3V7RA 1E1RA 3TOBA 1ETWA 4WF2A 2LZJA 3L2QA 3W2AA 2ZBVA 2HKXA 1EFRA 3MCAA 3IRQA 4IRHA 3CMEI 3HPGA 2XKPA 2O0VA 5K7HA 2DDAA 4RD6A 2G0EA 4AIJA 4W97A 5BQTA 3KE2A 3NWSA 5J40A 2VT2A 1AA7A 1LVKA 4WXDA 3H9GA 5JVGF 4OIPF 4NQWA 5E8IA 1VQ9I 4A3EJ 4RAZA 2MH9A 1CZFA 3IH3A 4RAFA 1E79A 4LBWA 2ADUA 5IK2A 2QY1A 5E18F 2Q6IA 2E5NA 2NSPA 2O61A 3RY8A 2CFOA 3DBRB 2E1NA 2ME0A 3BLYA 3TOAA 2XTYA 4Z05A 1HDPA 3B8HA 1BJKA 5E3LA 2RKHA 3FX3A 4MLOA 2KLOA 1T39A 2W82A 3PA2A 2CV2A 1XE1A 5H59A 5DM7F 1JGSA 3MKWB 3LJYA 5HLIA 3ZGKA 3JAMZ 2IS6A 2CSOA 1ZR4A 3P26A 4YELA 3CD6I 1GXQA 3FBIB 1ZM9A 2EA2A 5DEQA 2VBZA 4G5GA 1K73D 1M90D 1HW5A 3F22A 1DBGA 3KX2A 2E1BA 1FIPA 4XKBA 4CCMA 5HS9A 1VQPI 3WBJA 2UZKA 1J9IA 5HZAA 2EFWA 1GVJA 3CMYA 2F1LA 3ZSCA 2N8GA 4M0LA 2MFZA 2VKVA 1DPRA 3T53B 2QEXI 4BXUA 4ZCLA 1FMWA 1QU3A 3NAWA 2KL4A 4NC6A 3M1CA 3OYGA 4FTHA 1IJWC 4GO1A 1E17A 3BR5A 4XLFA 5FKKA 2P7VB 1BPLA 4D9JA 4O3MA 3VSVA 2QBYA 2EB7A 1X1AA 1H0MA 1W0TA 2K4JA 2MYSA 2XC7A 3BQJA 4JRAC 1R9TJ 1NG7A 3OSGA 3OFNA 1WH7A 3LWFA 3OYLA 3RTRA 2UWMA 5E1ZB 2OU2A 1LPQA 2OYNA 5L46A 5AIQA 4EVIA 1MMAA 1Z1DA 4RD0A 2V7QA 2DK8A 4YIRX 4XLHA 2R5YB 1KRHA 1I1GA 3SEZA 1VQOI 2CGPA 4M1KA 1WI3A 3T56B 4DNTB 3FY3A 4YFNF 5HDKA 2D9RA 4TV7A 5EF6A 5FKMA 1V5GA 3RPQA 1ACIA 1WJCA 3E3VA 4RLFA 2ZZQA 3BQYA 5D5XB 3MFKA 1AU7A 3P5JA 1E62A 4HOBA 1YFHA 1IZ1A 2KZVA 4UY8I 3K70C 2ZJPF 3FM5A 1P4XA 2MD5A 3K9TA 1JT6A 1OCZH 3CC2I 1VQNB 5JFRA 3GEZA 4H0EA 4DW6A 4E7ZA 2NNYA 3MMYB 5LRRA 3WTSC 1WJBA 3M3YJ 2IOUG 2QCOA 2L5QA 2PMHA 1YS7A 1AHDP 3HRTA 5M5XJ 1U5TC 4D7MA 4M9XA 3Q3SA 3WHCA 3PL8A 1MGTA 1BI2A 5HZBA 1M1KD 3PETA 3REOA 5C1CA 4BXXJ 4L9JA 5D6EA 2NVQJ 2LKXA 3HTUA 3B8YA 1W87A 3I4MJ 1X3WB 3U2QA 2STTA 3QU6A 4UZEA 3CCEB 1OYIA 2C4UA 5DD4A 2Z6BD 4L8JA 5C4XJ 2Z99A 4X06A 2LF8A 3ASOH 3ZPPA 5F0HA 1QBJA 4B47A 2E1RA 4CCLA 5GAGJ 5JHFA 1AOYA 2MD0A 2O17A 3OJWA 1IDJA 2FU4A 1KK1A 3NAUA 1I18A 5DUKA 3R60A 2ZMEC 4MEYF 2UXXA 2VOPA 1G3TA 3ZQHA 1V0FA 2PIAA 2V7TA 1O8MA 1NHAA 3N05A 3LSKA 4Z4UA 3LO8A 4OZYA 4I99C 1TNTA 3PUNA 3Q5FA 2Y9YA 1ZAOA 2DMNA 3CMAB 4BJ6C 2F4OB 3CQZJ 3DLAA 4L9TA 1LUJB 2DT5A 4DYCA 1F36A 1HW1A 4E6KG 1CNEA 4X8IA 4V02C 4U88A 1WSUA 1JRGA 2DOAA 3BG7A 1ZGWA 3LYCA 2YUHA 1WCMJ 3L9FA 3CW2A 2H09A 3VPRA 4EM0B 2JA7J 3KL9A 3E5QA 2M2EA 1NDHA 1T38A 3MZHA 4G7OF 1KU9A 2R93J 1HSJA 2L0KA 4WWVA 3OOUA 3KCCA 4J19A 4RDJA 1O8KA 1OHHA 4XD7A 5J1UA 2XNJA 2XNDA 3ML6A 1XSDA 4P12A 3WBKA 2XHKA 3CUQA 3FHZA 3PA1A 4RD4A 2VOOA 3CC4I 2QA4B 1JKQC 1R4NB 3E97A 2R7RA 3GVKA 1W4MA 1ZG5A 3BCAA 3T5XA 2H94A 3CLOA 3R6SA 4E70A 1V5FA 3VSKA 3OYMA 4Z4ZA 4JYKA 1NBMA 1JTAA 3OZWA 5ED4A 2EBIA 2HQAA 3OY9A 3ZXSA 3W2WA 3EUHA 3WNDA 4DYRA 1P7JA 5D4SA 2K3PA 1ON2A 2CUEA 1Q1HA 2KHMA 3HIFA 3K4LA 3GCMA 4PAAA 4N9HA 5M5YJ 3OZVA 2MSYA 2XB0X 3JSOA 4P26A 3MWMA 3B78A 1PLUA 3BR0A 2KIMA 1E3ZA 3QRFF 1USSA 2BE5F 4LIUA 5F0FA 2NYXA 4L5JA 2CW8A 1YTYA 3IAS2 4OM9A 2LOOA 1PJRA 3S3NA 4ZZLA 2EZIA 4Z4TA 5TJJA 2Q6KA 2XUBA 2OJED 3I4NJ 2X1CA 1ZELA 1JA0A 3S16J 2QWWA 4R79A 1NHCA 1XCVA 1OGIA 4PC7A 3G2BA 1FLIA 4BQOA 4LLNA 2HOAA 1LNWA 1REPC 4XK4A 1V4RA 4L5EA 3BC8A 3QODA 3CESA 5CYVA 4Q4ZF 1AKHA 4IX7A 3NQOA 3WTXC 3K6GA 5DYMA 3WNCA 2KISA 4MEXF 3GWZA 2P81A 3DFGA 1X4PA 4AWXB 1G59A 1H8AC 1L0OC 1MKMA 1ZRCA 3EYIA 1YW7A 3PO3J 4U0VA 2GIVA 2QDXA 2DMUA 2DOFA 4RB0A 1XGNA 4G9YA 5K7FA 3L2CA 1ZM2A 5DCMA 1HKTA 2QSGX 1H8EA 2M34A 1IRZA 4NQWB 3HOXJ 1VQ6B 5E17F 2Y75A 1MBHA 4HF1A 2W1OA 3S1RJ 1FWZA 1W35A 3SLNA 3BTIA 2GK6A 3OSFA 3GVAA 3GTLJ 4XMYA 1PDNC 1VI0A 1XD7A 1ENHA 1X3UA 3A02A 2H1LA 2NS8A 3P7NA 1OPCA 3DPLC 2L3DA 1VF7A 1RKWA 2XZPA 1EH8A 2NOJB 4Q47A 3OWTA 2GA1A 3O8GA 4A3LJ 1ETKA 2QN6A 4OPSA 2EJRA 2V9PA 2NV4A 1Q7YD 2GOXB 1YYVA 3CF2A 1R1VA 1XSVA 2X4HA 2PJRB 3F21A 4A3DJ 2V9VA 4P9FA 4H4KC 1BA5A 2LY2A 5JI6A 1HVXA 1E0EA 1FRQA 3ZQIA 1JNYA 3E1SA 3CJTB 4HV6A 5IYCJ 1LQ1A 3FDYA 4PUSA 1UZCA 1YO5C 3SQVA 2VPLA 4F7DA 4AVZA 3LA7A 4JOMA 1HF2A 4CDGA 2P8TA 4CCKA 1VFCA 2GXBA 1A04A 4TMWA 3WG7H 3V7AA 3ZR8X 3ZUGA 1D8KA 3P4GA 2C77A 1QGYA 5IOYA 4YAFA 2MLGA 2QBYB 5A88A 3VNVA 3VYSB 5IP9J 2WY7Q 2XAQA 1TQIA 3HHHA 2FX0A 3EPZA 2M7BA 2Y0SN 1H88C 1SFXA 2GOMA 5EZGA 1JKPC 1SKQA 1U9NA 1K6YA 1QVGB 3DBLB 4EW9A 4MFEA 4G8XA 1U8RA 1W36D 1IHMA 1RKTA 1SC7A 1I1SA 2KIQA 5J3OA 5AMVA 3DPUA 5JLXA 3KYLA 1EP1B 3OIOA 3CCJI 4C0SA 3AKZA 2R0QC 2D3NA 4F55A 3HSFA 2DTZA 4BQNA 1WPCA 4NK8A 3L00A 4J01A 1D0ZA 3WTUC 2WB1N 3IP4B 5DUIA 3OS1A 2DCEA 1T6SA 2B9SA 2B63J 2AXLA 2YPRA 5L3EA 3IRRA 2VNIA 1JA1A 3U1KA 2EV0A 1OYYA 3ISXA 3DEEA 2PMZN 2FXAA 1ETVA 2BW3A 3ASQA 1VQKB 4XKCA 3TBIA 2FMYA 1FNCA 4BQQA 3A2KA 3FXQA 4EJWA 3Q38A 3B6CA 3SEJA 4RGUA 1MBKA 5DDGA 1LFBA 1QA2A 3R6KA 4C2TA 2OA4A 4GRIA 3TO7A 3TP0A 1G7SA 3BR6A 2WTEA 3M1EA 4YEJA 2DFIA 1J09A 2BBYA 4NB5A 2R7XA 1SVOA 1OFDA 2FQ3A 1HQCA 2E7XA 5TRDA 2IS4A 4WXCA 2ZL7A 2R92J 4R71A 4OP7A 3LVBA 1P2FA 4G7XA 5HXBA 5D6FA 2RQPA 4Y7NJ 2WAEA 3QPHA 3L2UA 1UAAA 1G3WA 1Z77A 3W6VA 4Y9UA 4F7ZA 2BY0A 4P55A 5FO1A 1V55H 2M87A 3EQLF 3EUKL 4PCQA 3IH2A 1CF7B 2L4MA 2TCTA 5CVIA 2QLZA 1XQBA 4BJ5C 2ODLA 5H5JA 2JJ1A 3PFYA 2R5ZA 4OOVA 5JVTA 2EWNA 3O8HA 4ZJZA 2W84A 4XL9A 5CLSA 1YITB 1MNDA 1MABA 4UZFA 1NG6A 1FJLA 3MQ0A 3V7SA 2DW4A 3KP5A 1GAWA 1ZUNB 1TP4A 1TL8A 3MMPA 1W7PD 2DA7A 2PX9A 2NOGA 4ZYAA 1RZ4A 1RR8C 3CUQC 1IDZA 4U49A 2LY1A 1QQIA 4DNRB 3Q0UA 4EGYA 3I9V2 4HSTA 3TGNA 2HOEA 3RKYA 2ZJRF 3FXJA 1W34A 4DZJA 1H8HA 3BG9A 4XORA 3EUHC 3OR2C 1BN5A 2M8EA 2NAZA 1MJ9A 2XAGA 3CPXA 1U2RA 4V2FA 2HCJB 2HMAA 3I53A 3DV8A 4N3NA 3N6ZA 2CQKA 4HE5A 3KEYA 3FXOA 5F0CA 3ZPLA 2HVSA 3JTGA 1OFMA 3BCDA 3WQZA 2FRHA 2NRAC 3OYHA 4CICA 2GQFA 4FHTA 4X07A 1XPXA 2JK3A 3EYYA 1XGMA 1VQ4B 1PUFB 2IPQX 3S17J 2X6XA 4L9VA 4C30A 4CZCA 2V7WA 4WQMA 2L7KA 5ILUA 3GTPJ 5C1EA 1WXRA 2OV7A 4U7BA 2O6GE 2QX3A 2NTQA 2VONA 3PJRA 4FE7A 4Z4YA 3Q6RA 2DK5A 1QPMA 2IP2A 3VWBA 2JTVA 3JRHA 3EUAA 1I7PA 4ZDPA 4M2LA 3AVYA 2CO5A 4XICA 4KKTA 1BC7C 1YX3A 4BUPA 3LQRA 3DKXA 5H6QA 4LC0A 2BV6A 2HGCA 4RJLA 1BR2A 2HTSA 3F8NA 2VQHA 4Z06A 2HWVA 1P9QC 1OFCX 1WFXA 1P7IA 3P9IA 4I7HA 1UB9A 5LGUA 2XAUA 3VYTB 2CW7A 4RGSA 5GPAA 1PYVA 1BOAA 2DJIA 4I01A 3WU1B 1XG1A 1Y1VJ 3CO7C 3CB4A 3GQ9A 1VQLI 1VQNI 1FTTA 1R22A 1PJ5A 1R4MB 3ERED 4II3A 2BY1A 1RNLA 3C3WA 4E0FA 3BTCA 2GQQA 2ICWG 4B43A 3PSSA 4C3HJ 2JPBA 3BDDA 1BX0A 2XB5A 2VIXA 1Z6TA 3EDPA 4I09A 3CPWB 2HQNA 1SFKA 2Y2ZA 2XSDC 1LKXA 2L7MP 3ERMA 1E2XA 3OIPA 4OIRF 3QPTA 4FISA 5GAHJ 3GTKJ 1QGZA 1L1IA 4ABZA 3NRVA 4A2UA 4AYBN 2DT6A 5DNSA 2HYJA 5GADJ 4HBLA 1J5YA 2DO7A 4YALA 1OJLA 2CQNA 4O6JA 4IHXA 1V5EA 2VE8A 3VSTA 3D5SC 1QRCA 5HNFA 2XRNA 2P5VA 2A05A 2G9WA 1O8GA 3H5NA 2QENA 2M9HA 2WA0A 2QYOA 4I0BA 1JUMA
chains in the Genus database with same CATH topology
3HPGA 1SKYB 4DBQA 2O0VA 1OFLA 1VJSA 2CUJA 4LITA 4TT3A 3K4MA 2X3HA 4FXUA 3NWSA 4E7JA 1AA7A 1LVKA 4U87A 3H9GA 1OGMX 4E4HA 4NNJA 4RM2A 2V9KA 3OS2A 3H0DA 4Z03A 4XOPA 1CZFA 1YX5A 1E79A 5IK2A 2QY1A 2L9SA 1O8LA 2LYCA 2E5NA 2NSPA 1W9XA 3U21A 2CFOA 1N78A 2V1NA 1LFPA 3BLYA 2HU9A 2NZMA 2XDVA 4Z05A 3PNTA 2R4GA 1X0CA 3K4JA 2KLOA 4MLOA 2NSTA 2W82A 2CV2A 3BH4A 2Q2EB 3MKWB 3ZGKA 2IS6A 3HOTA 2ZZFA 4BEHA 2ZZEA 3OYEA 4YELA 4PJLA 3VYUB 4BL0B 3S3OA 3FBIB 2NT6A 3GRHA 3D5RC 3CZ6A 1DBOA 2XF5A 1DBGA 4F3QA 3KX2A 3HG9A 4HNUA 2E1BA 4NC7A 2XF7A 4XKBA 1O8DA 4CCMA 3MKYB 4CUGA 5HVQC 2XF6A 3ZPNA 2VB6A 1KMHA 4G6TB 1XG2A 4HSRA 3VSUA 2GJKA 4YZ0A 1X1DA 3ZSCA 2HPMA 2MFZA 3T53B 4LIVA 1IB4A 1FMWA 4ZC3A 1QU3A 2L2OA 4IQJA 2KL4A 4YZQA 3M1CA 3OYGA 2Z2SB 4OJ6A 3OYDA 4XLFA 4E7SA 1Y56A 1BPLA 4D9JA 3T9GA 3VSVA 1UELB 2JIZA 4BDZA 4BDYA 2PECA 1X1AA 4P5OA 4W8QA 3DDYA 2MYSA 2F5VA 3H9JA 3LSIA 2XC7A 2WJYA 3A35A 2MABA 1NG7A 3MD2A 3CJRB 3OFNA 1D0YA 3RTRA 3OYLA 2UWMA 3L2WA 3VMWA 2VASA 3UNGC 1MMAA 3CMMA 2DT7B 3HOSA 3UR3C 2V7QA 2QE7A 3OYNA 3HPHA 4XLHA 2NTPA 1WP6A 1Y6IA 1GQ8A 1KZLA 1T95A 2VQLA 3SEZA 4PK4A 3T56B 2V7FA 4PFPA 3C2GA 3DWLE 4DNTB 3FY3A 4OWRB 4LG3A 1V5GA 3GQBA 1WJCA 2WAFA 3IAM2 2QKMB 3LL7A 4RLFA 2ZZQA 3RQ4A 2CH0A 3PNYA 1DGWY 1X1BA 2L9NA 2KZVA 4W8TA 4CH7A 3K70C 2XOKA 1OR7C 2CS3A 4DIQA 2PYHA 4E7ZA 3MMYB 4II2A 4NC8A 1WJBA 2L5QA 2AQEA 2ZZGA 3H9QA 2VBMA 3PL8A 4EATA 2M4GA 5C1CA 2NTBA 3DQVC 3ZCOA 4BEHB 3H5RA 3B8YA 3K4NA 2Z6BD 3A1YA 4KT6A 4L8JA 3VR6A 2XGJA 3SZGA 2KMUA 3NWTA 3ZPPA 3OYJA 4B47A 3SYTA 2Q1ZB 3BCBA 4PJNA 2Y0SA 4CCLA 5JHFA 2MD0A 2O17A 1QJVA 1IDJA 3SEQA 3GBGA 3OEEA 1I18A 1O8HA 2ZXHA 4C2UA 4CSWA 1V0FA 4OJLA 1O8MA 2OUMA 3N05A 3LSKA 3A4CA 1VLYA 4OZYA 3F9KA 4IQ4A 3PSFA 5FRNA 2KVOA 1RMGA 1MMNA 2BVMA 5CDFA 4BJ6C 1RWRA 1TT0A 3DLAA 2QKLB 2X1EA 2WB1A 3OW7A 2X6YA 2Z1DA 4JQFA 4XN3A 4E6KG 1JRGA 2DOAA 3BG7A 2UV1A 1U0JA 3IUOA 4XM3A 1BMFA 2PMZA 3E0JB 2IGMA 4BS9A 1UD4A 4W8RA 1O8IA 1QCXA 4JMQA 3VDXA 3OOUA 1O8KA 4OJOA 3LMMA 3TL4X 1D1BA 2KRCA 4E7IA 1OHHA 2HLDA 2XNDA 3QYFA 4XD7A 2WBMA 5KCMA 4XNFA 3MKZA 1SAUA 3ZQQA 2HVQA 3ZRGA 2W6IA 4DOZA 2R7RA 2E5ZA 4NK6A 3GVKA 5FL7A 3BCAA 1K28D 3OYMA 4BXFA 1V5FA 2F4IA 2LH9A 3VSKA 5HKKA 2VJJA 1O8FA 2LBFA 1NBMA 1JTAA 3T51B 4I84A 1E43A 4GQNA 1W0KA 3OY9A 2HQAA 2X85A 3SUCA 3ZXSA 3W2WA 5TGTA 1HZEA 2JDIA 3GQ8A 2O5RA 3OYAA 2X53S 2K3PA 2HZDA 2LC2A 3OS0A 2KHMA 3K4LA 4J00A 2CMPA 1WJFA 3DTIA 1Z21A 4F92B 2V4DA 2PJRA 1PLUA 4CCOA 2E60A 1E3ZA 1UD2A 4LIUA 2RREA 2IS1A 2CW8A 2CV1A 2K9LA 2F6CA 3IAS2 3QYBA 4BACA 4MR0A 2R7WA 2LOOA 1PJRA 3S3NA 4XQFA 3NE5B 2OC6A 1MMGA 2IQ7A 2VJ5A 3HUGB 3BC9A 2M5SA 1WMRA 2HNHA 2RNGA 1KTWA 4C9YA 4PFOA 1S9HA 1WJAA 1ZELA 2X1CA 4XOTA 2JJ2A 4B44A 4R79A 1NHCA 1R6RA 2BSPA 1OB0A 3G2BA 1O8JA 4BQOA 2O0WA 1KCCA 2F43A 3JU4A 2V31A 2IGNA 4HG2A 3BC8A 3K4KA 3QODA 1YE9A 4Y4RA 4F91B 3CESA 4F93B 3LSHA 3L2QA 4PMHA 4IX7A 3K6GA 4IZZA 1UG0A 3OOCA 4DK1A 4E7KA 3FPPA 1GLNA 3OL4A 4XKVA 1Z7LA 4DBRA 4YRVA 3FKSA 4G6IA 3A3GA 2JVHA 2VKDA 3K4BA 1X4PA 4QPQA 4PJMA 2VQGA 4BE1A 4N4NB 4OAYA 1G59A 3KRGA 1FMVA 3OYKA 4CCNA 4F52A 4HNTA 1W0JA 3K10A 3L2RA 4XKWA 2VXZA 1UD6A 4BU2A 1WJDA 3OL3A 1H8EA 3TMOA 1RU4A 4NQWB 3B4NA 1Z3XA 2HDWA 3D5LA 3BG6A 5FRMA 2W1OA 2GK6A 1COWA 1N77A 2R7SA 4NUBA 4XMYA 4ZDLA 2LREA 2VJIA 2VBKA 3DTEA 3DPLC 1VF7A 1N75A 4ITVA 4ANJA 2JVGA 2XZPA 2NOJB 3I3LA 4OZZA 3OWTA 3WWGA 2MC4A 5FROA 1QHHD 4DJAA 1H80A 2KQRA 4QPOA 1E1QA 4OJPA 2GOXB 2M0MA 3CF2A 2DXIA 4FETA 2PJRB 4KISA 3S93A 1KONA 3OMYA 4H4KC 2LY2A 1HVXA 2E1MB 2JSPA 3GVLA 1E0EA 2A6TA 3E1SA 3CJQB 3FDYA 4HEA2 4PUSA 3G05A 3OEHA 2VPLA 3OAAA 1HG8A 4AVZA 2VQCA 1WTHD 4JOMA 4YZAA 4CCKA 1EE6A 2X8KA 2XSJC 4MXNA 2WAQA 3ZR8X 2KPMA 1VZ0A 2GJRA 4YZXA 3QYEA 3OYCA 4HWVA 5KNLA 3VYSB 2WPDA 2WY7Q 1WJEA 3C2HA 3EPZA 2M7BA 1WJ5A 2ZFUA 4DGWB 2R7TA 4XLEA 1DP3A 4E7HA 1MW7A 2GOMA 1E3XA 2NT9A 4P1WA 2W7NA 1K6YA 2W4SA 3EQOA 4EW9A 4PSXA 2R7UA 4HRIA 1ERDA 3RSNA 3LSGA 1PXZA 1W36D 4W8SA 1D0XA 3VYRB 3S8PA 1I8DA 5AMVA 4HIZA 3DPUA 3AL0B 3GVJA 3KYLA 3LMWA 2INUA 3AKZA 2W6JA 3LSMA 2A5WA 2D3NA 4F55A 4BQNA 1WPCA 4NK8A 1D1AA 4J01A 1D0ZA 4XR6A 3IP4B 3PSIA 3OS1A 5LFAA 4B3GA 2DCEA 4E7LA 3KEWA 4FASD 4Z1MA 4DK0A 1FX0A 3DEEA 4X0GA 4PSWA 2BW3A 4KKSA 4XKCA 3TBIA 1MMDA 2XZLA 4PJJA 4BQQA 3V42A 4BGDA 3A2KA 1K5CA 5CPRB 1G8XA 2IGOA 3K4CA 3ONQA 4KJZA 3J7AY 4ZTJA 2R7OA 3L2VA 4C2TA 2VXDA 5DN6A 4GRIA 2M4KA 2LG4A 4B3XA 1BR4A 4C2LA 2HPIA 2KRHA 2CUZA 3OYFA 1PKVA 2LRDA 2P0WA 4YEJA 5CQEA 1J09A 2R7XA 3LNNA 2IS2A 2IS4A 2V4JC 2FUG2 2Z16A 4G7XA 2ZXIA 2WAEA 3L2UA 1X1CA 1UAAA 3CP8A 4Y33A 1UD8A 3OE7A 1VBLA 3GQ7A 1JI8A 1DQUA 4RMNA 4N4OB 3OIQA 2M7AA 1LDKB 3EUKL 2R7QA 3FKJA 1IRXA 3H35A 1AIRA 2Z8GA 3DTKA 2KDOA 4BJ5C 2ODLA 4XLAA 2XZOA 2JJ1A 3PFYA 3DU6A 1KCDA 2ZSHB 2O04A 2BVLA 4RM3A 2GK7A 3SDBA 4ZJZA 3M8JA 4XL9A 4U4BA 4URRA 1MNDA 1MABA 2VLAA 3LFUA 2AQFA 3DKYA 3OYBA 1NG6A 2KP6A 4ZTFA 1TZLA 3HKZA 3JURA 1O88A 4UZUA 2R9VA 3W2VA 4ZYAA 3H94A 1BR1A 4IKFA 4YXWA 2V6EA 5CKTA 2VBEA 4U49A 2LY1A 4DNRB 2CV0A 3I9V2 4B48A 3B90A 4B3FX 3H5AA 4HSTA 5KHDA 3A3BA 3BCFA 2JA2A 2X1DA 2F1MA 1H8HA 2GJPA 2RQQA 4XORA 2M3AA 1BHEA 1DGRM 3EUHC 3OR2C 3RPUD 2BW3B 3OYIA 2I8DA 5HNHA 4D1QA 2ELJA 2K5CA 4HPQA 2LBFB 1PE9A 3KEYA 1V0EA 4BE0A 2HVSA 1OFMA 3VMVA 3BCDA 3WQZA 2E1MC 2WZPP 3OYHA 4XN0A 2WSSA 2IXSA 3HXLA 3QOEA 5HOOA 1T5EA 5HLTA 2V26A 1BN8A 4AU7A 3HL2A 2PYGA 2D3LA 2X6XA 4C30A 4CZCA 1W36C 2ZTNA 2VL8A 2QXZA 2L7KA 3S32A 5C1EA 2VKHA 2OV7A 4Y3OA 4U7BA 4ASUA 2UVEA 3EQNA 2QX3A 2NTQA 3PJRA 3UW0A 1OGOX 3AFHA 3VWBA 2X6WA 3GQAA 2INVA 1NRKA 3EUAA 4ZDPA 1T0FC 3PUBA 1UD5A 3HAGA 1O8EA 3DPTA 4KKTA 4XONA 4OJ5A 2JUGA 1YX3A 2VJ4A 4BUPA 3DU5A 3DKXA 4BJTA 2ZTGA 1BR2A 4CCJA 2UVFA 4XLCA 2VQHA 4Z06A 2BOLA 5LD2C 1IA5A 1P9QC 4OAZA 1WFXA 4BE2A 4ZDOA 3VSLA 2IGKA 1QHGA 2XAUA 3VYTB 2CW7A 2CK3A 1BOBA 1PYVA 2DJIA 5CQGA 4KITB 3S3MA 1EA3A 2WADA 3W3CA 3AL0C 3GQ9A 3ZIAA 3PNVA 1X4OA 1UD3A 2HVRA 4AYBA 3CP2A 4II3A 4E0FA 4TSFA 1D1CA 2R7VA 4B43A 2ZSIB 2X51A 4CA0A 4TKOB 2VIXA 3FHNA 1HA8A 1Z3YA 3K70D 1BLIA 2O1DA 1SFKA 1LKXA 1IDKA 3OIPA 3OPOA 3RCOA 4KKUA 1X19A 1OLTA 2K9MA 2EWEA 2DT6A 2DIEA 2UUZA 3OR1C 3VSTA 3HC7A 1V5EA 3D5SC 2W00A 1MNEA 1OOCA 5HNFA 1E1RA 1O8GA 4P22A 3H5NA 2LZJA 2WY8Q 4RLQA 4G7WA 3FBNB 2WA0A 2WJVA 3W2AA 1EFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4N A;  2ODL A;  4XLA A;  2O0V A;  2O17 A;  1OFL A;  1QJV A;  1IDJ A;  1KCD A;  4XMY A;  2O04 A;  2X3H A;  2VJI A;  1O8H A;  2VBK A;  4XL9 A;  4U4B A;  4URR A;  1OGM X;  4OJL A;  1O8M A;  4OZZ A;  4Z03 A;  4OZY A;  4XOP A;  1RMG A;  1CZF A;  1O88 A;  3JUR A;  3WWG A;  2QY1 A;  1H80 A;  1O8L A;  2NSP A;  2VBE A;  4U49 A;  4OJP A;  1RWR A;  2NZM A;  4Z05 A;  3B90 A;  2X6Y A;  1X0C A;  2NST A;  4XN3 A;  1JRG A;  4XM3 A;  4XOR A;  4W8R A;  1BHE A;  1O8I A;  4YEL A;  1QCX A;  1HG8 A;  2NT6 A;  4AVZ A;  3GRH A;  1DBO A;  4YZA A;  1EE6 A;  1DBG A;  1O8K A;  4OJO A;  4MXN A;  1O8D A;  1PE9 A;  4XNF A;  4YZX A;  1OFM A;  3VMV A;  1XG2 A;  4HWV A;  3VSU A;  4YZ0 A;  3ZSC A;  3ZPP A;  4XN0 A;  4NK6 A;  1IB4 A;  1BN8 A;  4XLE A;  2PYG A;  4YZQ A;  2VJJ A;  2X6X A;  1O8F A;  2NT9 A;  4OJ6 A;  2QXZ A;  1JTA A;  3EQO A;  4XLF A;  4I84 A;  5C1E A;  4EW9 A;  3T9G A;  2UVE A;  2X85 A;  3EQN A;  3SUC A;  2QX3 A;  3VSV A;  2NTQ A;  1PXZ A;  3GQ8 A;  2PEC A;  4W8Q A;  1OGO X;  4W8S A;  3UW0 A;  5AMV A;  2X6W A;  3GQA A;  2INV A;  3LMW A;  2INU A;  1O8E A;  1PLU A;  4XON A;  4OJ5 A;  3VMW A;  4NK8 A;  4XR6 A;  2UVF A;  4XLC A;  4Z06 A;  4MR0 A;  4XLH A;  1IA5 A;  4XQF A;  2NTP A;  1GQ8 A;  2IQ7 A;  3FY3 A;  3GQ9 A;  1WMR A;  1KTW A;  1K5C A;  4XOT A;  1NHC A;  2BSP A;  1O8J A;  2O0W A;  4W8T A;  1KCC A;  4C2L A;  2PYH A;  4YEJ A;  2O1D A;  1IDK A;  4PMH A;  4XKV A;  2VBM A;  2EWE A;  5C1C A;  1VBL A;  3KRG A;  2NTB A;  3GQ7 A;  3VST A;  3B8Y A;  1OOC A;  1O8G A;  4XKW A;  1AIR A;  1RU4 A;  2Z8G A; 
#chains in the Genus database with same CATH topology
 4L9N A;  1FPQ A;  4MHG A;  3JSP A;  2JRM A;  3ULQ B;  2R5Y A;  1SKY B;  1QRY A;  2HFH A;  2XAF A;  1BIA A;  4LIT A;  3J81 K;  1QFZ A;  2B0L A;  3ISP A;  4FXU A;  2R3S A;  3F3X A;  4E7J A;  1AIP A;  1S7O A;  4U87 A;  4PC1 A;  1OGM X;  1EV7 A;  4RM2 A;  2V9K A;  4BNC A;  2AO9 A;  2G0Y A;  2F4N A;  2NVX J;  4A69 C;  1BX1 A;  2JPC A;  4I98 B;  3HRS A;  4AM3 A;  4LFU A;  2LYC A;  1UST A;  2CQX A;  3C2B A;  3FXL A;  3U21 A;  1JUS A;  1LVA A;  1LFP A;  4MFD A;  4JX5 A;  1SAN A;  2XDV A;  4Z4W A;  3PNT A;  3A01 A;  3W6K B;  4ENJ A;  2R4G A;  2PBI A;  2BY3 A;  3K4J A;  1P6R A;  3R4K A;  4HX8 A;  1OQY A;  4BAY A;  1G7C A;  1G7T A;  2VNJ A;  1OCT C;  1LDJ A;  4KIB A;  1NK3 P;  2LSO A;  3HOT A;  2KKO A;  2ZZE A;  4RB1 A;  3VYU B;  3S3O A;  2NT6 A;  5D8K B;  1QZY A;  2EA4 A;  2XF5 A;  3BQZ A;  1FOX A;  4HNU A;  3GFM A;  4NC7 A;  4PZJ A;  2XF7 A;  1WDT A;  2RDP A;  1UHM A;  5KW9 A;  4ON0 A;  3ZPN A;  2VB6 A;  3S1Q J;  2D1H A;  3VSU A;  1WZ2 A;  4OU0 A;  2GJK A;  4RLZ A;  2K40 A;  3F6V A;  2XT2 A;  1RQP A;  3QSY A;  1R5N A;  1FP2 A;  2L2O A;  4IQJ A;  4YZQ A;  2Z2S B;  4BHC A;  4IHT A;  3OYD A;  1Y56 A;  1G2H A;  3T9G A;  4ESB A;  4LBY A;  1S8N A;  2NVY J;  4BDZ A;  1OCC H;  4BDY A;  2PLF A;  2PEC A;  1JTY A;  3LSI A;  1TNS A;  5KVR A;  2CC2 A;  2LK2 A;  1RET A;  1P4A A;  2EFP A;  2MAB A;  3AG4 H;  3G1L A;  3MD2 A;  4A3K J;  1GDT A;  1ZH5 A;  4EGZ A;  4ESF A;  3I4P A;  3L2W A;  3QFR A;  3QFS A;  1O3R A;  3WU2 C;  2C5B A;  1JKR C;  3CMM A;  2KT0 A;  3HOS A;  2QE7 A;  3R61 A;  1H9T A;  1JXS A;  1WP6 A;  2NTP A;  1Y6I A;  2B5O A;  1KZL A;  1T95 A;  1ZK8 A;  3DWL E;  4PFP A;  3O6B B;  4Z6Y A;  3ZN1 A;  1U2W A;  2WAF A;  2QKM B;  3SDG A;  2O3F A;  1K79 A;  1K83 J;  1RUO A;  4I76 A;  5EEH A;  4HX7 A;  3BTJ A;  1KK0 A;  5DM6 F;  4G6Q A;  4ETS A;  1T33 A;  3ZMS A;  3WTV C;  1QQ1 A;  2JWT A;  2XVC A;  2XOK A;  4RBO A;  3RDI A;  2ZBU A;  4DIQ A;  1SD7 A;  1IDY A;  3GTQ J;  4S04 A;  2PYH A;  5FJ8 J;  4II2 A;  5BS6 A;  2Z9O A;  3PQJ A;  1C0W A;  3JRD A;  2AQE A;  4G12 A;  2ZZG A;  2K85 A;  2DLL A;  2VBM A;  1T08 B;  3SZE A;  1SVM A;  3HSR A;  4BEH B;  1VQ6 I;  4QIW N;  2R5Z B;  3K4N A;  3BPV A;  2BEO A;  4KT6 A;  3VR6 A;  2VFQ A;  4GCV A;  2WR8 A;  2EZK A;  1B2R A;  1TLH B;  2F5F A;  1FT9 A;  3NWT A;  1K9M D;  2Y0S A;  1G7R A;  4RA2 A;  5BSY A;  4Q5S F;  2CUF A;  1QJV A;  1SD6 A;  1YJN I;  1XN7 A;  1TLL A;  2LFB A;  3KFW X;  2AS5 F;  3K2A A;  3ZMU A;  3OEE A;  3CCV B;  3CCR I;  3GSI A;  4NCN A;  4CSW A;  3JCU C;  1GV5 A;  4HDV A;  1FBU A;  1OCO H;  1IB0 A;  3R0A A;  2A3S A;  2K4B A;  3A8I A;  1TWA J;  5FRN A;  4X6A J;  3PSF A;  1CNF A;  3ZP5 A;  5B6I A;  3I56 I;  5CDF A;  4KIG A;  3ASP A;  5IYP A;  3LQE A;  4ZGN B;  2KIU A;  2DOD A;  1RWR A;  3F8B A;  5F08 A;  1O7L A;  1TT0 A;  2QKL B;  5IYB J;  1ZTR A;  3W2E A;  2WB1 A;  1FBQ A;  2IEK A;  1HC8 A;  1DPU A;  4JQF A;  4KFC A;  4J0Q A;  4FK8 A;  1FX7 A;  2DYI A;  2UV1 A;  3DBH B;  3ECH A;  3IUO A;  1PP7 U;  2PMZ A;  3E0J B;  2IGM A;  4JMQ A;  2YWE A;  3BH7 B;  3BPX A;  3VDX A;  2EIL H;  3N90 A;  1QNT A;  2GXA A;  2ZNZ A;  3WY9 A;  3M8F A;  4E7I A;  2HLD A;  2VNH A;  3M7G A;  5F1R A;  1I50 J;  3MKZ A;  4UXN A;  3GXO A;  2HVQ A;  3SZP A;  2W6I A;  2MH2 A;  2FNA A;  4NK6 A;  1F9N A;  3IHU A;  5LHH A;  4B09 A;  5ICF A;  4BXF A;  3CLQ A;  5JLV C;  3GIR A;  2LBF A;  3D1N I;  3T51 B;  4W1U A;  3HDD A;  4I84 A;  1OKR A;  1ODD A;  5FLV A;  3SUC A;  2X0L A;  3G1M A;  2VBW A;  4KNY A;  1HKQ A;  2VNK A;  1S6L A;  4M3F A;  5TGT A;  2PI0 A;  3GTM J;  3BZ6 A;  3OYA A;  4LMY A;  1ZM3 A;  2JDI A;  3G71 I;  2X53 S;  3ZQF A;  1YI2 I;  4DQL A;  3DEU A;  4QVJ A;  3W2F A;  3CCS B;  1PVE A;  2CMP A;  2E1C A;  4F92 B;  1QA3 A;  4MO7 A;  4IPA A;  3R0J A;  2PJR A;  1EA0 A;  2FQ4 A;  4CCO A;  4L0Z B;  3TED A;  3BR3 A;  3LOC A;  4DNC A;  5M3M J;  3JRA A;  3CCU I;  2IS1 A;  2R7D A;  3V8L A;  2K9L A;  4MR0 A;  1MZB A;  3H92 A;  2OZ6 A;  2EFG A;  3CDH A;  3CCQ I;  1MNM C;  4XQF A;  3GTG J;  3NE5 B;  2OC6 A;  1MMG A;  2FF4 A;  4M72 A;  3BC9 A;  2ID6 A;  2VUM J;  4IRG A;  1WMR A;  2HNH A;  3AAF A;  4C9Y A;  5TV2 A;  1S9H A;  4KT5 C;  2ELH A;  3JTH A;  4B44 A;  3UKG A;  1R6R A;  3ASN H;  1KU2 A;  1E3H A;  1OB0 A;  1O8J A;  3I0T A;  4U0W A;  2HDD A;  1NTC A;  5FNZ A;  2V31 A;  1WI9 A;  1ZG3 A;  4UV9 A;  2BX6 A;  3ZN0 A;  2HXI A;  3JRE A;  4MQV A;  1YE9 A;  1R5G A;  1RES A;  2E2J J;  1YOV B;  3EET A;  2BPO A;  5HLH A;  4IZZ A;  3OOC A;  4DK1 A;  2EPF A;  1VTN C;  4E7K A;  5C4J J;  1GLN A;  3OL4 A;  4YRV A;  2M30 A;  4RPD A;  4PMH A;  1A6Q A;  2DTR A;  1XMA A;  3A3G A;  2ZCW A;  2VKD A;  3F8C A;  4QPQ A;  4YHB A;  3KRG A;  2VQG A;  4N4N B;  5GP9 A;  5IP6 A;  1G3Y A;  4AIK A;  1L3L A;  5CVR A;  4Y7C A;  2LVS A;  3T0Y A;  1FMV A;  4HW0 A;  3CCM B;  1K8A D;  4F52 A;  3S14 J;  3A03 A;  4PDK A;  1EZG A;  3H3Z A;  2BV3 A;  3B4N A;  5FRM A;  4RCZ A;  2WWY A;  2JJ7 A;  4KMU X;  1BQE A;  1COW A;  1N77 A;  1JT0 A;  2R7S A;  3JW4 A;  2FJ1 A;  4ZDL A;  1QX4 A;  5K7Z A;  2VJI A;  2VBK A;  4A93 J;  1DDN A;  1XCB A;  1N75 A;  4ITV A;  4XRF A;  3A01 B;  3U6B A;  2YU3 A;  1GVD A;  3I3L A;  4OZZ A;  2H1K A;  1VQ5 B;  2XPW A;  3CCY A;  5DD8 A;  1BW6 A;  2MC4 A;  5FRO A;  1TYV A;  1H80 A;  3HB9 A;  2HYF A;  2VT3 A;  5ICC A;  1VQ7 B;  2NXN B;  1P4W A;  2M0M A;  2DXI A;  3QQA A;  4M74 A;  1RIO H;  3U2R A;  1KON A;  3ABL H;  1JGG A;  4HX4 A;  1QA6 A;  1VQ8 I;  3S2D J;  2YWG A;  3GUD A;  4Z4V A;  1QGP A;  4M3G A;  1J9Z A;  1UHS A;  1VQM B;  5CVU A;  2JA6 J;  4KUM A;  3QU3 A;  3OAA A;  4WZK A;  2M5W A;  2VQC A;  1KK2 A;  2M1B A;  1WTH D;  4YZA A;  3ZZU A;  4HE6 A;  4RDL A;  4HYE A;  2NVU B;  4G1V A;  2KPM A;  1CF7 A;  2Q2E A;  2GJR A;  2W57 A;  3JQR A;  1G4D A;  2VN2 A;  4S05 A;  3N97 A;  4HWV A;  4PC3 A;  3CO6 C;  3M07 A;  4AVP A;  1DP3 A;  1QGA A;  4OIN F;  4M53 A;  2FA5 A;  1SMT A;  3BJA A;  2Q6L A;  3ABU A;  3QFC A;  2ETH A;  5IT3 A;  4HRI A;  5E3M A;  3RSN A;  4CO8 A;  3SJP A;  2QVO A;  2FEZ A;  4QWQ A;  1B23 P;  4IW3 B;  4RD2 A;  3PIO F;  5DS0 A;  1F5T A;  1YJ9 I;  4HIZ A;  3KIO A;  2P6T A;  1HOM A;  2C2W A;  3G6E B;  1K61 A;  3GW2 A;  3WTY C;  1WSR A;  2Z5U A;  1QA1 A;  2OTJ B;  5M3F J;  4XR6 A;  3PSI A;  1B1B A;  2KRF A;  3RZO J;  2D74 A;  1HXD A;  2GZW A;  1O3T A;  6PAX A;  4OIO F;  1GO2 A;  2EFO A;  4Z1M A;  4G94 A;  3LSJ A;  5GAE J;  4NHJ A;  4JP0 A;  2JN9 A;  2ZC2 A;  3C18 A;  4PSW A;  3WU0 A;  2LDU A;  1QRB A;  2IRF G;  2YWF A;  2XZL A;  4QFM A;  3V42 A;  4BGD A;  1HDD C;  3ZQ7 A;  2IGO A;  3KYC B;  3K4C A;  3ONQ A;  3WXM A;  4KJZ A;  2OK8 A;  2R7O A;  1R1T A;  2XIG A;  4UVC A;  1F1Z A;  2QGU A;  1SEU A;  1YIJ I;  2Q0O A;  4ESJ A;  4C2L A;  2HPI A;  2YX4 A;  1PKV A;  3I55 I;  5CQE A;  1R36 A;  1PUF A;  1G3S A;  1ZRF A;  2V4J C;  2VZL A;  2Z16 A;  4LK1 F;  3PQK A;  2HI3 A;  3OE7 A;  1WH5 A;  3CP8 A;  3TO6 A;  4P3I A;  1MD0 A;  2K02 A;  2NS0 A;  4RMN A;  4EMS A;  1EH6 A;  1GV2 A;  4D5C A;  1X58 A;  4RB3 C;  3MVP A;  4U7D A;  3GLL A;  2V7X A;  2XAJ A;  3H35 A;  4I02 A;  4A3B J;  1ZYR F;  1SVL A;  1R23 A;  5EJC A;  4HA8 A;  3C1D A;  3RIR A;  1MDM A;  1IAW A;  2CF4 A;  3BP8 A;  3G4S B;  2OTL B;  2L7Z A;  3DU6 A;  1R1U A;  4A0X A;  2Y0M A;  1TYU A;  2BVL A;  1I3A A;  1OMI A;  3SDB A;  1D1N A;  4URR A;  4A3I J;  1I27 A;  2RNJ A;  1EJ9 A;  2M8G X;  4ZTF A;  3LQ6 A;  2M45 A;  3ZMD A;  3TW7 A;  1TT5 B;  2R9V A;  2NST A;  2IBD A;  3FZV A;  1A5J A;  2A5Y B;  5A2Q K;  4HLY A;  3H94 A;  4IKF A;  4YXW A;  2PFB A;  1IDK A;  4IHV A;  2COM A;  1BW5 A;  2E35 A;  4UUT A;  2XAH A;  4B48 A;  3LST A;  4B3F X;  2P5L C;  2YX7 A;  3JRG A;  2JA2 A;  1Y0R A;  2FBK A;  4ASN A;  2X1D A;  3K0L A;  3B82 A;  3HOU J;  3TO9 A;  1W5T A;  3HGY A;  3CC7 I;  3HOY J;  4B4C A;  4YG2 F;  1AWC A;  1RQR A;  1QO0 D;  2PN6 A;  5EEG A;  1JTX A;  4G1B A;  2H8W A;  1TQP A;  1QZZ A;  3G1O A;  2YS9 A;  3RPU D;  1YJW I;  3A8J A;  2I8D A;  5EEA A;  3CCL I;  2DFF A;  2LBF B;  1PE9 A;  4L18 B;  5KSW B;  1WGX A;  2FSW A;  1ON1 A;  3J80 K;  3ESW B;  1M1E B;  1TTY A;  4LB5 A;  2PJP A;  2NPF A;  4NDL A;  4XN0 A;  2DFH A;  2MLK A;  2BGI A;  1R58 A;  4ZCI A;  5HLT A;  1TWH J;  1N0V C;  5E3N A;  3ZBU A;  2D3L A;  2EQR A;  1FDR A;  2ZTN A;  2GWR A;  2Z33 A;  2JA8 J;  3UW0 A;  3ZZT A;  2F5E A;  2ZFW A;  2X0K A;  3ABM H;  2BF4 A;  3VO1 A;  2QYU A;  2IVM A;  3TH0 A;  3PFI A;  5KAI C;  1S5L C;  2JUG A;  2VJ4 A;  3HRU A;  3P9K A;  4BJT A;  2ZTG A;  2LLK A;  4CCJ A;  2UVF A;  1ZGA A;  2Y31 A;  3HHG A;  3AVT A;  1IA5 A;  2F5C A;  2HEO A;  4ZDO A;  5E20 A;  2OZU A;  3VSL A;  5LBQ A;  4RGR A;  4V2G A;  3S3M A;  2JQ7 A;  4X1E A;  9ANT A;  1IJF A;  2CK3 A;  1XGO A;  3ZIA A;  3PVD A;  3PNV A;  1X4O A;  1UD3 A;  1YHQ B;  3CP2 A;  2HDN B;  3KP7 A;  1MBG A;  5F6F A;  4O5V A;  1QVT A;  3MCZ A;  2ZSI B;  1JUP A;  2X51 A;  4XBF A;  4CA0 A;  1QUF A;  2OBS A;  1DAR A;  4QVA A;  2O1D A;  3K70 D;  1T8I A;  3X2Q H;  3OP1 A;  1K4S A;  2BYV E;  3CME B;  1BIB A;  3LSR A;  1KQ0 A;  3B73 A;  2GBY A;  3OPO A;  3ZBT A;  4XRM A;  5HS8 A;  1Y8Q B;  2CW0 F;  2DCU A;  2K9M A;  4UVB A;  3HRM A;  5H2F C;  5JLW A;  5DSZ A;  1N8R D;  1WPK A;  3RKX A;  3JRF A;  1W2B B;  3HC7 A;  4LD5 A;  1VQ9 B;  5ICG A;  1S72 I;  4WK8 F;  1JJ6 C;  1TC3 C;  4P22 A;  3DLL F;  3P27 A;  5EDN A;  4FN5 A;  1W1W E;  5J35 A;  2DA1 A;  2V4D A;  3HOZ J;  2FNP A;  1U3E M;  1LFU P;  5GTH C;  4DBQ A;  4HF2 A;  1BJZ A;  1B8I B;  2BMW A;  3L09 A;  5GV8 A;  2CUJ A;  4LJZ F;  3K4M A;  4GYI A;  3WGI A;  2X3H A;  4X7C A;  3GFJ A;  5A89 A;  3SFI A;  5D5W B;  1MIJ A;  3T8T A;  3CD6 B;  2BHZ A;  3CDL A;  1HST A;  2H6B A;  5FA6 A;  4XOP A;  1TBX A;  1YX5 A;  2ESH A;  3ZOB A;  1DAB A;  2Z3Y A;  1HW2 A;  1POG A;  2L9S A;  1O8L A;  1UFM A;  1PP8 F;  1W9X A;  3KP3 A;  1VQP B;  3O2P E;  3E6C C;  2B0R A;  1K78 B;  4ZV4 A;  1IO2 A;  4UUS A;  2RGV A;  3BJ6 A;  4EV0 A;  3GX4 X;  4FQG A;  2QEX B;  3VFZ A;  4FT8 A;  3BH4 A;  2GLO A;  2Q2E B;  5FD6 A;  5C3E J;  1J7K A;  2HOS A;  2O03 A;  4U0Y A;  3ABT A;  2ZZF A;  4BEH A;  3SFZ A;  5IP7 J;  4BL0 B;  5FFZ A;  4XRS G;  2G7H A;  3GRH A;  1MJA A;  3DF8 A;  4AID A;  1XSX A;  4F3Q A;  3HG9 A;  1SD5 A;  3VEP A;  5EGO B;  3MKY B;  4R8H A;  4V19 K;  4D0P A;  1IUY A;  1KMH A;  4G6T B;  1XG2 A;  1KQS B;  1IN7 A;  2CBX A;  4YZ0 A;  1X1D A;  3TDZ C;  1VHO A;  5FKN A;  3KPH A;  3FMQ A;  4LIV A;  5LHI A;  4P96 A;  3PEN A;  1IB4 A;  4ZC3 A;  1FYM A;  1K7A A;  3AVV A;  1GUU A;  3SJM A;  2VKE A;  4ENM A;  3ZZ0 A;  2QM3 A;  4LB6 B;  4EH1 A;  2ISY A;  1VQO B;  4W8Q A;  5KK1 A;  3K2Z A;  3GLX A;  2F5V A;  2XGE A;  1XC5 A;  3F72 A;  2WJY A;  5D5V B;  5LGT A;  2EZL A;  3A35 A;  1FNN A;  2EFQ A;  1GT0 C;  1KQ8 A;  1HA3 A;  4HLX A;  3UNG C;  2DT7 B;  4ACB A;  1LJ9 A;  1MH3 A;  3FK6 A;  3OYN A;  3HPH A;  2DBB A;  2BVN A;  2XEX A;  2RVC A;  1GQ8 A;  1IXS B;  3ECO A;  2CRV A;  2V7F A;  5FKO A;  3C2G A;  3AVU A;  2Q6O A;  2QZ8 A;  3CTA A;  3FXR A;  2FD5 A;  4JBA A;  3RQ4 A;  2CH0 A;  3PNY A;  1KU7 A;  3S1N J;  4UB6 C;  1Q82 D;  4W8T A;  4CH7 A;  5J6X A;  2W24 A;  2PE3 A;  1NK2 P;  2IA1 A;  1BI3 A;  1J0R A;  1FY7 A;  1QFY A;  4ZYH A;  1ZM4 A;  3V76 A;  3H9Q A;  1QG0 A;  1W5C C;  5DTD A;  3RYR A;  4EAT A;  1MDM B;  1FSH A;  2A68 F;  4OOI A;  2OPT A;  3ZCO A;  1ETY A;  4P25 A;  1N25 A;  2XPV A;  5TR9 A;  4YAW A;  1MBJ A;  1IC8 A;  2HZT A;  3GME A;  3SZG A;  3W6J B;  5JR3 A;  5FLM J;  4NBQ A;  4HV5 A;  5D8L B;  1OGJ A;  1VHE A;  3OYJ A;  3OKX A;  1Y0Y A;  3BCB A;  2QQB A;  4PJN A;  1W0U A;  4IF4 A;  2GM4 A;  1U6G A;  1IN8 A;  2JRT A;  2QGG A;  1MBE A;  3WE3 A;  1O8H A;  2DAO A;  1BJA A;  2ZXH A;  3G73 A;  4JX6 A;  1Q9S A;  3GZ5 A;  4KN7 X;  4OJL A;  2IA0 A;  4P3Y A;  4BPR A;  1VLY A;  4UHT A;  4RB2 C;  2CQQ A;  3F9K A;  2VBX A;  3HEF A;  4IQ4 A;  4XID A;  3CCE I;  5M5W J;  1A35 A;  2KVO A;  1IN6 A;  3ONU A;  1R00 A;  5FFX A;  4KN4 X;  2CYY A;  3E6M A;  3S2W A;  3MHP A;  2CFX A;  3WOD F;  4RCY A;  1IUF A;  3ASS A;  3W5H A;  3RYP A;  3CC4 B;  1T2K A;  2VFM A;  3RIQ A;  3OW7 A;  1KC8 D;  3FJO A;  4XN3 A;  1BC8 C;  2ZXW H;  3GO5 A;  3WTW C;  3COA C;  3RI4 A;  3F8M A;  4XM3 A;  1A31 A;  4OPW A;  4W8R A;  4IJA A;  1QCX A;  2FE3 A;  4AD9 A;  3QP5 A;  4Y15 A;  4MQ9 F;  2DET A;  2DYR H;  4RS8 A;  4OJO A;  3LMM A;  1D1B A;  1R71 A;  3ZMT A;  3QYF A;  2IJL A;  2WBM A;  3CMA I;  3WG9 A;  4C2M J;  3M4O J;  1FTZ A;  5EYR A;  1UCR A;  3ZRG A;  1FIA A;  4DOZ A;  4YIF A;  2VE9 A;  4PAB A;  3S1M J;  2E5Z A;  2K3F A;  4M9Z A;  4MTD A;  4DYQ A;  2L7F P;  3KZZ A;  3H0G J;  5HKK A;  2LH9 A;  1O8F A;  1RUN A;  1F60 A;  4GQN A;  1W0K A;  3G6E I;  3G3Z A;  4A0Y A;  2H27 A;  1E63 A;  3GQ8 A;  1FZP B;  1KZH A;  2O5R A;  2B7B A;  2MA3 A;  1ETQ A;  2LC2 A;  3IC7 A;  1WVR A;  3OS0 A;  2COB A;  3FIW A;  1WOS A;  4C43 A;  3VB2 A;  4J00 A;  1WJF A;  2XGC A;  1Z21 A;  2XTX A;  1RI7 A;  2H6C A;  5IPA A;  5C44 J;  2QA4 I;  2L9R A;  4Q48 A;  2E2I J;  3QE2 A;  2E60 A;  3Q9V A;  4BY1 J;  2RRE A;  3HSE A;  3M9A A;  3SLD A;  2E1O A;  1QVU A;  3HM5 A;  3E7L A;  3FM3 A;  2BZT A;  3IKV A;  2R7F A;  3QYB A;  2R7W A;  4BAC A;  4IHS A;  4CQJ A;  3W5V A;  3OW2 B;  2VJ5 A;  3HUG B;  5IT9 K;  2GXG A;  2M5S A;  5ICE A;  2WYR A;  1YW9 A;  2QQ8 A;  2X9D A;  2DDB A;  3HOV J;  2FX3 A;  1KTW A;  4PFO A;  1WJA A;  2OAZ A;  5IYD J;  4Y52 J;  2BSP A;  4UB8 C;  1T0F A;  2F43 A;  3BTL A;  2HQR A;  2PQ8 A;  4HG2 A;  3K4K A;  1WU8 A;  1K4Z A;  1U5T A;  4Y4R A;  4F91 B;  1LLZ A;  4F93 B;  2KJB A;  3LSH A;  1F43 A;  4CYC A;  3W2I A;  4PGH A;  1CQT A;  2BGC A;  2O0Y A;  4ZGQ B;  3FKS A;  4XKV A;  3ZQG A;  4G6I A;  1ORK A;  3NEU A;  4S0H B;  3QAH A;  4PJM A;  2LF7 A;  4BE1 A;  1Y0U A;  2JSC A;  3T8R A;  1KK3 A;  5CVJ A;  3E1Y E;  2VFN A;  2PLY A;  3OYK A;  4A3M J;  3J7A O;  3CXC B;  4CCN A;  1W0J A;  4HNT A;  3C7J A;  2JA5 J;  2C5H A;  2HTJ A;  4BU2 A;  4M6Y A;  2PG4 A;  4YII A;  2QTZ A;  3TW6 A;  1GAQ A;  1Y0N A;  2X48 A;  2H8R A;  4WZT A;  1TSP A;  5J4V A;  3D5L A;  1J59 A;  1O57 A;  3KLO A;  2EIX A;  5IYN A;  5J1R A;  4WXH A;  4UUV A;  4I2O A;  4Y13 A;  1ELO A;  1MH4 A;  4ANJ A;  3T1B A;  1F4K A;  2JVG A;  3WE2 A;  4UUS B;  5BMZ A;  2WV0 A;  1SFO J;  3JRB A;  1KJZ A;  2RV8 A;  3WWG A;  2QSF X;  4DJA A;  2D45 A;  2ECC A;  4OJP A;  4P1V A;  4HF0 A;  3FMR A;  2ZIT A;  4KIS A;  2DOE A;  3S2H J;  1YW8 A;  3SY2 A;  2E1M B;  2XRL A;  2RC5 A;  3GVL A;  4FE4 A;  3CJQ B;  2P4W A;  1DDG A;  3BR1 A;  3QPL A;  3I59 A;  2V1U A;  5IYQ A;  1HG8 A;  1LDD A;  2O8X A;  3JRI A;  5L3D A;  4AF6 A;  4CYD A;  1W7P A;  4A5N A;  1FOY A;  1EE6 A;  3E5U A;  5BPI A;  2XSJ C;  4MXN A;  1QUE A;  3HJE A;  2QQA A;  3CCJ B;  1VZ0 A;  1LM1 A;  1Y8R B;  2W7Z A;  4CZZ A;  3OYC A;  5KNL A;  3LSP A;  1EP3 B;  1TVC A;  2C78 A;  3HZJ A;  4EEF G;  2WPD A;  2J8I A;  3C2H A;  1IXR C;  2DA5 A;  3M8E A;  2R7Z J;  2ZFU A;  4DGW B;  2R7T A;  4XLE A;  1NB0 A;  3FK7 A;  4E7H A;  1UMK A;  1E3X A;  1X2N A;  2CG4 A;  2ZXJ A;  2W7N A;  4DQK A;  4A3J J;  2W4S A;  3EQO A;  3D0S A;  4PSX A;  5KAF C;  2R7U A;  1ERD A;  1PXZ A;  2DMQ A;  4W8S A;  3VYR B;  1ZLJ A;  3S8P A;  1I8D A;  2XTW A;  1IRF A;  3K1N A;  3IWF A;  3IWZ A;  1KA8 A;  1WWX A;  3SXY A;  4BH9 A;  4D5F A;  5EZH A;  4G7Z F;  3K1M A;  3AL0 B;  3KEQ A;  3GVJ A;  2INU A;  2W6J A;  1B9M A;  4PC6 A;  2A5W A;  4TMV A;  1SFU A;  3A8K A;  4EJO A;  1D1A A;  4BHP A;  2VYQ A;  5LEK A;  1EH7 A;  4OPO A;  3DXJ F;  5LFA A;  4B3G A;  4BY7 J;  3A0B C;  3J7Z I;  4OIQ F;  4DK0 A;  1VF9 A;  5DS9 A;  1YQA A;  3QPS A;  2DQR A;  2XRO A;  3LNQ A;  1EP2 B;  2DN0 A;  4PJJ A;  1V5V A;  2DA4 A;  2DY1 A;  4BKX A;  2W48 A;  5CPR B;  2J8K A;  4OOX A;  4MTE A;  2L9V A;  3J7A Y;  4ZTJ A;  1WQ2 A;  2HKO A;  5J1Y A;  3L2V A;  1JE8 A;  2VXD A;  1BR4 A;  5FKL A;  2KRH A;  3OYF A;  2CW5 A;  2KZG A;  2LRD A;  2P0W A;  2J7K A;  3SYJ A;  3HGG A;  2IS2 A;  3VOD A;  3FPK A;  1EWY A;  2A61 A;  1YX2 A;  4EJU A;  2FBI A;  3FF5 A;  3RKW A;  1KQ9 A;  2AXT C;  1AMO A;  2TDX A;  5J8C A;  2ZXI A;  4JX4 A;  1VQK I;  4AC9 A;  1X1C A;  3E5X A;  3LA2 A;  4GYG A;  4Y33 A;  1UD8 A;  1VBL A;  1JI8 A;  3DP7 A;  3AG2 H;  1DQU A;  2RAE A;  1E3O C;  4N4O B;  1MMS A;  3OIQ A;  5K5O A;  5HOD A;  4L0Y B;  3Q3A A;  2Y69 H;  4MGR A;  2M7A A;  5HDG A;  1LDK B;  1YRN B;  2R7Q A;  3FKJ A;  1DUX C;  1IRX A;  4H9G A;  1OCR H;  1OR7 A;  1B6A A;  2F2E A;  3DTK A;  5AIP A;  3IL2 A;  2KDO A;  5H20 A;  1Q81 D;  1IF1 A;  5LMZ A;  1LB2 A;  4Z4R A;  1SM4 A;  2V1X A;  2ZSH B;  3A0H C;  4RM3 A;  2GK7 A;  4U4B A;  3M8J A;  3LQQ A;  2YU9 J;  3PM1 A;  3DKY A;  3OYB A;  1K8F A;  2A6E F;  2K7L A;  1TZL A;  3OZU A;  1TW3 A;  2BY2 A;  3JUR A;  3BY6 A;  4UZU A;  1Z7U A;  4I0A A;  3W2V A;  1B9N A;  1BR1 A;  2VBE A;  3H3U A;  2ACJ A;  1BM9 A;  3AG3 H;  4BQA A;  3WHB A;  5IYW A;  4ENN A;  2F3L A;  3B90 A;  5IOZ A;  3H5A A;  2V79 A;  1FNB A;  2UXN A;  3JQQ A;  1LLW A;  1S3J A;  2IT0 A;  1DP7 P;  1GJR A;  2F1M A;  2I1L A;  1APL C;  2XNC A;  4LG0 B;  2GJP A;  3ML3 A;  2LP0 A;  1YIT I;  2RQQ A;  1TTT A;  2GIZ A;  4IL6 C;  2L02 A;  2M3A A;  1BHE A;  1DGR M;  3JX8 A;  2Y30 A;  1B4A A;  2RC4 A;  1V3F A;  3I64 A;  4AF7 A;  3H9N A;  5E6T A;  2ELJ A;  4ZCM A;  2OQG A;  5F27 A;  5EG0 B;  3VMV A;  4FX0 A;  4M71 A;  4PJ0 C;  1U9O A;  2P6S A;  1B8I A;  2Y48 A;  3HXL A;  3Q0W A;  3HBL A;  2LR8 A;  3QOE A;  1EFT A;  4ROX A;  2V26 A;  4AU7 A;  4Z2Y A;  5E1W A;  3HL2 A;  1JHH A;  2W25 A;  3SQN A;  1ZQ3 P;  1FP1 D;  1W36 C;  5FLX K;  4K2E A;  2LKS A;  4HQE A;  1GVH A;  2VKH A;  3SZT A;  1ZHF A;  2NVT J;  2FML A;  4YCQ A;  1JKO C;  5E79 C;  1OGO X;  2CWE A;  2BN4 A;  3FXK A;  4ZYG A;  1VQL B;  4Y9R A;  5D4R A;  2BM4 A;  1BI1 A;  3H1C A;  3Q9S A;  3I71 A;  1EFU A;  4R1H A;  1NRK A;  2INV A;  3AVW A;  1T0F C;  3PUB A;  3HAG A;  1ZGJ A;  1K78 A;  1O8E A;  2CRG A;  2KIF A;  3DPT A;  1X3Z B;  2R6H A;  4OJ5 A;  4LLL A;  1LE8 B;  5J3L A;  3V8J A;  4MNU A;  2K9Q A;  3WGG A;  3DU5 A;  4KMF A;  2VBV A;  3AK5 A;  2JZY A;  1T6X A;  1E64 A;  1I39 A;  2FVG A;  1VQ4 I;  2OK7 A;  2EIM H;  4OAZ A;  4GDF A;  3PSZ A;  1LEB A;  2IGK A;  4WWC A;  1QHG A;  3JRC A;  2RN7 A;  4UNO A;  1BOB A;  4KIT B;  1FND A;  1KYZ A;  1U5T B;  4WZE A;  1EA3 A;  2WAD A;  3BT9 A;  3QWL A;  3W3C A;  3D26 A;  5EGO A;  4CYC B;  2XV4 S;  3I58 A;  3DKW A;  5L3B A;  5LLQ A;  2EK5 A;  5THX A;  2EV5 A;  5DCF A;  4AYB A;  1GHC A;  4YC5 A;  4BBS J;  2WAQ N;  2E19 A;  2C6Y A;  1D1C A;  2I10 A;  4XLP F;  2OD5 A;  2E36 A;  2W85 A;  2QTL A;  4EM2 A;  1CLW A;  5B3S H;  1HA8 A;  4RD1 A;  3QP6 A;  3VOE A;  3RCO A;  3K69 A;  2FBH A;  2HS5 A;  1X19 A;  1IXC A;  3ZMZ A;  1D2E A;  4KKU A;  4M4S A;  2UUZ A;  1W5S A;  1Z0X A;  4P2N A;  4EQQ A;  3OR1 C;  2ZME B;  1UG2 A;  5F4O A;  3KEO A;  1P92 A;  2W00 A;  3IH4 A;  5K1Y A;  2V7V A;  5B5E C;  1WOO A;  2WY8 Q;  4RLQ A;  2BM1 A;  4ZYE A;  2V1N A;  3FBN B;  2WJV A;  4G7W A;  4KKS A;  5D5U B;  1ZKG A;  1OYW A;  4HZF A;  4QTR A;  3RKQ A;  1JHF A;  1MJB A;  2D2W A;  2Y9Z A;  3ES9 A;  1VJS A;  1OFL A;  4RM0 A;  4TT3 A;  4KIF A;  4OMY A;  2QSH X;  3K1P A;  2XT4 A;  1J75 A;  5K5R A;  4E4H A;  4NNJ A;  3CRZ A;  3OS2 A;  4XSZ F;  2STW A;  3H0D A;  4Z03 A;  3OV8 A;  1TW2 A;  2E7W A;  2HQ5 A;  3I59 B;  4A6E A;  1N78 A;  1T6Z A;  2NZM A;  2IAI A;  3JR9 A;  2HU9 A;  1T6Y A;  4X7F A;  1W7P B;  4G7H F;  2MW8 A;  5BNG A;  4QLC U;  1X0C A;  1MBF A;  1ZAR A;  2PEX A;  2GA2 A;  2GAU A;  1YS6 A;  3OYE A;  4PJL A;  2QUF A;  4B8X A;  3MKL A;  3AG1 H;  3Q6Q A;  3D5R C;  3CZ6 A;  4IHW A;  1DBO A;  1RMG A;  2HXO A;  5HLG A;  1O8D A;  4N9I A;  3GTJ J;  4CUG A;  5HVQ C;  2XF6 A;  1D8T A;  3VMF A;  3BZC A;  4HSR A;  2ID3 A;  2VFO A;  1R49 A;  3BJO A;  2JMW A;  2HPM A;  5FGM A;  3BWG A;  4KA4 A;  1FOK A;  3SJZ A;  4UAJ A;  2TRT A;  5GV7 A;  2YWH A;  4OJ6 A;  2MC3 A;  4GFB A;  1R5H A;  4LGW A;  4E7S A;  2D5V A;  3I1F A;  4ACA A;  4FWT A;  1I6X A;  1UEL B;  2HYG D;  1Y1W J;  2BHY A;  1HCR A;  2JIZ A;  1N08 A;  4UVA A;  4P5O A;  3DDY A;  3H9J A;  4GGG A;  4RPB A;  1D8J A;  2GPJ A;  3HKZ N;  3JQP A;  1PUE E;  4M6V A;  4OPV A;  3CJR B;  2LY9 A;  1IGN A;  1D0Y A;  3J81 Z;  1PJ6 A;  3NB2 A;  3WGH A;  2DI3 A;  3VMW A;  2VAS A;  1EXM A;  2FOK A;  3GZN B;  5ILS A;  1FRN A;  4YAU A;  3UR3 C;  1XDU A;  3DEW A;  3R6J A;  4U9U A;  1TWF J;  2VQL A;  3SHF A;  2DQL A;  4PK4 A;  4DZP A;  4LBZ A;  1DU6 A;  4OWR B;  4LG3 A;  2MGQ A;  5K5Q A;  4IHY A;  1I6H J;  3GQB A;  3IAM 2;  3LL7 A;  3F6O A;  1WRJ A;  5LHG A;  3ONY A;  3F23 A;  1NJI D;  1TYW A;  3HYI A;  1DGW Y;  4GXO A;  1X1B A;  1T98 A;  2L9N A;  3RJP A;  5JMC B;  3LA3 A;  1OR7 C;  2CS3 A;  2F5D A;  1QVF B;  1XDS A;  3AGP A;  1N07 A;  2DER A;  3RQI A;  2XPU A;  5FD5 A;  4NC8 A;  4A3G J;  2AHO A;  1YJN B;  3U1D A;  3BZK A;  1B59 A;  4HDU A;  2X3U A;  3CCR B;  2M4G A;  3ABK H;  2YR2 A;  3ROU A;  4YAO A;  3DQV C;  4RGX A;  2YUS A;  2NTB A;  4KH3 A;  3H5R A;  5IT9 Z;  1CQX A;  2LMD A;  1DG1 G;  1HLV A;  2DPU A;  4M3D A;  3SKB A;  3A1Y A;  4WX9 A;  2XGJ A;  1XX5 A;  4L5I A;  1XMK A;  2KMU A;  2E2H J;  3I56 B;  3TDU C;  2XGD A;  1OB5 A;  4B1R A;  3BR2 A;  2IW5 A;  3SYT A;  2Q1Z B;  1Z05 A;  3JAM K;  2KJC A;  5FB2 A;  3HUG A;  3SEQ A;  3V4G A;  3GBG A;  5ILV A;  3KZI C;  4TMZ A;  1UMQ A;  1G6N A;  4NBS A;  3PIP F;  4C2U A;  2A69 F;  2E34 A;  2OUM A;  3TQN A;  3HTS B;  3A4C A;  5IY5 H;  2L4A A;  3ELK A;  4YFK F;  4Y17 A;  5F04 A;  2ME6 A;  1MMN A;  2BVM A;  1QPI A;  1EF4 A;  2F48 A;  3E6B A;  3FWE A;  1RC9 A;  2ZKZ A;  4PC2 A;  2WC2 A;  2EH3 A;  3V7C A;  2X1E A;  2X6Y A;  2Z1D A;  5GTI C;  3ASR A;  1J2X A;  3VO2 A;  5DV5 A;  5H6R A;  3CCV I;  1U0J A;  2EIN H;  3KP4 A;  1BMF A;  3KZY A;  4BS9 A;  3BG5 A;  1UD4 A;  1O8I A;  5J4Y A;  4RAY A;  1XFO A;  2B7C A;  1N06 A;  2L01 A;  4XSX F;  2YSR A;  2QZA A;  3TL4 X;  2OF7 A;  1YG2 A;  4Q7J B;  5F4J A;  2KRC A;  1TWG J;  3WYA A;  3G71 B;  1O3S A;  1YI2 B;  1N0U A;  5KCM A;  4XNF A;  3WTT C;  1VLO A;  5B1A H;  1SAU A;  1SD4 A;  3ZQQ A;  4AUX A;  4IOC F;  4AIH A;  1FYL A;  1VND A;  4KIC A;  1O4X A;  3LAJ A;  5FL7 A;  3CCU B;  1K28 D;  5EMN A;  4LBV A;  3GFL A;  3ZQL A;  2F4I A;  3V8K A;  4M73 A;  2VJJ A;  5TY0 A;  3CCQ B;  1RRJ A;  4BBR J;  5F1J A;  4N0B A;  1E43 A;  1EFC A;  2X85 A;  4YDT A;  2XKO A;  1Q1V A;  1HZE A;  3BY2 A;  1QFJ A;  2BM6 A;  2HZD A;  2DA2 A;  5E3O A;  1FNM A;  3H09 A;  3F0C A;  1B72 A;  3OJX A;  3DTI A;  4PGO A;  1T56 A;  4TMT A;  4C3I J;  4UV8 A;  3O3K A;  1UD2 A;  4HAM A;  4M3B A;  2V6C A;  2EIJ H;  2CV1 A;  1KQ5 A;  2F6C A;  1IG7 A;  2DMT A;  2G7U A;  2IQ7 A;  1ZG1 A;  4X7D A;  2O6W A;  3FIS A;  3I5U A;  4TN1 A;  2RNG A;  2NS7 A;  3CDI A;  2JJ2 A;  1X2M A;  4XOT A;  4LK0 F;  3CCS I;  1XGS A;  4P6Y A;  4OOS A;  1Y39 A;  1XS9 A;  2QF7 A;  2O0W A;  1KCC A;  3NAR A;  2OCE A;  3JU4 A;  1UHW A;  3KET A;  2IGN A;  2JN6 A;  1KGS A;  3AVX A;  1BBY A;  4CGZ A;  1YIO A;  5GPC A;  2ECB A;  4CHU A;  2VBT A;  1ZLK A;  5FO0 A;  2OCC H;  1HKS A;  5F4M A;  1UG0 A;  1KU3 A;  1H89 C;  1HBX G;  2IA2 A;  1NH3 A;  3FPP A;  4A12 A;  1Z7L A;  1XTA A;  5F64 A;  2HR3 A;  1OCP A;  4DBR A;  1Z67 A;  1GXP A;  2JVH A;  4KDP A;  1H85 A;  3K4B A;  3CC2 B;  1DU0 A;  1P4M A;  1WKM A;  3P9C A;  4OAY A;  1U78 A;  3VNU A;  2DU9 A;  4A3F J;  1ZRE A;  1FYK A;  1OB2 A;  1D5Y A;  2DA3 A;  2ZL5 A;  5J47 A;  5LEJ A;  3K10 A;  3L2R A;  4XKW A;  2VXZ A;  2ZB9 A;  1UD6 A;  1WJD A;  3OL3 A;  3TMO A;  2LNB A;  1PJ7 A;  1WOP A;  2VC0 A;  2MBF A;  3CUQ B;  1Z3X A;  2HDW A;  3A1P A;  3BG6 A;  1RU4 A;  4FX4 A;  3U9G A;  2K27 A;  1VQ8 B;  2Q8K A;  3Q39 A;  1Z6R A;  4NUB A;  5L3F A;  2WZN A;  3S15 J;  4X7E A;  2LRE A;  5JBQ A;  1V54 H;  2X6O A;  5L3G A;  3DTE A;  1Q86 D;  1A36 A;  2HDC A;  3L7W A;  1D3Y A;  3U6K A;  2CU7 A;  4ZH4 F;  2I5U A;  2BSA A;  3CCM I;  5ERI A;  2BM5 A;  1JB9 A;  4LLG F;  1LEA A;  2QMU A;  1QHH D;  5B66 C;  1S7A A;  3BRO A;  2KQR A;  1KYW A;  5HDN A;  5LRS A;  1I3Q J;  2K86 A;  4QPO A;  1E1Q A;  2CJJ A;  3AST A;  1YLO A;  4FET A;  2VI6 A;  3S93 A;  1DDI A;  3OMY A;  2DOG A;  3BG3 A;  1ULY A;  2JSP A;  5IYR A;  2WV1 A;  2A6T A;  1OFE A;  2EIK H;  4PGG A;  4EM1 A;  3KYD B;  1H42 A;  3MEX A;  2KFD A;  4HEA 2;  3G05 A;  3OEH A;  3FKI J;  2LTP A;  3BH6 B;  4BYY A;  1VQ5 I;  3GFI A;  4IVN A;  1ZRD A;  2X8K A;  1YRN A;  2LD5 A;  2WAQ A;  1YJ9 B;  1STZ A;  2DMP A;  4YFX F;  2VOD A;  1VQ7 I;  4YZX A;  2K9S A;  2DPD A;  3QYE A;  4IEJ A;  3J7Y J;  3W5U A;  2DA6 A;  2DJN A;  2OBR A;  3MAJ A;  4XLN F;  1Z9C A;  4WCG A;  1N05 A;  1R5B A;  4RD3 A;  4XRS A;  1WJE A;  3I54 A;  2JUC A;  3F8F A;  4IOA F;  3IKT A;  3ZC3 A;  1WJ5 A;  1HF0 A;  1MW7 A;  2F4M B;  1VQM I;  2A6H F;  1AKH B;  2ZJ2 A;  2NT9 A;  4P1W A;  4A0Z A;  4P9S A;  3RPU A;  2OBP A;  3BY1 A;  3PO2 J;  3PUF A;  3LSG A;  4X05 A;  1FEX A;  2D1V A;  1TQM A;  1D0X A;  2ZO4 A;  5J8F A;  3AGQ A;  4MYU A;  5E8G A;  1RR7 A;  1ZR2 A;  3LMW A;  4ENK A;  2ELK A;  4RDU A;  3LSM A;  4FCY A;  4EJV A;  2QQ9 A;  2HOT A;  4BHB A;  1FSE A;  1D5V A;  1YIJ B;  1JJ8 C;  5DCM B;  1BL0 A;  4RDK A;  1ETO A;  3E6D A;  4LG0 A;  2PMD A;  3I55 B;  4AC0 A;  4E7L A;  3KEW A;  2V1D A;  4FAS D;  2VPR A;  2PMU A;  3GF2 A;  1MSE C;  1FX0 A;  1F20 A;  5TIS C;  4X0G A;  2CND A;  2KDZ A;  5AN9 A;  1ONV A;  1MMD A;  5BPD A;  3E20 A;  5FLX Z;  1K6O A;  1K5C A;  1G8X A;  2DFE A;  1WSV A;  1FBS A;  5EG0 A;  1S0U A;  4Z4S A;  5DN6 A;  1GR1 A;  3KP6 A;  2M4K A;  2LG4 A;  4B3X A;  2OTJ I;  2MG4 A;  2CUZ A;  2V7U A;  2XGX A;  3LNN A;  1IW7 F;  2BXZ A;  4KYW A;  1A8P A;  4M3E A;  3TKY A;  2O8K A;  2FUG 2;  1S4M A;  5E1X A;  3FXM A;  3CJN A;  2OBT A;  1KTV A;  1SFE A;  4M9S A;  3GQ7 A;  4B4D A;  2VBS A;  4B3A A;  3B6A A;  1LE8 A;  1ETX A;  2M0C A;  2ISZ A;  1X1P A;  4QSH A;  2P3M A;  1CGP A;  4HNV A;  1AIR A;  2Z8G A;  1O7F A;  1YLF A;  3IV5 A;  4IRI A;  4XLA A;  2XZO A;  1ITY A;  3RZD J;  5JHU A;  3B02 A;  1TWC J;  5CJ9 A;  5BSX A;  1QZE A;  3DCF A;  4A6D A;  1KCD A;  2ZJQ F;  1IV6 A;  4OMZ A;  2O04 A;  3CC7 B;  3N4M A;  4G6D A;  2VLA A;  4RAG A;  3DU1 X;  2XAS A;  3LFU A;  2AQF A;  4YEI A;  1IN4 A;  5LGN A;  2KP6 A;  2VC1 A;  4MYT A;  3HKZ A;  2EV6 A;  1O88 A;  1FC3 A;  1H9G A;  1YJW B;  1NB9 A;  1R5I D;  2AHQ A;  2ZL6 A;  3CCL B;  3BNW A;  2V6E A;  5CKT A;  4C3J J;  2E71 A;  3CUO A;  3PUM A;  2CV0 A;  3J81 k;  2K9N A;  1ZN2 A;  3Q0V A;  3K7A J;  2CQ7 A;  2BM7 A;  5KHD A;  3G4S I;  2OTL I;  4MIM A;  3MN2 A;  4DQ2 A;  3A3B A;  3BCF A;  1OIS A;  4N3G A;  3ZQC A;  4K1X A;  2RC6 A;  3CF5 F;  2BM0 A;  2ESN A;  2P7C B;  1S7E A;  2L54 A;  1KD1 D;  2P5K A;  4TMX A;  2ZME A;  3WNB A;  1TYX A;  1SMY F;  3MZY A;  2BW3 B;  2EZH A;  4P9U A;  1O3Q A;  3OYI A;  4QHY A;  5HNH A;  4D1Q A;  4HPQ A;  2K5C A;  2BGJ A;  3HOW J;  4WZL A;  3W2G A;  1V0E A;  2O7O A;  3LAP A;  4BE0 A;  2C4T A;  1IRG A;  1MRZ A;  5FIU A;  2BXY A;  2E1M C;  5FO5 A;  3TP3 A;  2WZP P;  4A5M A;  4LOC A;  2WSS A;  4YFO A;  2IXS A;  1EKE A;  1T5E A;  5HOO A;  2FOW A;  3H36 A;  4ZZD A;  1BN8 A;  1B72 B;  2PYG A;  1E3P A;  1SAX A;  2QXZ A;  2VL8 A;  2XC1 A;  3S32 A;  4Y3O A;  3FMS A;  1IN5 A;  5HS7 A;  4ASU A;  2UVE A;  3EQN A;  3OOP A;  1IV8 A;  4IO9 F;  3AFH A;  4A3C J;  4M6X A;  2X6W A;  3GQA A;  1XMX A;  2OQR A;  4EJT A;  1Z91 A;  2O9L A;  1UD5 A;  1XB4 A;  3MZ8 A;  2B7E A;  4XON A;  5L3C A;  1XB2 A;  1S29 A;  2VFP A;  3GYH X;  2A07 F;  5A8A A;  1U8B A;  4XLC A;  3L1P A;  2ZNY A;  1UJ8 A;  2BOL A;  5LD2 C;  3QFT A;  1BI0 A;  2ZBK A;  2DYS H;  1FOW A;  4BE2 A;  4QUZ A;  2NNN A;  5A2Q Z;  5B1B H;  5CQG A;  2J5P A;  3AL0 C;  4QV2 A;  1A6I A;  2GRE A;  3KP2 A;  4P6V F;  2HVR A;  1RPW A;  2EFN A;  2VBU A;  1WHU A;  4TSF A;  1S72 B;  4HQM A;  2R7V A;  2DEU A;  1WOR A;  3GZ6 A;  4I6Z A;  2JT1 A;  2J5O A;  4D7N A;  3H3V K;  4JK1 X;  5BOX A;  2V5I A;  4TKO B;  5AON A;  3FHN A;  1Z3Y A;  3BOQ A;  1BLI A;  1QH0 A;  1R5O A;  4X0C A;  4CXF A;  1MSF C;  1R7J A;  3KLN A;  2LKP A;  1OLT A;  2EWE A;  1JJ2 B;  2DIE A;  1I5Z A;  3J80 Z;  2VBY A;  3FXU A;  1IJE A;  4IXA A;  3WTZ A;  3ZMV A;  3LFK A;  3QOP A;  4ZYD A;  1K4T A;  1YHQ I;  1TUI A;  3W2H A;  1MNE A;  1OOC A;  5CVV A;  3GTO J;  3V7R A;  1E1R A;  3TOB A;  1ETW A;  4WF2 A;  2LZJ A;  3L2Q A;  3W2A A;  2ZBV A;  2HKX A;  1EFR A;  3MCA A;  3IRQ A;  4IRH A;  3CME I;  3HPG A;  2XKP A;  2O0V A;  5K7H A;  2DDA A;  4RD6 A;  2G0E A;  4AIJ A;  4W97 A;  5BQT A;  3KE2 A;  3NWS A;  5J40 A;  2VT2 A;  1AA7 A;  1LVK A;  4WXD A;  3H9G A;  5JVG F;  4OIP F;  4NQW A;  5E8I A;  1VQ9 I;  4A3E J;  4RAZ A;  2MH9 A;  1CZF A;  3IH3 A;  4RAF A;  1E79 A;  4LBW A;  2ADU A;  5IK2 A;  2QY1 A;  5E18 F;  2Q6I A;  2E5N A;  2NSP A;  2O61 A;  3RY8 A;  2CFO A;  3DBR B;  2E1N A;  2ME0 A;  3BLY A;  3TOA A;  2XTY A;  4Z05 A;  1HDP A;  3B8H A;  1BJK A;  5E3L A;  2RKH A;  3FX3 A;  4MLO A;  2KLO A;  1T39 A;  2W82 A;  3PA2 A;  2CV2 A;  1XE1 A;  5H59 A;  5DM7 F;  1JGS A;  3MKW B;  3LJY A;  5HLI A;  3ZGK A;  3JAM Z;  2IS6 A;  2CSO A;  1ZR4 A;  3P26 A;  4YEL A;  3CD6 I;  1GXQ A;  3FBI B;  1ZM9 A;  2EA2 A;  5DEQ A;  2VBZ A;  4G5G A;  1K73 D;  1M90 D;  1HW5 A;  3F22 A;  1DBG A;  3KX2 A;  2E1B A;  1FIP A;  4XKB A;  4CCM A;  5HS9 A;  1VQP I;  3WBJ A;  2UZK A;  1J9I A;  5HZA A;  2EFW A;  1GVJ A;  3CMY A;  2F1L A;  3ZSC A;  2N8G A;  4M0L A;  2MFZ A;  2VKV A;  1DPR A;  3T53 B;  2QEX I;  4BXU A;  4ZCL A;  1FMW A;  1QU3 A;  3NAW A;  2KL4 A;  4NC6 A;  3M1C A;  3OYG A;  4FTH A;  1IJW C;  4GO1 A;  1E17 A;  3BR5 A;  4XLF A;  5FKK A;  2P7V B;  1BPL A;  4D9J A;  4O3M A;  3VSV A;  2QBY A;  2EB7 A;  1X1A A;  1H0M A;  1W0T A;  2K4J A;  2MYS A;  2XC7 A;  3BQJ A;  4JRA C;  1R9T J;  1NG7 A;  3OSG A;  3OFN A;  1WH7 A;  3LWF A;  3OYL A;  3RTR A;  2UWM A;  5E1Z B;  2OU2 A;  1LPQ A;  2OYN A;  5L46 A;  5AIQ A;  4EVI A;  1MMA A;  1Z1D A;  4RD0 A;  2V7Q A;  2DK8 A;  4YIR X;  4XLH A;  2R5Y B;  1KRH A;  1I1G A;  3SEZ A;  1VQO I;  2CGP A;  4M1K A;  1WI3 A;  3T56 B;  4DNT B;  3FY3 A;  4YFN F;  5HDK A;  2D9R A;  4TV7 A;  5EF6 A;  5FKM A;  1V5G A;  3RPQ A;  1ACI A;  1WJC A;  3E3V A;  4RLF A;  2ZZQ A;  3BQY A;  5D5X B;  3MFK A;  1AU7 A;  3P5J A;  1E62 A;  4HOB A;  1YFH A;  1IZ1 A;  2KZV A;  4UY8 I;  3K70 C;  2ZJP F;  3FM5 A;  1P4X A;  2MD5 A;  3K9T A;  1JT6 A;  1OCZ H;  3CC2 I;  1VQN B;  5JFR A;  3GEZ A;  4H0E A;  4DW6 A;  4E7Z A;  2NNY A;  3MMY B;  5LRR A;  3WTS C;  1WJB A;  3M3Y J;  2IOU G;  2QCO A;  2L5Q A;  2PMH A;  1YS7 A;  1AHD P;  3HRT A;  5M5X J;  1U5T C;  4D7M A;  4M9X A;  3Q3S A;  3WHC A;  3PL8 A;  1MGT A;  1BI2 A;  5HZB A;  1M1K D;  3PET A;  3REO A;  5C1C A;  4BXX J;  4L9J A;  5D6E A;  2NVQ J;  2LKX A;  3HTU A;  3B8Y A;  1W87 A;  3I4M J;  1X3W B;  3U2Q A;  2STT A;  3QU6 A;  4UZE A;  3CCE B;  1OYI A;  2C4U A;  5DD4 A;  2Z6B D;  4L8J A;  5C4X J;  2Z99 A;  4X06 A;  2LF8 A;  3ASO H;  3ZPP A;  5F0H A;  1QBJ A;  4B47 A;  2E1R A;  4CCL A;  5GAG J;  5JHF A;  1AOY A;  2MD0 A;  2O17 A;  3OJW A;  1IDJ A;  2FU4 A;  1KK1 A;  3NAU A;  1I18 A;  5DUK A;  3R60 A;  2ZME C;  4MEY F;  2UXX A;  2VOP A;  1G3T A;  3ZQH A;  1V0F A;  2PIA A;  2V7T A;  1O8M A;  1NHA A;  3N05 A;  3LSK A;  4Z4U A;  3LO8 A;  4OZY A;  4I99 C;  1TNT A;  3PUN A;  3Q5F A;  2Y9Y A;  1ZAO A;  2DMN A;  3CMA B;  4BJ6 C;  2F4O B;  3CQZ J;  3DLA A;  4L9T A;  1LUJ B;  2DT5 A;  4DYC A;  1F36 A;  1HW1 A;  4E6K G;  1CNE A;  4X8I A;  4V02 C;  4U88 A;  1WSU A;  1JRG A;  2DOA A;  3BG7 A;  1ZGW A;  3LYC A;  2YUH A;  1WCM J;  3L9F A;  3CW2 A;  2H09 A;  3VPR A;  4EM0 B;  2JA7 J;  3KL9 A;  3E5Q A;  2M2E A;  1NDH A;  1T38 A;  3MZH A;  4G7O F;  1KU9 A;  2R93 J;  1HSJ A;  2L0K A;  4WWV A;  3OOU A;  3KCC A;  4J19 A;  4RDJ A;  1O8K A;  1OHH A;  4XD7 A;  5J1U A;  2XNJ A;  2XND A;  3ML6 A;  1XSD A;  4P12 A;  3WBK A;  2XHK A;  3CUQ A;  3FHZ A;  3PA1 A;  4RD4 A;  2VOO A;  3CC4 I;  2QA4 B;  1JKQ C;  1R4N B;  3E97 A;  2R7R A;  3GVK A;  1W4M A;  1ZG5 A;  3BCA A;  3T5X A;  2H94 A;  3CLO A;  3R6S A;  4E70 A;  1V5F A;  3VSK A;  3OYM A;  4Z4Z A;  4JYK A;  1NBM A;  1JTA A;  3OZW A;  5ED4 A;  2EBI A;  2HQA A;  3OY9 A;  3ZXS A;  3W2W A;  3EUH A;  3WND A;  4DYR A;  1P7J A;  5D4S A;  2K3P A;  1ON2 A;  2CUE A;  1Q1H A;  2KHM A;  3HIF A;  3K4L A;  3GCM A;  4PAA A;  4N9H A;  5M5Y J;  3OZV A;  2MSY A;  2XB0 X;  3JSO A;  4P26 A;  3MWM A;  3B78 A;  1PLU A;  3BR0 A;  2KIM A;  1E3Z A;  3QRF F;  1USS A;  2BE5 F;  4LIU A;  5F0F A;  2NYX A;  4L5J A;  2CW8 A;  1YTY A;  3IAS 2;  4OM9 A;  2LOO A;  1PJR A;  3S3N A;  4ZZL A;  2EZI A;  4Z4T A;  5TJJ A;  2Q6K A;  2XUB A;  2OJE D;  3I4N J;  2X1C A;  1ZEL A;  1JA0 A;  3S16 J;  2QWW A;  4R79 A;  1NHC A;  1XCV A;  1OGI A;  4PC7 A;  3G2B A;  1FLI A;  4BQO A;  4LLN A;  2HOA A;  1LNW A;  1REP C;  4XK4 A;  1V4R A;  4L5E A;  3BC8 A;  3QOD A;  3CES A;  5CYV A;  4Q4Z F;  1AKH A;  4IX7 A;  3NQO A;  3WTX C;  3K6G A;  5DYM A;  3WNC A;  2KIS A;  4MEX F;  3GWZ A;  2P81 A;  3DFG A;  1X4P A;  4AWX B;  1G59 A;  1H8A C;  1L0O C;  1MKM A;  1ZRC A;  3EYI A;  1YW7 A;  3PO3 J;  4U0V A;  2GIV A;  2QDX A;  2DMU A;  2DOF A;  4RB0 A;  1XGN A;  4G9Y A;  5K7F A;  3L2C A;  1ZM2 A;  5DCM A;  1HKT A;  2QSG X;  1H8E A;  2M34 A;  1IRZ A;  4NQW B;  3HOX J;  1VQ6 B;  5E17 F;  2Y75 A;  1MBH A;  4HF1 A;  2W1O A;  3S1R J;  1FWZ A;  1W35 A;  3SLN A;  3BTI A;  2GK6 A;  3OSF A;  3GVA A;  3GTL J;  4XMY A;  1PDN C;  1VI0 A;  1XD7 A;  1ENH A;  1X3U A;  3A02 A;  2H1L A;  2NS8 A;  3P7N A;  1OPC A;  3DPL C;  2L3D A;  1VF7 A;  1RKW A;  2XZP A;  1EH8 A;  2NOJ B;  4Q47 A;  3OWT A;  2GA1 A;  3O8G A;  4A3L J;  1ETK A;  2QN6 A;  4OPS A;  2EJR A;  2V9P A;  2NV4 A;  1Q7Y D;  2GOX B;  1YYV A;  3CF2 A;  1R1V A;  1XSV A;  2X4H A;  2PJR B;  3F21 A;  4A3D J;  2V9V A;  4P9F A;  4H4K C;  1BA5 A;  2LY2 A;  5JI6 A;  1HVX A;  1E0E A;  1FRQ A;  3ZQI A;  1JNY A;  3E1S A;  3CJT B;  4HV6 A;  5IYC J;  1LQ1 A;  3FDY A;  4PUS A;  1UZC A;  1YO5 C;  3SQV A;  2VPL A;  4F7D A;  4AVZ A;  3LA7 A;  4JOM A;  1HF2 A;  4CDG A;  2P8T A;  4CCK A;  1VFC A;  2GXB A;  1A04 A;  4TMW A;  3WG7 H;  3V7A A;  3ZR8 X;  3ZUG A;  1D8K A;  3P4G A;  2C77 A;  1QGY A;  5IOY A;  4YAF A;  2MLG A;  2QBY B;  5A88 A;  3VNV A;  3VYS B;  5IP9 J;  2WY7 Q;  2XAQ A;  1TQI A;  3HHH A;  2FX0 A;  3EPZ A;  2M7B A;  2Y0S N;  1H88 C;  1SFX A;  2GOM A;  5EZG A;  1JKP C;  1SKQ A;  1U9N A;  1K6Y A;  1QVG B;  3DBL B;  4EW9 A;  4MFE A;  4G8X A;  1U8R A;  1W36 D;  1IHM A;  1RKT A;  1SC7 A;  1I1S A;  2KIQ A;  5J3O A;  5AMV A;  3DPU A;  5JLX A;  3KYL A;  1EP1 B;  3OIO A;  3CCJ I;  4C0S A;  3AKZ A;  2R0Q C;  2D3N A;  4F55 A;  3HSF A;  2DTZ A;  4BQN A;  1WPC A;  4NK8 A;  3L00 A;  4J01 A;  1D0Z A;  3WTU C;  2WB1 N;  3IP4 B;  5DUI A;  3OS1 A;  2DCE A;  1T6S A;  2B9S A;  2B63 J;  2AXL A;  2YPR A;  5L3E A;  3IRR A;  2VNI A;  1JA1 A;  3U1K A;  2EV0 A;  1OYY A;  3ISX A;  3DEE A;  2PMZ N;  2FXA A;  1ETV A;  2BW3 A;  3ASQ A;  1VQK B;  4XKC A;  3TBI A;  2FMY A;  1FNC A;  4BQQ A;  3A2K A;  3FXQ A;  4EJW A;  3Q38 A;  3B6C A;  3SEJ A;  4RGU A;  1MBK A;  5DDG A;  1LFB A;  1QA2 A;  3R6K A;  4C2T A;  2OA4 A;  4GRI A;  3TO7 A;  3TP0 A;  1G7S A;  3BR6 A;  2WTE A;  3M1E A;  4YEJ A;  2DFI A;  1J09 A;  2BBY A;  4NB5 A;  2R7X A;  1SVO A;  1OFD A;  2FQ3 A;  1HQC A;  2E7X A;  5TRD A;  2IS4 A;  4WXC A;  2ZL7 A;  2R92 J;  4R71 A;  4OP7 A;  3LVB A;  1P2F A;  4G7X A;  5HXB A;  5D6F A;  2RQP A;  4Y7N J;  2WAE A;  3QPH A;  3L2U A;  1UAA A;  1G3W A;  1Z77 A;  3W6V A;  4Y9U A;  4F7Z A;  2BY0 A;  4P55 A;  5FO1 A;  1V55 H;  2M87 A;  3EQL F;  3EUK L;  4PCQ A;  3IH2 A;  1CF7 B;  2L4M A;  2TCT A;  5CVI A;  2QLZ A;  1XQB A;  4BJ5 C;  2ODL A;  5H5J A;  2JJ1 A;  3PFY A;  2R5Z A;  4OOV A;  5JVT A;  2EWN A;  3O8H A;  4ZJZ A;  2W84 A;  4XL9 A;  5CLS A;  1YIT B;  1MND A;  1MAB A;  4UZF A;  1NG6 A;  1FJL A;  3MQ0 A;  3V7S A;  2DW4 A;  3KP5 A;  1GAW A;  1ZUN B;  1TP4 A;  1TL8 A;  3MMP A;  1W7P D;  2DA7 A;  2PX9 A;  2NOG A;  4ZYA A;  1RZ4 A;  1RR8 C;  3CUQ C;  1IDZ A;  4U49 A;  2LY1 A;  1QQI A;  4DNR B;  3Q0U A;  4EGY A;  3I9V 2;  4HST A;  3TGN A;  2HOE A;  3RKY A;  2ZJR F;  3FXJ A;  1W34 A;  4DZJ A;  1H8H A;  3BG9 A;  4XOR A;  3EUH C;  3OR2 C;  1BN5 A;  2M8E A;  2NAZ A;  1MJ9 A;  2XAG A;  3CPX A;  1U2R A;  4V2F A;  2HCJ B;  2HMA A;  3I53 A;  3DV8 A;  4N3N A;  3N6Z A;  2CQK A;  4HE5 A;  3KEY A;  3FXO A;  5F0C A;  3ZPL A;  2HVS A;  3JTG A;  1OFM A;  3BCD A;  3WQZ A;  2FRH A;  2NRA C;  3OYH A;  4CIC A;  2GQF A;  4FHT A;  4X07 A;  1XPX A;  2JK3 A;  3EYY A;  1XGM A;  1VQ4 B;  1PUF B;  2IPQ X;  3S17 J;  2X6X A;  4L9V A;  4C30 A;  4CZC A;  2V7W A;  4WQM A;  2L7K A;  5ILU A;  3GTP J;  5C1E A;  1WXR A;  2OV7 A;  4U7B A;  2O6G E;  2QX3 A;  2NTQ A;  2VON A;  3PJR A;  4FE7 A;  4Z4Y A;  3Q6R A;  2DK5 A;  1QPM A;  2IP2 A;  3VWB A;  2JTV A;  3JRH A;  3EUA A;  1I7P A;  4ZDP A;  4M2L A;  3AVY A;  2CO5 A;  4XIC A;  4KKT A;  1BC7 C;  1YX3 A;  4BUP A;  3LQR A;  3DKX A;  5H6Q A;  4LC0 A;  2BV6 A;  2HGC A;  4RJL A;  1BR2 A;  2HTS A;  3F8N A;  2VQH A;  4Z06 A;  2HWV A;  1P9Q C;  1OFC X;  1WFX A;  1P7I A;  3P9I A;  4I7H A;  1UB9 A;  5LGU A;  2XAU A;  3VYT B;  2CW7 A;  4RGS A;  5GPA A;  1PYV A;  1BOA A;  2DJI A;  4I01 A;  3WU1 B;  1XG1 A;  1Y1V J;  3CO7 C;  3CB4 A;  3GQ9 A;  1VQL I;  1VQN I;  1FTT A;  1R22 A;  1PJ5 A;  1R4M B;  3ERE D;  4II3 A;  2BY1 A;  1RNL A;  3C3W A;  4E0F A;  3BTC A;  2GQQ A;  2ICW G;  4B43 A;  3PSS A;  4C3H J;  2JPB A;  3BDD A;  1BX0 A;  2XB5 A;  2VIX A;  1Z6T A;  3EDP A;  4I09 A;  3CPW B;  2HQN A;  1SFK A;  2Y2Z A;  2XSD C;  1LKX A;  2L7M P;  3ERM A;  1E2X A;  3OIP A;  4OIR F;  3QPT A;  4FIS A;  5GAH J;  3GTK J;  1QGZ A;  1L1I A;  4ABZ A;  3NRV A;  4A2U A;  4AYB N;  2DT6 A;  5DNS A;  2HYJ A;  5GAD J;  4HBL A;  1J5Y A;  2DO7 A;  4YAL A;  1OJL A;  2CQN A;  4O6J A;  4IHX A;  1V5E A;  2VE8 A;  3VST A;  3D5S C;  1QRC A;  5HNF A;  2XRN A;  2P5V A;  2A05 A;  2G9W A;  1O8G A;  3H5N A;  2QEN A;  2M9H A;  2WA0 A;  2QYO A;  4I0B A;  1JUM A; 
#chains in the Genus database with same CATH homology
 3HPG A;  1SKY B;  4DBQ A;  2O0V A;  1OFL A;  1VJS A;  2CUJ A;  4LIT A;  4TT3 A;  3K4M A;  2X3H A;  4FXU A;  3NWS A;  4E7J A;  1AA7 A;  1LVK A;  4U87 A;  3H9G A;  1OGM X;  4E4H A;  4NNJ A;  4RM2 A;  2V9K A;  3OS2 A;  3H0D A;  4Z03 A;  4XOP A;  1CZF A;  1YX5 A;  1E79 A;  5IK2 A;  2QY1 A;  2L9S A;  1O8L A;  2LYC A;  2E5N A;  2NSP A;  1W9X A;  3U21 A;  2CFO A;  1N78 A;  2V1N A;  1LFP A;  3BLY A;  2HU9 A;  2NZM A;  2XDV A;  4Z05 A;  3PNT A;  2R4G A;  1X0C A;  3K4J A;  2KLO A;  4MLO A;  2NST A;  2W82 A;  2CV2 A;  3BH4 A;  2Q2E B;  3MKW B;  3ZGK A;  2IS6 A;  3HOT A;  2ZZF A;  4BEH A;  2ZZE A;  3OYE A;  4YEL A;  4PJL A;  3VYU B;  4BL0 B;  3S3O A;  3FBI B;  2NT6 A;  3GRH A;  3D5R C;  3CZ6 A;  1DBO A;  2XF5 A;  1DBG A;  4F3Q A;  3KX2 A;  3HG9 A;  4HNU A;  2E1B A;  4NC7 A;  2XF7 A;  4XKB A;  1O8D A;  4CCM A;  3MKY B;  4CUG A;  5HVQ C;  2XF6 A;  3ZPN A;  2VB6 A;  1KMH A;  4G6T B;  1XG2 A;  4HSR A;  3VSU A;  2GJK A;  4YZ0 A;  1X1D A;  3ZSC A;  2HPM A;  2MFZ A;  3T53 B;  4LIV A;  1IB4 A;  1FMW A;  4ZC3 A;  1QU3 A;  2L2O A;  4IQJ A;  2KL4 A;  4YZQ A;  3M1C A;  3OYG A;  2Z2S B;  4OJ6 A;  3OYD A;  4XLF A;  4E7S A;  1Y56 A;  1BPL A;  4D9J A;  3T9G A;  3VSV A;  1UEL B;  2JIZ A;  4BDZ A;  4BDY A;  2PEC A;  1X1A A;  4P5O A;  4W8Q A;  3DDY A;  2MYS A;  2F5V A;  3H9J A;  3LSI A;  2XC7 A;  2WJY A;  3A35 A;  2MAB A;  1NG7 A;  3MD2 A;  3CJR B;  3OFN A;  1D0Y A;  3RTR A;  3OYL A;  2UWM A;  3L2W A;  3VMW A;  2VAS A;  3UNG C;  1MMA A;  3CMM A;  2DT7 B;  3HOS A;  3UR3 C;  2V7Q A;  2QE7 A;  3OYN A;  3HPH A;  4XLH A;  2NTP A;  1WP6 A;  1Y6I A;  1GQ8 A;  1KZL A;  1T95 A;  2VQL A;  3SEZ A;  4PK4 A;  3T56 B;  2V7F A;  4PFP A;  3C2G A;  3DWL E;  4DNT B;  3FY3 A;  4OWR B;  4LG3 A;  1V5G A;  3GQB A;  1WJC A;  2WAF A;  3IAM 2;  2QKM B;  3LL7 A;  4RLF A;  2ZZQ A;  3RQ4 A;  2CH0 A;  3PNY A;  1DGW Y;  1X1B A;  2L9N A;  2KZV A;  4W8T A;  4CH7 A;  3K70 C;  2XOK A;  1OR7 C;  2CS3 A;  4DIQ A;  2PYH A;  4E7Z A;  3MMY B;  4II2 A;  4NC8 A;  1WJB A;  2L5Q A;  2AQE A;  2ZZG A;  3H9Q A;  2VBM A;  3PL8 A;  4EAT A;  2M4G A;  5C1C A;  2NTB A;  3DQV C;  3ZCO A;  4BEH B;  3H5R A;  3B8Y A;  3K4N A;  2Z6B D;  3A1Y A;  4KT6 A;  4L8J A;  3VR6 A;  2XGJ A;  3SZG A;  2KMU A;  3NWT A;  3ZPP A;  3OYJ A;  4B47 A;  3SYT A;  2Q1Z B;  3BCB A;  4PJN A;  2Y0S A;  4CCL A;  5JHF A;  2MD0 A;  2O17 A;  1QJV A;  1IDJ A;  3SEQ A;  3GBG A;  3OEE A;  1I18 A;  1O8H A;  2ZXH A;  4C2U A;  4CSW A;  1V0F A;  4OJL A;  1O8M A;  2OUM A;  3N05 A;  3LSK A;  3A4C A;  1VLY A;  4OZY A;  3F9K A;  4IQ4 A;  3PSF A;  5FRN A;  2KVO A;  1RMG A;  1MMN A;  2BVM A;  5CDF A;  4BJ6 C;  1RWR A;  1TT0 A;  3DLA A;  2QKL B;  2X1E A;  2WB1 A;  3OW7 A;  2X6Y A;  2Z1D A;  4JQF A;  4XN3 A;  4E6K G;  1JRG A;  2DOA A;  3BG7 A;  2UV1 A;  1U0J A;  3IUO A;  4XM3 A;  1BMF A;  2PMZ A;  3E0J B;  2IGM A;  4BS9 A;  1UD4 A;  4W8R A;  1O8I A;  1QCX A;  4JMQ A;  3VDX A;  3OOU A;  1O8K A;  4OJO A;  3LMM A;  3TL4 X;  1D1B A;  2KRC A;  4E7I A;  1OHH A;  2HLD A;  2XND A;  3QYF A;  4XD7 A;  2WBM A;  5KCM A;  4XNF A;  3MKZ A;  1SAU A;  3ZQQ A;  2HVQ A;  3ZRG A;  2W6I A;  4DOZ A;  2R7R A;  2E5Z A;  4NK6 A;  3GVK A;  5FL7 A;  3BCA A;  1K28 D;  3OYM A;  4BXF A;  1V5F A;  2F4I A;  2LH9 A;  3VSK A;  5HKK A;  2VJJ A;  1O8F A;  2LBF A;  1NBM A;  1JTA A;  3T51 B;  4I84 A;  1E43 A;  4GQN A;  1W0K A;  3OY9 A;  2HQA A;  2X85 A;  3SUC A;  3ZXS A;  3W2W A;  5TGT A;  1HZE A;  2JDI A;  3GQ8 A;  2O5R A;  3OYA A;  2X53 S;  2K3P A;  2HZD A;  2LC2 A;  3OS0 A;  2KHM A;  3K4L A;  4J00 A;  2CMP A;  1WJF A;  3DTI A;  1Z21 A;  4F92 B;  2V4D A;  2PJR A;  1PLU A;  4CCO A;  2E60 A;  1E3Z A;  1UD2 A;  4LIU A;  2RRE A;  2IS1 A;  2CW8 A;  2CV1 A;  2K9L A;  2F6C A;  3IAS 2;  3QYB A;  4BAC A;  4MR0 A;  2R7W A;  2LOO A;  1PJR A;  3S3N A;  4XQF A;  3NE5 B;  2OC6 A;  1MMG A;  2IQ7 A;  2VJ5 A;  3HUG B;  3BC9 A;  2M5S A;  1WMR A;  2HNH A;  2RNG A;  1KTW A;  4C9Y A;  4PFO A;  1S9H A;  1WJA A;  1ZEL A;  2X1C A;  4XOT A;  2JJ2 A;  4B44 A;  4R79 A;  1NHC A;  1R6R A;  2BSP A;  1OB0 A;  3G2B A;  1O8J A;  4BQO A;  2O0W A;  1KCC A;  2F43 A;  3JU4 A;  2V31 A;  2IGN A;  4HG2 A;  3BC8 A;  3K4K A;  3QOD A;  1YE9 A;  4Y4R A;  4F91 B;  3CES A;  4F93 B;  3LSH A;  3L2Q A;  4PMH A;  4IX7 A;  3K6G A;  4IZZ A;  1UG0 A;  3OOC A;  4DK1 A;  4E7K A;  3FPP A;  1GLN A;  3OL4 A;  4XKV A;  1Z7L A;  4DBR A;  4YRV A;  3FKS A;  4G6I A;  3A3G A;  2JVH A;  2VKD A;  3K4B A;  1X4P A;  4QPQ A;  4PJM A;  2VQG A;  4BE1 A;  4N4N B;  4OAY A;  1G59 A;  3KRG A;  1FMV A;  3OYK A;  4CCN A;  4F52 A;  4HNT A;  1W0J A;  3K10 A;  3L2R A;  4XKW A;  2VXZ A;  1UD6 A;  4BU2 A;  1WJD A;  3OL3 A;  1H8E A;  3TMO A;  1RU4 A;  4NQW B;  3B4N A;  1Z3X A;  2HDW A;  3D5L A;  3BG6 A;  5FRM A;  2W1O A;  2GK6 A;  1COW A;  1N77 A;  2R7S A;  4NUB A;  4XMY A;  4ZDL A;  2LRE A;  2VJI A;  2VBK A;  3DTE A;  3DPL C;  1VF7 A;  1N75 A;  4ITV A;  4ANJ A;  2JVG A;  2XZP A;  2NOJ B;  3I3L A;  4OZZ A;  3OWT A;  3WWG A;  2MC4 A;  5FRO A;  1QHH D;  4DJA A;  1H80 A;  2KQR A;  4QPO A;  1E1Q A;  4OJP A;  2GOX B;  2M0M A;  3CF2 A;  2DXI A;  4FET A;  2PJR B;  4KIS A;  3S93 A;  1KON A;  3OMY A;  4H4K C;  2LY2 A;  1HVX A;  2E1M B;  2JSP A;  3GVL A;  1E0E A;  2A6T A;  3E1S A;  3CJQ B;  3FDY A;  4HEA 2;  4PUS A;  3G05 A;  3OEH A;  2VPL A;  3OAA A;  1HG8 A;  4AVZ A;  2VQC A;  1WTH D;  4JOM A;  4YZA A;  4CCK A;  1EE6 A;  2X8K A;  2XSJ C;  4MXN A;  2WAQ A;  3ZR8 X;  2KPM A;  1VZ0 A;  2GJR A;  4YZX A;  3QYE A;  3OYC A;  4HWV A;  5KNL A;  3VYS B;  2WPD A;  2WY7 Q;  1WJE A;  3C2H A;  3EPZ A;  2M7B A;  1WJ5 A;  2ZFU A;  4DGW B;  2R7T A;  4XLE A;  1DP3 A;  4E7H A;  1MW7 A;  2GOM A;  1E3X A;  2NT9 A;  4P1W A;  2W7N A;  1K6Y A;  2W4S A;  3EQO A;  4EW9 A;  4PSX A;  2R7U A;  4HRI A;  1ERD A;  3RSN A;  3LSG A;  1PXZ A;  1W36 D;  4W8S A;  1D0X A;  3VYR B;  3S8P A;  1I8D A;  5AMV A;  4HIZ A;  3DPU A;  3AL0 B;  3GVJ A;  3KYL A;  3LMW A;  2INU A;  3AKZ A;  2W6J A;  3LSM A;  2A5W A;  2D3N A;  4F55 A;  4BQN A;  1WPC A;  4NK8 A;  1D1A A;  4J01 A;  1D0Z A;  4XR6 A;  3IP4 B;  3PSI A;  3OS1 A;  5LFA A;  4B3G A;  2DCE A;  4E7L A;  3KEW A;  4FAS D;  4Z1M A;  4DK0 A;  1FX0 A;  3DEE A;  4X0G A;  4PSW A;  2BW3 A;  4KKS A;  4XKC A;  3TBI A;  1MMD A;  2XZL A;  4PJJ A;  4BQQ A;  3V42 A;  4BGD A;  3A2K A;  1K5C A;  5CPR B;  1G8X A;  2IGO A;  3K4C A;  3ONQ A;  4KJZ A;  3J7A Y;  4ZTJ A;  2R7O A;  3L2V A;  4C2T A;  2VXD A;  5DN6 A;  4GRI A;  2M4K A;  2LG4 A;  4B3X A;  1BR4 A;  4C2L A;  2HPI A;  2KRH A;  2CUZ A;  3OYF A;  1PKV A;  2LRD A;  2P0W A;  4YEJ A;  5CQE A;  1J09 A;  2R7X A;  3LNN A;  2IS2 A;  2IS4 A;  2V4J C;  2FUG 2;  2Z16 A;  4G7X A;  2ZXI A;  2WAE A;  3L2U A;  1X1C A;  1UAA A;  3CP8 A;  4Y33 A;  1UD8 A;  3OE7 A;  1VBL A;  3GQ7 A;  1JI8 A;  1DQU A;  4RMN A;  4N4O B;  3OIQ A;  2M7A A;  1LDK B;  3EUK L;  2R7Q A;  3FKJ A;  1IRX A;  3H35 A;  1AIR A;  2Z8G A;  3DTK A;  2KDO A;  4BJ5 C;  2ODL A;  4XLA A;  2XZO A;  2JJ1 A;  3PFY A;  3DU6 A;  1KCD A;  2ZSH B;  2O04 A;  2BVL A;  4RM3 A;  2GK7 A;  3SDB A;  4ZJZ A;  3M8J A;  4XL9 A;  4U4B A;  4URR A;  1MND A;  1MAB A;  2VLA A;  3LFU A;  2AQF A;  3DKY A;  3OYB A;  1NG6 A;  2KP6 A;  4ZTF A;  1TZL A;  3HKZ A;  3JUR A;  1O88 A;  4UZU A;  2R9V A;  3W2V A;  4ZYA A;  3H94 A;  1BR1 A;  4IKF A;  4YXW A;  2V6E A;  5CKT A;  2VBE A;  4U49 A;  2LY1 A;  4DNR B;  2CV0 A;  3I9V 2;  4B48 A;  3B90 A;  4B3F X;  3H5A A;  4HST A;  5KHD A;  3A3B A;  3BCF A;  2JA2 A;  2X1D A;  2F1M A;  1H8H A;  2GJP A;  2RQQ A;  4XOR A;  2M3A A;  1BHE A;  1DGR M;  3EUH C;  3OR2 C;  3RPU D;  2BW3 B;  3OYI A;  2I8D A;  5HNH A;  4D1Q A;  2ELJ A;  2K5C A;  4HPQ A;  2LBF B;  1PE9 A;  3KEY A;  1V0E A;  4BE0 A;  2HVS A;  1OFM A;  3VMV A;  3BCD A;  3WQZ A;  2E1M C;  2WZP P;  3OYH A;  4XN0 A;  2WSS A;  2IXS A;  3HXL A;  3QOE A;  5HOO A;  1T5E A;  5HLT A;  2V26 A;  1BN8 A;  4AU7 A;  3HL2 A;  2PYG A;  2D3L A;  2X6X A;  4C30 A;  4CZC A;  1W36 C;  2ZTN A;  2VL8 A;  2QXZ A;  2L7K A;  3S32 A;  5C1E A;  2VKH A;  2OV7 A;  4Y3O A;  4U7B A;  4ASU A;  2UVE A;  3EQN A;  2QX3 A;  2NTQ A;  3PJR A;  3UW0 A;  1OGO X;  3AFH A;  3VWB A;  2X6W A;  3GQA A;  2INV A;  1NRK A;  3EUA A;  4ZDP A;  1T0F C;  3PUB A;  1UD5 A;  3HAG A;  1O8E A;  3DPT A;  4KKT A;  4XON A;  4OJ5 A;  2JUG A;  1YX3 A;  2VJ4 A;  4BUP A;  3DU5 A;  3DKX A;  4BJT A;  2ZTG A;  1BR2 A;  4CCJ A;  2UVF A;  4XLC A;  2VQH A;  4Z06 A;  2BOL A;  5LD2 C;  1IA5 A;  1P9Q C;  4OAZ A;  1WFX A;  4BE2 A;  4ZDO A;  3VSL A;  2IGK A;  1QHG A;  2XAU A;  3VYT B;  2CW7 A;  2CK3 A;  1BOB A;  1PYV A;  2DJI A;  5CQG A;  4KIT B;  3S3M A;  1EA3 A;  2WAD A;  3W3C A;  3AL0 C;  3GQ9 A;  3ZIA A;  3PNV A;  1X4O A;  1UD3 A;  2HVR A;  4AYB A;  3CP2 A;  4II3 A;  4E0F A;  4TSF A;  1D1C A;  2R7V A;  4B43 A;  2ZSI B;  2X51 A;  4CA0 A;  4TKO B;  2VIX A;  3FHN A;  1HA8 A;  1Z3Y A;  3K70 D;  1BLI A;  2O1D A;  1SFK A;  1LKX A;  1IDK A;  3OIP A;  3OPO A;  3RCO A;  4KKU A;  1X19 A;  1OLT A;  2K9M A;  2EWE A;  2DT6 A;  2DIE A;  2UUZ A;  3OR1 C;  3VST A;  3HC7 A;  1V5E A;  3D5S C;  2W00 A;  1MNE A;  1OOC A;  5HNF A;  1E1R A;  1O8G A;  4P22 A;  3H5N A;  2LZJ A;  2WY8 Q;  4RLQ A;  4G7W A;  3FBN B;  2WA0 A;  2WJV A;  3W2A A;  1EFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...