4XM3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xm3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xm3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xm3A02
1NHCA 4XKVA 4EW9A 2QY1A 2NT6A 3GRHA 3VMVA 3GQ8A 4XOTA 4PMHA 1OFMA 4XMYA 4URRA 4Z06A 4YZXA 1RU4A 1IDJA 5AMVA 1KCCA 4OJOA 4HWVA 4XONA 4W8RA 2UVEA 4W8SA 3VSUA 2BSPA 1O8JA 1WMRA 1O8LA 2INUA 2VBEA 2O0VA 3B90A 3B8YA 1DBGA 2NSPA 3GQ7A 1OOCA 3EQOA 4OZZA 2X6XA 4XN3A 4XOPA 4W8TA 3JURA 4C2LA 2O1DA 3WWGA 3T9GA 2X3HA 1OFLA 4U4BA 3GQ9A 2NT9A 4NK6A 1PXZA 4XR6A 2Z8GA 3VSTA 4W8QA 4Z03A 5C1EA 2NTPA 3LMWA 1X0CA 4I84A 1O8KA 4XNFA 4YEJA 4AVZA 2EWEA 3GQAA 4XLAA 4MXNA 4Z05A 1OGMX 1DBOA 1JRGA 1K5CA 3VSVA 4OJ6A 1IA5A 1O8EA 1GQ8A 2VBKA 2O17A 4XL9A 1RWRA 3ZSCA 3KRGA 2NSTA 3SUCA 2PYHA 1O8DA 1H80A 4U49A 4OJPA 2ODLA 2PYGA 1CZFA 4XLFA 2O04A 2UVFA 2VJJA 1PLUA 2VBMA 4XKWA 1IB4A 4YZ0A 2NZMA 1BN8A 1O8IA 4XM3A 1VBLA 4YZAA 1IDKA 2X6WA 4OZYA 2X6YA 1O8GA 4XORA 2IQ7A 2O0WA 4NK8A 1PE9A 4XN0A 2QX3A 4YZQA 1OGOX 2X85A 4XLEA 1O8MA 1AIRA 3FY3A 2NTQA 4OJLA 1EE6A 4MR0A 4OJ5A 3UW0A 4XLHA 4YELA 2PECA 1QCXA 4XQFA 2QXZA 1O8FA 4XLCA 1O88A 3ZPPA 1HG8A 5C1CA 1BHEA 2NTBA 2VJIA 1O8HA 1XG2A 3B4NA 1QJVA 1KCDA 3VMWA 1JTAA 1RMGA 2INVA 1KTWA 3EQNA
chains in the Genus database with same CATH superfamily
4DZPA 1NHCA 1YW8A 1E63A 4FWTA 4KN7X 4XRSG 4M9XA 4Z4YA 5E18F 1U2RA 1JKPC 2E1RA 2NYXA 5JHUA 3MKLA 4QVJA 1L1IA 1T8IA 1QQIA 4RD1A 3JRFA 3R6KA 1FNBA 3FKJA 4YDTA 3CDHA 1XCBA 3WHCA 2YUHA 3T56B 1WJEA 5IOYA 3GZ5A 5J6XA 3U2QA 4U0YA 4NDLA 2M7AA 2O9LA 2EV5A 2M34A 3HTSB 2IS2A 1KK1A 1DPRA 4PCQA 2P5KA 2XGJA 5BPDA 4MYTA 2L9VA 2WY8Q 4M73A 1WSUA 3VYRB 1OCRH 5C1EA 2G0YA 2KIMA 4C3IJ 4IOAF 5F4MA 1XS9A 4XIDA 1QPMA 3U6BA 4OOXA 4YFKF 4KA4A 2BOLA 3FXQA 4LB6B 3WTZA 4QIWN 4Z03A 2OBSA 2HDWA 4KH3A 5GPCA 2R7QA 1H9TA 1U6GA 2F43A 3REOA 3KEYA 5H6RA 1DGWY 3A2KA 3OIOA 2CQ7A 5E1WA 3T8TA 3SLDA 3I56B 4FCYA 1XMAA 1H42A 3PA1A 1FBQA 1VQ7B 4A3FJ 2BV3A 1IA5A 5GV8A 1VQ5I 2V7TA 2C4UA 4BHBA 4XL9A 3BTLA 1QGPA 1P9QC 1VQLB 4M0LA 4IHWA 3DBLB 1G7CA 2XAUA 1VQKI 2RGVA 3OYAA 5HNFA 3GXOA 1PVEA 3G71B 2ZJ2A 1CQXA 5C44J 2C2WA 3TO6A 5CVVA 3VYSB 5IOZA 4PC7A 5EMNA 3C2BA 2IOUG 4IHTA 3O3KA 3SQNA 3NEUA 5L3FA 5FLVA 2NZMA 2MSYA 2WY7Q 3QOEA 2XPVA 5GTHC 2AO9A 4FXUA 4ZDPA 1OR7A 4LC0A 1IJWC 1KU3A 5FO1A 4HV5A 1XGMA 5E3LA 1R1TA 4DYQA 2VXDA 4JQFA 4BJ5C 1COWA 5FROA 4H9GA 2CUEA 5J8CA 4KKSA 3K10A 5HLHA 1XPXA 2QZAA 3CXCB 4N9IA 2XTYA 1YYVA 2M30A 3MWMA 4HSRA 2ZZFA 4JYKA 2ZBUA 1OPCA 1Y0YA 3MCAA 1OFCX 1KU9A 4EV0A 2VL8A 2DT5A 1R7JA 4ASNA 4P12A 1W5TA 1Z3XA 3DLLF 2GJKA 5KK1A 2UWMA 3CW2A 4YELA 2V4JC 3HZJA 3I5UA 5J40A 1UAAA 1D8JA 1EP1B 1KQ0A 2HOAA 2DOGA 5J1YA 2KVOA 5CDFA 2V6CA 2ZXWH 4C3JJ 2HQ5A 4CYCA 5J4VA 3S1NJ 1N06A 3OMYA 1V5EA 3K1MA 3TBIA 3AAFA 2EA4A 2GA2A 3S32A 4D9JA 3WTVC 1MBEA 4Y17A 3G71I 4IOCF 5J3OA 3J81K 2R7FA 4OIQF 2L01A 1BI1A 1BBYA 3KZYA 4HX7A 2W7ZA 1QA3A 3GLLA 4H4KC 2NV4A 3IL2A 3CZ6A 2O8KA 3VMVA 4XMYA 4EJUA 4URRA 1U78A 5FLXZ 2XUBA 2LZJA 3BH6B 2B63J 2NPFA 4HWVA 1P4AA 1WPKA 3OZWA 1M90D 1A35A 4L18B 2R5ZA 2KZGA 2L54A 3G6EB 4B3XA 1E1RA 1WU8A 1E0EA 1W9XA 4KN4X 1XD7A 3E6MA 5GAHJ 3DKYA 3W6JB 3KETA 3BCDA 3D5RC 5FFXA 4Z4VA 4KIBA 2XC1A 1WI3A 1TVCA 4OINF 4B09A 1EH7A 1ZG5A 1YJ9I 3IP4B 2GXAA 3ZQHA 3A02A 3J7AO 1AHDP 4HOBA 4ZYAA 3Q3AA 4AC9A 3V42A 3TKYA 1E2XA 4RM0A 1TZLA 2KLOA 1YLOA 2ZSHB 1EKEA 3OYKA 4X07A 1ETKA 1Q82D 5LHHA 1KQSB 3EUAA 1D5VA 2L3DA 2CBXA 4DK1A 3VNVA 3HYIA 2EFQA 2F5DA 1TYWA 1HSJA 2W4SA 1F4KA 2EIKH 2FE3A 2IP2A 2R4GA 4HW0A 4XRMA 2VNHA 1YHQB 2DFIA 5JMCB 2M9HA 3K9TA 3MQ0A 2DA3A 2IGKA 4D5FA 5C4JJ 1VQPI 1JKQC 1K5CA 3H5AA 5D5VB 1FYLA 2EPFA 2EH3A 1NH3A 2E7XA 4Y7CA 4FETA 3S1RJ 3KYDB 3E1YE 4A5NA 1S4MA 2GQFA 2NVTJ 3JRGA 3CF5F 2M2EA 3WE2A 1JHHA 3CD6I 1BOAA 1OB0A 2W00A 2AHOA 3OS1A 4BE2A 5LD2C 2HKXA 4BS9A 3Q38A 3FXKA 1LM1A 4ZV4A 4LBWA 4IL6C 3I53A 4YZ0A 2HZTA 2LMDA 5FGMA 3SDBA 4ABZA 1O3TA 1QRYA 2QDXA 2ZXIA 3A3BA 2F3LA 2FBHA 2HYFA 2ZFWA 2LTPA 3SFZA 1UCRA 4ZYEA 1FC3A 2K5CA 4OOSA 3JCUC 1P4WA 3SFIA 1X19A 3FMQA 4PC1A 4X7EA 4UNOA 1R71A 4A3JJ 2Z3YA 4XSZF 4PSWA 4UVCA 2KFDA 2RNJA 5D4RA 1AIRA 2KL4A 4HF1A 3NQOA 2CRVA 2G0EA 2XROA 4AYBN 2VFMA 4V19K 4CH7A 4PAAA 1LLZA 4LLNA 2YX7A 4IZZA 1D0YA 2VC1A 1K78A 3LFUA 4IPAA 2QXZA 5F6FA 1U8BA 2JRMA 2GQQA 1KONA 3RJPA 3HDDA 3KEWA 2XT2A 2XRNA 3W2FA 1ZGAA 4QPOA 1TTTA 2YS9A 1KCDA 4IXAA 2PIAA 3M4OJ 2G7UA 3CJQB 5FNZA 2VBSA 4RB1A 1RQRA 4B47A 3EQNA 3HRUA 4RA2A 5FKNA 4HQEA 3WQZA 1F9NA 1ON2A 4XOTA 2O5RA 3HGYA 3V7CA 3WXMA 3GQ8A 2JIZA 2P7CB 4N9HA 1R9TJ 4ANJA 3A8KA 4FASD 1KTVA 2PLFA 1KK0A 3V8KA 3BQYA 2ME0A 2I1LA 2C78A 3CCJB 1UHWA 2CH0A 1K4TA 2GZWA 3A0BC 1FNCA 2XAFA 3KE2A 5AIQA 2HU9A 2J5PA 4M71A 4FT8A 5B1AH 3SEQA 4A3IJ 4RDLA 3DQVC 2XF6A 3M8EA 2X6XA 4I99C 4F52A 3ABLH 1GJRA 2DBBA 4BY1J 1D3YA 2B5OA 3G1OA 3WWGA 1ZG3A 1AU7A 1Q1HA 4E7ZA 5HS9A 1AIPA 3ZMUA 4U4BA 3KCCA 2RQPA 2OTLI 1D0XA 1IF1A 1G3TA 4CHUA 2W48A 4M4SA 4DZJA 5FIUA 3RY8A 2WV0A 1X3UA 2HLDA 3M8FA 3JREA 5ERIA 5DEQA 1HCRA 2K9SA 2QA4I 3JTHA 5ILSA 3WTUC 4C2TA 3VDXA 2RV8A 3QPHA 3HSFA 2C5BA 2VXZA 4F7ZA 1J0RA 2VZLA 3D5LA 4V2GA 2ZJQF 5HDGA 3W2WA 2NVYJ 1KGSA 5GADJ 3BC9A 3L00A 2MFZA 2HEOA 3VSVA 3I4MJ 2YWGA 3CCRI 5D8KB 1O4XA 5TRDA 3M1EA 4LG0A 1G59A 4HNVA 3Q6QA 4XLPF 4YRVA 1PJ6A 4A3MJ 5DD4A 2Q2EB 4P9UA 1O8DA 1K4SA 2M45A 1OCPA 5B5EC 1G4DA 2LP0A 3OS0A 2BN4A 3OYJA 4XLFA 2UVFA 3SQVA 1QRBA 2V7QA 1X1DA 1BJAA 2Z5UA 4QPQA 4MGRA 2X53S 2EV0A 3FF5A 3B73A 1ZRDA 3OL3A 3AG2H 5DS0A 2VB6A 2FNAA 4ZH4F 2JA5J 3X2QH 3TDZC 4KNYA 5HKKA 1IV8A 3BG7A 2CUJA 3KP7A 1WOPA 4Z4TA 4TT3A 3CDIA 5CVIA 5J8FA 2QZ8A 3LSKA 3ZZ0A 1XMKA 2E1NA 1RKWA 1H8HA 1EP3B 3NAUA 4W1UA 5GTIC 3JRIA 1FSHA 2VBWA 2QMUA 3N05A 3C7JA 3TO7A 4P25A 3RQ4A 4YFNF 3WTXC 4J01A 5HLGA 2CNDA 1FMWA 2KMUA 3TW7A 1N05A 3OEHA 4CUGA 5H59A 2L9SA 4L9NA 4XLHA 2PFBA 3BCBA 3MAJA 3WNBA 1MBGA 3FBNB 1SKQA 3A4CA 2HVSA 3U6KA 4FISA 3C18A 4BH9A 3LAJA 2WZNA 1KQ9A 4U0VA 2OBTA 1W4MA 5KNLA 4M1KA 2JA2A 4YALA 3QWLA 2BZTA 3G73A 4XKVA 2PX9A 1QO0D 1Y1WJ 1Z91A 1LKXA 2V26A 1GLNA 3ABTA 2XT4A 3ZOBA 2AHQA 1USSA 2QGUA 2V9KA 1ZKGA 3BG5A 2V7VA 1TT5B 1KJZA 3HUGA 1KYZA 1WCMJ 4DOZA 2R7SA 4RAGA 2XAQA 3F6VA 3TP0A 1MNDA 3HHGA 4Q7JB 1PJ5A 5GP9A 2FOWA 4XOPA 4W8TA 3GTKJ 2V1XA 2QM3A 1W0TA 1A04A 1FOKA 2K40A 4MIMA 2VONA 4C43A 2OTJB 1BQEA 4FHTA 2VJ4A 3L7WA 1X0CA 3LWFA 4LIUA 2E5ZA 1HKQA 3HTUA 2EWEA 1YS7A 2LY2A 1OYYA 3LQQA 2JTVA 4QWQA 1TL8A 4LFUA 2BMWA 1WH7A 2E1MB 2E1OA 3ASTA 1VQLI 1RESA 3HC7A 3RIRA 1AKHA 2P6TA 2JK3A 4CGZA 2E2HJ 4G8XA 4AD9A 2CS3A 1MDMA 2AXTC 3SUCA 4WX9A 4L9JA 3S2WA 4YFXF 3DEEA 4KJZA 3CCUI 3TEDA 1S7EA 3DP7A 4IHYA 1YTYA 1N0VC 3OYNA 1K8AD 1K8FA 3FBIB 1NDHA 1R5BA 1F1ZA 2H6BA 2ISYA 3WU2C 1FOWA 1F36A 2RC6A 3PFIA 4NCNA 5K5RA 3BJ6A 1Y6IA 3OY9A 1Q1VA 4PJLA 1FSEA 1PUFA 1JT0A 1O8IA 1Z1DA 1MNMC 1JB9A 4P6YA 3DEUA 2GIVA 4YZAA 3H9NA 1SFOJ 1BX0A 1SC7A 1G7SA 4RCYA 2ECBA 2NNNA 3DTEA 2VN2A 3L1PA 1K6OA 4YFOA 1YRNA 4UZFA 1XDSA 4NK8A 2EFGA 3WHBA 4L5EA 2LF7A 3AG4H 1OCOH 5LHGA 3R6JA 5KHDA 2WYRA 2LVSA 3KPHA 4OAYA 3MZYA 1IZ1A 1RC9A 1W36C 3OS2A 2B0LA 3MN2A 3TP3A 1T2KA 1O57A 4OIPF 4XLNF 4IHXA 2CMPA 3NARA 3F72A 3K6GA 4X1EA 2COMA 3B78A 4FX0A 4KKUA 3WY9A 2FA5A 1XGOA 3BY6A 4M6YA 1Y8RB 2ID6A 3V4GA 3H3ZA 4P26A 3GVKA 2LFBA 1LVKA 2D3LA 1AWCA 2R7WA 3KP6A 1BHEA 4KIFA 3OZUA 2FBKA 3LNQA 2KIQA 3PNVA 3QYFA 4L5IA 4NHJA 4L9TA 1BA5A 1DQUA 2Y0SN 3FZVA 2C6YA 1NTCA 3L09A 3EUKL 4LIVA 1H8AC 1V5VA 5LMZA 2PJPA 3LQRA 4W8SA 1QU3A 4EW9A 3VNUA 2VFPA 1Z0XA 2HPIA 2L9NA 3FXLA 4L0ZB 5A88A 1MJ9A 2RAEA 3ONUA 4X7CA 3ZMSA 2ZMEC 1MD0A 2MBFA 1WKMA 2R7TA 5LEKA 4I98B 5J35A 1ERDA 2JUCA 3BR6A 2FMYA 2K7LA 2XTXA 2CW8A 2HQNA 2KRHA 2ME6A 4C30A 4B4CA 3WTSC 5F0HA 1STZA 2K4JA 1MW7A 2NOJB 5J47A 1DDIA 4DBQA 4AIKA 2DETA 1HZEA 3MZHA 3BR2A 4S04A 1KQ5A 4XN3A 3P4GA 3J81k 3GTJJ 1YX5A 2FU4A 2O1DA 2GXBA 3BR3A 1OFLA 3L2RA 4PGGA 3PQKA 2NVXJ 4BNCA 2A69F 1VQOB 3BG6A 2WJYA 4LBVA 1H8EA 4OU0A 4A69C 4ZZLA 1ETQA 2OAZA 2BGIA 4XNFA 4XRSA 3V7AA 4EQQA 1WJCA 2IVMA 2Z2SB 1FZPB 5F4OA 4X7FA 1VQ6B 4XICA 1JRGA 5EYRA 3I3LA 1BI0A 4I76A 3AVUA 2KDZA 1A6QA 3NB2A 4OJ6A 1ITYA 3KZIC 1WJFA 1OB5A 1QVGB 3WU0A 3FXOA 4EMSA 2FSWA 1QVTA 2DCEA 1HF0A 2HTJA 3QPLA 3F0CA 4M3BA 3WG7H 1EH6A 4XKCA 2LF8A 5A8AA 2V79A 1E64A 4ENNA 3PO2J 5F1RA 3J7YJ 3KP3A 4IRGA 4YIIA 1UG0A 3DU5A 3KP2A 3CP2A 3R0AA 5E17F 3HAGA 3W2EA 1XSDA 1ZUNB 3ASSA 3SKBA 3O6BB 3B6AA 4PUSA 1C0WA 3PSZA 4BPRA 3IRQA 4MLOA 1T6ZA 2W24A 1W7PD 4BBRJ 3MKZA 4N3NA 4J00A 3DU6A 3QU6A 3Q5FA 1MH3A 5HDNA 1D1BA 1ETVA 4Q47A 1QVUA 5E8GA 4LK0F 2LKXA 1OGIA 1WTHD 1YIJB 3Q0WA 3HUGB 3ZQCA 5IT3A 1T39A 2GPJA 2ZBVA 2H94A 3M3YJ 2P81A 3Q9VA 3GF2A 3VO2A 2LNBA 1WWXA 4A3GJ 4M9ZA 2V7WA 4NBSA 1J9IA 4M6VA 3OIPA 2K4BA 4MR0A 3J80Z 4Y7NJ 2KIFA 4YG2F 2R93J 5D6FA 5M5WJ 2E1MC 3Q3SA 1FP2A 1W35A 1S7OA 1MBHA 4C0SA 3HM5A 1WJBA 3BP8A 2D3NA 1GT0C 3CESA 3SZTA 4ROXA 1JGSA 1JUMA 2BVLA 2JWTA 3R4KA 3A01A 3K2ZA 2JSCA 4B3AA 1H88C 3H36A 3QU3A 4V02C 3P9CA 3OYGA 4PC3A 3CCUB 4KT6A 1P7IA 1NK3P 4A3EJ 1I1SA 2ZC2A 1CF7B 2HQAA 1SD7A 3OJXA 2CUFA 1E17A 4QLCU 1BR1A 4PJ0C 1LLWA 2XPUA 5ILUA 2H27A 3CLQA 4KITB 4B48A 4HF2A 2O0VA 4TMWA 4Y9RA 1R5OA 3NE5B 3OOCA 3A35A 4M9SA 1B1BA 2FMLA 5EDNA 4P3YA 1W36D 1UMQA 3BQJA 1OLTA 3KFWX 5ICEA 3PM1A 5IYWA 1GR1A 3C2HA 2COBA 1MKMA 2BHYA 3BNWA 1Y0UA 3BTCA 5IK2A 1QQ1A 2OTJI 1BMFA 1YITB 2F4OB 3VSLA 1Z7LA 5L3EA 3QP5A 3LQEA 6PAXA 2GAUA 1Z6TA 4BE1A 3HKZA 1PXZA 1KU2A 4E7JA 1XB2A 3DU1X 2F5CA 3GX4X 3ZP5A 1O3SA 1I50J 1MMGA 2EIXA 4QUZA 4EH1A 4I84A 1TYUA 4MQ9F 3AVWA 2KJCA 1VJSA 1UG2A 1O8KA 2L7MP 1SMYF 4DYRA 1VQMI 2ACJA 3P9KA 3BH7B 2JPCA 1MNEA 1UZCA 4RGXA 2J7KA 2OCEA 4ZYHA 3OYLA 3GFIA 3MMYB 1T5EA 3OW7A 3OV8A 5L46A 3BG3A 2FD5A 2VBKA 4E7SA 5FD6A 1VQPB 2R9VA 3HB9A 1T6YA 2JN9A 2P6SA 2ZTNA 4RDKA 3DKXA 1HXDA 2F1LA 2WAFA 1MH4A 5HS7A 1KK2A 2QBYA 2QE7A 1W5SA 3W5VA 3BT9A 3OYMA 1G8XA 5AONA 3BDDA 1X4PA 3ASOH 1E1QA 4X6AJ 1UD5A 4TSFA 2B0RA 4A5MA 3S1MJ 2BX6A 3ERED 1CQTA 2VE8A 5J1RA 5DUIA 1LPQA 2O0YA 2EV6A 2E71A 2EILH 2M8GX 3CCEB 3DFGA 1RRJA 1YJ9B 3O8GA 2X6YA 4IEJA 5KW9A 4DQLA 3RIQA 1S6LA 2VPLA 2E34A 2A61A 2MW8A 2CQQA 3OR1C 4BEHB 5EG0B 1SD4A 1LFUP 1EFTA 2KHMA 4EM1A 1HOMA 1PE9A 3ZMZA 1OGOX 5FJ8J 4PFPA 2A3SA 5L3BA 2H09A 3PSSA 3HOUJ 2OF7A 1ZHFA 4JX4A 4R8HA 5KAIC 3AVTA 2DQRA 4TV7A 3DTIA 3M07A 1XX5A 2XF5A 2YU3A 1T08B 1TNTA 1MABA 4Z4RA 5BSYA 3OL4A 2YSRA 2RC5A 4ZCMA 1I3QJ 2W25A 1TWFJ 2A5WA 1WRJA 2IS4A 3H0DA 2H8RA 1EXMA 2CSOA 3RSNA 5F0FA 2IRFG 3IHUA 3MCZA 4MTEA 5IP9J 1N8RD 3KEOA 1R58A 2GWRA 3CMYA 3A1YA 2FQ4A 1JTAA 4OPWA 2IA0A 1QBJA 1G3YA 3L9FA 1VHEA 4HYEA 3VO1A 4I6ZA 5D5XB 1BJZA 3Q0UA 1IV6A 2Z33A 3PUFA 4BHCA 1IG7A 1IN6A 1MBKA 3W6KB 5ICCA 2BSPA 2Q2EA 4FN5A 2P5VA 1VQMB 2VBEA 2LYCA 2YX4A 5FKMA 1V4RA 2VBUA 2FQ3A 3V8LA 3RI4A 2E1CA 1BI2A 3CC2B 3LSHA 1NRKA 3W5UA 5H5JA 1RNLA 2IXSA 3PIPF 4KMUX 1DARA 1UELB 5D6EA 3OZVA 5D5WB 2OTLB 5BMZA 5EF6A 1VQ8B 2PMUA 1BC7C 3OYDA 1YITI 2EK5A 2DCUA 4Z1MA 4IRIA 3GQ9A 1OYWA 1YX2A 2MYSA 4E0FA 2C5HA 1RKTA 3RQIA 1X3WB 2Y2ZA 1JXSA 1Y1VJ 2VQGA 2DU9A 2UZKA 3HOYJ 2M5SA 3ROUA 1MSEC 2IGOA 3F8CA 1VQKB 4RLZA 1IXRC 3CCJI 4LK1F 1WH5A 4YIRX 1Y0RA 1OGMX 5IT9Z 4Z4SA 2M5WA 2CG4A 2R5YB 2VKEA 1W0JA 3AVVA 3VPRA 1FTTA 5DNSA 1BJKA 2QEXI 4N4NB 5ILVA 2L4AA 2BW3B 3IH3A 2CV1A 5LBQA 2LRDA 5H20A 4CZCA 1DP3A 1Y56A 2PYHA 2HFHA 2YPRA 5E3OA 3ZQQA 1HA3A 2BGJA 1OISA 2ZZEA 1JJ8C 4OJPA 2GJPA 3RYPA 4EGZA 5FLXK 4I09A 4DYCA 1B59A 4EEFG 4F55A 2F4NA 5IYRA 3LSRA 3P26A 1VQNB 2YU9J 4KDPA 1U5TC 3IAM2 3N4MA 2MC3A 5F64A 4Z4ZA 3GEZA 2KPMA 1LFBA 3JRAA 1G3SA 1U5TA 3RPUD 1VZ0A 5TV2A 4ON0A 2ETHA 3I64A 3EETA 1IDKA 4UVBA 3ZBTA 4B1RA 1I5ZA 1F5TA 1W0UA 3S15J 3T0YA 4HA8A 1OQYA 1E43A 4K1XA 2DOFA 2QX3A 5GAEJ 1TT0A 2ZJPF 1R1UA 2EZKA 1XSVA 5CVRA 4GGGA 5EEAA 2V6EA 1YIJI 3H35A 3DPUA 1JI8A 3AG3H 2MABA 3A8IA 2V1UA 2JA6J 9ANTA 4OPOA 1FBSA 3F6OA 3UR3C 4BXXJ 2QWWA 3A8JA 1U0JA 2Z99A 2PECA 2K9QA 2XNJA 4XQFA 2E35A 1DDGA 1E3ZA 3OSGA 1PKVA 2CW5A 4BXUA 1QA1A 1SEUA 1Z21A 3ASNH 3H3UA 5EEGA 3GTGJ 4TMVA 4R79A 3AL0C 5JFRA 2VBYA 2VJIA 2AXLA 2ICWG 1GVJA 1WPCA 2GK6A 1A31A 5K7FA 1KK3A 1YIOA 4GXOA 4L0YB 1N07A 1E3XA 1TWGJ 2DJIA 3LSMA 4HE5A 2M3AA 3SXYA 2V1NA 3TOAA 5CQGA 3H92A 4J19A 3G4SB 1OFMA 4UZUA 2Y0SA 2HNHA 1XGNA 5DM6F 1Q81D 2DA2A 5LGTA 1MBJA 1YW9A 2ZNZA 4KISA 4I7HA 2K02A 3A0HC 3AL0B 5EGOB 5E1ZB 3KP4A 1XC5A 1WOOA 2YWFA 1MSFC 1IDZA 5FO0A 1O8JA 5DCFA 2K27A 4CDGA 1IN8A 4QSHA 4PC6A 4CQJA 4E7KA 3SZGA 2M4KA 4ZCLA 2LY1A 4MEYF 2Z1DA 4F3QA 2NSPA 1R5ID 3KL9A 4BJ6C 1QPIA 2V5IA 4OZZA 4UY8I 2J5OA 1G3WA 3CCEI 4BE0A 1BOBA 4BDYA 2BM6A 2KQRA 2VPRA 4O5VA 1JGGA 2IA1A 2LC2A 3CO7C 5GV7A 4ZYDA 3OPOA 2ZTGA 4Q5SF 1XFOA 3RKXA 4Y33A 1SVOA 3LSGA 4ZC3A 1T38A 1WZ2A 2NOGA 1DPUA 3A1PA 2PJRA 2W85A 3I59B 5IYPA 2BY0A 1EV7A 4IKFA 2VNJA 1JHFA 2R5ZB 1M1EB 4OMYA 3H5RA 2D1HA 2TRTA 2XB5A 4PJMA 3RDIA 1Q7YD 1LDDA 3D0SA 4CO8A 1XCVA 2ZJRF 1D1CA 2B7EA 1FNDA 3QE2A 4QFMA 1DG1G 4BACA 3TQNA 3BCAA 3WGGA 3ZIAA 4MXNA 3G2BA 4FTHA 2X4HA 2LOOA 2BBYA 2F2EA 4Y4RA 4HSTA 3EYYA 3ZQGA 3ZXSA 4ZTFA 4Y9UA 2ZKZA 3ABKH 3HPHA 1PP7U 1CLWA 1GQ8A 1DABA 3QOPA 4EJWA 1IN7A 1EFUA 2GOXB 1BPLA 1FRNA 1UD8A 3PFYA 2OBRA 4IF4A 1FPQA 4ITVA 4KT5C 4WK8F 1YRNB 2CQKA 4QHYA 4B3GA 3JAMK 2L7KA 1BN5A 2NS7A 2KT0A 2OZ6A 2QSFX 3KYCB 3P9IA 3QODA 2CW0F 2PLYA 4B4DA 1IAWA 2CC2A 2O04A 2XRLA 1POGA 2VJJA 3W6VA 1EF4A 4C2UA 4XKWA 1KZLA 1IO2A 1N75A 5J3LA 1WXRA 2OQGA 2YWEA 1ZM3A 4ENKA 4HX8A 1ZM4A 3LVBA 4PGHA 2WADA 1U9NA 4ZYGA 3VYTB 4UUSA 5DYMA 2J8IA 3RZDJ 2XZLA 1IHMA 3CPXA 4U0WA 1LNWA 4NUBA 5CJ9A 4N4OB 2RQQA 3FPKA 4BBSJ 3HOSA 3BJAA 1V3FA 5C4XJ 2BEOA 3F23A 2X1EA 3H09A 2M0CA 5H6QA 2QTLA 4G9YA 5E79C 1K79A 1EE6A 1QX4A 3JW4A 4CCKA 1IXCA 4WZLA 4IQJA 4R1HA 3E5XA 4CSWA 4FX4A 4IHSA 4AU7A 2WA0A 3ZMDA 2JQ7A 3S2HJ 5DN6A 3DCFA 4Y52J 1VQNI 5C1CA 2NTBA 2ZZQA 1T33A 1O8HA 3LA7A 1XSXA 3AGQA 1QZEA 4U9UA 2QYUA 1YX3A 4Z6YA 3LAPA 3WTWC 3ZBUA 4OOVA 4DQKA 3BPXA 1ZTRA 3MFKA 2R7VA 3W3CA 5IYDJ 3K4LA 2WV1A 4HDUA 3GO5A 2NT6A 3WTYC 1B72A 3KZZA 5ED4A 4A3BJ 2D74A 3OFNA 1XMXA 3MKYB 1BLIA 3Q6RA 4CA0A 3H9JA 3H94A 4P2NA 1KCCA 2A68F 2VNKA 3J81Z 1LDKB 1ZN2A 2JVHA 1OFEA 3ABUA 3CCVI 4MNUA 2ZL7A 1RPWA 2CRGA 5D8LB 1YE9A 2INUA 4M53A 3FDYA 4E7LA 3FHNA 3FKSA 3BH4A 1P4XA 2HZDA 2EIJH 3PSFA 2VFQA 4CCMA 4PGOA 3C1DA 3LSJA 1GV5A 3HKZN 1FOYA 4CYDA 5A2QZ 4GDFA 3LOCA 1UD2A 2OK8A 1FP1D 2A6HF 3CO6C 1GHCA 3VEPA 3JQPA 3HGGA 1U5TB 3FXRA 5IYQA 5HOOA 1VQ8I 3GVLA 1WFXA 2PBIA 4NK6A 1EA3A 2DQLA 4LLGF 1N08A 2R7OA 4MTDA 3I71A 2QQ8A 3ZN1A 2WTEA 1I6XA 1T0FA 4F91B 1NG6A 1T95A 3IWFA 3WNDA 3TH0A 1T98A 3HHHA 2VKHA 3V8JA 1GDTA 3JRCA 3CD6B 4ACBA 4PC2A 3HOTA 2EZHA 2XAHA 1FDRA 1QFJA 5IYCJ 1JJ2B 1VQ4B 5B6IA 2Q6IA 4RD4A 1BR4A 1AMOA 5FRMA 3NWSA 3U1KA 4BXFA 1Z9CA 5D4SA 2HXIA 3KRGA 4JRAC 2KDOA 5HODA 3SZEA 4RCZA 5H2FC 1YHQI 2Q0OA 3DEWA 3EUHC 3W2HA 3K4MA 2X3UA 2RDPA 2PYGA 4P1WA 1IRZA 3NRVA 1PP8F 2GXGA 4RAFA 3AFHA 2V4DA 2HVQA 5BPIA 4ZDOA 3OAAA 1Z3YA 2JJ1A 5CVJA 2XIGA 5BQTA 5C3EJ 2CU7A 2I5UA 4M3DA 4BY7J 4ACAA 4HDVA 1EWYA 1QHHD 2A5YB 5B3SH 3ZGKA 3ML6A 2JPBA 4IX7A 3CMEB 3OYBA 1SFKA 2DI3A 4BKXA 2L7FP 5EGOA 4UV9A 1WJAA 5FL7A 3ZUGA 2IQ7A 2Z6BD 5CKTA 2O0WA 4NC7A 1BW5A 3HXLA 4LD5A 5J1UA 3K0LA 2OUMA 1SFEA 3K4JA 4Y13A 2BM0A 1O8MA 3K70C 4YIFA 4ZTJA 1TSPA 2FNPA 1WP6A 2ESNA 2RVCA 1JA0A 1YJWB 3TL4X 4HNTA 2TDXA 4G7HF 5IT9K 2LDUA 3HSRA 3MKWB 1NB9A 1VI0A 2PI0A 3I4NJ 1YI2B 3E3VA 1R4NB 4FQGA 3U21A 3QFSA 1B8IA 3A03A 2NS8A 3E6CC 4A0XA 3ZPNA 1BIAA 4OPSA 3CCQB 3ZPPA 1JE8A 1OCCH 3J80K 1K9MD 3UKGA 2DK5A 1KC8D 4E70A 2IS1A 1V0FA 1U2WA 2K9NA 3ZC3A 4N3GA 1OR7C 3LL7A 3N90A 3SJPA 2PE3A 2DTRA 5JLWA 2QKMB 3GFLA 3CCMI 1OFDA 1RETA 3L2QA 2HDCA 1D8KA 3E5QA 1FX0A 4UUVA 3F8FA 3I0TA 3I54A 5DM7F 4I2OA 4W8RA 2FF4A 1JKOC 2HPMA 3W2IA 1CGPA 3EUHA 2VOOA 1VQ4I 4GYGA 1R6RA 3HRMA 3DPTA 1IRFA 3SJMA 2QBYB 1WI9A 2IS6A 2DT7B 2H1LA 2OJED 1PUEE 3V7RA 4RM2A 2H6CA 3O2PE 3L2CA 2BPOA 3GQ7A 3ZQFA 1MMSA 4DBRA 1R36A 2L4MA 4S05A 5TJJA 1YLFA 3JURA 2A6TA 4PJNA 2JUGA 4A3KJ 3WBJA 1EA0A 1XTAA 2GK7A 2DK8A 1RR7A 3WNCA 3S93A 3PENA 2IEKA 2DYSH 1KQ8A 3FMSA 3K7AJ 4CYCB 1IUYA 4G1BA 2BVMA 3GTLJ 4CICA 4MYUA 5KSWB 4W8QA 2F5EA 5CLSA 2RKHA 5EG0A 4PABA 1IN4A 3LMWA 2YUSA 5K7HA 2WC2A 3GW2A 4W97A 2V31A 4U88A 2VKVA 1BX1A 4KUMA 1TYVA 2JDIA 3Q9SA 2CGPA 4KMFA 2LY9A 2E19A 4WXDA 5JI6A 4YHBA 2E5NA 2LD5A 3U9GA 2XAJA 1JUSA 3CLOA 1ZQ3P 3GQBA 2VE9A 1GUUA 2Z16A 3IUOA 2LR8A 3BZKA 4OPVA 1APLC 2JJ2A 1VQ5B 1UD6A 3CC4I 4D5CA 4A3LJ 1T6XA 2NSTA 3I4PA 1R5NA 1J59A 4LJZF 5E20A 2WPDA 3SEJA 1X1CA 3ZRGA 4A2UA 1Z6RA 2VUMJ 1ZARA 3W2GA 2F1MA 3OSFA 1K83J 3G1LA 2VBMA 2QENA 4RD3A 2Q1ZB 1BN8A 4G94A 2R7ZJ 4ESBA 1LE8B 2BE5F 1F60A 2DAOA 2LH9A 3CUQA 4D7MA 3T51B 4AIJA 3HG9A 1SVLA 3VFZA 5BNGA 1JNYA 1Z77A 2X6WA 2XV4S 4OZYA 1PJ7A 4CCLA 3OEEA 4DIQA 2DA1A 1QUFA 1TLHB 3ZQIA 3RZOJ 4HE6A 1FNMA 3BTIA 5D5UB 2VBTA 2OZUA 2VLAA 4A93J 4WXCA 4DNCA 5IP6A 4E7HA 1BC8C 1J9ZA 5DSZA 4RAYA 3IH2A 4XBFA 2HQRA 3QRFF 3AVXA 1QVFB 3FM3A 3CC7I 1VQ9B 1EH8A 1KD1D 2QSGX 2F5FA 4RAZA 1QGAA 4NQWA 1GAWA 2E36A 1TC3C 2W1OA 3EQLF 3PNTA 1HKTA 5FO5A 3DWLE 3S17J 3VWBA 2A07F 1TWCJ 4BQNA 4HRIA 2ZMEB 2FRHA 2STTA 5E8IA 2CF4A 2JN6A 3F8BA 1HDPA 2QQ9A 1HG8A 3C2GA 4M72A 4U87A 2D45A 3I9V2 3FXUA 1Y39A 2XGXA 1FYKA 2PN6A 4C2MJ 4NBQA 2JRTA 3P27A 2BXYA 4G7WA 2MG4A 2EQRA 3JTGA 4TN1A 3BPVA 2DW4A 1IUFA 2ZBKA 2BW3A 4MO7A 4P9FA 4OWRB 2MD0A 1X1PA 3GTPJ 3GZ6A 1VTNC 2WAEA 1ORKA 2EFPA 1W34A 4L8JA 2VT3A 1A6IA 4KKTA 3BOQA 4R71A 2XDVA 1YJNI 1CNFA 2X6OA 5DCMB 3FJOA 2PMDA 2OU2A 2K86A 5ICGA 2B7CA 4ETSA 2CK3A 3MVPA 4G6DA 3M7GA 4GQNA 4U7DA 4E7IA 2DERA 3AG1H 2DEUA 2CQNA 3FISA 1BR2A 2O61A 1TQIA 1QGYA 2HVRA 4GFBA 5HNHA 1ZGJA 2Y31A 3VSTA 4HQMA 5IYNA 3VR6A 2KRCA 3S8PA 2CJJA 5DDGA 4TMTA 4BGDA 3VYUB 2ELHA 1ZGWA 4A3DJ 4MHGA 4IQ4A 4A12A 2ISZA 4IHVA 1EJ9A 3ZZUA 4XLAA 3G6EI 2EINH 4ZCIA 3ASRA 5BSXA 2DMQA 1IW7F 1R5GA 2JA7J 2RREA 1B72B 4QVAA 1BM9A 2KJBA 3OWTA 3DBRB 1J09A 2G9WA 3CCRB 4CCOA 4UUTA 3ZCOA 2VKDA 3H0GJ 2CFXA 5M3FJ 2Q6KA 1I7PA 1K28D 3R60A 2BY2A 2HXOA 4EATA 2DDAA 3E6BA 2QA4B 1GXPA 2DOEA 4P96A 1QUEA 1WVRA 4WXHA 5HS8A 4DQ2A 4X7DA 2K9LA 2HOEA 4WF2A 4HX4A 4ENJA 4ZGNB 4CZZA 3OYIA 1TW2A 4MFDA 2ESHA 3GLXA 2AS5F 3BY1A 1EFRA 3SHFA 1VBLA 1SFXA 5FD5A 3JRBA 2Z9OA 5THXA 5L3CA 2QGGA 4B3FX 3AGPA 1RR8C 4AVPA 2PG4A 1HBXG 1J75A 3VSKA 4I0BA 4F7DA 2FUG2 4U7BA 4AYBA 2O6GE 3IKVA 4HG2A 4AWXB 2JMWA 2E2JJ 4ZGQB 2GREA 1JUPA 1X2MA 2X1DA 2Q8KA 2W57A 4D7NA 3D26A 2Y75A 2EFNA 4XKBA 1ZRFA 3HOXJ 3ZMVA 1LQ1A 2H1KA 1SVMA 5CQEA 4S0HB 1O7LA 2WR8A 3ZN0A 1KRHA 3ZQ7A 1HA8A 1OCZH 2DOAA 2N8GA 2TCTA 2G7HA 2KISA 4EJOA 3EYIA 1O8FA 1D1AA 3ML3A 3JX8A 2PJRB 4P5OA 3PETA 3ELKA 1P4MA 5GPAA 4RD2A 2XPWA 3PUBA 2VFNA 3BR5A 3JRHA 3ONQA 2HKOA 3NWTA 2XASA 2DFFA 5M5YJ 3JR9A 2ZCWA 4UXNA 4YAUA 3B4NA 3LJYA 4TMXA 4BHPA 5DS9A 3LNNA 3CCQI 3GMEA 4CXFA 2R6HA 3V7SA 1S72I 1KTWA 1FMVA 3MHPA 5JHFA 2GIZA 4RLFA 2QY1A 4AF6A 1YO5C 1B23P 2LBFA 2A05A 1DDNA 2I8DA 3LSTA 4YXWA 2HR3A 2DY1A 3QQAA 2FJ1A 1MDMB 3VSUA 2EFWA 3I59A 1YJWI 3GFJA 1X2NA 3SEZA 4CCJA 1NJID 1WMRA 4I0AA 1OGJA 1O8LA 3GYHX 4E4HA 4XRFA 5HZBA 3FHZA 1MBFA 1WJ5A 4GCVA 3TO9A 4LOCA 1HVXA 1OJLA 1FT9A 3HIFA 2XGCA 1FJLA 4RDJA 4AM3A 4X0CA 3A01B 4BQQA 4AC0A 2L0KA 1R4MB 2MA3A 4KFCA 1OOCA 2HWVA 4RM3A 3LFKA 4DW6A 3E97A 5KVRA 1LE8A 1ELOA 2Y30A 3CMEI 4Z05A 1MGTA 3K1PA 3F8MA 1D8TA 1U9OA 1QHGA 1D2EA 1NBMA 2DYIA 5EJCA 1KU7A 4A6DA 3HOWJ 1HW1A 3I55I 2QQBA 1VF9A 2JJ7A 2X48A 4LGWA 3TGNA 3CRZA 2W84A 5F4JA 2Z8GA 2XF7A 2CWEA 2WBMA 3OOUA 3LSIA 1MMDA 3OKXA 5F1JA 1ZLJA 5F08A 1REPC 2YR2A 4LLLA 1PJRA 5JR3A 1YFHA 1NK2P 4X06A 4D0PA 3H9GA 1Z67A 3ABMH 5LLQA 3OYFA 1I6HJ 4YAFA 3CCYA 1TWAJ 3FK7A 2LKPA 2L02A 5HXBA 2DXIA 2EIMH 4G7XA 2BHZA 3PA2A 2ZMEA 4O6JA 1A5JA 1N78A 2HOTA 1R1VA 2DFHA 4UV8A 4EJTA 1E3PA 3EDPA 1JJ6C 2KP6A 2DMUA 2PQ8A 2STWA 1SAXA 1JT6A 4JP0A 3VOEA 1IB4A 3BROA 2AQEA 3DDYA 1XDUA 1E62A 3DV8A 3I55B 2VBXA 5LGNA 4J0QA 4EM0B 3CPWB 1T56A 2WWYA 2DYRH 2VASA 4HF0A 1X1BA 4EJVA 4RBOA 3MEXA 4JOMA 3K70D 2ZSIB 5HVQC 2CFOA 3S3OA 3ISXA 4YCQA 3IV5A 1H85A 4NC6A 3E1SA 3QFCA 3ZPLA 4P9SA 1HC8A 3WE3A 2W6JA 3SJZA 2IPQX 4AIHA 1U8RA 4WZEA 1S7AA 2HS5A 2M87A 2WAQA 1HW2A 3GTQJ 4YZQA 1T0FC 2DA4A 2O03A 3SY2A 2DMNA 5EEHA 4L5JA 3CCVB 1TLLA 1YQAA 3FY3A 3SDGA 3CUOA 3QFTA 2VT2A 3R6SA 4G7ZF 1ULYA 3IH4A 1UD4A 3UW0A 3FMRA 1K4ZA 1QCXA 1UHSA 4M74A 1E3OC 1DUXC 1LDJA 2EA2A 2Q6OA 3H1CA 2IJLA 1AOYA 2ELJA 1I3AA 3P7NA 3RCOA 1JTXA 1VFCA 5M5XJ 3QFRA 3W5HA 4X0GA 2WSSA 1ONVA 1TW3A 5E3NA 2IBDA 3CQZJ 1K6YA 4B44A 5IP7J 4UB6C 1XG2A 2QQAA 2UV1A 5KAFC 2BM4A 3FPPA 4F92B 3K4KA 3PUNA 4Y3OA 1RMGA 1X58A 4RGSA 2EWNA 2LK2A 1B6AA 2INVA 2MD5A 4G6TB 5E6TA 1MRZA 5CPRB 1G7RA 1ENHA 1S9HA 2QVOA 5DTDA 4G5GA 4Z06A 4XK4A 3RTRA 3ECOA 3L2WA 3DBHB 4OJOA 2UVEA 1NHAA 2OV7A 3T1BA 2BY3A 2HOSA 5FRNA 2GBYA 2XGEA 4ASUA 3GZNB 3I58A 4Z4WA 2B9SA 4BAYA 3CP8A 3L2VA 1FNNA 5ICFA 4WQMA 2XNCA 2NXNB 5DUKA 3EQOA 1RI7A 4FE7A 3ES9A 3GCMA 1YG2A 4WZKA 3S16J 5HDKA 3T9GA 3D5SC 2MGQA 1BL0A 3J7ZI 4HLXA 4ZDLA 4G7OF 1SD6A 4P55A 2DIEA 4HLYA 2NT9A 3ZQLA 3T5XA 1H0MA 1V54H 4H0EA 4RGRA 4E6KG 2CYYA 2MC4A 3BZ6A 4BU2A 3S3MA 2MH2A 2QKLB 4OOIA 2ZITA 4RD0A 4TMZA 4YAOA 1BIBA 1WOSA 2FEZA 5DD8A 3CB4A 3CJTB 3TDUC 4OP7A 4G12A 1ACIA 2C4TA 1P7JA 3JSPA 2V7UA 2D5VA 3F8NA 1O8EA 4N0BA 2O17A 4RMNA 3QYEA 1VQ7I 1QGZA 2EJRA 2M8EA 3OIQA 4FE4A 4PFOA 1YW7A 4M6XA 3I56I 5TY0A 3BC8A 3H3VK 3CCSI 3KIOA 4CCNA 2OA4A 2FVGA 4MFEA 2QN6A 2VJ5A 3K4CA 2VODA 2ZL6A 2BM5A 4PJJA 3ASQA 2R7RA 4NC8A 1S5LC 2M0MA 1PLUA 1QG0A 1X3ZB 3GWZA 1QA2A 2RNGA 2DODA 5DCMA 4B43A 2VFOA 3M1CA 4PK4A 2P5LC 3IWZA 2M1BA 4O3MA 1DGRM 2ZXJA 1B8IB 3MZ8A 1FOXA 1JKRC 4OM9A 2PEXA 4XORA 2OK7A 2DMTA 1W5CC 2FBIA 2O7OA 2F4MB 2F5VA 1QH0A 1N0UA 3KP5A 2OCCH 1MZBA 3CJNA 3OW2B 1OB2A 4B8XA 4RLQA 4A0ZA 1H89C 1IRGA 2J8KA 3S1QJ 3LO8A 3PVDA 1WGXA 2DN0A 2K3PA 3GBGA 4JX6A 2R3SA 2PMHA 3U1DA 2C77A 1TNSA 3JU4A 4RPBA 5IY5H 3DTKA 3G3ZA 2QCOA 2F4IA 3G4SI 5JVGF 1XB4A 2XAGA 1LVAA 5A2QK 1ETOA 2Y69H 1SFUA 3J7AY 3ASPA 3ESWB 3KLOA 5CVUA 1Y8QB 5HLTA 2WZPP 4WWVA 3KEQA 1D0ZA 4DGWB 5K5QA 2VOPA 4IVNA 4C3HJ 5BS6A 1S0UA 1EFCA 2Y9YA 1WSRA 3CCLB 5FB2A 3E5UA 2FXAA 1SANA 1IRXA 3LMMA 2EFOA 4BL0B 4DNRB 3GUDA 3E20A 1U3EM 1G2HA 2VC0A 4PMHA 1K7AA 2ZFUA 3WODF 3PIOF 2DMPA 4YZXA 2BV6A 1IDJA 1TWHJ 3CC7B 3GIRA 4OMZA 3CF2A 1VQ6I 3HSEA 2IGMA 2X8KA 3GVAA 2DPUA 2VBVA 1P6RA 1Z05A 5FA6A 2F48A 4HNUA 4V2FA 3DKWA 2E60A 2ADUA 2L9RA 5FKKA 1DBGA 1W1WE 4A6EA 3SYTA 1A36A 2L2OA 2JZYA 2O8XA 2X51A 1VQOI 5FLMJ 2OQRA 2BYVE 4X05A 5EZHA 4C2LA 1AKHB 5AN9A 1RZ4A 1V5GA 4NNJA 2X3HA 3TW6A 2DLLA 2DPDA 4RS8A 4A3CJ 2P0WA 3RKQA 4LMYA 4OIRF 1SKYB 4HIZA 4XR6A 3HL2A 3IRRA 1J5YA 3VODA 1WQ2A 5JVTA 2NTPA 3MD2A 1R22A 4BEHA 1TTYA 3E0JB 4EM2A 2HYGD 3BR1A 3WTTC 3PL8A 3Q39A 4YEJA 1D1NA 2ELKA 2IT0A 3I1FA 3AVYA 5L3GA 3CC4B 1HW5A 2X9DA 2HDNB 4P3IA 3K4BA 2PMZA 2QEXB 1VLYA 4NQWB 4BDZA 3BY2A 3BZCA 1GV2A 4GYIA 5AIPA 5K1YA 1MJBA 1OYIA 5F0CA 2EZIA 5F04A 4Z2YA 1HDDC 2XC7A 1ZRCA 3OR2C 1S72B 2UXNA 2DA7A 4UHTA 1H80A 4LBYA 1Q86D 2IGNA 1B4AA 1QZYA 2CV2A 3B6CA 3FKIJ 4JX5A 1MIJA 1LUJB 3DPLC 1VNDA 3GVJA 2P4WA 4QTRA 4II2A 4RD6A 5J4YA 3CTAA 3T53B 2ZZGA 5LRSA 1J7KA 2GOMA 3FXMA 2QSHX 4KIGA 2M4GA 1J2XA 2OYNA 1Z7UA 4UZEA 4HPQA 3SYJA 1G6NA 1KYWA 3F22A 2M7BA 1GAQA 1OHHA 1RQPA 3GFMA 2HCJB 1SMTA 3SZPA 3JQQA 3CUQC 3FX3A 2HTSA 1GVHA 3GTOJ 3PNYA 3ISPA 1R5HA 5LHIA 4II3A 3CC2I 3PJRA 2BF4A 1QZZA 4L9VA 3BTJA 4BJTA 2KZVA 3GTMJ 3N97A 1MMAA 2H8WA 2LREA 2WB1A 4IRHA 1E79A 4WWCA 2V9PA 4MQVA 3K4NA 2GA1A 1QA6A 2DA6A 2B7BA 2JT1A 2FX3A 4HEA2 5FKLA 1W87A 1LFPA 1V5FA 2OC6A 4K2EA 3HOVJ 2XSDC 1IJFA 1V0EA 4FK8A 3NAWA 1XG1A 2GJRA 2JVGA 4XLCA 4RPDA 2ZL5A 1TBXA 3FM5A 3L2UA 3D1NI 1Q9SA 2Y48A 4UUSB 5JLXA 3V76A 2BM7A 4YAWA 1V55H 4OAZA 1I27A 3S3NA 4YC5A 1WJDA 1UJ8A 3B02A 3OP1A 2XZPA 2O3FA 3VMWA 2P3MA 4Q4ZF 3RPUA 3ZZTA 2XTWA 1HQCA 2ZNYA 2BGCA 3HRSA 4A0YA 2GM4A 2HGCA 4I01A 3GRHA 1YI2I 1R49A 1ETXA 5E3MA 4QV2A 2DJNA 4JMQA 1RU4A 5AMVA 1WHUA 1UHMA 3CMAI 3COAC 2E7WA 3LA2A 5B1BH 3KLNA 1ETYA 3JRDA 1UMKA 3VB2A 4M2LA 2ID3A 2XOKA 4RDUA 4G6IA 4P6VF 2X1CA 1P2FA 3QPTA 5HZAA 1FTZA 3WG9A 3B90A 4IO9F 1I18A 2XVCA 1P92A 5KCMA 2MLGA 1YS6A 3O8HA 1IN5A 3CJRB 1ZR4A 2L7ZA 2HMAA 2R5YA 1X4OA 3ERMA 2QF7A 1BI3A 4RB3C 1EP2B 1GO2A 1FX7A 2I10A 1XN7A 4AUXA 5JLVC 1W0KA 1W2BB 3GSIA 2RN7A 4BUPA 3JQRA 3HJEA 1B2RA 2QLZA 3ONYA 2MH9A 3TMOA 1W7PB 2P8TA 2R92J 4OIOF 4Q48A 4AVZA 3MMPA 1K61A 2V7XA 2D1VA 2XHKA 1S8NA 1F20A 2DFEA 1HF2A 2KRFA 4ESFA 1DBOA 1LEBA 2DO7A 1ZM9A 2K9MA 3FIWA 1A8PA 3B8HA 5E1XA 1LEAA 2ZB9A 3ZSCA 2ZO4A 2XB0X 3S2DJ 2E2IJ 2LG4A 1KZHA 2JA8J 5DV5A 2IA2A 2D9RA 4DJAA 1IC8A 4U49A 3WGHA 2ODLA 2V1DA 5A89A 2IAIA 2K85A 3CCLI 1KA8A 4DNTB 4ENMA 4UB8C 1O3QA 2FOKA 3G1MA 1RUNA 1Y0NA 2F6CA 4M3FA 2R0QC 4M3GA 5FKOA 2EZLA 1IJEA 2XKOA 3RPQA 3N6ZA 4ZJZA 4XM3A 1GVDA 4KYWA 3JAMZ 4WZTA 1K73D 1VF7A 2LBFB 3M9AA 2WAQN 4YEIA 1VQ9I 4RJLA 1QRCA 3DF8A 2Y9ZA 3K1NA 4LG0B 2LKSA 2WB1N 2ZXHA 4UAJA 1O8GA 4I02A 1FEXA 3BJOA 3OOPA 1S3JA 4PZJA 4AIDA 3WYAA 5TGTA 1FY7A 3BWGA 2QTZA 2NS0A 2Y0MA 1MJAA 2VBZA 2VIXA 4LG3A 2LLKA 2QUFA 2VQCA 1NG7A 2RC4A 4RB0A 2LSOA 2YWHA 2IW5A 3OYHA 3B82A 1TYXA 2NTQA 2ECCA 3IC7A 2R7XA 1I39A 1CF7A 1RUOA 3CMAB 4M3EA 3WU1B 3F21A 2BVNA 3QSYA 4X8IA 4OJ5A 1XE1A 1M1KD 2UUZA 1OCTC 3OYCA 2FX0A 1HSTA 1JTYA 3F3XA 3UNGC 3RKYA 1FRQA 2X0LA 5LRRA 3G05A 2KIUA 1N25A 3ECHA 4G6QA 2O6WA 5BOXA 1O88A 2V9VA 3K2AA 3WBKA 3HEFA 3CMMA 1O7FA 3TOBA 1KMHA 1QNTA 4XD7A 4D1QA 4JK1X 3ZR8X 1UD3A 1ZR2A 3FXJA 2VNIA 3CCSB 3FK6A 4C9YA 1B9MA 3M8JA 1HLVA 2VQLA 1USTA 3K69A 5TISC 1H9GA 4Z4UA 1OMIA 2NRAC 3BG9A 1DU6A 3OJWA 4HBLA 4HZFA 1LJ9A 5IYBJ 1L3LA 4XONA 3HOZJ 3JSOA 2D2WA 2PMZN 1XGSA 4BQAA 3U2RA 4RB2C 3E7LA 3HRTA 1ZREA 5F27A 1WDTA 1AA7A 3T8RA 4BYYA 2HYJA 1MMNA 3PQJA 4DK0A 3B8YA 2CW7A 4GRIA 2NVQJ 1LB2A 1WORA 3BCFA 1TQMA 1G7TA 4IJAA 2BM1A 5LGUA 5CYVA 1FBUA 1YOVB 2MLKA 3R0JA 4PDKA 3KYLA 2GLOA 2DTZA 4IW3B 3H5NA 3OYEA 3E6DA 1QFZA 3F9KA 3HBLA 5L3DA 3QYBA 4UVAA 2K3FA 5M3MJ 3VMFA 1O3RA 5HLIA 1FIAA 3ULQB 1N77A 1VHOA 5TR9A 3LA3A 1T6SA 3WGIA 1EZGA 1ODDA 2NAZA 2BSAA 4F93B 3GQAA 2W82A 4NB5A 3RYRA 1JA1A 2WJVA 1TP4A 3LYCA 1ZYRF 1GXQA 1ZAOA 3R61A 5K7ZA 1I1GA 3PSIA 3S14J 2EB7A 2R7DA 2UXXA 2VQHA 4KICA 4LB5A 3FWEA 1K78B 1IXSB 3QPSA 3DLAA 4EVIA 1SAUA 3LSPA 4EGYA 1XQBA 1S29A 3EPZA 2CV0A 3A3GA 1RWRA 1PYVA 3PO3J 3OE7A 2P7VB 2X0KA 4TKOB 3CCMB 4ZZDA 3BR0A 1ZM2A 1F43A 1NB0A 3CDLA 1IDYA 3IAS2 3QP6A 2HI3A 4AF7A 2EBIA 4MEXF 1L0OC 1UFMA 2HDDA 1CZFA 1E3HA 2XSJC 1WSVA 3PUMA 2XKPA 1BW6A 3DXJF 1FIPA 3C3WA 1X1AA 2CUZA 1IB0A 3KX2A 4WCGA 1ZG1A 3BLYA 2KKOA 1VLOA 1UB9A 5FFZA 1PDNC 3LQ6A 3QAHA 1R23A 1YJNB 2L5QA 1FLIA 3IKTA 2OBPA 1OKRA 5B66C 2Q6LA 3ZMTA 1B9NA 2XNDA 1DP7P 3AK5A 1ETWA 3W2AA 1ON1A 2XGDA 3P5JA 4LITA 4XN0A 5LFAA 1TQPA 2W7NA 2X85A 1D5YA 2R7UA 4XLEA 2CQXA 2V7FA 3HPGA 4HAMA 2DDBA 3W2VA 1ZK8A 1I8DA 1CNEA 2VYQA 2QYOA 2BY1A 2XZOA 4OJLA 1FWZA 2OPTA 1QFYA 2W6IA 4XSXF 3AKZA 2CO5A 1ZH5A 1IGNA 3SLNA 5K5OA 5EZGA 4ESJA 4P22A 3CUQB 2BXZA 2XEXA 2AQFA 2OD5A 1R00A 2A6EF 4PSXA 3RKWA 2VI6A 1ZLKA 4G1VA 2NNYA 4GO1A 3Q0VA 1ZELA 3BQZA 2JSPA 4RGUA 5GAGJ 2E1BA 4P1VA 5IPAA 1RIOH 1HKSA 4Y15A 4BQOA 1W7PA 5LEJA 1QJVA 2NVUB 3H9QA 1DU0A 1TUIA 1FYMA 2DT6A 4JBAA 1PUFB 5JBQA 4HV6A 1SD5A 4LBZA 2DA5A 1SM4A
chains in the Genus database with same CATH topology
1NHCA 1QU3A 3K4LA 5CPRB 4EW9A 2NT6A 1S9HA 2HPIA 2L9NA 3OFNA 3MKYB 3RTRA 1BLIA 4Z06A 3L2WA 4CA0A 3H9JA 3H94A 1KCCA 4OJOA 1LDKB 2JVHA 2UVEA 3FKJA 2OV7A 2R7TA 5FRNA 4ASUA 1ERDA 2INUA 1YE9A 3T56B 1WJEA 3FDYA 4E7LA 2CW8A 4C30A 2KRHA 3CP8A 3FHNA 3L2VA 3FKSA 1MW7A 2NOJB 3BH4A 2HZDA 3PSFA 4DBQA 1HZEA 2M7AA 4CCMA 2IS2A 3EQOA 1UD2A 2XGJA 4XN3A 2WY8Q 1YX5A 3VYRB 2O1DA 3T9GA 3D5SC 5HOOA 1OFLA 4ZDLA 3L2RA 3GVLA 2NT9A 1WFXA 2DIEA 4NK6A 1EA3A 2BOLA 2R7OA 3BG6A 4Z03A 4F91B 2HDWA 4E6KG 1H8EA 1NG6A 1T95A 2R7QA 2WJYA 2MC4A 4BU2A 3S3MA 2INVA 2QKLB 2F43A 2VKHA 3KEYA 4XNFA 3A2KA 1DGWY 1WJCA 2Z2SB 3HOTA 1JRGA 3I3LA 4OJ6A 1IA5A 1O8EA 1BR4A 1WJFA 2O17A 4XL9A 5FRMA 3NWSA 1P9QC 3QYEA 4RMNA 2DCEA 3OIQA 4PFOA 4BXFA 3KRGA 2KDOA 2XAUA 4XKCA 3BC8A 3EUHC 3OYAA 5HNFA 3K4MA 4CCNA 2PYGA 2VJ5A 3K4CA 4P1WA 4PJJA 3HAGA 1UG0A 3DU5A 3VYSB 3CP2A 3AFHA 2R7RA 4NC8A 2V4DA 2HVQA 2M0MA 4ZDOA 3OAAA 1Z3YA 2JJ1A 1PLUA 2NZMA 2RNGA 4PUSA 4B43A 3M1CA 4PK4A 2WY7Q 3QOEA 1QHHD 4MLOA 4ZDPA 3ZGKA 4FXUA 3MKZA 4IX7A 1DGRM 4J00A 3DU6A 3OYBA 1SFKA 1D1BA 2VXDA 4JQFA 4XORA 1WJAA 5FROA 4BJ5C 1COWA 1WTHD 5FL7A 2IQ7A 4KKSA 2Z6BD 3K10A 3HUGB 5CKTA 2F5VA 4NC7A 2O0WA 3HXLA 2OUMA 3K4JA 1O8MA 4HSRA 2ZZFA 3K70C 4RLQA 4ZTJA 1WP6A 2K3PA 3GBGA 3TL4X 2VL8A 4HNTA 3JU4A 4MR0A 3OIPA 1Z3XA 2GJKA 2UWMA 3DTKA 4YELA 2V4JC 2F4IA 3MKWB 1UAAA 2ZZGA 5CDFA 2E1MC 2KVOA 3J7AY 3U21A 3OMYA 3ZPNA 5HLTA 1V5EA 1WJBA 2WZPP 2D3NA 1D0ZA 4DGWB 3ZPPA 3CESA 3TBIA 2BVLA 4D9JA 3S32A 2IS1A 1V0FA 1OR7C 3LL7A 3OYGA 1IRXA 3LMMA 4H4KC 4KT6A 4BL0B 2QKMB 4DNRB 3CZ6A 3VMVA 4PMHA 2HQAA 3L2QA 2ZFUA 4XMYA 4URRA 1FX0A 4YZXA 1BR1A 1IDJA 2LZJA 4HWVA 4W8RA 2HPMA 3CF2A 4KITB 1R6RA 2IGMA 2X8KA 4B48A 4B3XA 1E1RA 3DPTA 3W2AA 1E0EA 1W9XA 2O0VA 3NE5B 3OOCA 4HNUA 2DT7B 2IS6A 3A35A 3DKYA 3BCDA 2E60A 3D5RC 4RM2A 1W36D 1DBGA 1OLTA 3SYTA 2R7VA 3GQ7A 4DBRA 2L2OA 2X51A 3IP4B 3C2HA 3JURA 2A6TA 4PJNA 2JUGA 4C2LA 5IK2A 1BMFA 4ZYAA 3V42A 1V5GA 1Z7LA 4NNJA 3VSLA 2GK7A 3S93A 2X3HA 1TZLA 2P0WA 2KLOA 4BE1A 3HKZA 2ZSHB 1PXZA 3OYKA 1SKYB 4XR6A 4E7JA 2BVMA 4HIZA 3HL2A 4W8QA 3EUAA 4DK1A 2NTPA 3MD2A 4BEHA 3LMWA 1MMGA 4I84A 3E0JB 2W4SA 2V31A 1VJSA 3PL8A 2JDIA 2R4GA 1O8KA 4YEJA 1MNEA 2E5NA 3OYLA 3GQBA 3MMYB 2IGKA 1T5EA 3OW7A 1K5CA 3K4BA 2Z16A 2PMZA 3H5AA 3IUOA 1VLYA 4NQWB 2JJ2A 4E7SA 2VBKA 4BDZA 1UD6A 4FETA 2R9VA 2ZTNA 3DKXA 2NSTA 2XC7A 3OR2C 2WPDA 1H80A 2WAFA 1OB0A 2IGNA 2W00A 1X1CA 3ZRGA 3OS1A 4BE2A 5LD2C 4BS9A 2CV2A 2QE7A 3OYMA 2F1MA 3DPLC 1G8XA 3GVJA 3T53B 2VBMA 4II2A 1X4PA 1E1QA 4TSFA 1UD5A 4YZ0A 1BN8A 2GOMA 2Q1ZB 4JMQA 3SDBA 2M4GA 3A3BA 2ZXIA 4HPQA 2LH9A 3T51B 2M7BA 1OHHA 3HG9A 2X6WA 4OZYA 2X6YA 4CCLA 3OEEA 2K5CA 4DIQA 2VPLA 3PNYA 3OR1C 1X19A 4BEHB 4II3A 1PE9A 2KHMA 3PJRA 1OGOX 2VLAA 4BJTA 4PFPA 2KZVA 4PSWA 4E7HA 1MMAA 2LREA 2WB1A 1AIRA 2KL4A 1E79A 3K4NA 4CH7A 3DTIA 4IZZA 1D0YA 4HEA2 2XF5A 1LFPA 1V5FA 2OC6A 3LFUA 2W1OA 1V0EA 2QXZA 3PNTA 3OL4A 1KONA 3DWLE 2GJRA 2JVGA 3VWBA 4XLCA 4BQNA 4HRIA 3KEWA 2A5WA 3L2UA 1HG8A 2IS4A 3C2GA 4OAZA 3H0DA 4U87A 3S3NA 3I9V2 4QPOA 3RSNA 1WJDA 1KCDA 2XZPA 3VMWA 3A1YA 1JTAA 3CJQB 4B47A 3EQNA 4G7WA 3WQZA 3GRHA 3GQ8A 4XOTA 2O5RA 2JIZA 1RU4A 4ANJA 5AMVA 2BW3A 4FASD 2BSPA 4OWRB 2MD0A 2XOKA 4G6IA 2CH0A 2X1CA 2VBEA 2LYCA 2HU9A 3B90A 2WAEA 1I18A 3LSHA 5KCMA 4L8JA 4KKTA 3SEQA 1NRKA 3DQVC 2IXSA 2XF6A 2XDVA 3CJRB 2X6XA 1UELB 4F52A 1X4OA 4GQNA 2CK3A 4E7IA 3WWGA 3OYDA 4E7ZA 4Z1MA 1BR2A 4U4BA 3GQ9A 2HVRA 1D0XA 1W0KA 2MYSA 4BUPA 5HNHA 4E0FA 3VSTA 2HLDA 3VR6A 2KRCA 3S8PA 3TMOA 2VQGA 4BGDA 3VDXA 3VYUB 4C2TA 2M5SA 2IGOA 4IQ4A 4AVZA 2VXZA 4XLAA 3D5LA 3W2WA 1OGMX 3BC9A 1DBOA 2MFZA 3VSVA 1W0JA 2RREA 2K9MA 3OWTA 1J09A 4N4NB 4CCOA 3ZSCA 2BW3B 2VKDA 3ZCOA 1G59A 2LG4A 4YRVA 2CV1A 1K28D 2LRDA 2Q2EB 4CZCA 1DP3A 2PYHA 1Y56A 1O8DA 4DJAA 4U49A 3ZQQA 2ZZEA 4EATA 2ODLA 4OJPA 3OS0A 2GJPA 4DNTB 4F55A 3OYJA 4XLFA 2UVFA 2F6CA 2V7QA 1X1DA 4QPQA 2K9LA 2X53S 3IAM2 4ZJZA 3OYIA 4XM3A 1EFRA 2KPMA 1VF7A 1VBLA 3OL3A 3RPUD 2LBFB 1VZ0A 2VB6A 4B3FX 1IDKA 2ZXHA 5HKKA 1O8GA 3BG7A 2CUJA 3VSKA 2FUG2 4U7BA 4AYBA 4HG2A 5TGTA 4TT3A 1E43A 2QX3A 2X1DA 2VIXA 1TT0A 3LSKA 4LG3A 4XKBA 1H8HA 2VQCA 1NG7A 2V6EA 3OYHA 2NTQA 3H35A 3DPUA 3N05A 5CQEA 1JI8A 2MABA 2R7XA 3RQ4A 4J01A 1FMWA 2KMUA 3UR3C 1HA8A 4OJ5A 1U0JA 2DOAA 4CUGA 2L9SA 2UUZA 4XLHA 3OEHA 2PECA 3BCBA 3OYCA 4XQFA 1E3ZA 3UNGC 1PKVA 1O8FA 3FBNB 3G05A 1D1AA 3A4CA 2HVSA 2PJRB 1Z21A 4P5OA 1O88A 3PUBA 4R79A 3AL0C 2VJIA 3ONQA 3CMMA 3NWTA 3B4NA 1KMHA 1WPCA 4XD7A 4D1QA 3ZR8X 1UD3A 2GK6A 3LNNA 5KNLA 1E3XA 4C9YA 2JA2A 2DJIA 3LSMA 3M8JA 1KTWA 2VQLA 2M3AA 1FMVA 2V1NA 4XKVA 5CQGA 5JHFA 4RLFA 2QY1A 1OFMA 1LKXA 4UZUA 2HNHA 2LBFA 2Y0SA 2V26A 1GLNA 2I8DA 4YXWA 4KISA 4XONA 3VSUA 2V9KA 3AL0B 4CCJA 3SEZA 1O8JA 1WMRA 1O8LA 4E4HA 1WJ5A 4DOZA 1HVXA 2R7SA 1AA7A 4DK0A 4E7KA 1MMNA 3SZGA 2M4KA 2LY1A 2Z1DA 4F3QA 3B8YA 2NSPA 2CW7A 4GRIA 4BQQA 4BJ6C 1MNDA 1OOCA 4RM3A 4OZZA 3BCFA 4XOPA 4BE0A 4W8TA 1BOBA 4BDYA 3KYLA 2KQRA 3H5NA 3OYEA 2LC2A 3F9KA 1QHGA 1NBMA 3OPOA 2ZTGA 4Y33A 3LSGA 4ZC3A 3QYBA 2PJRA 2Z8GA 4IKFA 2VJ4A 5C1EA 2XF7A 1N77A 3H5RA 4PJMA 2WBMA 3OOUA 3LSIA 1MMDA 1X0CA 4LIUA 1D1CA 1PJRA 2E5ZA 4F93B 2EWEA 2W82A 3GQAA 2LY2A 2WJVA 4BACA 3H9GA 3BCAA 3ZIAA 4MXNA 3G2BA 2E1MB 3OYFA 2LOOA 4Y4RA 3PSIA 4ZTFA 4HSTA 3ZXSA 4Z05A 2VQHA 3HPHA 3HC7A 1GQ8A 3DLAA 3A3GA 1SAUA 1RWRA 2DXIA 2GOXB 3EPZA 2CS3A 2CV0A 1PYVA 3PFYA 1BPLA 1UD8A 3OE7A 4G7XA 4TKOB 4ITVA 4B3GA 3SUCA 3DEEA 4KJZA 1N78A 3OYNA 3IAS2 2L7KA 1MABA 3FBIB 3QODA 2KP6A 1CZFA 2O04A 2VJJA 2XSJC 1IB4A 1Y6IA 4XKWA 3OY9A 2AQEA 4PJLA 4C2UA 1KZLA 3DDYA 1N75A 1O8IA 1X1AA 2CUZA 2VASA 1X1BA 3KX2A 3BLYA 4YZAA 4JOMA 3K70D 2WADA 2ZSIB 5HVQC 2CFOA 3S3OA 3E1SA 3DTEA 3VYTB 2L5QA 2W6JA 2XNDA 2XZLA 4NK8A 2WAQA 4XN0A 4LITA 4NUBA 2W7NA 5LFAA 1T0FC 2RQQA 4N4OB 2X85A 4YZQA 2R7UA 3HOSA 4XLEA 3HPGA 2V7FA 3W2VA 5KHDA 1I8DA 2X1EA 4OAYA 3FY3A 1W36C 3OS2A 4OJLA 2XZOA 1EE6A 2W6IA 4CCKA 2CMPA 3K6GA 3AKZA 4CSWA 4IQJA 1UD4A 3UW0A 4P22A 4KKUA 1QCXA 4AU7A 2WA0A 2AQFA 2ELJA 4PSXA 3RCOA 5DN6A 3GVKA 4X0GA 2WSSA 1LVKA 1ZELA 2D3LA 2JSPA 2R7WA 2E1BA 1BHEA 2NTBA 5C1CA 4B44A 2ZZQA 1K6YA 1O8HA 4BQOA 1XG2A 1QJVA 2UV1A 3H9QA 1YX3A 3PNVA 3QYFA 3K4KA 4F92B 3FPPA 4Y3OA 1DQUA 2DT6A 1RMGA 4LIVA 3W3CA 3EUKL 4W8SA 4G6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHC A;  4XKV A;  4EW9 A;  2QY1 A;  2NT6 A;  3GRH A;  3VMV A;  3GQ8 A;  4XOT A;  4PMH A;  1OFM A;  4XMY A;  4URR A;  4Z06 A;  4YZX A;  1RU4 A;  1IDJ A;  5AMV A;  1KCC A;  4OJO A;  4HWV A;  4XON A;  4W8R A;  2UVE A;  4W8S A;  3VSU A;  2BSP A;  1O8J A;  1WMR A;  1O8L A;  2INU A;  2VBE A;  2O0V A;  3B90 A;  3B8Y A;  1DBG A;  2NSP A;  3GQ7 A;  1OOC A;  3EQO A;  4OZZ A;  2X6X A;  4XN3 A;  4XOP A;  4W8T A;  3JUR A;  4C2L A;  2O1D A;  3WWG A;  3T9G A;  2X3H A;  1OFL A;  4U4B A;  3GQ9 A;  2NT9 A;  4NK6 A;  1PXZ A;  4XR6 A;  2Z8G A;  3VST A;  4W8Q A;  4Z03 A;  5C1E A;  2NTP A;  3LMW A;  1X0C A;  4I84 A;  1O8K A;  4XNF A;  4YEJ A;  4AVZ A;  2EWE A;  3GQA A;  4XLA A;  4MXN A;  4Z05 A;  1OGM X;  1DBO A;  1JRG A;  1K5C A;  3VSV A;  4OJ6 A;  1IA5 A;  1O8E A;  1GQ8 A;  2VBK A;  2O17 A;  4XL9 A;  1RWR A;  3ZSC A;  3KRG A;  2NST A;  3SUC A;  2PYH A;  1O8D A;  1H80 A;  4U49 A;  4OJP A;  2ODL A;  2PYG A;  1CZF A;  4XLF A;  2O04 A;  2UVF A;  2VJJ A;  1PLU A;  2VBM A;  4XKW A;  1IB4 A;  4YZ0 A;  2NZM A;  1BN8 A;  1O8I A;  4XM3 A;  1VBL A;  4YZA A;  1IDK A;  2X6W A;  4OZY A;  2X6Y A;  1O8G A;  4XOR A;  2IQ7 A;  2O0W A;  4NK8 A;  1PE9 A;  4XN0 A;  2QX3 A;  4YZQ A;  1OGO X;  2X85 A;  4XLE A;  1O8M A;  1AIR A;  3FY3 A;  2NTQ A;  4OJL A;  1EE6 A;  4MR0 A;  4OJ5 A;  3UW0 A;  4XLH A;  4YEL A;  2PEC A;  1QCX A;  4XQF A;  2QXZ A;  1O8F A;  4XLC A;  1O88 A;  3ZPP A;  1HG8 A;  5C1C A;  1BHE A;  2NTB A;  2VJI A;  1O8H A;  1XG2 A;  3B4N A;  1QJV A;  1KCD A;  3VMW A;  1JTA A;  1RMG A;  2INV A;  1KTW A;  3EQN A; 
#chains in the Genus database with same CATH topology
 4DZP A;  1NHC A;  1YW8 A;  1E63 A;  4FWT A;  4KN7 X;  4XRS G;  4M9X A;  4Z4Y A;  5E18 F;  1U2R A;  1JKP C;  2E1R A;  2NYX A;  5JHU A;  3MKL A;  4QVJ A;  1L1I A;  1T8I A;  1QQI A;  4RD1 A;  3JRF A;  3R6K A;  1FNB A;  3FKJ A;  4YDT A;  3CDH A;  1XCB A;  3WHC A;  2YUH A;  3T56 B;  1WJE A;  5IOY A;  3GZ5 A;  5J6X A;  3U2Q A;  4U0Y A;  4NDL A;  2M7A A;  2O9L A;  2EV5 A;  2M34 A;  3HTS B;  2IS2 A;  1KK1 A;  1DPR A;  4PCQ A;  2P5K A;  2XGJ A;  5BPD A;  4MYT A;  2L9V A;  2WY8 Q;  4M73 A;  1WSU A;  3VYR B;  1OCR H;  5C1E A;  2G0Y A;  2KIM A;  4C3I J;  4IOA F;  5F4M A;  1XS9 A;  4XID A;  1QPM A;  3U6B A;  4OOX A;  4YFK F;  4KA4 A;  2BOL A;  3FXQ A;  4LB6 B;  3WTZ A;  4QIW N;  4Z03 A;  2OBS A;  2HDW A;  4KH3 A;  5GPC A;  2R7Q A;  1H9T A;  1U6G A;  2F43 A;  3REO A;  3KEY A;  5H6R A;  1DGW Y;  3A2K A;  3OIO A;  2CQ7 A;  5E1W A;  3T8T A;  3SLD A;  3I56 B;  4FCY A;  1XMA A;  1H42 A;  3PA1 A;  1FBQ A;  1VQ7 B;  4A3F J;  2BV3 A;  1IA5 A;  5GV8 A;  1VQ5 I;  2V7T A;  2C4U A;  4BHB A;  4XL9 A;  3BTL A;  1QGP A;  1P9Q C;  1VQL B;  4M0L A;  4IHW A;  3DBL B;  1G7C A;  2XAU A;  1VQK I;  2RGV A;  3OYA A;  5HNF A;  3GXO A;  1PVE A;  3G71 B;  2ZJ2 A;  1CQX A;  5C44 J;  2C2W A;  3TO6 A;  5CVV A;  3VYS B;  5IOZ A;  4PC7 A;  5EMN A;  3C2B A;  2IOU G;  4IHT A;  3O3K A;  3SQN A;  3NEU A;  5L3F A;  5FLV A;  2NZM A;  2MSY A;  2WY7 Q;  3QOE A;  2XPV A;  5GTH C;  2AO9 A;  4FXU A;  4ZDP A;  1OR7 A;  4LC0 A;  1IJW C;  1KU3 A;  5FO1 A;  4HV5 A;  1XGM A;  5E3L A;  1R1T A;  4DYQ A;  2VXD A;  4JQF A;  4BJ5 C;  1COW A;  5FRO A;  4H9G A;  2CUE A;  5J8C A;  4KKS A;  3K10 A;  5HLH A;  1XPX A;  2QZA A;  3CXC B;  4N9I A;  2XTY A;  1YYV A;  2M30 A;  3MWM A;  4HSR A;  2ZZF A;  4JYK A;  2ZBU A;  1OPC A;  1Y0Y A;  3MCA A;  1OFC X;  1KU9 A;  4EV0 A;  2VL8 A;  2DT5 A;  1R7J A;  4ASN A;  4P12 A;  1W5T A;  1Z3X A;  3DLL F;  2GJK A;  5KK1 A;  2UWM A;  3CW2 A;  4YEL A;  2V4J C;  3HZJ A;  3I5U A;  5J40 A;  1UAA A;  1D8J A;  1EP1 B;  1KQ0 A;  2HOA A;  2DOG A;  5J1Y A;  2KVO A;  5CDF A;  2V6C A;  2ZXW H;  4C3J J;  2HQ5 A;  4CYC A;  5J4V A;  3S1N J;  1N06 A;  3OMY A;  1V5E A;  3K1M A;  3TBI A;  3AAF A;  2EA4 A;  2GA2 A;  3S32 A;  4D9J A;  3WTV C;  1MBE A;  4Y17 A;  3G71 I;  4IOC F;  5J3O A;  3J81 K;  2R7F A;  4OIQ F;  2L01 A;  1BI1 A;  1BBY A;  3KZY A;  4HX7 A;  2W7Z A;  1QA3 A;  3GLL A;  4H4K C;  2NV4 A;  3IL2 A;  3CZ6 A;  2O8K A;  3VMV A;  4XMY A;  4EJU A;  4URR A;  1U78 A;  5FLX Z;  2XUB A;  2LZJ A;  3BH6 B;  2B63 J;  2NPF A;  4HWV A;  1P4A A;  1WPK A;  3OZW A;  1M90 D;  1A35 A;  4L18 B;  2R5Z A;  2KZG A;  2L54 A;  3G6E B;  4B3X A;  1E1R A;  1WU8 A;  1E0E A;  1W9X A;  4KN4 X;  1XD7 A;  3E6M A;  5GAH J;  3DKY A;  3W6J B;  3KET A;  3BCD A;  3D5R C;  5FFX A;  4Z4V A;  4KIB A;  2XC1 A;  1WI3 A;  1TVC A;  4OIN F;  4B09 A;  1EH7 A;  1ZG5 A;  1YJ9 I;  3IP4 B;  2GXA A;  3ZQH A;  3A02 A;  3J7A O;  1AHD P;  4HOB A;  4ZYA A;  3Q3A A;  4AC9 A;  3V42 A;  3TKY A;  1E2X A;  4RM0 A;  1TZL A;  2KLO A;  1YLO A;  2ZSH B;  1EKE A;  3OYK A;  4X07 A;  1ETK A;  1Q82 D;  5LHH A;  1KQS B;  3EUA A;  1D5V A;  2L3D A;  2CBX A;  4DK1 A;  3VNV A;  3HYI A;  2EFQ A;  2F5D A;  1TYW A;  1HSJ A;  2W4S A;  1F4K A;  2EIK H;  2FE3 A;  2IP2 A;  2R4G A;  4HW0 A;  4XRM A;  2VNH A;  1YHQ B;  2DFI A;  5JMC B;  2M9H A;  3K9T A;  3MQ0 A;  2DA3 A;  2IGK A;  4D5F A;  5C4J J;  1VQP I;  1JKQ C;  1K5C A;  3H5A A;  5D5V B;  1FYL A;  2EPF A;  2EH3 A;  1NH3 A;  2E7X A;  4Y7C A;  4FET A;  3S1R J;  3KYD B;  3E1Y E;  4A5N A;  1S4M A;  2GQF A;  2NVT J;  3JRG A;  3CF5 F;  2M2E A;  3WE2 A;  1JHH A;  3CD6 I;  1BOA A;  1OB0 A;  2W00 A;  2AHO A;  3OS1 A;  4BE2 A;  5LD2 C;  2HKX A;  4BS9 A;  3Q38 A;  3FXK A;  1LM1 A;  4ZV4 A;  4LBW A;  4IL6 C;  3I53 A;  4YZ0 A;  2HZT A;  2LMD A;  5FGM A;  3SDB A;  4ABZ A;  1O3T A;  1QRY A;  2QDX A;  2ZXI A;  3A3B A;  2F3L A;  2FBH A;  2HYF A;  2ZFW A;  2LTP A;  3SFZ A;  1UCR A;  4ZYE A;  1FC3 A;  2K5C A;  4OOS A;  3JCU C;  1P4W A;  3SFI A;  1X19 A;  3FMQ A;  4PC1 A;  4X7E A;  4UNO A;  1R71 A;  4A3J J;  2Z3Y A;  4XSZ F;  4PSW A;  4UVC A;  2KFD A;  2RNJ A;  5D4R A;  1AIR A;  2KL4 A;  4HF1 A;  3NQO A;  2CRV A;  2G0E A;  2XRO A;  4AYB N;  2VFM A;  4V19 K;  4CH7 A;  4PAA A;  1LLZ A;  4LLN A;  2YX7 A;  4IZZ A;  1D0Y A;  2VC1 A;  1K78 A;  3LFU A;  4IPA A;  2QXZ A;  5F6F A;  1U8B A;  2JRM A;  2GQQ A;  1KON A;  3RJP A;  3HDD A;  3KEW A;  2XT2 A;  2XRN A;  3W2F A;  1ZGA A;  4QPO A;  1TTT A;  2YS9 A;  1KCD A;  4IXA A;  2PIA A;  3M4O J;  2G7U A;  3CJQ B;  5FNZ A;  2VBS A;  4RB1 A;  1RQR A;  4B47 A;  3EQN A;  3HRU A;  4RA2 A;  5FKN A;  4HQE A;  3WQZ A;  1F9N A;  1ON2 A;  4XOT A;  2O5R A;  3HGY A;  3V7C A;  3WXM A;  3GQ8 A;  2JIZ A;  2P7C B;  4N9H A;  1R9T J;  4ANJ A;  3A8K A;  4FAS D;  1KTV A;  2PLF A;  1KK0 A;  3V8K A;  3BQY A;  2ME0 A;  2I1L A;  2C78 A;  3CCJ B;  1UHW A;  2CH0 A;  1K4T A;  2GZW A;  3A0B C;  1FNC A;  2XAF A;  3KE2 A;  5AIQ A;  2HU9 A;  2J5P A;  4M71 A;  4FT8 A;  5B1A H;  3SEQ A;  4A3I J;  4RDL A;  3DQV C;  2XF6 A;  3M8E A;  2X6X A;  4I99 C;  4F52 A;  3ABL H;  1GJR A;  2DBB A;  4BY1 J;  1D3Y A;  2B5O A;  3G1O A;  3WWG A;  1ZG3 A;  1AU7 A;  1Q1H A;  4E7Z A;  5HS9 A;  1AIP A;  3ZMU A;  4U4B A;  3KCC A;  2RQP A;  2OTL I;  1D0X A;  1IF1 A;  1G3T A;  4CHU A;  2W48 A;  4M4S A;  4DZJ A;  5FIU A;  3RY8 A;  2WV0 A;  1X3U A;  2HLD A;  3M8F A;  3JRE A;  5ERI A;  5DEQ A;  1HCR A;  2K9S A;  2QA4 I;  3JTH A;  5ILS A;  3WTU C;  4C2T A;  3VDX A;  2RV8 A;  3QPH A;  3HSF A;  2C5B A;  2VXZ A;  4F7Z A;  1J0R A;  2VZL A;  3D5L A;  4V2G A;  2ZJQ F;  5HDG A;  3W2W A;  2NVY J;  1KGS A;  5GAD J;  3BC9 A;  3L00 A;  2MFZ A;  2HEO A;  3VSV A;  3I4M J;  2YWG A;  3CCR I;  5D8K B;  1O4X A;  5TRD A;  3M1E A;  4LG0 A;  1G59 A;  4HNV A;  3Q6Q A;  4XLP F;  4YRV A;  1PJ6 A;  4A3M J;  5DD4 A;  2Q2E B;  4P9U A;  1O8D A;  1K4S A;  2M45 A;  1OCP A;  5B5E C;  1G4D A;  2LP0 A;  3OS0 A;  2BN4 A;  3OYJ A;  4XLF A;  2UVF A;  3SQV A;  1QRB A;  2V7Q A;  1X1D A;  1BJA A;  2Z5U A;  4QPQ A;  4MGR A;  2X53 S;  2EV0 A;  3FF5 A;  3B73 A;  1ZRD A;  3OL3 A;  3AG2 H;  5DS0 A;  2VB6 A;  2FNA A;  4ZH4 F;  2JA5 J;  3X2Q H;  3TDZ C;  4KNY A;  5HKK A;  1IV8 A;  3BG7 A;  2CUJ A;  3KP7 A;  1WOP A;  4Z4T A;  4TT3 A;  3CDI A;  5CVI A;  5J8F A;  2QZ8 A;  3LSK A;  3ZZ0 A;  1XMK A;  2E1N A;  1RKW A;  1H8H A;  1EP3 B;  3NAU A;  4W1U A;  5GTI C;  3JRI A;  1FSH A;  2VBW A;  2QMU A;  3N05 A;  3C7J A;  3TO7 A;  4P25 A;  3RQ4 A;  4YFN F;  3WTX C;  4J01 A;  5HLG A;  2CND A;  1FMW A;  2KMU A;  3TW7 A;  1N05 A;  3OEH A;  4CUG A;  5H59 A;  2L9S A;  4L9N A;  4XLH A;  2PFB A;  3BCB A;  3MAJ A;  3WNB A;  1MBG A;  3FBN B;  1SKQ A;  3A4C A;  2HVS A;  3U6K A;  4FIS A;  3C18 A;  4BH9 A;  3LAJ A;  2WZN A;  1KQ9 A;  4U0V A;  2OBT A;  1W4M A;  5KNL A;  4M1K A;  2JA2 A;  4YAL A;  3QWL A;  2BZT A;  3G73 A;  4XKV A;  2PX9 A;  1QO0 D;  1Y1W J;  1Z91 A;  1LKX A;  2V26 A;  1GLN A;  3ABT A;  2XT4 A;  3ZOB A;  2AHQ A;  1USS A;  2QGU A;  2V9K A;  1ZKG A;  3BG5 A;  2V7V A;  1TT5 B;  1KJZ A;  3HUG A;  1KYZ A;  1WCM J;  4DOZ A;  2R7S A;  4RAG A;  2XAQ A;  3F6V A;  3TP0 A;  1MND A;  3HHG A;  4Q7J B;  1PJ5 A;  5GP9 A;  2FOW A;  4XOP A;  4W8T A;  3GTK J;  2V1X A;  2QM3 A;  1W0T A;  1A04 A;  1FOK A;  2K40 A;  4MIM A;  2VON A;  4C43 A;  2OTJ B;  1BQE A;  4FHT A;  2VJ4 A;  3L7W A;  1X0C A;  3LWF A;  4LIU A;  2E5Z A;  1HKQ A;  3HTU A;  2EWE A;  1YS7 A;  2LY2 A;  1OYY A;  3LQQ A;  2JTV A;  4QWQ A;  1TL8 A;  4LFU A;  2BMW A;  1WH7 A;  2E1M B;  2E1O A;  3AST A;  1VQL I;  1RES A;  3HC7 A;  3RIR A;  1AKH A;  2P6T A;  2JK3 A;  4CGZ A;  2E2H J;  4G8X A;  4AD9 A;  2CS3 A;  1MDM A;  2AXT C;  3SUC A;  4WX9 A;  4L9J A;  3S2W A;  4YFX F;  3DEE A;  4KJZ A;  3CCU I;  3TED A;  1S7E A;  3DP7 A;  4IHY A;  1YTY A;  1N0V C;  3OYN A;  1K8A D;  1K8F A;  3FBI B;  1NDH A;  1R5B A;  1F1Z A;  2H6B A;  2ISY A;  3WU2 C;  1FOW A;  1F36 A;  2RC6 A;  3PFI A;  4NCN A;  5K5R A;  3BJ6 A;  1Y6I A;  3OY9 A;  1Q1V A;  4PJL A;  1FSE A;  1PUF A;  1JT0 A;  1O8I A;  1Z1D A;  1MNM C;  1JB9 A;  4P6Y A;  3DEU A;  2GIV A;  4YZA A;  3H9N A;  1SFO J;  1BX0 A;  1SC7 A;  1G7S A;  4RCY A;  2ECB A;  2NNN A;  3DTE A;  2VN2 A;  3L1P A;  1K6O A;  4YFO A;  1YRN A;  4UZF A;  1XDS A;  4NK8 A;  2EFG A;  3WHB A;  4L5E A;  2LF7 A;  3AG4 H;  1OCO H;  5LHG A;  3R6J A;  5KHD A;  2WYR A;  2LVS A;  3KPH A;  4OAY A;  3MZY A;  1IZ1 A;  1RC9 A;  1W36 C;  3OS2 A;  2B0L A;  3MN2 A;  3TP3 A;  1T2K A;  1O57 A;  4OIP F;  4XLN F;  4IHX A;  2CMP A;  3NAR A;  3F72 A;  3K6G A;  4X1E A;  2COM A;  3B78 A;  4FX0 A;  4KKU A;  3WY9 A;  2FA5 A;  1XGO A;  3BY6 A;  4M6Y A;  1Y8R B;  2ID6 A;  3V4G A;  3H3Z A;  4P26 A;  3GVK A;  2LFB A;  1LVK A;  2D3L A;  1AWC A;  2R7W A;  3KP6 A;  1BHE A;  4KIF A;  3OZU A;  2FBK A;  3LNQ A;  2KIQ A;  3PNV A;  3QYF A;  4L5I A;  4NHJ A;  4L9T A;  1BA5 A;  1DQU A;  2Y0S N;  3FZV A;  2C6Y A;  1NTC A;  3L09 A;  3EUK L;  4LIV A;  1H8A C;  1V5V A;  5LMZ A;  2PJP A;  3LQR A;  4W8S A;  1QU3 A;  4EW9 A;  3VNU A;  2VFP A;  1Z0X A;  2HPI A;  2L9N A;  3FXL A;  4L0Z B;  5A88 A;  1MJ9 A;  2RAE A;  3ONU A;  4X7C A;  3ZMS A;  2ZME C;  1MD0 A;  2MBF A;  1WKM A;  2R7T A;  5LEK A;  4I98 B;  5J35 A;  1ERD A;  2JUC A;  3BR6 A;  2FMY A;  2K7L A;  2XTX A;  2CW8 A;  2HQN A;  2KRH A;  2ME6 A;  4C30 A;  4B4C A;  3WTS C;  5F0H A;  1STZ A;  2K4J A;  1MW7 A;  2NOJ B;  5J47 A;  1DDI A;  4DBQ A;  4AIK A;  2DET A;  1HZE A;  3MZH A;  3BR2 A;  4S04 A;  1KQ5 A;  4XN3 A;  3P4G A;  3J81 k;  3GTJ J;  1YX5 A;  2FU4 A;  2O1D A;  2GXB A;  3BR3 A;  1OFL A;  3L2R A;  4PGG A;  3PQK A;  2NVX J;  4BNC A;  2A69 F;  1VQO B;  3BG6 A;  2WJY A;  4LBV A;  1H8E A;  4OU0 A;  4A69 C;  4ZZL A;  1ETQ A;  2OAZ A;  2BGI A;  4XNF A;  4XRS A;  3V7A A;  4EQQ A;  1WJC A;  2IVM A;  2Z2S B;  1FZP B;  5F4O A;  4X7F A;  1VQ6 B;  4XIC A;  1JRG A;  5EYR A;  3I3L A;  1BI0 A;  4I76 A;  3AVU A;  2KDZ A;  1A6Q A;  3NB2 A;  4OJ6 A;  1ITY A;  3KZI C;  1WJF A;  1OB5 A;  1QVG B;  3WU0 A;  3FXO A;  4EMS A;  2FSW A;  1QVT A;  2DCE A;  1HF0 A;  2HTJ A;  3QPL A;  3F0C A;  4M3B A;  3WG7 H;  1EH6 A;  4XKC A;  2LF8 A;  5A8A A;  2V79 A;  1E64 A;  4ENN A;  3PO2 J;  5F1R A;  3J7Y J;  3KP3 A;  4IRG A;  4YII A;  1UG0 A;  3DU5 A;  3KP2 A;  3CP2 A;  3R0A A;  5E17 F;  3HAG A;  3W2E A;  1XSD A;  1ZUN B;  3ASS A;  3SKB A;  3O6B B;  3B6A A;  4PUS A;  1C0W A;  3PSZ A;  4BPR A;  3IRQ A;  4MLO A;  1T6Z A;  2W24 A;  1W7P D;  4BBR J;  3MKZ A;  4N3N A;  4J00 A;  3DU6 A;  3QU6 A;  3Q5F A;  1MH3 A;  5HDN A;  1D1B A;  1ETV A;  4Q47 A;  1QVU A;  5E8G A;  4LK0 F;  2LKX A;  1OGI A;  1WTH D;  1YIJ B;  3Q0W A;  3HUG B;  3ZQC A;  5IT3 A;  1T39 A;  2GPJ A;  2ZBV A;  2H94 A;  3M3Y J;  2P81 A;  3Q9V A;  3GF2 A;  3VO2 A;  2LNB A;  1WWX A;  4A3G J;  4M9Z A;  2V7W A;  4NBS A;  1J9I A;  4M6V A;  3OIP A;  2K4B A;  4MR0 A;  3J80 Z;  4Y7N J;  2KIF A;  4YG2 F;  2R93 J;  5D6F A;  5M5W J;  2E1M C;  3Q3S A;  1FP2 A;  1W35 A;  1S7O A;  1MBH A;  4C0S A;  3HM5 A;  1WJB A;  3BP8 A;  2D3N A;  1GT0 C;  3CES A;  3SZT A;  4ROX A;  1JGS A;  1JUM A;  2BVL A;  2JWT A;  3R4K A;  3A01 A;  3K2Z A;  2JSC A;  4B3A A;  1H88 C;  3H36 A;  3QU3 A;  4V02 C;  3P9C A;  3OYG A;  4PC3 A;  3CCU B;  4KT6 A;  1P7I A;  1NK3 P;  4A3E J;  1I1S A;  2ZC2 A;  1CF7 B;  2HQA A;  1SD7 A;  3OJX A;  2CUF A;  1E17 A;  4QLC U;  1BR1 A;  4PJ0 C;  1LLW A;  2XPU A;  5ILU A;  2H27 A;  3CLQ A;  4KIT B;  4B48 A;  4HF2 A;  2O0V A;  4TMW A;  4Y9R A;  1R5O A;  3NE5 B;  3OOC A;  3A35 A;  4M9S A;  1B1B A;  2FML A;  5EDN A;  4P3Y A;  1W36 D;  1UMQ A;  3BQJ A;  1OLT A;  3KFW X;  5ICE A;  3PM1 A;  5IYW A;  1GR1 A;  3C2H A;  2COB A;  1MKM A;  2BHY A;  3BNW A;  1Y0U A;  3BTC A;  5IK2 A;  1QQ1 A;  2OTJ I;  1BMF A;  1YIT B;  2F4O B;  3VSL A;  1Z7L A;  5L3E A;  3QP5 A;  3LQE A;  6PAX A;  2GAU A;  1Z6T A;  4BE1 A;  3HKZ A;  1PXZ A;  1KU2 A;  4E7J A;  1XB2 A;  3DU1 X;  2F5C A;  3GX4 X;  3ZP5 A;  1O3S A;  1I50 J;  1MMG A;  2EIX A;  4QUZ A;  4EH1 A;  4I84 A;  1TYU A;  4MQ9 F;  3AVW A;  2KJC A;  1VJS A;  1UG2 A;  1O8K A;  2L7M P;  1SMY F;  4DYR A;  1VQM I;  2ACJ A;  3P9K A;  3BH7 B;  2JPC A;  1MNE A;  1UZC A;  4RGX A;  2J7K A;  2OCE A;  4ZYH A;  3OYL A;  3GFI A;  3MMY B;  1T5E A;  3OW7 A;  3OV8 A;  5L46 A;  3BG3 A;  2FD5 A;  2VBK A;  4E7S A;  5FD6 A;  1VQP B;  2R9V A;  3HB9 A;  1T6Y A;  2JN9 A;  2P6S A;  2ZTN A;  4RDK A;  3DKX A;  1HXD A;  2F1L A;  2WAF A;  1MH4 A;  5HS7 A;  1KK2 A;  2QBY A;  2QE7 A;  1W5S A;  3W5V A;  3BT9 A;  3OYM A;  1G8X A;  5AON A;  3BDD A;  1X4P A;  3ASO H;  1E1Q A;  4X6A J;  1UD5 A;  4TSF A;  2B0R A;  4A5M A;  3S1M J;  2BX6 A;  3ERE D;  1CQT A;  2VE8 A;  5J1R A;  5DUI A;  1LPQ A;  2O0Y A;  2EV6 A;  2E71 A;  2EIL H;  2M8G X;  3CCE B;  3DFG A;  1RRJ A;  1YJ9 B;  3O8G A;  2X6Y A;  4IEJ A;  5KW9 A;  4DQL A;  3RIQ A;  1S6L A;  2VPL A;  2E34 A;  2A61 A;  2MW8 A;  2CQQ A;  3OR1 C;  4BEH B;  5EG0 B;  1SD4 A;  1LFU P;  1EFT A;  2KHM A;  4EM1 A;  1HOM A;  1PE9 A;  3ZMZ A;  1OGO X;  5FJ8 J;  4PFP A;  2A3S A;  5L3B A;  2H09 A;  3PSS A;  3HOU J;  2OF7 A;  1ZHF A;  4JX4 A;  4R8H A;  5KAI C;  3AVT A;  2DQR A;  4TV7 A;  3DTI A;  3M07 A;  1XX5 A;  2XF5 A;  2YU3 A;  1T08 B;  1TNT A;  1MAB A;  4Z4R A;  5BSY A;  3OL4 A;  2YSR A;  2RC5 A;  4ZCM A;  1I3Q J;  2W25 A;  1TWF J;  2A5W A;  1WRJ A;  2IS4 A;  3H0D A;  2H8R A;  1EXM A;  2CSO A;  3RSN A;  5F0F A;  2IRF G;  3IHU A;  3MCZ A;  4MTE A;  5IP9 J;  1N8R D;  3KEO A;  1R58 A;  2GWR A;  3CMY A;  3A1Y A;  2FQ4 A;  1JTA A;  4OPW A;  2IA0 A;  1QBJ A;  1G3Y A;  3L9F A;  1VHE A;  4HYE A;  3VO1 A;  4I6Z A;  5D5X B;  1BJZ A;  3Q0U A;  1IV6 A;  2Z33 A;  3PUF A;  4BHC A;  1IG7 A;  1IN6 A;  1MBK A;  3W6K B;  5ICC A;  2BSP A;  2Q2E A;  4FN5 A;  2P5V A;  1VQM B;  2VBE A;  2LYC A;  2YX4 A;  5FKM A;  1V4R A;  2VBU A;  2FQ3 A;  3V8L A;  3RI4 A;  2E1C A;  1BI2 A;  3CC2 B;  3LSH A;  1NRK A;  3W5U A;  5H5J A;  1RNL A;  2IXS A;  3PIP F;  4KMU X;  1DAR A;  1UEL B;  5D6E A;  3OZV A;  5D5W B;  2OTL B;  5BMZ A;  5EF6 A;  1VQ8 B;  2PMU A;  1BC7 C;  3OYD A;  1YIT I;  2EK5 A;  2DCU A;  4Z1M A;  4IRI A;  3GQ9 A;  1OYW A;  1YX2 A;  2MYS A;  4E0F A;  2C5H A;  1RKT A;  3RQI A;  1X3W B;  2Y2Z A;  1JXS A;  1Y1V J;  2VQG A;  2DU9 A;  2UZK A;  3HOY J;  2M5S A;  3ROU A;  1MSE C;  2IGO A;  3F8C A;  1VQK B;  4RLZ A;  1IXR C;  3CCJ I;  4LK1 F;  1WH5 A;  4YIR X;  1Y0R A;  1OGM X;  5IT9 Z;  4Z4S A;  2M5W A;  2CG4 A;  2R5Y B;  2VKE A;  1W0J A;  3AVV A;  3VPR A;  1FTT A;  5DNS A;  1BJK A;  2QEX I;  4N4N B;  5ILV A;  2L4A A;  2BW3 B;  3IH3 A;  2CV1 A;  5LBQ A;  2LRD A;  5H20 A;  4CZC A;  1DP3 A;  1Y56 A;  2PYH A;  2HFH A;  2YPR A;  5E3O A;  3ZQQ A;  1HA3 A;  2BGJ A;  1OIS A;  2ZZE A;  1JJ8 C;  4OJP A;  2GJP A;  3RYP A;  4EGZ A;  5FLX K;  4I09 A;  4DYC A;  1B59 A;  4EEF G;  4F55 A;  2F4N A;  5IYR A;  3LSR A;  3P26 A;  1VQN B;  2YU9 J;  4KDP A;  1U5T C;  3IAM 2;  3N4M A;  2MC3 A;  5F64 A;  4Z4Z A;  3GEZ A;  2KPM A;  1LFB A;  3JRA A;  1G3S A;  1U5T A;  3RPU D;  1VZ0 A;  5TV2 A;  4ON0 A;  2ETH A;  3I64 A;  3EET A;  1IDK A;  4UVB A;  3ZBT A;  4B1R A;  1I5Z A;  1F5T A;  1W0U A;  3S15 J;  3T0Y A;  4HA8 A;  1OQY A;  1E43 A;  4K1X A;  2DOF A;  2QX3 A;  5GAE J;  1TT0 A;  2ZJP F;  1R1U A;  2EZK A;  1XSV A;  5CVR A;  4GGG A;  5EEA A;  2V6E A;  1YIJ I;  3H35 A;  3DPU A;  1JI8 A;  3AG3 H;  2MAB A;  3A8I A;  2V1U A;  2JA6 J;  9ANT A;  4OPO A;  1FBS A;  3F6O A;  3UR3 C;  4BXX J;  2QWW A;  3A8J A;  1U0J A;  2Z99 A;  2PEC A;  2K9Q A;  2XNJ A;  4XQF A;  2E35 A;  1DDG A;  1E3Z A;  3OSG A;  1PKV A;  2CW5 A;  4BXU A;  1QA1 A;  1SEU A;  1Z21 A;  3ASN H;  3H3U A;  5EEG A;  3GTG J;  4TMV A;  4R79 A;  3AL0 C;  5JFR A;  2VBY A;  2VJI A;  2AXL A;  2ICW G;  1GVJ A;  1WPC A;  2GK6 A;  1A31 A;  5K7F A;  1KK3 A;  1YIO A;  4GXO A;  4L0Y B;  1N07 A;  1E3X A;  1TWG J;  2DJI A;  3LSM A;  4HE5 A;  2M3A A;  3SXY A;  2V1N A;  3TOA A;  5CQG A;  3H92 A;  4J19 A;  3G4S B;  1OFM A;  4UZU A;  2Y0S A;  2HNH A;  1XGN A;  5DM6 F;  1Q81 D;  2DA2 A;  5LGT A;  1MBJ A;  1YW9 A;  2ZNZ A;  4KIS A;  4I7H A;  2K02 A;  3A0H C;  3AL0 B;  5EGO B;  5E1Z B;  3KP4 A;  1XC5 A;  1WOO A;  2YWF A;  1MSF C;  1IDZ A;  5FO0 A;  1O8J A;  5DCF A;  2K27 A;  4CDG A;  1IN8 A;  4QSH A;  4PC6 A;  4CQJ A;  4E7K A;  3SZG A;  2M4K A;  4ZCL A;  2LY1 A;  4MEY F;  2Z1D A;  4F3Q A;  2NSP A;  1R5I D;  3KL9 A;  4BJ6 C;  1QPI A;  2V5I A;  4OZZ A;  4UY8 I;  2J5O A;  1G3W A;  3CCE I;  4BE0 A;  1BOB A;  4BDY A;  2BM6 A;  2KQR A;  2VPR A;  4O5V A;  1JGG A;  2IA1 A;  2LC2 A;  3CO7 C;  5GV7 A;  4ZYD A;  3OPO A;  2ZTG A;  4Q5S F;  1XFO A;  3RKX A;  4Y33 A;  1SVO A;  3LSG A;  4ZC3 A;  1T38 A;  1WZ2 A;  2NOG A;  1DPU A;  3A1P A;  2PJR A;  2W85 A;  3I59 B;  5IYP A;  2BY0 A;  1EV7 A;  4IKF A;  2VNJ A;  1JHF A;  2R5Z B;  1M1E B;  4OMY A;  3H5R A;  2D1H A;  2TRT A;  2XB5 A;  4PJM A;  3RDI A;  1Q7Y D;  1LDD A;  3D0S A;  4CO8 A;  1XCV A;  2ZJR F;  1D1C A;  2B7E A;  1FND A;  3QE2 A;  4QFM A;  1DG1 G;  4BAC A;  3TQN A;  3BCA A;  3WGG A;  3ZIA A;  4MXN A;  3G2B A;  4FTH A;  2X4H A;  2LOO A;  2BBY A;  2F2E A;  4Y4R A;  4HST A;  3EYY A;  3ZQG A;  3ZXS A;  4ZTF A;  4Y9U A;  2ZKZ A;  3ABK H;  3HPH A;  1PP7 U;  1CLW A;  1GQ8 A;  1DAB A;  3QOP A;  4EJW A;  1IN7 A;  1EFU A;  2GOX B;  1BPL A;  1FRN A;  1UD8 A;  3PFY A;  2OBR A;  4IF4 A;  1FPQ A;  4ITV A;  4KT5 C;  4WK8 F;  1YRN B;  2CQK A;  4QHY A;  4B3G A;  3JAM K;  2L7K A;  1BN5 A;  2NS7 A;  2KT0 A;  2OZ6 A;  2QSF X;  3KYC B;  3P9I A;  3QOD A;  2CW0 F;  2PLY A;  4B4D A;  1IAW A;  2CC2 A;  2O04 A;  2XRL A;  1POG A;  2VJJ A;  3W6V A;  1EF4 A;  4C2U A;  4XKW A;  1KZL A;  1IO2 A;  1N75 A;  5J3L A;  1WXR A;  2OQG A;  2YWE A;  1ZM3 A;  4ENK A;  4HX8 A;  1ZM4 A;  3LVB A;  4PGH A;  2WAD A;  1U9N A;  4ZYG A;  3VYT B;  4UUS A;  5DYM A;  2J8I A;  3RZD J;  2XZL A;  1IHM A;  3CPX A;  4U0W A;  1LNW A;  4NUB A;  5CJ9 A;  4N4O B;  2RQQ A;  3FPK A;  4BBS J;  3HOS A;  3BJA A;  1V3F A;  5C4X J;  2BEO A;  3F23 A;  2X1E A;  3H09 A;  2M0C A;  5H6Q A;  2QTL A;  4G9Y A;  5E79 C;  1K79 A;  1EE6 A;  1QX4 A;  3JW4 A;  4CCK A;  1IXC A;  4WZL A;  4IQJ A;  4R1H A;  3E5X A;  4CSW A;  4FX4 A;  4IHS A;  4AU7 A;  2WA0 A;  3ZMD A;  2JQ7 A;  3S2H J;  5DN6 A;  3DCF A;  4Y52 J;  1VQN I;  5C1C A;  2NTB A;  2ZZQ A;  1T33 A;  1O8H A;  3LA7 A;  1XSX A;  3AGQ A;  1QZE A;  4U9U A;  2QYU A;  1YX3 A;  4Z6Y A;  3LAP A;  3WTW C;  3ZBU A;  4OOV A;  4DQK A;  3BPX A;  1ZTR A;  3MFK A;  2R7V A;  3W3C A;  5IYD J;  3K4L A;  2WV1 A;  4HDU A;  3GO5 A;  2NT6 A;  3WTY C;  1B72 A;  3KZZ A;  5ED4 A;  4A3B J;  2D74 A;  3OFN A;  1XMX A;  3MKY B;  1BLI A;  3Q6R A;  4CA0 A;  3H9J A;  3H94 A;  4P2N A;  1KCC A;  2A68 F;  2VNK A;  3J81 Z;  1LDK B;  1ZN2 A;  2JVH A;  1OFE A;  3ABU A;  3CCV I;  4MNU A;  2ZL7 A;  1RPW A;  2CRG A;  5D8L B;  1YE9 A;  2INU A;  4M53 A;  3FDY A;  4E7L A;  3FHN A;  3FKS A;  3BH4 A;  1P4X A;  2HZD A;  2EIJ H;  3PSF A;  2VFQ A;  4CCM A;  4PGO A;  3C1D A;  3LSJ A;  1GV5 A;  3HKZ N;  1FOY A;  4CYD A;  5A2Q Z;  4GDF A;  3LOC A;  1UD2 A;  2OK8 A;  1FP1 D;  2A6H F;  3CO6 C;  1GHC A;  3VEP A;  3JQP A;  3HGG A;  1U5T B;  3FXR A;  5IYQ A;  5HOO A;  1VQ8 I;  3GVL A;  1WFX A;  2PBI A;  4NK6 A;  1EA3 A;  2DQL A;  4LLG F;  1N08 A;  2R7O A;  4MTD A;  3I71 A;  2QQ8 A;  3ZN1 A;  2WTE A;  1I6X A;  1T0F A;  4F91 B;  1NG6 A;  1T95 A;  3IWF A;  3WND A;  3TH0 A;  1T98 A;  3HHH A;  2VKH A;  3V8J A;  1GDT A;  3JRC A;  3CD6 B;  4ACB A;  4PC2 A;  3HOT A;  2EZH A;  2XAH A;  1FDR A;  1QFJ A;  5IYC J;  1JJ2 B;  1VQ4 B;  5B6I A;  2Q6I A;  4RD4 A;  1BR4 A;  1AMO A;  5FRM A;  3NWS A;  3U1K A;  4BXF A;  1Z9C A;  5D4S A;  2HXI A;  3KRG A;  4JRA C;  2KDO A;  5HOD A;  3SZE A;  4RCZ A;  5H2F C;  1YHQ I;  2Q0O A;  3DEW A;  3EUH C;  3W2H A;  3K4M A;  2X3U A;  2RDP A;  2PYG A;  4P1W A;  1IRZ A;  3NRV A;  1PP8 F;  2GXG A;  4RAF A;  3AFH A;  2V4D A;  2HVQ A;  5BPI A;  4ZDO A;  3OAA A;  1Z3Y A;  2JJ1 A;  5CVJ A;  2XIG A;  5BQT A;  5C3E J;  2CU7 A;  2I5U A;  4M3D A;  4BY7 J;  4ACA A;  4HDV A;  1EWY A;  1QHH D;  2A5Y B;  5B3S H;  3ZGK A;  3ML6 A;  2JPB A;  4IX7 A;  3CME B;  3OYB A;  1SFK A;  2DI3 A;  4BKX A;  2L7F P;  5EGO A;  4UV9 A;  1WJA A;  5FL7 A;  3ZUG A;  2IQ7 A;  2Z6B D;  5CKT A;  2O0W A;  4NC7 A;  1BW5 A;  3HXL A;  4LD5 A;  5J1U A;  3K0L A;  2OUM A;  1SFE A;  3K4J A;  4Y13 A;  2BM0 A;  1O8M A;  3K70 C;  4YIF A;  4ZTJ A;  1TSP A;  2FNP A;  1WP6 A;  2ESN A;  2RVC A;  1JA0 A;  1YJW B;  3TL4 X;  4HNT A;  2TDX A;  4G7H F;  5IT9 K;  2LDU A;  3HSR A;  3MKW B;  1NB9 A;  1VI0 A;  2PI0 A;  3I4N J;  1YI2 B;  3E3V A;  1R4N B;  4FQG A;  3U21 A;  3QFS A;  1B8I A;  3A03 A;  2NS8 A;  3E6C C;  4A0X A;  3ZPN A;  1BIA A;  4OPS A;  3CCQ B;  3ZPP A;  1JE8 A;  1OCC H;  3J80 K;  1K9M D;  3UKG A;  2DK5 A;  1KC8 D;  4E70 A;  2IS1 A;  1V0F A;  1U2W A;  2K9N A;  3ZC3 A;  4N3G A;  1OR7 C;  3LL7 A;  3N90 A;  3SJP A;  2PE3 A;  2DTR A;  5JLW A;  2QKM B;  3GFL A;  3CCM I;  1OFD A;  1RET A;  3L2Q A;  2HDC A;  1D8K A;  3E5Q A;  1FX0 A;  4UUV A;  3F8F A;  3I0T A;  3I54 A;  5DM7 F;  4I2O A;  4W8R A;  2FF4 A;  1JKO C;  2HPM A;  3W2I A;  1CGP A;  3EUH A;  2VOO A;  1VQ4 I;  4GYG A;  1R6R A;  3HRM A;  3DPT A;  1IRF A;  3SJM A;  2QBY B;  1WI9 A;  2IS6 A;  2DT7 B;  2H1L A;  2OJE D;  1PUE E;  3V7R A;  4RM2 A;  2H6C A;  3O2P E;  3L2C A;  2BPO A;  3GQ7 A;  3ZQF A;  1MMS A;  4DBR A;  1R36 A;  2L4M A;  4S05 A;  5TJJ A;  1YLF A;  3JUR A;  2A6T A;  4PJN A;  2JUG A;  4A3K J;  3WBJ A;  1EA0 A;  1XTA A;  2GK7 A;  2DK8 A;  1RR7 A;  3WNC A;  3S93 A;  3PEN A;  2IEK A;  2DYS H;  1KQ8 A;  3FMS A;  3K7A J;  4CYC B;  1IUY A;  4G1B A;  2BVM A;  3GTL J;  4CIC A;  4MYU A;  5KSW B;  4W8Q A;  2F5E A;  5CLS A;  2RKH A;  5EG0 A;  4PAB A;  1IN4 A;  3LMW A;  2YUS A;  5K7H A;  2WC2 A;  3GW2 A;  4W97 A;  2V31 A;  4U88 A;  2VKV A;  1BX1 A;  4KUM A;  1TYV A;  2JDI A;  3Q9S A;  2CGP A;  4KMF A;  2LY9 A;  2E19 A;  4WXD A;  5JI6 A;  4YHB A;  2E5N A;  2LD5 A;  3U9G A;  2XAJ A;  1JUS A;  3CLO A;  1ZQ3 P;  3GQB A;  2VE9 A;  1GUU A;  2Z16 A;  3IUO A;  2LR8 A;  3BZK A;  4OPV A;  1APL C;  2JJ2 A;  1VQ5 B;  1UD6 A;  3CC4 I;  4D5C A;  4A3L J;  1T6X A;  2NST A;  3I4P A;  1R5N A;  1J59 A;  4LJZ F;  5E20 A;  2WPD A;  3SEJ A;  1X1C A;  3ZRG A;  4A2U A;  1Z6R A;  2VUM J;  1ZAR A;  3W2G A;  2F1M A;  3OSF A;  1K83 J;  3G1L A;  2VBM A;  2QEN A;  4RD3 A;  2Q1Z B;  1BN8 A;  4G94 A;  2R7Z J;  4ESB A;  1LE8 B;  2BE5 F;  1F60 A;  2DAO A;  2LH9 A;  3CUQ A;  4D7M A;  3T51 B;  4AIJ A;  3HG9 A;  1SVL A;  3VFZ A;  5BNG A;  1JNY A;  1Z77 A;  2X6W A;  2XV4 S;  4OZY A;  1PJ7 A;  4CCL A;  3OEE A;  4DIQ A;  2DA1 A;  1QUF A;  1TLH B;  3ZQI A;  3RZO J;  4HE6 A;  1FNM A;  3BTI A;  5D5U B;  2VBT A;  2OZU A;  2VLA A;  4A93 J;  4WXC A;  4DNC A;  5IP6 A;  4E7H A;  1BC8 C;  1J9Z A;  5DSZ A;  4RAY A;  3IH2 A;  4XBF A;  2HQR A;  3QRF F;  3AVX A;  1QVF B;  3FM3 A;  3CC7 I;  1VQ9 B;  1EH8 A;  1KD1 D;  2QSG X;  2F5F A;  4RAZ A;  1QGA A;  4NQW A;  1GAW A;  2E36 A;  1TC3 C;  2W1O A;  3EQL F;  3PNT A;  1HKT A;  5FO5 A;  3DWL E;  3S17 J;  3VWB A;  2A07 F;  1TWC J;  4BQN A;  4HRI A;  2ZME B;  2FRH A;  2STT A;  5E8I A;  2CF4 A;  2JN6 A;  3F8B A;  1HDP A;  2QQ9 A;  1HG8 A;  3C2G A;  4M72 A;  4U87 A;  2D45 A;  3I9V 2;  3FXU A;  1Y39 A;  2XGX A;  1FYK A;  2PN6 A;  4C2M J;  4NBQ A;  2JRT A;  3P27 A;  2BXY A;  4G7W A;  2MG4 A;  2EQR A;  3JTG A;  4TN1 A;  3BPV A;  2DW4 A;  1IUF A;  2ZBK A;  2BW3 A;  4MO7 A;  4P9F A;  4OWR B;  2MD0 A;  1X1P A;  3GTP J;  3GZ6 A;  1VTN C;  2WAE A;  1ORK A;  2EFP A;  1W34 A;  4L8J A;  2VT3 A;  1A6I A;  4KKT A;  3BOQ A;  4R71 A;  2XDV A;  1YJN I;  1CNF A;  2X6O A;  5DCM B;  3FJO A;  2PMD A;  2OU2 A;  2K86 A;  5ICG A;  2B7C A;  4ETS A;  2CK3 A;  3MVP A;  4G6D A;  3M7G A;  4GQN A;  4U7D A;  4E7I A;  2DER A;  3AG1 H;  2DEU A;  2CQN A;  3FIS A;  1BR2 A;  2O61 A;  1TQI A;  1QGY A;  2HVR A;  4GFB A;  5HNH A;  1ZGJ A;  2Y31 A;  3VST A;  4HQM A;  5IYN A;  3VR6 A;  2KRC A;  3S8P A;  2CJJ A;  5DDG A;  4TMT A;  4BGD A;  3VYU B;  2ELH A;  1ZGW A;  4A3D J;  4MHG A;  4IQ4 A;  4A12 A;  2ISZ A;  4IHV A;  1EJ9 A;  3ZZU A;  4XLA A;  3G6E I;  2EIN H;  4ZCI A;  3ASR A;  5BSX A;  2DMQ A;  1IW7 F;  1R5G A;  2JA7 J;  2RRE A;  1B72 B;  4QVA A;  1BM9 A;  2KJB A;  3OWT A;  3DBR B;  1J09 A;  2G9W A;  3CCR B;  4CCO A;  4UUT A;  3ZCO A;  2VKD A;  3H0G J;  2CFX A;  5M3F J;  2Q6K A;  1I7P A;  1K28 D;  3R60 A;  2BY2 A;  2HXO A;  4EAT A;  2DDA A;  3E6B A;  2QA4 B;  1GXP A;  2DOE A;  4P96 A;  1QUE A;  1WVR A;  4WXH A;  5HS8 A;  4DQ2 A;  4X7D A;  2K9L A;  2HOE A;  4WF2 A;  4HX4 A;  4ENJ A;  4ZGN B;  4CZZ A;  3OYI A;  1TW2 A;  4MFD A;  2ESH A;  3GLX A;  2AS5 F;  3BY1 A;  1EFR A;  3SHF A;  1VBL A;  1SFX A;  5FD5 A;  3JRB A;  2Z9O A;  5THX A;  5L3C A;  2QGG A;  4B3F X;  3AGP A;  1RR8 C;  4AVP A;  2PG4 A;  1HBX G;  1J75 A;  3VSK A;  4I0B A;  4F7D A;  2FUG 2;  4U7B A;  4AYB A;  2O6G E;  3IKV A;  4HG2 A;  4AWX B;  2JMW A;  2E2J J;  4ZGQ B;  2GRE A;  1JUP A;  1X2M A;  2X1D A;  2Q8K A;  2W57 A;  4D7N A;  3D26 A;  2Y75 A;  2EFN A;  4XKB A;  1ZRF A;  3HOX J;  3ZMV A;  1LQ1 A;  2H1K A;  1SVM A;  5CQE A;  4S0H B;  1O7L A;  2WR8 A;  3ZN0 A;  1KRH A;  3ZQ7 A;  1HA8 A;  1OCZ H;  2DOA A;  2N8G A;  2TCT A;  2G7H A;  2KIS A;  4EJO A;  3EYI A;  1O8F A;  1D1A A;  3ML3 A;  3JX8 A;  2PJR B;  4P5O A;  3PET A;  3ELK A;  1P4M A;  5GPA A;  4RD2 A;  2XPW A;  3PUB A;  2VFN A;  3BR5 A;  3JRH A;  3ONQ A;  2HKO A;  3NWT A;  2XAS A;  2DFF A;  5M5Y J;  3JR9 A;  2ZCW A;  4UXN A;  4YAU A;  3B4N A;  3LJY A;  4TMX A;  4BHP A;  5DS9 A;  3LNN A;  3CCQ I;  3GME A;  4CXF A;  2R6H A;  3V7S A;  1S72 I;  1KTW A;  1FMV A;  3MHP A;  5JHF A;  2GIZ A;  4RLF A;  2QY1 A;  4AF6 A;  1YO5 C;  1B23 P;  2LBF A;  2A05 A;  1DDN A;  2I8D A;  3LST A;  4YXW A;  2HR3 A;  2DY1 A;  3QQA A;  2FJ1 A;  1MDM B;  3VSU A;  2EFW A;  3I59 A;  1YJW I;  3GFJ A;  1X2N A;  3SEZ A;  4CCJ A;  1NJI D;  1WMR A;  4I0A A;  1OGJ A;  1O8L A;  3GYH X;  4E4H A;  4XRF A;  5HZB A;  3FHZ A;  1MBF A;  1WJ5 A;  4GCV A;  3TO9 A;  4LOC A;  1HVX A;  1OJL A;  1FT9 A;  3HIF A;  2XGC A;  1FJL A;  4RDJ A;  4AM3 A;  4X0C A;  3A01 B;  4BQQ A;  4AC0 A;  2L0K A;  1R4M B;  2MA3 A;  4KFC A;  1OOC A;  2HWV A;  4RM3 A;  3LFK A;  4DW6 A;  3E97 A;  5KVR A;  1LE8 A;  1ELO A;  2Y30 A;  3CME I;  4Z05 A;  1MGT A;  3K1P A;  3F8M A;  1D8T A;  1U9O A;  1QHG A;  1D2E A;  1NBM A;  2DYI A;  5EJC A;  1KU7 A;  4A6D A;  3HOW J;  1HW1 A;  3I55 I;  2QQB A;  1VF9 A;  2JJ7 A;  2X48 A;  4LGW A;  3TGN A;  3CRZ A;  2W84 A;  5F4J A;  2Z8G A;  2XF7 A;  2CWE A;  2WBM A;  3OOU A;  3LSI A;  1MMD A;  3OKX A;  5F1J A;  1ZLJ A;  5F08 A;  1REP C;  2YR2 A;  4LLL A;  1PJR A;  5JR3 A;  1YFH A;  1NK2 P;  4X06 A;  4D0P A;  3H9G A;  1Z67 A;  3ABM H;  5LLQ A;  3OYF A;  1I6H J;  4YAF A;  3CCY A;  1TWA J;  3FK7 A;  2LKP A;  2L02 A;  5HXB A;  2DXI A;  2EIM H;  4G7X A;  2BHZ A;  3PA2 A;  2ZME A;  4O6J A;  1A5J A;  1N78 A;  2HOT A;  1R1V A;  2DFH A;  4UV8 A;  4EJT A;  1E3P A;  3EDP A;  1JJ6 C;  2KP6 A;  2DMU A;  2PQ8 A;  2STW A;  1SAX A;  1JT6 A;  4JP0 A;  3VOE A;  1IB4 A;  3BRO A;  2AQE A;  3DDY A;  1XDU A;  1E62 A;  3DV8 A;  3I55 B;  2VBX A;  5LGN A;  4J0Q A;  4EM0 B;  3CPW B;  1T56 A;  2WWY A;  2DYR H;  2VAS A;  4HF0 A;  1X1B A;  4EJV A;  4RBO A;  3MEX A;  4JOM A;  3K70 D;  2ZSI B;  5HVQ C;  2CFO A;  3S3O A;  3ISX A;  4YCQ A;  3IV5 A;  1H85 A;  4NC6 A;  3E1S A;  3QFC A;  3ZPL A;  4P9S A;  1HC8 A;  3WE3 A;  2W6J A;  3SJZ A;  2IPQ X;  4AIH A;  1U8R A;  4WZE A;  1S7A A;  2HS5 A;  2M87 A;  2WAQ A;  1HW2 A;  3GTQ J;  4YZQ A;  1T0F C;  2DA4 A;  2O03 A;  3SY2 A;  2DMN A;  5EEH A;  4L5J A;  3CCV B;  1TLL A;  1YQA A;  3FY3 A;  3SDG A;  3CUO A;  3QFT A;  2VT2 A;  3R6S A;  4G7Z F;  1ULY A;  3IH4 A;  1UD4 A;  3UW0 A;  3FMR A;  1K4Z A;  1QCX A;  1UHS A;  4M74 A;  1E3O C;  1DUX C;  1LDJ A;  2EA2 A;  2Q6O A;  3H1C A;  2IJL A;  1AOY A;  2ELJ A;  1I3A A;  3P7N A;  3RCO A;  1JTX A;  1VFC A;  5M5X J;  3QFR A;  3W5H A;  4X0G A;  2WSS A;  1ONV A;  1TW3 A;  5E3N A;  2IBD A;  3CQZ J;  1K6Y A;  4B44 A;  5IP7 J;  4UB6 C;  1XG2 A;  2QQA A;  2UV1 A;  5KAF C;  2BM4 A;  3FPP A;  4F92 B;  3K4K A;  3PUN A;  4Y3O A;  1RMG A;  1X58 A;  4RGS A;  2EWN A;  2LK2 A;  1B6A A;  2INV A;  2MD5 A;  4G6T B;  5E6T A;  1MRZ A;  5CPR B;  1G7R A;  1ENH A;  1S9H A;  2QVO A;  5DTD A;  4G5G A;  4Z06 A;  4XK4 A;  3RTR A;  3ECO A;  3L2W A;  3DBH B;  4OJO A;  2UVE A;  1NHA A;  2OV7 A;  3T1B A;  2BY3 A;  2HOS A;  5FRN A;  2GBY A;  2XGE A;  4ASU A;  3GZN B;  3I58 A;  4Z4W A;  2B9S A;  4BAY A;  3CP8 A;  3L2V A;  1FNN A;  5ICF A;  4WQM A;  2XNC A;  2NXN B;  5DUK A;  3EQO A;  1RI7 A;  4FE7 A;  3ES9 A;  3GCM A;  1YG2 A;  4WZK A;  3S16 J;  5HDK A;  3T9G A;  3D5S C;  2MGQ A;  1BL0 A;  3J7Z I;  4HLX A;  4ZDL A;  4G7O F;  1SD6 A;  4P55 A;  2DIE A;  4HLY A;  2NT9 A;  3ZQL A;  3T5X A;  1H0M A;  1V54 H;  4H0E A;  4RGR A;  4E6K G;  2CYY A;  2MC4 A;  3BZ6 A;  4BU2 A;  3S3M A;  2MH2 A;  2QKL B;  4OOI A;  2ZIT A;  4RD0 A;  4TMZ A;  4YAO A;  1BIB A;  1WOS A;  2FEZ A;  5DD8 A;  3CB4 A;  3CJT B;  3TDU C;  4OP7 A;  4G12 A;  1ACI A;  2C4T A;  1P7J A;  3JSP A;  2V7U A;  2D5V A;  3F8N A;  1O8E A;  4N0B A;  2O17 A;  4RMN A;  3QYE A;  1VQ7 I;  1QGZ A;  2EJR A;  2M8E A;  3OIQ A;  4FE4 A;  4PFO A;  1YW7 A;  4M6X A;  3I56 I;  5TY0 A;  3BC8 A;  3H3V K;  3CCS I;  3KIO A;  4CCN A;  2OA4 A;  2FVG A;  4MFE A;  2QN6 A;  2VJ5 A;  3K4C A;  2VOD A;  2ZL6 A;  2BM5 A;  4PJJ A;  3ASQ A;  2R7R A;  4NC8 A;  1S5L C;  2M0M A;  1PLU A;  1QG0 A;  1X3Z B;  3GWZ A;  1QA2 A;  2RNG A;  2DOD A;  5DCM A;  4B43 A;  2VFO A;  3M1C A;  4PK4 A;  2P5L C;  3IWZ A;  2M1B A;  4O3M A;  1DGR M;  2ZXJ A;  1B8I B;  3MZ8 A;  1FOX A;  1JKR C;  4OM9 A;  2PEX A;  4XOR A;  2OK7 A;  2DMT A;  1W5C C;  2FBI A;  2O7O A;  2F4M B;  2F5V A;  1QH0 A;  1N0U A;  3KP5 A;  2OCC H;  1MZB A;  3CJN A;  3OW2 B;  1OB2 A;  4B8X A;  4RLQ A;  4A0Z A;  1H89 C;  1IRG A;  2J8K A;  3S1Q J;  3LO8 A;  3PVD A;  1WGX A;  2DN0 A;  2K3P A;  3GBG A;  4JX6 A;  2R3S A;  2PMH A;  3U1D A;  2C77 A;  1TNS A;  3JU4 A;  4RPB A;  5IY5 H;  3DTK A;  3G3Z A;  2QCO A;  2F4I A;  3G4S I;  5JVG F;  1XB4 A;  2XAG A;  1LVA A;  5A2Q K;  1ETO A;  2Y69 H;  1SFU A;  3J7A Y;  3ASP A;  3ESW B;  3KLO A;  5CVU A;  1Y8Q B;  5HLT A;  2WZP P;  4WWV A;  3KEQ A;  1D0Z A;  4DGW B;  5K5Q A;  2VOP A;  4IVN A;  4C3H J;  5BS6 A;  1S0U A;  1EFC A;  2Y9Y A;  1WSR A;  3CCL B;  5FB2 A;  3E5U A;  2FXA A;  1SAN A;  1IRX A;  3LMM A;  2EFO A;  4BL0 B;  4DNR B;  3GUD A;  3E20 A;  1U3E M;  1G2H A;  2VC0 A;  4PMH A;  1K7A A;  2ZFU A;  3WOD F;  3PIO F;  2DMP A;  4YZX A;  2BV6 A;  1IDJ A;  1TWH J;  3CC7 B;  3GIR A;  4OMZ A;  3CF2 A;  1VQ6 I;  3HSE A;  2IGM A;  2X8K A;  3GVA A;  2DPU A;  2VBV A;  1P6R A;  1Z05 A;  5FA6 A;  2F48 A;  4HNU A;  4V2F A;  3DKW A;  2E60 A;  2ADU A;  2L9R A;  5FKK A;  1DBG A;  1W1W E;  4A6E A;  3SYT A;  1A36 A;  2L2O A;  2JZY A;  2O8X A;  2X51 A;  1VQO I;  5FLM J;  2OQR A;  2BYV E;  4X05 A;  5EZH A;  4C2L A;  1AKH B;  5AN9 A;  1RZ4 A;  1V5G A;  4NNJ A;  2X3H A;  3TW6 A;  2DLL A;  2DPD A;  4RS8 A;  4A3C J;  2P0W A;  3RKQ A;  4LMY A;  4OIR F;  1SKY B;  4HIZ A;  4XR6 A;  3HL2 A;  3IRR A;  1J5Y A;  3VOD A;  1WQ2 A;  5JVT A;  2NTP A;  3MD2 A;  1R22 A;  4BEH A;  1TTY A;  3E0J B;  4EM2 A;  2HYG D;  3BR1 A;  3WTT C;  3PL8 A;  3Q39 A;  4YEJ A;  1D1N A;  2ELK A;  2IT0 A;  3I1F A;  3AVY A;  5L3G A;  3CC4 B;  1HW5 A;  2X9D A;  2HDN B;  4P3I A;  3K4B A;  2PMZ A;  2QEX B;  1VLY A;  4NQW B;  4BDZ A;  3BY2 A;  3BZC A;  1GV2 A;  4GYI A;  5AIP A;  5K1Y A;  1MJB A;  1OYI A;  5F0C A;  2EZI A;  5F04 A;  4Z2Y A;  1HDD C;  2XC7 A;  1ZRC A;  3OR2 C;  1S72 B;  2UXN A;  2DA7 A;  4UHT A;  1H80 A;  4LBY A;  1Q86 D;  2IGN A;  1B4A A;  1QZY A;  2CV2 A;  3B6C A;  3FKI J;  4JX5 A;  1MIJ A;  1LUJ B;  3DPL C;  1VND A;  3GVJ A;  2P4W A;  4QTR A;  4II2 A;  4RD6 A;  5J4Y A;  3CTA A;  3T53 B;  2ZZG A;  5LRS A;  1J7K A;  2GOM A;  3FXM A;  2QSH X;  4KIG A;  2M4G A;  1J2X A;  2OYN A;  1Z7U A;  4UZE A;  4HPQ A;  3SYJ A;  1G6N A;  1KYW A;  3F22 A;  2M7B A;  1GAQ A;  1OHH A;  1RQP A;  3GFM A;  2HCJ B;  1SMT A;  3SZP A;  3JQQ A;  3CUQ C;  3FX3 A;  2HTS A;  1GVH A;  3GTO J;  3PNY A;  3ISP A;  1R5H A;  5LHI A;  4II3 A;  3CC2 I;  3PJR A;  2BF4 A;  1QZZ A;  4L9V A;  3BTJ A;  4BJT A;  2KZV A;  3GTM J;  3N97 A;  1MMA A;  2H8W A;  2LRE A;  2WB1 A;  4IRH A;  1E79 A;  4WWC A;  2V9P A;  4MQV A;  3K4N A;  2GA1 A;  1QA6 A;  2DA6 A;  2B7B A;  2JT1 A;  2FX3 A;  4HEA 2;  5FKL A;  1W87 A;  1LFP A;  1V5F A;  2OC6 A;  4K2E A;  3HOV J;  2XSD C;  1IJF A;  1V0E A;  4FK8 A;  3NAW A;  1XG1 A;  2GJR A;  2JVG A;  4XLC A;  4RPD A;  2ZL5 A;  1TBX A;  3FM5 A;  3L2U A;  3D1N I;  1Q9S A;  2Y48 A;  4UUS B;  5JLX A;  3V76 A;  2BM7 A;  4YAW A;  1V55 H;  4OAZ A;  1I27 A;  3S3N A;  4YC5 A;  1WJD A;  1UJ8 A;  3B02 A;  3OP1 A;  2XZP A;  2O3F A;  3VMW A;  2P3M A;  4Q4Z F;  3RPU A;  3ZZT A;  2XTW A;  1HQC A;  2ZNY A;  2BGC A;  3HRS A;  4A0Y A;  2GM4 A;  2HGC A;  4I01 A;  3GRH A;  1YI2 I;  1R49 A;  1ETX A;  5E3M A;  4QV2 A;  2DJN A;  4JMQ A;  1RU4 A;  5AMV A;  1WHU A;  1UHM A;  3CMA I;  3COA C;  2E7W A;  3LA2 A;  5B1B H;  3KLN A;  1ETY A;  3JRD A;  1UMK A;  3VB2 A;  4M2L A;  2ID3 A;  2XOK A;  4RDU A;  4G6I A;  4P6V F;  2X1C A;  1P2F A;  3QPT A;  5HZA A;  1FTZ A;  3WG9 A;  3B90 A;  4IO9 F;  1I18 A;  2XVC A;  1P92 A;  5KCM A;  2MLG A;  1YS6 A;  3O8H A;  1IN5 A;  3CJR B;  1ZR4 A;  2L7Z A;  2HMA A;  2R5Y A;  1X4O A;  3ERM A;  2QF7 A;  1BI3 A;  4RB3 C;  1EP2 B;  1GO2 A;  1FX7 A;  2I10 A;  1XN7 A;  4AUX A;  5JLV C;  1W0K A;  1W2B B;  3GSI A;  2RN7 A;  4BUP A;  3JQR A;  3HJE A;  1B2R A;  2QLZ A;  3ONY A;  2MH9 A;  3TMO A;  1W7P B;  2P8T A;  2R92 J;  4OIO F;  4Q48 A;  4AVZ A;  3MMP A;  1K61 A;  2V7X A;  2D1V A;  2XHK A;  1S8N A;  1F20 A;  2DFE A;  1HF2 A;  2KRF A;  4ESF A;  1DBO A;  1LEB A;  2DO7 A;  1ZM9 A;  2K9M A;  3FIW A;  1A8P A;  3B8H A;  5E1X A;  1LEA A;  2ZB9 A;  3ZSC A;  2ZO4 A;  2XB0 X;  3S2D J;  2E2I J;  2LG4 A;  1KZH A;  2JA8 J;  5DV5 A;  2IA2 A;  2D9R A;  4DJA A;  1IC8 A;  4U49 A;  3WGH A;  2ODL A;  2V1D A;  5A89 A;  2IAI A;  2K85 A;  3CCL I;  1KA8 A;  4DNT B;  4ENM A;  4UB8 C;  1O3Q A;  2FOK A;  3G1M A;  1RUN A;  1Y0N A;  2F6C A;  4M3F A;  2R0Q C;  4M3G A;  5FKO A;  2EZL A;  1IJE A;  2XKO A;  3RPQ A;  3N6Z A;  4ZJZ A;  4XM3 A;  1GVD A;  4KYW A;  3JAM Z;  4WZT A;  1K73 D;  1VF7 A;  2LBF B;  3M9A A;  2WAQ N;  4YEI A;  1VQ9 I;  4RJL A;  1QRC A;  3DF8 A;  2Y9Z A;  3K1N A;  4LG0 B;  2LKS A;  2WB1 N;  2ZXH A;  4UAJ A;  1O8G A;  4I02 A;  1FEX A;  3BJO A;  3OOP A;  1S3J A;  4PZJ A;  4AID A;  3WYA A;  5TGT A;  1FY7 A;  3BWG A;  2QTZ A;  2NS0 A;  2Y0M A;  1MJA A;  2VBZ A;  2VIX A;  4LG3 A;  2LLK A;  2QUF A;  2VQC A;  1NG7 A;  2RC4 A;  4RB0 A;  2LSO A;  2YWH A;  2IW5 A;  3OYH A;  3B82 A;  1TYX A;  2NTQ A;  2ECC A;  3IC7 A;  2R7X A;  1I39 A;  1CF7 A;  1RUO A;  3CMA B;  4M3E A;  3WU1 B;  3F21 A;  2BVN A;  3QSY A;  4X8I A;  4OJ5 A;  1XE1 A;  1M1K D;  2UUZ A;  1OCT C;  3OYC A;  2FX0 A;  1HST A;  1JTY A;  3F3X A;  3UNG C;  3RKY A;  1FRQ A;  2X0L A;  5LRR A;  3G05 A;  2KIU A;  1N25 A;  3ECH A;  4G6Q A;  2O6W A;  5BOX A;  1O88 A;  2V9V A;  3K2A A;  3WBK A;  3HEF A;  3CMM A;  1O7F A;  3TOB A;  1KMH A;  1QNT A;  4XD7 A;  4D1Q A;  4JK1 X;  3ZR8 X;  1UD3 A;  1ZR2 A;  3FXJ A;  2VNI A;  3CCS B;  3FK6 A;  4C9Y A;  1B9M A;  3M8J A;  1HLV A;  2VQL A;  1UST A;  3K69 A;  5TIS C;  1H9G A;  4Z4U A;  1OMI A;  2NRA C;  3BG9 A;  1DU6 A;  3OJW A;  4HBL A;  4HZF A;  1LJ9 A;  5IYB J;  1L3L A;  4XON A;  3HOZ J;  3JSO A;  2D2W A;  2PMZ N;  1XGS A;  4BQA A;  3U2R A;  4RB2 C;  3E7L A;  3HRT A;  1ZRE A;  5F27 A;  1WDT A;  1AA7 A;  3T8R A;  4BYY A;  2HYJ A;  1MMN A;  3PQJ A;  4DK0 A;  3B8Y A;  2CW7 A;  4GRI A;  2NVQ J;  1LB2 A;  1WOR A;  3BCF A;  1TQM A;  1G7T A;  4IJA A;  2BM1 A;  5LGU A;  5CYV A;  1FBU A;  1YOV B;  2MLK A;  3R0J A;  4PDK A;  3KYL A;  2GLO A;  2DTZ A;  4IW3 B;  3H5N A;  3OYE A;  3E6D A;  1QFZ A;  3F9K A;  3HBL A;  5L3D A;  3QYB A;  4UVA A;  2K3F A;  5M3M J;  3VMF A;  1O3R A;  5HLI A;  1FIA A;  3ULQ B;  1N77 A;  1VHO A;  5TR9 A;  3LA3 A;  1T6S A;  3WGI A;  1EZG A;  1ODD A;  2NAZ A;  2BSA A;  4F93 B;  3GQA A;  2W82 A;  4NB5 A;  3RYR A;  1JA1 A;  2WJV A;  1TP4 A;  3LYC A;  1ZYR F;  1GXQ A;  1ZAO A;  3R61 A;  5K7Z A;  1I1G A;  3PSI A;  3S14 J;  2EB7 A;  2R7D A;  2UXX A;  2VQH A;  4KIC A;  4LB5 A;  3FWE A;  1K78 B;  1IXS B;  3QPS A;  3DLA A;  4EVI A;  1SAU A;  3LSP A;  4EGY A;  1XQB A;  1S29 A;  3EPZ A;  2CV0 A;  3A3G A;  1RWR A;  1PYV A;  3PO3 J;  3OE7 A;  2P7V B;  2X0K A;  4TKO B;  3CCM B;  4ZZD A;  3BR0 A;  1ZM2 A;  1F43 A;  1NB0 A;  3CDL A;  1IDY A;  3IAS 2;  3QP6 A;  2HI3 A;  4AF7 A;  2EBI A;  4MEX F;  1L0O C;  1UFM A;  2HDD A;  1CZF A;  1E3H A;  2XSJ C;  1WSV A;  3PUM A;  2XKP A;  1BW6 A;  3DXJ F;  1FIP A;  3C3W A;  1X1A A;  2CUZ A;  1IB0 A;  3KX2 A;  4WCG A;  1ZG1 A;  3BLY A;  2KKO A;  1VLO A;  1UB9 A;  5FFZ A;  1PDN C;  3LQ6 A;  3QAH A;  1R23 A;  1YJN B;  2L5Q A;  1FLI A;  3IKT A;  2OBP A;  1OKR A;  5B66 C;  2Q6L A;  3ZMT A;  1B9N A;  2XND A;  1DP7 P;  3AK5 A;  1ETW A;  3W2A A;  1ON1 A;  2XGD A;  3P5J A;  4LIT A;  4XN0 A;  5LFA A;  1TQP A;  2W7N A;  2X85 A;  1D5Y A;  2R7U A;  4XLE A;  2CQX A;  2V7F A;  3HPG A;  4HAM A;  2DDB A;  3W2V A;  1ZK8 A;  1I8D A;  1CNE A;  2VYQ A;  2QYO A;  2BY1 A;  2XZO A;  4OJL A;  1FWZ A;  2OPT A;  1QFY A;  2W6I A;  4XSX F;  3AKZ A;  2CO5 A;  1ZH5 A;  1IGN A;  3SLN A;  5K5O A;  5EZG A;  4ESJ A;  4P22 A;  3CUQ B;  2BXZ A;  2XEX A;  2AQF A;  2OD5 A;  1R00 A;  2A6E F;  4PSX A;  3RKW A;  2VI6 A;  1ZLK A;  4G1V A;  2NNY A;  4GO1 A;  3Q0V A;  1ZEL A;  3BQZ A;  2JSP A;  4RGU A;  5GAG J;  2E1B A;  4P1V A;  5IPA A;  1RIO H;  1HKS A;  4Y15 A;  4BQO A;  1W7P A;  5LEJ A;  1QJV A;  2NVU B;  3H9Q A;  1DU0 A;  1TUI A;  1FYM A;  2DT6 A;  4JBA A;  1PUF B;  5JBQ A;  4HV6 A;  1SD5 A;  4LBZ A;  2DA5 A;  1SM4 A; 
#chains in the Genus database with same CATH homology
 1NHC A;  1QU3 A;  3K4L A;  5CPR B;  4EW9 A;  2NT6 A;  1S9H A;  2HPI A;  2L9N A;  3OFN A;  3MKY B;  3RTR A;  1BLI A;  4Z06 A;  3L2W A;  4CA0 A;  3H9J A;  3H94 A;  1KCC A;  4OJO A;  1LDK B;  2JVH A;  2UVE A;  3FKJ A;  2OV7 A;  2R7T A;  5FRN A;  4ASU A;  1ERD A;  2INU A;  1YE9 A;  3T56 B;  1WJE A;  3FDY A;  4E7L A;  2CW8 A;  4C30 A;  2KRH A;  3CP8 A;  3FHN A;  3L2V A;  3FKS A;  1MW7 A;  2NOJ B;  3BH4 A;  2HZD A;  3PSF A;  4DBQ A;  1HZE A;  2M7A A;  4CCM A;  2IS2 A;  3EQO A;  1UD2 A;  2XGJ A;  4XN3 A;  2WY8 Q;  1YX5 A;  3VYR B;  2O1D A;  3T9G A;  3D5S C;  5HOO A;  1OFL A;  4ZDL A;  3L2R A;  3GVL A;  2NT9 A;  1WFX A;  2DIE A;  4NK6 A;  1EA3 A;  2BOL A;  2R7O A;  3BG6 A;  4Z03 A;  4F91 B;  2HDW A;  4E6K G;  1H8E A;  1NG6 A;  1T95 A;  2R7Q A;  2WJY A;  2MC4 A;  4BU2 A;  3S3M A;  2INV A;  2QKL B;  2F43 A;  2VKH A;  3KEY A;  4XNF A;  3A2K A;  1DGW Y;  1WJC A;  2Z2S B;  3HOT A;  1JRG A;  3I3L A;  4OJ6 A;  1IA5 A;  1O8E A;  1BR4 A;  1WJF A;  2O17 A;  4XL9 A;  5FRM A;  3NWS A;  1P9Q C;  3QYE A;  4RMN A;  2DCE A;  3OIQ A;  4PFO A;  4BXF A;  3KRG A;  2KDO A;  2XAU A;  4XKC A;  3BC8 A;  3EUH C;  3OYA A;  5HNF A;  3K4M A;  4CCN A;  2PYG A;  2VJ5 A;  3K4C A;  4P1W A;  4PJJ A;  3HAG A;  1UG0 A;  3DU5 A;  3VYS B;  3CP2 A;  3AFH A;  2R7R A;  4NC8 A;  2V4D A;  2HVQ A;  2M0M A;  4ZDO A;  3OAA A;  1Z3Y A;  2JJ1 A;  1PLU A;  2NZM A;  2RNG A;  4PUS A;  4B43 A;  3M1C A;  4PK4 A;  2WY7 Q;  3QOE A;  1QHH D;  4MLO A;  4ZDP A;  3ZGK A;  4FXU A;  3MKZ A;  4IX7 A;  1DGR M;  4J00 A;  3DU6 A;  3OYB A;  1SFK A;  1D1B A;  2VXD A;  4JQF A;  4XOR A;  1WJA A;  5FRO A;  4BJ5 C;  1COW A;  1WTH D;  5FL7 A;  2IQ7 A;  4KKS A;  2Z6B D;  3K10 A;  3HUG B;  5CKT A;  2F5V A;  4NC7 A;  2O0W A;  3HXL A;  2OUM A;  3K4J A;  1O8M A;  4HSR A;  2ZZF A;  3K70 C;  4RLQ A;  4ZTJ A;  1WP6 A;  2K3P A;  3GBG A;  3TL4 X;  2VL8 A;  4HNT A;  3JU4 A;  4MR0 A;  3OIP A;  1Z3X A;  2GJK A;  2UWM A;  3DTK A;  4YEL A;  2V4J C;  2F4I A;  3MKW B;  1UAA A;  2ZZG A;  5CDF A;  2E1M C;  2KVO A;  3J7A Y;  3U21 A;  3OMY A;  3ZPN A;  5HLT A;  1V5E A;  1WJB A;  2WZP P;  2D3N A;  1D0Z A;  4DGW B;  3ZPP A;  3CES A;  3TBI A;  2BVL A;  4D9J A;  3S32 A;  2IS1 A;  1V0F A;  1OR7 C;  3LL7 A;  3OYG A;  1IRX A;  3LMM A;  4H4K C;  4KT6 A;  4BL0 B;  2QKM B;  4DNR B;  3CZ6 A;  3VMV A;  4PMH A;  2HQA A;  3L2Q A;  2ZFU A;  4XMY A;  4URR A;  1FX0 A;  4YZX A;  1BR1 A;  1IDJ A;  2LZJ A;  4HWV A;  4W8R A;  2HPM A;  3CF2 A;  4KIT B;  1R6R A;  2IGM A;  2X8K A;  4B48 A;  4B3X A;  1E1R A;  3DPT A;  3W2A A;  1E0E A;  1W9X A;  2O0V A;  3NE5 B;  3OOC A;  4HNU A;  2DT7 B;  2IS6 A;  3A35 A;  3DKY A;  3BCD A;  2E60 A;  3D5R C;  4RM2 A;  1W36 D;  1DBG A;  1OLT A;  3SYT A;  2R7V A;  3GQ7 A;  4DBR A;  2L2O A;  2X51 A;  3IP4 B;  3C2H A;  3JUR A;  2A6T A;  4PJN A;  2JUG A;  4C2L A;  5IK2 A;  1BMF A;  4ZYA A;  3V42 A;  1V5G A;  1Z7L A;  4NNJ A;  3VSL A;  2GK7 A;  3S93 A;  2X3H A;  1TZL A;  2P0W A;  2KLO A;  4BE1 A;  3HKZ A;  2ZSH B;  1PXZ A;  3OYK A;  1SKY B;  4XR6 A;  4E7J A;  2BVM A;  4HIZ A;  3HL2 A;  4W8Q A;  3EUA A;  4DK1 A;  2NTP A;  3MD2 A;  4BEH A;  3LMW A;  1MMG A;  4I84 A;  3E0J B;  2W4S A;  2V31 A;  1VJS A;  3PL8 A;  2JDI A;  2R4G A;  1O8K A;  4YEJ A;  1MNE A;  2E5N A;  3OYL A;  3GQB A;  3MMY B;  2IGK A;  1T5E A;  3OW7 A;  1K5C A;  3K4B A;  2Z16 A;  2PMZ A;  3H5A A;  3IUO A;  1VLY A;  4NQW B;  2JJ2 A;  4E7S A;  2VBK A;  4BDZ A;  1UD6 A;  4FET A;  2R9V A;  2ZTN A;  3DKX A;  2NST A;  2XC7 A;  3OR2 C;  2WPD A;  1H80 A;  2WAF A;  1OB0 A;  2IGN A;  2W00 A;  1X1C A;  3ZRG A;  3OS1 A;  4BE2 A;  5LD2 C;  4BS9 A;  2CV2 A;  2QE7 A;  3OYM A;  2F1M A;  3DPL C;  1G8X A;  3GVJ A;  3T53 B;  2VBM A;  4II2 A;  1X4P A;  1E1Q A;  4TSF A;  1UD5 A;  4YZ0 A;  1BN8 A;  2GOM A;  2Q1Z B;  4JMQ A;  3SDB A;  2M4G A;  3A3B A;  2ZXI A;  4HPQ A;  2LH9 A;  3T51 B;  2M7B A;  1OHH A;  3HG9 A;  2X6W A;  4OZY A;  2X6Y A;  4CCL A;  3OEE A;  2K5C A;  4DIQ A;  2VPL A;  3PNY A;  3OR1 C;  1X19 A;  4BEH B;  4II3 A;  1PE9 A;  2KHM A;  3PJR A;  1OGO X;  2VLA A;  4BJT A;  4PFP A;  2KZV A;  4PSW A;  4E7H A;  1MMA A;  2LRE A;  2WB1 A;  1AIR A;  2KL4 A;  1E79 A;  3K4N A;  4CH7 A;  3DTI A;  4IZZ A;  1D0Y A;  4HEA 2;  2XF5 A;  1LFP A;  1V5F A;  2OC6 A;  3LFU A;  2W1O A;  1V0E A;  2QXZ A;  3PNT A;  3OL4 A;  1KON A;  3DWL E;  2GJR A;  2JVG A;  3VWB A;  4XLC A;  4BQN A;  4HRI A;  3KEW A;  2A5W A;  3L2U A;  1HG8 A;  2IS4 A;  3C2G A;  4OAZ A;  3H0D A;  4U87 A;  3S3N A;  3I9V 2;  4QPO A;  3RSN A;  1WJD A;  1KCD A;  2XZP A;  3VMW A;  3A1Y A;  1JTA A;  3CJQ B;  4B47 A;  3EQN A;  4G7W A;  3WQZ A;  3GRH A;  3GQ8 A;  4XOT A;  2O5R A;  2JIZ A;  1RU4 A;  4ANJ A;  5AMV A;  2BW3 A;  4FAS D;  2BSP A;  4OWR B;  2MD0 A;  2XOK A;  4G6I A;  2CH0 A;  2X1C A;  2VBE A;  2LYC A;  2HU9 A;  3B90 A;  2WAE A;  1I18 A;  3LSH A;  5KCM A;  4L8J A;  4KKT A;  3SEQ A;  1NRK A;  3DQV C;  2IXS A;  2XF6 A;  2XDV A;  3CJR B;  2X6X A;  1UEL B;  4F52 A;  1X4O A;  4GQN A;  2CK3 A;  4E7I A;  3WWG A;  3OYD A;  4E7Z A;  4Z1M A;  1BR2 A;  4U4B A;  3GQ9 A;  2HVR A;  1D0X A;  1W0K A;  2MYS A;  4BUP A;  5HNH A;  4E0F A;  3VST A;  2HLD A;  3VR6 A;  2KRC A;  3S8P A;  3TMO A;  2VQG A;  4BGD A;  3VDX A;  3VYU B;  4C2T A;  2M5S A;  2IGO A;  4IQ4 A;  4AVZ A;  2VXZ A;  4XLA A;  3D5L A;  3W2W A;  1OGM X;  3BC9 A;  1DBO A;  2MFZ A;  3VSV A;  1W0J A;  2RRE A;  2K9M A;  3OWT A;  1J09 A;  4N4N B;  4CCO A;  3ZSC A;  2BW3 B;  2VKD A;  3ZCO A;  1G59 A;  2LG4 A;  4YRV A;  2CV1 A;  1K28 D;  2LRD A;  2Q2E B;  4CZC A;  1DP3 A;  2PYH A;  1Y56 A;  1O8D A;  4DJA A;  4U49 A;  3ZQQ A;  2ZZE A;  4EAT A;  2ODL A;  4OJP A;  3OS0 A;  2GJP A;  4DNT B;  4F55 A;  3OYJ A;  4XLF A;  2UVF A;  2F6C A;  2V7Q A;  1X1D A;  4QPQ A;  2K9L A;  2X53 S;  3IAM 2;  4ZJZ A;  3OYI A;  4XM3 A;  1EFR A;  2KPM A;  1VF7 A;  1VBL A;  3OL3 A;  3RPU D;  2LBF B;  1VZ0 A;  2VB6 A;  4B3F X;  1IDK A;  2ZXH A;  5HKK A;  1O8G A;  3BG7 A;  2CUJ A;  3VSK A;  2FUG 2;  4U7B A;  4AYB A;  4HG2 A;  5TGT A;  4TT3 A;  1E43 A;  2QX3 A;  2X1D A;  2VIX A;  1TT0 A;  3LSK A;  4LG3 A;  4XKB A;  1H8H A;  2VQC A;  1NG7 A;  2V6E A;  3OYH A;  2NTQ A;  3H35 A;  3DPU A;  3N05 A;  5CQE A;  1JI8 A;  2MAB A;  2R7X A;  3RQ4 A;  4J01 A;  1FMW A;  2KMU A;  3UR3 C;  1HA8 A;  4OJ5 A;  1U0J A;  2DOA A;  4CUG A;  2L9S A;  2UUZ A;  4XLH A;  3OEH A;  2PEC A;  3BCB A;  3OYC A;  4XQF A;  1E3Z A;  3UNG C;  1PKV A;  1O8F A;  3FBN B;  3G05 A;  1D1A A;  3A4C A;  2HVS A;  2PJR B;  1Z21 A;  4P5O A;  1O88 A;  3PUB A;  4R79 A;  3AL0 C;  2VJI A;  3ONQ A;  3CMM A;  3NWT A;  3B4N A;  1KMH A;  1WPC A;  4XD7 A;  4D1Q A;  3ZR8 X;  1UD3 A;  2GK6 A;  3LNN A;  5KNL A;  1E3X A;  4C9Y A;  2JA2 A;  2DJI A;  3LSM A;  3M8J A;  1KTW A;  2VQL A;  2M3A A;  1FMV A;  2V1N A;  4XKV A;  5CQG A;  5JHF A;  4RLF A;  2QY1 A;  1OFM A;  1LKX A;  4UZU A;  2HNH A;  2LBF A;  2Y0S A;  2V26 A;  1GLN A;  2I8D A;  4YXW A;  4KIS A;  4XON A;  3VSU A;  2V9K A;  3AL0 B;  4CCJ A;  3SEZ A;  1O8J A;  1WMR A;  1O8L A;  4E4H A;  1WJ5 A;  4DOZ A;  1HVX A;  2R7S A;  1AA7 A;  4DK0 A;  4E7K A;  1MMN A;  3SZG A;  2M4K A;  2LY1 A;  2Z1D A;  4F3Q A;  3B8Y A;  2NSP A;  2CW7 A;  4GRI A;  4BQQ A;  4BJ6 C;  1MND A;  1OOC A;  4RM3 A;  4OZZ A;  3BCF A;  4XOP A;  4BE0 A;  4W8T A;  1BOB A;  4BDY A;  3KYL A;  2KQR A;  3H5N A;  3OYE A;  2LC2 A;  3F9K A;  1QHG A;  1NBM A;  3OPO A;  2ZTG A;  4Y33 A;  3LSG A;  4ZC3 A;  3QYB A;  2PJR A;  2Z8G A;  4IKF A;  2VJ4 A;  5C1E A;  2XF7 A;  1N77 A;  3H5R A;  4PJM A;  2WBM A;  3OOU A;  3LSI A;  1MMD A;  1X0C A;  4LIU A;  1D1C A;  1PJR A;  2E5Z A;  4F93 B;  2EWE A;  2W82 A;  3GQA A;  2LY2 A;  2WJV A;  4BAC A;  3H9G A;  3BCA A;  3ZIA A;  4MXN A;  3G2B A;  2E1M B;  3OYF A;  2LOO A;  4Y4R A;  3PSI A;  4ZTF A;  4HST A;  3ZXS A;  4Z05 A;  2VQH A;  3HPH A;  3HC7 A;  1GQ8 A;  3DLA A;  3A3G A;  1SAU A;  1RWR A;  2DXI A;  2GOX B;  3EPZ A;  2CS3 A;  2CV0 A;  1PYV A;  3PFY A;  1BPL A;  1UD8 A;  3OE7 A;  4G7X A;  4TKO B;  4ITV A;  4B3G A;  3SUC A;  3DEE A;  4KJZ A;  1N78 A;  3OYN A;  3IAS 2;  2L7K A;  1MAB A;  3FBI B;  3QOD A;  2KP6 A;  1CZF A;  2O04 A;  2VJJ A;  2XSJ C;  1IB4 A;  1Y6I A;  4XKW A;  3OY9 A;  2AQE A;  4PJL A;  4C2U A;  1KZL A;  3DDY A;  1N75 A;  1O8I A;  1X1A A;  2CUZ A;  2VAS A;  1X1B A;  3KX2 A;  3BLY A;  4YZA A;  4JOM A;  3K70 D;  2WAD A;  2ZSI B;  5HVQ C;  2CFO A;  3S3O A;  3E1S A;  3DTE A;  3VYT B;  2L5Q A;  2W6J A;  2XND A;  2XZL A;  4NK8 A;  2WAQ A;  4XN0 A;  4LIT A;  4NUB A;  2W7N A;  5LFA A;  1T0F C;  2RQQ A;  4N4O B;  2X85 A;  4YZQ A;  2R7U A;  3HOS A;  4XLE A;  3HPG A;  2V7F A;  3W2V A;  5KHD A;  1I8D A;  2X1E A;  4OAY A;  3FY3 A;  1W36 C;  3OS2 A;  4OJL A;  2XZO A;  1EE6 A;  2W6I A;  4CCK A;  2CMP A;  3K6G A;  3AKZ A;  4CSW A;  4IQJ A;  1UD4 A;  3UW0 A;  4P22 A;  4KKU A;  1QCX A;  4AU7 A;  2WA0 A;  2AQF A;  2ELJ A;  4PSX A;  3RCO A;  5DN6 A;  3GVK A;  4X0G A;  2WSS A;  1LVK A;  1ZEL A;  2D3L A;  2JSP A;  2R7W A;  2E1B A;  1BHE A;  2NTB A;  5C1C A;  4B44 A;  2ZZQ A;  1K6Y A;  1O8H A;  4BQO A;  1XG2 A;  1QJV A;  2UV1 A;  3H9Q A;  1YX3 A;  3PNV A;  3QYF A;  3K4K A;  4F92 B;  3FPP A;  4Y3O A;  1DQU A;  2DT6 A;  1RMG A;  4LIV A;  3W3C A;  3EUK L;  4W8S A;  4G6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...