4XM3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xm3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xm3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xm3A02
2VBKA 4XLEA 4XKVA 1X0CA 3JURA 4OJOA 4XN3A 4XL9A 4XMYA 1RMGA 3GRHA 2O17A 1BHEA 2NTBA 4W8SA 4XR6A 1GQ8A 3KRGA 1EE6A 1O8MA 2X6WA 1H80A 4Z05A 4U4BA 2NT6A 4XM3A 3FY3A 4PMHA 2PYGA 3ZSCA 4W8TA 2QX3A 4XOPA 2PYHA 2Z8GA 1RU4A 5AMVA 1PE9A 2PECA 4XLAA 1O8JA 3B4NA 4XKWA 3B8YA 3VMWA 4MR0A 4OJ6A 3EQNA 2NZMA 4HWVA 3T9GA 4XONA 4Z03A 4W8RA 4OZZA 4W8QA 1O8IA 1O8EA 1QJVA 4OJPA 4YZ0A 4XORA 4XN0A 1WMRA 3LMWA 4XLCA 1RWRA 2O1DA 3UW0A 3GQAA 2VJJA 1O8GA 1OOCA 5C1CA 4XLHA 3VMVA 2QY1A 4YZAA 1JTAA 2INVA 4NK8A 5C1EA 4XOTA 4XLFA 2NSPA 2VJIA 4Z06A 2INUA 4C2LA 1HG8A 1O8DA 3VSVA 2NSTA 3GQ9A 4XNFA 1O8HA 1OGMX 2O0WA 2QXZA 1JRGA 4EW9A 2O04A 2X85A 1KCDA 3SUCA 3GQ7A 3EQOA 4OJLA 4YELA 4URRA 4MXNA 3VSTA 3VSUA 1IDJA 1XG2A 1PXZA 2UVFA 2BSPA 1AIRA 2IQ7A 4OJ5A 1BN8A 2EWEA 4U49A 2UVEA 1O88A 1NHCA 2NTQA 2VBEA 2O0VA 1OGOX 1IA5A 2VBMA 4OZYA 3B90A 1O8LA 3ZPPA 1K5CA 4AVZA 1QCXA 1O8KA 4YEJA 4XQFA 1KTWA 2X6YA 2NTPA 2X6XA 1IDKA 1OFMA 1OFLA 4NK6A 4YZQA 3GQ8A 4YZXA 1PLUA 2NT9A 1IB4A 3WWGA 1VBLA 1DBOA 1KCCA 2ODLA 1DBGA 4I84A 2X3HA 1CZFA 1O8FA
chains in the Genus database with same CATH superfamily
2Q2EA 1SFEA 2GIZA 1VQ7I 3FM5A 1WJCA 3TBIA 1J2XA 3IAS2 4IQ4A 4D5FA 2I1LA 3K4BA 4Y17A 1K8AD 1I18A 3FPPA 4E0FA 1V5FA 2COBA 3BR2A 5F1RA 4HF0A 2AHQA 1VQLB 3Q0WA 2I10A 2O17A 4M2LA 2VXDA 3P9IA 4LBZA 1E1RA 4OOVA 2BVNA 1NK3P 2F5EA 1ZYRF 2A5YB 2QEXI 3GFLA 5GADJ 2E60A 4PFOA 3GFJA 4L9VA 4E7LA 4HA8A 1AIPA 2K9LA 2ZZQA 4Q5SF 2KL4A 2VBZA 2YU9J 1R5GA 2GJRA 3MKWB 1GXPA 1VQOB 4B4CA 4ROXA 2KIFA 3M8EA 4HLXA 4HOBA 4IF4A 2K86A 1P6RA 3NWSA 5FFZA 3EQNA 2LMDA 1TP4A 1MBFA 2HYJA 3I5UA 5M5WJ 1AKHA 2DA1A 3S14J 1FEXA 1TNTA 2K5CA 1QU3A 5F4JA 1PKVA 3H35A 4XORA 4U0YA 3PIOF 3L2UA 2JPCA 2V4DA 2F4NA 2VYQA 4YFOA 3H5AA 3BZCA 3WXMA 3QE2A 2W24A 5K7HA 5DM6F 1BC7C 1WJ5A 4JYKA 3LSHA 1FDRA 1JTAA 2FUG2 3FBIB 3RKWA 3PFYA 1R23A 3PNTA 4HV6A 4H4KC 4XLPF 2INUA 1BM9A 3JREA 2VFQA 4X7DA 1E64A 2DYSH 1YJNB 3S8PA 5HLGA 3FKJA 1VLOA 2CMPA 2J8IA 4Y9UA 3S1MJ 2V9VA 3WNDA 4OOXA 4BQOA 1EFTA 2KQRA 4XNFA 1OQYA 1J75A 3G1LA 5DEQA 3MAJA 4B3FX 1NJID 1T33A 5CQGA 5ILVA 2V7WA 2BHYA 4HNVA 3OYLA 4XICA 3CCYA 3GVKA 3OW7A 4M6XA 5BS6A 2VFNA 3QPLA 3OMYA 4C2MJ 4P22A 1W5SA 2BZTA 2ZJPF 1IXSB 3EUAA 3MZHA 3CLOA 1TYWA 1U0JA 3GO5A 1FMVA 3JU4A 1TQIA 3OZVA 2R7DA 2P7VB 1VZ0A 1Z77A 3ELKA 4CYCB 1P4XA 4HF1A 1EFCA 3FXOA 3VWBA 1W0TA 3A0BC 1DDNA 3HOUJ 3F6OA 1WU8A 5A89A 3LSKA 2CK3A 3ZPPA 4M3EA 2YWGA 3KP2A 3ASQA 4UNOA 3CQZJ 1IXRC 4G6TB 2BV6A 1QO0D 3CUOA 1WI3A 2VNKA 2R7RA 1ODDA 5FGMA 3K4NA 2UZKA 1R5BA 1J7KA 2E1CA 1FLIA 4MQ9F 4ZGQB 1KQ9A 3OL4A 2LKPA 3FXQA 2HQAA 4GO1A 4A3KJ 1QBJA 1IC8A 2HU9A 3W2FA 4BJ6C 1O4XA 4PAAA 2EQRA 4XLEA 2HKOA 1T6XA 1T39A 4OOIA 2ZL7A 4QWQA 4ASUA 1D1AA 1VQKB 5IT9K 2EFNA 1GVHA 3ASNH 1IO2A 2BX6A 3CCJI 3B73A 3G05A 1XSDA 3R4KA 3MFKA 2KDOA 3A3BA 2XGEA 3BQJA 1T98A 2EWNA 4IW3B 3TQNA 2DMUA 4ACAA 4ZZDA 4UV8A 3M07A 4OOSA 4PMHA 3LNNA 3KP3A 1TW3A 3RZDJ 1DP7P 1ZK8A 3CJRB 1DARA 2FQ3A 2I8DA 2L7KA 1H8HA 1ULYA 1W0KA 2ZZFA 3CCRB 2OTJB 3SHFA 3BCAA 4UUVA 5CKTA 4PJJA 1MJ9A 2GA2A 2XTWA 4EH1A 1K4ZA 3D5RC 2CQNA 4EGZA 3B4NA 1ZM4A 2MH2A 1N25A 3K4MA 1EP1B 4BY7J 2ZZEA 1FYMA 3CCMI 5J8FA 1RNLA 4XKBA 1WPCA 1Z91A 1ZLKA 1KA8A 3WTUC 1FNDA 2NZMA 4NDLA 5HDKA 2F4IA 1EA0A 2FX3A 1LB2A 1RKWA 4G5GA 2DW4A 2GWRA 2HOAA 3HXLA 1LVAA 2XGDA 4UXNA 1UG2A 4QSHA 2F5CA 5B3SH 2E2JJ 2L0KA 4TN1A 1RR7A 1FNBA 4YZ0A 4RDJA 5JHUA 2XGCA 4I0AA 1D1CA 4WWCA 4C2UA 1OOCA 1K79A 2V1UA 4EV0A 5IYBJ 2JRTA 4X7CA 2YUSA 4KIFA 3RSNA 4AF7A 1RESA 1I5ZA 1F36A 4F7DA 4CO8A 2ID3A 2WC2A 1RKTA 2X51A 4QHYA 2MLGA 1CGPA 3K1NA 4F91B 3K9TA 1I7PA 2W48A 1ZR2A 4U87A 4KDPA 3BPXA 3OS0A 9ANTA 2K4JA 2MBFA 2JJ1A 3GVJA 3ONUA 4P1VA 3LSRA 4NC6A 2M87A 5KNLA 2BM6A 5J1RA 2DA3A 3I55B 3DWLE 3L09A 2KRFA 1R1VA 4MYTA 4PDKA 2BM7A 1CNEA 1WRJA 1ZELA 4ZCIA 2EFOA 1MMAA 2R9VA 1XDUA 1I39A 2FA5A 2OYNA 3ASOH 3A2KA 2DTZA 3D26A 2EK5A 3I9V2 2KJBA 2EV6A 5H6QA 3K69A 1KZHA 5HS8A 5HNFA 4ENNA 1ZM3A 1MGTA 1SD5A 3G1MA 2MW8A 4P2NA 2O6GE 5CVIA 4M6VA 3S17J 2L3DA 3DEWA 1RQPA 4F92B 3OYDA 1FWZA 1PLUA 3C2BA 2PX9A 4YFXF 1GLNA 2PMZA 3OYCA 3SYJA 3F9KA 1ZGAA 1V5VA 1VQMI 4LIUA 2ZMEA 3CUQA 2J5PA 1O3QA 1BX1A 1N8RD 3MHPA 1FT9A 1N05A 2O0YA 4HX4A 4MLOA 4MTEA 4ESBA 5F4MA 3CCSB 2VOPA 2X3HA 4OIRF 3FJOA 2X6OA 3V7AA 1N06A 3OKXA 2ESHA 3GTJJ 2V9KA 5L46A 2GPJA 4HE6A 1DPUA 4KIGA 1S72B 4DYRA 5FL7A 3F21A 4OM9A 1D5VA 3OE7A 1OFCX 4KNYA 1ON2A 4XR6A 4ANJA 2R7FA 1QA2A 4BH9A 1XN7A 3GVLA 1Q1VA 3OEEA 2EIMH 1E3PA 5GV7A 1D0ZA 1X1PA 3Q0VA 1Y0YA 1KD1D 2CV1A 1YIOA 3OJWA 4BDZA 3FY3A 2ZJ2A 3RIQA 2WSSA 1U3EM 1OGJA 2RREA 5DNSA 2CC2A 4XOPA 5IK2A 3A8JA 2QYUA 3PA2A 5AMVA 4PC1A 5FROA 4LK0F 1E17A 1EJ9A 3ERED 3IAM2 3UR3C 1FPQA 2KFDA 5J6XA 2KJCA 4PFPA 4P9SA 3JTHA 1A6IA 1A35A 3AVXA 5B5EC 1HSJA 5BPDA 2R3SA 1WOOA 3SZPA 1GT0C 2BXYA 2LLKA 3B8HA 2BOLA 4WF2A 3TO6A 3TH0A 4IHWA 1SD4A 2J7KA 3AG3H 3KIOA 4OPSA 3G6EI 2R7SA 4BE1A 4I6ZA 2QSGX 2ZL6A 4X0CA 3ABUA 1TT5B 2FNAA 1YLOA 4JRAC 2F3LA 4DZJA 5J1YA 1VQ4B 1HSTA 3C3WA 4YRVA 3ZZTA 2ELHA 4KKSA 3Q0UA 5LFAA 1ETQA 3FDYA 2BPOA 2NPFA 2A61A 4Z4RA 2JMWA 2PLFA 4HDUA 5IP7J 5HODA 3TOAA 1WJDA 3VSTA 3PUBA 3A8IA 4A0XA 1TYXA 3I58A 2HCJB 2ZXIA 2UVFA 1KK1A 4A0ZA 1T2KA 4DQKA 3H36A 4R1HA 4UB6C 2DODA 2KZGA 2YX7A 3ZQCA 2MD0A 2RC4A 4BHCA 5L3CA 3CCQB 2NVQJ 3GZNB 4UZUA 1EF4A 5E3MA 5K5OA 2CS3A 2XSJC 2QKMB 5AONA 2QWWA 3HHGA 4EJTA 4D5CA 1K73D 2G7UA 2YSRA 2BN4A 2BVLA 2X8KA 1KC8D 3JCUC 4Q48A 1WOSA 2R7WA 2XRLA 4O6JA 5FKOA 1OFMA 3DBRB 1GUUA 2HS5A 2HXIA 1BR2A 3H0DA 2Y69H 2CW0F 1U9OA 2R7OA 3ONQA 4LLGF 1A5JA 5TY0A 1S9HA 1EH7A 2Y9ZA 5D8KB 1QZEA 1USTA 2KRCA 3I54A 3BH6B 2M7BA 2YPRA 2BHZA 2JSPA 4C3JJ 5BSXA 1MSFC 1VQ6B 1MBEA 3DTKA 3D1NI 5KSWB 2OD5A 1UB9A 3RDIA 4E7KA 2GBYA 2NAZA 5IP9J 2WZNA 3LQQA 4XKVA 2LH9A 3BROA 3DV8A 4XN3A 2O5RA 4XL9A 1HA8A 1GAQA 1X4PA 2VB6A 3CW2A 5FA6A 4GXOA 1W0UA 5LRRA 4CYCA 3CDLA 2R7VA 1VQPI 1W1WE 1E3ZA 2R5YB 1I6XA 1WI9A 5EEHA 3N6ZA 2HVRA 2ME0A 3KRGA 4BE0A 1HXDA 2EFGA 2X6WA 2K27A 3BR6A 3IC7A 1P4WA 4QPOA 4FT8A 3TDZC 1FNMA 4I98B 4P96A 2CU7A 3KP6A 2XHKA 2AXTC 2CRGA 2C77A 3JRAA 2MABA 4WZTA 5IOZA 4WZEA 4L9NA 1OCRH 2DMNA 1RU4A 2LBFB 2IW5A 2HZDA 2FVGA 1QZYA 3QOPA 5EG0A 1T8IA 5K5QA 2GXBA 1ZQ3P 4A0YA 2VT3A 2OK7A 4HPQA 4ZDLA 2VC1A 2VT2A 3CCEI 2PFBA 4OMZA 4BEHB 1EFUA 3BZKA 2EV5A 3FMSA 3GZ6A 3CCLI 2K02A 2VOOA 3H0GJ 2CFXA 3SFIA 3ZQIA 2LD5A 1FMWA 4LGWA 3LSIA 1YITI 3ULQB 2QVOA 4XN0A 3R61A 1H0MA 2H1KA 4A5MA 3BCFA 1J9IA 2R7ZJ 3LJYA 3CP8A 3RKYA 2VBVA 1FBSA 3PSIA 2FJ1A 4Z2YA 4G1VA 2K7LA 2Z99A 3A4CA 4OU0A 3VDXA 3CO6C 1TNSA 3BR1A 2W84A 4U0VA 4DBQA 2IPQX 3ZMZA 3IKTA 3HRMA 2VKHA 4IJAA 2IA1A 5GV8A 3RI4A 4E4HA 1IHMA 3U2QA 2CF4A 1LFBA 2E2HJ 3GTPJ 1R58A 2PBIA 4N4OB 3G2BA 1UHWA 4ITVA 4FHTA 1N08A 3E1SA 4QTRA 1WTHD 2HOEA 4L8JA 2OU2A 4M3BA 1QA6A 1TYUA 2VFOA 5IYNA 3V7CA 2QDXA 2PMUA 1RRJA 1AIRA 1X1BA 1BI0A 1T08B 1JTXA 2DK8A 2C78A 4KJZA 2BM4A 3S1NJ 4FN5A 5CJ9A 1R7JA 2XV4S 3LSTA 2WA0A 2M5WA 4HE5A 1O88A 4V2GA 3OJXA 4Z1MA 2JUCA 1K6YA 3GTGJ 3CCUB 1U8BA 2IOUG 2O0VA 2K9NA 5JMCB 3CRZA 4C43A 3IWFA 3HTSB 3PNVA 4UZEA 4YEJA 3BTIA 1LLZA 3OS2A 4NK6A 4NHJA 4YZQA 2LRDA 3RYRA 2VBXA 1E0EA 1JJ6C 1OLTA 1KK2A 2L4AA 1A8PA 4IOAF 1LDDA 3JR9A 4L9JA 2E71A 3I4NJ 1IUYA 3CC2B 3I0TA 3MEXA 2OBSA 1DBOA 2DOAA 2JPBA 4PK4A 1L3LA 2K85A 1DBGA 3ASSA 1BBYA 4II3A 4CCMA 3E6CC 3QFRA 5F4OA 1VI0A 4CUGA 1VNDA 3F6VA 3WE2A 1QRBA 3V7RA 4DIQA 2HDWA 2BXZA 5CQEA 2V79A 4Q4ZF 1YS7A 1X0CA 4KMUX 3SXYA 3JURA 3H9GA 2FNPA 3BG6A 5L3GA 1SMTA 1FIAA 1ZHFA 2DQRA 3ABTA 4KA4A 5LEKA 5JR3A 2CQ7A 1NB0A 4C3HJ 2A68F 3K7AJ 4ZYAA 4BBRJ 2WPDA 5L3FA 3CC2I 2DERA 1Y0UA 4L5JA 1IRXA 1D0YA 2PYGA 3LSMA 4RD2A 2VJ4A 3KZIC 1ZN2A 1Z67A 3KYCB 2LG4A 3HUGA 4ABZA 5K7ZA 3KEYA 4CCKA 1HBXG 5B6IA 1JKRC 4A2UA 3K10A 2UXXA 1QUEA 1TTYA 1KMHA 1TWCJ 2OZ6A 3R6KA 3SLDA 1BN5A 1KU3A 2V7XA 3GFMA 3HKZA 4Y52J 1OB5A 1OISA 4G7WA 2RGVA 1FRNA 1GVDA 1MNDA 2HNHA 1JGSA 3ML3A 5E79C 4I09A 4BY1J 2DMTA 4RM2A 1S6LA 1FOKA 2LC2A 3BY1A 3S1QJ 4P26A 4M3FA 3WGIA 1M90D 4XLCA 3WTTC 4S0HB 3BJ6A 2QM3A 5TGTA 4QV2A 4RLFA 1WGXA 4OIQF 3KLNA 1XG1A 3BC8A 4XIDA 2L7ZA 1TWFJ 3LL7A 3G1OA 4MHGA 2HDDA 5F0HA 4M73A 1ZR4A 4RM0A 3FBNB 2V9PA 3KP4A 1ZRFA 3VMFA 4N3GA 1ETVA 1YG2A 3LFKA 3J80K 1MSEC 2R7UA 3SUCA 4OP7A 3DU5A 4G6IA 1FRQA 3QU3A 1GHCA 3VSUA 2EB7A 2H8RA 4E7HA 1YIJB 3KETA 4B4DA 4F52A 2JJ2A 1B59A 5D5XB 2CUZA 5LEJA 2FOWA 4O5VA 3HIFA 1G3YA 2WY8Q 2XASA 1U5TB 3PQKA 4U88A 4JMQA 1RUNA 1WVRA 2GJPA 2VZLA 1HDDC 4A93J 1NHCA 3EYYA 2LREA 2L54A 2F4OB 5DCMB 5HDGA 4CCJA 5GP9A 5GAGJ 1EH8A 1WXRA 1IZ1A 2E19A 5H2FC 5DCFA 1JUPA 2CNDA 2DA6A 3CUQB 5HKKA 2VASA 4LFUA 5M3FJ 1YX5A 2DY1A 3SQVA 3K1PA 3K4JA 3T8RA 2CBXA 1F9NA 3H92A 2DQLA 2FD5A 2RC5A 2Y48A 5HZAA 1CZFA 2DPDA 2W7ZA 3RPUD 3K4KA 2VC0A 1WZ2A 3F8CA 3R6JA 1JUSA 1HW2A 1A6QA 1E63A 1S3JA 1QFYA 3Q9VA 3CB4A 2H1LA 2VFMA 1NTCA 2IS1A 1T6SA 2PN6A 3J81K 2RC6A 2CO5A 4M6YA 5J35A 5ED4A 4Y33A 4AF6A 2E35A 3HC7A 1MABA 1ZRCA 2CW5A 4W8SA 4BQQA 2JN9A 1YX2A 2M8EA 4Z4YA 2HWVA 1EE6A 2EFPA 2YWHA 4FISA 2XIGA 3PUMA 2WAQN 3MKLA 3OYMA 4HX7A 3W2EA 4U4BA 2HDCA 5JFRA 1JKQC 4RA2A 3O2PE 2CJJA 4NB5A 2GOMA 3ABMH 2VONA 1V0FA 1I50J 4A3CJ 1I27A 1WQ2A 2OZUA 2C4UA 2RVCA 4X05A 1M1KD 2QQAA 4LOCA 2WB1A 1FOXA 3ECOA 1QG0A 2BM0A 3VMWA 5GPAA 4RB3C 3CMEI 2JJ7A 2ACJA 1YHQI 2OK8A 2LY9A 1QX4A 3PETA 1YS6A 2LYCA 3V8JA 4BYYA 1H8EA 3E97A 3DXJF 1GR1A 2RDPA 2BM5A 3A0HC 3FX3A 4D0PA 3JRIA 5FLXK 4WX9A 4F3QA 4M3DA 1IJFA 1MMNA 3AFHA 4HDVA 1QQ1A 3QOEA 4YALA 1JA1A 4RGUA 2FMYA 2DFHA 5LHIA 2XAJA 1QHHD 2NV4A 4HNTA 2INVA 2R5YA 4EATA 4PZJA 1WCMJ 2ZC2A 2K4BA 1PYVA 3JX8A 1FNNA 3FF5A 5IYRA 4DW6A 4Y3OA 3HOZJ 4L18B 3B6CA 3FXUA 2HZTA 3MKZA 1LE8A 1PJ5A 2CSOA 3SEQA 1VQLI 2L2OA 4CHUA 3NAUA 2DMQA 2ESNA 5HXBA 5IYWA 1NB9A 1U9NA 2LBFA 3U6BA 4A6EA 5AIQA 3A8KA 1P9QC 3GQ7A 5EF6A 3GBGA 3WGGA 1D2EA 1UHMA 4LJZF 1VTNC 1YOVB 3AG4H 2P5VA 3VO2A 1YI2B 1I3AA 4C2TA 5EDNA 2V6CA 3CCVB 1BOBA 4JQFA 4BEHA 5FD6A 1Y8RB 2DOFA 2FQ4A 3NQOA 5GAHJ 1VQOI 1XGMA 2CV0A 2VBUA 1GVJA 4OAYA 2BSAA 1OKRA 1H89C 5AIPA 4P3IA 3ABLH 3RCOA 1IA5A 5HLIA 5J47A 5LGUA 2B7EA 3ZBUA 1NHAA 5J3OA 3SEJA 2X6YA 3SYTA 4M0LA 4J00A 5TISC 3T51B 3OSGA 1HC8A 2HPIA 2XKPA 4BNCA 2D74A 3FMRA 4GYIA 3S3MA 4PGOA 5FO0A 2DFFA 3P26A 2M9HA 5E3OA 3OS1A 2D1VA 3I4PA 3PNYA 3J80Z 1DG1G 3LVBA 1MBHA 2EIXA 3BT9A 3SEZA 2R6HA 2DA4A 3L2VA 2STWA 2E1RA 2VBYA 2GK6A 2HKXA 2HDNB 1YJNI 1FC3A 4HNUA 1IN6A 1Y1WJ 2KRHA 4EM1A 1ETOA 5HS7A 4EJOA 4XMYA 1RMGA 4L5EA 1YO5C 3AG1H 4AD9A 2DI3A 2FSWA 2IXSA 2XAGA 1R71A 3LSPA 4Q47A 2TDXA 4LG3A 1XMKA 3CD6B 4XM3A 4TMWA 1BR4A 4LC0A 3DEEA 4D9JA 2HYFA 5EG0B 3P9KA 4QPQA 2IVMA 5DS0A 3NAWA 1OMIA 3HJEA 3CC7B 5EJCA 4UB8C 4BHBA 3J7YJ 3CLQA 3RPUA 3FPKA 3CPWB 1Y8QB 1JGGA 2FEZA 1QVUA 1JHHA 1S7AA 3OW2B 2DT5A 3B8YA 3T56B 1I3QJ 3KL9A 2JN6A 4FASD 2W4SA 5D4SA 3ZZUA 3BG5A 2TCTA 2ZBKA 1BQEA 4XONA 1YJWB 2EV0A 2IGMA 3CTAA 3A01A 1LEAA 3U2RA 1NG7A 2Y0SN 1SEUA 1MD0A 1NK2P 4ON0A 2WADA 1R6RA 3J81Z 3T5XA 5D6FA 2D2WA 2QE7A 1VFCA 3COAC 3IH4A 3VSKA 2M4KA 3VMVA 3FMQA 4NCNA 2QY1A 3NE5B 3RKXA 5EEAA 2JTVA 3G73A 2LR8A 2DFIA 3LAPA 4BHPA 2E1BA 4RPBA 3BLYA 3SDGA 1VQKI 1VF7A 3VSVA 2OPTA 5IYDJ 4HSTA 4EEFG 3AL0C 3MMPA 5BSYA 3H9JA 4ENKA 4S05A 2VPLA 2XNJA 4BJ5C 4BBSJ 2R7QA 4RAGA 4PGGA 2B9SA 1SVLA 3HG9A 1HW5A 2FBHA 3C2GA 2HVSA 1CF7A 1DGRM 5LHHA 2A05A 1SC7A 3R60A 4ZYDA 5B1AH 1YW9A 1UAAA 1OCTC 3D5LA 4NQWB 3G3ZA 1OFDA 4BXUA 2V26A 1PP7U 2WBMA 1GO2A 1IDJA 3ZRGA 4UVCA 2OTJI 1HKTA 4JK1X 3CCRI 2L9NA 2H09A 2D45A 1G59A 4RCZA 3GLXA 2EWEA 2E7WA 2IS4A 2DOGA 2UWMA 1MNEA 5F0CA 5D5VB 5FLXZ 1Q7YD 2WAQA 4I76A 2NTQA 4Z4VA 3V4GA 3CXCB 4EVIA 5EGOA 3OYKA 2Z16A 3A02A 3B90A 3QODA 2AXLA 4M53A 1XD7A 2K40A 2Y75A 2CW7A 1BX0A 3N4MA 1H9GA 2NTPA 1S8NA 1EA3A 1JNYA 1PJRA 1MNMC 2BY2A 2IGOA 3AVUA 1DQUA 4YAWA 1IB4A 1LKXA 2R5ZB 2QTLA 1DDIA 3CJQB 3SQNA 3CP2A 2VQGA 1MRZA 1KQSB 2M45A 2QBYB 2HPMA 1KU7A 1HKQA 4EMSA 1NBMA 2VBKA 3T53B 5C4JJ 4YDTA 5C4XJ 2VKVA 2ZL5A 2ISZA 3L2RA 2O61A 1AWCA 3DPUA 1SM4A 3TOBA 2V6EA 1YJ9B 1TQPA 3DBHB 1WSVA 2COMA 1F60A 1U5TA 1SVOA 2CQXA 4AIKA 3HUGB 1GQ8A 4FE4A 2VQLA 2P4WA 1U2WA 1YLFA 5KK1A 3WHBA 3I55I 2L02A 1GV2A 2IS6A 1VQNB 1R5ID 2V7UA 5DCMA 2NT6A 3BY2A 3OYEA 5JLVC 1L1IA 4RLQA 2V7QA 1BLIA 2Q0OA 2QX3A 1G3WA 5K5RA 2HTSA 2LF8A 4V2FA 3TW6A 3F8NA 1OR7C 3HOXJ 1PE9A 2F1MA 4I7HA 3GQBA 3OZUA 1FTZA 1UD4A 3WYAA 3IV5A 1J9ZA 3CPXA 2KIUA 4XKWA 2QCOA 1X3UA 4ENJA 5LGTA 1T38A 2QF7A 3IRQA 3ZXSA 1VHOA 1SFOJ 2V7VA 1OYYA 2LFBA 1BL0A 4A3LJ 3AVYA 4N9IA 1Y39A 2M5SA 2LK2A 5DYMA 1HKSA 4AIHA 2XTXA 1XGNA 3KLOA 5ICEA 3MQ0A 1IXCA 4OZZA 4FWTA 3MWMA 1B9MA 5FD5A 1D5YA 1VQNI 4ZDOA 3FISA 2ID6A 5E3NA 4YEIA 1N77A 3OYFA 4OJPA 4KICA 3I71A 5LMZA 4AVPA 3HRUA 4IHYA 4DK1A 1ZG1A 3DLAA 1UD2A 2JVHA 3ZMSA 2H6CA 1TQMA 3VFZA 1X3ZB 2NVYJ 3E5UA 3C18A 3CCSI 4OIPF 2VJIA 1K83J 1P7JA 3Q5FA 4Z06A 2O7OA 3S16J 2X0KA 3WG7H 3ERMA 2DT7B 1ETYA 5GTIC 2JT1A 2R92J 4ESFA 1W7PD 4JX6A 5DD8A 1S72I 4BS9A 1I1SA 2O0WA 4FQGA 2Z1DA 4LB5A 3KPHA 1UELB 2FU4A 1K78B 1LJ9A 2Y30A 1IRGA 2QA4B 3PSSA 3MMYB 3F23A 2DDBA 4YELA 4U9UA 3BG7A 5DS9A 4MTDA 2ZBVA 2DPUA 3G71B 2B7BA 3L2QA 1WWXA 1X3WB 4G7HF 1QGZA 1BN8A 2MGQA 4FTHA 2BBYA 2ISYA 1V5GA 1TSPA 2Q6OA 4B43A 3H94A 1MH4A 4LG0A 2GOXB 1S7OA 2YX4A 3ZQLA 2BW3B 1R9TJ 3MZ8A 4N3NA 4WWVA 1ETKA 1LPQA 3KFWX 5FKNA 1LQ1A 1N78A 2OTLB 4FETA 4LB6B 4BDYA 5FRMA 2CFOA 1IV6A 2BGIA 2XEXA 2HXOA 3BDDA 3K2ZA 1Z6TA 5E1XA 4HX8A 1AMOA 2BEOA 4EJWA 3MVPA 2Y0MA 3GTLJ 4I02A 4CGZA 2W82A 1ZGWA 1UCRA 2RNGA 5THXA 1U2RA 4ZYHA 1E3OC 4IHVA 2V1NA 3KP7A 4IHTA 2IP2A 3J7AY 3B82A 1DGWY 5KW9A 2XZOA 1VQ5B 4W97A 1AA7A 1N75A 2ODLA 2W1OA 5J3LA 1BA5A 1U78A 2CUFA 5FLVA 1G7CA 4P3YA 1VLYA 1QQIA 3ZQHA 1VQ4I 3WBJA 4RMNA 3QFCA 1BI2A 4G9YA 3ZPLA 3GTMJ 3LQEA 2K9SA 1IDYA 2YS9A 1BI3A 3A35A 3SKBA 4WCGA 2PE3A 5FIUA 3OYNA 1K4SA 1BI1A 1MMGA 3BCBA 3H9QA 3A1YA 1ZM9A 3JRGA 3OP1A 3OYJA 1R1UA 1A04A 3EDPA 3BR5A 3QAHA 1P2FA 3RZOJ 3RYPA 5TR9A 2G9WA 4A3EJ 2B0RA 4MGRA 4RD4A 2IRFG 4Y4RA 1K61A 4WZKA 2P5LC 1Q81D 4HW0A 1SAXA 2XT2A 2PYHA 3CCQI 5JLWA 3PA1A 3R0AA 1V54H 1YE9A 4XLAA 5H6RA 2GIVA 3S32A 3EUKL 1CQTA 4IHSA 2DAOA 1N07A 1O8JA 1IB0A 1XB4A 1SD7A 2DJIA 1GJRA 2QUFA 4MR0A 1WDTA 3QYEA 2V4JC 4JBAA 3N90A 1TC3C 3BY6A 4L5IA 1NH3A 2EIKH 4BQAA 1NDHA 5J4VA 2E1NA 1TUIA 5EYRA 3E1YE 4RAYA 5CVRA 1RIOH 4LBYA 2XNDA 4GQNA 2XUBA 3LMWA 1N0VC 3ABKH 3CDIA 2GQFA 1BC8C 3ES9A 3KEWA 1IRFA 4XLHA 3OYAA 3IL2A 3H3UA 3JW4A 1LE8B 1U8RA 4PC2A 1VQ6I 1HW1A 3FXRA 3LOCA 3WGHA 4XOTA 4G8XA 2LOOA 3HL2A 4C2LA 1BIBA 3FIWA 2QGGA 2KMUA 4RD1A 2IEKA 4J19A 2B5OA 1R36A 3F8MA 4G6QA 3M8FA 4RS8A 4L0YB 2R7XA 4P5OA 2EFQA 1NG6A 3RQIA 2WV1A 4BUPA 1WSUA 1ZRDA 1KJZA 1QZZA 3PO2J 4TSFA 2YR2A 2M0CA 2XC7A 1X1CA 3GEZA 1BJAA 3DCFA 2H6BA 2OA4A 3DTIA 3CMMA 1D8JA 1OHHA 2XAQA 3BH4A 3T8TA 4M9XA 1DP3A 2F5FA 4W1UA 5KCMA 3VPRA 2F1LA 3WTWC 2MFZA 1IJWC 4G7OF 1D1NA 3K6GA 1TL8A 2XF7A 3ZQFA 5IP6A 3HZJA 4BGDA 4U0WA 1OGOX 3S2WA 4ESJA 3UNGC 4YAUA 3CMAB 2P0WA 2QMUA 4TMVA 1BR1A 4RD0A 5D6EA 1O8LA 4AM3A 3M1CA 2VE8A 4PC6A 2XRNA 3BTCA 1OFLA 4Z4ZA 2QSHX 1ORKA 2P7CB 4IL6C 1KU2A 3LAJA 2X9DA 3ZN1A 1FX7A 1W36C 1JUMA 4YXWA 4D7MA 2NT9A 2GLOA 4F93B 1OYIA 2IJLA 2BY3A 3NWTA 1VQ9B 3HBLA 5CVJA 3WHCA 4R79A 2KLOA 4B8XA 3CDHA 2W6IA 5D4RA 3IH2A 1K6OA 3DKWA 1O8FA 4BACA 5CYVA 4EGYA 2O9LA 2CQKA 2UXNA 1MJAA 2OV7A 4NQWA 4WQMA 2WZPP 1T56A 1Q86D 3GTQJ 2Q1ZB 3WU1B 3PUFA 2XGXA 4ZH4F 1LEBA 2VBTA 1HDPA 3QFTA 4RCYA 1HF0A 5B1BH 3HGYA 4ZV4A 2DT6A 1BHEA 5D5WB 3CF5F 2GZWA 3S1RJ 1JXSA 2OBRA 3AVWA 4PJ0C 4C3IJ 1O3SA 1O8MA 1IN7A 2TRTA 1UD5A 2E5NA 3JRDA 1VQ9I 3N97A 4LLNA 3E6MA 2YUHA 1LUJB 3WG9A 3VSLA 2KZVA 2MLKA 1TVCA 2LVSA 4ZJZA 3WTXC 3PJRA 3AGPA 1LLWA 4FXUA 1W0JA 4A3DJ 3BG9A 4NBQA 5HS9A 3CCUI 1VQ8B 5DM7F 3LNQA 3A01B 3CESA 2R5ZA 4RDLA 2D1HA 3E7LA 3QP5A 2R93J 4E7IA 1XGOA 1SFXA 3BJAA 4IRHA 1Q1HA 4G1BA 2LKSA 1CQXA 5JHFA 1S7EA 2QBYA 2A6TA 3HM5A 3ZOBA 3DPLC 1XS9A 1IUFA 1SVMA 1KTVA 3PSZA 1Y1VJ 4TMZA 3RIRA 3EQLF 4NC7A 2G0EA 2EBIA 5FLMJ 1PUEE 2AO9A 3P5JA 3B6AA 3DF8A 1E43A 3C1DA 1FYKA 4PCQA 3ONYA 1JI8A 3BG3A 1XSVA 3HTUA 2UV1A 2K9MA 4X1EA 4YIFA 4H9GA 4XD7A 5BMZA 2OCCH 2OF7A 4AIJA 1WJEA 1YYVA 3I4MJ 4OIOF 2NVTJ 2PIAA 3S3NA 5FO1A 2GJKA 1CF7B 2WR8A 3I1FA 4AIDA 2ZNYA 2PJPA 1XPXA 4V02C 4Z4TA 2VBSA 3OAAA 4B3GA 1JJ2B 1T95A 2VE9A 2QYOA 1EP3B 1O8HA 1TZLA 2BYVE 3TEDA 2KKOA 1EXMA 1T5EA 2L9RA 2KIQA 3C2HA 3PQJA 3TO7A 2LKXA 4FCYA 3G4SB 1ZKGA 4DYQA 3FXKA 4Z4WA 4P9UA 3SZTA 2W25A 5AN9A 1XG2A 2O8XA 4CICA 2BSPA 2IQ7A 1X4OA 3RJPA 4ETSA 5EGOB 2DN0A 1U6GA 4OJ5A 5L3DA 3SJZA 3ZQ7A 3UKGA 1SAUA 5IYQA 2WWYA 4U49A 1OGIA 1B23P 2P5KA 3S3OA 2OC6A 2XAHA 5EZHA 5M5XJ 3JQQA 1N0UA 4ZCMA 3H9NA 4E70A 1JHFA 2GA1A 2WTEA 3OYBA 1X58A 3DFGA 3JRCA 4AVZA 5D5UB 3WTSC 3F8FA 1DABA 2P6TA 1WHUA 3LQRA 4ZTFA 2ZTGA 2A07F 3TKYA 2WYRA 2ZMEC 1EZGA 2LTPA 5DD4A 5F08A 1S0UA 2VKDA 3WWGA 3M1EA 2OAZA 2XZPA 1MDMB 2DMPA 3W2IA 3CJTB 2X53S 4QVAA 2A6HF 4RGSA 3BC9A 2EZLA 1K78A 3TDUC 2AQFA 4TT3A 2VJ5A 3LMMA 4L9TA 1WP6A 2EIJH 4PJLA 3ZQGA 3X2QH 1OR7A 2MG4A 3OOPA 4MEYF 1JKOC 2ZFWA 1PUFB 1A31A 2V1XA 4AWXB 3HOSA 2HMAA 4X0GA 5KAFC 2HEOA 4A5NA 1QA3A 4AC9A 2FXAA 2C2WA 1G3SA 4UVBA 1IW7F 2E1MC 2HFHA 4LK1F 2JUGA 4HF2A 2ZXHA 2HOSA 4S04A 1F20A 2LZJA 4IEJA 4RB2C 2NTBA 2DK5A 4MNUA 3H1CA 1H9TA 1J09A 2BW3A 2V31A 1IG7A 3RKQA 2M0MA 2BY1A 2GQQA 2XT4A 3FHNA 4OWRB 1YIJI 2OQGA 3S2DJ 4YAFA 3VB2A 4D1QA 3BR0A 2HQNA 2JA7J 3JQRA 1ITYA 3OIOA 4IKFA 4LIVA 2XPWA 5FNZA 2H8WA 4M1KA 3DU6A 3EYIA 1Y0RA 1X2NA 3I56B 3DTEA 1S4MA 1YW8A 5B66C 2Q6LA 1B72B 1H42A 1USSA 4NUBA 4C30A 5HOOA 4P6VF 4QUZA 4RD3A 5CPRB 1TW2A 1E1QA 2R7TA 1BW5A 1XSXA 2PJRA 1QFZA 1FOYA 1F43A 4X8IA 5CVUA 2ZBUA 1ZREA 3W2AA 1W36D 1ZARA 3SDBA 1WMRA 2K9QA 3REOA 3VNVA 3AAFA 3UW0A 5F1JA 2QN6A 4I2OA 3BWGA 3AVVA 4LBVA 3CC4B 2I5UA 2JDIA 2E1MB 4KUMA 2RKHA 4XLFA 2STTA 1SFUA 1S29A 1VQ7B 2ZFUA 2ZSIB 1J59A 2NYXA 2DJNA 4V19K 2KP6A 3IKVA 5FKKA 3DKXA 4DOZA 1DDGA 3MZYA 1HOMA 4OPOA 1JRGA 4XBFA 1UMKA 3LA7A 2EPFA 4YIIA 1QGAA 1PP8F 3PUNA 4OJLA 2C5HA 5FKMA 3OYHA 4WXHA 3SZEA 2V7TA 3DQVC 3Q3AA 2QEXB 5FFXA 2CUJA 4LG0B 4ZC3A 1JA0A 2XB5A 3P4GA 2DU9A 2RAEA 1ENHA 4CCNA 2IAIA 2LNBA 2VLAA 1B8IB 1V0EA 5IYPA 1QVFB 1BOAA 3PVDA 3AGQA 3SY2A 1XCBA 5GTHC 1OPCA 2K3FA 5F64A 4BKXA 1E79A 3P9CA 2VBEA 5LBQA 2XAFA 4PJMA 4DQLA 2XGJA 1RC9A 2DYRH 3DEUA 4N9HA 1RUOA 2WY7Q 4YHBA 1R5NA 1P4AA 3GTKJ 1T6YA 4XQFA 1XB2A 3ASPA 1KQ0A 4JX4A 1R1TA 1QHGA 1OYWA 3LSGA 4RGRA 5GPCA 1QGYA 2BY0A 3M9AA 1PJ6A 2KVOA 1XCVA 3OYGA 3ZR8X 3FKIJ 3EUHC 4PABA 1PJ7A 3K4LA 2KIMA 2WJYA 1YX3A 3BP8A 4B3XA 2F4MB 4DNCA 2F43A 1FIPA 1WPKA 3NRVA 3ISXA 4UAJA 4AC0A 1H8AC 3VO1A 1EH6A 4AYBN 3BCDA 4HZFA 1JKPC 4X7EA 4Y7CA 2EILH 4X7FA 1GXQA 5BOXA 1R49A 2ZXWH 1I8DA 4KISA 1H85A 2PMZN 5FJ8J 3K1MA 2EZIA 5J40A 2VNHA 1LFUP 3V76A 1KYZA 2ZB9A 1G3TA 2EA2A 3HHHA 4YFKF 2D3NA 2WAEA 5FRNA 2DXIA 3DDYA 5GAEJ 4WXDA 1V55H 2FBKA 2CV2A 2QENA 3VNUA 2X48A 1SKQA 2NOJB 2MD5A 3LO8A 2P81A 1H80A 4PSXA 1M1EB 3HOWJ 3GUDA 1H88C 1YI2I 1R4MB 4E7JA 4ACBA 1MKMA 2NVUB 3CCVI 4A3BJ 3ZSCA 2KHMA 3IWZA 4EJUA 3KP5A 5ILSA 3FM3A 1K4TA 1BPLA 5E8GA 2DIEA 3QPHA 1MIJA 3O3KA 4CYDA 5HZBA 1R5OA 1HQCA 4IXAA 3OEHA 3RY8A 2ICWG 2BV3A 5J1UA 3M7GA 3VODA 4A3JJ 2PMHA 1XMAA 4MFDA 4EQQA 2VUMJ 1Q82D 1SD6A 3SZGA 1FY7A 4YFNF 4E7ZA 2MSYA 3E0JB 3WE3A 4H0EA 4Z03A 3W2GA 2VNJA 1TBXA 3A1PA 2NXNB 1JT6A 1YW7A 1IDZA 3ECHA 1O8GA 2HLDA 2QSFX 5DSZA 3L9FA 3WTVC 3PIPF 2GM4A 1ETXA 4BQNA 4NK8A 3SLNA 3HOVJ 2P6SA 4ZGNB 2M1BA 3AVTA 4UV9A 2WJVA 1UMQA 3E6BA 2CRVA 4J0QA 3F3XA 2JSCA 4I0BA 1HG8A 1O8DA 4YAOA 3F8BA 3D0SA 3H09A 2NSTA 2A3SA 1AOYA 3ASTA 4U7BA 3FHZA 1KZLA 4QFMA 3CCJB 2HQRA 2EJRA 1MH3A 3SFZA 4BXFA 1O7FA 4M74A 3U1KA 3T1BA 1YTYA 4GDFA 1EP2B 2X85A 1FP1D 4XSXF 2J8KA 1FX0A 1AU7A 5A2QZ 1FP2A 5DV5A 4Z6YA 3CMYA 4UUTA 2L7MP 3CD6I 1Z7LA 2LDUA 3TP0A 4X6AJ 1E3HA 4HLYA 5LLQA 2JWTA 5H59A 5HDNA 3CC7I 1W7PB 3JQPA 1Z3XA 2W7NA 1QPIA 1G4DA 3GX4X 2O8KA 4KKTA 3CJNA 4ENMA 3RPQA 3IUOA 2V7FA 1YQAA 2MC4A 2XB0X 2W57A 4HBLA 4XRSG 3F72A 4WK8F 3KYLA 4A3GJ 2BF4A 2NS7A 5K1YA 1EWYA 3MN2A 3CCMB 2ZJRF 1O3RA 1RI7A 2H94A 2Z5UA 1QFJA 1K5CA 5DTDA 4B44A 2XZLA 1QCXA 3J7AO 1YJWI 1FJLA 2FE3A 2RQPA 3C7JA 1CNFA 4LLLA 3BH7B 3QYBA 1WJBA 2E34A 2QKLB 1KU9A 4YCQA 4G7XA 2H27A 1B2RA 2DA2A 1E3XA 4FE7A 3Q6QA 1B4AA 1XTAA 2Q8KA 1Z7UA 3LA3A 5ILUA 2JQ7A 4Z4SA 2G0YA 1QA1A 4X07A 1ZAOA 1HF2A 4Z4UA 4A69C 3Q38A 5IYCJ 4RD6A 3KZYA 2GK7A 1MMDA 1FZPB 1ACIA 4IOCF 4ZCLA 5KAIC 1PVEA 5E6TA 2VN2A 4IO9F 3HPGA 2IA0A 1PDNC 4KT6A 2OQRA 1G7TA 2IGKA 2VBWA 3FWEA 5JBQA 2N8GA 4KH3A 3LWFA 1R5HA 2JA8J 4ZYGA 3W5UA 4EM0B 2ZKZA 2DEUA 4UHTA 4DK0A 3WTZA 1A36A 3VEPA 3ZMVA 1B6AA 3BZ6A 4MEXF 1IGNA 2PI0A 3Q6RA 1OB2A 3OOUA 3LQ6A 1CLWA 3GF2A 2RN7A 1IN4A 2LP0A 2ZCWA 3HSEA 4P1WA 3JRBA 1IRZA 1B1BA 1XFOA 3AL0B 1TLHB 1B9NA 1KCCA 2A5WA 2D5VA 1FNCA 3HAGA 5HLTA 2DFEA 2GXAA 4XRMA 4BJTA 2EZKA 1MDMA 1TWHJ 4OJ6A 2ETHA 2VI6A 2AQEA 4XKCA 2VL8A 5TRDA 3KX2A 4JOMA 3K70C 4HYEA 4HEA2 1ZLJA 2IS2A 2C5BA 4GFBA 5LHGA 2AS5F 2LY2A 2OCEA 3PM1A 1WJAA 3TO9A 3U9GA 2HR3A 2XSDC 4BL0B 1PUFA 4RAZA 2E36A 2HOTA 2HTJA 1WJFA 3QRFF 1HA3A 1P4MA 1T0FC 3I59B 4R8HA 2XROA 3ZCOA 2VJJA 1DU6A 4GCVA 1W5TA 1VQMB 2O3FA 3W2VA 1UG0A 3KEQA 4OINF 4HV5A 1GAWA 2X4HA 5JVGF 2NSPA 3DU1X 4QIWN 1D8KA 2LF7A 5C3EJ 1TYVA 3GFIA 2ADUA 2Z33A 1REPC 3GQ9A 4IRGA 4OAZA 1OGMX 1YJ9I 2X3UA 4AYBA 3RTRA 1P92A 1D8TA 2HYGD 3E6DA 4B3AA 4DNTB 2O04A 4EW9A 2ZZGA 3ZC3A 3KCCA 3ZZ0A 2BMWA 2QQ8A 2NS0A 1UZCA 3GMEA 2M4GA 3B78A 3BNWA 3J81k 2NS8A 5ICCA 4CXFA 1B72A 5D8LB 5L3EA 2X1EA 1K28D 1KQ5A 2DYIA 2DCEA 6PAXA 3LFUA 1GV5A 3V8KA 1HCRA 1ZUNB 2C6YA 2Z9OA 1DU0A 2CH0A 4XRSA 1LDJA 3ZIAA 4GRIA 3W5VA 3P7NA 1EV7A 1K7AA 1ERDA 3LYCA 3ZQQA 1O8KA 2QQBA 3W3CA 1OCCH 4ZYEA 4N0BA 3GCMA 1KONA 1P7IA 4UVAA 4WXCA 4U7DA 3WBKA 1C0WA 1DPRA 2M7AA 5FO5A 4II2A 5LRSA 5M5YJ 3V42A 1KRHA 3G6EB 5DDGA 3HRTA 1X19A 4PGHA 4RB0A 5ICGA 4RB1A 3JRFA 3AG2H 3KZZA 3QYFA 2ZJQF 2ZITA 4I84A 2DCUA 2L9VA 1K8FA 5H5JA 3HSFA 3L2WA 4UUSB 1BW6A 3OR2C 1R00A 1UFMA 2L7FP 2Z2SB 4OJOA 3I53A 2JA2A 1RZ4A 2M8GX 1RPWA 3O8HA 4AU7A 3H5NA 5E8IA 2XF6A 1B8IA 3MCAA 1FSHA 5J4YA 1W9XA 4IX7A 2QA4I 4G7ZF 5IT9Z 5DN6A 4CQJA 3H3ZA 2VFPA 3HYIA 2E1OA 1EFRA 1Y0NA 4HAMA 1LFPA 4LITA 5E1WA 1UD3A 1UD8A 4Z05A 4TMXA 1SMYF 4CZZA 1JB9A 3DP7A 1E2XA 3G71I 5F04A 3FXLA 2NOGA 2VPRA 3TL4X 3OPOA 1FSEA 1YRNB 2EZHA 2F5DA 5LD2C 4MIMA 4L0ZB 4A3IJ 5F6FA 2IA2A 2X0LA 4P25A 4NNJA 4P6YA 3ROUA 2E7XA 3S93A 2Y0SA 5DUKA 3K2AA 4P55A 4HQMA 3R6SA 4A12A 3H3VK 2PJRB 4DZPA 1ZH5A 3HOYJ 4LD5A 3BPVA 1TWAJ 1V3FA 4CCLA 1Z6RA 2OTLI 4BXXJ 4TKOB 3T9GA 3BQYA 2ME6A 4HRIA 1XQBA 4KYWA 2VQHA 4KKUA 2OUMA 2Y31A 1HZEA 1JTYA 1O8IA 1W5CC 1O8EA 1HVXA 2VXZA 2JZYA 2HGCA 4XLNF 3GYHX 1QRYA 2XOKA 1RWRA 4I01A 4B47A 2R4GA 5CVVA 2O1DA 3OL3A 1V4RA 4RM3A 3HKZN 1VQ5I 3M3YJ 4CZCA 4PC7A 1QH0A 2HVQA 5BNGA 1ZTRA 2MA3A 1SANA 5EZGA 3JTGA 4M71A 4B09A 2IGNA 4J01A 1OB0A 2FMLA 2O03A 5ICFA 1SKYB 1XMXA 5KHDA 3W6VA 3BTLA 3NEUA 4IQJA 1K9MD 2QLZA 3WODF 2LSOA 4OPVA 4E7SA 3ZN0A 1W34A 4M4SA 4IHXA 3QPTA 1F1ZA 3T0YA 1MBGA 1QNTA 3WY9A 1YFHA 3IP4B 4RGXA 3JAMK 3EETA 1VHEA 3K0LA 1VQPB 4JP0A 1IV8A 3QWLA 1QVGB 2Q2EB 4CA0A 4FX0A 1POGA 2L5QA 3F0CA 3GVAA 2ECCA 4RAFA 4YIRX 3WTYC 4MXNA 3EUHA 4KN4X 1FYLA 1STZA 5IT3A 2ELJA 5C44J 2ELKA 4BPRA 3KEOA 1Z3YA 2ZNZA 2JA5J 3W5HA 3OIQA 2KDZA 2JA6J 2V1DA 3U6KA 2XNCA 4M9SA 5BPIA 4DJAA 3GIRA 4M3GA 1WKMA 5EMNA 2FBIA 1X1AA 3L7WA 4G6DA 4P12A 2A69F 2VBMA 2XAUA 3U1DA 1FOWA 2F6CA 3CCEB 3K70D 4UY8I 4ASNA 1KTWA 2X6XA 4P9FA 3CCLB 3QSYA 2O6WA 2XC1A 1S5LC 3ZUGA 2M34A 4C0SA 1YITB 3LSJA 5E17F 1G7RA 4RPDA 2VODA 4Y9RA 1KGSA 3E20A 1HLVA 1TTTA 1ONVA 2R0QC 4XRFA 5E18F 3FK6A 2CYYA 1WORA 1WH7A 3A03A 3DKYA 4Y7NJ 5K7FA 3GZ5A 1AKHB 3HDDA 4KFCA 4NBSA 5F0FA 5E20A 4M9ZA 2GXGA 4B1RA 4YG2F 2XKOA 2PLYA 4QVJA 1XX5A 3WNCA 2F5VA 4KIBA 4NC8A 1D3YA 5M3MJ 4ZZLA 5JI6A 2VNIA 1XDSA 3EPZA 1IN8A 1W7PA 5JVTA 3BTJA 4CDGA 2QQ9A 4Y13A 4LMYA 5HLHA 3ASRA 2A6EF 2RV8A 3U21A 2PMDA 5BQTA 1COWA 1WH5A 3D5SC 2WV0A 2DBBA 1OJLA 2VIXA 3GLLA 2QZAA 5TV2A 4W8TA 2DA7A 3BR3A 2BVMA 5CLSA 2D3LA 4D7NA 1UHSA 1SFKA 5ERIA 2Z8GA 3HRSA 3HPHA 3QU6A 4YC5A 1Z05A 4ZDPA 1Z1DA 3GW2A 4MYUA 1G6NA 1BJZA 3MKYB 3CMAI 3B02A 1I1GA 2B63J 4M72A 4LBWA 5FB2A 2BGCA 2ZXJA 4HWVA 5E1ZB 4C9YA 2RQQA 1RR8C 1APLC 1J5YA 3J7ZI 1W87A 1MJBA 2ZO4A 1DUXC 2OBTA 3WNBA 2XTYA 3V7SA 2CWEA 3ZP5A 1VJSA 2FRHA 2WB1N 3BJOA 1X1DA 1QGPA 3ML6A 3GQAA 5L3BA 1W2BB 2F48A 2B0LA 3HGGA 2M3AA 2X1DA 4YZAA 5FKLA 5C1EA 3PL8A 3HB9A 2L01A 4E6KG 2DETA 5A8AA 3IH3A 1IJEA 4WZLA 1KK0A 4N4NB 2FX0A 4GGGA 3VYRB 1RETA 3E3VA 1D0XA 1OCZH 3KYDB 1OCOH 1IF1A 2QZ8A 2KISA 1W35A 2Y2ZA 3L1PA 1ZM2A 4MO7A 3WQZA 4CH7A 3CF2A 4FX4A 2EH3A 2P8TA 2PQ8A 2AHOA 1IN5A 3EQOA 2DTRA 1ZG5A 1QPMA 3L2CA 4HQEA 2PG4A 1FTTA 2RNJA 4XK4A 2DOEA 2QTZA 1PXZA 3OOCA 4CSWA 4EJVA 1G8XA 4RJLA 3RQ4A 4MQVA 4A3MJ 2J5OA 3JRHA 1JE8A 1FBUA 1IAWA 1TWGJ 4KITB 4AUXA 2OJED 4DQ2A 1VF9A 1L0OC 1XC5A 1VQ8I 1TT0A 2MH9A 3I59A 1QUFA 3FZVA 5H20A 3QFSA 2JK3A 3BOQA 4DBRA 2IBDA 3VYTB 3OFNA 3CZ6A 3WU0A 1R4NB 1G7SA 3VOEA 2FF4A 3HOTA 2EA4A 5E3LA 2MYSA 1D1BA 4B48A 4F7ZA 1UJ8A 4K2EA 4HIZA 3DBLB 3WU2C 2YU3A 4DNRB 3GQ8A 1GDTA 3E5QA 3O6BB 1ELOA 1Q9SA 5JLXA 3IHUA 2BGJA 1WFXA 4KT5C 4FK8A 1VBLA 1R22A 3JAMZ 1F4KA 1G2HA 1UD6A 3NB2A 1W4MA 2P3MA 3PFIA 1KYWA 1MW7A 3W6JB 3OYIA 5F27A 3SJMA 2NRAC 1JJ8C 3FK7A 1Y6IA 2JIZA 3QP6A 3VYSB 3CO7C 1QVTA 4PJNA 4TMTA 3GWZA 1AHDP 1U5TC 2PEXA 2L4MA 3ZGKA 1NRKA 3GRHA 2LY1A 2YWFA 4PUSA 4CCOA 4EM2A 3K4CA 1WOPA 4GYGA 4O3MA 3G4SI 2K3PA 1O7LA 2F2EA 3I64A 4KMFA 1Y56A 3ZMTA 3JSOA 2DLLA 3CUQC 4K1XA 1T0FA 2DA5A 2MC3A 2W00A 2XPVA 4G12A 4BU2A 1BJKA 4IPAA 2DDAA 2G7HA 3NARA 2IT0A 3ZBTA 4MFEA 2KT0A 3E5XA 3ZPNA 1MBKA 1ON1A 3S2HJ 3ISPA 3A3GA 1Z21A 3ZMDA 4ZTJA 1O3TA 2C4TA 4UZFA 2PECA 1XE1A 4QLCU 3JSPA 2Z6BD 1F5TA 1MZBA 5IY5H 4R71A 3PO3J 5LGNA 4X06A 4RBOA 1OCPA 3QPSA 1ZGJA 3DLLF 2FOKA 2VKEA 2QGUA 4BE2A 3FKSA 1Z9CA 4W8RA 3VR6A 4OMYA 4UUSA 4W8QA 1FBQA 2CGPA 1QJVA 3HSRA 2CG4A 3I3LA 1I6HJ 4KN7X 2Q6IA 2E5ZA 1MBJA 3FXJA 2DO7A 3H5RA 1LDKB 2HQ5A 1EKEA 4A6DA 4IRIA 1KK3A 1T6ZA 2WAFA 3Q9SA 5C1CA 3MCZA 3V8LA 2W85A 3DPTA 4IZZA 1OFEA 2D9RA 3N05A 1V5EA 3OWTA 3O8GA 3TMOA 2NNNA 2XF5A 3GTOJ 3GSIA 1LNWA 2GREA 3VYUB 3M4OJ 4TV7A 5HNHA 3AK5A 1TLLA 3OR1C 2Q6KA 2L9SA 5A88A 1J0RA 5A2QK 4RDUA 2EFWA 3PSFA 3TW7A 4Y15A 2ZSHB 4RDKA 4I99C 1YRNA 2ZMEB 4Q7JB 2QXZA 1JT0A 1E62A 1RQRA 3PENA 4RLZA 5KVRA 3OV8A 1LM1A 1KCDA 2JVGA 3GXOA 2EINH 2B7CA 4URRA 5IPAA 3OSFA 2CUEA 3AKZA 3W2HA 1QRCA 4IVNA 2JRMA 4G94A 4DYCA 2YWEA 2KPMA 3TP3A 1O57A 2NVXJ 3OZWA 2CW8A 3KE2A 2X1CA 5TJJA 1XGSA 2Z3YA 2UUZA 4PSWA 2OBPA 3Q3SA 1BIAA 2W6JA 3ESWB 2ZTNA 3LA2A 2UVEA 3ZMUA 1ZG3A 2XDVA 2XPUA 3R0JA 4HG2A 4XSZF 5DUIA 3S15J 3SJPA 3IRRA 5J8CA 3I56I 2E2IJ 1Z0XA 2NNYA 4OZYA 3CMEB 3M8JA 1YHQB 3QQAA 1KQ8A 3Q39A 4OPWA 2VQCA 5IOYA 2BM1A 1IDKA 1WSRA 4PC3A 3L00A 1ETWA 4A3FJ 2BE5F 1MMSA 1X2MA 2ECBA 3P27A 5CDFA 4YZXA 2HI3A 3FXMA 2XVCA 3BQZA 3MD2A 3OIPA 4F55A 5EEGA 2GAUA 1LVKA 2Y9YA 3W6KB 3W2WA 3F22A 2M2EA 3OY9A 3CC4I 4HSRA 4BAYA 2V5IA 5HVQC 2M30A 3TGNA 4JX5A 4DGWB 3HEFA 1BMFA 2CQQA
chains in the Genus database with same CATH topology
4CUGA 3TBIA 1WJCA 4DIQA 1VLYA 3IAS2 4IQ4A 2HDWA 2GK7A 3K4BA 1MMDA 5CQEA 3FPPA 1X0CA 4RMNA 4E0FA 3JURA 3H9GA 1V5FA 3BG6A 3HPGA 3A35A 4KT6A 2O17A 2IGKA 2VXDA 3OYNA 1MMGA 3BCBA 1E1RA 3H9QA 3A1YA 4ZYAA 2WPDA 3OYJA 4DK0A 2E60A 1D0YA 1IRXA 4PFOA 3LSMA 4E7LA 3OOUA 2PYGA 2VJ4A 4Y4RA 2K9LA 2ZZQA 2LG4A 2KL4A 4P1WA 3AL0B 3KEYA 4CCKA 2PYHA 2GJRA 3MKWB 3K10A 2A5WA 1YE9A 4XLAA 3HAGA 3S32A 3EUKL 5HLTA 1KMHA 1O8JA 2DJIA 3NWSA 4BJTA 4MR0A 4OJ6A 3QYEA 2V4JC 2AQEA 4XKCA 3HKZA 2VL8A 3EQNA 3KX2A 4JOMA 3K70C 2IS2A 4HEA2 4G7WA 1MNDA 2HNHA 2LY2A 1WJAA 2K5CA 1QU3A 4BL0B 4RM2A 2XNDA 2LC2A 1PKVA 3H35A 4GQNA 4XORA 3L2UA 2V4DA 4XLCA 1WJFA 3LMWA 1T0FC 3H5AA 3ZCOA 2VJJA 3KEWA 4XLHA 5TGTA 1WJ5A 3LSHA 1UG0A 3W2VA 3OYAA 1JTAA 2FUG2 3FBIB 3PFYA 4RLFA 3PNTA 4XOTA 4H4KC 2NSPA 3HL2A 2LOOA 2INUA 3BC8A 4C2LA 3LL7A 3S8PA 3FKJA 2CMPA 2KMUA 3GQ9A 4OAZA 4BQOA 2KQRA 4XNFA 1OGMX 3FBNB 4AYBA 3RTRA 2ZTNA 2R7XA 4B3FX 4P5OA 1NG6A 4DNTB 5CQGA 4BUPA 2O04A 4EW9A 2R7UA 2ZZGA 3OYLA 4TSFA 3SUCA 2XC7A 1X1CA 3GVKA 3OW7A 3DU5A 3OMYA 4G6IA 2M4GA 3DTIA 3CMMA 3VSUA 4P22A 1K28D 4E7HA 2X1EA 1OHHA 3EUAA 3BH4A 4F52A 2DCEA 2JJ2A 3LFUA 1U0JA 1DP3A 1FMVA 2CUZA 3JU4A 1VZ0A 2WY8Q 5KCMA 2MFZA 4JMQA 2GJPA 3VWBA 1NHCA 3K6GA 2CH0A 2XF7A 2LREA 1OGOX 4BGDA 3ZIAA 4CCJA 4GRIA 3UNGC 2P0WA 1O8LA 3LSKA 1BR1A 2CK3A 1ERDA 3ZPPA 3ZQQA 1O8KA 3M1CA 5HKKA 3W3CA 2VASA 1YX5A 4G6TB 1OFLA 1KONA 3K4JA 1W36C 2R7RA 4YXWA 3K4NA 2M7AA 2NT9A 4II2A 4F93B 3V42A 3NWTA 3OL4A 4R79A 2KLOA 2HQAA 2W6IA 1X19A 1KCCA 4I84A 2HU9A 3QYFA 1CZFA 4BJ6C 1O8FA 4BACA 4XLEA 3RPUD 3K4KA 3L2WA 2OV7A 3OR2C 4ASUA 2WZPP 2Z2SB 1D1AA 2Q1ZB 2IS1A 4OJOA 2JA2A 3G05A 4Y33A 4AU7A 3H5NA 2XF6A 2DT6A 2KDOA 3HC7A 3A3BA 1MABA 1BHEA 4W8SA 1W9XA 4IX7A 4BQQA 1EE6A 5DN6A 1O8MA 1EFRA 3OYMA 1LFPA 2E5NA 4LITA 1UD5A 1UD8A 4U4BA 4Z05A 4PMHA 3LNNA 3VSLA 2KZVA 3CJRB 4ZJZA 3PJRA 2I8DA 2L7KA 3TL4X 1H8HA 1W0KA 2ZZFA 3OPOA 1W0JA 4FXUA 5LD2C 3BCAA 2GOMA 1V0FA 5CKTA 4PJJA 4NNJA 3S93A 2Y0SA 3D5RC 3B4NA 3CESA 3K4MA 2PJRB 2WB1A 2ZZEA 3VMWA 4E7IA 4XKBA 1WPCA 4TKOB 4CCLA 2NZMA 5JHFA 2F4IA 3T9GA 4HRIA 2A6TA 1H8EA 2LYCA 3DPLC 2VQHA 4KKUA 2OUMA 3HXLA 1HZEA 1O8IA 1O8EA 1HVXA 2VXZA 4NC7A 4YZ0A 4F3QA 1MMNA 1D1CA 4C2UA 1E43A 3AFHA 2XOKA 3QOEA 4B47A 1RWRA 2R4GA 1OOCA 2O1DA 3OL3A 4RM3A 3RSNA 1JI8A 1QHHD 4CZCA 2UV1A 2K9MA 4HNTA 4XD7A 2INVA 2HVQA 4EATA 2X51A 1WJEA 1PYVA 3S3NA 4F91B 2IGNA 4J01A 1OB0A 2GJKA 1SKYB 4Y3OA 5KHDA 4U87A 4IQJA 3OAAA 3MKZA 4B3GA 1O8HA 1T95A 4E7SA 3OS0A 3SEQA 1TZLA 2L2OA 2JJ1A 3GVJA 3IP4B 1T5EA 2LBFA 5KNLA 3GQ7A 1P9QC 3C2HA 2Q2EB 4CA0A 3GBGA 2L5QA 3DWLE 4MXNA 1XG2A 2ELJA 1ZELA 2BSPA 4C2TA 1MMAA 2IQ7A 2R9VA 1BOBA 1X4OA 1Z3YA 4JQFA 4BEHA 4OJ5A 1SAUA 3OIQA 2CV0A 4U49A 3A2KA 4OAYA 4DJAA 3I9V2 2OC6A 3S3OA 1X1AA 1IA5A 3RCOA 2VBMA 5HNFA 2XAUA 3OYBA 4AVZA 2F6CA 3K70D 1KTWA 2X6YA 2X6XA 3SYTA 4J00A 4ZTFA 3T51B 2ZTGA 4F92B 2HPIA 3OYDA 1PLUA 1GLNA 2PMZA 3S3MA 3OYCA 3F9KA 4LIUA 2VKDA 3WWGA 3OS1A 2XZPA 3PNYA 2X53S 3BC9A 2X3HA 4MLOA 2AQFA 4TT3A 3DKYA 2VJ5A 3LMMA 1WP6A 3SEZA 4PJLA 3L2VA 2GK6A 1I18A 2V9KA 4HNUA 2F5VA 4NC8A 3HOSA 2KRHA 4X0GA 3EPZA 4XMYA 5FL7A 2E1MC 1RMGA 2JUGA 2ZXHA 2LZJA 3OE7A 2NTBA 2IXSA 4XR6A 4ANJA 3U21A 3GVLA 1COWA 3OEEA 3D5SC 1J09A 2BW3A 2V31A 1D0ZA 4LG3A 2CV1A 2M0MA 4XM3A 4BDZA 3FY3A 1BR4A 2VIXA 3DEEA 3FHNA 4OWRB 4D9JA 2WSSA 4QPQA 2RREA 4W8TA 4D1QA 2BVMA 2D3LA 4XOPA 1SFKA 5IK2A 2Z8GA 3HPHA 5AMVA 5FROA 4IKFA 4LIVA 4ZDPA 3DU6A 3IAM2 3UR3C 3T56B 3MKYB 3B8YA 3DTEA 4FASD 2W4SA 4PFPA 4NUBA 4HWVA 4C30A 5HOOA 4C9YA 2RQQA 4XONA 5CPRB 1E1QA 2R7TA 2IGMA 1NG7A 2PJRA 2BOLA 2WADA 3W2AA 1R6RA 1W36D 3SDBA 1VJSA 1WMRA 1X1DA 2QE7A 3UW0A 3GQAA 3VSKA 2M4KA 2R7SA 3VMVA 2JDIA 2M3AA 2X1DA 4BE1A 2QY1A 4YZAA 3NE5B 5C1EA 2E1MB 3PL8A 4XLFA 4E6KG 2ZFUA 4N4NB 2E1BA 3BLYA 3VYRB 1VF7A 3VSVA 2ZSIB 1D0XA 4HSTA 4YRVA 3AL0C 2KP6A 3DKXA 3H9JA 4DOZA 2VPLA 4KKSA 1JRGA 4BJ5C 5LFAA 2R7QA 3CF2A 4CH7A 3FDYA 3HG9A 2HVSA 3C2GA 3WQZA 1DGRM 3EQOA 4OJLA 3OYHA 1UAAA 3D5LA 4NQWB 1WJDA 3DQVC 3VSTA 3PUBA 2V26A 1IDJA 2CUJA 2WBMA 2ZXIA 4ZC3A 3ZRGA 1PXZA 2UVFA 3OOCA 4CSWA 1G8XA 3RQ4A 2L9NA 4CCNA 1G59A 2VLAA 2MD0A 4KITB 1V0EA 2EWEA 2IS4A 2UWMA 1MNEA 4UZUA 2WAQA 2CS3A 2XSJC 1TT0A 2QKMB 1E79A 2NTQA 2VBEA 4PJMA 2XGJA 3OYKA 2Z16A 3B90A 2BVLA 3QODA 4DBRA 2CW7A 2WY7Q 3VYTB 2X8KA 3OFNA 3CZ6A 2R7WA 4XQFA 2NTPA 3HOTA 1OFMA 1QHGA 2MYSA 1D1BA 3LSGA 1EA3A 4B48A 4HIZA 1PJRA 3H0DA 1BR2A 2IGOA 2KVOA 4DNRB 3GQ8A 3OYGA 2R7OA 1DQUA 3EUHC 3ONQA 3ZR8X 1IB4A 1LKXA 3K4LA 1S9HA 2WJYA 1YX3A 3CJQB 4B3XA 3CP2A 1WFXA 2KRCA 2F43A 1VBLA 2VQGA 2M7BA 1UD6A 2JSPA 3BCDA 2HPMA 3DTKA 2VBKA 1MW7A 1NBMA 3OYIA 3T53B 4E7KA 1I8DA 1Y6IA 3L2RA 4XKVA 4KISA 2JIZA 3DPUA 2LH9A 4XN3A 3VYSB 1HA8A 2O5RA 4PJNA 4XL9A 2V6EA 1X4PA 2VB6A 3ZGKA 1NRKA 3GRHA 2D3NA 2LY1A 2WAEA 4PUSA 2DXIA 4CCOA 5FRNA 3HUGB 3K4CA 2R7VA 2VQLA 1E3ZA 3DDYA 2CV2A 2HVRA 2IS6A 1GQ8A 2K3PA 4BE0A 3KRGA 2NOJB 2X6WA 1H80A 4PSXA 2NT6A 4QPOA 1Y56A 3OYEA 4RLQA 2V7QA 4E7JA 3ZSCA 2W00A 4BU2A 1BLIA 2KHMA 2MABA 2QX3A 1BPLA 3ZPNA 2DIEA 3A3GA 1RU4A 1OR7C 1Z21A 4ZTJA 2LBFB 2F1MA 1PE9A 2PECA 3GQBA 3OEHA 2Z6BD 2HZDA 1UD4A 4XKWA 3ZXSA 4HPQA 4ZDLA 2M5SA 4BE2A 3SZGA 4BEHB 3FKSA 4E7ZA 3E0JB 4Z03A 4W8RA 3VR6A 4OZZA 4W8QA 4ZDOA 1QJVA 1FMWA 3I3LA 3LSIA 3OYFA 1N77A 4OJPA 2E5ZA 3H5RA 1LDKB 4XN0A 2WAFA 4DK1A 3BCFA 3DLAA 1UD2A 2JVHA 5C1CA 3CP8A 2HLDA 1O8GA 3DPTA 4IZZA 3PSIA 3N05A 1V5EA 3OWTA 3TMOA 4BQNA 2XF5A 3A4CA 4NK8A 3VDXA 2VJIA 3VYUB 2WJVA 4Z06A 5HNHA 1HG8A 3OR1C 4DBQA 2DT7B 1O8DA 2L9SA 2NSTA 3PSFA 2VKHA 4U7BA 2ZSHB 4E4HA 4BS9A 1KZLA 2O0WA 2QXZA 4BXFA 2Z1DA 4N4OB 1UELB 3G2BA 2X85A 1KCDA 2JVGA 4ITVA 3MMYB 1FX0A 4URRA 4YELA 3BG7A 3E1SA 3AKZA 1WTHD 1Z7LA 4L8JA 2KPMA 3L2QA 2CW8A 1X1BA 2X1CA 1AIRA 4KJZA 2UUZA 4PSWA 1BN8A 1Z3XA 2W6JA 2W7NA 4KKTA 1V5GA 2WA0A 1O88A 2UVEA 2XDVA 3IUOA 2V7FA 2MC4A 4HG2A 4B43A 1UD3A 1K6YA 3H94A 4Z1MA 2GOXB 3KYLA 2BW3B 2O0VA 4OZYA 3M8JA 1K5CA 1N78A 4B44A 3PNVA 4FETA 2XZLA 1QCXA 4BDYA 4YEJA 5FRMA 2VQCA 2CFOA 1IDKA 3OS2A 4NK6A 5CDFA 4YZQA 2LRDA 3QYBA 1E0EA 1WJBA 2QKLB 4YZXA 1OLTA 4DGWB 4G7XA 2W82A 3MD2A 3OIPA 4F55A 1LVKA 2RNGA 3W2WA 1E3XA 3OY9A 3J7AY 2V1NA 1DBOA 2DOAA 4HSRA 4PK4A 2XZOA 1DGWY 5HVQC 1DBGA 2ODLA 1AA7A 1N75A 4II3A 4CCMA 1BMFA 2W1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBK A;  4XLE A;  4XKV A;  1X0C A;  3JUR A;  4OJO A;  4XN3 A;  4XL9 A;  4XMY A;  1RMG A;  3GRH A;  2O17 A;  1BHE A;  2NTB A;  4W8S A;  4XR6 A;  1GQ8 A;  3KRG A;  1EE6 A;  1O8M A;  2X6W A;  1H80 A;  4Z05 A;  4U4B A;  2NT6 A;  4XM3 A;  3FY3 A;  4PMH A;  2PYG A;  3ZSC A;  4W8T A;  2QX3 A;  4XOP A;  2PYH A;  2Z8G A;  1RU4 A;  5AMV A;  1PE9 A;  2PEC A;  4XLA A;  1O8J A;  3B4N A;  4XKW A;  3B8Y A;  3VMW A;  4MR0 A;  4OJ6 A;  3EQN A;  2NZM A;  4HWV A;  3T9G A;  4XON A;  4Z03 A;  4W8R A;  4OZZ A;  4W8Q A;  1O8I A;  1O8E A;  1QJV A;  4OJP A;  4YZ0 A;  4XOR A;  4XN0 A;  1WMR A;  3LMW A;  4XLC A;  1RWR A;  2O1D A;  3UW0 A;  3GQA A;  2VJJ A;  1O8G A;  1OOC A;  5C1C A;  4XLH A;  3VMV A;  2QY1 A;  4YZA A;  1JTA A;  2INV A;  4NK8 A;  5C1E A;  4XOT A;  4XLF A;  2NSP A;  2VJI A;  4Z06 A;  2INU A;  4C2L A;  1HG8 A;  1O8D A;  3VSV A;  2NST A;  3GQ9 A;  4XNF A;  1O8H A;  1OGM X;  2O0W A;  2QXZ A;  1JRG A;  4EW9 A;  2O04 A;  2X85 A;  1KCD A;  3SUC A;  3GQ7 A;  3EQO A;  4OJL A;  4YEL A;  4URR A;  4MXN A;  3VST A;  3VSU A;  1IDJ A;  1XG2 A;  1PXZ A;  2UVF A;  2BSP A;  1AIR A;  2IQ7 A;  4OJ5 A;  1BN8 A;  2EWE A;  4U49 A;  2UVE A;  1O88 A;  1NHC A;  2NTQ A;  2VBE A;  2O0V A;  1OGO X;  1IA5 A;  2VBM A;  4OZY A;  3B90 A;  1O8L A;  3ZPP A;  1K5C A;  4AVZ A;  1QCX A;  1O8K A;  4YEJ A;  4XQF A;  1KTW A;  2X6Y A;  2NTP A;  2X6X A;  1IDK A;  1OFM A;  1OFL A;  4NK6 A;  4YZQ A;  3GQ8 A;  4YZX A;  1PLU A;  2NT9 A;  1IB4 A;  3WWG A;  1VBL A;  1DBO A;  1KCC A;  2ODL A;  1DBG A;  4I84 A;  2X3H A;  1CZF A;  1O8F A; 
#chains in the Genus database with same CATH topology
 2Q2E A;  1SFE A;  2GIZ A;  1VQ7 I;  3FM5 A;  1WJC A;  3TBI A;  1J2X A;  3IAS 2;  4IQ4 A;  4D5F A;  2I1L A;  3K4B A;  4Y17 A;  1K8A D;  1I18 A;  3FPP A;  4E0F A;  1V5F A;  2COB A;  3BR2 A;  5F1R A;  4HF0 A;  2AHQ A;  1VQL B;  3Q0W A;  2I10 A;  2O17 A;  4M2L A;  2VXD A;  3P9I A;  4LBZ A;  1E1R A;  4OOV A;  2BVN A;  1NK3 P;  2F5E A;  1ZYR F;  2A5Y B;  2QEX I;  3GFL A;  5GAD J;  2E60 A;  4PFO A;  3GFJ A;  4L9V A;  4E7L A;  4HA8 A;  1AIP A;  2K9L A;  2ZZQ A;  4Q5S F;  2KL4 A;  2VBZ A;  2YU9 J;  1R5G A;  2GJR A;  3MKW B;  1GXP A;  1VQO B;  4B4C A;  4ROX A;  2KIF A;  3M8E A;  4HLX A;  4HOB A;  4IF4 A;  2K86 A;  1P6R A;  3NWS A;  5FFZ A;  3EQN A;  2LMD A;  1TP4 A;  1MBF A;  2HYJ A;  3I5U A;  5M5W J;  1AKH A;  2DA1 A;  3S14 J;  1FEX A;  1TNT A;  2K5C A;  1QU3 A;  5F4J A;  1PKV A;  3H35 A;  4XOR A;  4U0Y A;  3PIO F;  3L2U A;  2JPC A;  2V4D A;  2F4N A;  2VYQ A;  4YFO A;  3H5A A;  3BZC A;  3WXM A;  3QE2 A;  2W24 A;  5K7H A;  5DM6 F;  1BC7 C;  1WJ5 A;  4JYK A;  3LSH A;  1FDR A;  1JTA A;  2FUG 2;  3FBI B;  3RKW A;  3PFY A;  1R23 A;  3PNT A;  4HV6 A;  4H4K C;  4XLP F;  2INU A;  1BM9 A;  3JRE A;  2VFQ A;  4X7D A;  1E64 A;  2DYS H;  1YJN B;  3S8P A;  5HLG A;  3FKJ A;  1VLO A;  2CMP A;  2J8I A;  4Y9U A;  3S1M J;  2V9V A;  3WND A;  4OOX A;  4BQO A;  1EFT A;  2KQR A;  4XNF A;  1OQY A;  1J75 A;  3G1L A;  5DEQ A;  3MAJ A;  4B3F X;  1NJI D;  1T33 A;  5CQG A;  5ILV A;  2V7W A;  2BHY A;  4HNV A;  3OYL A;  4XIC A;  3CCY A;  3GVK A;  3OW7 A;  4M6X A;  5BS6 A;  2VFN A;  3QPL A;  3OMY A;  4C2M J;  4P22 A;  1W5S A;  2BZT A;  2ZJP F;  1IXS B;  3EUA A;  3MZH A;  3CLO A;  1TYW A;  1U0J A;  3GO5 A;  1FMV A;  3JU4 A;  1TQI A;  3OZV A;  2R7D A;  2P7V B;  1VZ0 A;  1Z77 A;  3ELK A;  4CYC B;  1P4X A;  4HF1 A;  1EFC A;  3FXO A;  3VWB A;  1W0T A;  3A0B C;  1DDN A;  3HOU J;  3F6O A;  1WU8 A;  5A89 A;  3LSK A;  2CK3 A;  3ZPP A;  4M3E A;  2YWG A;  3KP2 A;  3ASQ A;  4UNO A;  3CQZ J;  1IXR C;  4G6T B;  2BV6 A;  1QO0 D;  3CUO A;  1WI3 A;  2VNK A;  2R7R A;  1ODD A;  5FGM A;  3K4N A;  2UZK A;  1R5B A;  1J7K A;  2E1C A;  1FLI A;  4MQ9 F;  4ZGQ B;  1KQ9 A;  3OL4 A;  2LKP A;  3FXQ A;  2HQA A;  4GO1 A;  4A3K J;  1QBJ A;  1IC8 A;  2HU9 A;  3W2F A;  4BJ6 C;  1O4X A;  4PAA A;  2EQR A;  4XLE A;  2HKO A;  1T6X A;  1T39 A;  4OOI A;  2ZL7 A;  4QWQ A;  4ASU A;  1D1A A;  1VQK B;  5IT9 K;  2EFN A;  1GVH A;  3ASN H;  1IO2 A;  2BX6 A;  3CCJ I;  3B73 A;  3G05 A;  1XSD A;  3R4K A;  3MFK A;  2KDO A;  3A3B A;  2XGE A;  3BQJ A;  1T98 A;  2EWN A;  4IW3 B;  3TQN A;  2DMU A;  4ACA A;  4ZZD A;  4UV8 A;  3M07 A;  4OOS A;  4PMH A;  3LNN A;  3KP3 A;  1TW3 A;  3RZD J;  1DP7 P;  1ZK8 A;  3CJR B;  1DAR A;  2FQ3 A;  2I8D A;  2L7K A;  1H8H A;  1ULY A;  1W0K A;  2ZZF A;  3CCR B;  2OTJ B;  3SHF A;  3BCA A;  4UUV A;  5CKT A;  4PJJ A;  1MJ9 A;  2GA2 A;  2XTW A;  4EH1 A;  1K4Z A;  3D5R C;  2CQN A;  4EGZ A;  3B4N A;  1ZM4 A;  2MH2 A;  1N25 A;  3K4M A;  1EP1 B;  4BY7 J;  2ZZE A;  1FYM A;  3CCM I;  5J8F A;  1RNL A;  4XKB A;  1WPC A;  1Z91 A;  1ZLK A;  1KA8 A;  3WTU C;  1FND A;  2NZM A;  4NDL A;  5HDK A;  2F4I A;  1EA0 A;  2FX3 A;  1LB2 A;  1RKW A;  4G5G A;  2DW4 A;  2GWR A;  2HOA A;  3HXL A;  1LVA A;  2XGD A;  4UXN A;  1UG2 A;  4QSH A;  2F5C A;  5B3S H;  2E2J J;  2L0K A;  4TN1 A;  1RR7 A;  1FNB A;  4YZ0 A;  4RDJ A;  5JHU A;  2XGC A;  4I0A A;  1D1C A;  4WWC A;  4C2U A;  1OOC A;  1K79 A;  2V1U A;  4EV0 A;  5IYB J;  2JRT A;  4X7C A;  2YUS A;  4KIF A;  3RSN A;  4AF7 A;  1RES A;  1I5Z A;  1F36 A;  4F7D A;  4CO8 A;  2ID3 A;  2WC2 A;  1RKT A;  2X51 A;  4QHY A;  2MLG A;  1CGP A;  3K1N A;  4F91 B;  3K9T A;  1I7P A;  2W48 A;  1ZR2 A;  4U87 A;  4KDP A;  3BPX A;  3OS0 A;  9ANT A;  2K4J A;  2MBF A;  2JJ1 A;  3GVJ A;  3ONU A;  4P1V A;  3LSR A;  4NC6 A;  2M87 A;  5KNL A;  2BM6 A;  5J1R A;  2DA3 A;  3I55 B;  3DWL E;  3L09 A;  2KRF A;  1R1V A;  4MYT A;  4PDK A;  2BM7 A;  1CNE A;  1WRJ A;  1ZEL A;  4ZCI A;  2EFO A;  1MMA A;  2R9V A;  1XDU A;  1I39 A;  2FA5 A;  2OYN A;  3ASO H;  3A2K A;  2DTZ A;  3D26 A;  2EK5 A;  3I9V 2;  2KJB A;  2EV6 A;  5H6Q A;  3K69 A;  1KZH A;  5HS8 A;  5HNF A;  4ENN A;  1ZM3 A;  1MGT A;  1SD5 A;  3G1M A;  2MW8 A;  4P2N A;  2O6G E;  5CVI A;  4M6V A;  3S17 J;  2L3D A;  3DEW A;  1RQP A;  4F92 B;  3OYD A;  1FWZ A;  1PLU A;  3C2B A;  2PX9 A;  4YFX F;  1GLN A;  2PMZ A;  3OYC A;  3SYJ A;  3F9K A;  1ZGA A;  1V5V A;  1VQM I;  4LIU A;  2ZME A;  3CUQ A;  2J5P A;  1O3Q A;  1BX1 A;  1N8R D;  3MHP A;  1FT9 A;  1N05 A;  2O0Y A;  4HX4 A;  4MLO A;  4MTE A;  4ESB A;  5F4M A;  3CCS B;  2VOP A;  2X3H A;  4OIR F;  3FJO A;  2X6O A;  3V7A A;  1N06 A;  3OKX A;  2ESH A;  3GTJ J;  2V9K A;  5L46 A;  2GPJ A;  4HE6 A;  1DPU A;  4KIG A;  1S72 B;  4DYR A;  5FL7 A;  3F21 A;  4OM9 A;  1D5V A;  3OE7 A;  1OFC X;  4KNY A;  1ON2 A;  4XR6 A;  4ANJ A;  2R7F A;  1QA2 A;  4BH9 A;  1XN7 A;  3GVL A;  1Q1V A;  3OEE A;  2EIM H;  1E3P A;  5GV7 A;  1D0Z A;  1X1P A;  3Q0V A;  1Y0Y A;  1KD1 D;  2CV1 A;  1YIO A;  3OJW A;  4BDZ A;  3FY3 A;  2ZJ2 A;  3RIQ A;  2WSS A;  1U3E M;  1OGJ A;  2RRE A;  5DNS A;  2CC2 A;  4XOP A;  5IK2 A;  3A8J A;  2QYU A;  3PA2 A;  5AMV A;  4PC1 A;  5FRO A;  4LK0 F;  1E17 A;  1EJ9 A;  3ERE D;  3IAM 2;  3UR3 C;  1FPQ A;  2KFD A;  5J6X A;  2KJC A;  4PFP A;  4P9S A;  3JTH A;  1A6I A;  1A35 A;  3AVX A;  5B5E C;  1HSJ A;  5BPD A;  2R3S A;  1WOO A;  3SZP A;  1GT0 C;  2BXY A;  2LLK A;  3B8H A;  2BOL A;  4WF2 A;  3TO6 A;  3TH0 A;  4IHW A;  1SD4 A;  2J7K A;  3AG3 H;  3KIO A;  4OPS A;  3G6E I;  2R7S A;  4BE1 A;  4I6Z A;  2QSG X;  2ZL6 A;  4X0C A;  3ABU A;  1TT5 B;  2FNA A;  1YLO A;  4JRA C;  2F3L A;  4DZJ A;  5J1Y A;  1VQ4 B;  1HST A;  3C3W A;  4YRV A;  3ZZT A;  2ELH A;  4KKS A;  3Q0U A;  5LFA A;  1ETQ A;  3FDY A;  2BPO A;  2NPF A;  2A61 A;  4Z4R A;  2JMW A;  2PLF A;  4HDU A;  5IP7 J;  5HOD A;  3TOA A;  1WJD A;  3VST A;  3PUB A;  3A8I A;  4A0X A;  1TYX A;  3I58 A;  2HCJ B;  2ZXI A;  2UVF A;  1KK1 A;  4A0Z A;  1T2K A;  4DQK A;  3H36 A;  4R1H A;  4UB6 C;  2DOD A;  2KZG A;  2YX7 A;  3ZQC A;  2MD0 A;  2RC4 A;  4BHC A;  5L3C A;  3CCQ B;  2NVQ J;  3GZN B;  4UZU A;  1EF4 A;  5E3M A;  5K5O A;  2CS3 A;  2XSJ C;  2QKM B;  5AON A;  2QWW A;  3HHG A;  4EJT A;  4D5C A;  1K73 D;  2G7U A;  2YSR A;  2BN4 A;  2BVL A;  2X8K A;  1KC8 D;  3JCU C;  4Q48 A;  1WOS A;  2R7W A;  2XRL A;  4O6J A;  5FKO A;  1OFM A;  3DBR B;  1GUU A;  2HS5 A;  2HXI A;  1BR2 A;  3H0D A;  2Y69 H;  2CW0 F;  1U9O A;  2R7O A;  3ONQ A;  4LLG F;  1A5J A;  5TY0 A;  1S9H A;  1EH7 A;  2Y9Z A;  5D8K B;  1QZE A;  1UST A;  2KRC A;  3I54 A;  3BH6 B;  2M7B A;  2YPR A;  2BHZ A;  2JSP A;  4C3J J;  5BSX A;  1MSF C;  1VQ6 B;  1MBE A;  3DTK A;  3D1N I;  5KSW B;  2OD5 A;  1UB9 A;  3RDI A;  4E7K A;  2GBY A;  2NAZ A;  5IP9 J;  2WZN A;  3LQQ A;  4XKV A;  2LH9 A;  3BRO A;  3DV8 A;  4XN3 A;  2O5R A;  4XL9 A;  1HA8 A;  1GAQ A;  1X4P A;  2VB6 A;  3CW2 A;  5FA6 A;  4GXO A;  1W0U A;  5LRR A;  4CYC A;  3CDL A;  2R7V A;  1VQP I;  1W1W E;  1E3Z A;  2R5Y B;  1I6X A;  1WI9 A;  5EEH A;  3N6Z A;  2HVR A;  2ME0 A;  3KRG A;  4BE0 A;  1HXD A;  2EFG A;  2X6W A;  2K27 A;  3BR6 A;  3IC7 A;  1P4W A;  4QPO A;  4FT8 A;  3TDZ C;  1FNM A;  4I98 B;  4P96 A;  2CU7 A;  3KP6 A;  2XHK A;  2AXT C;  2CRG A;  2C77 A;  3JRA A;  2MAB A;  4WZT A;  5IOZ A;  4WZE A;  4L9N A;  1OCR H;  2DMN A;  1RU4 A;  2LBF B;  2IW5 A;  2HZD A;  2FVG A;  1QZY A;  3QOP A;  5EG0 A;  1T8I A;  5K5Q A;  2GXB A;  1ZQ3 P;  4A0Y A;  2VT3 A;  2OK7 A;  4HPQ A;  4ZDL A;  2VC1 A;  2VT2 A;  3CCE I;  2PFB A;  4OMZ A;  4BEH B;  1EFU A;  3BZK A;  2EV5 A;  3FMS A;  3GZ6 A;  3CCL I;  2K02 A;  2VOO A;  3H0G J;  2CFX A;  3SFI A;  3ZQI A;  2LD5 A;  1FMW A;  4LGW A;  3LSI A;  1YIT I;  3ULQ B;  2QVO A;  4XN0 A;  3R61 A;  1H0M A;  2H1K A;  4A5M A;  3BCF A;  1J9I A;  2R7Z J;  3LJY A;  3CP8 A;  3RKY A;  2VBV A;  1FBS A;  3PSI A;  2FJ1 A;  4Z2Y A;  4G1V A;  2K7L A;  2Z99 A;  3A4C A;  4OU0 A;  3VDX A;  3CO6 C;  1TNS A;  3BR1 A;  2W84 A;  4U0V A;  4DBQ A;  2IPQ X;  3ZMZ A;  3IKT A;  3HRM A;  2VKH A;  4IJA A;  2IA1 A;  5GV8 A;  3RI4 A;  4E4H A;  1IHM A;  3U2Q A;  2CF4 A;  1LFB A;  2E2H J;  3GTP J;  1R58 A;  2PBI A;  4N4O B;  3G2B A;  1UHW A;  4ITV A;  4FHT A;  1N08 A;  3E1S A;  4QTR A;  1WTH D;  2HOE A;  4L8J A;  2OU2 A;  4M3B A;  1QA6 A;  1TYU A;  2VFO A;  5IYN A;  3V7C A;  2QDX A;  2PMU A;  1RRJ A;  1AIR A;  1X1B A;  1BI0 A;  1T08 B;  1JTX A;  2DK8 A;  2C78 A;  4KJZ A;  2BM4 A;  3S1N J;  4FN5 A;  5CJ9 A;  1R7J A;  2XV4 S;  3LST A;  2WA0 A;  2M5W A;  4HE5 A;  1O88 A;  4V2G A;  3OJX A;  4Z1M A;  2JUC A;  1K6Y A;  3GTG J;  3CCU B;  1U8B A;  2IOU G;  2O0V A;  2K9N A;  5JMC B;  3CRZ A;  4C43 A;  3IWF A;  3HTS B;  3PNV A;  4UZE A;  4YEJ A;  3BTI A;  1LLZ A;  3OS2 A;  4NK6 A;  4NHJ A;  4YZQ A;  2LRD A;  3RYR A;  2VBX A;  1E0E A;  1JJ6 C;  1OLT A;  1KK2 A;  2L4A A;  1A8P A;  4IOA F;  1LDD A;  3JR9 A;  4L9J A;  2E71 A;  3I4N J;  1IUY A;  3CC2 B;  3I0T A;  3MEX A;  2OBS A;  1DBO A;  2DOA A;  2JPB A;  4PK4 A;  1L3L A;  2K85 A;  1DBG A;  3ASS A;  1BBY A;  4II3 A;  4CCM A;  3E6C C;  3QFR A;  5F4O A;  1VI0 A;  4CUG A;  1VND A;  3F6V A;  3WE2 A;  1QRB A;  3V7R A;  4DIQ A;  2HDW A;  2BXZ A;  5CQE A;  2V79 A;  4Q4Z F;  1YS7 A;  1X0C A;  4KMU X;  3SXY A;  3JUR A;  3H9G A;  2FNP A;  3BG6 A;  5L3G A;  1SMT A;  1FIA A;  1ZHF A;  2DQR A;  3ABT A;  4KA4 A;  5LEK A;  5JR3 A;  2CQ7 A;  1NB0 A;  4C3H J;  2A68 F;  3K7A J;  4ZYA A;  4BBR J;  2WPD A;  5L3F A;  3CC2 I;  2DER A;  1Y0U A;  4L5J A;  1IRX A;  1D0Y A;  2PYG A;  3LSM A;  4RD2 A;  2VJ4 A;  3KZI C;  1ZN2 A;  1Z67 A;  3KYC B;  2LG4 A;  3HUG A;  4ABZ A;  5K7Z A;  3KEY A;  4CCK A;  1HBX G;  5B6I A;  1JKR C;  4A2U A;  3K10 A;  2UXX A;  1QUE A;  1TTY A;  1KMH A;  1TWC J;  2OZ6 A;  3R6K A;  3SLD A;  1BN5 A;  1KU3 A;  2V7X A;  3GFM A;  3HKZ A;  4Y52 J;  1OB5 A;  1OIS A;  4G7W A;  2RGV A;  1FRN A;  1GVD A;  1MND A;  2HNH A;  1JGS A;  3ML3 A;  5E79 C;  4I09 A;  4BY1 J;  2DMT A;  4RM2 A;  1S6L A;  1FOK A;  2LC2 A;  3BY1 A;  3S1Q J;  4P26 A;  4M3F A;  3WGI A;  1M90 D;  4XLC A;  3WTT C;  4S0H B;  3BJ6 A;  2QM3 A;  5TGT A;  4QV2 A;  4RLF A;  1WGX A;  4OIQ F;  3KLN A;  1XG1 A;  3BC8 A;  4XID A;  2L7Z A;  1TWF J;  3LL7 A;  3G1O A;  4MHG A;  2HDD A;  5F0H A;  4M73 A;  1ZR4 A;  4RM0 A;  3FBN B;  2V9P A;  3KP4 A;  1ZRF A;  3VMF A;  4N3G A;  1ETV A;  1YG2 A;  3LFK A;  3J80 K;  1MSE C;  2R7U A;  3SUC A;  4OP7 A;  3DU5 A;  4G6I A;  1FRQ A;  3QU3 A;  1GHC A;  3VSU A;  2EB7 A;  2H8R A;  4E7H A;  1YIJ B;  3KET A;  4B4D A;  4F52 A;  2JJ2 A;  1B59 A;  5D5X B;  2CUZ A;  5LEJ A;  2FOW A;  4O5V A;  3HIF A;  1G3Y A;  2WY8 Q;  2XAS A;  1U5T B;  3PQK A;  4U88 A;  4JMQ A;  1RUN A;  1WVR A;  2GJP A;  2VZL A;  1HDD C;  4A93 J;  1NHC A;  3EYY A;  2LRE A;  2L54 A;  2F4O B;  5DCM B;  5HDG A;  4CCJ A;  5GP9 A;  5GAG J;  1EH8 A;  1WXR A;  1IZ1 A;  2E19 A;  5H2F C;  5DCF A;  1JUP A;  2CND A;  2DA6 A;  3CUQ B;  5HKK A;  2VAS A;  4LFU A;  5M3F J;  1YX5 A;  2DY1 A;  3SQV A;  3K1P A;  3K4J A;  3T8R A;  2CBX A;  1F9N A;  3H92 A;  2DQL A;  2FD5 A;  2RC5 A;  2Y48 A;  5HZA A;  1CZF A;  2DPD A;  2W7Z A;  3RPU D;  3K4K A;  2VC0 A;  1WZ2 A;  3F8C A;  3R6J A;  1JUS A;  1HW2 A;  1A6Q A;  1E63 A;  1S3J A;  1QFY A;  3Q9V A;  3CB4 A;  2H1L A;  2VFM A;  1NTC A;  2IS1 A;  1T6S A;  2PN6 A;  3J81 K;  2RC6 A;  2CO5 A;  4M6Y A;  5J35 A;  5ED4 A;  4Y33 A;  4AF6 A;  2E35 A;  3HC7 A;  1MAB A;  1ZRC A;  2CW5 A;  4W8S A;  4BQQ A;  2JN9 A;  1YX2 A;  2M8E A;  4Z4Y A;  2HWV A;  1EE6 A;  2EFP A;  2YWH A;  4FIS A;  2XIG A;  3PUM A;  2WAQ N;  3MKL A;  3OYM A;  4HX7 A;  3W2E A;  4U4B A;  2HDC A;  5JFR A;  1JKQ C;  4RA2 A;  3O2P E;  2CJJ A;  4NB5 A;  2GOM A;  3ABM H;  2VON A;  1V0F A;  1I50 J;  4A3C J;  1I27 A;  1WQ2 A;  2OZU A;  2C4U A;  2RVC A;  4X05 A;  1M1K D;  2QQA A;  4LOC A;  2WB1 A;  1FOX A;  3ECO A;  1QG0 A;  2BM0 A;  3VMW A;  5GPA A;  4RB3 C;  3CME I;  2JJ7 A;  2ACJ A;  1YHQ I;  2OK8 A;  2LY9 A;  1QX4 A;  3PET A;  1YS6 A;  2LYC A;  3V8J A;  4BYY A;  1H8E A;  3E97 A;  3DXJ F;  1GR1 A;  2RDP A;  2BM5 A;  3A0H C;  3FX3 A;  4D0P A;  3JRI A;  5FLX K;  4WX9 A;  4F3Q A;  4M3D A;  1IJF A;  1MMN A;  3AFH A;  4HDV A;  1QQ1 A;  3QOE A;  4YAL A;  1JA1 A;  4RGU A;  2FMY A;  2DFH A;  5LHI A;  2XAJ A;  1QHH D;  2NV4 A;  4HNT A;  2INV A;  2R5Y A;  4EAT A;  4PZJ A;  1WCM J;  2ZC2 A;  2K4B A;  1PYV A;  3JX8 A;  1FNN A;  3FF5 A;  5IYR A;  4DW6 A;  4Y3O A;  3HOZ J;  4L18 B;  3B6C A;  3FXU A;  2HZT A;  3MKZ A;  1LE8 A;  1PJ5 A;  2CSO A;  3SEQ A;  1VQL I;  2L2O A;  4CHU A;  3NAU A;  2DMQ A;  2ESN A;  5HXB A;  5IYW A;  1NB9 A;  1U9N A;  2LBF A;  3U6B A;  4A6E A;  5AIQ A;  3A8K A;  1P9Q C;  3GQ7 A;  5EF6 A;  3GBG A;  3WGG A;  1D2E A;  1UHM A;  4LJZ F;  1VTN C;  1YOV B;  3AG4 H;  2P5V A;  3VO2 A;  1YI2 B;  1I3A A;  4C2T A;  5EDN A;  2V6C A;  3CCV B;  1BOB A;  4JQF A;  4BEH A;  5FD6 A;  1Y8R B;  2DOF A;  2FQ4 A;  3NQO A;  5GAH J;  1VQO I;  1XGM A;  2CV0 A;  2VBU A;  1GVJ A;  4OAY A;  2BSA A;  1OKR A;  1H89 C;  5AIP A;  4P3I A;  3ABL H;  3RCO A;  1IA5 A;  5HLI A;  5J47 A;  5LGU A;  2B7E A;  3ZBU A;  1NHA A;  5J3O A;  3SEJ A;  2X6Y A;  3SYT A;  4M0L A;  4J00 A;  5TIS C;  3T51 B;  3OSG A;  1HC8 A;  2HPI A;  2XKP A;  4BNC A;  2D74 A;  3FMR A;  4GYI A;  3S3M A;  4PGO A;  5FO0 A;  2DFF A;  3P26 A;  2M9H A;  5E3O A;  3OS1 A;  2D1V A;  3I4P A;  3PNY A;  3J80 Z;  1DG1 G;  3LVB A;  1MBH A;  2EIX A;  3BT9 A;  3SEZ A;  2R6H A;  2DA4 A;  3L2V A;  2STW A;  2E1R A;  2VBY A;  2GK6 A;  2HKX A;  2HDN B;  1YJN I;  1FC3 A;  4HNU A;  1IN6 A;  1Y1W J;  2KRH A;  4EM1 A;  1ETO A;  5HS7 A;  4EJO A;  4XMY A;  1RMG A;  4L5E A;  1YO5 C;  3AG1 H;  4AD9 A;  2DI3 A;  2FSW A;  2IXS A;  2XAG A;  1R71 A;  3LSP A;  4Q47 A;  2TDX A;  4LG3 A;  1XMK A;  3CD6 B;  4XM3 A;  4TMW A;  1BR4 A;  4LC0 A;  3DEE A;  4D9J A;  2HYF A;  5EG0 B;  3P9K A;  4QPQ A;  2IVM A;  5DS0 A;  3NAW A;  1OMI A;  3HJE A;  3CC7 B;  5EJC A;  4UB8 C;  4BHB A;  3J7Y J;  3CLQ A;  3RPU A;  3FPK A;  3CPW B;  1Y8Q B;  1JGG A;  2FEZ A;  1QVU A;  1JHH A;  1S7A A;  3OW2 B;  2DT5 A;  3B8Y A;  3T56 B;  1I3Q J;  3KL9 A;  2JN6 A;  4FAS D;  2W4S A;  5D4S A;  3ZZU A;  3BG5 A;  2TCT A;  2ZBK A;  1BQE A;  4XON A;  1YJW B;  2EV0 A;  2IGM A;  3CTA A;  3A01 A;  1LEA A;  3U2R A;  1NG7 A;  2Y0S N;  1SEU A;  1MD0 A;  1NK2 P;  4ON0 A;  2WAD A;  1R6R A;  3J81 Z;  3T5X A;  5D6F A;  2D2W A;  2QE7 A;  1VFC A;  3COA C;  3IH4 A;  3VSK A;  2M4K A;  3VMV A;  3FMQ A;  4NCN A;  2QY1 A;  3NE5 B;  3RKX A;  5EEA A;  2JTV A;  3G73 A;  2LR8 A;  2DFI A;  3LAP A;  4BHP A;  2E1B A;  4RPB A;  3BLY A;  3SDG A;  1VQK I;  1VF7 A;  3VSV A;  2OPT A;  5IYD J;  4HST A;  4EEF G;  3AL0 C;  3MMP A;  5BSY A;  3H9J A;  4ENK A;  4S05 A;  2VPL A;  2XNJ A;  4BJ5 C;  4BBS J;  2R7Q A;  4RAG A;  4PGG A;  2B9S A;  1SVL A;  3HG9 A;  1HW5 A;  2FBH A;  3C2G A;  2HVS A;  1CF7 A;  1DGR M;  5LHH A;  2A05 A;  1SC7 A;  3R60 A;  4ZYD A;  5B1A H;  1YW9 A;  1UAA A;  1OCT C;  3D5L A;  4NQW B;  3G3Z A;  1OFD A;  4BXU A;  2V26 A;  1PP7 U;  2WBM A;  1GO2 A;  1IDJ A;  3ZRG A;  4UVC A;  2OTJ I;  1HKT A;  4JK1 X;  3CCR I;  2L9N A;  2H09 A;  2D45 A;  1G59 A;  4RCZ A;  3GLX A;  2EWE A;  2E7W A;  2IS4 A;  2DOG A;  2UWM A;  1MNE A;  5F0C A;  5D5V B;  5FLX Z;  1Q7Y D;  2WAQ A;  4I76 A;  2NTQ A;  4Z4V A;  3V4G A;  3CXC B;  4EVI A;  5EGO A;  3OYK A;  2Z16 A;  3A02 A;  3B90 A;  3QOD A;  2AXL A;  4M53 A;  1XD7 A;  2K40 A;  2Y75 A;  2CW7 A;  1BX0 A;  3N4M A;  1H9G A;  2NTP A;  1S8N A;  1EA3 A;  1JNY A;  1PJR A;  1MNM C;  2BY2 A;  2IGO A;  3AVU A;  1DQU A;  4YAW A;  1IB4 A;  1LKX A;  2R5Z B;  2QTL A;  1DDI A;  3CJQ B;  3SQN A;  3CP2 A;  2VQG A;  1MRZ A;  1KQS B;  2M45 A;  2QBY B;  2HPM A;  1KU7 A;  1HKQ A;  4EMS A;  1NBM A;  2VBK A;  3T53 B;  5C4J J;  4YDT A;  5C4X J;  2VKV A;  2ZL5 A;  2ISZ A;  3L2R A;  2O61 A;  1AWC A;  3DPU A;  1SM4 A;  3TOB A;  2V6E A;  1YJ9 B;  1TQP A;  3DBH B;  1WSV A;  2COM A;  1F60 A;  1U5T A;  1SVO A;  2CQX A;  4AIK A;  3HUG B;  1GQ8 A;  4FE4 A;  2VQL A;  2P4W A;  1U2W A;  1YLF A;  5KK1 A;  3WHB A;  3I55 I;  2L02 A;  1GV2 A;  2IS6 A;  1VQN B;  1R5I D;  2V7U A;  5DCM A;  2NT6 A;  3BY2 A;  3OYE A;  5JLV C;  1L1I A;  4RLQ A;  2V7Q A;  1BLI A;  2Q0O A;  2QX3 A;  1G3W A;  5K5R A;  2HTS A;  2LF8 A;  4V2F A;  3TW6 A;  3F8N A;  1OR7 C;  3HOX J;  1PE9 A;  2F1M A;  4I7H A;  3GQB A;  3OZU A;  1FTZ A;  1UD4 A;  3WYA A;  3IV5 A;  1J9Z A;  3CPX A;  2KIU A;  4XKW A;  2QCO A;  1X3U A;  4ENJ A;  5LGT A;  1T38 A;  2QF7 A;  3IRQ A;  3ZXS A;  1VHO A;  1SFO J;  2V7V A;  1OYY A;  2LFB A;  1BL0 A;  4A3L J;  3AVY A;  4N9I A;  1Y39 A;  2M5S A;  2LK2 A;  5DYM A;  1HKS A;  4AIH A;  2XTX A;  1XGN A;  3KLO A;  5ICE A;  3MQ0 A;  1IXC A;  4OZZ A;  4FWT A;  3MWM A;  1B9M A;  5FD5 A;  1D5Y A;  1VQN I;  4ZDO A;  3FIS A;  2ID6 A;  5E3N A;  4YEI A;  1N77 A;  3OYF A;  4OJP A;  4KIC A;  3I71 A;  5LMZ A;  4AVP A;  3HRU A;  4IHY A;  4DK1 A;  1ZG1 A;  3DLA A;  1UD2 A;  2JVH A;  3ZMS A;  2H6C A;  1TQM A;  3VFZ A;  1X3Z B;  2NVY J;  3E5U A;  3C18 A;  3CCS I;  4OIP F;  2VJI A;  1K83 J;  1P7J A;  3Q5F A;  4Z06 A;  2O7O A;  3S16 J;  2X0K A;  3WG7 H;  3ERM A;  2DT7 B;  1ETY A;  5GTI C;  2JT1 A;  2R92 J;  4ESF A;  1W7P D;  4JX6 A;  5DD8 A;  1S72 I;  4BS9 A;  1I1S A;  2O0W A;  4FQG A;  2Z1D A;  4LB5 A;  3KPH A;  1UEL B;  2FU4 A;  1K78 B;  1LJ9 A;  2Y30 A;  1IRG A;  2QA4 B;  3PSS A;  3MMY B;  3F23 A;  2DDB A;  4YEL A;  4U9U A;  3BG7 A;  5DS9 A;  4MTD A;  2ZBV A;  2DPU A;  3G71 B;  2B7B A;  3L2Q A;  1WWX A;  1X3W B;  4G7H F;  1QGZ A;  1BN8 A;  2MGQ A;  4FTH A;  2BBY A;  2ISY A;  1V5G A;  1TSP A;  2Q6O A;  4B43 A;  3H94 A;  1MH4 A;  4LG0 A;  2GOX B;  1S7O A;  2YX4 A;  3ZQL A;  2BW3 B;  1R9T J;  3MZ8 A;  4N3N A;  4WWV A;  1ETK A;  1LPQ A;  3KFW X;  5FKN A;  1LQ1 A;  1N78 A;  2OTL B;  4FET A;  4LB6 B;  4BDY A;  5FRM A;  2CFO A;  1IV6 A;  2BGI A;  2XEX A;  2HXO A;  3BDD A;  3K2Z A;  1Z6T A;  5E1X A;  4HX8 A;  1AMO A;  2BEO A;  4EJW A;  3MVP A;  2Y0M A;  3GTL J;  4I02 A;  4CGZ A;  2W82 A;  1ZGW A;  1UCR A;  2RNG A;  5THX A;  1U2R A;  4ZYH A;  1E3O C;  4IHV A;  2V1N A;  3KP7 A;  4IHT A;  2IP2 A;  3J7A Y;  3B82 A;  1DGW Y;  5KW9 A;  2XZO A;  1VQ5 B;  4W97 A;  1AA7 A;  1N75 A;  2ODL A;  2W1O A;  5J3L A;  1BA5 A;  1U78 A;  2CUF A;  5FLV A;  1G7C A;  4P3Y A;  1VLY A;  1QQI A;  3ZQH A;  1VQ4 I;  3WBJ A;  4RMN A;  3QFC A;  1BI2 A;  4G9Y A;  3ZPL A;  3GTM J;  3LQE A;  2K9S A;  1IDY A;  2YS9 A;  1BI3 A;  3A35 A;  3SKB A;  4WCG A;  2PE3 A;  5FIU A;  3OYN A;  1K4S A;  1BI1 A;  1MMG A;  3BCB A;  3H9Q A;  3A1Y A;  1ZM9 A;  3JRG A;  3OP1 A;  3OYJ A;  1R1U A;  1A04 A;  3EDP A;  3BR5 A;  3QAH A;  1P2F A;  3RZO J;  3RYP A;  5TR9 A;  2G9W A;  4A3E J;  2B0R A;  4MGR A;  4RD4 A;  2IRF G;  4Y4R A;  1K61 A;  4WZK A;  2P5L C;  1Q81 D;  4HW0 A;  1SAX A;  2XT2 A;  2PYH A;  3CCQ I;  5JLW A;  3PA1 A;  3R0A A;  1V54 H;  1YE9 A;  4XLA A;  5H6R A;  2GIV A;  3S32 A;  3EUK L;  1CQT A;  4IHS A;  2DAO A;  1N07 A;  1O8J A;  1IB0 A;  1XB4 A;  1SD7 A;  2DJI A;  1GJR A;  2QUF A;  4MR0 A;  1WDT A;  3QYE A;  2V4J C;  4JBA A;  3N90 A;  1TC3 C;  3BY6 A;  4L5I A;  1NH3 A;  2EIK H;  4BQA A;  1NDH A;  5J4V A;  2E1N A;  1TUI A;  5EYR A;  3E1Y E;  4RAY A;  5CVR A;  1RIO H;  4LBY A;  2XND A;  4GQN A;  2XUB A;  3LMW A;  1N0V C;  3ABK H;  3CDI A;  2GQF A;  1BC8 C;  3ES9 A;  3KEW A;  1IRF A;  4XLH A;  3OYA A;  3IL2 A;  3H3U A;  3JW4 A;  1LE8 B;  1U8R A;  4PC2 A;  1VQ6 I;  1HW1 A;  3FXR A;  3LOC A;  3WGH A;  4XOT A;  4G8X A;  2LOO A;  3HL2 A;  4C2L A;  1BIB A;  3FIW A;  2QGG A;  2KMU A;  4RD1 A;  2IEK A;  4J19 A;  2B5O A;  1R36 A;  3F8M A;  4G6Q A;  3M8F A;  4RS8 A;  4L0Y B;  2R7X A;  4P5O A;  2EFQ A;  1NG6 A;  3RQI A;  2WV1 A;  4BUP A;  1WSU A;  1ZRD A;  1KJZ A;  1QZZ A;  3PO2 J;  4TSF A;  2YR2 A;  2M0C A;  2XC7 A;  1X1C A;  3GEZ A;  1BJA A;  3DCF A;  2H6B A;  2OA4 A;  3DTI A;  3CMM A;  1D8J A;  1OHH A;  2XAQ A;  3BH4 A;  3T8T A;  4M9X A;  1DP3 A;  2F5F A;  4W1U A;  5KCM A;  3VPR A;  2F1L A;  3WTW C;  2MFZ A;  1IJW C;  4G7O F;  1D1N A;  3K6G A;  1TL8 A;  2XF7 A;  3ZQF A;  5IP6 A;  3HZJ A;  4BGD A;  4U0W A;  1OGO X;  3S2W A;  4ESJ A;  3UNG C;  4YAU A;  3CMA B;  2P0W A;  2QMU A;  4TMV A;  1BR1 A;  4RD0 A;  5D6E A;  1O8L A;  4AM3 A;  3M1C A;  2VE8 A;  4PC6 A;  2XRN A;  3BTC A;  1OFL A;  4Z4Z A;  2QSH X;  1ORK A;  2P7C B;  4IL6 C;  1KU2 A;  3LAJ A;  2X9D A;  3ZN1 A;  1FX7 A;  1W36 C;  1JUM A;  4YXW A;  4D7M A;  2NT9 A;  2GLO A;  4F93 B;  1OYI A;  2IJL A;  2BY3 A;  3NWT A;  1VQ9 B;  3HBL A;  5CVJ A;  3WHC A;  4R79 A;  2KLO A;  4B8X A;  3CDH A;  2W6I A;  5D4R A;  3IH2 A;  1K6O A;  3DKW A;  1O8F A;  4BAC A;  5CYV A;  4EGY A;  2O9L A;  2CQK A;  2UXN A;  1MJA A;  2OV7 A;  4NQW A;  4WQM A;  2WZP P;  1T56 A;  1Q86 D;  3GTQ J;  2Q1Z B;  3WU1 B;  3PUF A;  2XGX A;  4ZH4 F;  1LEB A;  2VBT A;  1HDP A;  3QFT A;  4RCY A;  1HF0 A;  5B1B H;  3HGY A;  4ZV4 A;  2DT6 A;  1BHE A;  5D5W B;  3CF5 F;  2GZW A;  3S1R J;  1JXS A;  2OBR A;  3AVW A;  4PJ0 C;  4C3I J;  1O3S A;  1O8M A;  1IN7 A;  2TRT A;  1UD5 A;  2E5N A;  3JRD A;  1VQ9 I;  3N97 A;  4LLN A;  3E6M A;  2YUH A;  1LUJ B;  3WG9 A;  3VSL A;  2KZV A;  2MLK A;  1TVC A;  2LVS A;  4ZJZ A;  3WTX C;  3PJR A;  3AGP A;  1LLW A;  4FXU A;  1W0J A;  4A3D J;  3BG9 A;  4NBQ A;  5HS9 A;  3CCU I;  1VQ8 B;  5DM7 F;  3LNQ A;  3A01 B;  3CES A;  2R5Z A;  4RDL A;  2D1H A;  3E7L A;  3QP5 A;  2R93 J;  4E7I A;  1XGO A;  1SFX A;  3BJA A;  4IRH A;  1Q1H A;  4G1B A;  2LKS A;  1CQX A;  5JHF A;  1S7E A;  2QBY A;  2A6T A;  3HM5 A;  3ZOB A;  3DPL C;  1XS9 A;  1IUF A;  1SVM A;  1KTV A;  3PSZ A;  1Y1V J;  4TMZ A;  3RIR A;  3EQL F;  4NC7 A;  2G0E A;  2EBI A;  5FLM J;  1PUE E;  2AO9 A;  3P5J A;  3B6A A;  3DF8 A;  1E43 A;  3C1D A;  1FYK A;  4PCQ A;  3ONY A;  1JI8 A;  3BG3 A;  1XSV A;  3HTU A;  2UV1 A;  2K9M A;  4X1E A;  4YIF A;  4H9G A;  4XD7 A;  5BMZ A;  2OCC H;  2OF7 A;  4AIJ A;  1WJE A;  1YYV A;  3I4M J;  4OIO F;  2NVT J;  2PIA A;  3S3N A;  5FO1 A;  2GJK A;  1CF7 B;  2WR8 A;  3I1F A;  4AID A;  2ZNY A;  2PJP A;  1XPX A;  4V02 C;  4Z4T A;  2VBS A;  3OAA A;  4B3G A;  1JJ2 B;  1T95 A;  2VE9 A;  2QYO A;  1EP3 B;  1O8H A;  1TZL A;  2BYV E;  3TED A;  2KKO A;  1EXM A;  1T5E A;  2L9R A;  2KIQ A;  3C2H A;  3PQJ A;  3TO7 A;  2LKX A;  4FCY A;  3G4S B;  1ZKG A;  4DYQ A;  3FXK A;  4Z4W A;  4P9U A;  3SZT A;  2W25 A;  5AN9 A;  1XG2 A;  2O8X A;  4CIC A;  2BSP A;  2IQ7 A;  1X4O A;  3RJP A;  4ETS A;  5EGO B;  2DN0 A;  1U6G A;  4OJ5 A;  5L3D A;  3SJZ A;  3ZQ7 A;  3UKG A;  1SAU A;  5IYQ A;  2WWY A;  4U49 A;  1OGI A;  1B23 P;  2P5K A;  3S3O A;  2OC6 A;  2XAH A;  5EZH A;  5M5X J;  3JQQ A;  1N0U A;  4ZCM A;  3H9N A;  4E70 A;  1JHF A;  2GA1 A;  2WTE A;  3OYB A;  1X58 A;  3DFG A;  3JRC A;  4AVZ A;  5D5U B;  3WTS C;  3F8F A;  1DAB A;  2P6T A;  1WHU A;  3LQR A;  4ZTF A;  2ZTG A;  2A07 F;  3TKY A;  2WYR A;  2ZME C;  1EZG A;  2LTP A;  5DD4 A;  5F08 A;  1S0U A;  2VKD A;  3WWG A;  3M1E A;  2OAZ A;  2XZP A;  1MDM B;  2DMP A;  3W2I A;  3CJT B;  2X53 S;  4QVA A;  2A6H F;  4RGS A;  3BC9 A;  2EZL A;  1K78 A;  3TDU C;  2AQF A;  4TT3 A;  2VJ5 A;  3LMM A;  4L9T A;  1WP6 A;  2EIJ H;  4PJL A;  3ZQG A;  3X2Q H;  1OR7 A;  2MG4 A;  3OOP A;  4MEY F;  1JKO C;  2ZFW A;  1PUF B;  1A31 A;  2V1X A;  4AWX B;  3HOS A;  2HMA A;  4X0G A;  5KAF C;  2HEO A;  4A5N A;  1QA3 A;  4AC9 A;  2FXA A;  2C2W A;  1G3S A;  4UVB A;  1IW7 F;  2E1M C;  2HFH A;  4LK1 F;  2JUG A;  4HF2 A;  2ZXH A;  2HOS A;  4S04 A;  1F20 A;  2LZJ A;  4IEJ A;  4RB2 C;  2NTB A;  2DK5 A;  4MNU A;  3H1C A;  1H9T A;  1J09 A;  2BW3 A;  2V31 A;  1IG7 A;  3RKQ A;  2M0M A;  2BY1 A;  2GQQ A;  2XT4 A;  3FHN A;  4OWR B;  1YIJ I;  2OQG A;  3S2D J;  4YAF A;  3VB2 A;  4D1Q A;  3BR0 A;  2HQN A;  2JA7 J;  3JQR A;  1ITY A;  3OIO A;  4IKF A;  4LIV A;  2XPW A;  5FNZ A;  2H8W A;  4M1K A;  3DU6 A;  3EYI A;  1Y0R A;  1X2N A;  3I56 B;  3DTE A;  1S4M A;  1YW8 A;  5B66 C;  2Q6L A;  1B72 B;  1H42 A;  1USS A;  4NUB A;  4C30 A;  5HOO A;  4P6V F;  4QUZ A;  4RD3 A;  5CPR B;  1TW2 A;  1E1Q A;  2R7T A;  1BW5 A;  1XSX A;  2PJR A;  1QFZ A;  1FOY A;  1F43 A;  4X8I A;  5CVU A;  2ZBU A;  1ZRE A;  3W2A A;  1W36 D;  1ZAR A;  3SDB A;  1WMR A;  2K9Q A;  3REO A;  3VNV A;  3AAF A;  3UW0 A;  5F1J A;  2QN6 A;  4I2O A;  3BWG A;  3AVV A;  4LBV A;  3CC4 B;  2I5U A;  2JDI A;  2E1M B;  4KUM A;  2RKH A;  4XLF A;  2STT A;  1SFU A;  1S29 A;  1VQ7 B;  2ZFU A;  2ZSI B;  1J59 A;  2NYX A;  2DJN A;  4V19 K;  2KP6 A;  3IKV A;  5FKK A;  3DKX A;  4DOZ A;  1DDG A;  3MZY A;  1HOM A;  4OPO A;  1JRG A;  4XBF A;  1UMK A;  3LA7 A;  2EPF A;  4YII A;  1QGA A;  1PP8 F;  3PUN A;  4OJL A;  2C5H A;  5FKM A;  3OYH A;  4WXH A;  3SZE A;  2V7T A;  3DQV C;  3Q3A A;  2QEX B;  5FFX A;  2CUJ A;  4LG0 B;  4ZC3 A;  1JA0 A;  2XB5 A;  3P4G A;  2DU9 A;  2RAE A;  1ENH A;  4CCN A;  2IAI A;  2LNB A;  2VLA A;  1B8I B;  1V0E A;  5IYP A;  1QVF B;  1BOA A;  3PVD A;  3AGQ A;  3SY2 A;  1XCB A;  5GTH C;  1OPC A;  2K3F A;  5F64 A;  4BKX A;  1E79 A;  3P9C A;  2VBE A;  5LBQ A;  2XAF A;  4PJM A;  4DQL A;  2XGJ A;  1RC9 A;  2DYR H;  3DEU A;  4N9H A;  1RUO A;  2WY7 Q;  4YHB A;  1R5N A;  1P4A A;  3GTK J;  1T6Y A;  4XQF A;  1XB2 A;  3ASP A;  1KQ0 A;  4JX4 A;  1R1T A;  1QHG A;  1OYW A;  3LSG A;  4RGR A;  5GPC A;  1QGY A;  2BY0 A;  3M9A A;  1PJ6 A;  2KVO A;  1XCV A;  3OYG A;  3ZR8 X;  3FKI J;  3EUH C;  4PAB A;  1PJ7 A;  3K4L A;  2KIM A;  2WJY A;  1YX3 A;  3BP8 A;  4B3X A;  2F4M B;  4DNC A;  2F43 A;  1FIP A;  1WPK A;  3NRV A;  3ISX A;  4UAJ A;  4AC0 A;  1H8A C;  3VO1 A;  1EH6 A;  4AYB N;  3BCD A;  4HZF A;  1JKP C;  4X7E A;  4Y7C A;  2EIL H;  4X7F A;  1GXQ A;  5BOX A;  1R49 A;  2ZXW H;  1I8D A;  4KIS A;  1H85 A;  2PMZ N;  5FJ8 J;  3K1M A;  2EZI A;  5J40 A;  2VNH A;  1LFU P;  3V76 A;  1KYZ A;  2ZB9 A;  1G3T A;  2EA2 A;  3HHH A;  4YFK F;  2D3N A;  2WAE A;  5FRN A;  2DXI A;  3DDY A;  5GAE J;  4WXD A;  1V55 H;  2FBK A;  2CV2 A;  2QEN A;  3VNU A;  2X48 A;  1SKQ A;  2NOJ B;  2MD5 A;  3LO8 A;  2P81 A;  1H80 A;  4PSX A;  1M1E B;  3HOW J;  3GUD A;  1H88 C;  1YI2 I;  1R4M B;  4E7J A;  4ACB A;  1MKM A;  2NVU B;  3CCV I;  4A3B J;  3ZSC A;  2KHM A;  3IWZ A;  4EJU A;  3KP5 A;  5ILS A;  3FM3 A;  1K4T A;  1BPL A;  5E8G A;  2DIE A;  3QPH A;  1MIJ A;  3O3K A;  4CYD A;  5HZB A;  1R5O A;  1HQC A;  4IXA A;  3OEH A;  3RY8 A;  2ICW G;  2BV3 A;  5J1U A;  3M7G A;  3VOD A;  4A3J J;  2PMH A;  1XMA A;  4MFD A;  4EQQ A;  2VUM J;  1Q82 D;  1SD6 A;  3SZG A;  1FY7 A;  4YFN F;  4E7Z A;  2MSY A;  3E0J B;  3WE3 A;  4H0E A;  4Z03 A;  3W2G A;  2VNJ A;  1TBX A;  3A1P A;  2NXN B;  1JT6 A;  1YW7 A;  1IDZ A;  3ECH A;  1O8G A;  2HLD A;  2QSF X;  5DSZ A;  3L9F A;  3WTV C;  3PIP F;  2GM4 A;  1ETX A;  4BQN A;  4NK8 A;  3SLN A;  3HOV J;  2P6S A;  4ZGN B;  2M1B A;  3AVT A;  4UV9 A;  2WJV A;  1UMQ A;  3E6B A;  2CRV A;  4J0Q A;  3F3X A;  2JSC A;  4I0B A;  1HG8 A;  1O8D A;  4YAO A;  3F8B A;  3D0S A;  3H09 A;  2NST A;  2A3S A;  1AOY A;  3AST A;  4U7B A;  3FHZ A;  1KZL A;  4QFM A;  3CCJ B;  2HQR A;  2EJR A;  1MH3 A;  3SFZ A;  4BXF A;  1O7F A;  4M74 A;  3U1K A;  3T1B A;  1YTY A;  4GDF A;  1EP2 B;  2X85 A;  1FP1 D;  4XSX F;  2J8K A;  1FX0 A;  1AU7 A;  5A2Q Z;  1FP2 A;  5DV5 A;  4Z6Y A;  3CMY A;  4UUT A;  2L7M P;  3CD6 I;  1Z7L A;  2LDU A;  3TP0 A;  4X6A J;  1E3H A;  4HLY A;  5LLQ A;  2JWT A;  5H59 A;  5HDN A;  3CC7 I;  1W7P B;  3JQP A;  1Z3X A;  2W7N A;  1QPI A;  1G4D A;  3GX4 X;  2O8K A;  4KKT A;  3CJN A;  4ENM A;  3RPQ A;  3IUO A;  2V7F A;  1YQA A;  2MC4 A;  2XB0 X;  2W57 A;  4HBL A;  4XRS G;  3F72 A;  4WK8 F;  3KYL A;  4A3G J;  2BF4 A;  2NS7 A;  5K1Y A;  1EWY A;  3MN2 A;  3CCM B;  2ZJR F;  1O3R A;  1RI7 A;  2H94 A;  2Z5U A;  1QFJ A;  1K5C A;  5DTD A;  4B44 A;  2XZL A;  1QCX A;  3J7A O;  1YJW I;  1FJL A;  2FE3 A;  2RQP A;  3C7J A;  1CNF A;  4LLL A;  3BH7 B;  3QYB A;  1WJB A;  2E34 A;  2QKL B;  1KU9 A;  4YCQ A;  4G7X A;  2H27 A;  1B2R A;  2DA2 A;  1E3X A;  4FE7 A;  3Q6Q A;  1B4A A;  1XTA A;  2Q8K A;  1Z7U A;  3LA3 A;  5ILU A;  2JQ7 A;  4Z4S A;  2G0Y A;  1QA1 A;  4X07 A;  1ZAO A;  1HF2 A;  4Z4U A;  4A69 C;  3Q38 A;  5IYC J;  4RD6 A;  3KZY A;  2GK7 A;  1MMD A;  1FZP B;  1ACI A;  4IOC F;  4ZCL A;  5KAI C;  1PVE A;  5E6T A;  2VN2 A;  4IO9 F;  3HPG A;  2IA0 A;  1PDN C;  4KT6 A;  2OQR A;  1G7T A;  2IGK A;  2VBW A;  3FWE A;  5JBQ A;  2N8G A;  4KH3 A;  3LWF A;  1R5H A;  2JA8 J;  4ZYG A;  3W5U A;  4EM0 B;  2ZKZ A;  2DEU A;  4UHT A;  4DK0 A;  3WTZ A;  1A36 A;  3VEP A;  3ZMV A;  1B6A A;  3BZ6 A;  4MEX F;  1IGN A;  2PI0 A;  3Q6R A;  1OB2 A;  3OOU A;  3LQ6 A;  1CLW A;  3GF2 A;  2RN7 A;  1IN4 A;  2LP0 A;  2ZCW A;  3HSE A;  4P1W A;  3JRB A;  1IRZ A;  1B1B A;  1XFO A;  3AL0 B;  1TLH B;  1B9N A;  1KCC A;  2A5W A;  2D5V A;  1FNC A;  3HAG A;  5HLT A;  2DFE A;  2GXA A;  4XRM A;  4BJT A;  2EZK A;  1MDM A;  1TWH J;  4OJ6 A;  2ETH A;  2VI6 A;  2AQE A;  4XKC A;  2VL8 A;  5TRD A;  3KX2 A;  4JOM A;  3K70 C;  4HYE A;  4HEA 2;  1ZLJ A;  2IS2 A;  2C5B A;  4GFB A;  5LHG A;  2AS5 F;  2LY2 A;  2OCE A;  3PM1 A;  1WJA A;  3TO9 A;  3U9G A;  2HR3 A;  2XSD C;  4BL0 B;  1PUF A;  4RAZ A;  2E36 A;  2HOT A;  2HTJ A;  1WJF A;  3QRF F;  1HA3 A;  1P4M A;  1T0F C;  3I59 B;  4R8H A;  2XRO A;  3ZCO A;  2VJJ A;  1DU6 A;  4GCV A;  1W5T A;  1VQM B;  2O3F A;  3W2V A;  1UG0 A;  3KEQ A;  4OIN F;  4HV5 A;  1GAW A;  2X4H A;  5JVG F;  2NSP A;  3DU1 X;  4QIW N;  1D8K A;  2LF7 A;  5C3E J;  1TYV A;  3GFI A;  2ADU A;  2Z33 A;  1REP C;  3GQ9 A;  4IRG A;  4OAZ A;  1OGM X;  1YJ9 I;  2X3U A;  4AYB A;  3RTR A;  1P92 A;  1D8T A;  2HYG D;  3E6D A;  4B3A A;  4DNT B;  2O04 A;  4EW9 A;  2ZZG A;  3ZC3 A;  3KCC A;  3ZZ0 A;  2BMW A;  2QQ8 A;  2NS0 A;  1UZC A;  3GME A;  2M4G A;  3B78 A;  3BNW A;  3J81 k;  2NS8 A;  5ICC A;  4CXF A;  1B72 A;  5D8L B;  5L3E A;  2X1E A;  1K28 D;  1KQ5 A;  2DYI A;  2DCE A;  6PAX A;  3LFU A;  1GV5 A;  3V8K A;  1HCR A;  1ZUN B;  2C6Y A;  2Z9O A;  1DU0 A;  2CH0 A;  4XRS A;  1LDJ A;  3ZIA A;  4GRI A;  3W5V A;  3P7N A;  1EV7 A;  1K7A A;  1ERD A;  3LYC A;  3ZQQ A;  1O8K A;  2QQB A;  3W3C A;  1OCC H;  4ZYE A;  4N0B A;  3GCM A;  1KON A;  1P7I A;  4UVA A;  4WXC A;  4U7D A;  3WBK A;  1C0W A;  1DPR A;  2M7A A;  5FO5 A;  4II2 A;  5LRS A;  5M5Y J;  3V42 A;  1KRH A;  3G6E B;  5DDG A;  3HRT A;  1X19 A;  4PGH A;  4RB0 A;  5ICG A;  4RB1 A;  3JRF A;  3AG2 H;  3KZZ A;  3QYF A;  2ZJQ F;  2ZIT A;  4I84 A;  2DCU A;  2L9V A;  1K8F A;  5H5J A;  3HSF A;  3L2W A;  4UUS B;  1BW6 A;  3OR2 C;  1R00 A;  1UFM A;  2L7F P;  2Z2S B;  4OJO A;  3I53 A;  2JA2 A;  1RZ4 A;  2M8G X;  1RPW A;  3O8H A;  4AU7 A;  3H5N A;  5E8I A;  2XF6 A;  1B8I A;  3MCA A;  1FSH A;  5J4Y A;  1W9X A;  4IX7 A;  2QA4 I;  4G7Z F;  5IT9 Z;  5DN6 A;  4CQJ A;  3H3Z A;  2VFP A;  3HYI A;  2E1O A;  1EFR A;  1Y0N A;  4HAM A;  1LFP A;  4LIT A;  5E1W A;  1UD3 A;  1UD8 A;  4Z05 A;  4TMX A;  1SMY F;  4CZZ A;  1JB9 A;  3DP7 A;  1E2X A;  3G71 I;  5F04 A;  3FXL A;  2NOG A;  2VPR A;  3TL4 X;  3OPO A;  1FSE A;  1YRN B;  2EZH A;  2F5D A;  5LD2 C;  4MIM A;  4L0Z B;  4A3I J;  5F6F A;  2IA2 A;  2X0L A;  4P25 A;  4NNJ A;  4P6Y A;  3ROU A;  2E7X A;  3S93 A;  2Y0S A;  5DUK A;  3K2A A;  4P55 A;  4HQM A;  3R6S A;  4A12 A;  3H3V K;  2PJR B;  4DZP A;  1ZH5 A;  3HOY J;  4LD5 A;  3BPV A;  1TWA J;  1V3F A;  4CCL A;  1Z6R A;  2OTL I;  4BXX J;  4TKO B;  3T9G A;  3BQY A;  2ME6 A;  4HRI A;  1XQB A;  4KYW A;  2VQH A;  4KKU A;  2OUM A;  2Y31 A;  1HZE A;  1JTY A;  1O8I A;  1W5C C;  1O8E A;  1HVX A;  2VXZ A;  2JZY A;  2HGC A;  4XLN F;  3GYH X;  1QRY A;  2XOK A;  1RWR A;  4I01 A;  4B47 A;  2R4G A;  5CVV A;  2O1D A;  3OL3 A;  1V4R A;  4RM3 A;  3HKZ N;  1VQ5 I;  3M3Y J;  4CZC A;  4PC7 A;  1QH0 A;  2HVQ A;  5BNG A;  1ZTR A;  2MA3 A;  1SAN A;  5EZG A;  3JTG A;  4M71 A;  4B09 A;  2IGN A;  4J01 A;  1OB0 A;  2FML A;  2O03 A;  5ICF A;  1SKY B;  1XMX A;  5KHD A;  3W6V A;  3BTL A;  3NEU A;  4IQJ A;  1K9M D;  2QLZ A;  3WOD F;  2LSO A;  4OPV A;  4E7S A;  3ZN0 A;  1W34 A;  4M4S A;  4IHX A;  3QPT A;  1F1Z A;  3T0Y A;  1MBG A;  1QNT A;  3WY9 A;  1YFH A;  3IP4 B;  4RGX A;  3JAM K;  3EET A;  1VHE A;  3K0L A;  1VQP B;  4JP0 A;  1IV8 A;  3QWL A;  1QVG B;  2Q2E B;  4CA0 A;  4FX0 A;  1POG A;  2L5Q A;  3F0C A;  3GVA A;  2ECC A;  4RAF A;  4YIR X;  3WTY C;  4MXN A;  3EUH A;  4KN4 X;  1FYL A;  1STZ A;  5IT3 A;  2ELJ A;  5C44 J;  2ELK A;  4BPR A;  3KEO A;  1Z3Y A;  2ZNZ A;  2JA5 J;  3W5H A;  3OIQ A;  2KDZ A;  2JA6 J;  2V1D A;  3U6K A;  2XNC A;  4M9S A;  5BPI A;  4DJA A;  3GIR A;  4M3G A;  1WKM A;  5EMN A;  2FBI A;  1X1A A;  3L7W A;  4G6D A;  4P12 A;  2A69 F;  2VBM A;  2XAU A;  3U1D A;  1FOW A;  2F6C A;  3CCE B;  3K70 D;  4UY8 I;  4ASN A;  1KTW A;  2X6X A;  4P9F A;  3CCL B;  3QSY A;  2O6W A;  2XC1 A;  1S5L C;  3ZUG A;  2M34 A;  4C0S A;  1YIT B;  3LSJ A;  5E17 F;  1G7R A;  4RPD A;  2VOD A;  4Y9R A;  1KGS A;  3E20 A;  1HLV A;  1TTT A;  1ONV A;  2R0Q C;  4XRF A;  5E18 F;  3FK6 A;  2CYY A;  1WOR A;  1WH7 A;  3A03 A;  3DKY A;  4Y7N J;  5K7F A;  3GZ5 A;  1AKH B;  3HDD A;  4KFC A;  4NBS A;  5F0F A;  5E20 A;  4M9Z A;  2GXG A;  4B1R A;  4YG2 F;  2XKO A;  2PLY A;  4QVJ A;  1XX5 A;  3WNC A;  2F5V A;  4KIB A;  4NC8 A;  1D3Y A;  5M3M J;  4ZZL A;  5JI6 A;  2VNI A;  1XDS A;  3EPZ A;  1IN8 A;  1W7P A;  5JVT A;  3BTJ A;  4CDG A;  2QQ9 A;  4Y13 A;  4LMY A;  5HLH A;  3ASR A;  2A6E F;  2RV8 A;  3U21 A;  2PMD A;  5BQT A;  1COW A;  1WH5 A;  3D5S C;  2WV0 A;  2DBB A;  1OJL A;  2VIX A;  3GLL A;  2QZA A;  5TV2 A;  4W8T A;  2DA7 A;  3BR3 A;  2BVM A;  5CLS A;  2D3L A;  4D7N A;  1UHS A;  1SFK A;  5ERI A;  2Z8G A;  3HRS A;  3HPH A;  3QU6 A;  4YC5 A;  1Z05 A;  4ZDP A;  1Z1D A;  3GW2 A;  4MYU A;  1G6N A;  1BJZ A;  3MKY B;  3CMA I;  3B02 A;  1I1G A;  2B63 J;  4M72 A;  4LBW A;  5FB2 A;  2BGC A;  2ZXJ A;  4HWV A;  5E1Z B;  4C9Y A;  2RQQ A;  1RR8 C;  1APL C;  1J5Y A;  3J7Z I;  1W87 A;  1MJB A;  2ZO4 A;  1DUX C;  2OBT A;  3WNB A;  2XTY A;  3V7S A;  2CWE A;  3ZP5 A;  1VJS A;  2FRH A;  2WB1 N;  3BJO A;  1X1D A;  1QGP A;  3ML6 A;  3GQA A;  5L3B A;  1W2B B;  2F48 A;  2B0L A;  3HGG A;  2M3A A;  2X1D A;  4YZA A;  5FKL A;  5C1E A;  3PL8 A;  3HB9 A;  2L01 A;  4E6K G;  2DET A;  5A8A A;  3IH3 A;  1IJE A;  4WZL A;  1KK0 A;  4N4N B;  2FX0 A;  4GGG A;  3VYR B;  1RET A;  3E3V A;  1D0X A;  1OCZ H;  3KYD B;  1OCO H;  1IF1 A;  2QZ8 A;  2KIS A;  1W35 A;  2Y2Z A;  3L1P A;  1ZM2 A;  4MO7 A;  3WQZ A;  4CH7 A;  3CF2 A;  4FX4 A;  2EH3 A;  2P8T A;  2PQ8 A;  2AHO A;  1IN5 A;  3EQO A;  2DTR A;  1ZG5 A;  1QPM A;  3L2C A;  4HQE A;  2PG4 A;  1FTT A;  2RNJ A;  4XK4 A;  2DOE A;  2QTZ A;  1PXZ A;  3OOC A;  4CSW A;  4EJV A;  1G8X A;  4RJL A;  3RQ4 A;  4MQV A;  4A3M J;  2J5O A;  3JRH A;  1JE8 A;  1FBU A;  1IAW A;  1TWG J;  4KIT B;  4AUX A;  2OJE D;  4DQ2 A;  1VF9 A;  1L0O C;  1XC5 A;  1VQ8 I;  1TT0 A;  2MH9 A;  3I59 A;  1QUF A;  3FZV A;  5H20 A;  3QFS A;  2JK3 A;  3BOQ A;  4DBR A;  2IBD A;  3VYT B;  3OFN A;  3CZ6 A;  3WU0 A;  1R4N B;  1G7S A;  3VOE A;  2FF4 A;  3HOT A;  2EA4 A;  5E3L A;  2MYS A;  1D1B A;  4B48 A;  4F7Z A;  1UJ8 A;  4K2E A;  4HIZ A;  3DBL B;  3WU2 C;  2YU3 A;  4DNR B;  3GQ8 A;  1GDT A;  3E5Q A;  3O6B B;  1ELO A;  1Q9S A;  5JLX A;  3IHU A;  2BGJ A;  1WFX A;  4KT5 C;  4FK8 A;  1VBL A;  1R22 A;  3JAM Z;  1F4K A;  1G2H A;  1UD6 A;  3NB2 A;  1W4M A;  2P3M A;  3PFI A;  1KYW A;  1MW7 A;  3W6J B;  3OYI A;  5F27 A;  3SJM A;  2NRA C;  1JJ8 C;  3FK7 A;  1Y6I A;  2JIZ A;  3QP6 A;  3VYS B;  3CO7 C;  1QVT A;  4PJN A;  4TMT A;  3GWZ A;  1AHD P;  1U5T C;  2PEX A;  2L4M A;  3ZGK A;  1NRK A;  3GRH A;  2LY1 A;  2YWF A;  4PUS A;  4CCO A;  4EM2 A;  3K4C A;  1WOP A;  4GYG A;  4O3M A;  3G4S I;  2K3P A;  1O7L A;  2F2E A;  3I64 A;  4KMF A;  1Y56 A;  3ZMT A;  3JSO A;  2DLL A;  3CUQ C;  4K1X A;  1T0F A;  2DA5 A;  2MC3 A;  2W00 A;  2XPV A;  4G12 A;  4BU2 A;  1BJK A;  4IPA A;  2DDA A;  2G7H A;  3NAR A;  2IT0 A;  3ZBT A;  4MFE A;  2KT0 A;  3E5X A;  3ZPN A;  1MBK A;  1ON1 A;  3S2H J;  3ISP A;  3A3G A;  1Z21 A;  3ZMD A;  4ZTJ A;  1O3T A;  2C4T A;  4UZF A;  2PEC A;  1XE1 A;  4QLC U;  3JSP A;  2Z6B D;  1F5T A;  1MZB A;  5IY5 H;  4R71 A;  3PO3 J;  5LGN A;  4X06 A;  4RBO A;  1OCP A;  3QPS A;  1ZGJ A;  3DLL F;  2FOK A;  2VKE A;  2QGU A;  4BE2 A;  3FKS A;  1Z9C A;  4W8R A;  3VR6 A;  4OMY A;  4UUS A;  4W8Q A;  1FBQ A;  2CGP A;  1QJV A;  3HSR A;  2CG4 A;  3I3L A;  1I6H J;  4KN7 X;  2Q6I A;  2E5Z A;  1MBJ A;  3FXJ A;  2DO7 A;  3H5R A;  1LDK B;  2HQ5 A;  1EKE A;  4A6D A;  4IRI A;  1KK3 A;  1T6Z A;  2WAF A;  3Q9S A;  5C1C A;  3MCZ A;  3V8L A;  2W85 A;  3DPT A;  4IZZ A;  1OFE A;  2D9R A;  3N05 A;  1V5E A;  3OWT A;  3O8G A;  3TMO A;  2NNN A;  2XF5 A;  3GTO J;  3GSI A;  1LNW A;  2GRE A;  3VYU B;  3M4O J;  4TV7 A;  5HNH A;  3AK5 A;  1TLL A;  3OR1 C;  2Q6K A;  2L9S A;  5A88 A;  1J0R A;  5A2Q K;  4RDU A;  2EFW A;  3PSF A;  3TW7 A;  4Y15 A;  2ZSH B;  4RDK A;  4I99 C;  1YRN A;  2ZME B;  4Q7J B;  2QXZ A;  1JT0 A;  1E62 A;  1RQR A;  3PEN A;  4RLZ A;  5KVR A;  3OV8 A;  1LM1 A;  1KCD A;  2JVG A;  3GXO A;  2EIN H;  2B7C A;  4URR A;  5IPA A;  3OSF A;  2CUE A;  3AKZ A;  3W2H A;  1QRC A;  4IVN A;  2JRM A;  4G94 A;  4DYC A;  2YWE A;  2KPM A;  3TP3 A;  1O57 A;  2NVX J;  3OZW A;  2CW8 A;  3KE2 A;  2X1C A;  5TJJ A;  1XGS A;  2Z3Y A;  2UUZ A;  4PSW A;  2OBP A;  3Q3S A;  1BIA A;  2W6J A;  3ESW B;  2ZTN A;  3LA2 A;  2UVE A;  3ZMU A;  1ZG3 A;  2XDV A;  2XPU A;  3R0J A;  4HG2 A;  4XSZ F;  5DUI A;  3S15 J;  3SJP A;  3IRR A;  5J8C A;  3I56 I;  2E2I J;  1Z0X A;  2NNY A;  4OZY A;  3CME B;  3M8J A;  1YHQ B;  3QQA A;  1KQ8 A;  3Q39 A;  4OPW A;  2VQC A;  5IOY A;  2BM1 A;  1IDK A;  1WSR A;  4PC3 A;  3L00 A;  1ETW A;  4A3F J;  2BE5 F;  1MMS A;  1X2M A;  2ECB A;  3P27 A;  5CDF A;  4YZX A;  2HI3 A;  3FXM A;  2XVC A;  3BQZ A;  3MD2 A;  3OIP A;  4F55 A;  5EEG A;  2GAU A;  1LVK A;  2Y9Y A;  3W6K B;  3W2W A;  3F22 A;  2M2E A;  3OY9 A;  3CC4 I;  4HSR A;  4BAY A;  2V5I A;  5HVQ C;  2M30 A;  3TGN A;  4JX5 A;  4DGW B;  3HEF A;  1BMF A;  2CQQ A; 
#chains in the Genus database with same CATH homology
 4CUG A;  3TBI A;  1WJC A;  4DIQ A;  1VLY A;  3IAS 2;  4IQ4 A;  2HDW A;  2GK7 A;  3K4B A;  1MMD A;  5CQE A;  3FPP A;  1X0C A;  4RMN A;  4E0F A;  3JUR A;  3H9G A;  1V5F A;  3BG6 A;  3HPG A;  3A35 A;  4KT6 A;  2O17 A;  2IGK A;  2VXD A;  3OYN A;  1MMG A;  3BCB A;  1E1R A;  3H9Q A;  3A1Y A;  4ZYA A;  2WPD A;  3OYJ A;  4DK0 A;  2E60 A;  1D0Y A;  1IRX A;  4PFO A;  3LSM A;  4E7L A;  3OOU A;  2PYG A;  2VJ4 A;  4Y4R A;  2K9L A;  2ZZQ A;  2LG4 A;  2KL4 A;  4P1W A;  3AL0 B;  3KEY A;  4CCK A;  2PYH A;  2GJR A;  3MKW B;  3K10 A;  2A5W A;  1YE9 A;  4XLA A;  3HAG A;  3S32 A;  3EUK L;  5HLT A;  1KMH A;  1O8J A;  2DJI A;  3NWS A;  4BJT A;  4MR0 A;  4OJ6 A;  3QYE A;  2V4J C;  2AQE A;  4XKC A;  3HKZ A;  2VL8 A;  3EQN A;  3KX2 A;  4JOM A;  3K70 C;  2IS2 A;  4HEA 2;  4G7W A;  1MND A;  2HNH A;  2LY2 A;  1WJA A;  2K5C A;  1QU3 A;  4BL0 B;  4RM2 A;  2XND A;  2LC2 A;  1PKV A;  3H35 A;  4GQN A;  4XOR A;  3L2U A;  2V4D A;  4XLC A;  1WJF A;  3LMW A;  1T0F C;  3H5A A;  3ZCO A;  2VJJ A;  3KEW A;  4XLH A;  5TGT A;  1WJ5 A;  3LSH A;  1UG0 A;  3W2V A;  3OYA A;  1JTA A;  2FUG 2;  3FBI B;  3PFY A;  4RLF A;  3PNT A;  4XOT A;  4H4K C;  2NSP A;  3HL2 A;  2LOO A;  2INU A;  3BC8 A;  4C2L A;  3LL7 A;  3S8P A;  3FKJ A;  2CMP A;  2KMU A;  3GQ9 A;  4OAZ A;  4BQO A;  2KQR A;  4XNF A;  1OGM X;  3FBN B;  4AYB A;  3RTR A;  2ZTN A;  2R7X A;  4B3F X;  4P5O A;  1NG6 A;  4DNT B;  5CQG A;  4BUP A;  2O04 A;  4EW9 A;  2R7U A;  2ZZG A;  3OYL A;  4TSF A;  3SUC A;  2XC7 A;  1X1C A;  3GVK A;  3OW7 A;  3DU5 A;  3OMY A;  4G6I A;  2M4G A;  3DTI A;  3CMM A;  3VSU A;  4P22 A;  1K28 D;  4E7H A;  2X1E A;  1OHH A;  3EUA A;  3BH4 A;  4F52 A;  2DCE A;  2JJ2 A;  3LFU A;  1U0J A;  1DP3 A;  1FMV A;  2CUZ A;  3JU4 A;  1VZ0 A;  2WY8 Q;  5KCM A;  2MFZ A;  4JMQ A;  2GJP A;  3VWB A;  1NHC A;  3K6G A;  2CH0 A;  2XF7 A;  2LRE A;  1OGO X;  4BGD A;  3ZIA A;  4CCJ A;  4GRI A;  3UNG C;  2P0W A;  1O8L A;  3LSK A;  1BR1 A;  2CK3 A;  1ERD A;  3ZPP A;  3ZQQ A;  1O8K A;  3M1C A;  5HKK A;  3W3C A;  2VAS A;  1YX5 A;  4G6T B;  1OFL A;  1KON A;  3K4J A;  1W36 C;  2R7R A;  4YXW A;  3K4N A;  2M7A A;  2NT9 A;  4II2 A;  4F93 B;  3V42 A;  3NWT A;  3OL4 A;  4R79 A;  2KLO A;  2HQA A;  2W6I A;  1X19 A;  1KCC A;  4I84 A;  2HU9 A;  3QYF A;  1CZF A;  4BJ6 C;  1O8F A;  4BAC A;  4XLE A;  3RPU D;  3K4K A;  3L2W A;  2OV7 A;  3OR2 C;  4ASU A;  2WZP P;  2Z2S B;  1D1A A;  2Q1Z B;  2IS1 A;  4OJO A;  2JA2 A;  3G05 A;  4Y33 A;  4AU7 A;  3H5N A;  2XF6 A;  2DT6 A;  2KDO A;  3HC7 A;  3A3B A;  1MAB A;  1BHE A;  4W8S A;  1W9X A;  4IX7 A;  4BQQ A;  1EE6 A;  5DN6 A;  1O8M A;  1EFR A;  3OYM A;  1LFP A;  2E5N A;  4LIT A;  1UD5 A;  1UD8 A;  4U4B A;  4Z05 A;  4PMH A;  3LNN A;  3VSL A;  2KZV A;  3CJR B;  4ZJZ A;  3PJR A;  2I8D A;  2L7K A;  3TL4 X;  1H8H A;  1W0K A;  2ZZF A;  3OPO A;  1W0J A;  4FXU A;  5LD2 C;  3BCA A;  2GOM A;  1V0F A;  5CKT A;  4PJJ A;  4NNJ A;  3S93 A;  2Y0S A;  3D5R C;  3B4N A;  3CES A;  3K4M A;  2PJR B;  2WB1 A;  2ZZE A;  3VMW A;  4E7I A;  4XKB A;  1WPC A;  4TKO B;  4CCL A;  2NZM A;  5JHF A;  2F4I A;  3T9G A;  4HRI A;  2A6T A;  1H8E A;  2LYC A;  3DPL C;  2VQH A;  4KKU A;  2OUM A;  3HXL A;  1HZE A;  1O8I A;  1O8E A;  1HVX A;  2VXZ A;  4NC7 A;  4YZ0 A;  4F3Q A;  1MMN A;  1D1C A;  4C2U A;  1E43 A;  3AFH A;  2XOK A;  3QOE A;  4B47 A;  1RWR A;  2R4G A;  1OOC A;  2O1D A;  3OL3 A;  4RM3 A;  3RSN A;  1JI8 A;  1QHH D;  4CZC A;  2UV1 A;  2K9M A;  4HNT A;  4XD7 A;  2INV A;  2HVQ A;  4EAT A;  2X51 A;  1WJE A;  1PYV A;  3S3N A;  4F91 B;  2IGN A;  4J01 A;  1OB0 A;  2GJK A;  1SKY B;  4Y3O A;  5KHD A;  4U87 A;  4IQJ A;  3OAA A;  3MKZ A;  4B3G A;  1O8H A;  1T95 A;  4E7S A;  3OS0 A;  3SEQ A;  1TZL A;  2L2O A;  2JJ1 A;  3GVJ A;  3IP4 B;  1T5E A;  2LBF A;  5KNL A;  3GQ7 A;  1P9Q C;  3C2H A;  2Q2E B;  4CA0 A;  3GBG A;  2L5Q A;  3DWL E;  4MXN A;  1XG2 A;  2ELJ A;  1ZEL A;  2BSP A;  4C2T A;  1MMA A;  2IQ7 A;  2R9V A;  1BOB A;  1X4O A;  1Z3Y A;  4JQF A;  4BEH A;  4OJ5 A;  1SAU A;  3OIQ A;  2CV0 A;  4U49 A;  3A2K A;  4OAY A;  4DJA A;  3I9V 2;  2OC6 A;  3S3O A;  1X1A A;  1IA5 A;  3RCO A;  2VBM A;  5HNF A;  2XAU A;  3OYB A;  4AVZ A;  2F6C A;  3K70 D;  1KTW A;  2X6Y A;  2X6X A;  3SYT A;  4J00 A;  4ZTF A;  3T51 B;  2ZTG A;  4F92 B;  2HPI A;  3OYD A;  1PLU A;  1GLN A;  2PMZ A;  3S3M A;  3OYC A;  3F9K A;  4LIU A;  2VKD A;  3WWG A;  3OS1 A;  2XZP A;  3PNY A;  2X53 S;  3BC9 A;  2X3H A;  4MLO A;  2AQF A;  4TT3 A;  3DKY A;  2VJ5 A;  3LMM A;  1WP6 A;  3SEZ A;  4PJL A;  3L2V A;  2GK6 A;  1I18 A;  2V9K A;  4HNU A;  2F5V A;  4NC8 A;  3HOS A;  2KRH A;  4X0G A;  3EPZ A;  4XMY A;  5FL7 A;  2E1M C;  1RMG A;  2JUG A;  2ZXH A;  2LZJ A;  3OE7 A;  2NTB A;  2IXS A;  4XR6 A;  4ANJ A;  3U21 A;  3GVL A;  1COW A;  3OEE A;  3D5S C;  1J09 A;  2BW3 A;  2V31 A;  1D0Z A;  4LG3 A;  2CV1 A;  2M0M A;  4XM3 A;  4BDZ A;  3FY3 A;  1BR4 A;  2VIX A;  3DEE A;  3FHN A;  4OWR B;  4D9J A;  2WSS A;  4QPQ A;  2RRE A;  4W8T A;  4D1Q A;  2BVM A;  2D3L A;  4XOP A;  1SFK A;  5IK2 A;  2Z8G A;  3HPH A;  5AMV A;  5FRO A;  4IKF A;  4LIV A;  4ZDP A;  3DU6 A;  3IAM 2;  3UR3 C;  3T56 B;  3MKY B;  3B8Y A;  3DTE A;  4FAS D;  2W4S A;  4PFP A;  4NUB A;  4HWV A;  4C30 A;  5HOO A;  4C9Y A;  2RQQ A;  4XON A;  5CPR B;  1E1Q A;  2R7T A;  2IGM A;  1NG7 A;  2PJR A;  2BOL A;  2WAD A;  3W2A A;  1R6R A;  1W36 D;  3SDB A;  1VJS A;  1WMR A;  1X1D A;  2QE7 A;  3UW0 A;  3GQA A;  3VSK A;  2M4K A;  2R7S A;  3VMV A;  2JDI A;  2M3A A;  2X1D A;  4BE1 A;  2QY1 A;  4YZA A;  3NE5 B;  5C1E A;  2E1M B;  3PL8 A;  4XLF A;  4E6K G;  2ZFU A;  4N4N B;  2E1B A;  3BLY A;  3VYR B;  1VF7 A;  3VSV A;  2ZSI B;  1D0X A;  4HST A;  4YRV A;  3AL0 C;  2KP6 A;  3DKX A;  3H9J A;  4DOZ A;  2VPL A;  4KKS A;  1JRG A;  4BJ5 C;  5LFA A;  2R7Q A;  3CF2 A;  4CH7 A;  3FDY A;  3HG9 A;  2HVS A;  3C2G A;  3WQZ A;  1DGR M;  3EQO A;  4OJL A;  3OYH A;  1UAA A;  3D5L A;  4NQW B;  1WJD A;  3DQV C;  3VST A;  3PUB A;  2V26 A;  1IDJ A;  2CUJ A;  2WBM A;  2ZXI A;  4ZC3 A;  3ZRG A;  1PXZ A;  2UVF A;  3OOC A;  4CSW A;  1G8X A;  3RQ4 A;  2L9N A;  4CCN A;  1G59 A;  2VLA A;  2MD0 A;  4KIT B;  1V0E A;  2EWE A;  2IS4 A;  2UWM A;  1MNE A;  4UZU A;  2WAQ A;  2CS3 A;  2XSJ C;  1TT0 A;  2QKM B;  1E79 A;  2NTQ A;  2VBE A;  4PJM A;  2XGJ A;  3OYK A;  2Z16 A;  3B90 A;  2BVL A;  3QOD A;  4DBR A;  2CW7 A;  2WY7 Q;  3VYT B;  2X8K A;  3OFN A;  3CZ6 A;  2R7W A;  4XQF A;  2NTP A;  3HOT A;  1OFM A;  1QHG A;  2MYS A;  1D1B A;  3LSG A;  1EA3 A;  4B48 A;  4HIZ A;  1PJR A;  3H0D A;  1BR2 A;  2IGO A;  2KVO A;  4DNR B;  3GQ8 A;  3OYG A;  2R7O A;  1DQU A;  3EUH C;  3ONQ A;  3ZR8 X;  1IB4 A;  1LKX A;  3K4L A;  1S9H A;  2WJY A;  1YX3 A;  3CJQ B;  4B3X A;  3CP2 A;  1WFX A;  2KRC A;  2F43 A;  1VBL A;  2VQG A;  2M7B A;  1UD6 A;  2JSP A;  3BCD A;  2HPM A;  3DTK A;  2VBK A;  1MW7 A;  1NBM A;  3OYI A;  3T53 B;  4E7K A;  1I8D A;  1Y6I A;  3L2R A;  4XKV A;  4KIS A;  2JIZ A;  3DPU A;  2LH9 A;  4XN3 A;  3VYS B;  1HA8 A;  2O5R A;  4PJN A;  4XL9 A;  2V6E A;  1X4P A;  2VB6 A;  3ZGK A;  1NRK A;  3GRH A;  2D3N A;  2LY1 A;  2WAE A;  4PUS A;  2DXI A;  4CCO A;  5FRN A;  3HUG B;  3K4C A;  2R7V A;  2VQL A;  1E3Z A;  3DDY A;  2CV2 A;  2HVR A;  2IS6 A;  1GQ8 A;  2K3P A;  4BE0 A;  3KRG A;  2NOJ B;  2X6W A;  1H80 A;  4PSX A;  2NT6 A;  4QPO A;  1Y56 A;  3OYE A;  4RLQ A;  2V7Q A;  4E7J A;  3ZSC A;  2W00 A;  4BU2 A;  1BLI A;  2KHM A;  2MAB A;  2QX3 A;  1BPL A;  3ZPN A;  2DIE A;  3A3G A;  1RU4 A;  1OR7 C;  1Z21 A;  4ZTJ A;  2LBF B;  2F1M A;  1PE9 A;  2PEC A;  3GQB A;  3OEH A;  2Z6B D;  2HZD A;  1UD4 A;  4XKW A;  3ZXS A;  4HPQ A;  4ZDL A;  2M5S A;  4BE2 A;  3SZG A;  4BEH B;  3FKS A;  4E7Z A;  3E0J B;  4Z03 A;  4W8R A;  3VR6 A;  4OZZ A;  4W8Q A;  4ZDO A;  1QJV A;  1FMW A;  3I3L A;  3LSI A;  3OYF A;  1N77 A;  4OJP A;  2E5Z A;  3H5R A;  1LDK B;  4XN0 A;  2WAF A;  4DK1 A;  3BCF A;  3DLA A;  1UD2 A;  2JVH A;  5C1C A;  3CP8 A;  2HLD A;  1O8G A;  3DPT A;  4IZZ A;  3PSI A;  3N05 A;  1V5E A;  3OWT A;  3TMO A;  4BQN A;  2XF5 A;  3A4C A;  4NK8 A;  3VDX A;  2VJI A;  3VYU B;  2WJV A;  4Z06 A;  5HNH A;  1HG8 A;  3OR1 C;  4DBQ A;  2DT7 B;  1O8D A;  2L9S A;  2NST A;  3PSF A;  2VKH A;  4U7B A;  2ZSH B;  4E4H A;  4BS9 A;  1KZL A;  2O0W A;  2QXZ A;  4BXF A;  2Z1D A;  4N4O B;  1UEL B;  3G2B A;  2X85 A;  1KCD A;  2JVG A;  4ITV A;  3MMY B;  1FX0 A;  4URR A;  4YEL A;  3BG7 A;  3E1S A;  3AKZ A;  1WTH D;  1Z7L A;  4L8J A;  2KPM A;  3L2Q A;  2CW8 A;  1X1B A;  2X1C A;  1AIR A;  4KJZ A;  2UUZ A;  4PSW A;  1BN8 A;  1Z3X A;  2W6J A;  2W7N A;  4KKT A;  1V5G A;  2WA0 A;  1O88 A;  2UVE A;  2XDV A;  3IUO A;  2V7F A;  2MC4 A;  4HG2 A;  4B43 A;  1UD3 A;  1K6Y A;  3H94 A;  4Z1M A;  2GOX B;  3KYL A;  2BW3 B;  2O0V A;  4OZY A;  3M8J A;  1K5C A;  1N78 A;  4B44 A;  3PNV A;  4FET A;  2XZL A;  1QCX A;  4BDY A;  4YEJ A;  5FRM A;  2VQC A;  2CFO A;  1IDK A;  3OS2 A;  4NK6 A;  5CDF A;  4YZQ A;  2LRD A;  3QYB A;  1E0E A;  1WJB A;  2QKL B;  4YZX A;  1OLT A;  4DGW B;  4G7X A;  2W82 A;  3MD2 A;  3OIP A;  4F55 A;  1LVK A;  2RNG A;  3W2W A;  1E3X A;  3OY9 A;  3J7A Y;  2V1N A;  1DBO A;  2DOA A;  4HSR A;  4PK4 A;  2XZO A;  1DGW Y;  5HVQ C;  1DBG A;  2ODL A;  1AA7 A;  1N75 A;  4II3 A;  4CCM A;  1BMF A;  2W1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...