4XNHC

Crystal structure of yeast n-terminal acetyltransferase nate (ip6) in complex with a bisubstrate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
159
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEKDVHFTQMAYYSEIPVGGLVAKLVPKNELSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 43
structure length 159
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xnhC00
1IIDA 2JLMA 3GYAA 4B5PA 1BO4A 3R95A 4CAVA 1M4GA 3W6SA 4HNXB 4R9MA 2R1IA 2CNTA 1NSLA 2Q44A 5IB0A 3FNCA 4HNWB 5J8FA 1UFHA 1WK4A 4U5YA 2FCKA 1YLEA 1Z9UA 1YVKA 3LODA 4FD5A 3DR6A 5EBVA 2AE6A 2I79A 2EVNA 1RXTA 2IL4A 4L89A 2FIAA 4IF5A 3VWEA 1XF8A 2A4NA 2ZW7A 3MGDA 3P2FA 2BL1A 4QC6A 4JXRA 4ZBGA 2QMLA 3NE7A 4U9ZA 4Y49B 3RYOA 4H6ZA 3TE4A 2ZPAA 2X7BA 4DNCA 5IV0A 1P0HA 4XPKA 4JLYA 4NF1A 4NSQA 3G8WA 4LUAA 4NEXA 4PV6A 3KKWA 2OU2A 4E8OA 2Q4VA 2PR1A 4MJ8A 3R9GA 4E0AA 1SQHA 3EO4A 2QECA 3SXNA 4KOWA 1VHSA 2D4PA 4R87A 3G3SA 3BJ8A 2QIRA 4KOYA 1IB1E 2AJ6A 5EC4A 2D4OA 1NMTA 3OWCA 2OZHA 3K9UA 3QAHA 4MHDA 3TO9A 5KTCA 5I0CA 1J4JA 1XEBA 1YK3A 3TOBA 1KUXA 4KLVA 5GCNA 2CY2A 4KOXA 3JVNA 2PR8A 4H89A 2GANA 4UWIA 4KVXA 2B5GB 4UA3A 3GKRA 1KUYA 2F5IA 2VI7A 4JXQA 1U6MA 2REEA 4PK2A 2FIWA 4KOTA 2PQ8A 2C27A 2BEIA 1MJBA 4LX9A 2FL4A 2OH1A 3TO7A 1Q2DA 2CNSA 4JD6A 2Q0YA 4CAXA 3FYNA 4MY0A 2J8MA 3LD2A 1S7KA 1KZFA 4KUBA 1MK4A 5DWNA 1P4NA 1QSOA 3EXNA 2ARHA 2ZW4A 4R3KA 4KOUA 3S6FA 2B4DB 4KOVA 4XNHC 1PUAA 4UBRA 4CRYB 2ZW6A 3FXTA 2GIVA 1IICA 5KTAA 3T90A 4PK3A 2VBQA 3DDDA 1RO5A 4F0YA 4JWPA 1YX0A 3PZJA 3T9YA 5JPHA 3IWGA 2P6FA 1I12A 1Q2CA 4MY3A 1VKCA 4M85A 3R9EA 2FSRA 2GE3A 1XIXA 2R8VA 4R57A 4XPLA 3PGPA 3TOAA 5F48A 3S6HA 1BOBA 1M44A 2FT0A 2KCWA 2HV2A 3W91A 3DR8A 4KLWA 2J8RA 5J8CA 4J3GA 2DXQA 2JDCA 4MI4A 3V8IA 2B4BA 2Z0ZA 5IX3A 4KZTA 4XNHB 4E2AA 2G3AA 4HNYB 2HUZA 5KTDA 5DWMA 1S3ZA 3JUWA 2Q7BA 1WWZA 2WPXA 4KOSA 4AVCA 2WPWA 5HH1A 2OZUA 4QBJA 2R7HA 4JJXA 4ONUA 4QUSA 1B6BA 1FY7A 2BUEA 4PSXA 4XPDC 4CRZB 1Y7RA 1S7NA 1K4JA 2FE7A 1Z4RA 3EC4A 3FB3A 3R1KA 3W6XA 4AVAA 3S6GA 3BLNA 1KUVA 1N71A 5HMNA 5JQ4A 1YVOA 2ZW5A 2JEVA 3S6KA 2ZXVA 1S60A 2JDDA 4HKFA 3TO6A 1QSRA 1I1DA 2J8NA 4CS0B 3D3SA 4RS2A 1QSMA 4B5PB 2NMTA 3CXSA 2B5GA 4ORFA 4UWJA 3F5BA 5H86A 2B3UA 2PRBA 1YGHA 2Q4YA 5E96A 2HQYA 2FS5A 5C88A 4IUSA 1YREA 2H5MA 3R9FA 3DNSA 1S5KA 3D2PA 5F49A 2PDOA 2OB0A 4QVTA 2P6GA 4KORA 2VEZA 4KUAA 4AG9A 3CXQA 3N7ZA 2CNMA 1Y9WA 3PP9A 4H6UA 2VZZA 4XPDB 1YR0A 2P6EA 4X5KA 2BSWA 2G3TA 4FD7A 5F47A 3SXOA 3TFYA 3QB8A 1CM0A 4YRHA 3DSBA 2PSWA 2B4DA 4KVME 1OZPA 4GS4A 4QB9A 1MJAA 2P0WA 1XMTA 2PC1A 2VXKA 4II9A 3EY5A 4AVBA 2O28A 3E0KA 4F6AA 3I9SA 4K30A 2K5TA 1Y9KA 2VQYA 2VZYA 4YGOA 3GY9A 3FRMA 5F46A 2Z11A 2B3VA 4AG7A 1IYLA 3I3GA 4FD4A 3H4QA 1I21A 1M1DA 4EVYA 4RI1A 2I00A 3TT2A 1S7LA 1S7FA 4L8AA 1PU9A 3ZJ0A 4U9YA 1B87A 3P2HA 2G0BA 4CAWA 3IGRA 2R98A 4NXYA 3F0AA 2Q04A 4AB7A 3D8PA 1XE4A 1NE9A 3ZZIA 4B5OA 4I49A 4BMHA 3FBUA 1IYKA 1QSTA 2OZGA 4NCZA 4OADA 4OLLA 1LRZA 4KVOE 4R3LA 3TTHA 5C82A 5ISVA 1L0CA 2REFA 2EUIA 2RC4A 1Q2YA 5FVJA 1MJ9A 3D2MA 1V0CA 3B8GA 1GHEA 1QSNA 1Z4EA 3C26A 3WR7A 4M3SA 3UY5A 3FIXA 2B58A 3R96A 4OAEA 2ATRA 3BJ7A 3TCVA 5H84A 1ON0A 3F8KA 4Y49C 1M4IA 1TIQA 3VWDA 2Z10A 1M4DA 5CNPA 2Y0MA 4MBUA 4YFJA 4FD6A 1R57A 1CJWA 3EFAA 3SHPA 3CXPA 2FXFA 4PSWA
chains in the Genus database with same CATH superfamily
2YNCA 1H8LA 1IIDA 2JLMA 3GYAA 4NGRA 1BO4A 3R95A 4B5PA 4MHYA 3MRUA 4UCMA 3WC5A 2ZOFA 2OR4A 4CAVA 1M4GA 3NA6A 4GM5A 4MRIA 3W6SA 4HNXB 2C6CA 4R9MA 2R1IA 4TNUA 4B12A 3BXMA 2WUUA 5LRGA 2CNTA 1NSLA 2Q44A 5IB0A 4UEFA 3FNCA 3K9TA 4HNWB 5J8FA 4W9YA 1LAPA 2YGWA 4F0XA 2IJZA 4JZ0A 1UFHA 1WK4A 4U5YA 2FCKA 4MCPA 4ONWA 1YLEA 1Z9UA 1YVKA 3LODA 4FD5A 4OC0A 4A32A 3KQXA 3DR6A 5EBVA 2AE6A 2I79A 2EVNA 4X8IA 3IFEA 1RXTA 1AMPA 2IL4A 4L89A 4CGNA 4MFQA 2FIAA 2AFZA 4IF5A 1XF8A 4UIBA 3VWEA 2XEFA 4MFZA 2A4NA 2ZW7A 3MGDA 4A95A 3P2FA 2BL1A 4CGMA 2JEWA 4QC6A 4JXRA 4ZBGA 2PVVA 4MHNA 2XEJA 4A31A 4WWVA 2QMLA 2CXAA 3NE7A 1Q7LA 4NGMA 4U9ZA 1YQEA 1Z8XA 2DF5A 3B7IA 4Q38A 4Y49B 4P6YA 4DUKA 3D7GA 1JQGA 1ZG7A 3RYOA 1Z8LA 4H6ZA 3TE4A 2ZPAA 2O53A 2X7BA 4DNCA 4C7IA 1R43A 1P0HA 3JRUA 5IV0A 5LRJA 3IWWA 4XPKA 2XEIA 4BD9A 4JLYA 4NF1A 4CAEA 3NH5A 4A37A 2PIZA 3MN8A 3IU1A 4NSQA 3G8WA 4LUAA 4C2ZA 3CZXA 2ANPA 4NEXA 4PV6A 4CYNA 2ZEGA 1XOVA 4CAFA 2ZEFA 2IQ6A 3KKWA 5AGEA 3GLJA 1TF9A 2OU2A 2PJ2A 4E8OA 2Q4VA 2EK9A 1IY7A 2PR1A 4MJ8A 3R9GA 1SQHA 4E0AA 1F57A 2AFSA 3EO4A 2QECA 1GYTA 5LRKA 2V8VA 5G22A 3SXNA 2ZOGA 1TF8A 1VHSA 2D4PA 4KOWA 2PVWA 4R87A 5LYFA 3G3SA 3BJ8A 2VL1A 2QIRA 1ARMA 5DS0A 1BLLE 4K3NA 4C2XA 1IB1E 2AJ6A 3IU2A 4KOYA 2D4OA 5EC4A 1NMTA 3OWCA 1IOFA 4CGOA 3V7ZA 2OZHA 4UFXA 5LYLA 3K9UA 1NSAA 3QAHA 1HDQA 3KGQA 4TWEA 3WABA 4MHDA 3LACA 3TO9A 5KTCA 1LAMA 1AYEA 4CYQA 5I0CA 1J4JA 1XEBA 2PRQA 3KZWA 3B35A 1YK3A 3I1UA 3TOBA 1KUXA 3FMCA 3PFOA 4KLVA 4ZX9A 5GCNA 2CY2A 2J9AA 3FVLA 3LWUA 3A9LA 4KOXA 4Z65A 3JVNA 4MFLA 3VH9A 2PR8A 4H89A 1TKHA 2GANA 4O23A 4UWIA 4PXDA 4KVXA 2B5GB 4UA3A 3GKRA 5A28A 3DGVA 2PJ0A 3GIUA 3D4UA 1KUYA 2F5IA 5G1ZA 2PJ4A 2VI7A 4ZI6A 2C6GA 3TC8A 3LMSA 2QJ8A 4JXQA 1HEEA 1U6MA 2DPSA 2REEA 4OC3A 4PK2A 2Q4ZA 2FIWA 4F9UA 4UCPA 4KOTA 3T8WA 2PQ8A 4UFWA 2C27A 2BEIA 4P4DA 1MJBA 4F8ZA 4LX9A 2FL4A 2OH1A 4NGTA 3TO7A 4B6ZA 1Q2DA 2CNSA 4JD6A 2Q0YA 4CAXA 2PJ5A 4KS9A 3BHXA 2PJBA 2GLJA 3JTKA 5JGFA 4DYOA 3FYNA 3PFEA 4MY0A 3PEIA 2J8MA 5HVHA 4UEEA 3LD2A 4NGSA 1S7KA 3FH4A 2JBJA 1M4LA 3IO1A 1KZFA 2F7VA 4KUBA 1MK4A 4NJRA 5DWNA 4A94A 1P4NA 1YW6A 1QSOA 3EXNA 3ISXA 2ODFA 2ARHA 2PJ9A 4FUUA 2G9DA 3FEEA 3B3SA 4NFRA 5JM6A 2FVGA 4UIAA 1CPXA 2BO9A 2ZW4A 3KASA 2IMOA 4OIDA 4R3KA 4M6IA 4MCRA 4KOUA 1Z8TA 3S6FA 2B4DB 4KOVA 3NH4A 1CPSA 4XNHC 1PUAA 4UBRA 2Q7SA 3ISZA 3HUVA 4CRYB 4DJLA 4YU9A 2C1CA 4PXBA 2ZW6A 3FXTA 3S9NA 2PJ1A 2GIVA 1Z8WA 1CP7A 2ZEHA 1IICA 1IU8A 5KTAA 4P4BA 2DEAA 3RNZA 3T90A 2AFUA 4PK3A 4CYOA 2DPTA 2VBQA 2HB6A 3KR5A 3NFZA 3PB4X 3DDDA 1QQ9A 1RO5A 4F0YA 4JWPA 4CYPA 2V8GA 1YX0A 2Z3PA 3PZJA 3SI0A 3T9YA 2V8HA 5JPHA 1LOKA 3IWGA 2P6FA 5HXDA 1I12A 4AXVA 1Q2CA 1Z5RA 1VKCA 4M85A 4MY3A 5LYIA 3R9EA 2FSRA 4LQ6A 4NGNA 4P45A 5AG5A 2EBJA 1TKJA 3H8FA 3RAMA 3PBEA 2ZEEA 5K8MA 4RN7A 1XFOA 3D67A 4LQGA 3B2YA 2Q51A 3NH8A 2GE3A 1XIXA 2R8VA 4UF4A 4R57A 3S9LA 3PB7X 4XPLA 3PGPA 3TOAA 4MHPA 1R3NA 2EK8A 2PJ7A 1Y0RA 3IJ3A 5F48A 3S6HA 1ELLP 1BOBA 1M44A 1YMEA 1AUGA 2PCUA 3B3CA 1LANA 3QAYA 4OC4A 2FT0A 3S9MA 5K8NA 2KCWA 2HV2A 3W91A 4NGPA 3DR8A 4KLWA 2J8RA 3BI1A 2YNCC 3B3VA 3H5ZA 4OC5A 5J8CA 2ZEDA 4J3GA 4ZY1A 2V77A 5G21A 3IIBA 3WC7A 1X10A 4MMOA 3SJFA 2DXQA 2JDCA 1KWMA 4MI4A 1OBRA 2B4BA 3V8IA 2OOTA 1ZO0A 2Z0ZA 4F9VA 4KZTA 5BWAB 4XNHB 4KSFA 4E2AA 3D7DA 5IX3A 3PB8X 4PXEA 2ZEPA 2G3AA 4HNYB 3HLPA 4NGQA 3VARA 2HUZA 3H8EA 5KTDA 5DWMA 1XJOA 2PJ3A 3GB0A 1S3ZA 3JUWA 1VHEA 4CPAA 1CP6A 2Q7BA 1WWZA 2WPXA 4KOSA 4AVCA 2JBKA 2EO8A 4A33A 5D29A 3BI0A 2WPWA 5HH1A 2OZUA 3SJGA 4QBJA 2R7HA 4JJXA 5THWA 4ONUA 3PBBA 4QUSA 1B6BA 1FY7A 2BUEA 3SI1A 4PSXA 4XPDC 4CRZB 3WC6A 4MXUA 3IEHA 1Y7RA 1S7NA 2QVPA 2PJ8A 1K4JA 4FWUA 5AG4A 5G20A 2FE7A 6CPAA 2O4HA 1Z4RA 3EC4A 3IWEA 3FB3A 3R1KA 4Q36A 3W6XA 2ZEMA 4WJBA 8CPAA 1Y0YA 2BCOA 4AVAA 4P4FA 3S6GA 1VHOA 3BLNA 1KUVA 3CPAA 1N71A 1ZLIA 5HMNA 4CGLA 3CT9A 5JQ4A 1YVOA 2ZW5A 2JEVA 3S6KA 4BINA 1LFWA 3KQZA 3D7HA 2ZXVA 2WSAA 1S60A 2JDDA 4HKFA 4OMEA 4JYWA 5D8NA 3TO6A 1QSRA 1IGBA 1I1DA 1F2OA 2J8NA 4MFJA 4CS0B 3D3SA 4RS2A 1UWYA 1QSMA 3FF3A 4B5PB 2NMTA 3CXSA 3KHZA 5LYDA 4ZYQA 2YNDA 3RZAA 4BBHA 2B5GA 4ORFA 4UWJA 3F5BA 5H86A 1CBXA 2B3UA 2PRBA 2BOAA 1YGHA 2Q4YA 2Z3MA 4A30A 4OP4A 1RTQA 5E96A 2HQYA 2FS5A 1A2ZA 5C88A 4IUSA 3TX8A 1YREA 2H5MA 3D66A 4H2KA 1PYTB 1TXRA 3DNSA 3R9FA 1S5KA 3D2PA 5F49A 2PDOA 2Z3NA 2OB0A 5JH9A 1IOIA 4QVTA 2RB7A 2P6GA 4A38A 4KORA 1FT7A 2GFQA 2VEZA 4KUAA 5CPAA 4ZGYB 1F2PA 4AG9A 3CXQA 3N7ZA 4B14A 5F09A 3PRTA 2CNMA 2ZEOA 1Y9WA 4ZY0A 4FBEA 4EFDA 3PP9A 5I4MA 4H6UA 2VZZA 4XPDB 1YR0A 1LCPA 2P6EA 4G1PA 4X5KA 4B13A 1YSJA 2BSWA 4C2YA 2WYRA 2G3TA 4FD7A 4P4IA 4UEZA 5F47A 3KI9A 3SXOA 3FECA 4CGPA 3TFYA 2Z3KA 3QB8A 2QYVA 3KR4A 3D7FA 3KHXA 4R7MA 1CM0A 2PJAA 2WZNA 3DSBA 2PSWA 4OKOA 2B4DA 4YRHA 3WT4A 1EE3P 1ELMP 4KVME 1TKFA 1OZPA 4GS4A 2AFXA 4MFPA 4QB9A 3SI2A 2AFMA 1MJAA 3K2KA 2P0WA 1XMTA 1DE4C 2EWBA 2PC1A 2VXKA 4II9A 1XRYA 3EY5A 5A27A 4M6HA 4P4EA 7CPAA 4MCQA 2O28A 3E0KA 4P4JA 5AG6A 4AVBA 4B11A 1ARLA 2GU2A 3I9SA 4F6AA 4K30A 1YW4A 2K5TA 1Y9KA 2VQYA 3RBUA 2PJ6A 3CDXA 5AG7A 2VZYA 2GLFA 4YGOA 2PIYA 5CBMA 3GY9A 4YWYA 3FRMA 5F46A 1X12A 2Z11A 2B3VA 4AG7A 1IYLA 1ZLHA 3I3GA 3N5FA 3PB9X 1BPMA 4FD4A 3H4QA 4RUHA 2ZENA 1I21A 4EWTA 1M1DA 4EVYA 1XBUA 4OC2A 3IC1A 3V38A 4OC1A 4RI1A 2I00A 3TT2A 1XMBA 1S7LA 3H8GA 1S7FA 4X2TA 4L8AA 1BAVA 3D68A 2V8DA 4A2ZA 1PU9A 3KL9A 2CIJA 4IAVA 4MHZA 1ZG8A 3ZJ0A 4U9YA 1DTDA 1B87A 3P2HA 1FNOA 2G0BA 4B10A 2GREA 4CAWA 1ZG9A 3IGRA 2R98A 4R8FA 3FEDA 5EMIA 3SJEA 4NXYA 3F0AA 4C68A 2Q04A 4AB7A 4P10A 3SJXA 1VGYA 3D8PA 1XE4A 1NE9A 3ZZIA 4B5OA 4FAIA 1CG2A 2ABZA 2CTBA 4IK2A 1VIXA 3FX6A 4I49A 4BMHA 2Z3LA 4PQAA 3FBUA 4MFKA 3DLJA 4C7HA 4PXCA 1IYKA 1QSTA 2OZGA 2RFHA 4HPSA 4NCZA 2XEGA 4OADA 4OLLA 3GUXA 1LRZA 2NSMA 3QNVA 2I3CA 4KVOE 2YNEA 4OIWA 4R3LA 3TTHA 5C82A 3VATA 4EMEA 3NE8A 5ISVA 1L0CA 2REFA 2EUIA 4PPZA 2POKA 2RC4A 4IHMA 1Q2YA 2Q43A 5FVJA 3L2NA 5HVFA 1MJ9A 3D2MA 3FJUA 1V0CA 3B8GA 1GHEA 4UFVA 1HDUA 1QSNA 1Z4EA 1JWQA 3C26A 3WR7A 4M3SA 4UCNA 1YLOA 1Z2LA 2C6PA 4GXHA 2CF4A 5J1QA 4M6GA 4R6TA 4ZX8A 1BPNA 3UY5A 3FIXA 2CTCA 2ZELA 4MCSA 3PB6X 2B58A 2HC9A 4NJQA 5ELYA 2PJCA 4OAEA 3R96A 3CPXA 1QMUA 2ATRA 2AFWA 3BJ7A 4KSAA 5IB9A 3TCVA 4A39A 5H84A 1ON0A 3F8KA 5K8OA 4Y49C 1M4IA 4ZY2A 1CX8A 4P44A 4Q7AA 1Y7EA 2Z3OA 1TIQA 3B3TA 3VWDA 2Z10A 4KSIA 1M4DA 3B3WA 5CNPA 2PE3A 1PCAA 2Y0MA 4MBUA 2F8HA 4YFJA 4FD6A 1R57A 1CJWA 2AFOA 3EFAA 3SHPA 4X3RA 5K8PA 5HVGA 3CXPA 2FXFA 4PSWA 2NYQA 3RO0A 4R76A
chains in the Genus database with same CATH topology
2YNCA 1IIDA 2JLMA 3GYAA 4B5PA 1BO4A 3R95A 4UCMA 4CAVA 1M4GA 3W6SA 4HNXB 4R9MA 2R1IA 4B12A 2WUUA 2CNTA 1NSLA 2Q44A 5IB0A 3FNCA 4HNWB 5J8FA 2YGWA 4F0XA 1UFHA 1WK4A 4U5YA 2FCKA 1YLEA 1Z9UA 1YVKA 3LODA 4FD5A 4A32A 3DR6A 5EBVA 2AE6A 2I79A 2EVNA 1RXTA 2IL4A 4L89A 4CGNA 4MFQA 2FIAA 4IF5A 3VWEA 1XF8A 4MFZA 2A4NA 2ZW7A 3MGDA 4A95A 3P2FA 2BL1A 4CGMA 4QC6A 4JXRA 4ZBGA 4A31A 2QMLA 2CXAA 3NE7A 4U9ZA 4Q38A 4Y49B 3RYOA 4H6ZA 3TE4A 2ZPAA 2X7BA 4DNCA 4C7IA 5IV0A 1P0HA 4XPKA 4JLYA 4NF1A 4CAEA 4NSQA 3IU1A 4C2ZA 3G8WA 4LUAA 4NEXA 4PV6A 4CYNA 4CAFA 3KKWA 5AGEA 2OU2A 4E8OA 2Q4VA 2PR1A 4MJ8A 3R9GA 4E0AA 1SQHA 3EO4A 2QECA 3SXNA 5G22A 4KOWA 1VHSA 2D4PA 4R87A 3G3SA 3BJ8A 2QIRA 4C2XA 1IB1E 2AJ6A 3IU2A 4KOYA 2D4OA 5EC4A 1NMTA 3OWCA 4CGOA 2OZHA 4UFXA 3K9UA 3QAHA 4MHDA 3TO9A 5KTCA 4CYQA 5I0CA 1J4JA 1XEBA 1YK3A 3TOBA 1KUXA 4KLVA 5GCNA 2CY2A 4KOXA 3A9LA 3JVNA 4MFLA 2PR8A 4H89A 2GANA 4UWIA 4KVXA 2B5GB 4UA3A 3GKRA 5A28A 5G1ZA 1KUYA 2F5IA 2VI7A 4JXQA 1U6MA 2DPSA 2REEA 4PK2A 2FIWA 4UCPA 4KOTA 2PQ8A 4UFWA 2C27A 2BEIA 1MJBA 4LX9A 2FL4A 2OH1A 3TO7A 1Q2DA 2CNSA 4JD6A 2Q0YA 4CAXA 4KS9A 3JTKA 3FYNA 4MY0A 2J8MA 3LD2A 1S7KA 1KZFA 4KUBA 1MK4A 5DWNA 1P4NA 1QSOA 3EXNA 2ARHA 2ZW4A 4R3KA 4KOUA 3S6FA 2B4DB 4KOVA 4XNHC 1PUAA 4UBRA 4CRYB 2ZW6A 3FXTA 2GIVA 1IICA 5KTAA 3T90A 4CYOA 4PK3A 2DPTA 2VBQA 3DDDA 1RO5A 4F0YA 4JWPA 4CYPA 1YX0A 2Z3PA 3PZJA 3T9YA 5JPHA 3IWGA 2P6FA 1I12A 1Q2CA 4MY3A 1VKCA 4M85A 3R9EA 2FSRA 5AG5A 2GE3A 1XIXA 2R8VA 4R57A 4XPLA 3PGPA 3TOAA 5F48A 3S6HA 1BOBA 1M44A 2FT0A 2KCWA 2HV2A 3W91A 3DR8A 4KLWA 2J8RA 3H5ZA 2YNCC 5J8CA 4J3GA 5G21A 2DXQA 2JDCA 4MI4A 3V8IA 2B4BA 5BWAB 1ZO0A 2Z0ZA 5IX3A 4KZTA 4XNHB 4KSFA 4E2AA 2G3AA 4HNYB 2HUZA 5KTDA 5DWMA 1S3ZA 3JUWA 2Q7BA 1WWZA 2WPXA 4KOSA 4AVCA 4A33A 2WPWA 5HH1A 2OZUA 4QBJA 2R7HA 4JJXA 4ONUA 4QUSA 1B6BA 1FY7A 2BUEA 4PSXA 4XPDC 4CRZB 1Y7RA 1S7NA 1K4JA 5AG4A 5G20A 2FE7A 1Z4RA 3EC4A 3IWEA 3FB3A 3R1KA 4Q36A 3W6XA 4AVAA 3S6GA 3BLNA 1KUVA 1N71A 5HMNA 4CGLA 5JQ4A 1YVOA 2ZW5A 2JEVA 3S6KA 2ZXVA 2WSAA 1S60A 2JDDA 4HKFA 3TO6A 1QSRA 1I1DA 2J8NA 4MFJA 4CS0B 3D3SA 4RS2A 1QSMA 4B5PB 2NMTA 3CXSA 2YNDA 4BBHA 2B5GA 4ORFA 4UWJA 3F5BA 5H86A 2B3UA 2PRBA 1YGHA 2Q4YA 2Z3MA 4A30A 5E96A 2HQYA 2FS5A 5C88A 4IUSA 1YREA 2H5MA 3R9FA 3DNSA 3D2PA 1S5KA 5F49A 2PDOA 2Z3NA 2OB0A 4QVTA 2P6GA 4KORA 2VEZA 4KUAA 4ZGYB 4AG9A 3CXQA 3N7ZA 4B14A 2CNMA 1Y9WA 3PP9A 4H6UA 2VZZA 4XPDB 1YR0A 2P6EA 4B13A 4X5KA 2BSWA 4C2YA 2G3TA 4FD7A 5F47A 3SXOA 4CGPA 3TFYA 2Z3KA 3QB8A 1CM0A 4YRHA 3DSBA 2PSWA 2B4DA 4KVME 1OZPA 4GS4A 4MFPA 4QB9A 1MJAA 2P0WA 1XMTA 2PC1A 2VXKA 4II9A 3EY5A 5A27A 4AVBA 2O28A 3E0KA 4B11A 5AG6A 4F6AA 3I9SA 4K30A 2K5TA 1Y9KA 2VQYA 5AG7A 2VZYA 4YGOA 3GY9A 3FRMA 5F46A 2Z11A 2B3VA 4AG7A 1IYLA 3I3GA 4FD4A 3H4QA 1I21A 1M1DA 4EVYA 4RI1A 2I00A 3TT2A 1S7LA 1S7FA 4L8AA 4A2ZA 1PU9A 3ZJ0A 4U9YA 4B10A 1B87A 3P2HA 2G0BA 4CAWA 3IGRA 2R98A 4NXYA 3F0AA 4C68A 2Q04A 4AB7A 3D8PA 1XE4A 1NE9A 3ZZIA 4B5OA 4I49A 4BMHA 2Z3LA 3FBUA 4MFKA 4C7HA 1IYKA 1QSTA 2OZGA 4NCZA 4OADA 4OLLA 1LRZA 4KVOE 2YNEA 4R3LA 3TTHA 5C82A 5ISVA 1L0CA 2REFA 2EUIA 2RC4A 1Q2YA 5FVJA 1MJ9A 3D2MA 1V0CA 3B8GA 1GHEA 4UFVA 1QSNA 1Z4EA 3C26A 3WR7A 4M3SA 4UCNA 3UY5A 3FIXA 2B58A 3R96A 4OAEA 2ATRA 3BJ7A 4KSAA 3TCVA 5H84A 1ON0A 3F8KA 4Y49C 1M4IA 2Z3OA 1TIQA 3VWDA 2Z10A 1M4DA 5CNPA 2Y0MA 4MBUA 4YFJA 4FD6A 1R57A 1CJWA 3EFAA 3SHPA 3CXPA 2FXFA 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IID A;  2JLM A;  3GYA A;  4B5P A;  1BO4 A;  3R95 A;  4CAV A;  1M4G A;  3W6S A;  4HNX B;  4R9M A;  2R1I A;  2CNT A;  1NSL A;  2Q44 A;  5IB0 A;  3FNC A;  4HNW B;  5J8F A;  1UFH A;  1WK4 A;  4U5Y A;  2FCK A;  1YLE A;  1Z9U A;  1YVK A;  3LOD A;  4FD5 A;  3DR6 A;  5EBV A;  2AE6 A;  2I79 A;  2EVN A;  1RXT A;  2IL4 A;  4L89 A;  2FIA A;  4IF5 A;  3VWE A;  1XF8 A;  2A4N A;  2ZW7 A;  3MGD A;  3P2F A;  2BL1 A;  4QC6 A;  4JXR A;  4ZBG A;  2QML A;  3NE7 A;  4U9Z A;  4Y49 B;  3RYO A;  4H6Z A;  3TE4 A;  2ZPA A;  2X7B A;  4DNC A;  5IV0 A;  1P0H A;  4XPK A;  4JLY A;  4NF1 A;  4NSQ A;  3G8W A;  4LUA A;  4NEX A;  4PV6 A;  3KKW A;  2OU2 A;  4E8O A;  2Q4V A;  2PR1 A;  4MJ8 A;  3R9G A;  4E0A A;  1SQH A;  3EO4 A;  2QEC A;  3SXN A;  4KOW A;  1VHS A;  2D4P A;  4R87 A;  3G3S A;  3BJ8 A;  2QIR A;  4KOY A;  1IB1 E;  2AJ6 A;  5EC4 A;  2D4O A;  1NMT A;  3OWC A;  2OZH A;  3K9U A;  3QAH A;  4MHD A;  3TO9 A;  5KTC A;  5I0C A;  1J4J A;  1XEB A;  1YK3 A;  3TOB A;  1KUX A;  4KLV A;  5GCN A;  2CY2 A;  4KOX A;  3JVN A;  2PR8 A;  4H89 A;  2GAN A;  4UWI A;  4KVX A;  2B5G B;  4UA3 A;  3GKR A;  1KUY A;  2F5I A;  2VI7 A;  4JXQ A;  1U6M A;  2REE A;  4PK2 A;  2FIW A;  4KOT A;  2PQ8 A;  2C27 A;  2BEI A;  1MJB A;  4LX9 A;  2FL4 A;  2OH1 A;  3TO7 A;  1Q2D A;  2CNS A;  4JD6 A;  2Q0Y A;  4CAX A;  3FYN A;  4MY0 A;  2J8M A;  3LD2 A;  1S7K A;  1KZF A;  4KUB A;  1MK4 A;  5DWN A;  1P4N A;  1QSO A;  3EXN A;  2ARH A;  2ZW4 A;  4R3K A;  4KOU A;  3S6F A;  2B4D B;  4KOV A;  4XNH C;  1PUA A;  4UBR A;  4CRY B;  2ZW6 A;  3FXT A;  2GIV A;  1IIC A;  5KTA A;  3T90 A;  4PK3 A;  2VBQ A;  3DDD A;  1RO5 A;  4F0Y A;  4JWP A;  1YX0 A;  3PZJ A;  3T9Y A;  5JPH A;  3IWG A;  2P6F A;  1I12 A;  1Q2C A;  4MY3 A;  1VKC A;  4M85 A;  3R9E A;  2FSR A;  2GE3 A;  1XIX A;  2R8V A;  4R57 A;  4XPL A;  3PGP A;  3TOA A;  5F48 A;  3S6H A;  1BOB A;  1M44 A;  2FT0 A;  2KCW A;  2HV2 A;  3W91 A;  3DR8 A;  4KLW A;  2J8R A;  5J8C A;  4J3G A;  2DXQ A;  2JDC A;  4MI4 A;  3V8I A;  2B4B A;  2Z0Z A;  5IX3 A;  4KZT A;  4XNH B;  4E2A A;  2G3A A;  4HNY B;  2HUZ A;  5KTD A;  5DWM A;  1S3Z A;  3JUW A;  2Q7B A;  1WWZ A;  2WPX A;  4KOS A;  4AVC A;  2WPW A;  5HH1 A;  2OZU A;  4QBJ A;  2R7H A;  4JJX A;  4ONU A;  4QUS A;  1B6B A;  1FY7 A;  2BUE A;  4PSX A;  4XPD C;  4CRZ B;  1Y7R A;  1S7N A;  1K4J A;  2FE7 A;  1Z4R A;  3EC4 A;  3FB3 A;  3R1K A;  3W6X A;  4AVA A;  3S6G A;  3BLN A;  1KUV A;  1N71 A;  5HMN A;  5JQ4 A;  1YVO A;  2ZW5 A;  2JEV A;  3S6K A;  2ZXV A;  1S60 A;  2JDD A;  4HKF A;  3TO6 A;  1QSR A;  1I1D A;  2J8N A;  4CS0 B;  3D3S A;  4RS2 A;  1QSM A;  4B5P B;  2NMT A;  3CXS A;  2B5G A;  4ORF A;  4UWJ A;  3F5B A;  5H86 A;  2B3U A;  2PRB A;  1YGH A;  2Q4Y A;  5E96 A;  2HQY A;  2FS5 A;  5C88 A;  4IUS A;  1YRE A;  2H5M A;  3R9F A;  3DNS A;  1S5K A;  3D2P A;  5F49 A;  2PDO A;  2OB0 A;  4QVT A;  2P6G A;  4KOR A;  2VEZ A;  4KUA A;  4AG9 A;  3CXQ A;  3N7Z A;  2CNM A;  1Y9W A;  3PP9 A;  4H6U A;  2VZZ A;  4XPD B;  1YR0 A;  2P6E A;  4X5K A;  2BSW A;  2G3T A;  4FD7 A;  5F47 A;  3SXO A;  3TFY A;  3QB8 A;  1CM0 A;  4YRH A;  3DSB A;  2PSW A;  2B4D A;  4KVM E;  1OZP A;  4GS4 A;  4QB9 A;  1MJA A;  2P0W A;  1XMT A;  2PC1 A;  2VXK A;  4II9 A;  3EY5 A;  4AVB A;  2O28 A;  3E0K A;  4F6A A;  3I9S A;  4K30 A;  2K5T A;  1Y9K A;  2VQY A;  2VZY A;  4YGO A;  3GY9 A;  3FRM A;  5F46 A;  2Z11 A;  2B3V A;  4AG7 A;  1IYL A;  3I3G A;  4FD4 A;  3H4Q A;  1I21 A;  1M1D A;  4EVY A;  4RI1 A;  2I00 A;  3TT2 A;  1S7L A;  1S7F A;  4L8A A;  1PU9 A;  3ZJ0 A;  4U9Y A;  1B87 A;  3P2H A;  2G0B A;  4CAW A;  3IGR A;  2R98 A;  4NXY A;  3F0A A;  2Q04 A;  4AB7 A;  3D8P A;  1XE4 A;  1NE9 A;  3ZZI A;  4B5O A;  4I49 A;  4BMH A;  3FBU A;  1IYK A;  1QST A;  2OZG A;  4NCZ A;  4OAD A;  4OLL A;  1LRZ A;  4KVO E;  4R3L A;  3TTH A;  5C82 A;  5ISV A;  1L0C A;  2REF A;  2EUI A;  2RC4 A;  1Q2Y A;  5FVJ A;  1MJ9 A;  3D2M A;  1V0C A;  3B8G A;  1GHE A;  1QSN A;  1Z4E A;  3C26 A;  3WR7 A;  4M3S A;  3UY5 A;  3FIX A;  2B58 A;  3R96 A;  4OAE A;  2ATR A;  3BJ7 A;  3TCV A;  5H84 A;  1ON0 A;  3F8K A;  4Y49 C;  1M4I A;  1TIQ A;  3VWD A;  2Z10 A;  1M4D A;  5CNP A;  2Y0M A;  4MBU A;  4YFJ A;  4FD6 A;  1R57 A;  1CJW A;  3EFA A;  3SHP A;  3CXP A;  2FXF A;  4PSW A; 
#chains in the Genus database with same CATH topology
 2YNC A;  1H8L A;  1IID A;  2JLM A;  3GYA A;  4NGR A;  1BO4 A;  3R95 A;  4B5P A;  4MHY A;  3MRU A;  4UCM A;  3WC5 A;  2ZOF A;  2OR4 A;  4CAV A;  1M4G A;  3NA6 A;  4GM5 A;  4MRI A;  3W6S A;  4HNX B;  2C6C A;  4R9M A;  2R1I A;  4TNU A;  4B12 A;  3BXM A;  2WUU A;  5LRG A;  2CNT A;  1NSL A;  2Q44 A;  5IB0 A;  4UEF A;  3FNC A;  3K9T A;  4HNW B;  5J8F A;  4W9Y A;  1LAP A;  2YGW A;  4F0X A;  2IJZ A;  4JZ0 A;  1UFH A;  1WK4 A;  4U5Y A;  2FCK A;  4MCP A;  4ONW A;  1YLE A;  1Z9U A;  1YVK A;  3LOD A;  4FD5 A;  4OC0 A;  4A32 A;  3KQX A;  3DR6 A;  5EBV A;  2AE6 A;  2I79 A;  2EVN A;  4X8I A;  3IFE A;  1RXT A;  1AMP A;  2IL4 A;  4L89 A;  4CGN A;  4MFQ A;  2FIA A;  2AFZ A;  4IF5 A;  1XF8 A;  4UIB A;  3VWE A;  2XEF A;  4MFZ A;  2A4N A;  2ZW7 A;  3MGD A;  4A95 A;  3P2F A;  2BL1 A;  4CGM A;  2JEW A;  4QC6 A;  4JXR A;  4ZBG A;  2PVV A;  4MHN A;  2XEJ A;  4A31 A;  4WWV A;  2QML A;  2CXA A;  3NE7 A;  1Q7L A;  4NGM A;  4U9Z A;  1YQE A;  1Z8X A;  2DF5 A;  3B7I A;  4Q38 A;  4Y49 B;  4P6Y A;  4DUK A;  3D7G A;  1JQG A;  1ZG7 A;  3RYO A;  1Z8L A;  4H6Z A;  3TE4 A;  2ZPA A;  2O53 A;  2X7B A;  4DNC A;  4C7I A;  1R43 A;  1P0H A;  3JRU A;  5IV0 A;  5LRJ A;  3IWW A;  4XPK A;  2XEI A;  4BD9 A;  4JLY A;  4NF1 A;  4CAE A;  3NH5 A;  4A37 A;  2PIZ A;  3MN8 A;  3IU1 A;  4NSQ A;  3G8W A;  4LUA A;  4C2Z A;  3CZX A;  2ANP A;  4NEX A;  4PV6 A;  4CYN A;  2ZEG A;  1XOV A;  4CAF A;  2ZEF A;  2IQ6 A;  3KKW A;  5AGE A;  3GLJ A;  1TF9 A;  2OU2 A;  2PJ2 A;  4E8O A;  2Q4V A;  2EK9 A;  1IY7 A;  2PR1 A;  4MJ8 A;  3R9G A;  1SQH A;  4E0A A;  1F57 A;  2AFS A;  3EO4 A;  2QEC A;  1GYT A;  5LRK A;  2V8V A;  5G22 A;  3SXN A;  2ZOG A;  1TF8 A;  1VHS A;  2D4P A;  4KOW A;  2PVW A;  4R87 A;  5LYF A;  3G3S A;  3BJ8 A;  2VL1 A;  2QIR A;  1ARM A;  5DS0 A;  1BLL E;  4K3N A;  4C2X A;  1IB1 E;  2AJ6 A;  3IU2 A;  4KOY A;  2D4O A;  5EC4 A;  1NMT A;  3OWC A;  1IOF A;  4CGO A;  3V7Z A;  2OZH A;  4UFX A;  5LYL A;  3K9U A;  1NSA A;  3QAH A;  1HDQ A;  3KGQ A;  4TWE A;  3WAB A;  4MHD A;  3LAC A;  3TO9 A;  5KTC A;  1LAM A;  1AYE A;  4CYQ A;  5I0C A;  1J4J A;  1XEB A;  2PRQ A;  3KZW A;  3B35 A;  1YK3 A;  3I1U A;  3TOB A;  1KUX A;  3FMC A;  3PFO A;  4KLV A;  4ZX9 A;  5GCN A;  2CY2 A;  2J9A A;  3FVL A;  3LWU A;  3A9L A;  4KOX A;  4Z65 A;  3JVN A;  4MFL A;  3VH9 A;  2PR8 A;  4H89 A;  1TKH A;  2GAN A;  4O23 A;  4UWI A;  4PXD A;  4KVX A;  2B5G B;  4UA3 A;  3GKR A;  5A28 A;  3DGV A;  2PJ0 A;  3GIU A;  3D4U A;  1KUY A;  2F5I A;  5G1Z A;  2PJ4 A;  2VI7 A;  4ZI6 A;  2C6G A;  3TC8 A;  3LMS A;  2QJ8 A;  4JXQ A;  1HEE A;  1U6M A;  2DPS A;  2REE A;  4OC3 A;  4PK2 A;  2Q4Z A;  2FIW A;  4F9U A;  4UCP A;  4KOT A;  3T8W A;  2PQ8 A;  4UFW A;  2C27 A;  2BEI A;  4P4D A;  1MJB A;  4F8Z A;  4LX9 A;  2FL4 A;  2OH1 A;  4NGT A;  3TO7 A;  4B6Z A;  1Q2D A;  2CNS A;  4JD6 A;  2Q0Y A;  4CAX A;  2PJ5 A;  4KS9 A;  3BHX A;  2PJB A;  2GLJ A;  3JTK A;  5JGF A;  4DYO A;  3FYN A;  3PFE A;  4MY0 A;  3PEI A;  2J8M A;  5HVH A;  4UEE A;  3LD2 A;  4NGS A;  1S7K A;  3FH4 A;  2JBJ A;  1M4L A;  3IO1 A;  1KZF A;  2F7V A;  4KUB A;  1MK4 A;  4NJR A;  5DWN A;  4A94 A;  1P4N A;  1YW6 A;  1QSO A;  3EXN A;  3ISX A;  2ODF A;  2ARH A;  2PJ9 A;  4FUU A;  2G9D A;  3FEE A;  3B3S A;  4NFR A;  5JM6 A;  2FVG A;  4UIA A;  1CPX A;  2BO9 A;  2ZW4 A;  3KAS A;  2IMO A;  4OID A;  4R3K A;  4M6I A;  4MCR A;  4KOU A;  1Z8T A;  3S6F A;  2B4D B;  4KOV A;  3NH4 A;  1CPS A;  4XNH C;  1PUA A;  4UBR A;  2Q7S A;  3ISZ A;  3HUV A;  4CRY B;  4DJL A;  4YU9 A;  2C1C A;  4PXB A;  2ZW6 A;  3FXT A;  3S9N A;  2PJ1 A;  2GIV A;  1Z8W A;  1CP7 A;  2ZEH A;  1IIC A;  1IU8 A;  5KTA A;  4P4B A;  2DEA A;  3RNZ A;  3T90 A;  2AFU A;  4PK3 A;  4CYO A;  2DPT A;  2VBQ A;  2HB6 A;  3KR5 A;  3NFZ A;  3PB4 X;  3DDD A;  1QQ9 A;  1RO5 A;  4F0Y A;  4JWP A;  4CYP A;  2V8G A;  1YX0 A;  2Z3P A;  3PZJ A;  3SI0 A;  3T9Y A;  2V8H A;  5JPH A;  1LOK A;  3IWG A;  2P6F A;  5HXD A;  1I12 A;  4AXV A;  1Q2C A;  1Z5R A;  1VKC A;  4M85 A;  4MY3 A;  5LYI A;  3R9E A;  2FSR A;  4LQ6 A;  4NGN A;  4P45 A;  5AG5 A;  2EBJ A;  1TKJ A;  3H8F A;  3RAM A;  3PBE A;  2ZEE A;  5K8M A;  4RN7 A;  1XFO A;  3D67 A;  4LQG A;  3B2Y A;  2Q51 A;  3NH8 A;  2GE3 A;  1XIX A;  2R8V A;  4UF4 A;  4R57 A;  3S9L A;  3PB7 X;  4XPL A;  3PGP A;  3TOA A;  4MHP A;  1R3N A;  2EK8 A;  2PJ7 A;  1Y0R A;  3IJ3 A;  5F48 A;  3S6H A;  1ELL P;  1BOB A;  1M44 A;  1YME A;  1AUG A;  2PCU A;  3B3C A;  1LAN A;  3QAY A;  4OC4 A;  2FT0 A;  3S9M A;  5K8N A;  2KCW A;  2HV2 A;  3W91 A;  4NGP A;  3DR8 A;  4KLW A;  2J8R A;  3BI1 A;  2YNC C;  3B3V A;  3H5Z A;  4OC5 A;  5J8C A;  2ZED A;  4J3G A;  4ZY1 A;  2V77 A;  5G21 A;  3IIB A;  3WC7 A;  1X10 A;  4MMO A;  3SJF A;  2DXQ A;  2JDC A;  1KWM A;  4MI4 A;  1OBR A;  2B4B A;  3V8I A;  2OOT A;  1ZO0 A;  2Z0Z A;  4F9V A;  4KZT A;  5BWA B;  4XNH B;  4KSF A;  4E2A A;  3D7D A;  5IX3 A;  3PB8 X;  4PXE A;  2ZEP A;  2G3A A;  4HNY B;  3HLP A;  4NGQ A;  3VAR A;  2HUZ A;  3H8E A;  5KTD A;  5DWM A;  1XJO A;  2PJ3 A;  3GB0 A;  1S3Z A;  3JUW A;  1VHE A;  4CPA A;  1CP6 A;  2Q7B A;  1WWZ A;  2WPX A;  4KOS A;  4AVC A;  2JBK A;  2EO8 A;  4A33 A;  5D29 A;  3BI0 A;  2WPW A;  5HH1 A;  2OZU A;  3SJG A;  4QBJ A;  2R7H A;  4JJX A;  5THW A;  4ONU A;  3PBB A;  4QUS A;  1B6B A;  1FY7 A;  2BUE A;  3SI1 A;  4PSX A;  4XPD C;  4CRZ B;  3WC6 A;  4MXU A;  3IEH A;  1Y7R A;  1S7N A;  2QVP A;  2PJ8 A;  1K4J A;  4FWU A;  5AG4 A;  5G20 A;  2FE7 A;  6CPA A;  2O4H A;  1Z4R A;  3EC4 A;  3IWE A;  3FB3 A;  3R1K A;  4Q36 A;  3W6X A;  2ZEM A;  4WJB A;  8CPA A;  1Y0Y A;  2BCO A;  4AVA A;  4P4F A;  3S6G A;  1VHO A;  3BLN A;  1KUV A;  3CPA A;  1N71 A;  1ZLI A;  5HMN A;  4CGL A;  3CT9 A;  5JQ4 A;  1YVO A;  2ZW5 A;  2JEV A;  3S6K A;  4BIN A;  1LFW A;  3KQZ A;  3D7H A;  2ZXV A;  2WSA A;  1S60 A;  2JDD A;  4HKF A;  4OME A;  4JYW A;  5D8N A;  3TO6 A;  1QSR A;  1IGB A;  1I1D A;  1F2O A;  2J8N A;  4MFJ A;  4CS0 B;  3D3S A;  4RS2 A;  1UWY A;  1QSM A;  3FF3 A;  4B5P B;  2NMT A;  3CXS A;  3KHZ A;  5LYD A;  4ZYQ A;  2YND A;  3RZA A;  4BBH A;  2B5G A;  4ORF A;  4UWJ A;  3F5B A;  5H86 A;  1CBX A;  2B3U A;  2PRB A;  2BOA A;  1YGH A;  2Q4Y A;  2Z3M A;  4A30 A;  4OP4 A;  1RTQ A;  5E96 A;  2HQY A;  2FS5 A;  1A2Z A;  5C88 A;  4IUS A;  3TX8 A;  1YRE A;  2H5M A;  3D66 A;  4H2K A;  1PYT B;  1TXR A;  3DNS A;  3R9F A;  1S5K A;  3D2P A;  5F49 A;  2PDO A;  2Z3N A;  2OB0 A;  5JH9 A;  1IOI A;  4QVT A;  2RB7 A;  2P6G A;  4A38 A;  4KOR A;  1FT7 A;  2GFQ A;  2VEZ A;  4KUA A;  5CPA A;  4ZGY B;  1F2P A;  4AG9 A;  3CXQ A;  3N7Z A;  4B14 A;  5F09 A;  3PRT A;  2CNM A;  2ZEO A;  1Y9W A;  4ZY0 A;  4FBE A;  4EFD A;  3PP9 A;  5I4M A;  4H6U A;  2VZZ A;  4XPD B;  1YR0 A;  1LCP A;  2P6E A;  4G1P A;  4X5K A;  4B13 A;  1YSJ A;  2BSW A;  4C2Y A;  2WYR A;  2G3T A;  4FD7 A;  4P4I A;  4UEZ A;  5F47 A;  3KI9 A;  3SXO A;  3FEC A;  4CGP A;  3TFY A;  2Z3K A;  3QB8 A;  2QYV A;  3KR4 A;  3D7F A;  3KHX A;  4R7M A;  1CM0 A;  2PJA A;  2WZN A;  3DSB A;  2PSW A;  4OKO A;  2B4D A;  4YRH A;  3WT4 A;  1EE3 P;  1ELM P;  4KVM E;  1TKF A;  1OZP A;  4GS4 A;  2AFX A;  4MFP A;  4QB9 A;  3SI2 A;  2AFM A;  1MJA A;  3K2K A;  2P0W A;  1XMT A;  1DE4 C;  2EWB A;  2PC1 A;  2VXK A;  4II9 A;  1XRY A;  3EY5 A;  5A27 A;  4M6H A;  4P4E A;  7CPA A;  4MCQ A;  2O28 A;  3E0K A;  4P4J A;  5AG6 A;  4AVB A;  4B11 A;  1ARL A;  2GU2 A;  3I9S A;  4F6A A;  4K30 A;  1YW4 A;  2K5T A;  1Y9K A;  2VQY A;  3RBU A;  2PJ6 A;  3CDX A;  5AG7 A;  2VZY A;  2GLF A;  4YGO A;  2PIY A;  5CBM A;  3GY9 A;  4YWY A;  3FRM A;  5F46 A;  1X12 A;  2Z11 A;  2B3V A;  4AG7 A;  1IYL A;  1ZLH A;  3I3G A;  3N5F A;  3PB9 X;  1BPM A;  4FD4 A;  3H4Q A;  4RUH A;  2ZEN A;  1I21 A;  4EWT A;  1M1D A;  4EVY A;  1XBU A;  4OC2 A;  3IC1 A;  3V38 A;  4OC1 A;  4RI1 A;  2I00 A;  3TT2 A;  1XMB A;  1S7L A;  3H8G A;  1S7F A;  4X2T A;  4L8A A;  1BAV A;  3D68 A;  2V8D A;  4A2Z A;  1PU9 A;  3KL9 A;  2CIJ A;  4IAV A;  4MHZ A;  1ZG8 A;  3ZJ0 A;  4U9Y A;  1DTD A;  1B87 A;  3P2H A;  1FNO A;  2G0B A;  4B10 A;  2GRE A;  4CAW A;  1ZG9 A;  3IGR A;  2R98 A;  4R8F A;  3FED A;  5EMI A;  3SJE A;  4NXY A;  3F0A A;  4C68 A;  2Q04 A;  4AB7 A;  4P10 A;  3SJX A;  1VGY A;  3D8P A;  1XE4 A;  1NE9 A;  3ZZI A;  4B5O A;  4FAI A;  1CG2 A;  2ABZ A;  2CTB A;  4IK2 A;  1VIX A;  3FX6 A;  4I49 A;  4BMH A;  2Z3L A;  4PQA A;  3FBU A;  4MFK A;  3DLJ A;  4C7H A;  4PXC A;  1IYK A;  1QST A;  2OZG A;  2RFH A;  4HPS A;  4NCZ A;  2XEG A;  4OAD A;  4OLL A;  3GUX A;  1LRZ A;  2NSM A;  3QNV A;  2I3C A;  4KVO E;  2YNE A;  4OIW A;  4R3L A;  3TTH A;  5C82 A;  3VAT A;  4EME A;  3NE8 A;  5ISV A;  1L0C A;  2REF A;  2EUI A;  4PPZ A;  2POK A;  2RC4 A;  4IHM A;  1Q2Y A;  2Q43 A;  5FVJ A;  3L2N A;  5HVF A;  1MJ9 A;  3D2M A;  3FJU A;  1V0C A;  3B8G A;  1GHE A;  4UFV A;  1HDU A;  1QSN A;  1Z4E A;  1JWQ A;  3C26 A;  3WR7 A;  4M3S A;  4UCN A;  1YLO A;  1Z2L A;  2C6P A;  4GXH A;  2CF4 A;  5J1Q A;  4M6G A;  4R6T A;  4ZX8 A;  1BPN A;  3UY5 A;  3FIX A;  2CTC A;  2ZEL A;  4MCS A;  3PB6 X;  2B58 A;  2HC9 A;  4NJQ A;  5ELY A;  2PJC A;  4OAE A;  3R96 A;  3CPX A;  1QMU A;  2ATR A;  2AFW A;  3BJ7 A;  4KSA A;  5IB9 A;  3TCV A;  4A39 A;  5H84 A;  1ON0 A;  3F8K A;  5K8O A;  4Y49 C;  1M4I A;  4ZY2 A;  1CX8 A;  4P44 A;  4Q7A A;  1Y7E A;  2Z3O A;  1TIQ A;  3B3T A;  3VWD A;  2Z10 A;  4KSI A;  1M4D A;  3B3W A;  5CNP A;  2PE3 A;  1PCA A;  2Y0M A;  4MBU A;  2F8H A;  4YFJ A;  4FD6 A;  1R57 A;  1CJW A;  2AFO A;  3EFA A;  3SHP A;  4X3R A;  5K8P A;  5HVG A;  3CXP A;  2FXF A;  4PSW A;  2NYQ A;  3RO0 A;  4R76 A; 
#chains in the Genus database with same CATH homology
 2YNC A;  1IID A;  2JLM A;  3GYA A;  4B5P A;  1BO4 A;  3R95 A;  4UCM A;  4CAV A;  1M4G A;  3W6S A;  4HNX B;  4R9M A;  2R1I A;  4B12 A;  2WUU A;  2CNT A;  1NSL A;  2Q44 A;  5IB0 A;  3FNC A;  4HNW B;  5J8F A;  2YGW A;  4F0X A;  1UFH A;  1WK4 A;  4U5Y A;  2FCK A;  1YLE A;  1Z9U A;  1YVK A;  3LOD A;  4FD5 A;  4A32 A;  3DR6 A;  5EBV A;  2AE6 A;  2I79 A;  2EVN A;  1RXT A;  2IL4 A;  4L89 A;  4CGN A;  4MFQ A;  2FIA A;  4IF5 A;  3VWE A;  1XF8 A;  4MFZ A;  2A4N A;  2ZW7 A;  3MGD A;  4A95 A;  3P2F A;  2BL1 A;  4CGM A;  4QC6 A;  4JXR A;  4ZBG A;  4A31 A;  2QML A;  2CXA A;  3NE7 A;  4U9Z A;  4Q38 A;  4Y49 B;  3RYO A;  4H6Z A;  3TE4 A;  2ZPA A;  2X7B A;  4DNC A;  4C7I A;  5IV0 A;  1P0H A;  4XPK A;  4JLY A;  4NF1 A;  4CAE A;  4NSQ A;  3IU1 A;  4C2Z A;  3G8W A;  4LUA A;  4NEX A;  4PV6 A;  4CYN A;  4CAF A;  3KKW A;  5AGE A;  2OU2 A;  4E8O A;  2Q4V A;  2PR1 A;  4MJ8 A;  3R9G A;  4E0A A;  1SQH A;  3EO4 A;  2QEC A;  3SXN A;  5G22 A;  4KOW A;  1VHS A;  2D4P A;  4R87 A;  3G3S A;  3BJ8 A;  2QIR A;  4C2X A;  1IB1 E;  2AJ6 A;  3IU2 A;  4KOY A;  2D4O A;  5EC4 A;  1NMT A;  3OWC A;  4CGO A;  2OZH A;  4UFX A;  3K9U A;  3QAH A;  4MHD A;  3TO9 A;  5KTC A;  4CYQ A;  5I0C A;  1J4J A;  1XEB A;  1YK3 A;  3TOB A;  1KUX A;  4KLV A;  5GCN A;  2CY2 A;  4KOX A;  3A9L A;  3JVN A;  4MFL A;  2PR8 A;  4H89 A;  2GAN A;  4UWI A;  4KVX A;  2B5G B;  4UA3 A;  3GKR A;  5A28 A;  5G1Z A;  1KUY A;  2F5I A;  2VI7 A;  4JXQ A;  1U6M A;  2DPS A;  2REE A;  4PK2 A;  2FIW A;  4UCP A;  4KOT A;  2PQ8 A;  4UFW A;  2C27 A;  2BEI A;  1MJB A;  4LX9 A;  2FL4 A;  2OH1 A;  3TO7 A;  1Q2D A;  2CNS A;  4JD6 A;  2Q0Y A;  4CAX A;  4KS9 A;  3JTK A;  3FYN A;  4MY0 A;  2J8M A;  3LD2 A;  1S7K A;  1KZF A;  4KUB A;  1MK4 A;  5DWN A;  1P4N A;  1QSO A;  3EXN A;  2ARH A;  2ZW4 A;  4R3K A;  4KOU A;  3S6F A;  2B4D B;  4KOV A;  4XNH C;  1PUA A;  4UBR A;  4CRY B;  2ZW6 A;  3FXT A;  2GIV A;  1IIC A;  5KTA A;  3T90 A;  4CYO A;  4PK3 A;  2DPT A;  2VBQ A;  3DDD A;  1RO5 A;  4F0Y A;  4JWP A;  4CYP A;  1YX0 A;  2Z3P A;  3PZJ A;  3T9Y A;  5JPH A;  3IWG A;  2P6F A;  1I12 A;  1Q2C A;  4MY3 A;  1VKC A;  4M85 A;  3R9E A;  2FSR A;  5AG5 A;  2GE3 A;  1XIX A;  2R8V A;  4R57 A;  4XPL A;  3PGP A;  3TOA A;  5F48 A;  3S6H A;  1BOB A;  1M44 A;  2FT0 A;  2KCW A;  2HV2 A;  3W91 A;  3DR8 A;  4KLW A;  2J8R A;  3H5Z A;  2YNC C;  5J8C A;  4J3G A;  5G21 A;  2DXQ A;  2JDC A;  4MI4 A;  3V8I A;  2B4B A;  5BWA B;  1ZO0 A;  2Z0Z A;  5IX3 A;  4KZT A;  4XNH B;  4KSF A;  4E2A A;  2G3A A;  4HNY B;  2HUZ A;  5KTD A;  5DWM A;  1S3Z A;  3JUW A;  2Q7B A;  1WWZ A;  2WPX A;  4KOS A;  4AVC A;  4A33 A;  2WPW A;  5HH1 A;  2OZU A;  4QBJ A;  2R7H A;  4JJX A;  4ONU A;  4QUS A;  1B6B A;  1FY7 A;  2BUE A;  4PSX A;  4XPD C;  4CRZ B;  1Y7R A;  1S7N A;  1K4J A;  5AG4 A;  5G20 A;  2FE7 A;  1Z4R A;  3EC4 A;  3IWE A;  3FB3 A;  3R1K A;  4Q36 A;  3W6X A;  4AVA A;  3S6G A;  3BLN A;  1KUV A;  1N71 A;  5HMN A;  4CGL A;  5JQ4 A;  1YVO A;  2ZW5 A;  2JEV A;  3S6K A;  2ZXV A;  2WSA A;  1S60 A;  2JDD A;  4HKF A;  3TO6 A;  1QSR A;  1I1D A;  2J8N A;  4MFJ A;  4CS0 B;  3D3S A;  4RS2 A;  1QSM A;  4B5P B;  2NMT A;  3CXS A;  2YND A;  4BBH A;  2B5G A;  4ORF A;  4UWJ A;  3F5B A;  5H86 A;  2B3U A;  2PRB A;  1YGH A;  2Q4Y A;  2Z3M A;  4A30 A;  5E96 A;  2HQY A;  2FS5 A;  5C88 A;  4IUS A;  1YRE A;  2H5M A;  3R9F A;  3DNS A;  3D2P A;  1S5K A;  5F49 A;  2PDO A;  2Z3N A;  2OB0 A;  4QVT A;  2P6G A;  4KOR A;  2VEZ A;  4KUA A;  4ZGY B;  4AG9 A;  3CXQ A;  3N7Z A;  4B14 A;  2CNM A;  1Y9W A;  3PP9 A;  4H6U A;  2VZZ A;  4XPD B;  1YR0 A;  2P6E A;  4B13 A;  4X5K A;  2BSW A;  4C2Y A;  2G3T A;  4FD7 A;  5F47 A;  3SXO A;  4CGP A;  3TFY A;  2Z3K A;  3QB8 A;  1CM0 A;  4YRH A;  3DSB A;  2PSW A;  2B4D A;  4KVM E;  1OZP A;  4GS4 A;  4MFP A;  4QB9 A;  1MJA A;  2P0W A;  1XMT A;  2PC1 A;  2VXK A;  4II9 A;  3EY5 A;  5A27 A;  4AVB A;  2O28 A;  3E0K A;  4B11 A;  5AG6 A;  4F6A A;  3I9S A;  4K30 A;  2K5T A;  1Y9K A;  2VQY A;  5AG7 A;  2VZY A;  4YGO A;  3GY9 A;  3FRM A;  5F46 A;  2Z11 A;  2B3V A;  4AG7 A;  1IYL A;  3I3G A;  4FD4 A;  3H4Q A;  1I21 A;  1M1D A;  4EVY A;  4RI1 A;  2I00 A;  3TT2 A;  1S7L A;  1S7F A;  4L8A A;  4A2Z A;  1PU9 A;  3ZJ0 A;  4U9Y A;  4B10 A;  1B87 A;  3P2H A;  2G0B A;  4CAW A;  3IGR A;  2R98 A;  4NXY A;  3F0A A;  4C68 A;  2Q04 A;  4AB7 A;  3D8P A;  1XE4 A;  1NE9 A;  3ZZI A;  4B5O A;  4I49 A;  4BMH A;  2Z3L A;  3FBU A;  4MFK A;  4C7H A;  1IYK A;  1QST A;  2OZG A;  4NCZ A;  4OAD A;  4OLL A;  1LRZ A;  4KVO E;  2YNE A;  4R3L A;  3TTH A;  5C82 A;  5ISV A;  1L0C A;  2REF A;  2EUI A;  2RC4 A;  1Q2Y A;  5FVJ A;  1MJ9 A;  3D2M A;  1V0C A;  3B8G A;  1GHE A;  4UFV A;  1QSN A;  1Z4E A;  3C26 A;  3WR7 A;  4M3S A;  4UCN A;  3UY5 A;  3FIX A;  2B58 A;  3R96 A;  4OAE A;  2ATR A;  3BJ7 A;  4KSA A;  3TCV A;  5H84 A;  1ON0 A;  3F8K A;  4Y49 C;  1M4I A;  2Z3O A;  1TIQ A;  3VWD A;  2Z10 A;  1M4D A;  5CNP A;  2Y0M A;  4MBU A;  4YFJ A;  4FD6 A;  1R57 A;  1CJW A;  3EFA A;  3SHP A;  3CXP A;  2FXF A;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...