4XNQA

Antibody hemagglutinin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords H5.3 Light chain
total genus 47
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA01
3T0DA 4X6BB 1IRAY 3LN5A 4GW4B 1NBYB 2WINB 3GSXB 1S78D 3ETBF 4JY4B 2FX9H 5IVXA 2LFGA 1PZ5B 4QRUB 2DQEL 3BGFB 3NMEA 4RDQF 2JJVA 3G5XA 4NZJA 3AS0A 1GSMA 4DVRH 3MV7A 4X9IA 4I3RL 1RUMH 2ERJC 1Q9KA 3GJFA 5F9OL 4KKCD 4QF1A 3OTTA 4KJWD 2F53B 4MHHI 4RNRA 1A1OB 5HD8C 5ETUB 3ARDC 2A6JA 3NZHL 4IHOA 2A1WH 2FIRT 1P9MC 4YGVB 4Y1AE 5EULV 5T3XE 3ZE1F 1HQ4A 2KH2B 4I0KA 4P23C 1EEZA 2YBRB 3V0VB 3BPOB 3HKFA 1UXSB 1UADC 5EC1B 2YEZA 2A77H 3C5JB 4MJIE 4Q6IA 5EUOF 3T3PE 3FQXA 3UBXI 2VKWA 4JFED 3H9ZA 5F7WC 1ED3A 3WJLC 4M02A 4XGZA 3ZYIA 1T1ZA 2NTFB 5I8EA 1U2CA 3DSFH 3MBEC 1LO0L 5DVOA 2V9TA 4IDLA 4UV4H 3MLXH 4NHUB 1NKOA 5ITFB 3LKQA 3BD3A 1T2QL 3HR5B 5EA0H 2BNQD 1QSEA 4S0TD 5B38A 4J12A 2I26N 1PQZB 3L5IA 2R56L 4JHWL 4R97C 4XPFH 1CLZL 5IESH 4EI6B 1NGYB 5M7QA 4BKLA 3QO0A 1HHIA 1T1YB 3AAZA 2FATH 1HCFX 4CVWA 4JO4H 3T08A 1ROWA 1T5WA 2EDDA 4HJGB 1NUFA 4B7IA 5JHLH 1V7ML 5E2TL 4WI2A 3VA6A 5GXBB 4Y5VA 2VERN 5DHVH 2G9HB 4APQB 5BCAA 2F53A 1J86A 1UM6H 2EXYD 2OTUA 1Q38A 5DO2D 4ZAKC 1OTUD 1QR1A 4CW1B 1OAXL 2VZVA 1GH7A 4NKMB 4OLXL 3VFPA 3MSPA 3D0LB 2P46B 1I8IB 3ZTJH 4XCFL 1QO3A 3WHXA 1F58H 5TE4L 1XF5B 5FGBC 5DJYB 3DV4B 3WD5H 4IIQB 1IILE 2KQMA 4HJGA 1GC1L 3GIVB 1EFQA 3GMQB 3MJ9L 5DR5L 5IVXB 3UTOA 2BMKA 3LIZL 5A3IC 1J8KA 3GMRA 3GSWB 3MUY1 1WFTA 1OP3K 5IFJA 4MA7L 2BNQB 4YHMH 4NWUL 3LPGA 2VXUL 4C4KO 3IXAA 5IBUG 2YMXH 3BO8B 5DVLA 4UBDC 4J3VA 3GIZH 2D4DA 5CZVL 2CSPA 4IRSD 2M2DA 1LEGA 2W65A 1UXWB 3HPLA 1XIWD 4WO4D 1IGIH 1OCWL 1QSFA 1XIWA 5B3JE 1CLCA 5C2BH 3KPSE 1OF2B 3TM6A 1BGXH 4MA1C 4KY1H 5CHNA 1YMMB 1FSKB 2ADIA 2QLVB 4HWNA 3QUYD 4EDXA 1P4LA 2OI9C 3GJEA 5HI5C 1UEMA 1A7PL 4K7PL 1RURH 4YIQA 3T3MF 1KLGB 2EDOA 4O58L 1R5VA 3LEVH 1KV3A 3FN9A 5ESVB 3WHE0 4P5KA 4HG4K 4G7YH 4LLQB 3TJEH 2NY4B 2LAGB 4QHKJ 5F93C 4XPBL 5F9WC 2GJ6A 4P4KA 1C7TA 2AJZA 1HI6B 1AE6L 1LWRA 2D4FA 1A7RH 4HS3B 3VI3F 4XPTH 4JRXD 5D4QA 4DQOH 5CD5C 3H3PH 2QADB 3AS3A 3QEQD 2N7BA 4U1SB 2NY2C 4JAMB 2O5XH 1VFMA 2XT1B 1A6VH 4PP2B 2DLIA 3QJFB 3O6FD 4LKCB 7FABH 1KACB 2PXYB 4WWKD 5T1LA 3REVA 3O6LL 5EBLA 4Q9RL 3FOMA 2EEAA 4JZOB 3BPNB 3RWIB 1B6DA 2UWEA 4PJHE 5ETUA 3S37L 3RA7H 1T21B 4LAJH 1D5IL 5D1XA 4PLOB 2FBJL 1L9NA 5EZLA 2R1YA 3HPJB 4KQ4L 1R24B 3BYTA 4XBGB 3QEHA 4PJGE 3GO1L 4QRQB 4LOUC 2H6PA 1P2CA 2XZZA 1SEBB 5BQ7A 1FRGL 3KYMB 3QWRD 1RK1A 2WLYA 1ZGLP 5E9DA 3EFDH 3DV6A 3TVMC 1MVUB 4J2XA 4JB9L 4WJ5A 1KB9K 3P3YA 5T5FL 2XRAH 3JWOH 4JCMA 2AI0L 1AC0A 4OFIA 1FFOB 2CLZA 2X70B 5AG8A 1ZS8A 3KPTA 3IVKB 1MCJA 1IC7L 5LAXA 1D7FA 2H26B 1AGEA 4QXGL 5ANMA 1F4WL 3GUTB 3C5SB 3D9AH 1XGQA 3KGRA 4ZPTB 3O3EB 4KTEH 1OSZB 1CS6A 1JI1A 2FHFA 1CWVA 2I60H 5D1XD 4YWGH 5CEXB 1IAMA 4BQ6A 4MNHA 5HYSA 3QXAA 4S1SH 2A6DA 1J0YA 4ZOBA 1CBVL 3BPLC 3O4LE 5EBMA 3RWHB 2VR5A 1UWEL 3FZUD 2VLRE 5EIQA 4JQVC 3MLUL 1S8DB 1U3YA 3NTCL 3F58H 5BZWA 1ZLWK 3ZKSD 4YC2C 3QUXC 5DMKA 1I3UA 3RZWA 4L29B 5GS2D 5D7KD 5KW9H 1OSZA 3MFGB 3NCMA 5EBWB 4LGRB 1SY6A 5E1HB 5DJZA 4Z7UE 5BJTB 4XMKH 5JDSB 3GGWB 3GSNB 1HHKB 1KCLA 1L0XA 2ZNXA 1T7VA 1HZHL 3FO2B 5GGRY 1KN2H 5E5MB 1ZA6B 1MSPA 5KTEL 2VLJE 3GMOB 5D5MB 5JW3L 1UKSA 1ODAA 3EYUL 1LO2L 2QADC 4F7TA 4XVTL 1BOGA 1ZHBA 1UWXH 1KIQA 2XFXB 4LHUA 4WIQA 3S97C 1CDUA 2MHAB 3FB8B 5EOCH 1W72L 5F9WB 1QA9A 2YUWA 5IQ9A 1JJUA 2DIJA 5FAAA 2EKSB 5HD8D 1L6ZA 4F7MB 4M4PA 4OI9A 3KPRA 1HXMA 3HCVB 4PJFE 4OFDA 4OIIL 3TH2T 2Q8AH 2BHYA 5DRXB 2HG5A 1DR9A 1ZHBB 4N0CC 1P1ZB 3GI8L 3U1SH 3IVKA 4NM4L 3BIKB 3DURB 4KY1L 3AM8C 3S5LB 4YHLL 5MHSD 3PGDB 3V5KB 1KGCE 2IEPA 4QXTB 3FRUA 3O9WB 4U1HA 5F7LB 3DYOA 3BPLB 5CEZD 1ZKAA 2ADJA 4K2UH 5D2NB 2D3VA 3HLAA 1F58L 5TE4H 1F3DJ 1CFNA 1KTKE 1PDKA 5AZ2L 5EOQH 5L8LB 1EJ6A 5BV7C 4X0KB 2X4QA 1JPGB 1WFOA 5IVXF 4GLRH 4LQFL 3IRPX 5C0JA 1MFEL 3OXRA 5TE6H 5FYKE 4Q7DA 1OT1A 4CN4A 1OB1A 4BUGA 5D2LF 1U58A 1IAOA 3MJ8A 2NLJA 2EIDA 1C1EH 3U7WH 4RAVA 3ARFD 3IFPB 3BGMA 1IAIH 4Z77B 4K94H 5FECA 1Z5LB 3U4EA 1S9WB 3ULVL 4YPGB 1VFAB 1DBJH 5FK9A 1JZ8A 1UKQA 3QXAB 4X0KA 3QEGL 3SE9H 2GK0B 4R3SA 3SGJC 3I02B 5F8QC 3CLFH 4OCNC 3TBTA 3WHE1 1AGDB 1KC5L 1CGUA 1T22A 2YA0A 3PDOB 3T77A 3TIDA 3GMOA 4KROC 1A14H 2BDNH 4H8WL 5C7XL 5K9JL 4R8WL 4JFDB 2AJSH 3DPBA 1DDHB 3B43A 4Q6YA 5FUOL 5EU6E 1CZ8H 4U1NA 3S3SA 5I1HH 4J6RL 2ATPB 4G42B 5DEFB 5FGCB 5I1GH 1MLCB 2FIKA 1WT5C 4C56D 3X14B 4HMDA 2XA3A 4FQIH 3MCG1 1M7IA 1C7SA 1PX4A 1JPFA 1U2HA 2AXJA 4NKIL 4PGEA 3HG1A 1LK2A 3FN3A 3BQUB 2F74A 5HGGS 1I1AA 3SGDI 1UB5A 4A2LA 3A6BL 4YHIA 2APTA 2DLHA 1AGEB 5ANMB 4CJ1A 1OAKL 4BFBD 2Q7NA 4OB5H 2MMXA 3DRQA 1YNLH 3RWDB 1SQ2N 1GYAA 4IRSC 3LSOA 1BQHA 3W2DH 2QSCH 2PF6A 3PP4L 5F7NC 3DROA 3HI1B 1SM3H 3RZCB 1G6RL 4NKDB 1E4XI 1GPOL 4KI1A 1TQBB 4ESKA 3BE1L 4HUVB 3LKPB 3RIAK 3VXMA 1KELL 1EO7A 1FSKC 2EC8A 3C60D 3EGSA 4F3FA 1D5ZA 1P84J 3NCCB 4PREA 3IKCA 3WIIL 3SCMD 1IGJB 5E1AB 4Z7VA 2JLLA 4EI5A 3HZKA 3BESR 2OX5A 5I1CH 1YNKL 4JVWA 3HMXA 4Y5YC 4XXCC 4BZYA 1I3VA 5E7BA 3J8F7 3FT4B 4Y4FA 2WUBH 3V4PL 1A47A 4JRXE 1N5YH 4X6EA 3WJJC 2CXKA 3VWKC 4YGAB 5KSBE 3QEQE 5K9KB 4AIZB 2NY2D 4E9LA 4WU7A 2QL1A 5EUOE 4K9EH 2J6EA 5TE7H 2YD5A 1VKXB 4N5EC 2XWBB 1YZZA 4WW2C 5EO1A 2XZQH 1Q1JH 4U1GC 1QTYT 4CL7A 4JFZH 5T3ZL 5GS0L 1R5IA 4ONHA 1NAMA 3AREB 4X9GA 2QEJA 4TOYL 5IFAL 3S36X 4X5LA 1JWUB 2LQRA 5IHZA 2APWA 1F6AA 2JELL 2BSRB 4YK4B 4G7VH 2H32B 2E9BA 5E8NB 5JO5B 5SWSD 2E7BA 3MUJA 4E0RA 4H1LA 2AK4E 2K7QA 4NO5A 3X11A 1OAXH 4KGJA 4BH7B 1BOYA 3TBYA 1OWWA 2BCKB 3BWUC 4PS4H 3FTGA 1KPRB 2SEBB 3V6OE 5AAWA 3Q5TA 1ZT4B 2F58L 2R1WB 2ATKA 2AV7A 2VXSH 5FUCE 5C0CA 3WKMH 4WV1C 3PWNA 4K8RH 5IW6B 4XCYB 2HT2C 2ZWLT 3MXVL 1YEFL 5E2JA 4X6DB 3JWDC 2FCBA 1CTOA 3BH8A 1X5ZA 3D85D 1PGRB 1IGFL 1SYSA 1LQSR 4P46B 5DUPL 1TQCB 4AIOA 3LMJL 1OAKH 2IPKA 1NGYA 4X9HA 3WE6B 2B0SH 2H2SC 3ZYZA 1J18A 1UWEH 1HH9B 1NDMA 4LGPB 2AV7B 4P23B 3QXVA 5JW5B 1GVIA 4QHLA 3MRHB 4FFVD 1KCUH 4LCCA 2O61A 4DZBB 5DD5L 4JM2C 2MQ0A 2D9QB 3PXHA 1CICC 5K9JH 2R69H 1T03L 3BH8B 4B0MM 1OGAD 3CZJA 4GRWH 1IGTA 3TA3B 4GXUN 3QI9A 1UCTA 4WNQA 4LEOB 2IPKB 1B0GA 1Z9LA 3PG2A 1UQSB 3IDUA 1U92B 1ZA3A 4P4KD 4RAUB 5IHZB 1KJVB 4PRAB 3QHFL 4XBEL 2Z91B 3BGFC 1MAML 4JFYA 3OF6A 4OM0L 1T5WB 2ZP0T 4RIRA 4HIJA 5DK2A 3ULUL 1AJ7L 1IL1B 5DVKA 4TPRH 3P77A 4PLJC 3C5ZC 4DGVH 2H32H 2GJ6E 3LPFA 4M7JL 4OCMC 5J6GB 2G60H 1OP3H 1DBJL 3D48R 4G5ZL 1YN7A 1JPTH 3BP6A 4P5TC 4XZUA 4U3XA 4LSTH 3ZTJG 2QSQA 2YKLL 1MY5A 2VLKE 2YSSA 5TDNB 4MYWB 3CMGA 3WV0A 3VWJD 2OJZL 4PJ7A 4BQCA 5HYEA 3IDXH 1QRKA 1KLUA 1MUJB 4DTGH 1E27A 3QDMA 4OCRH 2HLAB 1CGVA 4PGEB 3UTSE 3RTQD 1Z0MA 2G9HA 2Y9RT 5F72S 1S7XA 5IHUH 5JOFB 3NTCH 5F1NA 2PTUA 3QZWG 2PN5A 1VEMA 2YD9A 4L3EB 2IJ0C 2W65B 2H1PH 3HG1D 1ZLUK 2DQTH 4Y4HC 5JOPD 4KV5E 3DNKA 4RGNC 4U3HA 1CDIA 1MHCA 4NPYB 4RQQA 4RRPG 2A6KB 3HMXL 3UTQA 4NBYB 2O61B 3GHBH 1K4DB 3OBAA 5ICXB 3GBML 4F9PA 4RZCB 3MV9E 3SPVB 1QHOA 4ZFOA 1P4BL 2VAAA 5F7EH 4CNIB 2BSSB 5BZDB 4HDIA 5JW3H 2Q3ZA 3I50H 1X5KA 3PWPA 5DZOA 1SYSB 2P24A 2V17H 3D85B 3CC5A 4OGXH 5DD3L 1UYWL 3NPSC 3G6JE 3NIFF 4ELMF 1HN1A 3K2UL 2DWDB 4PBXA 2FL5B 2H41A 1B0WA 5LBSH 4EI5C 4QRRE 4W70A 4YBLB 1UH3A 2WWMC 5E8NA 5JO5A 4LK4A 1NCCH 2OI9B 4IMLA 3MLUH 3U9PH 1MI5D 2OZ4L 5FF6B 1TLKA 3QJHA 2IAMC 5MENB 1EMTL 4PJHF 1P7QD 4JJHA 4WDIA 3W9DB 3IFOB 3HC0B 4PY7A 4GAGL 2XV6B 1I85A 2VC2H 1XGRB 4EN3D 1REIA 1P53A 4GAJL 2AW2A 3STBA 3TT3L 5IMLA 2O5YH 8CGTA 2H2SD 4NKQB 4U3CA 4WFEE 2YRPA 1A6WL 1U93A 3FHQA 3CFDB 4MJIB 3V8OA 1ZT7A 4MZ3A 4U1MB 1MH5B 1YA5A 1N59B 1I7ZB 5C0AE 3WFHA 4LQFH 3MA7B 1QSEE 4CN6A 1T1ZB 2NTFA 4A6YH 4YJZL 4X5WA 3ZO0A 4RAVB 2P1YA 5JXAL 3MLYL 1EK3A 3GSRB 1K3IA 1AHWC 5TQ2L 3K2UH 2J12B 4JFZL 1W72H 1IKFH 4AQOA 3G5VB 3BMWA 3B9KC 4FQXB 3LB6D 1CR9L 2LU3A 4PJ9A 1UGNA 1FNLA 3CDGA 3DOSA 4OD1H 5HGAB 5C8JB 1G7MA 1FVCB 4LCCC 1K9TA 5L88H 3MRLA 2C26A 3PQYB 4YDVA 5L88L 4XPAH 3WNPA 5AZEH 2E7MA 4OV6F 4LCWE 3S37X 3MFFB 1BQLL 2P5WD 3O0RH 1YDPA 3KJ6L 2EDLA 3DIFB 3QXDB 4LIQL 5DA0B 4KQ3H 2OSLB 4HJ0C 5HSFA 1WICA 4TTGA 2CIIB 4QXUH 2PYEE 1MHHB 2UWEE 2JCCF 4FFZL 4PRNB 1I1RA 1LILA 1J9CT 2WZPD 4GSDL 2JIXA 4GSDH 4KH2A 1JF1B 2ZOKA 1R5WB 3OAZK 1MPAH 5IROC 2VRAA 5EIVA 3OGOE 1CIUA 5DR5H 1FFRA 1A6AB 2R0LH 3MBEB 5FGRA 1ZVSA 3IB4A 2J4WH 4HWEL 1PSKL 4C58B 3S5LG 2DQUL 1W0VA 5I19H 1RJZA 4PJXA 3CFCH 5HYSG 2J5LB 1HWGB 1CFSA 4NJAL 4N0UE 4MQ7B 3MNZA 3TCLA 3FFDA 3RWEB 5E00A 3G5VA 3MV7D 4Q97A 4TN9A 2APXA 4DUXA 3UJIL 3V79C 5FKAA 5F1IB 1MFAH 1IM9B 1ACZA 1DE4A 4F37F 4PJIA 2JJTA 5MENA 1BGXL 3O0RL 1AI1L 4JFPB 3FFCE 4WFHD 4PJ5E 1G9NL 3T4AB 1IGMH 4JO2L 1GOHA 3GM0A 2R2CA 4K7FA 1NC4D 5GPRA 1J1PL 5L7XH 2V2WB 1OWRM 1EV2E 1OAUH 5HHNB 1YEDA 4JZNB 1AFVL 1A3LH 2DIAA 2IQ9H 2UYLA 3HMXH 4TUJA 5EZOL 3CX5K 1BM3H 1EA9C 1OGTB 1HOCA 1W8OA 4PRIA 1A8JH 1C1EL 5GJSH 1G7IB 1U3HC 4YHNA 4XXCA 3R06B 1EPFA 1T1WB 4ZUSA 1RUPH 4N0FB 3H3PL 1GGYA 2BHZA 5I75B 4YR6B 2ZCLL 3UTTA 4FA8A 3FT3B 4FFVC 4LKCA 3NACH 3VMOA 2CK0L 5CP7B 2I24N 4NZTH 3KPOA 2W0KA 1Q9WA 3SE4A 3TBTB 4NO3B 4MQ7A 1AKJD 2P43B 1F5WA 2OJZH 1P6AB 4UB0H 2B1HL 5JA8B 3WIFA 1AQDB 2HKHL 4RFEB 2ZCKH 3ZL4H 1CICD 1NEUA 3RL2A 4DTGL 4XHJD 5CMAA 1YECL 3ARBB 4U1NB 2AABL 5HGDB 4QTHB 3OJMB 4NQTA 3BOVA 4WCYH 5E2VH 3HE7C 3QXDA 3QDJE 3QIBA 3MJ8B 2ENSA 2H2PD 3HUJF 3HNTL 2HFEA 3GSNL 3HC0A 1NGWA 5EOQL 1IQWL 1JTTA 4Y1AD 5SX5K 5L0QC 2GTWA 2ITDA 4LCUA 4AY0A 5JLZA 3V6OC 1AJ7H 3MRJB 4IRZH 1D6EB 4IOIB 4OZGA 4GG8A 3TESA 2ESVD 2Q3AA 2QKIB 5TDOB 5I9QC 5KVGL 4JQXA 4L9DA 3QIWA 4J8RA 4UQ2B 2NNAA 5IFHL 4WU5B 3MLPA 1WEJL 2AEPL 1DBMH 3VWJC 1CGWA 5E2UL 2GJZB 5DJ2A 8FABA 2XIDA 5EU6B 4GJTB 2H26A 5D1QB 1P2CB 5EOCL 5T3ZH 4F57L 5DTFA 4FQLH 5EZIL 1VENA 2H45A 3D5OF 2YPLD 3ZE0F 5J6HB 3EYFB 1XGPB 4H25B 3S8WA 3ULUC 4NQCE 3OSKA 2FH6A 4HKJA 4OCLC 4DN3L 1ZT1B 3L6FA 3V8CA 5C07E 5CP3A 1BQUA 3MA7A 4DEPB 2DJ4A 4I0PB 4J3SA 1L4IA 5MHSE 4X6DE 5HPMA 4R7NB 4GAFB 1HILA 1N8ZB 2ZUTA 5LGKA 4MAUL 5HHOD 1DTUA 5DUBB 1PG7H 4U33A 4G8GD 3BX7C 1PEWA 1S9VA 4GS7B 4NUJB 5DHYA 2ESVE 4ZO8A 4PJDE 3G9VA 3MV9D 2OQJB 2XTJE 3BZFA 1MELA 5EBMB 5T1KB 3TO4B 4NRZA 2FHBA 4N8VA 2HTKD 3BN9D 4F7TB 1F8TL 5CUSL 4ZXBB 4OFYD 1X5FA 2ZJSL 1PYWB 2X7LA 4L4VA 4X99B 5C71A 4XPFL 1V3JA 3DTXB 5IESL 1U3HB 2CXGA 1G7HB 3B6SA 2KUTA 3QDJD 4OQ1A 2FYYA 1U8JB 2R4SL 5JDSA 3UZEA 1YPZF 4WI8A 4NWTH 1DUYB 5JHLL 2DIBA 1U9KA 3UBXA 1A1NA 4BQ8A 2F54A 4ZPVB 1JGDB 4UNVA 5HI3C 2FD6L 2IC2A 4PLKC 5K9QG 5D1XC 4AM0B 4JY4A 5SV3A 2IAMD 4CMMB 1J0JA 1YYLL 4DGIL 5KW9L 1ZVSB 3T1WA 3ARGA 3I75B 1LEKB 3GSUA 4Y5XC 4PP2A 4D94A 2IMMA 4J4PD 3MRDA 4WUUB 4MJ5A 1JHKL 5EZJA 5B39G 3CX2A 1R5IB 4LLDB 4JFFB 4K9EL 1CTNA 4NQVA 3TO2A 3BEWB 3IF1B 1RUAH 1KPVB 4LDLB 3O2WL 5F1IA 5FOJA 3OKOB 2Z31C 4RNRB 4CAGA 3GI9L 4X4XB 4LQ1A 3FMGL 3B2VL 4MA3A 4LARL 3UTSB 3S4SG 2EDJA 3HC3L 3RI5F 3MRQA 4WW1A 4D0BB 4ZFGH 1QVOA 1MHEB 3QEGH 3IYLW 4HKZB 4NJ9L 4NZRL 3SE9L 2ZSVA 3VFNA 1BWMA 1T1YA 1CL7L 4K23H 1A7NL 2DQHL 3WLWD 3E0GA 5EUOB 5C09A 3SDDC 1C5BH 2BY2A 5BW7C 4L9LA 3WO3B 3GMNB 3S7GA 1JV5A 5DD0H 3HC4L 4X8XA 3WFDH 4CKVX 3BGAA 5BV7H 3SGKC 4OCYH 1XCTA 5D72H 2NY0B 1VA9A 2D7OA 3N85H 3HZYB 3M1BB 2YWYA 3D87B 3I9GL 1A6PA 4NO5B 3C8KB 3S96B 3HB3D 4NN7B 5CEYB 3IDYB 4H8WC 1U92A 3KPRE 4R0LC 1MY7A 4BZ1H 3T04D 2Z8SA 4IMKA 1IQDA 1TPXB 3FFCD 1K8DB 5JXED 3GMRB 2BMKB 4HIEA 3SDCB 4MNGE 1FZJA 3DYPA 1AO7E 4P49A 1FE8L 3B9KB 5GGTL 4O2CA 1IMHC 4X7EC 5ELIA 2NNAB 2YD7A 2Z93B 4NFBA 5EFIB 4HS8L 5A2FA 1NCBL 3JV5A 1AHWB 1HYSD 2PW1B 2HJLA 3WLBB 4JY6B 2DL2A 4PY8J 1M4KA 4MXVF 3BXNB 1RUQL 1CD1A 4DAGL 5LBSL 4X4ME 3RY5A 3BI9X 3P4NA 3AM8A 4RMUA 2QJDA 5KANI 4OUUB 1HHJA 4M8VA 2EXWD 3HNTH 2FJGB 3IJSB 2JCCB 3MOBH 4NN5C 4BSWA 5DSCA 3NFNB 3T2OA 3BZEA 1D9KB 3K8KA 3UMTA 3JWNC 4G6FD 4M62L 3NIGE 4LLDA 4APQD 3RGHA 4JB9H 4XCNA 5GRZA 2FR4A 3HTLX 3F12A 2YPVH 4JKPH 1WAAA 1FN4B 2C3WA 1B4JL 2R23A 1J05B 3GSVA 4JPIA 4NQDA 3DLQR 4RFOL 2DI7A 4KKCC 3PQYE 3VXNB 3W39B 4JKKA 2V17L 5JHDA 2CKBL 5LJYH 3GDBA 2J88H 2X7LB 3CDYA 5LGHL 4Y4KA 2BRRL 4ZUVB 3O6MH 2AK4D 4F58L 3EO9H 3FQRB 3FTGB 4R7NA 1SVCP 1CFSB 2I60L 2R4RL 5SWSB 3GMMA 4OV5B 1QFWL 4JANA 1QSFD 2PTVA 1UC6A 3SDAB 5IVOA 3M07A 4X98B 2OZ4H 1MHPH 5E8DH 4WU7B 4Z7QF 2RQ8A 4GBXC 3MLRH 4Z76A 4OJFH 5KVFH 3FQUA 1JI2A 3P0VL 1KN4H 1FL3A 3BEVB 4OIBA 3MRMB 1M7DB 2P8MB 5EPMB 3IJYA 1SEQL 5TPWL 2IH3B 5A16B 1YYML 4OBRA 5A2IH 2ICWB 2WNGA 4LFHG 1SJEB 3K46A 2GAZA 1M05A 3SDDD 3DXAE 1ES0B 4V2BA 2WUCH 3JV4B 2VL4A 3W0WE 1W72A 4QRRA 5F7MC 5INCB 1MRDL 3GI9H 1U3JA 3QNXA 1A0QH 1N4XL 3PHOA 5GGVL 3DI3B 1NL0H 2OJEA 3LH2H 3T4YB 3LS5H 2XPGA 3M45A 4YEEA 5EO9B 4LU5L 1AKJA 2W60B 1T89A 1T6WA 2O5XL 4ZNEE 5TGBA 2FZ3B 1G7PB 4BK4A 5HXMA 5KVMC 4NWTL 5IB5B 2YA1A 3QWOA 1VGKA 5EO0B 2X1WL 4P9HC 2AS5M 3UTTD 3JVGC 3BKML 4LAQL 2QQLH 1Q0XL 4AH2B 1R0AH 2BHUA 4HJJL 5C7XH 3OKKA 3IXTB 1TZIA 2AJXL 2E27L 4ISVB 4YHLH 2DWEB 5IVNA 4LIQH 4OCYL 5D72L 5D2LB 1KPUA 3KLDA 3SCMA 2FRGP 4PJGB 2DTML 3H9SE 4XWOD 3TA3C 3TT3H 1CXHA 3X3FL 4NYLA 3LSOB 3SKOA 2BERA 3MLSL 2R15A 1A21A 3RVWD 3U46B 3CDGB 5C8JA 5CEXA 1T4KB 1QHPA 3VH8B 1XF2A 3UAJC 4X8JA 4FNLL 1JVKA 4R7DA 1UM5L 5HGBA 4OZGF 3NAAH 2X4TB 1WUNT 3KYKL 1KENH 3D39E 4BA8A 3D0VA 3RY4A 3A6OA 4LBEB 4PGCA 5DEGB 1NMCB 1QP1A 3S88H 2XYCA 4QYOB 2DI8A 1JZ3A 2EE2A 1JCKA 4Y4KC 1QRND 3MRBB 1JHLL 5F1OB 2P8LB 2CDGB 2Y07H 5C0ND 3CSYB 1ZT7B 2O5ZH 3GEWB 4NN5B 4ODTH 2YUXA 2DQIL 5KOVC 4C55A 1LO5B 1IM9A 5IB5A 4Y1AB 3OZ9L 4H20L 2ZCKL 5DK0A 5HI3D 3EDKA 3FB5B 2HKHH 5HHME 2ZCHH 3DWTA 4MQTB 2R2EA 3QFDA 1MCIA 3V5DB 1OSPL 3RWGB 1WCBB 1BAFL 1YEEH 5C0FB 2NYYC 1A6UH 5DFTA 3C6LD 5IK3A 5D2LE 2DM3A 4FFZH 1RJZB 2X4QB 5L9DH 1KJMB 4RMWA 1DVFA 4L3EA 3OG4B 3VXSA 4PGBB 4D9RD 2R8SL 2DLFH 4PRHD 4NKIH 1E6OL 1E6JL 1HXMB 5CLTA 5HYFA 1KB5L 1JF1A 1N5YL 2FJHB 3AREC 1U58B 4NQCB 4G9FB 5BRZD 4Q9QL 1E27B 3OKEB 5JHDD 3MBED 3RUGF 5ANME 3T4AA 1KXQE 2BP3A 3MRCA 5HYJE 1MF2H 1QPPA 1AGFB 2HT4D 4KK8D 4WW2B 3MRGA 1YNTB 4KMLB 2QHLA 2G5RA 4RWYH 3LKOB 2Q6WA 2QSCL 3KJ4C 1QUNA 2FLBT 3JV0A 4IOSD 2APFA 2A38A 1R5WA 4Q9RH 5C9JA 2V7HA 4L1DA 4OZ4A 5GGUB 1EZVY 3WNMA 2CD0A 5BV7L 4X6DF 1YEIL 4Y1AA 1BIIA 2V6HA 3IT8D 4FHBD 5DURB 4EN3B 4FABH 3AGVA 4N8CH 5SX5H 1F97A 1FL6A 5DFVD 1JRHH 1AGCB 4PJFF 2AXGB 3WFBH 3W9EB 5C9KA 3BPCA 4Z78A 2FBJH 5HY9A 4A2MA 4DKFH 1CLYL 3HPJA 3FO9A 1IBGH 3S36L 1D5MA 4RFNC 5TH2B 4GAJH 1FVDB 1TNNA 2OL3H 4NP4H 5C0EA 4LVNB 3GBNL 1JZ4A 1FDLL 1OL0A 2I9LA 4XAWH 1TQBC 5IT2H 1KJ2L 3RWHA 3ZDZE 1MCWM 2B4CH 3EYQC 4NOFA 2QQKH 1AO7D 2Q87A 3QQ3A 2XZCL 5TE7L 2JB6B 3C5ZA 2BVYA 3OKDB 3MFFA 3WIHH 1O7VA 3B9DA 2DD8L 5DJ6A 4XVSL 1U95A 1KLFA 4TVSa 1JGVH 2WWKO 5F71A 3GSNA 5TFSH 5BS0E 5D1ZA 4QRTA 5KAQG 2EDEA 1I8MB 4Y5XB 1SY6L 3UXFA 3QDGB 1FPTH 4KDVA 4BQBA 4CVZB 3VXSE 1D5IH 3TEUA 3O6FB 4TNWK 3VG0H 3TZVC 4NQEB 1MI5B 3GSNH 3VH8G 4PYHA 4TVPH 3D3VE 5I74B 5D2LA 5E94A 4Z95H 4YIQB 4L8BB 1BQHG 4KPHH 3I6LD 3OAUL 2BNUB 2FO4B 4G6JL 1HINH 3D25A 3LZFL 4F9LA 3KVQA 5GZNC 2BVOA 1XGYH 4XI5D 1U8LB 1XF5A 4OIAA 5FUZH 5ENWB 3AMLA 3EFFB 3QXWA 4WHTA 2F54D 3DHMA 5TGBB 4ZXBC 5JUEH 3TNNA 3LEXB 3L5JA 3RWJB 3DSFL 2OLDA 3EOTL 3B3IB 2IPTL 5IVZA 2DD8H 2A83A 2F8VA 4X7TA 4N8VB 1NDGB 5FKPA 1MWAA 3KYAA 5JTWA 4HWUA 1TZIB 5EFIA 3B5TA 3CFCL 1UJTA 5IMKA 1Q0YL 5SWZE 4ZUUA 3CSGA 1DUZB 1JWSA 1R3JB 3L9RA 3UPAA 5DJ0A 4X5XB 3MNWA 3QUXA 4C59B 4NT6B 1CFQB 3NH7H 2BY0A 2Y36H 4M6NH 4Y89A 4KRPB 1X7QB 3NACL 4MD4A 2JK5A 1CIDA 2WBJD 1SMOA 1EFXA 1J10A 5DFWH 4HPOH 1K4DA 1KT2A 3CFIC 2C3GA 3TV3L 4F7CB 1T21A 1I9JH 4G3YH 15C8L 4K71C 4UU9B 2IFGA 4WFGE 3RTQB 4P59L 4HGWA 2DKUA 1YEIH 4ZOEA 3GFUA 3WFZA 2VLLA 4O51A 1MQKH 1QR1B 4R4FH 1NCUA 5D2NA 2F54E 2Y7QB 3KPQA 4WUKL 2Z8WC 5L7XL 4WFGD 1G7HA 3ABZA 4XNUL 4WJ5B 4G8EA 2VITA 1SJHB 3L1OH 5ADPH 1CF8L 2F19L 3HZMB 3L3JB 1VB9A 4LCIH 1XR8B 2YPLA 3ALXA 3SJVB 3LKSB 5I9QB 2GJ6B 1B2WL 5B38G 3RVUD 4JFXB 1I9RL 3ARGB 4JO3L 1NDGA 5FEBA 5I1DB 4PJCE 3PWLB 1DQQB 1S5IH 1II4E 4XVSH 4R2GB 1EEYB 25C8H 4Y4FD 2ESVA 3O8XB 2FSEB 3WNKA 3K1DA 4PGDA 3REVB 1K6QL 5C0BD 5E8PA 3NPZB 3OZ9H 3WKNA 1I1AB 4G8GA 5E5MA 4XNXH 4KMTL 5E94B 5GSRB 1T0NA 3K0WA 3OKOA 4WWID 3ARBA 5BO1L 3LQMA 3NZHH 3UPCA 4WNQB 5H2BA 1F90H 1JN6B 4O58H 5C07A 5E4EB 1PBYA 2I25N 1WBYA 4NRYB 1VGEL 2A73A 3D2UD 5DTFB 2GCYB 2DQFB 4MJ5B 1KJVA 3CMOL 4U0RB 1BVZA 3KPOB 4U6XA 5IUSA 1B9ZA 2EIEA 4JFDE 3MRHA 2VITB 5T5FH 3GSWA 1KBGH 1MCOL 1KB5H 3KPPB 4L3CA 3UTZA 4ELME 3MACH 3FRPG 5IB3A 4YPJA 3GHEH 3O8XD 2DJUA 2PW1A 3C2SA 1FNGB 2X4SA 4QRPD 4K7PY 4YAQB 5DT1L 1YPZB 3GUTA 4LDEB 3SCMC 1MEXH 4YQXL 2YD4A 3MA9L 4YX2H 5C0NC 1IJ9A 5JPNA 1XIWB 5FXCH 1QLEL 1MCDA 1CVRA 3VI4E 1MREL 1JE6A 1E4WH 5I76A 3T8XB 2EZ0D 3I6GB 1ORSB 1L7IL 1RJYB 1INDL 1FJ1A 3FT2A 1HH6B 2HTLD 1Q0XH 4L4TD 1O7SA 4HFUH 1QVOB 4Y2DC 1TTFA 3QCTH 4F2MA 1P5UA 5I1IH 4AT6B 2XQBH 1KULA 3WSQH 1H9VA 3L5HA 1G7QA 3ARED 1TJIL 4JVUA 2NW2B 5C09B 1DBAL 3ARDA 4PRPA 4U6VH 4HAGA 3WUWB 4OZFH 3M17A 4GRMA 4KZEH 3D1MC 2AK1L 3CCHB 3BZFB 5D8JL 3L6FB 3RU8L 3PUCA 3G5YB 1CU4H 1NMBL 2R1XB 3IFPA 1DL7H 4XP9H 3RHWF 4MQXD 4S11A 3ULUH 1YMME 2B4CC 2JJSA 4ZUVA 3X3GH 1F45A 3T0EC 4JHWH 4LVHC 3O3BA 3QISA 4BQ9A 4I3RH 1N8ZA 1TNMA 1U3HA 4HPYH 1R3IH 3R8BB 5LGJA 3AREA 4TQEH 3O45B 1G9MH 4NFDA 3VRJA 4YZFF 4LRNL 3BKMH 4LAQH 4H0HB 2CUIA 4G6AD 3QI9D 5LVEA 4AL8H 3LKRA 4PJIB 4EOWH 2DQCH 4UDUA 2R2EB 3QFDB 1BZ9B 2VDQH 1QFWM 5IOPB 5K33A 4JDVB 1U8PA 3EZ8A 1CGXA 1PYWA 1ZHKA 3BWAB 5CJ8A 5DJXB 1A3RH 1UA6H 5EBWA 4DK3A 2H9GA 4OAWA 4XTRD 3UJTL 1P7KA 2X4PA 3HCVA 4S10A 3W11C 1DQLL 4P2RD 5GRXG 3UC0L 3P2TA 4PJ9D 4S1RL 1LK2B 3HI1A 2JJUA 3MV9B 4NRXA 4XWGL 3QT2A 2WINA 4LNRA 1MFCH 3MR9A 2Z31A 3O2DH 3LPWA 3NZ8B 4WHCA 3KXFD 4X6CE 5DEFA 3QUMH 3KPNA 3QAZC 1BREA 5DRWB 2J1KA 5I2IB 3MXWH 4G9FD 1A7NH 5GZOD 5I17A 3ZSSA 3UEZA 3FCTB 3DXAA 4LIQE 5DRNB 1KTLB 2AJYL 2W38A 2MCPH 3MMEB 3G6JF 1T3FB 1JPFB 1RUML 1CLOL 4NQVB 3TZVD 3A6CL 1U8KB 5GGSB 4IRJA 3HNVL 5HHVH 4LLUB 5GZND 1I9IL 5CZXC 4G8IA 2BOBB 1UB5B 3OB0K 2WIIB 1PZ5A 5CD3B 3C6LB 4PJBB 4LPWA 1R3KB 1CDCA 5J3HC 5J4MA 2E9WA 4CUCA 3DO3A 4DJMA 4YO0B 1OGAE 2GFBA 4TSAL 2A77L 1FC1A 3ROOB 1X44A 2EEDA 2Y06H 1BMGA 1JWUA 2FWOB 4P4RB 3KPSA 3MJ9A 2D0GA 4XX1E 1NFDE 4MNGB 4PJXB 4PRDA 1W0VB 1V7NL 4J8RB 3Q5YA 4M6OH 5GS1A 2CKBH 4G5ZH 5LWYH 3BGMB 3CZFA 1Q94B 3JWDH 2DBJA 5E00B 3P4OB 4RGNB 1C08A 3IGAA 5C0AA 1GRWA 5KS9A 5DMIH 3K8MA 1FG2B 1DEEB 2RCSL 3MJ7A 2HG5B 1DE4B 5GGVY 3KPSB 3N85L 4Y16B 2Y72A 3X12B 2PCPA 3BHBA 1NGZA 5D5ME 4KKAC 4NHCH 5EC1A 1X5AA 4L8CB 4QYOA 1QOKA 1H15A 5HYQA 1IARB 1NFDF 4LPYA 2DM2A 1R3KA 4JEGB 3CVHA 2NR6D 3OR6B 1TJIH 1OP9A 4TNVK 4TPRL 1HOCB 5GGSA 1CDHA 5DD6B 5KVEH 1NUGA 4I13B 2WWMD 4NNPH 3RAJH 3ZE0E 3D0VB 4N0FA 1NFDB 5I6XC 2AQ1A 2VISB 3ARFA 1EO8H 4WI5A 2XZAH 1EO8L 2QHRH 2XA8L 4FQJL 2RGSA 2RIKA 1RHHB 4M5ZH 1KEGH 4K7FB 4Z0BL 2I07B 1JGEA 3INUL 4RA0C 1NCAL 2NCMA 5EU7E 1J0ZA 1UQSA 3BJ91 3VRJB 1AO7A 1YEDB 1QFWH 5INDA 4HULB 4M7KH 4I3SL 1U8KA 4L9LC 1NBYA 3GSXA 1IM9D 3T65A 2P48B 1NAMH 2A1WL 5I71B 1KCUL 1F90L 3DX7A 3SQOH 3FOLA 3PIQA 4HIIB 3E6HB 3X12A 4K3DH 3MOBL 3PHOB 1N6VA 2M26A 2FB4L 1ZHKB 3UPRA 3DV4A 1F3DH 4GUPA 5L2KA 5DZNA 3QP3A 1C5DA 2J8HA 2DMKA 1KJ3H 4ELKA 4WGWB 1SJEA 4XP4H 4KTDH 4RFEA 1X4ZA 4K8RL 1UWGH 4UINH 1P4IH 4Y5VB 2Q20A 3VXOA 3NAAL 5D8JH 1WZMA 3KS0J 4QGYA 1YPZE 2B5IB 5E0QA 1S7WB 3C5ZD 2P47B 2QADD 4C83A 2VDOL 5DJAA 4ZS6D 1RZGB 4HWEH 3MLVH 5HYQB 3A67H 1AP2A 4S2SB 5DGQA 4CU8A 3OKNB 1ZA3B 2R56H 4P5TD 1JMXA 1MWAH 3KHQA 1B4RA 1B0GB 2NY3C 2B1AL 2ZUQC 1UACL 5E99H 3NIDE 1QFUH 1FGNH 1MCFA 2QV2A 4ZDHB 5JZ7D 4DN3H 2XN9B 2QSVA 2D03L 4NQSB 1BZ7B 3O41A 4UOW0 2UWEB 3X13A 1NLDL 2VH5L 4U7SA 3SEPA 3RGVC 1G9MC 4RX4A 5L0QB 1LDPL 4OF7A 2NY6B 2WUBL 3BMVA 4JAMA 1MHCB 4NPYA 4RQQB 3THMH 3S35H 2DQJL 4H26B 4LCYB 3N1GC 3AAZB 4NGHL 4O02L 4WUKH 3BZ4A 3ZE1E 5TDNA 2FWOA 2GEEA 3NABH 1UWGL 2JE8A 5D6CA 4PJEF 4PBWD 5H94A 1H5BA 5FKPB 4LLMB 4N0UA 4PJEB 4L4TB 3P11L 4OKVA 1EEQA 1WK0A 4M1GH 3LKQB 5GS1B 2BNRE 4P9HH 2VDRH 5A43C 1FIEA 5JMRA 4PY7B 3QUKA 4XMPL 1UT9A 5C08E 3QFJE 1S7QA 1S7UA 3BUYB 4G7VL 3CH1A 4OCWL 2EYSA 1ERNA 1MJUH 4GRWE 3UJJH 3VH8A 5C0BB 1TETH 4PJFB 3FAXA 1HH9A 2DBLH 1CD1B 1CXKA 2VWEC 3ROOA 3UYRL 1HSAA 4IBLT 3VXUB 3LV3B 3P77B 3PXJA 2D31B 4HWBL 3W39A 2X44D 2D7TH 3SPVA 4AK1A 1MCBA 3C09C 1JNLL 2V5TA 3CFEB 3O11B 1Y6KR 4LCWA 4MAYC 4PLNC 4PJ9C 2HKFL 4RGMB 2MJWA 3BO8A 3MRBA 3QB7C 4J1UB 1T20A 3NFNA 4D3CH 2IALA 4IRSB 3BZEB 3CFDA 1WJ3A 2GI7A 3EOTH 3Q3GA 5DHVA 1CFVH 4LSUL 2VABA 4KI5C 4LSVL 3WS6C 2IPUK 3IF1A 2I5YH 4GW5A 4LCWD 3BRGC 1YQVL 4M1GL 4HK3N 2WBKA 1J5OL 1JRHI 3AU1A 1J0KA 2ADIB 2YPLE 1QNZH 2DQEH 1I8IA 4WEBH 1QO3B 2ZZUT 3WHXB 1EBAA 1WBZA 2H2PC 3MXWL 4WEBL 1EEYA 4Z7NF 4KUCF 1JZ6A 3HAEH 1XF4A 5HHXL 5ILTH 2AJYH 4UIKH 1VHPA 3T1FB 3CFJB 4M1CC 1T83A 4JVPA 3SE8L 5L8KB 4R90L 3CUPB 3SJVA 3RPIB 1IL1A 3HFMH 1QBAA 1QSVA 4M03A 5DMGC 1R3HB 4XCEA 1LMKA 1BIIB 4M93B 1RFDH 4I1NB 3EYOB 3F58L 4MD0B 4D2NA 2VLRA 4E41D 1NLDH 1TXKA 2VH5H 1WFNA 5L9DL 4HFUL 1EERB 1GGUA 5D7LD 1A7BA 1DQQA 4U2ZA 2M8XA 4HF5L 3ELAT 3VXMD 5AWNH 4JR9L 5D9SA 5ESVA 2CIKA 1J8HB 4POYA 3GMPB 4UU9A 4IOFD 5ESQA 5HGAA 5A2KH 3L3DA 4O4YH 4FXKA 3QNZB 1QKZH 1JNNH 4HMEA 3T0WA 4HS6B 4HH8A 4L8BA 5MERB 4BUHA 3RGVD 4JFXA 3NGBB 5F7KC 3PJSB 4HXBL 4ODUA 1S7QB 4NKOA 2W9EL 1I1AD 4QCIA 4ODXB 4RBPH 1WBZB 1WLHA 4NQED 3QO0B 5K93A 1CT8A 5FO7A 4H5SB 5D2NC 4EXKA 1IQDB 1JGLL 1UVQA 2A9NH 2A83B 5C6PB 5D93B 4OLYH 2QSTA 3V5KA 2MCPL 5FUCC 4JFDA 4FFYL 5AZEL 2C4XA 2NR6C 2FJGA 1I1YA 1LVEA 3SDXE 4L4VB 5CINH 5DJ6B 4F2MB 2HYMA 4NN6B 2HTKC 3D25B 1G9NH 4J1UA 5ICZA 3DVNA 2BVOB 2OTWA 3WFEH 3MROB 5CIPH 1NMAL 3QDME 2BNUA 4YBHA 4XMKL 3T1FA 2JJTC 4F7MA 5MENE 1OP5H 4PJIE 1FYTB 1T5XA 3SDXF 5J9PB 3A0OA 2PW2B 2P5EB 3WS6A 1P4IL 2XY1A 3LEXA 5E70A 4D9LH 2Z35B 3L7EA 5C08B 5J57B 1GOFA 1T1WA 4ZUSB 4MA7H 1ND0A 1ZTXL 1DZBA 2X1PA 4I18A 5IK3B 5CZKA 1AE6H 3MV8B 5MEPA 1XGUB 1G84A 2VXUH 3EYQD 1T66C 1ZHNB 5DSCB 3MGAA 4U1IB 3VMNA 4HKXA 1MFBH 2C1OB 4JO4L 1MJ8H 3V7AG 4U49A 5BJTA 2XTJB 2LU4A 5C0BA 4OIIH 5ENWA 2MKLC 3HHRB 5JXEA 1YY8A 3W5MA 3NCJL 1NBZB 4FFYH 1OARL 1RUKL 3VFUB 3EYSH 4FG6C 5KSVB 1CDGA 3BQUA 1C12B 3ZT5A 1AXSA 2J8UE 1A3QA 4YDLB 4Y19E 1QLRA 1CZ8L 1D5XA 2NMSA 3K4DA 1TVBB 2X42A 3KYOB 3MGTA 1K5NA 4AIXA 1OD7A 4XNQB 4OZHE 1H0DA 3TT1H 1RZIA 5C3LD 1K8IB 3LEVL 4GG6E 2E9IA 3NABL 5FCUL 1AGDA 3EJZD 3GRWH 1LK3L 3CVHH 3QUZC 4FXKB 4PRHB 1G0YR 2BVUA 5EORH 3NIGF 5CGYD 4EBQL 3PL6A 4HWZA 4R26H 4LHUD 1T1XB 4X7DC 4QRRB 5FOBA 5DMGD 2ILLA 5TQ2H 4YBQC 1J5OH 3DVGA 4G6KH 1IAII 2BVQA 3ARQA 2HFEB 4AZ8A 3OF6D 5CFHA 5I8CA 4LSTL 4YE4H 2GK0A 4R3SB 7FABL 4ZQKA 2P8MA 2CK0H 3SO3B 4UAOC 4N0CD 4LRNH 3IDGA 1M7XA 2O5ZL 2QQNH 5AYQA 3PHQA 3QEUB 3VCLA 1TIUA 4HZLA 5DYOA 2ED8A 2F8OA 3RA7L 2D7TL 4PRPE 5DD0L 3WFDL 3GMNA 1HXYA 5DS8A 4GFTB 5E1AA 5HGDA 4OF6A 1CD9B 3LS4H 4CVXA 5HPMB 2P5WA 3BPCB 2WBJC 4FTVE 4Z78B 4JREB 2LE9A 1URLA 4RGOH 2HP4A 1YN6B 3EO0B 4MNQD 3ILQD 1JYNA 4HK3J 1ZLWH 3S36H 5E8OA 4R7DB 1CF8H 32C2B 5J13B 3U4BL 5ID0A 4FP8H 4ZG1A 2VDLL 1DBAH 3AY4C 5J6HA 3LVEA 3DXAB 4D8PB 1JPSH 3NFPA 2L0DA 4DCQB 2XTJC 4P9HL 2VL5A 5C92A 5GRWA 1PVHA 3EOAA 5DJDA 1P69B 3WFCH 5IJVA 2DWEA 5GQBA 1I7TB 4W6XB 2P8LA 5J7CC 2WIIA 3ZE2F 1IC4H 1CFNB 2VB5A 3ULSA 3IGAB 5C0AB 5T33H 2BVQB 2NXZD 3RVVD 3ARPA 1SBSL 4JDTL 1IGFH 5KSBA 4NQUA 4AMKL 4Q6IC 4GAYB 5CP7A 2R4RH 2H3NA 4ELMA 4Y7MA 4P2RE 3MV9A 3OMZA 2XACC 1CR9H 2EXYC 5IKCA 3FCTA 1T04B 2E6JA 1QLFA 1N0LA 4KKBC 1IAOB 5CGTA 2X4TA 4CRPA 5JR1H 4WUUE 4N1HB 3ZHLA 2VO5A 4OZHA 3VRLF 5C0FA 3MGOA 4L29A 4ZFOL 3TBYB 1HNFA 4FZ8L 3RVXD 4N1CA 3IDNB 4J4PC 4FN0A 2V2TB 3V4PH 3TIDB 5A3ID 1N0XH 5IT2L 1XGPA 4H25A 5JOPE 2RFXB 4P2YA 2A6DB 5FUZL 4ALAH 1YJDL 1XR9B 4JDZA 5IQ7L 4X4ZA 4UINL 3ZTNL 5T3ZE 4M8QB 3BH9B 2VQUA 4FQPA 2R9HD 3MC0A 3RL1A 2F8XC 5IFHH 1DL7L 3FQUB 2L7JA 1NFIB 5IMMB 3RU8H 2XXMB 2W91A 3O3BB 5I8CB 2P42B 3DGCR 1FV1A 3RWFA 5T1MA 4DVRL 1PLGH 4PG2C 1F3RB 4UTBL 4HK0B 1VPOL 1JFQL 5CP3H 5FM8A 2KKQA 3VXSB 4P4KC 1YEKH 3QUMB 1Z9OA 4JM2A 3PV6B 4YDJB 2JELH 3D3VB 2P7TA 5E8DL 2PW2A 3MJGX 1QRNB 1MHPL 5F88B 1G7JB 2BRQA 3FRUB 3O9WA 4Z6AT 1G9EA 3VXRE 1BEYH 4D9QE 1D5MB 4QRSB 3FO9B 4MS8D 5DXWA 3RIFK 1P7QB 3ARYA 4OZIB 3HB3C 1ZSDB 4MD5A 1ADQL 1OQOA 1VSCA 2MHAA 4N9OB 1YY9C 2DQDL 4ODSL 4EUPH 1Y18A 5C0JB 3QWOB 4NCC1 4LF3B 4IRJC 3MREB 1VEOA 1JGUL 1FL5A 1U3ZA 4NOBA 5FHBH 2E7LA 1GC1H 2P5ED 4MDIA 3MOQA 3CNKA 5HJ3A 5TDOA 4Z7OF 4I5BB 3MR9B 2ICES 3VXUE 4WEMB 4FQXD 4YFLI 4NQDE 3C8KA 1UG9A 3S96A 3SKNA 3C6LA 3OJ2C 3I6KB 3T0BA 5IB4A 5DRWA 3KYMA 2HFFB 3LS5L 4R4BB 1WBXB 3HZVB 4XWOC 1CK0L 3QJFA 3RWFB 3HUJE 4PRID 5C09D 3CLFL 1AR1C 5H35B 3VW3L 2C7UA 4FTVB 1A7OH 4G8FB 4KUCD 5EG6C 3QQ9D 3SQOL 2CLZB 2X70A 3S3JA 1FNAA 3IDIA 3SBWC 1XF3B 4DKAA 4C4KT 1IGML 4PJBF 4ISVA 1LDPH 3H7BA 4LLUA 4YAQA 1J7VR 1ADQH 2C3XA 4FXLA 2P24B 1DQJA 1S7VB 1SEQH 1OT2A 3O3EA 3S35L 3P4OA 2K3TA 4Q58C 5C6TL 5HVGB 1U91A 2V9QA 4QRRD 3ZKND 5MEND 4TUKL 4FNLH 1GJIA 1NEZB 4HWBA 4KHTL 4S1RH 1IC5H 3QHFH 4XBEH 5KN5B 3GMMB 5DK0B 4OV5A 3PGCB 2XOTA 1CG9A 4WFFE 4F8TA 2PO6B 4DFHA 3PWPB 3K1KC 1KBGL 1MCOH 4R4ND 1FE8H 1Q9LA 2DQUH 2ZJSH 5DMKB 3A67L 1V7NH 5GGVH 2OM5A 3SO3C 1G0XA 3P4MB 2FECL 4P2QA 1UM4H 1MRFL 4CVXB 2DWDA 4HLZH 2YXMA 1DBML 1UXWA 5FYLL 2QHRL 5E95B 5T33L 1XGTB 3HMWH 2AV1B 4QOKA 4MNHB 3RFZC 4OQTH 4MJIA 3D39B 5FYJD 2HAZA 5D5MA 2IH1B 3QUXD 1FZJB 2GUOA 2ZUXA 4XP1H 1ITBB 1MI5E 2BVPB 2ZG2A 4D8PA 5BZDA 4NC1E 4Q0XH 1DLFL 4KQ4H 1DLFH 1CE6A 3AB0B 4O51B 4L8DA 5C2UB 4Q2ZB 4P3DA 2FGWL 2MQCA 2YSSB 4JRXB 1MJ7H 1WWAX 1PG7L 4LVOC 3FQWB 4P2OA 1KJ2H 4ZTOH 3ZZ1A 1H8NA 1KT2B 1JV5B 1B2WH 3MLZH 1BD2A 3B2VH 3BP4B 4KKLC 4ACPA 2ZOKB 1RSFA 3OHXB 2AJVL 3MQIA 1UM4L 2ZKHH 5E8EB 1HQ4B 43CAA 1V3LA 1MHEA 1YC8A 4LHUB 5HDLA 1T7XA 2WWKT 1KEGL 1MRCL 1BPVA 4QY8B 1ZXQA 4XZUB 2YD2A 1QBLH 1NL0L 3LH2L 4XCNB 5EBLB 1IT9H 4DW2H 4DVBA 4NM8L 4ZUTB 1ZVYA 4TOYH 4Z7QE 2R0ZL 1ZAGA 4LSRH 4JRYA 3QIUD 1T0NB 4UT6L 2DKSA 3SE4C 1PG7W 3EW3B 1EMTH 1WT5A 3W9DA 3P4NB 4WWKC 3VXPA 5BQ7B 3T2PA 5I15L 1MCQA 4RISL 2X9XA 2GCYA 4W68A 1G6VK 1KFAL 1CE1L 3D18A 1X5IA 2D7NA 1I1FA 4HXAH 3KDMA 2VR9A 4OI8A 5KTEH 2Z4QB 5D6DC 3O41B 1NCWH 1KN2L 2E7CA 4APQA 4UAOB 4G8GB 1ED3B 4H0IA 4WEUD 4PRIB 2VNCA 1G7LA 5KSAA 4YZFE 4U6YB 2JB5H 4RRPA 1FYTE 2JCCA 1IFHL 3QNYB 4I48A 3HRPA 3U2SB 3GKWH 2PO6C 1CGSH 4KJYB 4KFZC 3V0VA 5FV2A 1PQZA 3V4VL 4DAGH 1GGCH 4CBPA 2ADFL 1H5BC 3D39A 3U7AA 3FO0H 4UIMA 1PG7X 1KGCD 3T8XA 2FJFB 3WS3A 4FZEH 4DKFL 1CXFA 4HC1A 4X9BA 4YFEA 1OAQL 2UZYB 1UJ3A 4PJIF 2EDTA 5M95B 1FZMB 3LKNB 3HRZA 3V6FB 5I1HL 5B38B 3VGGA 1X7QA 1S7UB 1H3UA 3BUYA 4G6ML 2BJML 1BJ1H 4BKLB 4CADB 1MJJA 4ZO7A 2D0FA 1OF2A 1J8HA 2EH7H 4P23A 2CUHA 5D7JC 1DBKH 5E8EA 5E7FA 3E8UL 3EO1A 5DUML 3CPLB 1S7TB 4L4TA 1PSKH 5CCKH 3HC3H 1IKFL 1FLTX 5B4MD 4KK8C 2GSGB 1UB6B 3WJJA 1Y6MR 3CDCA 4G8EB 3FQNA 4GO6B 1CL7H 4K23L 5FKAB 1LNUA 1EUTA 4HPOL 1EFXB 4PRAA 3JTTA 5EU6D 4D9QD 1AD0B 5LXGL 3ARRA 4ZTPL 1PFCA 2FLRT 3TN0D 4KKLD 3QDJA 3DUUB 4C56B 1U8HA 5JQ6H 4E41B 4F3FB 4UT9H 3EGSB 1PKQA 4FXGB 2XNAA 1DFBH 3PP3H 4MS8C 4AEIH 1DFBL 4OF0A 1H3GA 3G5XB 5HDBF 1AGFA 1DSFL 5HHQB 1A3RL 2CMRL 3QPXH 3U0PB 3OR7B 4L8CA 5ERWA 3QQ4A 4M7ZC 4XNUH 3MV8E 1WFUA 4FQXC 2FX8L 1VERA 2IBZX 5C0DA 1F6AB 3O3AA 4MA1B 4NQXB 4Z7UB 1BD2B 1MOEA 3PGFH 4GXVL 1AGCA 1SHMA 1EHNA 4XC3H 4WU5A 3T0VA 3SDYL 3WFCL 4JO3H 5D7IB 5TQ0H 1ZWIA 3CK0H 4U31A 4A6YL 1BX2A 3TC9A 1S3KH 1NMBH 3DSNA 4L8DB 1BBJA 3LDBB 5C0EB 3CD4A 2J8UF 3TZVA 1YEJH 2ATKB 1YEJL 1E4JA 1FORL 2YR3A 2BOCA 3ZL4L 3DXAD 2OZ4A 1MCSA 2COQA 2JB6A 4QNPF 2CKBA 4ODWB 3OKEA 43C9A 3ESVF 3RGVA 1A5FL 4KWUA 1G7JA 3TBVA 3GO1H 2WQ8A 5IF0A 3H3KA 1NGQH 3VGBA 2XWJB 3VMPA 1DUZA 1JWSB 3L9RB 5I1IL 3VRLE 3SGKA 4P9ML 5EOCJ 4ZAKB 5D96C 1T0MB 1MH5A 2X1OA 2B4CL 4QOKE 5EU5B 2VE6A 3O4LD 1Z9SA 4QXWA 1DQTA 4OGAD 1T3FA 3CAFA 4PLKD 4LBEA 4U1KA 1GAFL 4UQ2A 2J6EL 2OXGA 4NQCA 3PWUB 2W0FA 2Q7YA 2R2BA 4HBQA 4YHNB 5F1SA 1Q94A 4N0YH 2R39A 3SHSA 3UYPA 2VUYA 3MA9H 5E8OB 4JPVH 4LPVA 3ZDXF 4XVUC 5CBAB 2DS4A 2RHEA 1CICA 1DQDL 1BIHA 5E9DB 3RKDC 3HE7D 1R3IL 4Y5VC 2P5EA 4Y4HB 4HKJB 2C5DC 1QFWI 2VZOA 4G9FA 1R3LA 4PJEA 3UJIH 3V5DA 2Z31D 1HXYB 2XG4A 4XPAL 3WIIH 4QO1A 4DZ8B 1UWXK 2AXGA 1AXIB 3FB8A 5ICZB 3OR7A 3EOAB 5DJDB 4L8SC 5KSBF 4P2RA 3IDGB 3C09B 3EO0A 3U36A 4Z7OE 1M1SA 1UZ6F 3WNNA 3ARDB 3L3HA 1J87A 5I71C 5LQBL 2AEQH 5ID0B 1U6AH 3FO2A 3IAQA 1P1ZA 4D9LL 4HX1B 1NC4B 1HSBA 3DURA 1NFIA 5EN2B 4HIJB 5C0CE 3BVNA 1XGUA 2XKSA 3GB7A 4HCRA 1QQDA 3Q2CA 1WIPA 4JCLA 1F4HA 4M6AA 4FQLL 5EZIH 1R24A 4XBGA 1XAUA 3V4VH 4PB9H 3BSZL 3HZKB 1JNJA 3GGWA 5AUMA 5F9JA 3FB6A 1Z3GH 1PZUB 3T65B 4JKLA 2VSCA 4NRXB 1J88A 3V7MA 1ZLSL 3D3VA 4OSUL 1A7OL 2AK4A 2E6PA 1AC6A 2FD6H 4EN3A 5JXEC 1V7MH 1T1XA 1NANH 2HT3C 4TVPL 1F11A 3E3QE 2HJFA 5E6IC 3WNLA 1RJLA 1IAKB 1YEHL 2AJ3B 3DVGB 1N3NB 4U7MA 3ZDZF 5FUOH 5J8OA 5T1MB 4PS4L 7CGTA 1QEWB 4JO2H 3LZFH 2J8UB 1A7PH 2CGRH 2H3NB 3V9FA 1EXUB 1CN4A 3K3QA 5EU5A 4JRYE 3FFDB 3MRPB 3RWEA 1PJ9A 1UM5H 3MV01 4JGMA 4P46C 1FO0A 4XP6H 4OGZA 1YY8B 3KLSA 2IAND 2W9DL 4HUUB 4LKXA 3R8QA 1XCQA 3MNVA 4KJQC 5H2BB 4KRLB 1Z5LA 2P5WB 2NW3B 4LNRB 1Q0YH 5JQHC 5C07D 4S1DD 2ZUUA 4PB9L 4OZFB 3X14A 3C2AH 4P3CH 2J88L 1ZHLB 4ONFL 4NZTL 4PBVC 2EC9T 4F37K 32C2A 1WZLA 3MRPA 4FRWA 5C70A 3EBAA 2YKLH 4EUPG 2X09A 4PJBE 3H0TB 2NY1C 3WEXA 3AB0C 5IBTH 1IEAA 3FOMB 4M48L 2X40A 4QGTA 2AJSL 5I1KH 4OGAC 5F9OH 1LP9F 4JPIB 1WIOA 1WTGT 2Z92B 3QJHB 2Z8RA 5FF6A 2HFTA 3S98A 5CEYA 3TBWB 4YDKH 3ULSB 3UX9B 5BS0D 5DC4B 1S5HB 2NPLX 1HHGA 2B20A 4YPGA 4X6FA 1VGEH 4GAGH 3DGGA 2FGWH 3UBXG 4X7FC 3H9HB 3L1OL 1KFAH 4MJID 2AQ2A 4YHZH 4L9LB 5I76B 3LHPL 2ICWA 4YUEH 4ERSL 5IWLA 5EOTB 3GHBL 1LD9B 1YQVH 3FHAA 3LQZA 3UO1H 4MSWB 3MUGB 5ACMA 4MVBD 5JIHA 3PDGA 3I6LE 5F96H 4K3GA 4GRLC 3RIAF 3PNWB 3TYFB 3FFCB 1X5LA 3PJSA 3OKLB 3WDJA 2IADB 4OQTL 4PLJD 4HG4J 5A16A 3WUWG 3QRFM 3DX9A 4HUMB 4LSQH 3AROA 3FQTA 1G7MB 3QRGL 3FB7B 4X9FA 3QIBC 3SDCA 4HUVA 2G2RB 2B39A 4IJ3B 5JOFA 3CSPA 4GT7A 3MV8A 1FJ1B 4LLWB 2GT9A 4POZC 4WW1B 2AERT 4NZDA 4L4VD 2E27H 3DIFA 5ECJE 3OKLA 1GZQB 4P5KB 2VDKL 4HLZG 4HUXA 3QPQC 3S35X 5GIRB 2Q76A 4MNQE 2GJ6D 2O5YL 1FCGA 1NC2B 3ES6B 4CADA 5ICYA 3AY4A 5KVEL 4PTUB 3B5HA 2EYRB 1RZ7H 5HTSA 3B9KA 1IC7H 2YD1A 4OB5L 4OZFA 4OGXL 5IB3B 4JM4H 4E42A 2I9TB 4X99A 3NA4A 3LOWA 3SKJH 4JY6A 3VFGH 2XTJD 4EUPB 3F12B 4PRIE 1J8HD 3PWPE 5C0RL 3TPKA 4WY7H 4GG6A 5DHYB 4PJ8C 1XF1A 4JLRB 3NCFB 3REWB 4R96B 2VLRB 3RVVC 3QCUH 5CJXA 5CZXD 2VOTA 3QG7L 2XWBA 4OUUA 3GNMH 4IEFB 4P46A 1IVLA 4OT1L 5HDOA 1OSPH 1KPRA 5CKGA 5EZJB 3JSSA 4KROB 2DQDH 1XGTA 4QOKB 4G6JH 3U0PA 1UA6L 1ACYH 5JW5A 1JWMA 3Q5OA 3KDMB 1ACYL 1A22B 2Z4QA 4RMTA 2HN7B 3CLEL 5GIRA 4G8FA 3M8OL 3FB6B 5GJTL 4LP4A 5KSUA 1MLBA 1RIHH 2N7AA 5HHPB 3TIEA 3VXPB 4PJ7E 3MV11 2A9ML 5CGMA 4ODVL 3VWKA 3MRMA 4QCIB 5FYKL 2BFVL 4NKOB 2X05A 3CFBA 2E7LC 3UCRA 4UTBH 4JRXA 4N5ED 4PJXF 1E28B 4ENEC 5CILH 3C87A 3DROB 1RZKL 4P23D 3H42H 4PGZA 4YLQT 2XXCB 4PJ5D 4PTUA 1LE9B 1JZ5A 4KV5F 2EDKA 1LO4L 1X3DA 5ESQB 2NY6D 1ZGLA 2IBBA 3OKMA 2VZ3A 4CJ0A 5C1MB 1GC1C 3BD5A 2HT4C 2D9CA 4MA3B 4QRUA 5C86A 5E2WL 3ARFC 3X3FH 3MOAL 5I8OL 1OY3B 4KI5E 2EYSB 4BZ1L 5J11B 3TPUB 1M7IB 2Y06L 1MUJA 1IC5L 1H8OA 4XP6L 1AO7B 1Z2KA 1BHGA 5JLZB 3JV6B 3ARUA 5D7LB 4F33A 5GGTH 4KROD 2ORBL 5ISZB 4NNYA 4HIXH 3QIBD 4KI5F 3CFEA 2B5IC 1CE6B 1M6OA 4G6KL 1CFBA 4ZFZB 2R2BB 2Q7YB 1MWAL 2CPCA 4R2GC 2VJXA 2FEEL 5J13C 3ULUD 5DQ9A 3NVQA 4ODHH 3Q6FB 2DQIH 4X6EB 4HBCL 2IH1A 4BJLA 1X4YA 3ILPA 2AV1A 1XR9A 3IS1X 2WBJB 2Z91A 3V6OA 5I18L 1SM3L 3C08L 5SV4A 4OLXH 1L6XA 2PR4L 1ZT1A 4PIRF 4YC2B 5I73C 4TSBH 4Q0XL 3RIFF 1IGYB 1AH1A 3BAEL 3TBSB 2OTUB 3R1GL 3ESUF 5GRJH 1F4YH 2YZ8A 4LCWB 5KSAC 3VGAB 5FDWB 3U9UA 4LSPL 3OXRB 4OD3H 5HDBE 4ELKB 2XN9D 1FG2A 1GHFL 4MLSA 3CVIL 4YHPB 1S9VB 3RDTA 2EC9U 4QHLB 3U7WL 1NBVH 3GBMH 5D7SH 2C9AA 3R06A 5CWSA 4JHZA 3U30C 4C83B 3SCMB 1OTSC 2AXFA 1HNGA 3MLXL 1KYOK 3E6HA 1A6VL 2NY1D 5DT1H 4PRDB 1W0WB 3OL2A 4KK6C 1H3WM 2A9MH 4E41E 3GRWA 1K4CB 3OR6A 1BF2A 5DI8A 1FBIH 2EE9A 3MODH 4YWGL 4AEHL 4KK9D 4NQXA 1WZ1L 5DLML 4R8WH 4MDIB 4OCRL 3QRGH 3ECBB 4M1DL 1W8NA 5C0AD 2EO1A 3RX5A 3MUHL 3S3PA 4G9DB 3W9EA 5E2TH 3CU7A 4LHUG 1Q72H 3N1PC 1RZGA 5D71H 5FGBA 1HHHA 3WYRA 3OGCB 4PJDB 2XNAB 1XMWA 4U1LA 4RCAA 3QFJD 3BQUD 1A6ZB 3OXSB 3KPSD 2J8UA 4WHYG 4K3EH 2VDPH 4Y2DD 3HE7A 5CIPA 2NX5B 4D0CB 1C5CL 1BFOB 4LEXL 1OW0A 2PXYC 1I1AC 3CDFA 3GJFB 3LKOA 5JMOC 1I7UB 3X13B 1JNHA 1T7YA 1YEGL 4HGMA 2BK8A 3BEWA 1LO0H 2YD8A 1MIEH 3EYUH 4TUOA 4XWGH 2F15A 3CXHJ 1CU4L 2LVCA 5DMYA 2J2ZA 3QQ4B 2YEZB 5I19L 4JFEA 3HG1E 4MLIA 3W0WA 2BC4B 1DEEA 5I0DA 2VDML 1MFBL 1JNHB 3U48A 1TZGH 1QRNE 5T1LB 4PJ9B 4U1MA 3G04A 1BOGB 1DN0B 3B8YA 5J11C 4ZNCD 4YHOH 1M05B 1P4LB 1VFBB 3BP5A 4QF1B 5C0GA 3HI5L 4OFYA 4WRLA 1JHTA 4ZTPH 1WZKA 2VISA 3ARFB 4LLVA 2HA1A 1NKRA 1RIVH 3MRGB 4NUGH 3O4OC 4S2SA 4W6WB 3SDDA 4L3EE 5FO9B 4PRNA 3W5NA 2GJZA 5DJ2B 8FABB 3FKUS 4LHQB 5I8OH 2VLJB 5CBAA 2ZG3A 3ECBA 2RBLA 4FQCH 4UOW1 2VKXA 3SO5A 5I66A 4I18C 4ERSH 5IJKA 4JM4L 5TF0A 4L4VE 1BECA 3X3GL 4U1KB 4PJDA 1BWWA 5GRUH 3TJHC 4PJ8A 4Q9QH 4YHML 3JTSA 2MQ3A 2AXHA 1CLZH 3QUYA 4LARH 5LG1A 3L3KA 1F4AA 4GUPB 2HRLA 3MNZB 5SX4H 4HK0A 4JY5L 1NBQA 4GRLB 1GIGH 5CILL 3EYVA 4XP5L 2HLFC 4NNXA 1F6FB 1YNLL 2VQ1B 1DBBH 1UKTA 1JBJA 5T3XD 2NY7H 2UYLB 3MO1A 5ICXA 3BXNA 5C2BL 4JRWA 5L2KD 3IJHB 3GSVB 1MQ8A 3KYNA 1PKQE 1RMFH 3B8SA 4M48H 2N56A 4A6YB 1DN0A 5KSVA 4F33B 5F7DA 3BP7B 1JTOA 3O4OB 4JFPA 4AEIL 1VFAA 1FNEB 5E2WH 3MV7E 2DQGL 1LO3H 4ORGA 5AUMB 3OAZH 1CI5A 1YJDC 3H9SA 1MFEH 2VXSL 4WTZG 1OAUL 2EZ0C 1G9NC 2F19H 5HYSB 2XICA 5FCUH 4ZSOB 5DJCA 1HEZA 4JR9H 1IAIM 4IIQA 5ADPL 4AEFA 2CKBB 3IETB 1VFBA 2AJUH 3ROLB 4ZOCA 5GJSL 1A7RL 5FCSH 4GOSA 4EVNB 5LAXB 3UO1L 2BSSA 2O93L 1YN6A 3RNQB 3HNSH 4ZNEA 2J7LA 2BZDA 2IMNA 5TDPB 5CBEB 4Y4KB 5I30H 4QRPB 4WGVB 4W4NA 3DECA 1BX2B 3TF7C 4AT6A 4RWYL 1YMMD 5F3BB 3HMWL 2UUDH 1ZLSH 5EUOA 1QYGL 4Y4HD 2VLME 2K1MA 3RNKB 3DV6B 4UIKL 3L3DB 4JJ5B 5I1AB 5B8CB 1EJOH 1SJHA 1AI1H 2AJZB 4DCQA 1HH6A 1GPOH 4IHOB 4XNXL 1WV7T 5JORB 3NN8B 1Z6JT 2R0KL 2WW8A 4KAQL 3GSRA 3PL6C 3LKRB 4PUBH 5JW4R 1A6ZA 2CR3A 4IJ3C 2HMIC 4KHTH 2APBA 4I4WA 5EBGA 3VU2A 1ZHNA 2FEEI 4ODXA 4ETQB 4TRPH 5KJRH 1MCEA 4QXUL 1P7KB 2GY5A 3NOIA 4PGDB 4EJ1C 5KS9E 1XZ0A 4LPCA 4MJ6B 5CHNB 3QXTA 1SMAA 4M3JA 4KGLA 3F6IA 3GSOB 5EH1A 5IM7A 4HZAA 3KLHC 1WEJH 3MXVH 1OQXA 1QBMH 5C0IB 1C16B 1RZKC 2DQFA 1HCVA 4KHXL 35C8H 4NRYA 4PTTA 3QULA 1PW3A 3HZMA 5E24E 4D0CA 2WSKA 4UDTA 4RMQA 5E9DE 1TVHA 5I0ZA 2Y23A 5B21A 3MMEA 3PL6B 4UT7H 1CGYA 3IDJA 4PJEE 4K8RD 3RX7A 1XGQB 4G9FE 4WO4C 1KIUA 2LABA 3NCBB 1RULH 4JKWA 1NFKA 2CRMA 4I3GA 4HUXB 1WBYB 3QG6B 4JPWH 4L5FL 2Y5TA 2DQGH 4KK5D 4GBXB 2OL3A 4ODSH 3VFWA 2X5PA 3O8XC 4DEPC 2AVGA 1J05A 4NGHH 3L5XH 2ENYA 1T5XB 1F3JB 3ALWA 2EDFA 3KR3L 2A6IA 1KCKA 2G2RA 4MCZA 4UV4L 5C0BE 4GKSA 5HPOA 1OTSD 3ARGD 4FQJH 1BD2E 5A40E 2F9BT 4KK6D 3PHSA 4W6YB 5A2LH 4JDVA 2OR9H 4P3DB 4ZS6C 3TYGL 4LU5H 1GZQA 5D7IE 3MCKB 4U6XB 1VPOH 4XB8A 1FGNL 4PTTB 4WO4B 3CCHA 3QUZA 4IMLB 4X6DA 5T1KA 3TO4A 1R3HA 2Z35A 3L7EB 4GRMB 1TJGL 4H20H 4WFHE 4PV8A 4ZYKA 5D7LE 3QDJB 1FNGA 1F4XL 3I6GA 4QEGA 1DVFC 1CGTA 3DRTA 3HI6H 3QIWB 4H88H 4L4JA 5TJWK 2PR4H 3CFKA 5EUKA 2HFGH 2DTMH 3HZVA 4KXZI 4HUWB 1I8LC 4P57A 2MCG1 1JP5A 3SDXA 3R1GH 5DJ0B 1A4KB 2OTWB 4HXAL 4Y88A 3PABA 3SGJA 3V52H 1GGBL 2DM7A 1FFNA 1K3ZA 4GBXD 3DX6A 4MHHG 4PB0L 2DYPA 1JF5A 4P2QE 3ROLA 3WIHL 5D7IF 1K85A 3M17B 2XWTA 4F7CA 4X98A 3V4UH 5I1DA 1IGCL 5FM5O 1BQSA 1FAKT 2X4RA 4GKZB 3G6AA 3S4SB 5JNYB 4U1SA 3ZKMC 3U2SA 1QBBA 3EIFA 1GGCL 3MYJA 3DGGB 3BN9C 2NZ9C 3PABB 2IANA 3MCLH 1S7SB 5D2NE 3RZCA 4F80A 3O3DB 5EOTA 4FZEL 4U05A 3FRPA 4LLQA 2DM4A 1EGJH 4N90D 2X4OB 4PREB 4XNYL 4XVJL 4E42B 2YC1A 5CJOH 3STZB 2C3VA 1N5AB 1FYHB 4KQ3L 4Y5YA 5I74C 4B50A 4YXHL 3BAEH 1NMAH 1U8MA 4JN2A 2PTTB 3MOAH 1LE5B 4PUBL 3RPKA 4DUWA 12E8L 2IANB 1FV1B 4QNPE 3NBNA 2ICCA 4HF5H 3B6SB 3TJEL 5EORL 3TJHD 3RY6C 1KNOB 4HC1H 4ELMB 4K55A 4L3CB 5DVNA 2B2XL 5H8DA 3WEXB 2CJUH 4M6MH 3BH9A 3T0EB 4Z8FH 3T0XA 3QQ3B 3FJTA 3L5WA 1P4BH 3DX8A 3SDYH 1BJ8A 2V5RA 1WWBX 5ID1B 5HHPA 1S7RA 3QHZL 1DLHB 4FQHA 1KJ2B 1UENA 5EA0L 4KVNH 2VLKB 1TMCB 3QDMD 5B3JF 5DD3H 5HHXH 1EO5A 3HAEB 4HBCH 2YRLA 4OLUL 4WHTB 5DUBA 4MDJA 3NCJH 4N9GA 4RWHA 4S1SL 1ZANL 2F54B 4X6CF 3PDOA 4YXLL 2B1AH 4YEFA 3EUUA 4Y4KD 5CSBA 1WVZA 2R0ZH 2AEWA 3G04B 4ZYKB 5EN2A 5K9KA 5M94B 4U1JA 4TTDD 4PG9A 4HIHB 4QWWC 2X89A 4LMQE 2NY3D 1H15B 5AYUH 3MRNA 5BW7A 2DQTL 3SJVD 3UTSA 4ZXBA 3WDHA 3FFCA 4P9MH 1JIBA 4LF3A 4PG2A 1QSZA 4IDJH 1L0YA 4HZLB 5SX4I 1CXEA 1A9EB 1I7RA 4B53A 5ABDE 3BZ4B 1QR4A 5IB1B 2XN9A 3V52L 3MLZL 2JCCE 3FQTB 4QHNB 1DDHA 1J11A 3LDBC 1PY4A 1H8SA 2BVEA 4QRSA 3KPLA 1T80A 3PWJB 3QFJA 4X7TB 1NANI 4X6CA 2EDBA 4Y8DC 2XKNA 5IIEB 1Y0LB 5I8KH 2HFFA 1WWWX 1U8QB 4JFQB 3RX8A 1R3JA 1ZEAL 3L3IA 4LDOB 3VFNB 4ZUUB 3VFRA 3DRQB 3P9LB 1HYSC 3KPRD 2BNRD 1M71B 3MZGB 4QHUB 1G6RH 1V5JA 4NQSA 4O00A 3E6FB 1OD9A 4U7KA 1GGTA 3NCYS 3ZKXB 1Q9OA 4R0LB 2XN9E 3S5LA 5I73B 2DQCL 5T1DL 4Y16A 5IMMA 3IDYC 15C8H 4AL8L 1PD6A 4FZ8H 4OCXH 1KIPA 3REWA 1J0HA 1MFNA 3K81A 4OCXL 1EEZB 3QG7H 2DJSA 2AJ3A 5K59E 5JW4Q 4H26A 4ZAKA 1W0WA 3MBXL 3QA3B 3MRDB 4I0PC 3L5XL 2V2TA 1VGKB 5EO0A 2UZIH 2Y25A 1D6EA 1MCCA 5INDB 5GS2H 1SJVA 1HYRC 3DO7A 4F7PB 4PP1C 4EI5D 1Q1JL 5GGRA 1T2JA 2X89D 5GS0D 5HY9B 3BDXA 4G80B 2BCKA 4LFHD 1TJHH 4QTIH 5DUPH 1I3GH 2VDRL 3W0WB 3KNBA 4X4YA 5D7JB 1U91B 4Q74A 4Y4HA 3ARSA 5DI8B 1I4FB 2VXVL 4HFWB 4HKBA 3B5GA 4ZUWB 2DQHH 3O6FA 5HJ3B 3TV3H 5DC9B 1FZKA 3J7HA 5MEQA 4WWKA 1BVKB 3MGOB 2AXFB 4QHKI 1PY9A 3TFKC 3AFLA 3P0VH 4DWHA 4EDWL 3I3DA 1F4XH 2VIRB 1OAYL 4WV1A 1KIPB 2IGFH 1GL4B 5B4MC 5DWUL 3HE7B 5CIPB 4XNMB 4XRCB 4MWFA 3I02A 4TSAH 1XF2B 4JANB 4TRPL 1N2RA 3HE6D 2P5EE 3LEYH 1HSBB 4C56A 1I8KB 1QD0A 4OM1L 5CSGA 4XI5C 3RJDA 4ETYA 3WUZA 1UFUA 4NNPL 3RUGA 1JFQH 3S9DB 5E03A 2EYTA 4U0RC 3R0NA 1AP2B 1FH5L 3TN0B 3D3VD 5HHOE 3INUH 3BISA 2Q8AL 1Y6NR 5BVPH 3TO4C 3VJ6B 4LCYA 2L7UA 1N2RB 2HVKB 5FYJH 4D0DA 1T0PB 1TETL 1PEZA 3BYYA 3RVTC 1FLRL 3ZDXE 3VXOB 1L7TL 4KKNA 2N1KA 5IB2A 3BE1H 2GIYA 2YN5A 1ZWIB 4J6RH 1IKNA 4NO0A 5EIIB 4YXHH 3VD3A 2VIRA 2VZUA 4BSVB 4NNXB 3HN3A 2NY5L 1IC1A 2GTZB 2QR0B 4YHZL 3FQRA 3X17A 3ILQC 4ZSOA 1ZMYA 1YMHA 1AKJB 2W60A 5J1SC 1FZKB 4XC1H 4HC1L 4OGYH 3L3GA 4IMKC 4QTHA 3ARWA 4ALAL 4JPKL 1WGOA 3UP1A 4X5WB 2UWEF 4MGXA 1FNEA 1A1MA 1K2DA 4HS8H 2HJKB 5D7IA 4NO0D 1U8QA 2E8YA 3I2CL 25C8L 4JQIL 1LDSA 4Z5RB 1X5GA 4XNMA 1EXUA 3IRZA 4OLUH 2HT2D 5DK3A 2IQAB 3GK8L 1CBVH 4RIRB 2Q1EA 5C0RH 4QOKD 2ZUYA 3L95A 5L6YL 4G43B 3QUYB 4GH7B 3V5HA 1EVTC 1IQWH 2GY7B 3CIQA 1KG0A 4JM2F 4NYLB 5IOPA 1YNKH 3H7LA 3OX8B 4GKOA 5F1NB 1T66D 3U6RB 4KJYA 2NYYD 3DMMD 1EHLH 2NY0D 4JM2D 5L2JB 1ZT4A 2R1WA 3P30H 5EO9A 4FQ2H 3QO1A 1N0XL 1NQBA 3SN6N 4U6VL 2X4PB 5D5MF 4XC3L 1LO2H 4I18B 3OKMB 5KSAD 1GZPA 4P4KB 1T2QH 1W72B 3TFKD 2G5BB 2EDYA 1I1YB 1U8HB 3BP6B 4N68A 3FMGH 2R1YB 5F1KC 3U79A 2W1NA 3EOBB 3SDCD 4U1GB 1NUDA 3D18B 3QUZD 3KPNB 2HRPH 3CX5J 3O3UN 2NXYD 2F5BL 5IFAH 3ZHKA 2ZPKL 2VDMH 4HT1L 1TTGA 3FB7A 5MI0B 1HI6A 5HI4C 1ZLUH 3O3AB 3OHXA 1HQRB 1S7XB 5J56B 2F5AH 1IBGL 3H2WA 4HS6A 3KYOA 3MGTB 2UVEA 4YBQD 1QSEB 5ERWB 2YPKA 3QG6A 3PNWA 3TYFA 2DF3A 1LEGB 3Q6FA 1HINL 3HPLB 1F02I 3JBG7 2IAMB 5IBLC 1TZHB 3UBXB 4V1DD 4TULH 5EU3B 4RZCA 4XCCH 4TULL 5GRYA 4JO1H 3CU1A 5CD5D 4UOJA 3DUUA 5AD0B 1AD9A 2D7PA 1OTTC 5FYLE 2AJUL 5TF1L 5CUSH 5GRUL 5TF1H 2YD6A 4MNGA 2ZUVA 1IAIL 3NPSB 5DJZB 5IW1B 3QUML 3RY6A 2DDQL 2GSGA 3UTPD 4JFHE 2Y36L 4M6NL 5L2JA 4P5MB 3B9EA 5IJKC 1OPGH 3UDWA 4F15C 2OL3B 3DVIA 3RRQA 3QYCA 4Z7VE 4LSDA 1I9JL 1ZE3C 3GSOA 4OZFG 5IBTL 4B41A 2YXFA 3DETD 2RAMA 4NBXB 4XNYH 1KYOJ 1JUFB 1U36A 3DUSA 4U1JB 1ZLVK 4UILL 4EDXB 4UT9L 3F6LA 1EIBA 2PYED 1YEEL 1N6UA 1ZHLA 1X6NA 2CMRH 3DVFA 3H9SB 3QPXL 5FYKU 1TFHA 5KANG 5IR1A 2A0LC 1MFDH 1MCPH 1NSNL 5BOZG 2P8PA 4ORGB 1MNUL 3SBWA 3GRWL 4PV9B 4UDTB 4J7RA 3ZKNC 5B39A 2X41A 5FYLD 4N8PA 2OMNA 1A3LL 5KG9B 3HUJA 2FJFA 5AAMA 4EBQH 1U3HD 4OGYL 1JUFA 3EKCA 2OK0H 1B0RB 4NRZB 4DGVL 1TVDA 2YPLB 5ALCH 3F7QA 1RUPL 5I1JH 5C07B 2PYEB 3O2VH 4GMTH 3LRHA 5IR1B 3RBGA 1A7QL 1FIGL 3VGAC 1IGIL 3U4AA 5E8PB 3SGEH 2EIZA 4OAWB 5BVPL 3CJJA 4JFFD 5IROA 5HVHC 3EYSL 3RZCD 4LASH 3QUZB 1BLNA 4M1DH 2C3VB 1BJMA 2VQTA 1XEDA 2ZOLB 3BKJH 4JN1L 4DGYL 5J89A 3E3QC 3QIWD 3OKNA 3QIUB 2YA2A 2LU7A 5EU6A 3O9WC 1NAKH 4NP4L 1CFVL 4LSUH 5KJRL 1NAKL 1E6JH 2AEIT 1MVFA 2FYYB 3RQ3A 3WIFB 4E5XB 1JPGA 3QCVL 3RNKA 4Z7WA 1S9YB 1J1OH 4JFEE 3CUPA 5HI4D 1NBVL 4GG6F 4PR5B 1XZ0B 1S7TA 4GRWB 1QRNA 4M3KB 4CDGC 4LSSL 1WWCA 4ZODA 2VR4A 1BZQK 3C2AL 3U82B 2R0LL 1FP5A 5F6HI 3RWCB 4HW6A 5JZ7C 4HUKB 1N26A 3MRQB 4AMKH 4GKNA 3UJJL 5F9JB 2KZ1B 5D96B 2C4FU 4MXWH 3F65A 3HFML 3EDEA 3I9GH 5JPMB 3KPPA 1X9QA 1AY1L 2GW5A 4M8QA 1XR8A 5DF0A 1MFAL 5J1AA 9CGTA 5IMOB 3FT2B 5F7HA 2H1PL 3H7BB 4OJFL 1NC2D 4WUUA 5J1TC 3HI6L 5BRZB 1P84K 1BFTA 1C16A 3CZFB 3EOBA 4KRMB 5DRZA 4WTXA 2V2XA 2OP4L 5T5NG 1BQHB 2Y5TB