4XNQA

Antibody hemagglutinin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords H5.3 Light chain
total genus 47
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA01
4YUEH 5EBWB 1J9CT 4OQTA 3ULSA 5IESH 3MLPA 1F90H 2IPKB 3V5KB 2AJVH 4EBQH 4K2UL 2VE6A 3QRGH 3D0VA 5I1HL 1V3MA 1U8JA 5JDSA 3INUH 2ZUTA 2A6JB 3SDXE 5JQHC 2Q8BH 3U7YH 2HFEB 5E6IC 5KSUA 3O3AA 4GO6B 4P3CH 1KELH 3MLWH 4P2RD 3KPPA 1P6AB 4OD3H 4U3HA 5DHVB 1MFBL 5T3ZH 4X7TA 1ZXQA 4XHQA 3L5WB 1VKXA 3WV0A 5JHDA 4QTIH 3SDXB 3MRNB 4HS6A 3LH2L 4KK5D 4YNYB 2E7LA 2F74B 4WFHE 5FHAH 2H32A 2WUCH 2R56H 4GG8A 4K8RD 4YHMH 4ZS6D 3ZE0E 2VLLA 2XN9A 3UTSE 5B3NA 1RZ8A 5GRXG 1ZVYA 1UADC 5E08L 1VPOL 1F45A 3GSWA 2QQNH 5J1AA 2YRPA 3B5HA 3QDHA 4UOJA 1NANI 3D48R 5KSUB 1FYHB 2R4SL 3MGOB 4NFCA 3CXHK 3WO4B 1OP3H 4BFEA 2X4NA 4PUBL 1JF1B 2OL3H 3ILPB 2FEDC 3U7WL 2H1PL 3P2TA 1KGCE 4PB9L 5J8OA 1WCBA 3MCLH 5I16A 1TENA 3DI2B 3MRRB 1BBDH 4RIRA 2BVEA 2IGFH 5DD1L 2E9BA 1U58A 4UT9H 5IT2L 3BIKA 4LPTA 5MHSE 3NOIA 2XA3A 3IFPA 4JR9L 4KTEH 4PJHF 5D2LE 3ZTNH 2VR9A 3JZ7A 1A3RH 4LVHC 5IJKA 4WW1B 4KWUA 3M17A 2XXCB 1A7NL 3L3JA 5DC0A 1CD8A 2ZCLL 2EE6A 2H2PD 3FB7B 4MJID 3ARYA 4M5ZH 3L95B 3CVHA 4NGHL 1JNJA 4GJTB 4OCYL 4PRPD 3U4BL 4JRYB 5KANG 3NA4A 4NBZB 4I3RL 1RZ7L 4HCRH 4YBQD 1NFIA 2VN4A 5E2WH 3F58H 2AEIT 5HI5C 1U8MB 3NVQA 4QXWA 3BWAA 3LH2H 3SDAD 5I8OH 5JW3H 4TSAL 1NDGB 5E2VH 4KHTH 3S4SA 3BXNB 1G1CA 3WFCL 1CICC 1KC5L 4YPGB 4POYA 4ZDHB 2F5BH 2LV4A 3PHQA 2GYSA 4CMHC 4YHZL 3F8UB 2HYMA 1QFPA 1KEML 5IFJB 1F11B 4U6VH 1W72A 4ERSH 4PJDE 1R6VA 4ZFZB 1KIQB 1BREA 3ZYIA 3MNWA 1EHLH 4PJAF 2FIRT 1MOEA 4UV7L 4PJBF 4LU5H 2XFXA 3MRQB 2IGFL 1GC1H 1G7JA 4A2MA 5EZIL 3U0WH 1QRNE 4XVSH 4QXGH 1CE1H 3ARGB 3VXME 1T1WB 4P5MB 3UCRA 4JQXA 1FSKB 3QIUA 4K3JL 5EU7E 1DCLA 3O4OB 4KRNA 3RZCD 2WANA 1UWGL 3V0VB 4L1HA 3ARDA 1FH5H 4FQPA 4WTZA 3QEUB 3DGGB 4RFEB 4HUKB 3SN6N 4NQCD 1Y0LA 3REVB 5E5MA 1NFDF 1NFDB 2AK1H 4PJ8C 1IKFH 4JHWH 3IT8D 3DI3B 4HH8A 4KDVA 1JTPA 3BE1L 5BXFA 1QLFB 5LGKA 2VZ1A 1AGDB 3PE9A 4EEEA 2QQQA 4NQCA 1H8NA 4J3WA 4PTTB 4CU8A 1RJCA 1CN4A 2FHBA 2A6DA 4FQHB 1IVLA 2L7JA 4NWUL 3LKOA 5L9DL 3SKMA 5F7EL 2QADB 1ORQB 3HNVH 4J12A 4H26A 2EC9T 3GHEL 1Q1JH 5D8JH 3SDDA 2NTSP 4U7MA 5GPRA 2OTUA 4PJAA 5DO2C 4LVNB 5I1IH 1XH3B 1IGCL 4MCZA 3LB6C 5GS3A 1GOHA 4OV6F 2AJXH 2ZCKL 4BKLA 3IFLL 3QDMA 2NW3A 5L0QB 1E6JL 2YD5A 4XBEL 4KVCH 1WGOA 4IS6A 4UB0L 1UZ8B 5JXEC 3IRZA 4RMUA 4WENB 2EYSB 1GZPB 2CDEA 3CSPA 1HWHB 4KI5D 5DZNA 3V7AG 1MI5B 3QUKA 4HIIB 2CLZA 3S4SB 1CU4H 4QGYA 1VSCA 2O5YL 3IS0X 4N5EC 5B38A 2YEZA 4D94A 1BM3H 2DIJA 4KK9D 3STZA 4NZUL 3AM8C 5DGRA 1UG9A 3QQ4A 4WDIA 4PBVC 1IL1B 5GGVL 4XHJD 5FO7B 3R1GH 4YDIH 1P7KA 2QLVB 4WI2A 1YJDC 4C56B 2BXYA 3H42H 2FIKB 5SWZD 3D25B 2OR7A 4X7TB 5C0FB 3VD7A 2OR9L 3KPPB 3GSOB 4JFDE 3TT1H 3FN0H 2A0LD 5EO9A 4F8QA 5ISZD 5T3XD 1OP3K 3I3EA 3TA3A 5CHNA 3G6JF 4YH6A 3BPNB 4BUGA 5MENE 3HAEA 5CEYA 5CINL 1F3DH 3DX8A 2ICES 3QI9B 1N6UA 4M1GL 5CP7A 1CQYA 2AVGA 4HQQH 4HIEB 1LP9F 1YYLL 3MRFB 2VITA 4ELMB 3C60B 1ZMYA 2R2HB 1BJMA 4KZEL 3FFCA 2R0KL 4G9DB 1LE9A 2ADJB 5IVZA 5BW7A 4X4YB 3FHAA 3NCCB 2EIZB 3NPSB 4JZOA 5TE6L 4HIHB 4NFBA 5J6GA 5IV2B 3HUJE 3VW3H 2A74B 4OD1L 2VITB 4OCNC 2NYYC 2IH3A 4HF5H 1RUML 3WD5L 3ILPA 4ZSOA 3B3IB 4RGOH 3EJZC 3U48A 5A43C 1JPTL 3BPCB 1HXMB 1O5DT 1YJDH 2VDPL 1NGYA 5F7MC 3C5SA 3OAUL 2PXYA 4NKIH 4TPRL 5GZOD 3CZFB 2FEEL 1NCWH 3VGAB 1RD6A 5M95B 2X6MA 1K6QL 2FGZA 4HGKC 3NN8B 4XWOD 2BSED 3QDGE 3GSQB 5TF0A 3TO2B 1NC2D 3LEVL 3HI6L 5DK2B 3WNPA 2H2SD 4JCLA 4OZHA 5E0QA 4ZFGH 2P47B 1PEZA 1YPZA 3HUJF 3RX5A 4MAYC 4YJZL 1DANT 4OJFH 5GJSL 3KPTA 3QPQD 1X6NA 1BIIB 3O6FC 1KG0B 3ULUH 5F9AC 1HYRC 5JW5B 4HAGA 1UKSA 3OV6A 4PYHA 3V2AR 4JRYE 5DD0L 4RGNC 4KKLD 4WFFD 4GG6B 5TQ2L 4PR5A 1FFNB 4ZFOL 3D85D 4Z7WF 1A9EA 5AWNL 5LAXB 1UH3A 1HHJB 4Z7VA 1Q38A 3CXDL 4K7PH 2EDDA 3L3KA 1QRND 3MGAA 5T3XE 1BJ1J 5EB9A 5CJQL 4PJ8B 3GEWB 5FB8A 2VKWA 3RUGF 1I9JH 4N9GB 2HKHL 4F15B 1XIWD 1RUQH 5F96H 3FO0H 1OSZA 3VCLB 2G5BA 4WVRA 4LL9A 4R7DA 5C0CB 3BOVA 4UQ3B 3ULUC 3T2NH 1AGEB 3U9PL 4XNZC 2VL5A 1FN4A 2O5YH 4M8QB 4YDJA 4M4RA 5EU4A 1T5WA 2F58H 4ZD3L 1WZ1L 5J13B 5DEGA 1CGXA 4P99A 3IVKA 1MCWW 2HTLD 4ELME 3C8HA 3U46B 3P4NA 2GTZB 4M93C 3WKML 3BFOA 3QG6B 4MD4A 4G8EB 3TF7C 2X89D 1NGPH 3EOBA 4DK3A 3LD8C 4PJ8A 3P73A 2BVQA 3BYTA 1UGNA 1ZKAA 3OHXA 1FNEA 1REIA 1ZHKB 1FRGL 1XF1A 3KWWB 4NNPH 4ODWA 5B38G 2VSCA 2FJFB 3GMPA 1MFBH 1Q9KB 4JO4H 1CL7L 3QCVL 4KQ4L 4JPIA 3DV6B 5EN2B 1XGPB 5LBSL 2PTVA 4YHLL 1P84K 2CGRH 4P3DB 5DJ8B 3NABH 1GPOL 5E2UH 4TUJA 1ZSDA 3LQZB 2VLKE 1DL7H 1VFBB 3V7AE 1E4JA 4WHCA 1OLZA 3CUPA 5TDPA 3REWA 2ERJB 4AZ8A 2ZJSH 3T4AA 1KSRA 3BKMH 1JF1A 4EBQL 4I3RH 3RWFA 2W9DH 2QBWA 3NZ8A 1ND0A 1P2CA 5IBTH 5IB4A 5IKCB 3P30L 2X1PA 1F97A 4UZGA 4X6BB 3VXMB 3BRDA 1I7ZB 1T3FB 3TVMD 3KLSA 3T0WA 1K4CB 1EAPB 4F7PB 3DRQA 1CFTA 3GNML 3V0WH 1QBAA 2OMNA 4QHNB 2Z4QA 3PIQA 4J3TA 5J6GB 2JF1A 5IVXF 2BJML 1WWCA 4FTVB 4IDJL 2N56A 4JHAH 5FYLD 4S1QH 2P1YA 4X5WB 3VXRE 3MXVH 5CEZH 4HAFA 3H3PL 4BYHA 4M5YL 4ODVL 3IDNA 2OL3A 1QLRA 3MROB 3NFPB 2RIKA 4FTVE 1EHLL 3W11D 1OCWH 2P48B 4L4VE 1WBYB 1T0NB 1CD0A 3QXAA 1RK1B 3DLQR 3F7RA 4XGZB 1Q0XH 3T04D 3IDGA 1KPVB 4W4OC 5KJRH 5E8NB 1F4HA 2C4XA 4PB9H 3UX9B 4KJQD 5J1SC 1M1SA 3D25A 1DBKH 3CGTA 3VFUB 3MRPA 5BV7B 2EXWD 2LU3A 1CGUA 1UXSB 3FO0L 1B2WH 4KRMB 2VXTH 3V6OE 2FHCA 4LHUG 4Z7UF 3TVMA 4K7PY 3LIZH 5ELIA 2NTFA 2P8LA 2W65B 3QO1A 1I3GL 4HC1L 4X6DF 3TO4C 4MNHB 5ESVB 5I76B 4U1MB 1I7ZA 3MGOA 3ARGC 1K3IA 1B9ZA 3CLFL 4LSVH 4HC1H 4FQQB 2V7HB 1BQLH 3GMNB 1Z3GH 4OB5H 5CP3A 4EDWH 5T1DH 4YC2B 1BQLL 5F8RC 4UILH 1C1EH 5AZ2H 3ULVH 5GHWH 5JA9A 1UM4H 3MLUH 1LK2B 4WEUD 1CD1B 3I3DA 5A1AA 3DSFH 3TC9A 2DMBA 1TDQA 3KYMB 3FT2B 4HS6B 2JK5B 1EO8H 2CDGA 3VFWB 1FV1A 1SEBA 3S88H 3HE7A 4NQEA 4OI9A 5B38B 4Y19B 4PFEA 5J12B 4P23A 5MEOA 4U49A 1INQB 1PSKH 1AFVH 2CKBB 4QF1B 1U9KA 2NZIA 5ALCH 3D3VE 1OAQL 2A9NL 5JQ6L 2VMFA 4JN1L 4N8CH 2J8HA 2WQ8A 3H6JA 4ZS6C 3ZT5A 3SKMB 5DR5L 2FYYB 4WFFE 3VXNA 2DQJL 4ZAKB 3DGCR 4K8RH 4LBEB 4ZS7L 2XTJD 2ZSVB 3QO0A 2Q8AH 3RWCA 3P4NB 5CEZE 5KS9E 1BQHB 2FBJL 3MRGA 3QZWA 4JQVA 3VH8B 2I26N 3HC4H 5D7LE 3BO8B 2HFGL 5HGBA 3HE6B 2DTMH 1HIML 2O5XH 3HPLB 1JN6A 3BQUD 5HD8D 3V8OA 2QSTA 4MDIA 5K9JH 1H3PH 1LDPL 2X7LA 2WMPA 1EUTA 1PFCA 1AKJD 5EORH 1N3NA 5BQ7B 5F88B 3PGDB 1PEWA 3W2DL 4PLNC 1B4JL 4C58B 1BX2B 5JHDD 1CLZL 4Z7WE 1KT2B 3MACH 4RDQF 5ACMA 5DJXA 1WZMA 4L9LB 3DGGA 4H0GA 2G60L 3HS0A 1RJZA 1XGUA 3PP4L 1F3JB 1QSFB 1QSZA 2CGRL 4AYFA 1YNKL 4JDZA 4AIOA 3TT3L 2YUZA 4XZUB 5T1LB 3DOSA 4F7TB 4U1KB 5IB5A 4TQEL 1QFWM 2D7QA 4F3FA 3DTXA 1XGTB 1ZLWK 5CEXB 3NBNA 5C71A 3P73B 3WN5C 1BAFH 1GGCL 4HJGB 2HT2D 3B43A 4PJ7A 2BVPB 1INQA 3L3GA 2CH8A 4MQXD 1IZKA 1IGML 1YMHA 1QG3A 5A3ID 2VLKD 1NFIB 4KMTL 4KVNH 5ETUA 1QVOA 4AQ1B 2YXMA 4Y16D 5IFJA 4M8QA 1A7QL 5GRZA 3DX9A 1RUQL 4OLXL 4A6YA 4Z77B 4EI6A 6FABL 3WJLA 1VEMA 1OWWA 4WUKL 4IRJA 2VZUA 3QCTH 3MRCB 4LHUA 3S98A 4U1IB 2UVEA 3BUYB 1G9MC 3SE9L 3WHXB 3RVVC 5E03A 2WINA 3B9KA 4R2GC 2EKJA 4PLKD 3E6HA 1OLLA 5IW3A 4RISL 1P84J 3B83A 5GGQH 4XP9H 1R3KA 2ZOKB 4XCYB 2JCCA 2M26A 1BFSA 3NN8A 1FNLA 3LQAC 4QRUA 2EDOA 3EIFA 4Q2ZA 2P5EB 1EJOL 4U3CA 1LEKA 2IADB 5IVOA 1I1AB 2ESVA 2G9HB 3IAGC 1CK0H 2DQGL 5F9JB 4JJHA 4QHLB 3LKPB 5IFHH 3U1SL 5I1JH 4NT6B 2YC1A 1Z9OA 2V2TB 1E6OL 3WIHA 5KS9A 4MVBC 4J8RA 1MFAL 1XCQA 1MEXL 2B4CC 4I3SL 4E41E 1EXUB 3MRDB 2Y06H 4JN2A 5KSBE 2DM7A 1QFOA 4HH9A 2VZOA 3QA3B 4TUKH 3QPQC 5IB3B 4RIRB 5IVXE 3I85A 4XT1C 3P11H 1S7TA 2UWEA 2WIMA 4HWBL 4Q2ZB 5D6DC 3KXFB 12E8L 1DBAL 1NCDL 2NW2B 5ANMB 3GI8H 3QFJA 1RJLA 5HHMD 1JIBA 2G5RA 5BJTB 4IMLA 3ZDYE 2R4RH 5DUML 3BP7A 1R3LB 3GM8A 2EYTB 1RK0A 5GRUH 4K94C 4ZUTB 3B9KB 3FQUB 1JVKA 2JIXD 1TTUA 3IETA 1J0YA 4XVUC 3PL6D 2VDPH 3MRDA 3QULB 4P9HH 2W9LA 3C08H 4QRQA 3VI3E 5FUOL 1ZTXH 4XXDB 4NN6C 2X1WL 3SE9H 4WEMB 2Q6WA 3QIUD 4M48H 3QIWB 3MBEA 3ULVF 1I1AA 2ESVB 3MUY1 3O0RL 4N0YH 1JV5A 1A7OH 1F90L 2XKUA 2BK8A 4C54A 1I8IA 3F7YA 1WWWX 3C6LC 4NZRL 4PJGF 4DW2L 3UJJH 5JHDB 2SEBB 4PRAA 4MD0B 5F89B 4G7VL 4E9LA 1QSED 4AEHL 3B8SA 1HHGA 5FECA 4KKAD 4KMTH 3LN4B 1BVKA 3E6FA 4EN3B 4I0KA 5BVJB 2GCYA 1HZHH 3UO1L 1ZHNA 1R5IA 1XF3A 2DQTL 2ED9A 1ZGLP 1A1NA 4P2QD 3ZDXE 1PBYA 4UTAL 1ZWIB 3ZYJA 4JKPL 4QHUA 1JZ6A 1K4DA 3VFNB 5J7CC 3F6IA 4UTAH 1KLUA 2HG5B 2ZP0T 4FTVA 5SWSA 5BS0D 4P9HC 5E6YA 1BVZA 5FYLE 1UCBL 5IQ7L 1QHOA 2VQ1B 1RURL 5B22A 2ESVE 1ZANL 5GGUB 4J6RH 2Q7YB 1L9NA 1P9MA 1MCLA 3U36A 4NM8L 1M71A 2AK4D 5D7LB 5SWZE 3VGFA 2A1WL 5FM5O 2PTUA 5CUSH 2YD6A 1JYWA 3QUXC 5FF6A 3WN5A 4CDGC 35C8H 2UVFA 4Q0XL 1FO0A 4LVOC 2F8VA 4HXBL 1BBDL 1JF6A 2DDQH 4X9GA 5JPNB 5I0DA 1AY1H 5IBLD 3SBWA 2DQCH 4WEBH 3KYNB 1IZJA 1HDMB 3MZGB 1DSFL 5EH1A 4JEGB 4BKLB 3G5VA 4HLJA 3BI9X 4B7IA 1EGJA 5DJDA 2HJKB 5C2BH 4HMCA 1P4LB 4JFOB 1KTDA 4Z7NF 4BFBD 1IQDA 2R1XA 4IRSA 3GMOB 4UIMA 4OV5A 2V5YA 2BSRA 3KJ4C 2AXGA 3S37X 3UTQB 4GKSB 1T7YA 2P8PB 4AEHH 4KJWC 1IT9L 3CVIH 4Z78A 1ZGLB 1IQDB 4M1CD 5DD1H 4KPHL 1DQLH 1O0VA 3QXVA 5CGTA 4HUXB 1EMTH 1WIUA 3G04B 2ATKA 4NKDB 2W60A 4X0KA 1BFOB 5D2NE 4D0CB 3RAJH 3KYAA 1LO2H 3GKWL 3WO3B 5FOBB 3RAJL 3PDDA 4FRWA 5IR1B 1A6PA 1WBXA 3O4LE 2E5EA 4TSCL 4JZJA 1PZUB 4JPKL 3SDXF 3ZT7A 3TT1L 1QYGL 1J7VR 4UT7H 3DHJA 1D6EB 4YXHL 1U3HB 1J8HD 4GKSA 3TBTB 1UXWB 2W9EL 4HDIB 5C0BA 2VYRE 3H7BB 4FQIH 3LRHA 3HPLA 1RVFH 4Y88A 4TQEH 5FAAA 1KTDB 1BWMA 2I25N 1F4AA 4KGLA 1U92A 2I60H 4UIKH 5C0JA 3O6ML 5HGAB 2VAAB 4JM4H 1LDSA 5IV2A 1NLDH 3TGXA 1MF2L 3KS0H 3QQ3B 3FB7A 1S3KL 2JJTC 2E7LC 3MXWL 1HDMA 1HSBA 4P3CL 5AAMA 4D8PB 2Y23A 1MSPA 2DMCA 2V2WA 3AS0A 4XCCH 3TESA 3ABZA 3QI9A 5CP7B 4MQTB 2ARJA 4M7ZB 1HHHA 3C5JB 5DFVD 3EDEA 4JRYD 2W0FA 4KU1A 1I8MB 2LTQC 1A6TB 2F9BT 3TLRA 4GBXA 3T77B 5K9KA 2A1WH 5GZNC 3VFWA 4GAYA 2QSCL 1K6QH 2DLHA 1NGQL 4OZHB 4R26H 3WLBA 4TN9A 1HQRA 4GS7C 3JWDH 1JV5B 4NQXA 3EDKA 4XNQA 1I8LA 4ZODA 3RI5F 2PNDA 3TPUB 3VXTA 1I3UA 2VXVL 2BNQD 2L7UA 2HWZL 5ISZA 5TE7H 4PYGA 2VDKH 5F1NA 3VXSD 2FZ3A 1NCWL 3VFNA 3DURB 5E8PB 4MZ2A 2H9GA 4WU5B 2NY4B 2XWJA 3EFDL 2W9DL 1R3IL 1INEH 3PP4H 3Q5TA 3FO2A 4LEOB 1IM9D 1HHHB 3C5JA 4EN3A 3MRHB 3WKNA 2VWEC 2AK4A 1QP1A 3PXJA 4ORGB 3BUTA 2P5ED 4UINL 1FE8L 3TVMB 5BJTA 3EDDA 3VXQA 4Q9BA 3NZHL 5HVWA 4HIHA 5T1MA 2Y6SC 1CG9B 1KCUL 2YS4A 4K23H 5HDBF 4OSUH 3ZE2E 1WISA 5LBSH 1VGEL 2BVYA 4MWFA 3FT3B 5KZCB 4XXCC 3GSNA 3OB8A 1JGUH 1ZHBB 2FATH 1ZLSH 2O5XL 4RBPK 4FQXC 4P4RA 1KJ3H 2AW2A 4P2QA 3IGAB 4OUUB 1NKOA 3FFCE 2V9QA 1DBJH 1UJ3C 4LAJH 1MY5A 5CSGA 3MLTA 1U3HA 1FYTD 3WFEH 4CMMB 3C9NA 3R1GL 4WW2C 4ZS7H 3RTQD 4NO0D 4G8EA 4EI5D 2FIKA 2Y5TA 3DYPA 4LCYA 2D9QB 3GK8L 5EC1B 3T0EE 3QUXB 5GSRA 5ICXB 4LVOB 2XWTB 1EEYB 3C6SB 3CDGA 3KPNB 5DK3A 3VE0A 1EEZB 3LEXB 2ADFH 4NQSA 3ARDD 3BGFB 3IJYB 1T03H 1NAMH 3M45A 5HDBE 1KOAA 4M03A 3EFFA 4OLWL 5DO2D 4PRIE 1NGQH 2A9NH 1D3CA 3BD5A 4O4YL 3VRIA 5KVFH 2DI9A 5EOQH 1NH6A 2M2DA 4ZNEA 4Y4HB 1CXHA 4P57B 5BVPL 2ARJB 4Y16C 4P5MA 5D5MB 1TZGL 1GC1L 2BNRE 2O5ZL 5C0NC 3ULVL 5DSCB 1BQSA 1XGTA 1AR2A 4F15C 2J4WH 5C09D 2FCBA 3CU1A 3DVGB 3KJ4B 4WTZG 3QFJD 2NNAB 3PXHA 5DMGD 1Z5LA 2YPKA 3U46A 3CMOL 3SO3B 4MCZB 3BP4A 1EJOH 4PPTA 3MJ9H 3OGCA 1E27A 3GMLB 1VHPA 2ENYA 3MRJB 4ZXBC 1N59A 1EZVY 3RZCB 2IH1B 4HUNB 4BH7A 3FFDB 4PRHD 2EH8L 1KCSL 4CRPA 2ADIA 4KXZH 3JBG7 4QY8A 4R7NB 1I3GH 3QUMH 3WS3A 2CO7B 4N8CL 2R0ZL 4WU7B 3C5ZA 5E6IB 5HI3D 4NZTH 4I2XB 1T6WA 2UWEE 3SDAA 3GBMH 3HZVB 5C08E 3V5HA 3ARED 3SJVB 5EIIA 4WO4C 4W6YB 1CFSA 3LKNA 3O8XD 1X9QA 3ARZA 3FQNB 4OLUH 5DJ2A 1U3HC 4OD3L 3FJTA 3DRTB 4ODTL 1W72H 4CVZB 4OLXH 1QLEL 1D5ZA 4NNYB 4OCWH 2C4FU 2BSTB 1U91B 2CIIA 2OXHA 1NCBL 4JVUA 4YHKL 1KLUB 2APWA 1LO4L 2APBA 2DS4A 4W4OA 4QHUB 3VXNB 1U8LB 2A73A 1NSNL 4RGMB 3I9GH 1TMCB 1DQDL 3NCFB 4KGJA 4P9ML 2ITCA 3I9GL 3N1FC 5B3JE 1TPXB 3QJFB 4Y4KC 2YSSB 3FB6A 2PO6C 3RVTC 1J8KA 3GIVA 4HCRA 3MRIA 5KTEH 2O61A 3UO1H 1D6VH 4M7ZC 1RUPL 2NZ9D 4JFDB 4V2CB 4Y16A 5GGTA 1P4IH 3KDMB 4YGAB 2ZUSA 4X98B 5DGQA 3T0EA 2VLJB 4H88L 5J0BA 4EUPA 3ZDZF 1RUMH 3WD5H 1EO7A 1HNGA 4ZPVB 4NYLA 1LEIA 1M05B 4PJGA 1IGIL 4ZUSB 2L4OA 5A40E 3IFOB 2MWCA 5T3XH 4XVTL 3QIUC 1MWAA 1N5AA 1G6RB 1IGJB 4LSQH 1T7WA 2X1QA 1M7XA 5CHNB 1KIRA 4PREB 4TOYH 5MEOB 5IMLA 1DJSA 4GFTB 3JTTA 4U2ZA 3UYRL 2IBZX 3IKCA 1S7QA 4YDIL 3SPVB 4PS4H 2ZUXA 5B3JF 3ARBB 5JORA 1MCEA 5H37H 5FK9B 2Z93B 1CT8B 4PBXA 5I18H 3MUZ1 3WLWD 5KW9L 4UT7L 2Z31D 1EVUA 2A74A 2ZCLH 4KRPB 1GVIA 4NZUH 4XNQB 2Q87A 2FX7L 4H8WC 5C1MB 4X7SL 3VMOA 1I3RB 3FQWA 5E2JA 3O9WC 3SDCC 4HHAA 3L5WA 1VKXB 4G9DA 3EZJB 1IKNA 3SGEI 1AXTH 4JM2B 1E4XL 5E4EB 5CJOH 1AXSB 1W72L 3INUL 2DLIA 1CICB 1K8DA 3UMTA 1HXMA 2J88L 4YWGH 1KLFA 4N8VB 5CBAA 4O2EA 1AHWA 3HZYA 1IBGH 4XNXH 2QL1A 3TIDB 2YZ8A 2IG2L 4BUHA 1AFVL 4MNGA 5EDXA 2CO6B 2X4TA 4WWKD 4WFEE 1QO3B 1IAIM 4DEPC 2RHEA 4V1DA 2FJHA 5D1XC 1RIHH 3H9HB 3QYCA 4KQ3L 5IBLC 5H94A 1F3RB 1FL5B 2DQEL 1CFQB 5GGSA 4BSWB 1KB5A 3DV4B 4JKMA 3CFCH 2BFVL 4L8BA 3IAPA 3UP1A 3VXOA 4K9EH 3ALPA 3LKOB 1DBMH 1DANU 3HPJB 1D5XB 2CLRB 2LABA 5F9OL 3UAJC 1G6RA 3ALWA 3QDGD 3V4UL 2VDLH 4H5SB 1BEYH 3VDCA 1KYOJ 3RIFF 1NFKA 4CADB 4L8SA 3V6ZA 2XN9E 1JWSA 3S9DB 4WFGE 2VLRB 2ZPKH 5B4MD 3A67L 5DHVA 3K2UH 4UI2A 2AK4E 4U6HA 1ZGLA 4NRZB 2FO1A 3SO3C 4DN3H 1CXFA 2OCFD 1EHAA 1HOCA 4IJ3C 3ZL4H 4OTXL 2DBLL 3D0LB 3OHXB 2AJSH 3OQ3B 3FN9A 4Y4FD 3WS3B 2GK0A 5CKGA 5ABDE 4F58L 15C8L 1J0IA 2XTJE 1M6OA 3RVWC 1JPFA 3SE3A 3I75A 3KPLB 5MEQB 2A77L 3RVUC 1QPPA 1XR8B 4MJ5A 3MXVL 4KDWA 5CEZL 1JPGA 4ORZC 1YA5A 3JV4B 3RA7L 5C0JB 1V8HA 1RZIA 3U79A 4XPBH 4ODHL 3GBNL 3QIWD 2E27H 4O00A 4GMSH 3BT2L 5J1TC 2ITCB 3ARVA 1OTTC 2VXQL 5HYSG 3NGBC 3BZ4B 3DX7B 1J1OH 3VRLE 3KPRB 4YGVB 1MJ8H 5BQ7A 2E8ZA 4MQ7B 5KVMC 2I27N 5CJQH 4AH2B 4P2RE 4U0RB 4JZJB 3THML 1T0MA 3MV9D 2CLVA 2R69H 1WAAA 3QCTL 5JW4N 2ADIB 1F42A 4D0DB 1G7QB 4WUUD 1T80A 2VL4A 5DVOA 5HHME 2YA1A 3D39E 5AUMA 2R1WB 3HRPA 4YR6B 5D93C 4W6XB 2PO6B 1BLNB 3MV8D 4MCYB 1MHEA 4H88H 4HWUA 4JPVH 4Y5XC 5EBMB 1V7NH 2DD8H 3QO0B 1U8KA 3D39B 1Q9KA 1B0RB 1EZVX 5B8CA 5J9PA 4F7EB 4WCYL 1FVCA 1IGIH 1WAAE 4TNVK 1KJVB 2Z8WC 4QY8B 4R7NA 1ACZA 3QXWA 2BOCB 3PL6A 2Q3ZA 4LQFH 4P0DA 4NCDA 4OZIF 1T20B 1MNUL 1AGCB 2XQBH 1M7DA 1KB9J 4R26L 3RI5K 1MFAH 2CDGB 3EJYC 3DXAB 4R4ND 5AUMB 3WMSA 5DJ6A 1PKQE 3HG1B 5IK3B 1SVZA 2AAVA 5DRXA 3QIWA 3UTTA 3GJFB 1P7QB 5EOCL 4MB3A 1PQZA 4NN6B 5T1DL 3KPOB 8CGTA 5I71B 5IB2B 4R97C 3VWJD 5C0GB 4KI5E 1IM3B 2MKLC 5KVDH 3MLUL 4HJ0C 4YIQA 1RVFL 5IIEA 4GMTL 1BP3B 3B9KD 5I8OL 3O2WL 1HNFA 1CLOH 25C8H 4PBWD 4ZO6A 2H3NB 2IALA 1AGBA 4PRPE 5FYJL 1JF5A 3OKOA 3ROOB 3BP7B 3HI1A 2F5AL 4IMKA 1CF8L 3HRZB 5IHUL 2V2XB 2ATPA 5CCKH 2FJHB 3G6JB 1F6AB 2R0KH 3TJEL 3WNOA 3WLBB 3BGMA 4PB0H 4KJWD 4XP4H 5T1MB 4P2CG 1I9IH 3ZE1F 2NLJA 4X4ZA 4TTGA 1NCNA 4ELMA 1CLZH 4L3CB 1R5IB 1XF3B 2DQJH 1F58H 4L8BB 1F2XK 3WYRA 5I8EB 4Y5VC 3BQUC 1FHGA 4QTHA 4JFXA 5HD8C 1I1YA 3SDCA 4Z76A 5ACZA 4G8GA 1J1OL 3N50A 3LV3A 1SM3H 3P4MB 1CE1L 1HH9A 3RKDC 1T04B 5F1NB 3VA6A 2JK5A 1WV7T 4HZLA 2EEDA 3G9VA 3RL1A 3ZTJG 1TCRB 3THMH 1H9VA 5F3HA 1N5YL 3DMMA 3GSQA 4XCFL 2DI7A 3X11A 1MREL 5D6CB 3SJVE 5B21A 2Y4SA 3HZKB 1AHWB 2DWDA 4WHYG 3WL9A 4BK5A 5AYUL 4XWGH 1T3FA 4JM2F 2F54B 5GHWL 1NGWB 1WT5A 3S36L 5D7JD 3RDTD 3QULA 5AYUH 5KW9H 5C6WH 4NUJA 3MC0A 4KZDH 5L6YL 5JLZA 1AXSA 4PGCA 3D2UD 2EDXA 1U8JB 5JDSB 1FYTE 3IU4H 4EJ1C 4WRLA 5KOVC 4PJHE 5D2LF 2DWDB 3LRSA 1RHHB 5IHZA 1YEFL 1DQJA 2HRLA 1KEMH 4G8FB 1P5VA 1FNGA 3QXDA 3IFOA 5J3HC 1AC6A 3DMMB 1X3DA 1UXSA 5D7JB 4I77H 3VW3L 1JGUL 2EIZA 2R2CA 3L1OH 1YUHB 3TJHC 2NR6C 1L7TL 1DBBH 4G7YL 3BDYL 1DTUA 1L7TH 4GH7B 5JNYA 1V5JA 4AIXA 3QUML 2EIBA 2VDNH 2AJYH 3JXAA 2GFBA 4G3YH 2X4RA 1QTYT 1EFXD 2BNRD 4Y7MA 1JNLH 1RUPH 1AXIB 5EBMA 3CMOH 4NO0B 4JFPB 3WIIH 3NIFE 3FB8B 1WBXB 3QFJE 4QHNA 2R2BA 3HRZA 2HT4C 4DGVL 3GMQA 4K3HA 4WDIB 1NFDA 4MAYB 1A3LH 2F15A 1DUZA 2CXKA 3MQIA 4NOBA 2VWEE 1UXWA 4R7DB 5C0CA 5IP4A 1D6EA 1T66D 2BP3A 3RWEA 1MAKA 4LRNL 3QUYC 5A2LH 4HIXL 3B4NA 3GKWH 2J7LA 3LKRB 4FXGB 1NCAL 4AIZA 1TZHB 4U1HB 4G8IB 3MREA 4LIQH 2AXGB 2KKQA 3UEZA 4CW1B 1J88A 3MR9A 4XH2B 4PJ5E 1VADB 3MLVH 4NKMA 1QVOB 3BAEH 3DXAA 3BO8A 3CFJA 5C0IA 1VFAB 2AJXL 1KCSH 2Y7QB 4Y16B 4KUZL 1IILE 3S3SA 1LO0H 2PETA 2HG5A 3C09C 4QT5B 2DQFB 1QBLL 5C07D 5I1KL 5EO0A 3WNMA 4PB0L 3ES6A 1F13A 2YK1H 4UDTB 1FL3A 4NSKA 4ZXBB 1EUUA 1G9NL 5KSAD 4JFZL 4HBCL 4G80A 1MHEB 2WUBH 5E8DL 5ITBL 5MI0B 3CVHH 4DKDC 1BLNA 1QLFA 3AMLA 3ET9F 3EO1B 4NRYB 1YY9C 3AREB 1L6ZA 1S7RB 4O51A 3BE1H 3BKYH 2VRAA 1VB9A 1BGXH 3LPGA 4HXBH 5TFSH 3UBXB 5DD3L 4PJHB 1ONQB 4YXLH 3KYNA 3VWJA 1EEUA 5D2NC 4PRBA 4N8PA 4YX2L 5L0QC 2G75A 3MV9B 5D5MA 2BX5A 4OGAD 2ZKHL 4Q9RL 3T0DA 5I1CL 2HVKA 5C0AB 5CILH 1T2XA 4ZXBD 1Q0YL 5IVXB 3MRKB 4RRPG 5TE7L 1GZQA 3QHFL 1N2RA 2NY4D 4QXTA 3RU8L 2F8XC 4FQLL 1KIQA 2EDJA 3W0WE 1J86A 3GO1L 3JSSA 5EO1A 1XR8A 4YBHA 3V6FA 2YZ1A 1ZLSL 4KJYA 3RX7A 5F21B 3BDBA 1B2WL 2V5SA 4R4FL 2WNGA 1DLFL 1X44A 4WW1A 3U7AA 4RX4D 1CR9H 4OZFH 4HFUL 3MLSH 2VUOA 2R2EA 4XNMA 3GUTA 5C0EB 8FABB 3NIDE 3TN0C 3MNZA 5I15H 1NBYB 4Y19A 1BZ7B 5ANME 1KPRA 3IS1X 4RA3A 1FORL 1MCBA 2Y9RT 1YMME 3P0YL 5FGCB 2FD6L 1SMAA 4ZUTA 3LD8B 3KYKH 4PJGE 4HT1L 4R8WL 3K7UA 1OPGH 3ZE1E 2RAMA 4QRUB 1LP9E 3HC3H 2AKRA 3LEVH 1FNGB 4KJPD 35C8L 4Y4FC 4Y4HC 3K8KA 2EEAA 3RY6A 3BKJH 3CSGA 1C08A 4H8WH 3L95A 3CIQA 3D18A 2OR9H 5JIIA 1J0ZA 1KB9K 1KEGH 2X9XA 1MFCL 5ILTL 3JWOC 2AV7B 4KK6D 2Y5EA 2NY5H 3F12B 3VGHA 1LO4H 4APQA 4KAQH 1NKRA 3CFEB 2PYEE 4OF0A 3ZKXC 4I2XE 4LSPH 3D18B 3LSOB 4U6YA 2QSVA 4LHJB 3TWCH 3QNZA 2V2WB 4JREC 2X4PA 4NDMB 5H94B 3LKPA 3IU3A 3L3OB 4Z7UE 4RAUB 3VGAC 4MWFB 1T1XA 5HDQH 3L3IB 1TZGH 4OLEA 3H3BC 4LSUH 1JMZA 3FFCB 4JFZH 5ITBH 4GBXB 3T77A 5KG9A 5I30L 1GGBL 2DYPD 3OKDA 4JM2D 3Q3GB 3QUZD 1AP2A 4PGZA 2J5LC 3MLXL 3VG9B 5D1QB 2VABA 4NC1E 5DD0H 4ETQA 5LKNA 3V0AC 5KBNC 4LSSL 2XI9A 4WV1B 5SV3A 1ZE3C 3V4UH 1XZ0A 1MIML 3U0PA 2DDQL 3W9EA 1UWXK 5KVDL 1A0QL 1EBPA 2CIIB 4PS4L 3QUYB 2AK1L 5M94B 3L7FB 1AO7D 5IEKA 1H3TA 1RIVL 1S9WA 5J12C 1OPGL 3O3EA 4KTYA 5D1XA 2P8MA 1P9MC 2X4QB 4CNIA 3LHPL 3D3VD 4Y2OA 3W0WA 3AMKA 4RFNB 4ZQKB 2UV3A 5E1AA 1ZV5A 5HGDB 3QEGL 1MFNA 1UC6A 4LSRH 2ICEA 2EIEA 4Z8FH 3D85B 2PYFA 1OD7A 1BMGA 3HMWH 3LAFA 3EO0B 1FL6B 3G5XB 1IC7L 4PJHA 1XF5B 1GGCH 2NW3B 1D6VL 2DOCA 3F7PC 1M05A 1HHJA 5AZEH 3RA7H 5EZLA 1MFDL 4HPOL 2WAHA 3GMMB 5B39A 1X5LA 4G6ML 5DRZB 4JDVB 1VERA 2Y72A 3MRGB 3QZWB 1D9KC 1FZJA 5DQ9A 2DD8L 3NCMA 2AGJH 4J3SA 5I1DA 4PRDA 5C6PB 1FP5A 4KK5C 1PG7H 3UTSD 1KT2A 4M7LT 3WDIA 3H7LA 4S1RL 4X5XB 1UH4A 5TDOB 4K8RC 4ELMF 1FCCA 3TIEA 2PYFB 3HTLX 1S7XB 4CU6A 5J9PB 1L4IA 2A6DB 1NANH 2EKSB 1B4JH 2VJXA 4OCXH 4XTRD 2C4FT 5F7FA 3MACL 4OFDA 2EICA 5CSZA 4U31A 1JRHH 4YHNB 3GFUA 4H1LG 1J1PL 3EOYG 3GSUB 3CH8A 3V6ZB 3ULUL 4P2OC 4QRTB 4XP6L 3RBSA 2QHRL 4D3CL 1A9BA 4RWYL 2VDLL 3EFDH 4EIGB 1U6AH 5EPMB 1P4BL 2CRYA 2QHRH 2I9LA 4AT6B 2CUMA 4S1QL 2GJJA 3KAAA 4YHYB 4GXUM 1I7TA 1AJ7L 4NN7B 1IGFL 2Q76A 4G9FB 2FEEI 3V95A 1WITA 3GGWA 5BOZG 4JR9H 4PIRF 1KEGL 3MFGB 2KDGA 1AQKL 1C7SA 3IFPB 5JNYB 4P2RB 2DIBA 4UDUA 15C8H 4NJ9H 4LK4A 4IIQC 5LAXA 3RGVB 4RGNB 2VR4A 2A77H 1RZGA 2GTWB 1HE7A 3FOLA 3QBTB 4NQEB 1QFWI 4HUWB 3MBEC 4PJBB 2NY3B 1OP5K 4HIJA 1HH9B 1SY6H 2PF6A 1DUYA 4U1JA 5HXMA 4WGVB 1K4DB 5I1LB 4JGMA 2PCPA 4JY5L 3JV5A 3C5ZD 1CVSC 1UWEH 3R4DA 4MXVE 1GGTA 1F02I 3FO2B 3AXLB 5FF6B 1BGXL 1S9YB 4LLYB 3VXUD 2GUOB 4XPFL 3T2PA 2KH2B 3GSOA 2ZUYA 3GSWB 3WS6A 4FQCH 1A1OA 5CLWA 1M71B 2R4SH 1U8HB 4CADA 1JNNL 1F6AA 5FUOH 4G9FE 4PJFB 1VPOH 1EEYA 2OQJA 1WSST 3D5OF 3IU3B 4DOHE 2H32B 3S37H 4RISH 5HVFB 1DBML 3MJ7A 3QDJE 5DUBB 4OQ1A 3QHFH 1Q9LA 3OXSB 5I2IB 2A6IA 1VGKA 5MEPB 1B0GB 2XZAH 1KPRB 4XMKL 1TTFA 1AI1L 2J8UA 4TRPL 2G2RA 5CGYC 2HKFL 3S35H 4M7LH 3SDDD 3FT4B 1S9YA 4LLYA 5I30H 1INDL 1JHKH 3UZVB 1HI6A 4N5UA 4J8RB 1EO5A 3QZWG 1VGEH 2EYTA 4FQ1H 2QQLH 3NFPA 1MELA 1X4ZA 4LLQA 4Q0XH 1N5AB 3RTQB 1YPZE 1CXEA 5L88L 3P9MA 3QNXB 4H25B 3KGRA 1X6LA 2YMXL 3WXVL 2AEQL 2KQMA 3ZYOA 2XQBL 4YFEA 3OF6D 3SCMD 1FFQA 4YHOL 5T5NG 3U6RB 5I75C 4X7EC 3B9KC 5HHOE 1UCBH 3BQUB 2Q6WB 2YUVA 3RTQA 2FHFA 1T0PB 4WHDA 4BQ6A 3FL7A 1U3HD 1TVBB 2BOBA 3GDBA 4Q9QL 2ERJC 1GZQB 5HTSA 3QSKB 2EECA 4AEIL 4LCIL 2OL3B 4UILL 4IOFD 4R96A 1NUFA 3BKJL 3O2DA 2FWOA 2PKDA 3VXUB 5TQ0L 2VIRA 3T8XB 4NQCB 1AQDB 4Y5YA 5FKAA 3G6JA 3DETC 3KPSE 3UZQA 5GGRB 2BCKA 5FO7A 4M62L 1NL0L 1N7MH 1EAPA 5CIPA 4POZD 5C08B 5DJ8A 3V5DB 2P5WE 1M7DB 5JMRA 4NO3B 1DQQB 1BZ7A 2NX5D 4F8TA 1YEHH 3IB4A 3SDAB 4PRPA 3KWWA 4M6NL 1P4IL 1WT5C 3KPOA 1IAIL 1IGTA 5KTEL 2J2ZA 4U0RC 4KV5F 5ADOL 4KDTC 4KMQA 1VFBA 2XNAB 2FLRT 3OG6B 4G42B 4P49A 2X40A 2P5EA 2V9RA 4JAMA 2HT3D 4X9HA 3IXAA 4FQIL 4MDJB 1RZKH 1XIWA 3HE6D 1TJIH 1YMHB 5C6TL 4R0LB 5HHNA 5GS0H 1CE6A 2NY6D 2VXUL 4NKIL 3N85H 2K9UA 1VADA 4FFWC 4HWZA 3O3UN 4WI5A 1QRNA 2HLAB 4OCWL 5EA0H 3WLWC 1IM9B 3EO0A 3ARBD 4F7MB 4V1DE 5J3HD 1U8LA 4ZNCD 4K71C 1QEWA 1TETL 1B0RA 4PTTA 2UY7A 5D7SH 1IGFH 5IJVA 1KGCD 2W38A 4Z0XB 5CINH 4EN3C 5IR1A 3BPOC 2NYYD 1WUNT 3IVKB 2W59A 3P4OA 3T65B 1A9BB 1CE6B 4ZFOA 4MXWL 2E6QA 4WI7A 1EGJH 4XVJL 3FB8A 4PY7B 4LF3B 2YD9A 3GJFH 4WWKA 3AFLA 1CBVH 5GZOC 2C3XA 3BMWA 1UKTA 1MI5E 5MENA 1RPQA 4JDTL 4Z7WA 1OAZH 4UTBL 2F5AH 5E6IA 1T1YB 1C7TA 4OM1H 2HT4D 4NHCL 1GPOH 2BSRB 1IGCH 4F3FB 3IF1A 4ZSOB 5D72L 2DM2A 5GGSB 3PP3K 5C0DB 2ZG1A 4M7KH 1MRCL 4AEIH 4GAGL 1AKJA 4C4KO 2LVEA 1OP5H 2GJZA 3IDJB 1SBSH 5CP3H 3LOWA 3NCYP 4N0FA 3VRJA 2YPLB 3FB5B 3SKOA 2AJUH 1LGVA 2B0SH 1G7LA 4JPKH 4BSVA 1A5FL 2OBGA 3GMRA 3EDJA 4V2BA 2BVTA 3V52H 1N3NB 2JIXB 4CU7A 1UCTA 4AK1A 2JKXA 3V0WL 1ZGLM 4H1LH 4QF1A 3CAFA 1KN4L 2JJSC 3WUWB 4OLZL 3U0WL 1FNAA 3EFFB 1S7WB 1EFQA 2BJMH 4U1MA 4FMKA 4GAFB 4YDLC 5D7SL 4IMKC 4KI1A 4U3XA 1TETH 2FJGA 4P48A 2BSSA 2YOCA 1BAFL 2EDBA 2AP2A 4JFPA 3RVWD 1UYWH 2OSLA 3RBGA 1JPSH 1T04A 1WEJH 2Y5TB 4MXVF 3P30H 4GRLC 1A1OB 3P4LA 4KKBC 4ZAKA 4I0PA 4GW4B 3R0MA 1ZAGA 3ZT6A 4KVNL 4GXVH 5ESVA 3E6FB 4G3YL 3WEXA 4JFEE 1OGTA 2PW2A 1FL5A 4M61B 4NPYB 2CKBA 2B4CL 1U3JA 1C16B 3W39B 3QT2A 5C7XH 3S5LG 1FVEB 2MQ3A 2RJMA 2RCSL 2CMRH 4U0QB 5IMOA 4X6CF 4JY5H 5F71A 3IXTB 5C7XL 4I5BB 5CD5C 2IPTH 1I1CA 2A6IB 1KLGA 5EOTA 4EQ3A 4X4YA 4BZ1H 1FLTX 3VI4F 2QKIA 1XF2A 4HKXA 4X83A 2OQJB 4G8FA 5C0CE 5IWLA 4IDLA 2WK2A 3E3QC 1IAOB 5LXGH 3CLEL 2NY4C 3BIBX 1OAYH 4G6JH 3H9SD 5I1AB 3ZKMC 1S7WA 4GOSA 4DFIA 5IVXA 3WNNA 1CDHA 1IGYB 2W0KA 1A5FH 2EDWA 3ZE2F 5LG1A 2XN9B 3GBLA 5I1LA 3GSNL 4NQDE 3BN9D 4O2FB 1PSKL 5DEFA 3T0BA 3BP5B 2LTQB 2UWEB 1FGVL 4QRTA 3T1FB 1TVDA 2X4OB 1K5NA 2DLFH 4NRYA 1JPST 1WZKA 1PKQB 2DQDL 2GTWA 2WM0A 3B2VH 5KSBB 1AGCA 4N8VG 4JPIB 2N7AA 1T5XB 4PRID 5AWNH 4YBLB 5C0EA 3QUKB 4HIIA 2JIXA 5C0RH 1T1WA 4OCLC 1U2CA 1RFDH 2NY2C 3C5ZB 3LPFA 3UTQA 5T1LD 4N9OB 5K93A 2BY2A 1OL0A 1DQTA 4ZPTB 3BEWB 3CUPB 2ILLA 3GSXA 3HMXH 5J11C 1NLBH 4PJ5A 1ZSDB 3QDJD 2C7UA 2YRZA 3I3BA 4Z7UB 3R8QA 1KFAH 1FSKC 3ECBA 4HFWB 4P9HL 4OB5L 5BS0E 3OJVC 2HA1A 1JGEA 4XH2A 1I9RH 2XY2A 3WJJA 1WAAF 3H7BA 1K9TA 1K2DB 4XP5H 5ISZE 3BSZH 4EUPH 5BVPH 3SJVA 3OZ9L 4KJQC 4GMTH 1ND0B 1RZJL 1GHFH 3E2HB 3VG0H 5T5FL 4B7LA 1KELL 3MLWL 5FYKD 5MENB 4OJFL 5GJSH 2A6KB 3E0GA 4O4YH 4ODXB 3N9GL 5FCUL 2F58L 4ZD3H 2MQ0A 2JB5H 5TDOA 1NQBA 2BSTA 5BO1L 3OKLA 1N64L 3MCLL 4FFVC 5KJRL 3FMGH 3MBXL 4WWID 4PJ9D 3WFHB 3T65A 4YDJB 1A9EB 3N1GC 3MNWB 5D5MF 1DVFD 1R3JA 1BQHA 1Z0MA 3V79C 1HYSC 2C3WA 3D1MC 5IJVB 3VFSA 5DF0A 3GSXB 5JO5A 3KPRA 1A2YA 2IBBA 2I9TA 1LK3L 2AS5M 4WU7A 1IM9A 5GS0L 3FQXA 5E9DB 1T21A 4TUOB 4AM0B 2BY1A 4E42B 4IRJD 3MJ8B 1BVKB 4OV5B 5T3ZL 4P2YA 5I15L 3CFBB 3ILQD 4OKVA 3LKSA 5I8CA 1NUNB 4YDVA 3DECA 2V5RA 4M3KB 5KVGL 5C0RL 4Q58C 5CGYD 1GH7A 4XPAH 2VLKA 3HNVL 4YR6A 3T3PF 3S5LA 4ODBD 1XGQA 4FNLL 3KPNA 5I17A 3CD4A 3NACL 3QRFM 4CW1A 2IPUK 1X5FA 1DQJB 4TYUA 1U41A 4MA1C 3D85A 3O4LD 2PYEB 4QRQB 1R3IH 2NY5L 3RQ3A 1OW0C 2AXFA 4GLRH 4JHZA 4M5YH 2Q7NA 4Y4KB 5HHPA 1T7VA 2AXHA 1FIEA 1EFXA 1BQUA 2BNRA 3ZDZE 1OHQA 4BSWA 1VACA 3LEXA 5I1KH 2Y1VA 3MOQA 1C08B 1T83C 4LKCA 3L5IA 1U8PB 3X11B 1FAKT 4UV7H 1Y6NR 5DJZB 1S9VA 4ZTOH 1G9MH 3IDMB 5DT1H 2NY7H 5LGHL 1F6FB 5E2TH 4OF5A 3VFTA 4AENA 1CVRA 4KY1H 3VFUA 3O11B 5ESQB 5MEQA 2Y06L 4XCFH 1YEKH 4JG1H 1A1NB 1XEDA 5J13C 1JHKL 1DFBH 4P2OD 4WW2A 4S11A 3DHMA 3IGAA 1PX3A 2VDOH 1T0NA 2ZJSL 5F9WC 1JUFB 4Q6IB 3DO7B 3L3HB 3OR7A 2DYPB 1H8SA 4ZOEA 5IQ9A 2UZXB 3TZVD 4JM2A 2GY7B 2PXYD 4PD4K 4S1DC 1U8OB 5DYOB 1WVZA 4KRPC 2VN7A 4ALAH 2EDLA 3QWOA 2OSLB 3MNVB 3GKZA 5D7JA 3N9GH 3PJSB 5F3BA 4MS8D 3VD4A 2AEPL 4WI6A 2VAAA 1TIUA 5DJZA 3P9MB 1RIVH 3QNXA 3SKNA 3N1PC 2FECI 2WWMC 4BQ9A 1UM6L 4YO0A 1KFAL 4FS0A 4N90E 4TRPH 5TPWH 4OT1H 3CCHB 4KHXL 4OM0H 4MA8L 4MXWH 4DN4H 1A7RH 1E4XI 4Y5VA 3VXSB 3T3MF 3OXRB 5EUKB 3PQYB 1QOKA 2HMID 4X7CC 5EBLB 3MV7A 3VFPB 1DLHB 1NCDH 2LQRA 3P40A 1FH5L 4YO0B 4JO2H 2ZG2A 5DD3H 1IAOA 2FGWL 2HH0L 4CL7A 2VLLB 1E4WL 1KPUB 4KTDL 4HKXB 2D03H 1KTKE 4XP1H 3FCTB 3SKOB 2NY2B 3C5ZC 2AJVL 3DUSA 1MFEL 5T33H 1FDLL 3MNVA 1FG2B 1QNZL 3G04A 1I7UA 1IEBA 3T0EB 4LPUA 2FX9L 1PY4A 4H20L 3L3GB 3ARRA 4TUKL 2DYPA 4X7FC 2CD0A 3ESUF 4KDTA 1YY9D 1EXUA 2QTEA 1HEZA 3VGBA 1CLCA 4XCNA 4YEFA 5K59F 1IGJA 4HBCH 4KY1L 4NOFA 4XP5L 2GQHA 2R1YA 1B6UA 4BSJA 3U0TB 1P7HL 4MJ6A 3GMOA 3OKYA 1UB6A 1NMAL 3QDMB 1U8KB 3D39A 4LLVA 3VWKD 4OQTL 5CJXC 4JFQB 1C1EL 5AZ2L 4PJ9A 5GS2D 4RAVB 4ODTH 2GY5A 4NN7C 1CTNA 2R1WA 1CT8A 1OB1B 5E5MB 2C3GA 1SMOA 4RA0C 3MR9B 1OT1A 1UFUA 1BX2A 3BISA 3W2DH 4HDIA 3H9YA 4RQQA 4DEPB 4PJAE 1UB5A 3NZHH 4NZJA 3NCJL 3U83A 1KB5L 1OF2A 4P46B 4MB4A 1MQKL 4XRCA 2BNUA 1ED3B 1MCSA 1YEEH 3TO4B 3GJFA 4ONGL 4PP2B 4FZ8L 1D5MB 1B6DA 4PJGB 1X5HA 1SJHB 4E41A 5C09E 1YZZA 3RWIA 4Y5YC 3GMQB 3MV11 3NCEB 5SWQA 3JV4A 3KDMA 2C7UB 2E27L 4N90D 4Z7UA 5CSZB 4KUCD 4WY7L 2ITDA 4G80B 4JKPH 2ZOLB 1P5UA 4PJXF 3K8MA 4WY7H 4I2XA 3JUYA 1WFOA 5IFAH 1MHCA 1GAFL 3O3DB 1S7XA 4NJAH 2QHLA 2Z0BA 3EBAA 2BVOB 1FORH 5LXGL 4P57A 4LAQH 4NKOA 4CGTA 3AVEA 5FUCE 1ITCA 1IFHH 2X9WA 3ARXA 5KOMC 4HJJL 3SHSA 1R3JB 3W0WB 2X4UB 5KSBA 3BWAB 1U91A 3FHQA 4PRAB 4L9LA 4K07A 4KKAC 2XQYK 2ZUUA 4C56E 3D2UB 4Z8FL 1Y0LB 1XF5A 1L0QA 2N1KA 4K71B 2HN7A 1JPSL 5FA4B 3PHQB 4G8IA 1CZ8H 5IHZB 2QQKL 3QIUB 2HT3C 3QEQD 3RNQA 1DL7L 3NIDF 1R5VA 5DQJB 3HE6C 1BIHA 3F7QA 3K8LA 4KKNA 1YMMB 4HG4K 1OOAA 2H8PB 3QUMB 5I9QB 4AY0A 1TFHA 3V6BR 1G84A 4NNPL 2V17H 4FQ2L 1K8IA 3FQRB 3UXFA 4BK4A 2BY0A 5F3BB 1A6ZB 4X6EA 3ZHKA 2V6HA 1OY3B 4NUGL 1H5BC 1N5YH 3MYZA 4NO5A 3RNKA 1H3WM 4EN3D 3SDCB 5FYKE 1MHHA 2VDMH 3L9RA 1ZHNB 1A14L 1Y6KR 1C5CL 2FR4A 2JJWA 3KJ6H 4Z5RB 3UJTL 3KYOA 4QO1A 4UT6H 5ILTH 4BQBA 1UVQA 3L3DA 3PWUA 1BECA 1KULA 3VXSA 5I6XC 1RHFA 1B4RA 4IHOB 4S0TD 4XC1L 4YXKH 1CDJA 3W5MA 2Q1EA 5ESQA 3JTSB 2GK2A 2IANA 4L8SB 3L3IA 5IHUH 3CFDB 1IAMA 2VLJD 3DUSB 4JGUA 1MFCH 4IOIA 3N0PB 4H5SA 2NW2A 1U8PA 4M9PA 4Y19E 5ANMA 3DVNB 32C2B 4KAQL 1Q1JL 4YNYA 5FK9A 4ZTPH 1YQ2A 2EZ0D 2XRAL 3EHBD 5C0CD 5C2BL 4M1CC 5DWUH 1JFQL 4EDXB 1NCCL 4V1DD 1A8JH 5ENWB 2OYPA 4YAQB 1CXKA 1MI5D 4UMGA 4Y5VB 3I6GA 3IETB 3WHE0 1VESA 3BUYA 2DN7A 3KYOB 4JFEA 4PP1D 2PUQT 3S3PA 4J1UA 2ID5A 3UTTB 2NXZC 3GSNB 4N0FB 4XMPH 1LD9A 4KQ3H 4KKCC 3MRPB 4TUJB 1YN6A 1KC5H 2ADJA 2RFXA 5IVZB 1QD0A 5D7KE 3P11L 1RZJC 4HH9B 3GBNH 2B1AH 3J8F7 4I18B 4DKFL 2BRQA 1AD0A 4J1UB 3I50H 3PWUB 1WF5A 1CWVA 5JXEA 2A6JA 3MPCA 3HAEB 5CEYB 3QIBD 2BOCA 5C0BB 4GRLA 3W81A 5ID1A 3V9FA 3GSVA 3HFMH 3IU4L 3P9LA 1KBGH 3I6GB 3JVGC 1SJEB 5IQ7H 2XT1B 3N85L 3N1QC 1HINH 2VXSL 3LQAH 3QEHB 1V7MH 1AXTL 3A6CH 5LWYL 1S78C 4ODSH 3WIHH 5DRXB 1KJ2L 5E56A 5EU6E 1T5WB 1DSFH 4PLOB 3OKOB 3ROOA 3CSYA 3W0WD 4X7DC 5JORB 1FN4B 1NDMB 5DJYB 3KPRD 4G8GE 1N2RB 3TNMB 4G6JL 4UNVA 1KXTB 2XKNB 2YBRB 5GZND 1MIEL 3V4VL 3VG0L 4BFGA 1I8MA 3BP6A 1OAXH 3BKCH 4PJCF 2IQ9L 5EIQA 2D7TL 5GIRB 4PJFE 3KR3H 4W68A 1OSPL 4R90H 5CJ5A 5AAWA 1A2YB 3WHE1 5SX5K 1PYWB 4H1LA 1J05B 3HC4L 3ZKMD 3SGDI 4BH7B 1Y18B 5HHNB 3EO1A 4OGZA 4PV8B 2Q8AL 4CN6A 1N0XH 4GKNB 5ERWA 1W72B 4R2GD 1WIPA 4PLKC 3T0AA 1OTSC 1WK0A 4UDTA 2COQA 4GQPH 5HYQA 2Q20A 5F70A 5D4QA 5SWZA 4HIXH 1C5DB 5DJ0B 3ZHLA 5GXBB 4FQCL 1UM6H 5F88A 5DRNA 3FN3A 4ENED 1CDGA 1J1XL 2NXYB 1IKFL 4HWEH 2AXJA 5CSBA 4YHOH 2ITDB 3LS4H 4P23B 4JKWA 1YPZB 4M7JL 2PO6A 5BXFB 4FQXD 2VLRA 4HUVB 4NNYA 1IEAA 4MVBD 4ZFOB 2UY6A 3MV8A 4PJXE 4Y4FB 1A6AA 3K1KC 1RUKL 3VE0B 1CFBA 1QSEE 1J0KA 2VQ1A 3RWHB 4J7RA 1T2QL 4XMKH 4RDQG 3PWJB 2E8YA 1V7ML 1I9RL 3CVHB 3VXRA 4NNXA 2NY1B 3PV6B 5CWSB 5GJTH 1INDH 4EI5C 3HLAA 1ZT7B 4NKOB 3BW9B 5DHVH 1HHIA 4YEEA 3SCMC 1RMFL 4XNZB 3ULVC 4F9PA 4JQXC 3DX7A 4DOHB 5FUZL 3P9LB 1G7JB 1WQVT 1G9EA 1CLOL 2F8OA 1UYWL 3RJDA 2NY5C 1QA9B 1HEZB 3ARDC 3HI5L 3LN4A 3HB3D 4LP4A 4PRDB 4CKVX 5IFAL 1BD2B 4HS3B 5C0BE 5D6DA 2IH1A 1C5BL 2VZ3A 1RI8A 5FYJU 5INDA 2HFGH 3KPRE 2VLRD 1HKLL 4NP4L 3Q6GL 5EOCH 1JCKA 2ED7A 5DS8B 4RNRB 5L2KA 4XAWH 3CFKB 3CX5K 4ODUB 3SGKA 2X4RB 4QXUH 4K7FA 5HPMA 2J3SA 3G6JE 2FH8A 4FFVD 2AABL 4TNWF 3HPJA 5L6YH 5E99H 2Y07H 5HGDA 1RIUL 3GMNA 4HK0A 4XC3L 5HI4D 5HDLA 4OZ4A 3GM0A 2R9HC 4XAKD 1Y6MR 2ZCKH 3DV4A 1JGVH 2X4OA 1TZIA 4ZTOL 4OZFB 4CVWA 3C6LA 3S8WA 5E9DD 5CD3B 1ZVSA 4J4PA 1R3HA 1HKFA 3H2WA 4XVSL 4WHTA 5FCSH 3TT3H 3GHEH 4U1NA 4LSTL 3PGCA 4UV4H 3IDUA 3K1DA 1X4XA 5DMGC 4Y5XB 3SQOH 5C09B 5E8NA 5FO9A 5C07E 1MEXH 3KS0J 4I3SH 1U8QA 2W0FB 1SQ2N 3AXLA 5F97E 5BV7H 3FRUB 2R2EB 1KB5B 1RZKL 3G08A 5F6HI 1DBJL 4P4RB 4RWHA 3KYKL 2BDNL 4BSVB 1JL8A 3GBML 4QHLA 3H9HA 4RMTA 3RY5A 4LSQL 4RRPA 2ZNWA 1ZVHA 5ICYB 4HK3N 4JPWL 4PD4J 3FRPA 3IDYB 1UENA 3NH7H 4P3DA 4HJJH 2EC8A 3D39D 1NCUA 3GRWL 2AI0H 5IF0A 3NCBB 2YHGA 5HPOA 5FGSA 5GS0D 3BSZL 3WS6C 2R15A 1YECL 5F9OH 1W8OA 4LEOA 1CF8H 5H2BB 1MLCB 1PG7L 4RMRA 2OZ4H 1MCIA 3I6KA 1A4KB 1NBVH 2IMMA 4QGTA 1DQDH 1N6QL 1RZ8B 1JZ4A 4XVJH 1VGKB 5MEPA 4OQTH 4U1NB 3RGHA 3DO3A 1X5AA 5J11B 2WBJA 1T4KB 1ONQA 1H3GA 2JCCB 4LVEA 2BHUA 3TN0B 4F2MA 1ZA6B 3QWRA 1U42A 2KQNA 2JB5L 3S34H 1KCUH 4K23L 1UZ6E 1XGRB 1JNHA 4PREA 3UBXI 1BM3L 2ENSA 4YUEL 5ICZA 1NAKL 1XF4B 2BHZA 2R0WL 3TIEB 1G0YR 2VO5A 1PQZB 1GZPA 1SBSL 5GSVB 2WWMD 5DDHB 5CZKA 2VDML 4F7EA 3HG1A 1M7IB 4A6YH 1NUGA 1FGNH 4E5XB 2DQHH 4X99B 3S97C 2OL3L 1OW0A 4LSVL 3TYGH 3D69A 5TE4L 1WFUA 2VAJA 1J18A 1R5WA 2IJ0C 3DV6A 2HJLA 2W1NA 3BZFA 5EN2A 1AGFB 1PAMA 4PJCE 5FEBA 2GJ6D 5E5UB 4E41B 5HYJE 2CKBL 4P2RA 4UDUB 5D70L 3HZMB 1ADQA 4HT1H 4R8WH 2R0LH 3MO1A 3FQXB 1LE5A 3TO4A 5HHPB 4U1HA 2QV2A 4JY4B 4L3EB 1JYVA 2CK2A 4ODXA 4XPTL 2CPCA 1TQBC 4ZG1A 2B5IB 1MCWM 1TVHA 1TQCB 1RJZB 4E0RA 4BZ2L 2ARWA 2I9LB 3MO1B 4AT6A 3VGDA 1UJ3B 2A9ML 2IFFH 2A2QT 5SWSE 1E28B 3U4AA 3EYFA 2V9TA 1MCOH 1A6AB 3DROA 4KTDH 2AV1B 3FFDA 4TTDC 3CDGB 5C86A 1CGSH 3VXPA 3HC0A 2HRPL 3CH1B 4U2YA 3O3BA 2CRIA 4JFHE 1KJ2A 2P4AB 3OAUH 4MB5A 3QEHA 4R4FH 2ORBH 5IOPB 1CL7H 4YK4C 3WIIL 2F54E 4ZOCA 3H8NA 1ZEAL 4L3EA 4LAQL 1CL7I 3HUJB 4K3GA 2P46B 3BJLA 5KZCD 3ZKSD 4NHUA 3R06A 1ZEAH 2YKLL 1D5BA 2PN5A 2MCPL 2N7BA 4Y2DA 5EU6D 4BZ1L 1MVUA 3MA7B 1YEDB 3KLHD 1QKZL 3GIZH 4JZOB 4JHBA 3AS2A 3TBSA 5FDYA 4ISVB 4J4PD 4W6WB 1EEZA 5HYSA 4PJIB 1U3ZA 1SJHA 3O2DL 4DKFH 2VQUA 2EEBA 3UAJD 3WE6A 3H9SB 5JR1H 1G7HA 3O2DH 4KK8C 3M8OL 1FL6A 3OKMB 2OZ4A 2EDYA 1CR9L 3SGJC 5L7XH 2ZPKL 4XX1G 3C60D 2LVCA 4MSWB 3FN0L 2OXGA 2VTFA 1K3ZA 2HVJA 2HTKC 4XCEA 3HAEG 3S35X 5C0FA 1U8MA 5GISL 4LRIC 4X6CE 3WFBL 1J5OH 1Q9LB 1FVDA 3C8DA 4JKLA 4AMKL 4GRMB 4WNQA 4G9FD 1LK2A 4ZTPL 4LFHG 1FIGL 4HZLB 4X6FB 5CGMA 1QBBA 3QWOB 4OZHE 5TF1L 3SE8H 4K3DH 1GRWA 1QLEH 1SJEA 3Q2CA 4IHOA 2FYYA 2VDQL 4OZ4B 5EZOH 4HIEA 5GS1C 4OFYA 4RBPH 1HHKA 3SGKC 1KBGL 1H3XA 4CVXB 3KXFE 1DQLL 4YXLL 1QLRB 3MROA 1EX0A 3NACH 1HH6B 4IS6B 3FZUD 3O41A 2D31A 5BRZB 3VI3F 3CJJA 3PGCB 3NCYS 5ICYA 5F7NC 1YMMD 5CD3A 2BERA 5DMKB 1HH6A 4LLQB 1OQXA 3MRFA 4RX4A 1LP9A 1A64A 1FRGH 1O7SA 4RMQA 3ROLA 3PG2A 4X5LA 1VEOA 3S37L 4P4KA 3ZO0A 4PGJA 3UTPD 1UM4L 3BGAA 4YXHH 1YMMA 2NY6B 3SE4C 2NY3C 3BPNC 2BZDA 2JB6B 3P0VL 3BGFC 4WUUB 3CDCA 2XWJB 3JWOL 3QI9C 4K94H 43CAB 5CCKL 2J5LB 1Q9WA 1W8NA 2X1XR 4HHAB 5I0ZA 1CI5A 4C56A 3FONA 1MIMH 5TDNB 1MWAH 3CFKA 1CFNA 3EDFA 2R23A 4JANA 4G7YH 3HCVA 5ADOH 3S96B 3BHBA 1F4XL 5IHLB 2BNQA 4JFYB 2XV6B 2CUIA 3MCKA 3GI8L 2M8XA 2VZVA 4PJEF 4PJBA 4ENEC 2P45B 1KYOK 5BOPA 5IG7B 5K9QI 3QRGL 5D7IF 1C16A 3O8XC 2P5WD 1P53A 5FFLA 3B2VL 3VGEA 1RK1A 4R4NC 4C83B 1UA6H 3D0VB 2LE9A 1QACA 5HHVL 4LNVA 1S5IH 1FNEB 4WI4A 4ZNEE 4QRPE 3HR5A 4QRRD 3PNWB 1YEIH 5CAYB 4LVNC 2VDQH 2GIYA 4NN5C 3GI9L 3L5JA 1ZT4B 1HILB 5D5ME 1SBBA 2VDKL 2NQCA 4HJ0D 3BH8A 3PDOA 2YWYA 4GRMA 5D2LA 1NBZA 4N0RA 5DJCB 3VFVA 1D7FA 3QG7H 1CFTB 2OTWB 3GSRA 3PWVA 2IALB 5I1IL 5AYQA 4DAGL 1BFOA 2V7NA 2VL5B 3R06B 2F53D 3MRKA 1A1MB 5I9QC 2P43B 1K85A 4EXKA 4M6NH 5IB4B 5IKCA 3VCLA 4HKZA 1A7OL 4OGYL 2H45A 3LB6D 2AXFB 1XCTB 3OZ9H 1YEJL 5FHBH 5BMFH 5JHDE 3L1OL 1C5DA 1CGTA 1JGVL 2QSCH 1H15B 5JXED 1XAUA 1E6OH 2HLAA 5EZOL 2CIKA 2VLJE 1FJ1A 1KJ2H 5GGRY 1UACL 4NZDA 1N59B 3BH8B 3PDOB 4JRYA 5EG6C 2R9HD 3TM6A 2IQAA 4TVPH 2PXYC 5I8CB 3BESR 4Q97A 3CFBA 1MREH 4X4XA 2W92A 4ETQB 2HJFB 1ZLWH 4MS8C 2DM3A 4CBPA 4L8SC 2GFBB 5JIPA 1MUJB 4M1DH 4LCCC 3L3KB 3PDGA 1X5ZA 3Q3GA 5J4MA 3NFNB 1WC7B 2YXFA 4M6OL 5F7DB 3X14A 3SDCD 5DHYB 2GTZA 2APTA 1L0XA 1KJ2B 2IWGA 3SDAC 1TITA 3VFGH 1DQQA 1T03L 2P8MB 3QFDA 3RUGB 2HMIC 5ALCL 5CBEB 3T1FA 1IC5H 4IM8A 4JFYA 5DK0B 3EYFB 5DQDH 4PJDB 3CU7A 4RAUA 2WBJB 3QUYA 5BRZD 1EO8L 3E8UH 1F2QA 2IAND 5EOQL 1UT9A 4ZUWB 1H5BB 1F4XH 2XTJC 4JFEB 2HKFH 3S35L 4M7LL 4P2QE 4RFNC 4MQ7A 3AY4A 5KVEL 3OXRA 3I02A 4MHHI 3AU1A 4F37K 3AAZA 2D0HA 1OGAB 3CPLB 4DVRL 3TPKA 3UC0H 4YHML 2MJWA 3DMMD 2GAZB 2NY1C 4NFDA 3C8KB 5DD6A 3TNNB 1YYMH 1IC4H 1BBJB 5ECJE 1CXIA 1YN7B 5IMMB 4U6XB 3QR2A 5BS0A 5DYOA 2DTSA 5FYKU 1FGNL 4G8GB 1A4KA 1ZWIA 4I9WE 4JO3L 3T3ME 4ONGH 4X6CB 3QDJB 5INCA 3GIZL 2EC9U 2WIIA 3KLAB 3CX5J 4DFHA 1PLGH 5FYLH 3FAXA 4NC0B 3F12A 2D0GA 4RZCB 4OF6A 1ERNA 4YAQA 1JP5A 3O4LA 4MJIB 1S5HA 4MAYD 3MMEA 4HKJA 4EZMA 4RFOL 4LIQL 2X42A 5CZXD 3L7EA 4EIZC 1J8HB 1U8IA 4DUVA 5I2IA 1RK0B 4OZHF 5DK2A 3U1SH 5E2WL 2X2YA 2EE9A 3DVNA 5DEFB 4PJ5D 3WDJA 1YPZF 3L3OA 4PTUA 3BZDA 1R3KB 4XCYA 4JO1L 1G7MB 1NCBH 1AQKH 2F74A 3DRQB 3U30C 4CN4A 4RGND 2DRUA 3G08B 1BOYA 4PG2C 4YDKL 3SPVA 3CZFA 5LCVL 5A2JH 2DWEA 5LWYH 3CFEA 5SX4H 4AMKH 4DAGH 5DFTA 4FFZH 4WUUA 4NUJB 1JZ8A 4JRXE 4OD1H 4OF3A 3ZKND 3BKML 3O8XA 1QSFE 3FQUA 3QHZH 4OAWB 3MLZL 3BWUC 3RHWF 1RSFA 2NTFB 3BDXA 3VI4E 1VFOA 5E8OB 3MFFB 4I48A 1G7LB 4FABH 3U6RA 3UBXA 3SKUD 4GW5B 5HBBA 1SY6A 3FO9A 4MX7A 2E9JA 4KJYB 5E70A 3PJSA 5EOTB 2WUCL 4YHLH 1QO3A 4EUPB 4ONFH 4L3AA 5JOEA 2VDNL 2QSQA 3LN9A 4Z0BH 5HI4C 4HMDA 1MRCH 4H25A 1FDLH 1RZGB 1MPAL 1U92B 1A7QH 2X4UA 5E6ZA 4OKVB 1YDPB 5JMOC 3OKKA 3IF1B 5F7EH 5MHSD 2IPKA 2APFA 3V5KA 3E3QE 4XHJC 1ZLVK 1BVLA 4TSCH 3ALXA 4X6DB 4PJEE 1CDUA 4K7PX 3B6SA 5DWUL 1JFQH 3O3BB 4OTXH 5EU3A 3QPXH 3IDMA 4UNTA 5DD6B 3TNNA 5E9DE 3JWOH 4K94L 4FZ8H 3RGVA 1N64H 4PJEB 2IPUG 1AR1D 5KAQF 3A67H 3VDAA 3MYJA 1JYXA 1JJUA 1EFXB 2BNRB 1AGEA 3HMWL 3BMVA 1MQKH 3K80A 3ARDB 2DL2A 5JA8B 5IMLB 5DQDL 43C9B 2RR3A 3GZKA 2ICCA 3KLHC 1IE5A 2CKNA 3EJYD 5F7LB 2C3HA 1KACB 4FQHA 1SYVB 2YD4A 1DE4B 5EU6A 3DIFA 4O9HH 2YUXA 4N0UA 2JJUA 3ME0A 2C1OA 4Y4HD 5AG9A 1AGDA 3HKFA 3ZDXF 1K2DA 2W0PA 2XFXB 5JW4M 1IAKB 4M1DL 1I9JL 3EGSB 3C60C 3LQZA 5C6TH 3KHOA 4XXCA 3BPOB 2YD3A 3EYOA 4M8VA 2VLKB 5F1KC 2DKMA 1MCFA 3TN0D 1CGVA 1VFAA 4JFDA 5TQ0H 3V0VA 4LARH 3TBVB 2QQNL 2R4RL 3ISWA 4KMLB 5DFWH 4K9EL 2FJFA 5DUMH 1OAZL 4UTBH 3STBA 4HJGA 4JLRA 5FHAL 1M6OB 1GGIL 1P1ZB 2MHAA 1ZLUH 5ADPH 5D8JL 3WIFA 2MKWA 3TV3H 3PABB 4DKEH 3MV7D 4XNUL 3WDHA 1X7QA 3MRQA 3BDYH 2W91A 4UIMB 4I8DA 4MXQC 4Y1AB 4XNXL 2OJZL 3U9UB 4ZMAT 4ZQKA 4UU9A 4R97B 5F1OB 3CH1A 4RQQB 3L5XL 4NQDA 3O6FD 3V5DA 4HXAL 1CZ8L 4JM2C 1OAXL 4OGYH 3RWHA 5CIPB 5GGUA 2GKIA 3QUZC 5HGBB 4K3EL 1FBIH 4PP1C 5K9QG 3KR3L 2XWTA 4OBRA 3KPMB 2OI9C 1TQBB 2K1MA 1RZFL 4PJ7F 4N0UB 1HINL 2VXSH 1PKOA 1T0MB 1D5XA 3IKKA 4KKLC 3RKDD 3QCVH 5IEHA 1H8OA 3RWEB 1YNLL 2YPLE 4AG4H 2YKLH 4F7MA 3EUUA 2JB6A 5LCVH 3HNSH 3G6DL 4LNRA 5T1KB 1OARL 4P2OA 5HYQB 3WFBH 5BVJA 1RULL 1S7SB 3TO4D 2LU4A 2GITA 5IROC 2OTWA 3PWVB 3GSRB 5JDJA 3BIKB 3ARGD 1A7BA 2J6EA 3CXDH 4K7PL 4YFLI 4LQFL 4MD0A 3D6GA 4JDVA 5F3HB 4HGWB 4JFQA 2RQ8A 1I4FB 3P0YH 1OM3H 4FZEH 4JRWA 5I16B 2D31B 4WV1A 1N6VA 1DN0A 2XACC 5HGHA 2EDQA 3QWRD 3RL2A 2DKSA 5CMAB 4YPGA 5D1QA 3S36X 3BVNB 3LZFL 2GCYB 4L5FH 1WBYA 2IBGA 3O6MH 4C57C 4MJ4A 4C83A 4NKQB 3WCYA 5EUKA 2B4CH 1WCQA 3H3PH 3EYQD 2HTLC 1SEQL 2VOTA 5BW7C 5JW3L 2X4QA 4CVUA 3ZZ1A 2GSGA 4GAJH 2WLYA 5DUBA 1CICD 1RZKC 2P7TA 2ATPB 4N1CA 4ODVH 4IMLB 4L8CB 4PRNA 3RU8H 1CQKA 1WEJL 4NDMA 3NPSC 4LKCB 3LSOA 3A6BH 4PY8J 1CFVL 2EDRA 2OM5A 5HYJB 3FQTB 3PGFL 4JJ5A 5DEZA 3MMEB 4HKJB 5TFSL 4ZYKB 1T1ZB 1SYSB 1HIMH 1FBIL 4RZCA 2AV7A 2ORBL 2V7HA 1JGDA 3PWPE 5JPMA 1JTOA 2R8SL 3D3VA 1L7IL 4FFYL 4LDEB 2WIIB 3ZKQD 3NMEA 4YE4H 1P69B 2B0SL 4MA1B 4OCSH 2IH3B 1G7MA 4Z95L 4I18A 3DBXB 4W81A 4NO5B 5C3TA 1GXEA 1DN0B 4ZUSA 4X4MA 1TCRA 4O02L 3MUGA 3NGBB 5ESAB 4QRRA 2Y36L 3S5LB 3L7EB 1B3JA 5E8EA 2R0WH 3KHQA 1PLGL 4K3DL 3ZE0F 4PRHA 4FP8L 2GITB 3MLYL 3FFCD 2HFEA 2YD2A 4P23D 3MOBH 1ES0A 4E42A 4MNQB 2KL6A 1XCQB 1FNFA 1OGAA 4JFFD 4Z7OE 1ZLVH 1NGZA 4LCCB 3NAAL 4L4JA 4C59B 4GW4A 1AJ7H 2VERN 4X7SH 3TCXA 2H9GB 4WU5A 5C09A 4Z7WB 25C8L 1O7VA 4I0CC 4WEBL 5I66A 3HLAB 3FQWB 2KZ1B 3B9VA 3MUHL 5L9DH 4O9HL 5KVEH 1P7QA 3FOMA 5JXAH 2AQ1A 3VXPB 1WFTA 1A6UL 2AKRB 4NQDD 5EU4B 1XMWA 5D7LD 3BD4A 4OI7A 3E8UL 3MRNA 3M1BA 4LCWE 4HG4J 2Q8BL 3AC0A 2GSGB 3B9DA 4OFPA 1I1RA 1S7UA 1ZT1A 4X6BA 3VXMA 4UQ3A 5IIEB 1S9XB 4Y4KA 2G5BB 2J12B 5EWIH 3UBXG 5A3IC 1LEGB 4DVBB 5C9JA 1WLHA 4L4TA 3SE4A 4ONFL 3E2HC 3GMRB 3K74B 5DC4B 2D9CA 1UWEL 1IT9H 4TSBH 3VXUE 3MV9E 2VXUH 1TTGA 4KI5C 4PJDA 3VRJB 5DVKA 5I17B 5EZIH 3HR6A 4WI3A 4Z6AT 3UPRA 5EUOF 1L7IH 1N8ZA 4FFYH 4IDJH 4L29A 1IC5L 4LDLB 2GJ6E 4N5ED 1INEL 2O61B 4PR5B 2RB8A 4LLUA 2BVPA 1FL3B 4NSKB 2VH5L 2OK0L 5I8KL 4QHKI 2JTDA 5ALBH 4NHUB 1YNTA 2NY1D 5EZJA 1LVEA 3H3KA 1UA6L 5A16B 1BOGB 3JV0A 4F37F 5JIKA 1L0YA 3RNQB 5H8DA 4X4XB 2GT9B 3GNMH 2ZOLA 5CWSA 4YC2C 3KJ6L 1XGRA 5D7LA 2OTPA 1KXQE 1JWSB 1ZOXA 1SEQH 4DQOL 3ELAT 4D0DA 1YY8A 3U30B 5DTFA 4DQOH 2P42B 4POUB 5FO8B 4D9QD 4DUWA 4L9DA 5I74B 3T3PE 1A7NH 7FABL 1OSZB 2ED8A 4Y1AE 4TVSa 4KZDL 3ARWA 4M7KL 3VFOA 1A02N 4L4VA 4NGHH 1BOGA 2BVOA 4MDIB 3OKEB 1QRNB 3MLYH 4FP8H 4GRWF 2IBZY 4GBXD 2B2XH 5GS0C 4IRSB 2UWEF 4QT5A 1RZIB 1NBZB 3HI5H 1V3KA 3MRJA 1BFVL 1XF2B 4XVUD 2K7QA 4PJ9B 4OLYL 5IM7B 3PWNB 3ZKNC 4KUCF 5HVHB 3QAZC 2BC4B 1NSNH 3U82B 3HA0A 4U7SA 5E00B 2E9WA 2VISB 2X4TB 3S96A 3H0TB 3T4YA 2ESVD 1MFDH 4HPOH 5IVNA 4XC3H 3QNYA 3V7MA 2Q3AA 4F80A 1OAQH 1JWMA 4OLVL 1ED3A 4RAHA 4XPGH 3MJ9A 1XF4A 5LGJA 1JYNA 5HSFA 1KNOB 1AI1H 1MHPL 5J6HA 1UB5B 3UTSA 5J1AB 1MCQA 5F9WB 5DLML 3UC0L 4CNIB 3D87B 3TNMA 3LKQB 1CIDA 3VFGL 1FG2A 1I3RA 2ICWJ 4YHIA 1IC4L 4NQSB 1P7KB 2BNQB 3PF2A 2VDRL 1CCZA 4KFZC 3T08A 2DTML 5JOFA 4L8CA 1ROWA 3MFFA 1OP9A 3HAEH 4I48B 5K9OB 5HI3C 1RULH 1KLGB 3GJEA 4FXLA 2Q86B 4ZO9A 4D9RD 4OKDA 3K2MC 1HXYB 1T83A 3LMJL 1UB6B 4M5ZL 4S1SL 1AO7B 5GGVH 5ACZB 3U0TA 2CK0H 2GUOA 1UKQA 3VD3A 1KNOA 5H2BA 5J6HB 4KXZI 4O2EB 4XNMB 3GUTB 1I8KA 5ID1B 1J10A 2NY6C 2DWEB 4XC1H 1DLFH 3ROLB 3AY4C 1CICA 5CJXA 2AJUL 5ITFB 2XZZA 1QHPA 4JFED 4PTUB 4RNRA 3BJ91 3X13B 2G9HA 4MD5A 4QHMA 1OGAE 1NAMB 3WXWH 4OD2B 2X4SB 3MODL 3OMZA 1AD9A 1EMTL 3QQ3A 4QRRB 5ESAA 5AEAA 2PTTB 4LSPL 4JFHD 4XNYL 1S9VB 2UZYB 4G6FB 1FPTL 3MRIB 3K4DA 4JFFE 5MERB 4P9MH 1Q0YH 2H3NA 1FYTB 1EBAA 3LKQA 3O8XB 1PY9A 1U8NA 2NZ9C 1JZ2A 3Q5OA 1IRAY 3HI6H 3WHXA 3IJHA 3NZ8B 1CXLA 4EVNB 3DURA 5E8PA 4U1GC 3T0ED 2PYEA 3CX2A 2JJSA 5IB2A 2HRPH 4LPVA 4RGOL 1IAIH 3IDIB 4K3EH 3MLVL 2D4DA 2YR3A 1YEHL 2YA0A 4LGPB 5I6XB 4F7PA 3F7VA 2R56L 1VACB 2VXTL 4PJIE 1J8HA 4WUKH 2EDFA 1HZHL 3S6CA 2E9IA 2VLJA 4YPJA 1AKJB 3UPCA 3EOAA 4JG0L 3VRLF 3HN3A 4KZEH 4MA3B 4LMQI 5GISH 1P2CB 3MRMB 5TJWK 4JFXB 4LIQE 4XVTH 5CZXC 2D2OA 2FATL 1WC7A 1JUFA 2R0ZH 1EA9C 2CXGA 4Z5RA 1MUJA 4C4KT 1H5BA 2FL5B 3KPQA 4DZBA 5F72S 5EA0L 4L3CA 5A16A 5I1HH 1G7HB 2ZSWA 3RPIA 2IAMD 3CMGA 2UZIH 4XPGL 4NRXA 1ZANH 1S9KC 1KJMB 3LQMA 2WBJC 4FQLH 5DJ6B 1NEZG 1MCCA 5DK0A 2NX5A 4N0CC 4F9LA 2GJZB 3IDJA 4HGMA 2XTJB 3OGCB 4ZUUA 1OM3L 5C92A 4L29B 4Y89A 4MDJA 3PL6C 4D9RE 4UAOC 3TCLA 3BX7C 4G8GD 1XR9A 3F6LA 3WFHA 4Y19D 3P3YA 1QR4A 4MHHG 1NEUA 2GW5A 4NQED 4U6TA 4PRHE 3SGDH 4JB9L 1MRFH 4P2OB 1FC1A 4LSRL 3SGEH 3GGWB 4F33B 1MFEH 5D96B 3EYUL 3MBED 2B7DT 1QEWB 5C9JB 4F57L 3BP6B 4L4VD 2XG4A 5TGBB 4HXAH 2AJ3B 4Z18A 5GGTL 2DL9A 2XPGB 1IBGL 4CVZA 5BZDA 2IMNA 4PJBE 3Q48A 5F96L 3CVIL 1CU4L 1MCOL 3EYQC 2ZUQC 5T5FH 1QSVA 3IJSA 4S2SA 5ID0B 3FZUC 3CSBA 3RGVC 3B2UD 3W9DA 3FO1A 5I66B 4ZXBA 1DVFA 1TXKA 1V05A 4NRXB 4WHYH 1F4WL 3V8CA 2E7BA 4IRZH 2EDHA 5DJ0A 3N06B 3TP4A 1E4KA 5EO0B 4LSSH 3RWGB 1ES0B 1AR1C 1KN2H 2V7NB 4S1RH 4WO4B 2KPNA 3FO1B 3KG5A 4R2GB 1MHPH 4U7KA 2O5ZH 5DQ9B 1AIFA 5C3LD 1VENA 3T09A 4PV9B 1KIPA 3G5VB 1Q9OA 3EGSA