4XNQA

Antibody hemagglutinin complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
b'YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 47
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqA01
4F7MB 2ERJB 1A7OL 5JHDA 1XIWB 3MO1B 4Q58C 2YUXA 2IH1A 1OM3H 4GO6B 2XZZA 3QZWG 2KH2B 4PBVC 4DKFH 1UM4L 1FH5L 2CLRA 4HIIB 2DMKA 3KDMA 2AV7A 1DANU 4D0BB 2H32H 4ELKB 5D7KE 5HGAB 3ECBB 4LCYA 5IF0B 3TP4A 4I5BB 1OP3H 3EOAB 1SYSA 1AGFA 2XACC 4HS3A 1ZT1B 4QRRE 5D2NB 2XZAL 4NQXB 4GSDL 4MMZC 4CVXA 4OGAD 1XIWD 4KQ4L 2NW3A 2W92A 3UYRH 1KPRB 1MIML 3ULSA 4DUVA 5F71A 1IAMA 2FB4H 5L9DH 1RQ5A 3GJFK 4K3HA 1GGYA 4NUGL 6FABH 1J10A 3C5ZC 2WIIA 5LBSL 2WUCL 1NEZB 5DLMH 2QHRL 4NO0A 4Z5RB 1EZVX 4NC0B 3TT3H 5E2UL 5T5FH 1J8HA 4Z0BL 3QZWA 4U1SB 5DMKA 4CMHB 3E8UL 1IC7L 3MV7A 3W39A 4JRWA 3RJDA 1JRHL 4NC2B 3JTSA 5J12C 1C5DB 3HLAA 4TN9A 1Q94B 3ZE0F 4O51A 3VFRA 4BH8B 4MJ6A 5EA0L 1CD1B 2YWZA 2EC9T 3BKYH 4AM0A 1NMBH 4PJ9B 1P4BH 2VZUA 3WKNA 3ZKQD 3BZ4A 5J1AB 4XNQB 4QCIB 4J8RA 1DEEB 3QCVL 4G6KH 2IC2A 4PLKD 2IG2L 4MVBC 2EYRA 2DQTH 3QNZB 3PWJA 5F7MC 1D5IH 1D5ZB 3WFHB 4YGVB 5E2WL 2F8VA 2FD6L 1OW0A 3HUJB 4D3CH 3QDAA 4OIAA 1E27B 4MJIA 4OLUH 5BQ7A 3BHBA 5L7XH 3CU7A 4PJ9D 1CGUA 1CG9A 1KJ2A 4HMCA 1JHTA 5B39B 3IJSA 1BF2A 3FQRA 1ORSA 1UWGH 5LQBL 1NFDF 4DTGH 4R96A 5BVPH 3EJJX 2R2HB 3RL1B 1NCAL 1UWXH 1TQCC 4R4BA 2ICCA 2AK4E 3NZ8A 2LE9A 4POZC 1TJHL 3EJYD 1E4KC 5D5MB 4E41B 3I50H 3FB8A 2P8PA 3T0BA 4H20H 2VDPH 2IQ9L 4PJDB 3LQAL 4R97C 3AMKA 3B2UC 4HWBA 4X7TB 3D3VE 2CO7B 3ZTNH 4QOKA 2GTWA 5C09A 3PL6C 2I9TB 2D2OA 4PJEE 2AEQH 3QRGH 5C6TH 4OD1H 5KOVC 4X6CE 1RZKL 2XWTB 1MJ7L 4MXQD 4K94H 1N6QH 3ZE1E 3QIUA 1A4KB 4E41D 3N06B 3KJ4C 5DVMA 4I3RL 1UQSA 1RMFL 2EEBA 1U3YA 4JO3H 3BAEH 3S6CA 1YZZA 2XZCH 3JSSA 3QFDB 1Q0XL 4JFFA 5EFIB 1IE5A 1UKSA 3K81A 3RA7H 5TDPA 4D9LH 3TPUA 1T1WB 4FFWC 2VDLL 2FATL 4PJHA 3D87B 3G5ZA 2APXA 4RDQF 4AH2B 5HYJE 5BZDA 5DK0A 2H2SC 1S5IL 4HIXH 2DQIL 3C08H 4FQ1H 4XH2A 1AQKL 3HPLB 1N8ZB 1TVDA 2F5AH 4XP5L 5IB5A 2PO6B 4H88L 5ESQA 3KYOB 1ZHKA 4IMLA 2OYPA 4YDJB 5EU4A 3K2UL 4Y5VC 2X4OB 5EU5A 5C0FA 1HIML 2NZ9C 3QG7H 4HUXA 5SWQB 4TSBH 4PTUB 1IAII 2R39A 3G04A 1AC6A 1A6AA 2F58H 1RZJC 1VGEH 2APVA 2YC1B 4CMMB 1ADQH 3MR9B 4JLRA 2VWEC 3SDXE 2GFBB 2YD6A 1UB6A 5CFHA 4U6HA 5DD5H 4LF3B 2OTUA 2PO6D 4JPVH 4UI2A 3MFGB 2DAVA 2DQDL 3UTTB 1V7NH 2F54B 3C5JB 5EOTA 1CE6A 1X5LA 4UQ3A 1RJZA 1GGBL 1JPSL 2PYEA 5KVFH 2DQUH 1WQVT 3HC0B 4JKWA 3U46B 2ZCKH 5IMKA 3SBWA 2Q76A 1NJ9A 2N56A 5GRZA 4E0RB 1JNNL 1PKQB 2OSLA 3PIQB 5JZ7D 1PLGH 1N3NA 4GAGL 3O2DL 3SDCC 3ULUD 1KIQB 5I6XB 1AXSB 4LSVH 4ZFOB 1G1CA 2K7PA 1U8MA 1MCHA 4JFED 2BY3A 2Y7QB 3EFFA 1LE5A 2QEJA 2ADIB 1FDLH 1LO0H 3S37X 1A7NH 2NQCA 3VMPA 3T3MF 4LHUB 3UTTD 2F54D 1KJ3L 3KYKH 2A6DA 3KPPA 8CGTA 4U4BA 3CIQA 3DURA 3D0LB 2JB6B 5MENA 5JQ6L 2OJZL 4L3CA 4ZNEE 5GSRB 2ADGA 2NY6B 4HMDA 5GRJL 4JKKA 5D96C 3MUY1 2BK8A 5DSCA 4Z8FH 1FNGB 5I1HL 1HI6A 4NRZB 3LPWA 3RWFA 3T65A 2VITB 1J05A 5AUMA 2IGFH 2F74A 3CH8A 2DDQH 1H0DB 4LHUD 4JGJA 4KRPC 4LBEB 4FXKA 1QD0A 5ALBL 4JRYE 3QPQD 4DEPB 5DJ0A 3H3PH 2EO9A 4L4TA 1HEZB 3P4OA 3S36L 1W72A 4OFIA 2F19H 3U1SL 4I9WD 5T3ZD 1P4LA 1ZHBB 2NY6D 1Y6NR 2OI9B 4Z9KB 3MRKA 1QFWH 5BS0E 3KS0H 4PJAB 5IEKA 4K3JL 4KZEL 2EDXA 3O81A 4K3EH 5CJOH 4K71C 1JGUL 2QQLH 4K8RH 5I2IB 3Q0HA 3ZKSD 2WWMD 3GUTA 3MV8B 3PGFL 2Y9RT 1RJYA 2HVKA 1XF3A 3EFDL 5KSAB 1NBVL 2FBJL 2EKJA 3BH9A 4GW1B 4XVJH 1NLDH 3FN9A 4O5LH 1H8NA 4LIQL 1FVEA 2W07A 1OCWL 1G0YR 3FQXA 3BYYA 4HWEH 2UYLB 1MY5A 3VXQB 3WV0A 1MPAH 3JTTA 3IDYC 3U9UB 5TF0A 4LLWA 1TNNA 1Q38A 4P2OC 4E5XB 3MV8D 4JY5H 4GRLC 1CLYL 2XNAB 3GHBL 1J8KA 3OQ3B 4DOHE 1GIGH 5KSAD 4HWUA 4EUPH 3STBA 2B1AH 3DMMA 1DQDH 1U8IA 3ILPA 4LEXL 1XGQA 2NY2B 1KN4L 3DUUB 3EYFA 1B4RA 3DRTA 4G8GB 5TH2B 1RIHH 4F58L 4U3XA 1RIVH 3FT2A 1TPXB 3HG1E 2GEEA 1K6QL 4L29A 5EUKB 3Q6FB 1TQBB 1ORQB 4KJYA 4KRLB 4XNXL 3T2QA 1A7PL 1QVOB 2DF3A 5CILH 3C8KA 3O2WL 3RTQB 2VOTA 5DFTA 3WYRA 2OS7A 4FQHB 4JFHE 2I25N 4JFXA 4K3DH 2GJ6B 3GIZL 5KW9L 3L5XL 1A1NB 2NY2D 1XAUA 1VKXA 4L8CA 1JE6A 4G8GD 4HKJA 4OZFH 4KUCD 4ZOAA 4ZD3L 5HDLA 1JHLL 4PRHB 1FGVH 5E8PA 3OJDA 3OKDA 1BMGA 5F93C 4AT6A 1KELH 3MACH 2AP2A 1MJUL 4CJ0A 3SKUD 2P24B 3JV4A 3QG6B 3RTQD 3VXSA 4NQSA 1VFBB 2WBJA 1KJMA 2H1PL 4Y7MA 2ORBH 3NACH 2A9ML 5C07B 2GJ6D 5EU3A 1A02N 4CVZB 4Z7WA 4JFDA 2NY0C 5EOCH 1WITA 3RVXC 3PV6A 4X0KB 3LS4L 3REVA 4KI5F 3CFIC 4KMTH 4AG4L 5JA8B 1T04B 3BP5A 4PRHD 3UBXG 5JXEA 4J3XA 2F15A 5I66A 3LQZA 5DQDL 1RUPH 1Q8MA 2VTFA 3QCTL 1LP9F 4M6MH 3TEUA 5EIIA 2QV2A 3GSXB 3B9KB 3MLPA 3S8WA 1MFEH 1PVHA 2NW2A 3QDMB 3DIFA 5D2NE 5CEZL 5C07D 3RU8L 4ZMAT 4F7PA 4EOWH 4TPRL 4K23L 1CTOA 2FIKB 4JZOB 3GSUB 2XG5A 3GSQA 3QXDB 4KKCD 4NHCL 4U1NA 3U0TA 4YBLC 1U8OB 3IDJA 2VUYA 3IFOB 1ZWIA 1JGEA 2YD7A 3MV11 3T4AA 2I60L 4EN3C 4IRZH 5FYKL 3WIIH 1JGLH 2BJMH 3OKEB 5MEQB 1YN6B 3B9KD 4UTBL 5AZEL 2ZPKL 1U6AH 3QDMD 4F15B 1BQHB 3LEYL 2A6JB 5E5MA 4EN3A 4JVWA 2FJGA 5L88H 3O3DA 3N1PC 4DN4H 3D39B 1BWMA 2ZCLL 1S8DB 3CDGB 3ARQA 5DHVA 1RVFL 3FZUD 5F9AC 2EE9A 3UBXA 4ODSH 4X5WA 1EUUA 3TNNB 1M1SA 1VACB 4Q6YA 3WMSA 4ETQA 3KPLA 5EN2B 5KAQG 2HKFH 2HTKD 5CUSL 3BKJL 3FQUA 4GRWH 4BFIB 4J4PD 2IANB 1HXMA 3RWEA 5GGVY 2YPLA 1BREA 4P2YA 4N9GB 5IP4A 1J0YA 4RRPG 1UXWB 1XH3A 1AGBA 2R69L 4LAJH 3PWUB 4RFOH 3D39D 3BRFA 1S7SB 4XNUL 1S78C 1AHWB 1NUFA 1REIA 3SKJH 3QEUB 3HNSL 3P77A 3STZB 4G80A 5I1EL 2OCFD 1XCQB 4OI7A 3MGTA 3ILQD 2B0SH 5MI0C 3HUJE 4TULL 4RFNC 3ARBB 3QJFB 1IGFL 3ARYA 4CAGA 1MCFA 1KF9B 2FECL 5FHBH 1ED3B 1IAOB 3RNKA 1DQQB 3PABB 2IAND 1YDPB 1PSKL 4HJGA 4MQXD 4JQXA 3OF6A 1YYMH 5F72S 4F57L 4XP4H 2RIKA 4YXHL 3MRGB 4UT7L 5J9PA 5BXFA 4K7FB 2DI7A 4GKSB 4CW1A 3IAGC 4P4KC 5ICXB 4QYOA 3D9AL 3QP3A 3FFCB 3SGKA 2DMCA 3L7EA 3V5HB 5L2KB 3PE9A 5C0DA 1A1OB 5D5ME 3MNVB 2EDQA 3O2VH 5FUCC 4E41E 2ZKHL 4NO3B 1R3KB 3ARBD 3V4UH 2X4TB 1FAIH 3PWLA 4PJDE 4A6YB 1E28B 3TO2B 3BRGC 2PYFB 4PJIA 1AP2B 3VMOA 2V2TA 1IGYB 4ONFH 1CF8L 2AJUH 3W0WB 4RRPA 4O2FA 3MLSL 3CVHA 1WSST 1I4FA 2BP3A 1TFHA 3I75A 4JFYB 4C59B 5ADOH 4P23A 4P57B 5GGTA 3D25B 3L5JA 5DT1H 4E42B 1C5BH 3FFCD 3VFOB 5L2KD 1RUKL 1KUMA 4G8EB 1IKFH 3RQ3A 2CR3A 4NSKB 4X98A 1FZKB 1BFSA 5E5RB 3F62A 2Z91A 5EORL 5DYOA 3MCLH 5E8NA 3W0WD 2FX7H 3HI6L 1KTLA 2D7TH 3DHMA 2DI9A 4P46A 5HYSA 3ETBF 5DHYB 3EOTH 3VD9A 4MS8D 5T3ZL 3F12B 3OAUL 2VDKH 4MDIB 1FG2A 3KPSA 5D1ZA 5DC4B 3RWDA 3E1F1 4WJ5A 3BZEA 1KNOA 1B88A 1V3JA 3U0PB 4MAUH 1TNMA 2EYSB 2YBRB 4YR6A 2GSIB 5I1JL 1KC5L 3GJFB 1AGDA 3BPCA 2HJKB 4M02A 2C1PB 3ZSSA 2R0LL 1LDPH 3CLFL 5ICZB 1D5BB 1NQBA 3RWHB 1PG7L 1OD9A 3ULUE 3KPOB 4O2CB 2YRPA 2DIJA 5EU7E 1T20A 2VH5L 3EHBD 4JFEE 4BFEA 3UMTA 3BPOC 3BMVA 4GH7B 4TUOA 4U31A 1FAKT 2VLMD 3P4NA 3SGJA 2F54E 3UTTE 2R23A 3TH4T 1MCPH 3F58L 1J0IA 3GMOA 1NBYA 4XNZB 3MRHA 3T0EA 3MLXL 2Z9TA 4R7DB 5E4EC 1GYAA 1PKQE 3SGEH 4CU7A 3WEXB 4F3FA 1KJ2H 4W70A 5C0RL 4HQQH 3NIFE 2XICA 3TVMB 3BDYL 1T1XA 4W4NA 5F8QC 1UM5L 4LNRB 4U6XB 2WLYA 4KDTA 5IBLD 3VFWA 3O6MH 3G5XB 1S7XB 2AQ3A 5DJ8A 2AK4A 2Y5TA 3MOQA 1KEML 4YBQC 2HMID 5F9JA 3LKPA 4HUUB 1DVFA 4PJBF 3UZVB 1CDHA 1CZ8H 1LK3H 1JTTA 5GSVB 1I8IB 2EKSA 5D1QB 3D3VA 4I9WE 5T3ZE 5DRWA 1ZV5A 2Q87A 4LGRB 1XF4B 2BNQA 3CFKB 2QHLA 4G7YL 4PJEA 2YZ8A 5I16A 1WBZA 4P5KB 5DEGB 5HGDA 4Z7OF 5E6IB 2JCCB 5GGQL 2VZVA 1I1YB 3RVWC 3IDGA 1FL6A 5FO8A 4LGPB 4ZFFB 4BQ6A 3EO1B 1I85C 4M3JA 1KFAL 3TO4B 2BSRA 2LV4A 1FO0B 4UMGA 3QBTB 4NZJA 1D9KA 5ILTL 1B0RB 1RURH 1NCBH 3EBAA 3FT3A 4BQCA 4JFOA 5D1QD 4YFLF 1X5IA 3U82B 4KTDL 1HYRC 1I85A 4O02H 2HN7B 3LH2L 5EBGA 4KKBD 5MP6H 4AL8H 2P43B 4PRNB 5LXGL 4PJAE 1II4E 2A77L 3UTQA 1E4WL 2MQ0A 2X4SA 4XBEL 4GW5A 4XXDA 5E6ID 3H0TA 4ODBD 4DKAA 1RI8A 1QBLL 5HYJA 3O3AA 2KPNA 3CC5B 3MV8E 4P5TC 4Z7VB 3TO4D 3TYGH 2RGSA 3HC4L 5EZLB 4F7TB 1G9NH 3N50A 3QB7C 1WT5C 2B5IB 1JPST 4OZIF 5FGRA 1ZA3B 4P5TA 5FDWB 5GZOD 5DS8A 1Y0LA 1WBXA 4NQVB 5GGUB 3O6LL 3VDCA 4PIRF 2VXQH 2QKIB 2DD8L 2AI0H 4QTIH 1L0YA 2QTEA 3G08A 3C6LC 5DJ6B 3P73B 1A6VH 4JN2B 1U2CA 4NN7B 1T0NA 1ZK9A 4NKOA 3MNWA 4U1IA 1A9EB 3SDXA 1IEHA 2FZ3B 1MLCB 1MHEA 1X4YA 4LLDB 3BGAA 3VE0B 1LP9B 1G6RA 4L9LC 1XR9B 4U2YA 1RZKC 3Q6GH 3RHWF 3SY0B 2LU7A 1I3GH 4Z7NF 4PRIA 3FCTB 4XTRD 2D31A 3TV3H 5BCAA 2FHFA 2Z0BA 1T7VA 2AW2A 1MJJB 3MREB 4TTGA 1H15A 1Q1JL 2EC8A 2BY0A 2J6EL 2NYYD 2IALA 1FNLA 5L0QC 3QUKA 5I19L 4OAWB 4XPFH 5CBEB 5IIEA 1B4JH 3MBXL 5AG8A 4KI5D 3GSNB 3QPXH 3BGMB 2A1WL 1CDYA 2VZ1A 3QUXB 2GJ6E 4FP8L 4R8WH 2PR4H 1CXHA 5H35A 3MJGX 3GMMB 5DO2D 1AXTH 4RGMC 4HK0B 1HILA 1Y18B 4Q9QL 4PRHE 3G5VB 3VFMA 4GT7A 3ROOA 4ZNEA 2HAZA 1F5WA 3OR7B 4KJWC 5DUML 2W0LA 1HSAB 4TVSa 1CFSB 1NC4B 1UCTA 3BE1L 1CICA 3QXUA 5F6HI 5C0AB 1FNSL 2ADFH 1TJIL 3AREA 3NPSC 5KVDL 2DIAA 3OJ2C 3QUXD 4LPWA 2R2BA 3HKFA 5C07E 4NC1E 4XCNA 3S96B 2X7LA 5C7XH 1TCRA 5DJXB 1V3MA 2HT3D 2H2PD 1HCFX 4X9BA 1NDMA 2X1XR 1CVRA 4KDVA 4QF1B 1RUML 4KK8C 4JY4B 3D2UA 3T2NH 1W72H 1G7JA 3MXWH 1WC7B 3KR3H 3BSZL 3WHE0 1NC4D 3KVQA 3SDAC 5C0AD 3DSFL 2VDQH 3ZDXF 3QDME 1LK2A 3CFBB 2G60H 1KLGA 1OLLA 3UDWC 1YNLL 1S9WA 3V5DA 1AE6H 2P5WB 4O4YL 1RY7B 2BVOB 2P42B 4OCWL 1J5OH 2GSGA 4WEMB 3L7FB 3MRNB 5AWNL 4G6JL 5AYUL 4TSAL 3K8MA 1HINH 3O2DA 1YN7B 2ICWA 3W2DH 5JNYB 2D03L 4HLZH 1DBJH 5ACLA 2XKNA 1K2DB 5EZOL 3BEWB 1FORH 3D69A 5DEFA 4BQ9A 4E9LA 1FVDB 1EUTA 5DMGD 1BQLH 3TIEA 3D39E 3RWGA 2P5WD 4ZO9A 4GMTL 3E6HA 5KTEL 1KCRH 1QR1B 3DTXA 1A6WL 4GRMB 5SX5K 4APQA 1BHGA 4RAVB 1S7WA 4WU5A 5C6WH 1N2RA 1NGXB 2VDOL 2NLJA 4N0UB 3ZDZF 2V2XB 1FFOB 3WLBA 5HHVH 3VXNB 2IANE 4FZ8H 5DK2B 4WGVB 1H3UA 1SJHB 4XNYL 2IQAA 4NJAH 1GHFH 4WV1B 5FM4A 5DFVD 1A14L 2L0DA 3MOAL 2DQFA 4TYUA 1MFNA 4WI5A 1J0ZA 1FIGL 2F5BL 1NAKH 5C0EA 4NRXB 1WWBX 1IC4H 3GIVA 5IK3B 1MH5B 4YLQT 4D0CB 1JIBA 3HMXL 5F9DC 2OK0H 1W0VA 1JNLH 3GEWB 3K0WA 2AKRB 2H6PA 2CUIA 4M00A 4M8QB 4WW2C 4HGWB 4X7DC 5J1SC 1XIWC 5JW4N 1SJXA 1N64L 4S1RH 5HDOA 3FFCE 1FFPA 5L2KE 3NFNB 1NEZG 4ZFGH 5CGMA 2OQJA 4WWID 4O2EB 4F7MA 1FC2D 1EAJA 5FO7B 4UDTB 1NH6A 2RB8A 4Z95H 3W0WE 2PCPB 2XY2A 5AEAA 3TCLB 3CLEH 4OCYH 1WEJH 2BVQA 2CXKA 4G3YH 4JHWL 2IWGA 4Y2DA 5GS2H 5D2NC 4D0BA 3NABL 3KYNB 5HGAA 5CCKL 5IF0A 5FKPA 4I5BA 4OI9A 3QHFL 3WD5H 1ZT1A 1F4XH 1JPFA 5DQ9A 2AXGB 1IMHC 2HLAA 1JYWA 3SDDC 1KPRA 3TJEL 2YWYA 4LSSL 2HA1A 1EJ6A 4PP1D 1SY6L 4HT1H 5IMOA 5CP3A 3RVTD 5CSZB 2WAHA 4HKBB 5DMIL 4CMHC 1WTLA 4YZFE 1G7MB 5DWUH 4PJBB 4Z5RA 3NCMA 5IJKC 4L5FH 3QI9B 3SQBA 4O9HH 3IGAB 4U1SA 3QEHB 2HH0L 2L4OA 5B39G 1H3VA 5FOBB 4OF7A 5DHVH 4OLVL 3OX8B 2VLME 1C5DA 1FN4B 5GJTH 1P2CB 4PJ9C 5F7KC 4J1UB 1TMCB 1P84J 1FO0L 1A9BB 2YD9A 2Q8BL 3UC0L 2FEEI 2DLGA 4Q0XL 4ZXBB 1Y6MR 2CDFA 3CVIH 4LKCB 2PF6A 5J1AA 3S3PA 1XF2A 4XNQA 3DGGB 3QI9D 5C0NC 5KVEL 1BVKA 4URTB 4D8PA 2VIRB 1DEEA 4G43A 3EJYC 1IKNC 2YOCA 1MCIA 2H3NB 4OM1L 1UG9A 3QNZA 4YHYB 5GPRA 5GGSA 4DKEL 3BESR 1D5ZA 1KYOJ 3WUWB 4WCYH 5CSBA 4ODUB 4JPIB 3N1MC 3WFBH 1E27A 4QRPB 4F80A 4DFHA 1P84K 3FJTA 4K7PH 1RULH 4ZXBD 3NCJL 3HHRB 1MCNA 5D7IB 5JIIA 3D18B 4KUZH 1TDQA 3VJ6A 1ZLUH 4X8JA 3MV9B 4RAUA 5BZWB 4UV4L 3UTSA 1A6UH 4FA8A 2DM3A 1AD0A 2P44B 4TRPH 2JJWA 2IBBA 2R2HA 3SQOH 5IR1A 4WI7A 2CQVA 2C3GA 3DV4B 1FJ1B 1M71A 1MHCB 1GRWA 2WLZA 1OLZA 1QLFB 1KYOK 1MRDL 4QWWC 4PJDA 3NPZB 4QRPD 5F7UA 4X7TA 2W0KA 3TWCH 2V2WB 4UIMB 4ZS6D 4U1HB 2AJVH 4KAQL 4Y19B 4HDIA 2I9TA 3L6FB 4ZTPL 5F3BB 2E7LC 3FN3A 3QO0B 3B6SB 1G7IB 3CVHH 1U92A 3MV9D 3LHPL 3QA3B 2JCCE 3OWEA 2EDLA 3FO0L 2XWTA 5GGTH 5ALCL 1JWMB 4HJ0D 4NP4H 3BX7C 4MGXA 5FYJL 4QT5A 2BOCB 2JB5H 5BV7H 1Z5LA 3R4DA 4P49A 5DA0B 5ANMA 3VD5A 5KN5B 3QUZC 2ICEB 2ICWI 4ONGL 4CADB 1UCBH 2EDYA 4RA0C 2ITCB 3MCKB 5F6IC 4Y19D 1FYHB 3FOMB 4DGYL 4R3SB 3MYZA 2MQCA 3O11B 5D2LF 4NFBA 1YYLL 5JW3H 4JO2H 4Z7UB 2AABL 2D7PA 5DMYA 9CGTA 5IJVB 3MLZL 2ATKB 2VZOA 3B8YA 4ODHH 4NWTH 4Z7VE 3HPLA 3FMGH 2F53A 1QFUL 4TUJA 1DUZB 4PJCB 2PO6A 2BRQA 4YDJA 3EJZD 4Y4HA 1SJEA 3SOBL 2X4OA 3VFUA 3OXSB 4XBGB 3ULUC 5SWQA 1MELA 4YFDB 1RJLB 4LHUG 4PTUA 2OZ4L 2FSEB 3IETA 1GOFA 1P5UA 4X4YB 1T0MA 1IFHH 2Y07L 3EW3B 2HWZL 2FX8L 3PWVB 4QGTA 4WI8A 4H1LB 4NDMA 3G6AB 4JFEA 1NANI 1ZS8B 4KI5E 2PNDA 2VLRD 2NXYB 1A7OH 1DFBL 1MQ8A 2UUDH 4LF3A 4IEFB 4FS0A 1LP9E 1R3JA 4F37K 3UTTA 3VFNB 2F54A 2GCYB 3VRIA 1U8KB 1I3VA 3C5JA 4JG0L 5B4MC 1UM4H 3T0AA 1FH5H 4X7CC 4G8FA 4G42B 4WTZA 3U46A 2W59A 5CJXA 4OZ4A 5FM5O 4E0RA 4LOUD 4I4WB 1ULVA 4Y1AA 5F3HB 3X13A 3FHAA 3GKZA 1HSBB 3UJTH 2O61A 1LDSA 2M1KA 3WL9B 3ZKMD 4RSVA 2Y7QA 3OKKA 5J4MA 1Q9WB 1IILE 2XZAH 4GSDH 1OB1B 2NXYD 2ADIA 3QPQC 1YJDL 4XAKD 1MIMH 1YQ2A 3WHE1 2X6MA 2Q7YA 3MUZ1 2HFEB 2NY6C 2Z31A 1AXIB 4JAMB 4RCAA 4NUGH 3F5WB 1Q9OB 3W11D 2OMNA 1CDCA 1U93A 3V0AC 5LBSH 1U3HA 3TESA 2QHRH 1U8JA 4EVNA 3CSBA 5E2UH 3G6DL 4Z0BH 3TC9A 1FNGA 2DJSA 5C0AE 1DSFL 4NRZA 3WBDA 3HZMB 3E8UH 1IC7H 1Q9LA 2VITA 3FO1A 4DEPC 4FHBD 1JRHH 4DCQA 4XZUA 3NVQA 3Q3GA 4LBEA 3B43A 5CLWA 4XWOD 4ZTOL 4PRAB 3VH8B 5EA0H 2BSTB 3S35X 4XAWL 1ZHBA 2AJZB 2IH3A 4LCIL 2FX9L 3ABZA 3QCVH 2Z35A 1T6VN 3KYMB 2IG2H 2Z92B 3H9YA 4JVPA 5KSAC 1N6UA 1XGRB 3DSNA 3WFDL 5T1KB 1WBYB 3LCYA 4XB8A 3MLTB 4IOIB 2NNAB 2P5WE 5E2WH 3HR5B 5C0BB 2FD6H 3TZVB 4QTHB 3V7MA 2NR6C 4N0RA 4GW1A 2A74B 3QIBB 4IRJB 4D9QD 1YEDB 4U6YB 1NC2A 2Q86B 1QHPA 1F3RB 3EYUL 4N8CL 4JREB 3SE8L 5LQBH 3K1KC 1I9RL 4PY8J 1NCAH 5T1KD 3DX9B 5DJAA 3IAQA 1TJHH 4RAHA 4E5XA 5C0BD 3A6CL 3BOVA 1CFBA 1IAKB 1NCWL 2AVGA 3BDBA 3TZVD 3QQ9D 2VXUL 2IQ9H 3LQAH 3VFVB 3DVNB 3GM8A 4PRBA 3QIBD 3LKSB 4IRJD 4MA1B 4D0DB 5GHWL 5IEHB 5IM7B 3WNMA 5CD5D 1MREL 4N0UE 3QISA 4DZBB 3T0VA 4J3TA 2Y25A 1G1YA 1MEXL 1BZ9B 5EUKA 3Q6FA 3D6GA 1MJ7H 2ADJB 2QSTA 4H26A 2XXMB 1QVOA 3CPLB 5DJYB 4JM2C 2GI7A 1QEWB 3RZCB 2EDBA 3RTQA 3ZKND 4I3RH 1RMFH 3K4AA 4FQHA 2VISB 5GXBB 1OL0A 3FB7B 3P9WB 4HMEA 4IS6A 3MJ8B 4OZGB 2GJ6A 3DI3B 5IVZA 1Q0XH 3UX9B 4GXVL 1HDMB 2XFXB 2A73A 3KLHC 2PXYA 3I9GL 2VDLH 1P7QB 2FATH 3MRJA 5I1LA 1UKQA 3OB0H 1JZ8A 1JF1B 3ARTA 4NC1C 1S5IH 1DBML 2DQIH 3MLUL 1KLUA 2GJJA 2P47B 1AQKH 1UEYA 4Z77B 3RZCD 1D5MA 3ZYJA 4XP5H 3LZFL 4OKVB 4H88H 1UADC 5C07A 4FTVB 4PV9A 3K2UH 3B2VL 3BWAB 4QRTB 3M17B 4N1EA 1HIMH 4X4XB 1YC7A 3EGSB 3MRLB 3REWA 5EO9B 3SDYL 4LLVA 1T04A 1EFXB 3B9KC 1P7QD 3DV6A 4QXWA 4W6XB 4LQ1A 4RIRB 3GSXA 4R7NB 3DX8B 4XXCC 3FZUC 2VAAB 3IFPB 1T7ZA 1ZE3C 2DQDH 4FTVD 2FECI 3GM0A 5CAYB 5HHOB 2FIKA 4PJ7F 1GGBH 1JPSH 4JO1H 4JZOA 2HTKC 4HH9B 3CU1A 3VCLA 1YEGL 5LWYL 2J6EA 3ZHLA 1EFXD 3PXHA 3U79A 1NFDA 1JNNH 1I1AC 1UZ6F 4Y4KA 4P5MB 4GAGH 3GNML 3IFOA 3O2DH 1LHZA 2AXFB 2FHBA 3GMLB 3RVUD 5EC1A 2JIXB 4HPYL 3RI5K 4J4PA 5MEQA 2BMKB 1YN6A 4PJBE 2IADB 3QWOB 5ISZB 1NUNB 5ACZA 4OJFL 3ALWA 1KJ3H 4XHJD 5TF1L 5HHOD 4LEOB 5HI5D 2VXTL 4OUUA 2X41A 4OLWL 2CUHA 2C4FU 2BY1A 3IVKB 2X9WA 2Q20A 4KV5F 3TNNA 5JQ6H 2OJZH 4Z7OE 2WV3A 1VACA 2OLDA 3Q2CA 4MQXC 2EDOA 5BRZB 5GRJH 3B83A 4PJFB 2JIXD 2XZQL 4BFIA 3P9LB 5I1HH 1T1ZB 2IANA 2J8HA 3WS6C 4LRIC 5GRYA 5ISZD 1R5VA 4N9GA 4PJ8B 1UXWA 2AV1B 3BIKB 3MRMB 1WLHA 3PWUA 1GC1L 1QO3B 3ARBC 1XF1A 4EQ2A 1AHWA 3T4YB 5ALBH 1O5DT 1O7VA 3IDIB 3O3BA 4FQJL 3EO9L 3KLAB 3S36H 3U1SH 4X6BA 5D72L 5BRZD 4Z76A 4QRPE 3TBSB 1ODAA 4MJ2A 5LCVL 4EI5A 5D7IE 4V1DA 1DQQA 2R1WB 3UZEA 4Q97A 5HYEA 4LCUB 1RAMA 3MJ7B 4K3JH 4KZEH 4WVRA 4L8SB 4XBPA 3MV9E 1JGUH 4PJ8D 2A83A 3MRGA 4PGDB 5EU6A 5L8JB 4M61A 2H26B 4FQPA 5DMJB 2XKSA 3PGFH 3ARFC 5ICXA 4TQEL 1OAUL 3EFDH 1BZQK 1NBVH 2C3WA 2FBJH 1NFIB 3FFCA 1MY7A 4Z78B 2ZUUA 2ZG3A 4AEEA 1M7XA 1HXYA 1OSZB 1MF2L 2RR3A 3NGBC 2DN7A 3WN5B 1R3KA 2X4TA 4LVEA 3TO2A 4YWGL 4LIQH 3ZKXB 4YDLB 1IGYA 4MNGB 2NTFB 4P2CG 1OCWH 2M8XA 4MS8C 4Y19E 1FCGA 2Q1EA 5JORA 4M3KB 1BGXL 4ZUWB 4X5LA 2Y23A 4O58L 1CLYH 3VFGL 3GHBH 1VADB 4EIZC 4Z7NE 4E42A 3H9HB 4UAOB 3VFOA 4G8EA 2BSED 4J6RL 2I27N 3KXFB 4LKXA 4RFEB 4LEXH 15C8L 1NGZA 4K8RD 5DD1L 2GW5A 3HPJB 1KN4H 3T3PF 1AR1C 4HFWB 4F58H 1OP9A 4PD4J 1CXKA 1ZHNA 1X5GA 3RL2B 4EUPB 1K6QH 4B50A 1JNHB 5AYQA 3TH2T 1Z9MA 3EHBC 3E3QE 4ZPVA 4XNXH 2WQ8A 4WWKA 1A7PH 4Z7UE 4GXUN 1QZ1A 2A0LC 3O2WH 5I1CL 2EC9U 4YHZL 3LDBB 4Y2OA 4KROB 2VLRE 2V7HB 2CPCA 2HRLA 3GIZH 3KXFD 5KW9H 3U0PA 1NEUA 3L5XH 3OG4B 3MNZA 2FYYB 4PJCE 2BZDA 2EYSA 5ID1B 4YDVB 3GMPB 4ZD3H 2NPLX 2HJKA 2BHYA 2C1PA 4ZSOA 3HMXA 1I8LC 5SV4A 1JHLH 3P0VL 4PD4K 4H25B 1IC1A 3JWDC 5D1XB 1D5BA 3RWHA 1C12B 3GKWL 5HPMB 5C8JB 4WFHD 4ISVB 5JW5A 5MEPA 4OZFB 1MJUH 5CEYB 5IBLC 5HXMA 5TQ2L 2CIIA 4JJHA 4M6NL 8FABB 1URLA 2H1PH 4XCCL 4KROD 2A9MH 2X4NB 2HMIC 1U9KA 4XCFL 2JLLA 1AFVL 1CIDA 3WIHL 4XNZC 3OPZL 4XAKE 4W4OA 1P4BL 4YHIA 3LS4H 4XB7A 2PW2B 4AG4H 3TA3C 5B8CA 4HCRL 1F6AB 3ZDXE 2BVEA 4MCYB 5D1XD 4MDJB 2WP3T 5DQDH 3TVMC 3LSOB 3QCTH 4HS6B 3CFJA 1YPZB 4MA7L 3FO2B 1HE7A 3WEXA 4BK5A 2RJMA 2DQEL 5FYLD 3NFSL 5CEZH 2E8YA 3RU8H 4Y5YC 4M4PA 4LNRA 4U6XA 4TPRH 4K23H 1C1EL 3HI1B 4KC3B 1MRCL 4YK4C 1F3DH 1JUFB 5D1QC 4GG6F 2LABA 5MEOA 4WFED 4BUHA 3KJ6L 1UYWL 1SY6A 4KKBC 1QKZL 5GSVA 1I8IA 2VC2L 5E9DB 2I60H 4FXLA 4HIEB 5E6IC 4PYHA 5FYKH 1FFRA 1XF4A 1S3KL 5AZEH 2ZPKH 1MAJA 1LD9A 2VL5B 3LEYH 3PQYB 2ENYA 4NN5B 5C3TA 3TO4C 5E6IA 2BDNL 4K7PX 3FB6B 4HWNA 2ZCLH 1PZUB 1I1YA 1QRKA 4KMQA 1RVFH 4S2SA 1NGYB 2IFFL 4LPTA 2HG5B 3CGTA 5GZOC 3AUVA 1FO0A 1AGCA 4NO2B 1KSRA 4DZ8B 4D9QE 5E9DD 4GQ9L 5CUSH 3BKJH 3LB6D 4U6TA 5IB3B 5DI8B 2HN7A 3WNLA 3DVGA 5B3JE 1M7DB 3WIFA 3Q1SL 4PRNA 3PQYD 4G5ZL 2R69H 1WWWX 2IMNA 5SWZA 43C9B 2VN4A 4WHCA 4XNUH 1CIUA 2ZSWB 1YMHA 3HNSH 5I1EH 3RKPA 5C0BE 4TULH 3X3GL 4F7TA 1XGYL 4XTRC 1IGFH 4L1DA 1P53A 3D48R 1VEOA 4M9OA 1ZLUK 1ZA3A 3C60C 1Z9OA 1OAYL 1PSKH 2WINB 4FMFA 1VFAA 4F57H 4NN7C 4HXBL 2W9LA 4YXHH 3LEXA 4UT7H 2QKIA 2NX5D 3P73A 3D9AH 4JN2A 3GBNL 4XT1C 3RWCB 1LEKB 1A9EA 2ZKHH 5F7HA 5FM8A 5GRUL 3MPCA 5DO2C 4U2ZA 2R1XA 1LP9A 1ADQL 1CF8H 1KJVB 3L95B 4PJ5B 5J11B 4QHLB 2OM5A 3BVNA 4PLOB 3MLSH 1FNFA 1J1XL 5IWLA 5E2TL 3FCTA 3GSWB 2D3VA 4M1CC 1EBAA 5H8DA 1MJJA 3MREA 2I5YL 3S98A 5IHBA 2IH1B 1W8NA 4NQED 4OAWA 4X6FA 1V7NL 1SBSL 2V7NA 3QUXC 1RUKH 3IDNB 3MSPA 2HT3C 4X9HA 2H2PC 2LTQB 1DDHA 4U1MB 4OZGE 5EORH 1QA9B 3VFPB 4C54A 4LCYB 5D7SL 2O5ZL 4PJ5D 3CFCL 4HUVA 3HI6H 1SYSB 1AGFB 1OGTA 4HS3B 4HK0A 5D7JA 4JQVA 4IHOA 1Y18A 2NW3B 4LSRL 1N7ML 2WQRA 5T3ZH 4DK3A 3OAUH 3ULSB 4G9FA 3LV3B 4MNQB 3L3DB 3OR7A 1HSAA 3IFNL 3MQIA 1CFSA 1NC4A 3NCBB 4XWGL 1QQDB 3EZJB 5C0AA 4PJGF 3ROLA 2WIIB 4CRPA 1KC5H 4OUOA 3S96A 4FTVE 1RK0A 2FJHA 5AD0A 1J8HB 2R0LH 3U4BL 3CLFH 3SEPA 4QF1A 3TNMA 2OZ4A 5DMKB 4WO4A 1RHFA 4YE4L 1PG7H 3MV7B 2GTZB 3JTSB 1CGTA 1CK0L 4HUWB 4NO5A 4MNQD 2KZ1B 4PG2A 2ZUTA 3VI4E 2UUDK 4NOBA 2VH5H 4ZAKA 2R15A 4BSWA 4MJ6B 3TF7C 5INDB 4LNVA 2ZUSA 1N26A 3TM6A 5I15L 3CFBA 4Y4FC 3BZ4B 2P5WA 5HHOE 4YQXL 1J8HD 3EYQD 4J8RB 3F58H 4UNTA 4WI2A 5CEXA 4OLYL 3L7FA 3MLXH 3MRNA 2YXFA 4J3SA 2HTLD 3MV7D 3TBVB 3SE3A 5LGKA 5GRVL 1YN7A 1MCSA 3HE6B 4FABL 3TCXA 5C0RH 3L9RA 3GSOA 4S0SD 4U6VL 3O8XA 3VA6A 3NCYS 3BDYH 5HHQB 3PGCA 3THML 4YHOL 5CZKA 1UM5H 5ADPL 4P9HL 2XIDA 5DFVC 4MJIB 5ISZE 1F02I 1UXSA 2ZG2A 4PGEA 2YKLL 3BHBB 1CG9B 4OLXL 5JHLL 3LN4B 4UU9A 1JHTB 1KEMH 3S3SA 1HH9A 1QR1A 1ORSB 4WY7L 2FLBT 5EULV 1J1PL 4R4BB 5BRZE 1M05B 3NZ8B 3HE6D 4G7YH 4QRUB 4PJFE 4N0UA 1A7RL 4BA8A 4WV1C 2D7MA 1BQSA 2J8UF 4MJID 5GGQH 5FFLA 2MMXA 1SJHA 2GTWB 4YNYA 4HW6A 3IDXL 3NN8B 4CKVX 1RIHL 4WV1A 1KFAH 1CBVL 1VPOL 4K9EL 3W82A 5ILTH 1MCOL 3M1BB 1A1MB 5F96L 2UZXB 4NRXA 4KTDH 3WNOA 1NGPL 2EE2A 3QIUB 3LH2H 1IL1A 1CXLA 1ND0A 5IK3A 2EICA 5LXGH 3RAJL 2A77H 1UC6A 1E4WH 3GO1L 2C7UA 4XBEH 3VU2A 2G9HA 3UPAA 2AKRA 3UPCA 2M26A 4JRXA 4JCMA 4JFFB 1S9VA 1QBLH 2L7UA 1QPPA 3PWNB 3X14A 5JW4R 1FNEB 3HC4H 3TPUB 2GY7B 2CJUL 1EHLL 3NFNA 5TE4L 4PJHB 1OPGL 5FYLL 5J6HB 4O2EA 5KSUA 1AGEA 3PHOA 3QIUD 4HAGA 2P4AB 3P30L 3O6LH 4MNGE 5CBAB 5F1OB 2PCPA 2GT9A 1CWVA 5IB5B 2DD8H 4PB0L 1ZHKB 3LEVL 2BHZA 3NCEB 4JFFD 5C0FB 4QEGA 5GGVL 1S7QA 5FUZL 1T7YA 1FL5A 5HJ3A 3G04B 4I8DA 4KMTL 1A6AB 3I85A 4MB5A 2CMRL 1L9NA 2CDGB 1CGVA 2OXGA 3KXFE 4CVWA 2AXGA 3GSRB 4HC1L 4ZO8A 1T1YA 1MCWW 5ABDE 2A38A 5E56A 1PYWB 2HJFA 5IGXL 4FQ2L 1BX2A 4PGCA 2VQUA 2OL3L 4BKLB 1Q1JH 1QLEL 2XN9A 4U6HB 2J6EH 3U30B 5HDQL 2OTUB 2DS4A 1HH6A 3W5MA 3QI9C 5I19H 3WUWG 3LIZL 3AS0A 4WHDA 5EB9A 4WFHE 3MBXH 5EOTB 5IFHL 3LN5B 2R0WL 4MD4B 1RJZB 2PYEB 2YPVH 4GG6B 5D7LA 1U8QA 4PJBA 1R3HA 2A1WH 5IMKB 2VAJA 5EOQL 1NJ9B 4F7CB 1JWSB 3HE7D 4FP8H 1N3NB 5D8JL 2R8SL 3PF2A 2Q3AA 3T09A 2Y6SD 1ZSDB 1AIFA 1FN4A 4ZXBC 3EFFB 1LE5B 2NY3C 4Q9QH 4FZEL 1CGWA 3IRZA 5DUMH 4EDWL 3KPPB 3BE1H 5FV2A 2PYED 3PJSB 1FNSH 4YHYC 1TJIH 5KVDH 3DGGA 5MENB 1YEHL 5FYLE 2Z93B 2VIRA 4L3CB 5JOEA 2ADGB 3S34L 12E8L 1WWAX 4PGZA 5DSCB 5FB8A 1UB5A 3D5OF 3FQWB 5HYFA 4MB4A 1HI6B 1RUMH 4K55A 1UH4A 4ZS6C 2J5LB 5LAXA 3RWFB 4WFEE 3T65B 1FSKB 1IAIL 4PLJC 1DQJA 3R0MA 2F74B 3U7WL 4JPIA 4FXGA 4BJLA 3BSZH 3L5WA 1CS6A 1YPZE 4FXKB 2KL6A 1SEQL 3DSFH 5T1DL 1A3QA 2FEDD 5MEND 1W72B 3T77B 1HQ4A 5BZWA 1P4LB 5FGCB 1YNLH 2NY4B 4AK1A 4OZIA 4O4YH 2BHUA 4OCWH 3MRKB 3KPRB 3GJEA 4I77L 3DV4A 2H41A 3MRFA 1FJ1A 2OTWA 5AWNH 4J3WA 1MHCA 3B9AA 4G6JH 4H0IA 5FGBA 4FMKA 4P2RA 3PP4L 2CD0A 1JGVL 5E9DE 2D03H 4UIMA 1RJYB 2MKWA 1XF3B 4U1HA 5EZOH 5JW4Q 4X9GA 4YEFA 3BH9B 3L6FA 1INEL 4MLSA 5F3BA 1JV5A 2GAZA 3QO0A 3B6SA 3PQYE 1G7IA 1UKTA 4G9DA 3U0WL 3QA3A 2NY4D 4GMTH 1GGCL 3KPRD 2CDEA 4AY0A 5KTEH 1G6VK 5I1AB 1A6WH 3EJZC 4OI8A 4ELMF 5KZCB 2DIBA 1MHPL 1UA6L 2GQHA 4LLWB 3ZO0A 1ZLWK 2VDOH 3E3QC 3BIBX 2EXYD 2ITCA 4QHNA 3MCKA 3DMMB 5IROA 3OZ9L 1U8IB 4R3SA 1TVBB 4XNYH 1IEAB 3O11A 5C2BL 1YEIL 2NX5E 1A14H 3MOAH 1H3WM 2ATKA 2AJYL 3FT2B 1DR9A 1FIGH 2F5BH 4L29B 5KZCD 2VLRA 3S4SA 5F44A 1HZHL 3BXNA 3MUJA 4KJYB 1DLHB 2PETA 3GRWL 2UV3A 3LN9A 4KZDL 4LOUC 3T1FB 1WZKA 3HMXH 3OXSA 2W65B 4XBGA 3CX5J 3DMMD 5F88A 3OKMB 4ZQKA 3V5KB 1FGNL 2FSEA 3ZKMC 4DGIL 1MCKA 1VKXB 4HKJB 4LPVA 5IVXF 1C8PA 4NQEE 2D0FA 4WENB 2Z8WC 1N64H 2Y06L 3PWVA 3G6AA 3JVGC 3BT2L 4OFVA 4HAFA 4BSJA 1RUQL 3OKDB 3WXWL 3BZDA 1J1OL 1ZA6B 3TFKD 2J12B 3W11C 3JV4B 3VXSB 3FAWA 1S7UA 3QIWA 4PJ5E 4NQSB 2WBJB 4DN3L 1KJMB 3QEQB 3QWQB 1OTSC 4YHKL 4JHWH 2RQ8A 5EU3B 2OR9L 2ZOLA 4Z7WB 3CX5K 3NABH 3VH8G 4I4WA 4XI5D 1TTFA 3L3OB 5CCKH 4KK6C 3QHFH 5JIPA 5IW1B 5I66B 1CFQA 3LQZB 1OB1A 1WWCA 5EPMA 2ZUQB 5T5NF 1S9YB 2IJ0C 3WDIA 1KT2A 4OQTL 3TJEH 3MOBL 4LSSH 3T1WA 2WBJD 1PFCA 5E8OB 2HFEA 2NW2B 3QEQD 3DIFB 1SY6H 1IQDA 4JAMA 4F7PB 4IIQB 5DMIH 4JFPA 3GSQB 3ZSTA 4MNQE 4OGYL 1BBDL 4G6FB 3TBTB 1OARL 4FQQA 5FCSH 5JXED 3DI2B 3BW9B 4PRPA 3HZMA 2HH0H 3RPIA 5DTFB 1JGEB 3JV6B 4PY7A 3T4AB 1NMCB 4OLVH 4LP4A 1NKRA 3QHZL 1AJ7L 3CNKA 5E6ZA 5GS0L 5FA4A 1J8HE 4K7PY 1FO0H 1BFTA 1AD9B 5E5MB 2FJGB 3BP6B 3O3DB 2C3XA 2BSTA 2Q8BH 3UC0H 4CU6A 3MV7E 4Q0XH 5DHVB 3BUTA 4M93B 3UBXB 1UWEL 4X5WB 3BGFB 1ERNA 3I2CL 4G6FD 5KVEH 3WNKA 2DLEA 2IPTL 4LRNL 3LKRA 1WIUA 2CKBL 4OM1H 4ETQB 3TZVC 3QQ9C 3WIHA 2I24N 5C6PB 1MVUB 5IT2L 1KTRL 1XGRA 4ZDHB 2K1MA 3I84A 5T1KA 1G9ML 1OQOA 5ESAB 1WBYA 4DKEH 5E24E 1L4IA 1HXMB 3RWEB 4HCRA 3HR5A 5E1AB 3HAEH 3R8QA 5CD5C 3IDMB 4QTHA 1XH3B 3VDBA 1AGBB 2C5DC 1LE9A 4HPOL 2PUQT 2A74A 4JREC 3QIBA 4IRJA 3NCJH 1J88A 3P77B 5DUBB 3SPVA 2Q86A 3QUML 3ZT5A 4JKLA 5DZOA 1GZQA 2EH8L 4UV4H 1AI1L 1Q9KA 4MJIE 4OF5A 4YFLI 4JPKL 4MAYA 3RNKB 3DX9A 1BD2A 2X70A 2CLVA 1ZKAA 4MA1C 4LVHB 3DRQA 1MRDH 3DX6B 1ZMYA 5I9QC 5J9PB 3VFVA 4F33A 4CW1B 1T5WB 1T5XB 2FO1A 4KAQH 3RRQA 3EIFA 3V6FB 4ZTPH 4IMKA 3BJ91 3ULVF 3T04D 4AEHL 3LHPH 3PWLB 3RX5A 3FO0H 3R06A 4PJIB 2V2TB 3FN0L 4PV8B 4N5UA 2C4XA 3WJLC 1F58L 4K94C 3QDGA 1XZ0A 5FGSA 5FYJH 3OF6D 5DJYA 1QEWA 3RZCA 4DVBA 3CVHB 3K4ZA 1I4FB 3EDEA 2D4DA 1QFWM 3FB7A 5AG9A 2JE8A 4P23B 4RGOL 4ONGH 3WKML 2XOTA 2G2RA 4G7VL 3BKCL 4U0RC 1MCLA 4DGYH 2XFXA 5BV7B 4X98B 5EZIL 1YYLH 4LAQL 2Z91B 1FBIL 5DD6A 2AABH 1JF1A 4JFFE 5E8NB 3MLZH 2UWEF 1LEGB 1EVUA 5J6GA 5JA9A 2VXSL 2P8MA 4Z77A 1QFUH 4P46B 5HYSB 3MJ6A 3VGHA 4PJHE 1F6LL 4P23D 5FF6A 3SOBH 3KPSB 1FG2B 3BWAA 3PGDB 3O9WB 4QRTA 3RIAK 1FQ9C 5D1ZB 4PGBB 5DF0A 3BZEB 3MRLA 4GG8A 4XCYB 3KGRA 2GK0B 2OZ4H 3RVUC 4CBPA 3HN3A 4XPTL 4YR6B 1V05A 5HVHB 2Y07H 1AGDB 4CN4A 1SYVB 2HWZH 2HKHL 2FX8H 3ARDC 4AQ1B 1PY9A 4XHJC 4FOMA 4R7NA 3HNTL 4P46D 1DFBH 2DM2A 3IFPA 1ADQA 3KPSD 5D6CA 4U1GB 3O9WD 5D1ZD 5HHOA 1T20B 3ALPA 3BP4A 4HH9A 2R1YA 4I3GA 2OP4H 4HKZA 5JXAL 3BPNB 3HMWL 3P4NB 2AXFA 3GMLA 2PYEE 4GG6E 3GMOB 3VRLE 4UOJA 3T0EB 4WEUD 1TZGL 1YJDH 3SJVA 4F3FB 1HINL 1T22B 1X5HA 4LEOA 1OT1A 1F45A 3V8CA 4KHXL 1T1XB 5JMOC 1VB9A 4QLRA 3VFWB 2EE6A 2Y5EA 3DROA 2AGJL 4NNYA 5BRZA 1JWUA 2Y5TB 2ARJB 4PJ8C 5F9JB 3LKNA 1DVFB 3G6DH 3DO7B 5CP7A 3P9LA 2YS4A 1DSFH 1CT8A 2VDRL 4M43L 3T0ED 2Z8VC 2KUTA 5MENE 4PJ8A 3N9GL 2R9HD 5F7EL 3MRMA 2BNQB 4JQIL 4ZTOH 1NMAL 1OAZL 1WBZB 5KSBF 3IDIA 3TIDB 3MA9L 3KLAA 3U9PL 4KTYA 1EV2E 4X4ZA 5D2LA 4DW2L 2HT2C 1FL6B 3IDGB 4XAWH 5FO8B 4L8SC 3JWNC 3DXAA 1J86A 3BQUC 5TDNB 3GHEL 2BSRB 4LCIH 1JHKL 2FX9H 1UM6L 4S1SL 2K3TA 2R1WA 1U41A 2MJWA 3MJ7A 3FT3B 1BZ7A 3IRPX 3OXRB 1LILA 3WFDH 5HYIA 2JJSC 5FGCE 4EUPG 3UJIL 2BNQD 1WICA 4K8RC 5FYKU 1CFVL 3KPRE 3JV5A 1L6ZA 1W0WA 1NFIA 3ZKXC 2VMFA 4YDLC 4GW5B 4XXDB 3H0TB 2NY5L 3WN5A 3V4PL 1I1CA 1ZGLB 4OF8A 3O3AB 3EYUH 3B9EA 1T83C 4MNGA 4N8CH 2NTFA 1B6UA 5JO5A 3SE8H 3B3IA 4F37F 1FFNA 1I9RH 2XTJB 3G9AB 4PRDA 4UAOC 2BVUA 3VGBA 5DS8B 1Y0LB 1WBXB 3VFSA 3WE6B 4YJZL 3FO9A 3A6CH 1NCWH 4MNHB 1A22B 2VXUH 1KB9J 5DRZA 4OZFG 1HKLL 2XPGA 3OMZA 3E2HB 3G08B 3KXFA 3L3IA 4LHJB 4RBPH 5TE6L 4QXTB 5GHWH 1T0NB 3DNKA 4I0PA 5DZNA 3QQ4B 1MREH 3MNWB 4JO4L 4NQCA 3R1GL 5EO1B 1MHEB 3ZDYE 1MEXH 2FWOB 1F4HA 2MHAB 2AQ2A 2XTJD 4H5SA 5HTSA 3LDBC 5A3ID 4PRIB 1IM3A 3ZE2E 1CGYA 3KLDA 2YEZB 3LRSA 2N4IA 5DURB 5LVEA 1KB9K 3MRIB 3VGAC 4FQIL 5IIEB 2FYYA 2XWBB 1HOCA 5IW6B 4YDVA 1MCCA 4GXVH 3CDCA 5CZVL 3GMPA 4NBYB 3RDTA 4KRNA 5F1NB 2FIRT 1T89C 4L5FL 3I9GH 1ZEAL 3WO3B 5D1XA 3HR6A 5C8JA 4PLNC 1DBMH 1MCQA 3MLUH 3WXVL 1R5IA 4PRID 5CEYA 1HILB 1KCLA 3LZFH 8FABA 1DN0A 5DURD 3VFMB 2X4NA 1IARB 2XI9A 4OZHF 3B2VH 5HI4C 3VXUB 5JUEL 1CICB 1HHHA 1X5YA 4KXZH 3CK0L 3AREB 3SDYH 4QNPF 2P46B 3BH8A 3QEQE 2R2BB 4MDJA 4Z7WE 4HSQA 2C26A 4HS6A 1TCRB 3QFJA 1K4CA 1MOEA 5EBLB 5CWSA 3HFML 4LPXA 1HHIA 4YBHA 3D2UB 4UDUA 1G7JB 4HC1A 5E99L 2R0KL 3VXUD 4W68A 1CICD 4NCC1 2OL3A 1YEGH 3ARED 3LB6C 5LWYH 3T2OA 1LK2B 5D71L 1YY9C 5J06A 3GNMH 3AY4C 1S9WB 2C3HA 5FA3B 4LQFL 4HZAA 4NN5C 5E9DA 3SQOL 4U49A 4HPYH 4HIEA 4YO0A 1T7WA 2GSGB 4X80L 3D2UD 2VL5A 5I1GH 2IF7A 3KPQA 5FECA 3D1MC 4OJFH 2ICWB 2UVFA 3IT8D 5TF1H 1UJ3A 4NFDA 2VXTH 2XKNB 4OLWH 3D0VA 4JHAL 4JB9L 1DZBA 1J12A 3QEGL 4FQXC 2AJXL 3RWGB 3N1QC 5BMFL 2AEPL 3DTXB 4APQB 1M7DA 4P2QA 1N2RB 3MLRL 1F4WL 4IRSC 1GC1H 1T2QL 1MCRA 3V8OA 43C9A 1GCFA 3MTRA 2NX5A 4FQJH 3EO9H 4XVUC 1P6FA 3LMJL 3MRRB 1F4YL 1KIUA 4M7KL 3SE4C 5D72H 1F2QA 4PG9A 1BQUA 2VSCA 2IQAB 5LCVH 3I6KA 3VI3F 1MWAL 4APQD 4JZNB 3MRCA 5C0EB 2EIDA 4BZYA 3CFEA 2AERT 3GIVB 4NQEA 4TQEH 1OAUH 4BELD 4YHLL 1L7TL 3WDHA 3CZJA 1MF2H 3MRBB 5J11C 2H6PB 3NIGF 4WGWB 4YWGH 2NY1B 2KQNA 3L95A 2VABA 4AIXA 4QHLA 5K9QG 3SGDH 4R26L 1BGXH 1VERA 1FE8L 5CHNA 2WP3O 2QSQA 4O58H 1EEYA 4PJIE 2LTQC 2V17L 1MQKL 3VFGH 4PJ7A 5HHPB 3U36A 4KKLC 3TGXA 1DUYA 4HIHB 2BVQB 1XR8A 4Y5XA 3IDNA 4J6RH 4WFFD 4Y2DB 5DD1H 15C8H 1ACYL 1EDQA 2NY1D 4U1MA 4UOW0 1X4ZA 4PJXF 1QA9A 1PDKA 3VFPA 3CFDA 4LVOB 5FKPB 3UJTL 2UZYB 1F90H 1JPFB 1MFBL 5DQ9B 2HLAB 4MZ3A 1WTGT 1MFCL 3N0PB 2FL5A 3LV3A 4MNQA 3FFDB 1RV6X 3L3DA 5I1CH 1H3TA 1CXFA 4YHZH 5AAMA 1QQDA 2LU4A 5GGRA 5IMOB 3C6SA 5GGSY 1T4KA 3EYQC 4Y2DD 5A2JH 1WISA 4Q6IA 5JOPD 3GRWA 4M1GL 3KPSE 3ZLQC 3LPGA 5F8RC 3P0VH 4OLZL 3K7UA 2H9GB 1P7KA 3GKWH 2GTZA 5K9OA 4HUWA 1ONQB 3SO3B 4KVCL 5TQ2H 2DJUA 4M6NH 4XCCH 5FM5M 4Y16B 4XCFH 1AFVH 1BAFL 5INDA 3WIHH 1C16B 1T66C 1INDL 1N59A 3OPZH 1GL4B 2QQQA 1CGSL 2CDFB 1G0DA 1CU4L 4G6ML 1U91A 5HGGS 1XF2B 3M45A 2OJEA 3PDOA 4HCRH 1BVKB 4D8PB 4G43B 4MB3A 1R6VA 4OCXL 3JWOL 1OW0C 4XC3L 4HK3J 2MFNA 4MA7H 3TBVA 3WLWC 3RVVD 5GGSB 1CD9B 2V5YA 3HE6A 2DQEH 5HHQA 3NFSH 1D5XA 4I3SL 3T0EE 4Y16D 1U8PB 3BP7A 1C1EH 5I1KL 1EHNA 4OQTA 1MRCH 2QADD 3LN4A 4YIQA 4H8WL 1A3LL 4MXVE 3VJ6B 4X8JB 1NUDA 1WFOA 4W81A 3KJ6H 1UYWH 4RAUB 5EWIL 1QKZH 3UTSB 1BIIA 5C3LD 1AD0B 4MSWA 2VC2H 5IR1B 2A6KB 1M05A 2DLIA 4HBCL 5CJ5A 1S3KH 1M71B 4QRUA 2CGRL 1U95A 2Z8SA 2E6PA 2BDNH 1G7HB 1A7QL 4X7EC 4M6AA 3U4EB 2IFFH 4HDIB 1H3PL 3FTGB 2BNQE 1MAKA 4F2MB 3NN8A 5BOPA 2YK1L 3QIUC 1IM9B 5JLZB 1U92B 5CEZD 1ITCA 2GITA 3UTSD 2E7CA 3KWWA 3M1BA 1A1MA 4GQ9H 1FIEA 5FOJA 2FEEL 4QT5B 2RFXB 3Q1SH 3AROA 2NXZC 3QDHA 5IFJA 3O45A 1Z5LB 4M48L 5ANMB 4J12A 2CKBA 4G5ZH 4B41A 1EFQA 5DA4A 5FYKD 3PWNA 3OTTA 1FNEA 2WBWB 4BM7A 3C8HA 1YMMB 1V8HA 1IM9D 2ZUXA 3X3GH 4M5ZL 1XGYH 3JZ7A 5J12B 5J6HA 1G9NC 1Z3GL 1OAYH 3QUMA 5JOFB 1Q72L 1GOHA 4HXBH 4JHZA 1SVZA 2F53B 5CBAA 5IVNA 4TUJB 3G6JF 5IOPB 5C0GA 3PP3H 4OZHB 2XTJE 3GMQA 5TQ0L 4Y4HB 1SJEB 3VFUB 3GBNH 3KHOA 3WO4B 4U1KA 4OF3A 3K1DA 1Z6JT 1YMMD 1GAFL 1OSPL 1WCQA 3IETB 5GRUH 1B0GA 4UV7L 1T0MB 2CDGA 2DKSA 3HE7A 4M5YL 3GDBA 3U30C 3GSRA 1DQML 4YHPA 2VYRE 4NBXB 1GPOL 4NDMB 1PYWA 4JFEB 1J1XH 5E2TH 2QJDA 2F53D 2X44D 5TGBB 2I5YH 4BKLA 5HHXL 3SBWC 1R3JB 4Y4HD 3VRIB 1EVTC 1SBSH 4N8VA 2BVPB 2OXHA 4FFVD 4J2XA 1WJ3A 3LN5A 4MD4A 4JO1L 4PRIE 4GG6A 4OLEA 4G8FB 3MXVL 3HNVL 2CUMA 2YUZA 4MLIA 4OZ4B 1MAML 4F7CA 4Y1AB 1JWSA 2FR4B 1K4DA 3X13B 4N9OB 5D7SH 2O5ZH 1BOYA 4JANA 3CFCH 1TIUA 2O61B 2YPKA 2GIYA 4XC1L 1ZSDA 3OKKB 1I9EA 2H8PB 1EMTL 4KVNL 3ULVL 4LSRH 4HKXA 1N7MH 4L3EB 5JIKA 3MBEA 3QT2A 4OBRA 5HVFB 2Q7YB 3IFNH 2FHCA 4U7MA 4XCEB 4XWGH 1MFDL 2Z31B 5I76A 3PJSA 4ESKA 1K8IB 1U93B 4ZFZA 4Y1AD 2Z93A 1U3HB 2J5LC 3O4OB 4HBQA 1FSKC 3VXUE 4OCNC 1A3RL 1U8JB 2MKLC 5TDOB 3TBWB 4EVNB 3V79C 3KJ4B 3U4BH 3FQWA 3HRPA 1BEYL 3B2UD 4HLZG 4YE4H 1Q9LB 3FO1B 1DEDA 4L3ED 4QHUB 4DCQB 1CK0H 1NFKA 4XZUB 3H42L 5CIPB 3Q3GB 2NY4C 2Z31D 3F7RA 4NHUA 5E0QA 5I15H 1QP1A 2E6QA 3T77A 1QG3A 5C08B 1U3HD 3BO8B 4XP1L 2CO6B 4YQXH 1CGXA 2IH3B 2LU3A 3KPRA 2Z35B 2B4CL 5KAQF 1YECL 4OLYH 2EXYC 2BSSB 3J7HA 1R24B 5H37H 3SKMB 4RISL 4HS8L 1RZIA 4FABH 3BI9X 4U6VH 3THMH 4FFWD 4YHOH 3A6OA 5ADPH 4P9HH 3NFPA 1CYGA 2YKLH 4U1JB 5C08D 2H2SD 2MQ3A 4OLXH 5JHLH 1BVLA 2EIEA 1BJ1J 1NC2B 3RGVA 5K9KA 4S11A 3AGVA 4CDHA 4WY7H 5I1AA 5E8DL 4ONHB 3X11A 3ARVA 1J1PH 1EHAA 3DMMC 3I02B 1GJIA 5DJAB 5DJDB 5DK3A 1H3XA 1TCMA 3ISWA 4IDJL 3V52L 1U42A 1A7RH 4MQTB 3NCYP 4PRBB 4DAGH 4X6EB 5F7YC 1I7RA 1TVBA 3EDJA 1IEAA 3VWKA 1NC2D 3DPBA 3IDXH 1CBVH 1OTTD 1TZIB 4I48A 4R4ND 4LLMA 1VPOH 4K9EH 3TFKC 1MCOH 2JTDA 5J3HD 5F96H 3MLYL 2X4QB 3P4LA 4I18A 3EYVA 1NLBL 2JK5B 1DLHA 4H26B 1NGPH 4MQ7B 4LSQL 1L9MA 5D6DA 3IB4A 3T1FA 3C9NB 5E1HB 3RAJH 2PTTB 2W65A 3GO1H 1YUHA 4IS6B 2DICA 3OKMA 4PJGA 3V5KA 4ZUUA 2W0FB 5IVZB 4LMQI 1NCUA 1VFMA 1JPGB 4UOW1 1W8OA 5L2JB 1CE1L 5LGHL 2A73B 4ETYA 5B38B 1EHLH 2CJUH 2PXYB 3DUSA 3P4MA 5TE4H 3MRJB 1OPGH 3GFUA 5FYLH 5I1LB 2WBJC 4WFFE 2D7QA 4HEPG 4F7EB 1ZA6A 1KLUB 3P30H 3TN0A 3AFLA 2R2EA 1D5MB 4CJ1A 4N90D 3QEQA 4PB0H 1CDBA 3LEVH 4PV9B 2BNUA 4MJ5B 4FQLH 5JXEC 1U58A 2BFVL 1OY3B 5GGVH 4LIQE 5FUZH 4KHTL 5EIQA 3UAJD 2ZUQC 3L3OA 3REWB 4RBPK 4X4ME 4RGNB 4LLVB 1ZLVH 1NUGA 4K71B 2PXYD 3VW3L 3DV6B 2CMRH 4HZLB 5IW1A 4HC1H 4AEFA 3GK8L 2D0GA 3OAYH 1DN2A 1KIRA 1S9YA 5JOPE 3CXHK 5IGXH 4FQ2H 2MSPA 4EDXB 2OL3H 4C83A 1QLEH 5HDQH 1NSNL 5E8OA 1LWRA 3I6LD 3HCVA 3LIZH 4BYHA 4IIQA 5IFHH 4KTEL 2R0WH 2N7BA 2RHEA 3VCLB 1K5NB 4OF0A 3MLVL 1NMCC 1ZANL 4Q74A 4RGND 4ZUVA 3ARXA 3TBTA 5EOQH 1NFDB 2F9BT 4PREA 4Y4KB 1CDGA 4N0FA 3BW9A 4X6CF 4GRLB 5D8JH 2R8SH 5DTFA 3JV6A 5EC1B 3ZE1F 3TH3T 4KQ3L 4UTAL 1PAMA 1A6TA 1LEIA 4M93C 3S9DB 1R0AL 5KS9F 4F9PC 5ACZB 4G6AC 2J8UA 1AD9A 3BP6A 4FZEH 3DECA 2ZSVB 4EDWH 1EO5A 2J3SA 4OUUB 5I1IL 1LO5A 4F9PA 1RZ8B 1FNHA 5KSBE 1ZHLA 2WM0A 1YEHH 5BW7A 5F1IB 4KY1L 4Y4KD 3S34H 3TT1L 12E8H 3HZKA 4KU1A 4POYA 4GRLD 1MVUA 3NAAL 1IGIL 4NN6B 5KANI 4ZDHA 5ESAA 1D3CA 1RUAL 4NWUL 5E1AA 1IAIH 2BERA 1R5VB 3IDMA 2VLLA 4NQTA 4RZCB 3U7WH 1ZLSL 4OFDA 43CAA 4N0YL 1INQA 1SVCP 3O3BB 1SEQH 5DUBA 5T1DH 4MHHG 3UTZB 3F7QA 2VZTA 5IB1B 4JQXC 4X6BB 2ICES 4Z76B 5B21A 3GMRB 4U1LA 1HYSD 1LNUA 2BVTA 3OR6B 4EI5B 1I8KA 1JF6A 4V1DB 4I77H 3V2AR 2N1KA 3H7LA 3IF1B 3H9SA 3SGKC 4XBPB 5CEZE 2A83B 3DX6A 3UTSE 2X89A 2Y72A 2A2QT 5EU6B 3PP4H 4M61B 1JGVH 2HVJA 1T5WA 3I6GA 3FL7A 5HYSG 1T5XA 2ZCHL 4N1CA 4P4RB 1P6AB 4X5XA 5T33L 5DVOA 1GGIL 4WI3A 4HIJA 3V6FA 3MROB 1INEH 1HXYB 1FZMB 3RHWK 3WJJA 3U0WH 2EE3A 1J87A 3FRPG 1GGCH 5FYKE 1OHQA 4PV8A 3CSPA 3EO0A 1OTUD 4EI5D 3S35L 3BN9C 4P23C 4V1DD 1JL8A 4FNLL 5JORB 1RPQA 5KG9A 1MHPH 1P9MA 1UA6H 5EU6D 5BV7C 3OBAA 4W6YB 1XGTB 4LVNB 3NIDF 2YD8A 4WU7B 1AKJB 5J89A 4YBLB 1K9TA 4NPYB 4F8QA 3VGFA 3OZ9H 1ZGLM 5ANME 4UINL 3W81A 3O6FA 4LKXB 1NGZB 1S7RA 2DKUA 3H2WA 2DTML 2DQGL 5C2BH 4P46C 1YEIH 3P11L 4X7SL 2BOBB 1D6EA 2BC4A 3WS3B 1SMAA 1LEGA 1ZHNB 2JELL 2AJYH 4YPGA 1OOAA 1YMME 5D1ZC 1X4XA 1HZHH 4ZPVB 2VJXA 4WWKB 3GRWH 3PGDA 4KZDH 1AKJD 2YA2A 3O9WA 4NKDA 4PGBA 1MWAA 4YX2L 5JIHA 3TJHC 4N0CD 2F53E 4GKZB 4XCYA 4UQ2A 3FRPA 2GK0A 1FGNH 2DBLL 3MNZB 4DGIH 4OZHE 1CFNB 1OQXA 3UJJL 2BCKB 4ZSOB 1SYVA 3MRQA 2Y06H 3L3KB 2MOVA 4ORGB 2W60A 3BT2H 5CJBA 4QNPE 1RUQH 1ROWA 3WXWH 4WWKD 2Z8RA 1J1OH 2A6IA 2YMXL 5MEPB 5JW5B 2BY2A 4MXWL 2CK2A 5MI0B 2CIIB 4DN3H 1JGDA 3SGJC 4YHKH 5I17A 2OR9H 2GY5A 3O41A 2EDEA 4OSUL 3T0EC 4M03A 4OM0L 3CMGA 4YHIB 2VKXA 1ZVHA 5B8CB 3WNPA 2W38A 3MC0A 4MWFA 2R9HC 4IBLT 5I75B 3A67H 1RZJL 1DE4A 3EKCA 3CFJB 5CKGA 4Y1AE 1OP3K 5J13B 4OQTH 2ZUVA 2IAMA 4KDTC 3U7AA 1T22A 3MOBH 1EEZB 3CUPB 6CGTA 1DVFC 4YFEA 3KHQA 3BMWA 4L3EE 4FFYL 2ARJA 4OGYH 1BBDH 5MEOB 4B53A 3LKOB 3ESUF 1OARH 2LFGA 3DO7A 2KQMA 4QXUL 5SX4I 4ELMA 2E7MA 1IZJA 2Y4SA 4QKXB 3QUYA 3QHZH 1AJ7H 4FQCL 4RQQA 5GS0H 4ZG1A 3NTCL 1LD9B 3ARGA 3MRPA 4J23A 3IJYA 3TIDA 5FKAA 3OB8A 4ACPA 5GS1B 1D9KC 4N5EC 4S2SB 1UWEH 3I2CH 5TDNA 2IPTH 1KENH 4LRNH 3C2AL 2CKBH 1AGCB 4KRMB 5IT2H 1A2YA 3U2SB 2R29L 3OXRA 5C08E 5HGHB 4WHTB 1G9MH 4BFBD 4I2XB 1QBAA 3DVGB 3U48A 3WIFB 2VLJB 4YHNB 4WW2F 4HPOH 5SWZB 1KPVB 2G5BB 2V6HA 1YMHB 5IVXA 1M7IA 2XTJC 1ZGLA 3H6JA 4JZJA 4TNWF 3QUMH 4XNMB 3HAEB 1PQZB 5A3IC 4HFUL 2EH8H 3LRGA 2CRZA 3DYPA 1AI1H 1U36A 5DJZA 2HJLB 3NIGE 4JPKH 2MNUA 1QFPA 1EJOL 1I7TB 5DD3L 1QLRB 3E2HC 3WE6A 1VFAB 4HGKC 3BPOB 1IBGL 3BEVA 2VLJD 3O6KL 4MNHA 2AXJA 1UWXK 2OTPA 1WZ1L 4EEEA 3NMEA 3LEXB 5ETUA 5SWZD 4EBQL 2LQRA 5EIVA 3LQAC 4QXTA 3ALXA 3QQ4A 2YN5A 3HTLX 1HWGB 5EO1A 4ALAL 5E4EB 4AEHH 1QFOA 4F9LA 4RNRB 2FWOA 2MHAA 2R1XB 1A6ZA 2EZ0D 3FRUA 2GJZB 3FN0H 3GZKA 2VE6A 4PJXE 1F58H 3BVNB 3HA0A 3AS1A 4P9ML 3VXRB 2YEZA 1UFUA 4UILL 4RGOH 2APFA 2DQHL 3MRIA 3M8OL 3WKMH 4X6FB 2V7NB 2X4PA 2XWBA 5IW6A 2IPKB 4G7VH 1WFUA 2YPVL 3BKCH 3JV0A 1Y6KR 2QBWA 2EDKA 5F1NA 4MMXC 4N90E 4XMKL 4QHKJ 1FZJA 5EZIH 1DDHB 3FONB 4LAQH 1EPFA 3UO1L 4NZRL 1FBIH 2XV6B 5I18L 5E94A 4U05A 4HUVB 5F7WC 2VXSH 1OGTB 1NAML 1PW3A 1XCTB 5D7JB 2IBGA 4IHOB 3VXRD 1CICC 5KS9B 2X1QA 1CXEA 1QBML 3VXOA 2P7TA 3AREC 1YY8A 4G9FB 3VXUA 1OAQL 1PZ5A 2RCSL 2UY7A 5FYJD 3PP3K 2XWJA 5M95B 3ZE0E 3ROLB 4L4VB 3HUJF 5FCUL 3I6LE 4XPTH 1F13A 1RK0B 1NPUA 4L8BA 4P99A 5H2BB 2HKHH 2FJHB 5AD0B 1N5AB 4JPWL 4LPCA 5EBLA 3TNMB 2YZ1A 3HNTH 5D7JD 4WO4B 4RGNE 2YUWA 1IEBA 1BJMA 5E7BA 1MRFL 3U4AA 5F7FA 5ERWB 4G9FD 4NO5B 4NGHL 1TITA 3UPRA 1FL3A 5T3XL 2LAAA 3HB3C 4ZAKB 1J9CT 4LHQB 1UEMA 4BSWB 5D5MF 4LU5L 2EH7L 4V2CB 4L4VD 2JJUA 1VFOA 3MA7A 5JXAH 3HMWH 4JFZL 5FA3A 3SE9L 2PTUA 2O26U 5CEXB 4PR5A 1AO7A 1IT9L 5FO9A 4WO4D 3GGWB 4KGLA 1NFDE 1TZGH 3X12B 1U8HA 1HKFA 3L9RB 1H5BA 3GSOB 3O8XB 2DRUA 4ZAKD 3PGCB 4KHXH 4FG6D 4WI9A 1UXSB 4PGEB 1JZ7A 4APQC 2EDFA 4GOSA 2AGJH 4IOFC 1KCUL 2FH6A 4UU9B 4EQ3A 1JK8A 1HH9B 3AB0B 4D2NA 1F11B 1JPTL 2VDRH 3BYTA 4M43H 3KS0J 3RY6A 1JZ3A 3L3GA 5IESL 2X05A 3N9GH 2JJVA 4GUPA 5F7EH 3X3FL 4JQIH 3O8XD 1NMAH 3IXTB 1OAZH 3V9FA 1F97A 1N6VA 3OKLB 3MA9H 3MRRA 2MCG1 5I71B 3U9PH 2DLHA 4DW2H 4YNYB 4LCCA 4LSTL 3GHEH 2UWEA 1JHKH 3CSGA 2XRAL 1UM6H 4S1SH 4C58B 4WUUB 1G7LB 1BFVL 4JZNA 5KOMC 3RIAF 1I9IL 1QUNA 3UJIH 1FCCA 1IL1B 2X4UA 3ULUF 3AU1B 4AENA 1ND0B 1CFVH 4N1HB 2NY1C 4V1DE 5F1KC 4KK5D 5GRVK 5E2VL 2C7UB 1K3ZA 1N4XL 2G9HB 5KVGL 2EDJA 3MRBA 4JRXB 2NY5H 5CS7A 1S9VB 3V4PH 5EU6E 4XPGL 4ODXB 3X14B 3TYFB 1MJ8L 3T0XA 2ERJC 4OGAC 3ES6B 2RBLA 4LLUA 1R3IL 4WUUD 1E4JA 3VGEA 4KJWD 5KSUB 2C1OA 1AGEB 3PHOB 1DBAL 3HZYB 4Y2DC 3PHSA 1I3RA 3C09B 5HHPA 3MRDA 4X4MA 2GT9B 5LGJA 5JDJA 3MUHL 1HKLH 4HIHA 4WIQA 2ZUYA 3PNWB 4LVOC 4JRXD 2ITDA 4NM4L 5TE6H 1BECA 1S7QB 4JO4H 3R1GH 1FL5B 5HJ3B 3CXDL 4YC2B 5HBBA 3OAZH 1XF5B 1KIPA 3VWJA 1T1YB 3K80A 2HJFB 5C0JA 3AVEA 1BX2B 3RUGF 2KDGA 4PGCB 1LO4L 3LOWA 3FFDA 2XN9B 1NBZB 4B5EA 5HYQA 1WUNT 4RWHA 5TFSL 1HH6B 3GBML 5HD8D 3LRHA 2QR0A 4FQIH 1UGNA 5A2LH 4PLKC 3KPNA 1LMKA 3T3ME 5DVKA 4NCC2 4TSCL 5CZVH 5EOCJ 4BK4A 5D7LB 1HQRB 1U8QB 1B0WA 1R3HB 3RVVC 2D7OA 1G7PB 1ZEAH 4DVRL 3SO3C 2H9GA 4NZUL 3AAZA 5IFAL 2V5RA 2WNGA 3WXVH 1ONQA 1AIFB 4ZSOE 2A9NL 2XN9D 1P4IL 5KSBA 4PJAF 5IQ7L 2DYPB 3NA9L 4Y16A 2R0ZL 1CDUA 2ATPB 5JUEH 1C16A 1QSEA 3CK0H 5KSVB 5I8KL 5ESVB 5D7LD 3SCMA 3OKOA 2V5SA 1E4XL 1H3GA 1BIHA 1ZLVK 4EKXA 5FB8B 1UB5B 2VL4A 1G84A 3HFMH 5LAXB 1DQJB 3OL2A 2DYPD 4XP9L 5E99H 2R0KH 5IV2A 4FXGB 1U8PA 3L5WB 4L1HA 1CLZL 4KWUA 4Z0XA 1KG0B 2P5EA 1A64A 5FUCE 1QFWI 4MXQC 3HZVA 5D71H 1JP5A 1HQ4B 1V3LA 1NCTA 1HCVA 4OZIB 1IGML 4LQFH 4NCDA 2A6KA 3RJQB 3GJEB 4LPUA 3MRFB 4KUCF 1S5HA 2OTWB 4X80H 4DWHA 5IUSA 4GAFB 5ITFB 3DBXA 4P2RB 1MI5B 1G7HA 4AIZA 5A2FA 2EEDA 3U4EA 4X9IA 2W9DL 4JHAH 3LVEA 4JB9H 3FTGA 5IHZB 1QACA 4F2MA 1JV5B 2GAZB 4BSVA 5BJTB 5KBNC 4ZODA 3SDDB 1IM9A 4G9DB 5GISL 5JLZA 4DFIA 2CIKB 3SKNB 3QEGH 1IC5L 5BMFH 2AJXH 2FGZA 2XQYG 4JM2F 2CK0L 2AEPH 2CDEB 2VZ3A 1S9KC 2RFXA 2G75B 4M7ZB 1IGJB 3C5ZA 4P2RD 3MLRH 1MI5D 1F4WH 1T2QH 1TZHA 3CX2A 4I2XE 4QHNB 1FHGA 3LMJH 3RWIB 1F4YH 1YMMA 4ZUSB 2VLJE 2XY1A 4M7KH 3SDDD 1F8TL 3UYOD 4JDTL 5SWZE 3DJ9A 4WTZG 3AM8C 2PO6C 4JG1L 2E5EA 3IAPA 1MWAH 4Y4HC 5JOFA 4NKIL 1ZT4A 2VLRB 4FFVC 3S4SB 3WO4C 1J0KA 3BXNB 3AM8A 5IOPA 3CZFA 3BUYA 4OZHA 5JZ7C 4YHLH 4HUNB 4NUJB 1L7TH 1Z9LA 1NCNA 5F88B 1X5FA 4ZQKB 5EU7C 2O5YL 1NGWB 3OJMB 4KK9D 1WCBA 4NQDA 1QOKA 4X99A 3BN3B 4R26H 1BBJA 5TGBA 3T8XA 1FE8H 1RU9L 3WNNA 3BKML 5CJXC 2V17H 1MQKH 1S7UB 3QIWB 5C0ND 1OAXL 2W9EL 2BVPA 4LARL 1V5JA 4X7FC 3KNBB 5I6XC 3VXRE 2ZOLB 1G9EA 1ACYH 1OVZA 2OP4L 4AMKL 2ARWA 2FR4A 4RMWA 1DJSA 1G6RL 4M7JL 1X6NA 1E4KA 1QTYT 3GB7A 5FYJE 4NOFA 2H8PA 1MFBH 3RPKA 1CFQB 5EPMB 2Z31C 4NRYB 4JVUA 5T1LB 3EDFA 4L3EA 5CKAA 1MFCH 1KT2B 3PL6A 3HC3L 4ZS7L 3QIWD 5IG7B 1U3HC 3O4OC 3Q5YA 1BFOA 4XCEA 5CD3A 4UB0L 5DVLA 1IQDB 5KS9E 1K8IA 1YEEL 4JFPB 4M1GH 1CL7L 4G9FE 1QRNB 5A2IH 1PD6A 5D70L 3TBWA 5TDOA 2BNRB 2YUVA 4L8DA 4OLZH 4FQQB 3QUZB 2WWMC 1KPUB 1V7ML 1XGPA 4QWWD 3RWJB 1LQSR 4BFGA 2ESVB 4P3CL 1I9JL 4PRPB 3RPIB 3MODL 4L4VE 3ZMRA 5HY9B 4PY7B 5T1LD 5F6IB 4QHUA 2Q7NA 4KVCH 5CIPA 5A2KH 5FA4B 3RP1A 4OCSH 3EOYG 2D9QB 2OI9C 1BAFH 1INDH 1Q0YL 2UVEA 5C08A 3BO8A 1IVLA 1CGSH 1QRND 3DWTA 1CU4H 4G6MH 1MCDA 2BNRD 3INUL 3QUZD 3CJJA 3LKRB 4OCXH 3JWOH 2X09A 5D4QA 2ESVD 4PRPD 2BSSA 4XC3H 3L5IA 1R24A 1T2XA 4Y5VA 4WEBL 3SKMA 4A2MA 5J0BA 3S88L 1BWWA 4OFPA 4WNQA 1FZOA 2Q6WA 2E7HA 1JZ5A 1LE9B 4I3SH 1FPTL 1OTTC 4R4NC 5I1KH 4U1JA 1OP5H 1MIEL 1NL0L 5J3HC 4ODTL 3SPVB 3IFLL 1JI2A 3AS3A 5CZXD 2DWEA 1A3LH 4H8WH 3IS0X 2P49B 1GZQB 5EWIH 3WFCL 1KTDA 4ONHA 1Q9KB 1X3DA 3L3HB 1KGCD 1RZ7L 5B38G 3IU4L 3AXLB 4MAYB 4XX1E 3I02A 1BD2B 2X70B 2CLVB 3O3EA 4HBCH 5DJDA 5SV3A 1QYGL 2CGRH 2NY2C 4NNXB 3DRQB 3ZYOA 3EDKA 4AQOA 1KXTB 1A7QH 5EBMB 3SDCA 4F33B 4X6EA 1B90A 5H94B 4ZYKA 1S7TA 1TPXC 4Y88A 2APTA 2ZNWA 4PJXA 3JXAA 1H3PH 5SWSB 3NIDE 1TQBC 4YZFF 3ZHKA 3WSQL 4G8IB 1TZIA 2YK1H 1KCSL 5CLTA 3QO1B 3RTQC 4GAJL 3R06B 5GRWA 4K3GA 2X4QA 4MAYD 5B4MD 2JK5A 3IJHB 5SX5H 1BD2D 4MQ7A 3RUGB 3QDGB 1XZ0B 4WW1B 1LGVA 4DVBB 4EIGB 4M48H 3KPTA 3C9NA 4WUUE 3UAJC 2PTTA 1I7ZB 1NCDL 4RWYL 4AEIH 2PXYC 2W0FA 2G2RB 4QY8A 1JPGA 2XKUA 5SWSD 4I0KA 5L2JA 4BZ1L 2EDHA 4NZTL 1HHJB 2B39A 1YQVL 5B38A 4M5ZH 3LS5L 1C08B 4JRXE 5DD6B 1Z3GH 1ETZA 4F7EA 5K9QI 1RFDL 5J6GB 3QDGD 1Q72H 2ZJSL 2P8MB 3BJLA 1P1ZB 1GZPB 1VENA 4OGXL 1J0JA 5DFWH 2EIZA 4KKCC 4RGNC 5GZND 5FF6B 5TQ0H 5J56B 4MJ5A 4LCWA 4PS4L 5E08L 5CJQL 2DJ4A 4XHQA 3AC0A 5DJ2B 5DJCA 1GAFH 1OSPH 5E00B 4GG8B 3KYAA 1HNFA 4GKNA 4UV7H 3V0WL 4HZLA 4M5YH 1T3FA 1DQMH 5C9JA 4OD2A 1GPOH 3C5SA 3VXPB 1CR9L 4EDXA 2XT1B 5HHXH 4LSUL 5D6CB 3ZZ1A 4MA8L 4Y4KC 4R4FL 4P59L 3SN6N 2DM4A 3BP4B 2H45A 2R1YB 3MUGB 3MXVH 1K5NA 3HNVH 3QAZB 3VD3A 2XN9E 4J4PC 1MAMH 2PW1B 4HKZB 4P2OA 2JCCF 4XVSL 4F15C 4GRLA 3SGEI 1D7FA 1A47A 4RX4D 5HI3D 1CFTB 4XC1H 2XA8L 4KVNH 4PTTB 1EMTH 2NR6D 5D7LE 5ENWA 3ULVH 1FVCA 2IMMA 4RDQG 3RY5A 5I8CB 1EXUB 5D9SA 4YXKL 3DETD 5I1GL 3SJVB 3ILQC 2ZSVA 1MFDH 4KH2A 2EXWD 1NAMA 4WDIA 1HYSC 4NN6C 1RZ8A 2COQA 5F1IA 1PX3A 1MLBB 3DROB 4NNYB 1CDIA 1M4KA 1JWUB 4JM2B 1A3RH 1KLFA 3LKNB 3P0YL 5CP7B 1BEYH 1CT8B 4Z7VF 1S9XB 1AHWC 3ARWA 1BM3L 3SJVD 4RZCA 1CCZA 3QQ3A 3UTOA 2J88L 3H42H 2YD4A 4H0HB 4IOSD 1RJCA 3GI8L 2HFTA 3S7GA 2X1OA 1NANH 3U7YH 4PY8I 1OTUC 3VRJA 4ZO6A 4EI5C 3P9MA