4XNQB

Antibody hemagglutinin complexes
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
217
Chain Sequence
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords H5.3 Light chain
total genus 45
structure length 217
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB01
5MI0B 1KT2A 4MD4B 4XX1G 3WHXB 4U3HA 1EUTA 1Y18B 5D70H 3R8QA 3MRIB 4IHOA 1ZGLA 1SJEA 1OB1B 4PV8B 3QHFL 3QSKB 3GI9L 3Q5TA 3C9NB 2XY1A 3LEYL 4ZFGH 5FYKL 5JW3L 1NBVL 3BEWB 1P4LB 4PV9A 5DUBA 5ESAB 3BWAB 1VGKA 4ZSOE 5F7WC 4J23A 2FJGB 3BP7B 3UTTB 4XPBL 1RJLA 1QA9B 2IANB 3ISWA 1PY4A 1IQDB 4U49A 3WS6A 2G9HB 5JZ7D 4UIMB 3VGFA 4OZIF 2IH3A 4UT9L 2J12B 1S78C 1CFQA 5JW5A 5I1CH 3HRZA 3WS6C 4LVOB 3MGTA 2Y07L 2E9BA 3OJMB 4LARL 5EBWA 5EWIH 2AVGA 4GAGH 3HZMB 4PD4K 3VGAC 2OTPA 2CD0A 4K7PY 1AGEB 2HJFA 3MLRH 3VXSE 4B7LA 1UCBL 2HT3D 2Y1VA 3DUUB 4KROD 1NEZB 4PJBE 2XACC 1U3JA 3BKYH 2YA2A 4QRTB 1A2YB 3ARRA 4CDGC 2DIBA 1VFAB 2FH8A 2P5EE 1BAFH 5DJ2B 1HQ4B 3PXJA 3MFGB 4WDIB 5BRZB 3D87B 1W2KT 4Q58C 3KYOA 3QI9D 4QF1A 1WT5A 3QPXL 4QGTA 4WFHE 3ARFD 4NM4L 2RGSA 3PIQA 2ZPKH 3MR9A 2OP4H 2ZNWA 3PGDB 1MIEH 3HA0A 5ICXA 5TPWH 4L8BA 3QYCA 2XZAH 3HZVB 5I9QB 1FFOB 2VXUH 4ENEC 5EOCJ 15C8H 4NKDA 1KN2H 4ZD3L 5GZOC 4HJJH 1EAPB 1C8PA 8CGTA 1M6OB 4W6YB 1NANI 3MCKA 3IXTB 3MBEB 1X6NA 3QFDA 3QHZH 2ERJC 1A0QH 3BKCH 3FQTB 3ARGD 3EYSH 2IANE 3WNLA 5I16B 4AEHL 4Y4HD 2C3HA 3TVMC 4I77H 1LEKB 2YA0A 1BIIB 1JGVL 4OD2B 2J6EH 4LAQH 1IGYB 3RPIB 4U1NB 3RQ3A 5ACLA 5IQ7L 5CJXA 1QSVA 5I76B 2VXSL 5B8CA 4L3EE 3VFGH 3LB6D 4LF3A 1PYWB 4HSQA 3MV7D 4POUB 5ELIA 2PN5A 2ADFH 4JR9H 1XF4A 4Z18A 5D1ZD 4LSRL 4RFNB 4MCZB 5HTSA 4KHTH 1YN6A 4TUKH 5HYJB 3H7BA 1MFDL 1FNGB 5L9DL 3CZFA 1A0QL 5T1KB 3IJSB 4MQSB 5CEXB 1ZHNA 4R4FL 1T89A 3C09C 4ZO6A 4AJ0A 2VXUL 4R26L 3CK0H 3QFJD 1E4JA 3ARYA 4EIZC 1T1WA 4W68A 4ODTH 4JRXE 3TBVB 3ULVC 5CJOH 3VXRD 4BA8A 5FAAA 3V0WL 1MLBA 5IHUL 2FR4A 2E6QA 1VGKB 1X5YA 3QQ3A 3MNWB 3D9AH 3HB3D 4PJEB 1KJVA 1RJLB 1VSCA 5T1MA 3RTQC 4RQQA 4ZO7A 3S37L 3N0PB 4RIRB 4MA8H 1GCFA 2ICCA 3DXAD 5FO7B 1LILA 4WHYH 1HHIB 1U8NA 2DM7A 3TWCH 5IB1A 4LLAA 3N06B 2ZUWA 1YECL 4RISL 4J1UA 1JZ8A 4PG2C 3NTCL 3O9WB 4PGEB 4GMTL 5EO0A 1EXUB 4TSCH 3RY6A 3OQ3B 3QDGA 2E6PA 2BVQB 5D6CB 3FO1A 4PJFF 4L3EA 3ZDZF 1LDPH 1MIMH 1P7QA 1CT8B 2F53B 3NCBB 3MNZB 1TZGH 5KS9F 1MOEA 1OGTA 1C16A 4NQSA 1U92A 2H41A 2Y25A 4MJIE 4BSJA 4I4WA 4JGUA 4CN6A 4EI6A 4H26B 4XCYA 1R3KA 3T1FA 1UADC 5C0RL 3LZFL 5C70A 2YMXH 5GJTH 3IAGC 1YNTB 2RQ8A 4KK8C 2XKNB 4IJ3B 4ZAKB 3ZE0F 1H3TA 1OWRM 3U30B 4FNLL 5I74B 4KVNL 1KCSL 4MDIB 2AXFA 5LVEA 1M71A 4K23L 3C6LB 4L4VB 4XGZB 5F89A 3RRQA 3VMPA 3EIFA 4X6FA 4DVBB 3QJFA 4DN4H 3SHSA 4YHZH 2B0SH 1NGYA 2EDOA 4N0CC 4X6CB 3UTOA 4D8PA 5HYSG 5D6DA 1ITCA 4HMCA 1YY9C 4MXWH 2EXWD 4OGAC 5FKAB 2NW3A 5JDSB 3JSSA 3VFSB 3ARZA 3RHWK 3TJHD 5I16A 1H3GA 3NBNA 2PYEB 2ENYA 1BGXL 4B5EA 3EHBC 3RY5A 2F54B 3CLEH 2YPKA 1LEKA 1B88A 2VLMD 3GRWL 3HCVA 1AGDA 5JPMB 2E9IA 2DWDA 3M8OH 4NO3A 4FQJH 4QTIH 5D7IA 4C4KT 4K94H 4JPIA 5FF6B 3B6SB 2H32H 1MJJA 2EH8H 5E5MA 5L0QC 2W91A 1MREH 3SKNA 2EXWC 3W81A 2UY7A 5INCB 3NPZB 4YEFA 4W70A 3TT1L 4NO0B 2DI7A 3MSPA 3QIBD 4PRHB 4R8WH 4GKNB 4HK0B 1MWAH 4LNRB 1K2DB 1WFUA 5EB9A 1G9NL 3KYNA 4QHUA 1GGBL 3FT4B 4I0KA 4KGLA 4U7SA 1FFPB 5IOPA 4P2QE 2HVKA 4Z76B 4NUJB 3QDMA 2LU3A 4Y2OA 5D2NB 2FX7L 4P9HL 5L0QB 4XNUL 4XP6L 1G9EA 2JIXD 4UZGA 1RZKH 4H20H 5HYQA 2MJWA 3VXSA 3PGFH 3QQ3B 4UIKH 5CZXD 1YMHA 1S5HB 2G5BB 1GH7A 1L0QA 2D7PA 2CDGA 1XF1A 2XIDA 3BPCA 5FO7A 1Y6KR 4KZDH 3SCMD 1VCAA 2C4FT 5JIPA 2I9LA 2VN4A 3S3JA 5I1DB 1DEEB 4NZUL 1TITA 4YO0A 5K9QG 3RU8H 2VC2L 4KJWC 3TCLB 1E4XL 3VXUA 3U79A 1Q94B 2O5XL 4N0UE 1F6FB 2ZCHL 1T21A 4FP8H 4F58L 1JUFA 1KEMH 4N8CH 4ODSL 1GVIA 4OLXH 2KUTA 3DSFH 4JFZL 3I6GB 1BBDH 4V1DE 3CFEA 5C0FB 1ZK9A 4ZPTB 2YD8A 3TH4T 3CSYB 5DO2C 3V5DB 3SO3B 2R0KH 2YK1H 2H3NB 3V7MA 2RCSL 4ZAKA 2XA8H 5EDXA 1UA6L 4XVTH 3QBTB 4KK5D 4RAUA 1JNNH 1B2WL 3P9WB 4JHZA 3QUML 4U6TA 2A6KA 3REVA 3O4OC 1P4BL 5F6HJ 1A02N 1F8TL 4QHLA 4XPGH 2NY3D 4HIHB 4R8WL 4KU1A 1FL5A 4KI1A 2EO1A 3FN0H 4LCIH 4LKXB 2YPVL 1YYML 4WNQB 3OKEA 5EBGA 4HK3N 3IU4L 3KPOB 1IQWL 3TN0A 4GRWH 5C6TH 2PKDA 1XZ0A 1R5IB 4LSVH 2ARJB 2QADB 4F8TA 3D5OF 1ZSDB 4WW1A 2B5IC 3U4EB 3L7FB 4MJ2A 4I0PA 3RWHB 2VE6A 3BZFA 3BE1L 4XAWH 1LD9A 2EDKA 4X80L 3QXAB 5FUOL 1SBSL 1JGDA 1N3NA 1OTUC 4HQQL 5EUKB 2DDQH 4DN3H 1IKFL 5D1XC 1QNZL 3X3GH 4PJGB 1V3MA 4YHLL 3PHOB 3SN6N 3V8OA 1BJMA 2Q76B 4J3UA 2E8ZA 4D0BB 5BZDB 1G9NC 3GIZL 5GIRA 5IFAL 5IHBA 4GW4B 5GRWA 3RNQB 3EGSA 2EH7L 3TJEH 5A2IH 4BQ9A 3MV8E 1A7PL 3IGAA 1YNKL 4YHIA 4YNYA 1RZ7L 2DQJL 5GZOD 1ADQH 5GHWH 3VG9B 3GSUA 4LBEA 3S7GA 1B4JL 2LAGB 3RWDB 5D7SH 3KJ4C 4G3YH 3LCYA 1H3XA 2EKSA 5T3XE 1MFDH 3RL2A 2WLYA 4XBPB 3CSBA 1P7QD 5FM8A 1GOFA 4ZAKD 3HTLX 1KG0A 1WSST 5CBAA 3DYPA 5AD0B 5EU7E 4HXBH 2ADFL 1FNSH 1G0XA 1MH5A 3ARBA 1NGXB 1T20B 3L3HA 4ODVL 5GZND 3IS1X 4NO2B 3FL7A 1YQ2A 5C8JB 4YC2B 4YXKL 1LO3H 4NM8L 5FHAH 4OLWH 5IM7B 4YQXH 4AENB 3IF1A 4NWTL 4UV4H 4LVHC 3AUVA 2GFBB 4PY8I 3TCLA 3O3AA 4X9HA 3N9GL 1HOCA 1IEBA 1N5YH 4H25B 5CMAA 2VDNH 4OLUH 4GMTH 5E95B 5ECJE 2AJXL 3VWJD 1DBBL 2R2EB 1F42A 5DMGC 3V95A 4I3RH 3NACL 15C8L 4I2XA 4WI5A 5JPNA 4XPTH 2ZJSH 1AHWB 5JXAH 2HJLB 3E3QC 3QUZD 3ULUH 3VXRB 1KLGB 3OJDB 1HHKA 3Q6GH 1NUNB 4YH6A 4JLRA 5DRWA 1S5IL 3D69B 3FMGH 4GSDL 4LSDA 1KIPB 2CJUH 1K9TA 2DQFB 4DK6A 3IXAB 1R0AH 1IKNA 1AE6H 3PV7A 2GCYB 4ODBD 1SMOA 5FGSA 5KG9B 1PW3A 1HYSD 3DXAA 5ALBH 1RHHA 1H5BB 1QOKA 2W9LA 5IMKB 3SOBH 4QHLB 3FQRA 4NKOA 2VLJD 3Q2CA 2PR4L 4XTRD 3RPKA 3E6FA 4L9DA 4S1SH 2X5PA 2NY6D 3DI2B 3FQWB 4LPCA 1F3JB 5CEYA 4R6UA 3U4EA 1T0NB 5HDQH 2F53D 4U1HA 4PGBB 2WANA 5C3TA 4M8QB 1O5DT 1BFVL 5I1HH 3QXAA 2PYFB 3Q6FA 1RK1A 4MX7A 5E94A 4E0RB 2CLRB 4P2OB 4YFLI 2D3VA 3NFSH 2ZSWB 4ZS7L 1JGUH 4JDVB 4IDLA 3T0EA 5FYJL 3UTZB 5MEPA 4LRNL 3BVNA 1QR1B 3KGRA 3IDIA 2QADC 3IJHA 3IETA 4D9RD 1ZEAH 1F2XK 3EYVA 4CN4A 1QBAA 2OJZL 3PDGA 1SJEB 1DVFA 4XHQA 4LIQL 5CHNB 2EECA 2CLZA 4PJ9A 4JQIH 3QJHB 1UXSB 1MCQA 1RUQL 2DN7A 4LPUA 1LVEA 1IEAB 4I13B 4MQXD 3MLPA 4LL9A 1RUMH 2DIJA 5LWYH 1KCSH 3N1QC 1MJ7L 3KDMB 5KVEL 2Q8BH 1Y18A 4G7YH 4AMKL 3FT2B 2ZPKL 4LRIC 3U46B 2R1XA 4C56E 1G6RH 5EC2A 3MUGA 5C86A 4JHWH 1J0KA 2EE3A 4HLJA 5C08D 3SO3C 5JW5B 5D71H 3QDJB 2AJSL 3DVIA 3EUUA 2NNAB 5DJCA 3GSXA 1NAMB 3KS0J 2XQYK 3MRHB 5DUBB 3MRNB 5D7LE 3RA7H 1F2QA 4KZEL 3HZMA 2X10A 4CDHA 4U1MA 3ARDD 3G6JB 4YGAB 2EDHA 2BNQD 3PWPB 4G5ZL 4X7DC 4KGJA 4MGXA 4XHJD 2C26A 4XAKD 3S37X 1HE7A 4LSPL 4WI2A 1PG7L 1TZGL 2QHRL 1X3DA 4KJWD 1A47A 4O9HH 5IBUG 1N59A 4YC2C 4G6JL 4CU8A 2GFBA 4OTXH 4PB0H 3MRRB 2VDOH 3VFTB 4Q6IC 4CADA 1NC2D 4X99B 4Y4FC 1T1YA 5J9PA 2W59A 2GJZA 4KAQH 5CCKL 3HI1A 4YXLL 4XBGA 1TQBC 5CP3H 3GMNA 2DM3A 3A67H 4H0HB 2R2EA 3LKOA 5E1AB 4Y4FA 3MJ7B 4JM2C 2E7MA 2R0KL 4IOSD 5ETUB 4QNPE 1U9KA 4MA8L 5KW9L 3PGDA 25C8L 4CBPA 3LN4B 3QZWA 5DC9B 5DTFA 1DANT 3MV8A 2CJUL 2JJUA 3IT8D 4KKAD 3BP4B 3BPNB 3UJIH 3ULUE 1S5IH 1TLKA 1QBLL 4NQDB 4Y2DA 4PJDF 5JR1H 3U48A 3MLYL 4OF5A 2VLKE 1JIBA 4HF5L 5CILH 1RZGA 4ZTOL 3RL1B 5HHVL 2I5YL 5ICXB 2PUQT 4IMKA 3NZ8B 4GAYB 4WCYL 4KHTL 1BLNB 1E6OH 2Y5TB 1DLFH 2DLTA 4JRXD 2R0ZL 5SWZD 3RVXD 1JPTH 1CL7H 3V4PH 5IEHA 4UOJA 2A77H 1SMAA 4A6YB 1VEOA 2FGWH 1OP5K 4WW2B 3QUKA 3GIVB 5C09B 1E28A 3CFIC 3IXTA 4BH8B 5DT1H 3D0VB 5C0EA 5GXBB 5ALCL 4YXKH 1G84A 1G0YR 2D7NA 4OV6F 4EBQH 4WEUD 5KN5B 4OF3A 3H2WA 5MEPB 4X9GA 3DV4A 5DI8A 4K3HA 5HYJA 4TN9A 4M1DH 3S36L 1EX0A 4M5ZH 4ODUA 5D7JA 3SPVB 1MFCL 5GGRA 2YBRA 5EOQH 5KAQG 2J6EA 2YD1A 5C0AB 5K59F 1U95B 3HS0A 2YPLA 2XWBA 2B1AH 3FRPA 1NH6A 4EDWL 3GMMA 4DZBA 2FNBA 3UYPA 1EJOH 1TPXC 3LIZL 2O26U 4X7TA 2OI9C 4KK6C 2FLRT 4ZUWA 4X7CC 3LMJL 1AO7A 2VAJA 5HHOE 1DQDH 5JO5B 1TCMA 4J3TA 4Y19B 2VZUA 5HGHA 5T1MB 1KJ3H 3C60D 4RMSA 4FTVA 5JLZA 5TDNB 1QSED 5D8JH 3HPJA 5EBMA 5EBLA 5ENWB 4YXHH 1V5JA 5HGAB 1AP2B 2BOCB 3GIZH 4PJ5A 1K5NA 3ZDYF 2GJ6A 1EEUA 4L8CA 3ZTJG 1JZ5A 1Z3GH 5CINH 5EO0B 4JFQB 3EYFB 1INQA 3EFFA 5FYLE 1X6LA 4F9LC 5LGHL 3RDTA 2VN7A 5FUOH 4K94C 4RWYL 3JWOL 3VXQA 1L7TH 2ADGA 4KUCD 4AIZA 1AD0A 3C5ZA 4DN4L 4J1UB 4NWUH 5HYEA 1UM6H 1YPZE 1U92B 4AEIH 5DA4A 3P73B 1X5GA 2FWOB 4ZNCD 4CADB 1EEZA 2HKFL 3T1FB 1IQWH 4RDQG 2R2BB 1GRWA 4D0CA 1FCGA 1RIVH 5KVGH 4Y4HB 2NY1B 1D5IL 5I73C 5CSBA 1LEIA 1EH9A 4HBQA 4LNVA 5E00A 1CTOA 1PG7X 1FFNA 5CSZB 2AABL 3D2UD 4V2CB 3MV8B 2C4FU 1U8PB 5F7LB 1M71B 1N64L 3QCTL 1UWEH 5ISZD 3HAEH 3DXAE 2CKNA 4PJGF 1YEFL 4DVBA 1J8HE 1A5FH 1MHHB 2VR5A 2FEDC 2H9GA 1ND0B 4LASH 4QXUL 3VGGA 2JJSA 1NGYB 2B1HL 3CVIL 3WLWC 2ZCLL 5E9DA 3DTXA 1BQHG 3KLHD 4WUUB 3QUMA 2BCKA 1CLYH 2HYMA 5ILTL 1GGCL 5IMOA 2A9NH 1X7QB 3EAKA 4X6FB 4CU6A 5DJ8B 5LQBL 1I7TB 1JF1A 3F6IA 4NJAH 4OQTH 4M62H 1AGDB 4E41A 1D5BA 2R29H 5EN2B 1Z3GL 5CINL 1E28B 4NZUH 3MNVA 5BZWA 5TQ0L 4HH9B 1H15B 1OCWL 3O4LE 1ACZA 1A3LL 4LFHD 4Z7NF 4QXGL 4XNXH 3IKKA 5DMJB 3C08H 1CXIA 2UZYB 4MZ2A 4R2GC 5KN5A 4HIEA 4NSKB 3S4SB 1YEDA 5KTEH 3GBNL 5C6WH 1RIVL 5FK9B 1I7RB 1W72A 3G5ZB 2YPKB 4M5YH 3QAZC 3QRGH 1NSNH 1UZ6F 4XMKL 4GKNA 1FL6A 2VOTA 1FPTL 3LQZA 5D7LB 5TF1L 2UYLB 5GGTL 5E9DD 1JN6B 1YYLL 3TBYB 1JRHI 1NJ9A 4BKLA 3HI5H 4Z7WB 5AZEL 5GS2D 5E6ID 1S9XB 5A3IC 5E08H 5DQDH 5JXEC 3S36H 4UTAL 3S35L 2CLVB 4MJIB 1J9CT 2WMPA 1RY7B 4OZIB 1UB5A 4LNRA 1I85C 4NQVA 3BPCB 4GLRH 3RJQB 2ICES 1HZHL 2BNRA 1NFDB 3O3EB 2J8UA 1UJ3B 3AXLB 4K94L 1AP2A 4NUJA 1QR4A 4PJ5B 4Y4FD 3DBXB 1EBPA 2WAHA 2IBZY 2PYED 3WE6A 1KEGL 3M1BB 1DN0B 1CF8H 1EMTH 1MCHA 4RWHA 3QCUL 3X3FL 2AV7B 2DQIH 7FABL 1TZHB 2HKHL 3EYFA 3TH2T 4D9QD 5HYJD 4S1RL 2F74B 3DX6B 3T0XA 5DD5H 1R3HA 1P6FA 5C0AD 4OGXL 3CVHH 4YAQB 5TE4H 3RGVD 3VXQB 5HVGB 1QBMH 1R3LA 12E8H 4ZTOH 5DZLA 3T0EC 3W5MA 3CFEB 1ZANL 1IM9A 2OBGA 4P23B 5KJRH 3M07A 3UTPD 4MAYA 3UBXG 4ONFL 2EIEA 2NXYD 1D6VL 3KAAA 5SWZA 4MA3A 4P2QB 1YNLL 2ORBH 4M6NH 4KTYA 5JORA 1U41A 3LS5H 3D1MC 2RHEA 4PS4H 4KMTL 4FZ8H 3MMEB 3L3KB 2DYPA 4LLQB 5HI5D 3LKPB 1PY9A 5FIEA 2NY0D 4MSWA 1N4XL 1INEH 3KHOA 1CL7L 2C1PB 3T3PF 4NN7B 3WEXA 2Y9RT 3G9VA 2ICEA 4PJHA 1SY6L 43CAB 3O3DA 4KDTC 1ZSDA 4WW1B 4KXZH 3VXRE 2VZOA 3MOAL 4DTGH 1KACB 4BELD 5J06A 3HE6B 1U3ZA 1KCKA 3QFJA 2J8UF 3EO0B 1X7QA 1NC2B 4RGOL 3BJ91 1X4YA 4WY7L 3FZUC 5DRNA 3BI9X 1UM4L 1JYVA 3KWWB 4AQOA 4U0RB 4UT9H 4KZEH 1REIA 3DROA 4HS3A 3ZL4L 1V7NH 3QO0A 4ZODA 5GIRB 1JL8A 4S2SA 1LD9B 5BV7H 1OP3K 3UC0H 2OL3H 5JOPD 1R3IH 4OZGB 2FSEA 1TCRB 1S78D 5FYKH 4M7LT 1W72B 5EU4A 4FQQA 5IFJA 1X9QA 4YZFF 3LEVL 1RUML 3IGAB 4HV8B 1LNUA 2AEIT 1F5WA 5EU7C 4X8JB 3S34H 1RD6A 2HMID 3ZYZA 2ADJB 5C0GA 4OZ4B 1RJCA 3OAYK 3ARTA 3RL2B 4ODTL 4Z7WA 4BKLB 1B0GB 4F7PA 4RGNB 1OB1A 3C8KB 1ZVSA 5I15L 1OTSD 4QRPA 2P5EB 3HNTH 1DUYA 2A6JB 2NY0B 3VFMB 1AGCA 1MRDH 3B4NA 3U7WL 1MH5B 2R23B 3HZYB 2DMCA 4PJFB 3MV9D 1FNEA 3ULVH 2H32B 4HLZH 3O4LD 3WKMH 1BQUA 3BKJH 1UJ3A 1CGWA 5H94A 3C6SA 3VWKB 4XBPA 5DR5H 3L7EA 5CBAB 4UU9A 4HCRH 2VLRB 1KGCD 2FECL 1P2CB 4MB5A 5E5RB 3KR3L 5A1AA 3GMLA 3L3HB 3DWTA 3HC3H 1ZT4A 4F33B 2IG2H 2XTJB 1MFBH 5I75C 3I84A 1CD8A 5DQ9B 1JGEB 2VR4A 1VGEH 4Y5VB 4JRYD 1EEYA 2BHZA 5E8PA 4NPYA 5FYJD 3JV6B 4PJEE 3F5WB 5ALBL 1JF6A 5HHXH 1PSKL 2EC9T 3DUUA 1DBMH 5DJDA 1ZLUK 2BNUA 1TVBB 3DETC 4WHCA 1A6WL 4POZC 1QLRA 1CDCA 2NY4C 5GRJL 4XWOC 1EEQA 1T0MB 3IDXH 1R3JA 5B4MC 1CIDA 1ZHKA 1OM3H 1Q9WA 4XNQA 1IGCH 3MJ8A 1PQZA 4RMWA 1D5MB 5C0AE 3HKFA 1EGJA 2ZUVA 3BAEL 1FG2B 4MSWB 2NY5C 2BJMH 3MV9A 5DVLA 4PP2B 5DRWB 4HUVB 5D2LE 4S1SL 1DCLA 2W92A 1FVEA 5GRXG 4RZCB 4BQ6A 2ICEB 5MHSE 3SJVE 1TFHA 2V5TA 2G60H 5ADPL 3KPLB 1T0NA 3IAPA 2F5AL 3SOBL 2P49B 4EI5A 3BSZL 3GSVA 2PYFA 5DJAB 4JKKA 3DHMA 1RZJC 4NKOB 3EO0A 2AJYL 1IC4H 3P4MB 1ZT1A 2CLRA 4WTWA 2MKWA 4J4PC 1NGZB 3Q1SL 5DRNB 3U1SH 4TNWF 2ZSWA 1IGCL 3DVNB 3W2DL 3D3VB 5DXWA 4JRYA 4Y8AA 3LEVH 4PJAE 3GSRA 5CBEB 2IAND 3P4NA 4HS3B 5BOZG 4AEFA 4MNQA 2UY6A 3BP5A 1B0WA 4OD2A 1J0JA 4JFDE 3LKRB 1AXSA 1HSBB 1DE4B 4OZGA 2Q7YA 2GYSA 4JDZB 4DGYL 3MUHL 1F58L 1WZLA 1MI5B 4U3CA 3MRGB 2AJVL 1AY1L 2BDNL 3QJHA 2V2XB 2D9CA 2QBWA 4ORZC 5K9KB 2VDNL 4OLUL 4DUXA 4JVUA 3A6BL 4XMLL 3KYKL 4TPRH 2DQGL 1DSFL 3BESR 4WU5B 2VDLH 5F70A 3LS4H 4CVXB 2XZCL 5CHNA 5IJVB 4OLWL 4LHUD 5EUOF 1MCWM 2GSIA 5F7MC 2VITB 5IV2A 2NY6C 2E27H 5E2JA 1G7JA 1JPSH 4BUHA 1OPGL 4TNVF 1OP3H 3MNWA 5AG8A 3MRDA 4V1DB 1YEGL 1X5IA 4KRLB 1FNSL 1OTSC 3HUJE 5I0DA 3W39A 5TE6L 3VWKA 4OCRL 2AEQH 4Q97A 3MUGB 1I8LA 4Y0GA 3VG0H 1U8NB 3W82A 3DVFA 3O4OB 1MRDL 1HK6A 4X7FC 1HQRB 5GRVL 2A83A 3SKOA 3WUWA 1MJ8H 4X99A 5EZLB 2I60L 2DOCA 3G6JE 4U1JB 1PKQE 4OZFH 4DGVL 1U8KB 3H3BC 1LO0L 3LKOB 1KPRB 5KAQF 5DJ0A 2CGRH 1F8TH 2EC9U 2LU4A 4XPGL 5L2KB 1RURL 3D18B 4K9EH 1AQKH 3FOMB 3E2HB 4OKVB 3FFCD 3L3JB 4S11A 1SEQH 1T2QL 4NWUL 4NQSB 4QRRA 3NPSC 5GJSH 1BVKA 1JPFB 4QRUB 4NQDA 4OCRH 4OZIE 3LPWA 1C1EH 3B9AA 4U6VL 3E3QE 5C08E 4PJ7B 2OXGA 3QDJD 2WINB 3VWJC 4FXLA 2M1KA 4UOW1 3C6LC 1X4ZA 2DTML 1XGTA 2FBOJ 4ODSH 3W0WE 4Z7WE 3OAYH 4BH7B 4HEME 4QRPD 2P44B 4LSVL 1GHFH 3NZ8A 3ARWA 1IILE 1IL1B 5EORH 1HZHH 2I9TB 3MOBH 4JZNA 3D85B 2E7CA 1FLRL 1N6QL 2AI0H 4TPRL 1JJUA 2FEEI 3S96A 4FQIH 3QJFB 3JV4A 1A3RL 1FP5A 4JJ5B 3QUKB 2R9HD 5D1QA 4HT1H 3QXDB 1QLEL 2WLZA 5BS0B 4IM8A 3GSVB 4CKVX 5CLWA 2HTKC 2MSPA 4J3WA 1YZZA 2Z9TA 2A6IB 4F7EA 1DLHB 2NMSA 2FLBT 4HAFA 3QDGD 2Q87A 3QRFM 2IH1B 1OP5H 4Z78B 4HPYH 4GAFB 4FOMA 4M7ZC 5F7YC 2K3TA 4P0DA 2DJ4A 1AQDA 3HNSH 3BZEB 4Y89A 4XBEL 3SCMA 3UMTA 3HC0A 1FRGH 1FGVH 4X7TB 1JZ4A 4PJCF 3WXVL 1KB9K 3K8LA 5INCA 5IGXL 4OGYH 4KDWA 4P46A 1DUZB 2K1MA 5D7JB 4HK0A 2IAMB 3L5JA 4KV5E 4JFHE 4HS6A 3HMXL 1E27A 2F5BH 4M7JL 3P11H 5DYOA 1TQCC 2YRZA 1CLYL 2EH8L 3VXMA 5E8DL 3PWLA 1UG9A 1A3RH 4Z76A 1Q9KA 4QTIL 5J0BA 2EEDA 1UJTA 5HHVH 4YHYC 3EKCA 1K5NB 3HE6D 3V2AR 2DQIL 4P4KD 5B39B 2GJ6B 5E2WH 1NBZA 3CXHK 3RI5K 4ZUWB 4ZQKA 4XXDA 1S7TB 2X4OA 1KFAH 4HWZA 3BQUC 3I9GL 3PXHA 1E4KA 1I3RB 1I7UB 3CLEL 2IANA 1C12A 3VXPA 2ITCB 3UTSE 5JR1L 2HLFD 3MLUH 3TN0C 3W39B 1KF9B 4FFVC 2QKIA 3TIEA 1QBLH 2VL4A 3RDTB 1WAAF 2XA3A 5B39G 4FTVB 5JLZB 5IJKC 4WO4A 2XFXB 4N0UB 2A6DB 4Z7QF 3VRJA 5HGAA 4FQXA 4BZ2L 1NGPH 4IRJC 2VIRB 2OZ4L 4KJQC 5ICZB 4NJ9L 1K85A 4L8CB 5J6GA 2YD9A 4PRDA 1WWWX 1D5IH 1ADQA 3MV9E 3J8F7 3OF6A 5F3HB 4K3JL 1KXVC 4YDLC 4DGVH 4MNQE 3MQIA 4Y4HA 4EJ1C 4HULB 2CR3A 2F9BT 1RURH 4X98A 4PJBF 1F3DH 4Y1AD 1NEZA 1MCOH 4G8EB 3TBTA 3L1OL 2FWOA 4G6JH 4F9PA 4YHNB 4UMGA 4YDVB 5C2BL 4Z8FH 1BVKB 2JB5H 4NHUB 4RX4A 1U58A 3V6BR 5KSAC 5DR5L 5CD5C 2G75B 5F8QC 4PRPA 3PHSA 3QIBA 1BGXH 3RWJB 4N8VA 3WNMA 2R29L 5CP7B 5EZIH 1R5VB 2AEQL 5AWNL 2B2XL 5D2LA 5SX4H 4APQB 1T66D 3PUCA 1AR2A 2E27L 3PQYE 2IPKA 3H7LA 2A38A 4QHKJ 2MHAA 2EDLA 1PKQA 4XCNB 2I9TA 1O7VA 5F7NC 3MLWL 1IVLA 4JG0H 4PJ7E 4FABL 4PRHD 3B9DA 5D1ZB 3SDXF 2EEAA 3QG6B 1N5AB 3IJYA 3HMXH 5BS0A 2ARJA 3QFDB 4KVNH 1JHKL 2JB6A 4P2RB 4GKSA 1XEDA 2L4OA 1WICA 2XPGB 1H15A 1KC5L 3C60C 5MHSD 4CMHB 3DV6B 5T5FL 3GHBL 4HFUH 5MENA 3C87A 4WHYG 3S4SA 2OSLB 1I7TA 5FUZL 2EDFA 4OD3L 5E8OB 1ZVHA 3OKOB 4JZJC 3MOQA 5BV7B 5C0RH 4MNGE 5J1SC 5I17A 2XZQH 2AKRB 4Z0XA 3GMOA 4LF3B 4GS7B 1AQDB 1WBZB 1NJ9B 1CGUA 3CMGA 3TA3B 3D39A 5D2NC 3RNQA 1ZA3A 2OTWA 3U1SL 2F5AH 1PGRB 1YN6B 1LDPL 4UUJA 1FSKC 3JBG7 1DUZA 4OLVL 1FGNH 2W60B 4OKDA 3MXWH 2ZSVA 1RI8A 4HS6B 4NQDE 1FNAA 2IMMA 4U6YB 2O61A 2ESVA 4NKIL 4N0FA 5CLTA 4TVSa 3AXLA 2FH6A 2ZZUT 1MRFH 1GZQB 5GSRB 3G6AA 4HF5H 5JOEA 4Q7DA 1JPGB 4M7KH 1S9WA 1VFBA 3WNPA 1VADA 4ACPA 1B4RA 5IVXF 4XXCA 5J6HA 1RULL 3DX6A 1NUDA 2E7LA 1YN7A 3L5WA 5DVMA 2QKIB 3TIEB 4JPWL 1OSPL 1OAQL 4WO4B 1RZ8B 5ACZB 2XFXA 4N0UA 4O4YL 3ZKMC 3VRJB 2E7LC 4ZOAA 1T5WA 1C1EL 2VKWA 3DBXA 1OGAB 4HHAB 5IB5A 2CRYA 5HHQB 5MP6H 4JCLA 3V5HA 3OKLA 4HWBA 2FX9L 1TJHL 2VJXA 3QIUC 5JQ6H 1I1YB 1NMCB 5D6CA 3IDMB 5JNYA 2DBLH 2R0WL 3P9LA 1I8KA 4I9WD 4PJGE 3VI4E 3WHE0 1CT8A 2F53A 1I75A 4X98B 1A8JH 4WFFD 3DHJA 4JM2D 2FGZA 3MLWH 2XN9D 4OFPA 1R3KB 4P57A 1FN4B 1RUAL 1IC7L 1RSFA 1C5BH 4MA7L 4JJHA 1HHKB 4YX2L 4PRPB 1SBBA 1MLCA 3A6CL 4FFZL 4GBXB 1JK8A 4JLRB 3BKJL 1S7WB 3Q5OA 5GSVB 4O51A 2W9EL 1J1OH 5I1KH 3WEXB 4LVNB 5D2LB 4GUPA 1MRFL 1NLBH 4PJHB 3GMQB 2IAMD 3O3DB 1TNMA 4LRIA 2AJSH 3QHZL 5MEOA 4GW5A 4AEEA 4OLZL 3U2SA 4XX1E 1Q1JL 3RX8A 4LVOC 3B2VH 2Q8BL 3HI5L 2BZDA 5I74C 3BPOC 3G6DL 4YHKL 3CC5A 3T4YA 4P2OD 5L2JA 4GRWF 4L4TD 1N0XH 5D1ZA 3ULVE 4U1IA 4X6CA 3IJYB 4PRNB 3G08B 5CEYB 4PGZA 2ATPB 2SEBA 2XPGA 4GKSB 4POYA 1I8IB 1VERA 4RGNC 5I1CL 2XNAA 3PHQB 4NM4H 2PYEA 2X9WA 5EH1A 1UM5L 4L9LC 4OD3H 3F8UB 3H3PH 1FORL 4DKDC 2FL5B 1T3FB 1ZA6B 3LRSB 3HC4L 4G80B 4JCMA 2GT9A 1J1PH 4HV8A 4KDTA 4NIKB 1EV2E 3ULVD 4FMFA 1QR1A 4QEGA 3ETBF 4GKZA 4ZUVA 1XGRB 4G6KL 3WJLA 4I3GA 3VJ6B 4DQOH 3IETB 2LAAA 3ARDA 5CZKA 4M1GH 1BFVH 3IDGA 1WBYA 5I1HL 2X4QA 4PPTA 2FSEB 1N0XL 3U7YH 1U42A 3RWCB 3TO4C 4X83A 4PRHA 2O5YL 3K7UA 4UQ3B 3GB7B 4P59H 5DFTA 4MD5B 2XTJD 5IW1B 3TPUB 3ULUC 4HUUA 5C3LD 3QUXB 5LGJA 1FFRA 2R1XB 3C8KA 3K3QA 3CZJA 5F93C 4PS4L 3HNSL 4Y2DC 3MXVL 1UA6H 2DYPD 4KV5F 5D1QC 5DD1H 3QUZB 3EDKA 3MV01 3MRLA 5EZJB 1V8HA 4U1MB 4G42B 4NFCA 1MHEA 3TBSA 3EYQD 1KULA 2R1YA 1T5WB 3IDXL 5F9OH 4G6FD 5E8PB 1A1NA 5F6IC 1DEEA 3UO1H 3BEVB 4G7VH 5K9OA 4F3FA 4OCXL 3H9SD 3CDGB 3PDOA 3PQYA 2ZUUA 2KZWA 2PO6A 2P7TA 1IC5L 3IDMA 4DFHA 2OQJB 2QQLL 4H8WC 4X6BA 1ZANH 5ABDE 3FCTB 5TDPA 1HIMH 5HJ3B 2Q3ZA 1MAMH 2NW2B 3O6FB 2VLLA 4HUXA 4XNZC 3WNNA 4NPYB 3QDJE 3HRPA 3JV6A 4MXVE 4FQCL 1Q9OA 3MFFA 1QFUL 5E56A 1KJMA 4RRPA 5C0FA 4YQXL 4TOYH 5CJXC 3S3SA 1G6RB 3LN4A 3E0GA 3QIUB 2JCCE 1TVBA 2O93L 3MV9B 4P2RE 3Q3GA 1NCAL 4HUVA 4K3EL 2PW2B 1OAZH 1KPVA 1XIWB 1A7BA 3LHPL 1L4IA 2Z8SA 4KHXH 1QHOA 4MJID 3AU1A 5E2WL 1UWGH 3WLBA 5HDBE 1T0MA 1DP0A 3AB0C 4U6VH 3X14A 3LEXA 5HSFA 4X5LA 4PB9L 2H2PD 4ODXA 5FEBA 1XGYH 1T4KB 5E6IA 1G9MH 1TJGL 5EOCL 5F97E 1FG2A 1U2HA 9CGTA 1ZT1B 2DLEA 2BC4A 4OGAD 1AC6A 4U6XB 5IEHB 3DVNA 4U1IB 3NOIA 4A6YA 1JZ6A 4G8GE 1MY7A 2IBZX 1AI1H 3GBNH 4PBVC 5DK0A 2UUDH 4EI5B 1ZLVH 5IVOA 3ZMRA 2ZUQB 4HG4J 1O7SA 2IBBA 1AR1D 4UBDC 3DRQA 1MI5A 1R3IL 1JWSB 2CK0L 5CUSH 1PX4A 3OF6D 4GJTB 3KG5A 3X3GL 4I18B 2Q76A 1YEHL 4LCWE 4MNQB 1N26A 4QOKD 4LHUG 2RAMA 2V9QA 5IF0A 1T7ZA 5C0AA 3HS0B 4UB0L 1JPSL 1P1ZB 1QLFB 3D25B 1XGQB 4K3DL 4BM7A 3SGKA 3T0VA 3PWVA 5J13C 5K9KA 4HPOH 4J3VA 5DHXB 4BSWA 4QXUH 2EXYC 4MD5A 2M2DA 1JV5A 4BZ1H 2DIAA 2DQGH 1GHFL 4ALAH 3T0BA 4XH2B 3UTSD 2DD8L 5F8RC 3JTSA 4PJDE 1GGIL 1Q9LB 5HGBB 2CUMA 3PWJA 1XF5A 2V6HA 5C2UB 4FFWD 3TO4D 1JNNL 4LASL 1J05A 3W11D 2X9XA 4X6EB 4QLRA 2P45B 1P4LA 3T3PE 3VXUE 4CVZA 3MRLB 4NRXA 2CRZA 4JFQA 4NQDD 3BP7A 4G42A 1WIUA 1QA9A 2VUYA 4RDQF 2AABH 3O6ML 2G9HA 1SEQL 3LZFH 4ERSL 5GHWL 5D1QD 1EAJA 5IQ9A 5K9OB 2ADIA 4JFXB 4OKVA 1EDQA 4AEIL 2DD8H 1MNUH 3C5SA 3SKOB 2P7TB 3WUWB 3K4AA 4O9HL 2Y36L 4GOSA 4DZ8A 2EDRA 4H88H 1I8LC 5E7BA 4D0CB 5E99L 3FONA 2Q20A 3QXVA 4LSPH 4AZ8A 1AGEA 1RZKC 5L2KA 5C09E 5IHZA 1VACB 5LG1A 3QHTC 4CJ1A 4IIQA 4JVPA 1RZJH 4KC3B 1KJMB 1QNZH 3O3UN 2JJWA 4PB9H 4MS8C 1LP9A 5HPOA 4HS8H 3V4VL 3QA3B 2R4RH 3ESUF 4S10A 4RA0C 1PZ5A 2I07B 4NCDA 4TTGA 4QTHA 1JWMB 3K1DA 5B4MD 5CUSL 4S0TD 3SGEH 1OPGH 4JZNB 5BS0E 4OV5A 4LSQH 4PRHE 3P4OA 4POZD 3H8NA 1JE6A 4EXPX 1CS6A 3VI3F 5FYJE 1TZIB 1A6TB 3S5LB 3LY6A 1MQ8A 4JQIL 4XC1L 3ECBB 5FECB 2GAZB 1DBML 4F7EB 3WCYA 1P4BH 4PLOB 3CXHJ 1R24B 3HZVA 2WK2A 4R90H 2FYYB 1ZEAL 2P8MB 4J7RA 4R4FH 1NFIA 4OCWH 3S96B 3NA4A 4LDOB 2QR0B 3VXOB 5J8OA 2F54E 4GFTB 4P3CH 1F02I 3K8KA 5D1QB 2WNGA 4LSRH 3QULA 4U1LB 2HJKA 1JGLH 4K7FA 3MROB 5BZWB 3QIUD 4MX7B 5IIEB 1ZGLP 4JFOA 5F9OL 3SE3C 2VDRL 3WV0A 1QACA 3FQTA 4F57L 4FQJL 2HLAB 2IQ9L 1VB9A 3FO2A 4LCWD 5DT1L 1P7HL 1QKZH 2EIZA 2X4TB 3MZTA 1MHPH 3W11C 1IM3B 1YEDB 3BVNB 4LLYA 2FGWL 4LGPB 3WFDL 3IDIB 4RFEB 5MEQA 5DFWH 4JKPH 1JPTL 5I66B 5DYOB 1HWGB 1FC1A 3S35X 2FJHA 1AXTH 4WI8A 3TBYA 5BXFA 2NLJB 2VNCA 1NCUA 3V52L 3VFUB 1QLFA 3SCMB 4ZUSB 4G8GD 1GGCH 1TMCB 1MFAH 5JW4Q 5T1KA 5T1LD 3VXPB 2ITCA 3B9VA 4GBXD 2XV6B 1R0AL 4WTZA 3PWJB 3MRKA 3U46A 3HAEB 1UCTA 1AXIB 4K23H 3DMMA 4APQD 2ILLA 3QDJA 4WI7A 5C1MB 1CGYA 8FABA 4X6EA 4X4MA 1YEKH 4ZDHA 1DQML 3L95A 5JHDA 4L1HA 1DN0A 4CVZB 1NBZB 4WTXA 4ZQKB 1CICC 2F53E 4RNRB 3QPXH 2D2OA 4PJHE 5DZNA 5C0DA 2F74A 3IYLW 1KPUB 3UYOD 3BUTA 4HIJA 5E0QA 5D72H 5BW7C 3LD8B 4EI5D 4ZXBD 4L9LA 3DVGA 2H6PA 1R3LB 1NCDL 3BWUC 4Y4KD 1L0XA 1KIQB 2DMBA 3TBTB 2DMKA 4Z7WF 5C07E 1UCBH 2J5LB 4W6XB 1EXUA 1T1YB 1EHNA 3V9FA 5J9PB 2Q1EA 2R2HB 5DJXB 1YEJH 1HEZB 5D96B 3ZO0A 2YD3A 3SGJA 2BHYA 2X89A 4Y4FB 5KVFH 4GBXC 1CXKA 1R5VA 2NY0C 3H9SE 2UUDK 3STZA 4LVNC 3AM8A 4LQFL 1HI6B 4ZOBA 4RGMC 4NCC1 4PJ8D 4HGMA 3H42L 2B39A 4YDVA 2R8SH 3ME0A 3OL2A 6FABL 1G6RL 4UI2A 2BVYA 4KMTH 3P0YH 1TVDA 3S37H 3U82B 3L3IA 5LWYL 4EQ2A 4N8VB 5E8NA 2EYRA 1N5AA 1YNLH 2FZ3A 3E6HB 4FQLL 4YFEA 4JE4B 3O0RH 5FYLL 4MDIA 4KK8D 4XAKE 5E6ZA 2VB5A 4HIXH 2PCPB 3QIBC 5ITFB 2P5ED 4XCNA 5DMGD 3VD3A 1IGML 4BFGA 4YWGL 4PG9A 1FZOA 4YGVB 1A7OL 1V3LA 4TUKL 1BM3H 3OKOA 2NY1D 6FABH 2HJKB 3U6RA 4XP5L 3F7YA 5TE4L 4NQUA 4QHNB 4KKNA 3DROB 3H42H 2ZNXA 1EGJH 2AGJH 1IC1A 1WAAA 2D4FA 4QRPE 3SGEI 3OBAA 4S2SB 5JDSA 4FZEL 4FMKA 4ZXBA 5J57B 3MUY1 4UDUB 5DD3L 3S8WA 5IBUB 1FO0B 1IM9D 1DQLL 4UILH 4J8RA 1OD9A 3O8XB 1TCRA 2YSSA 4JFPA 4NNYA 3OAUH 3CFCL 1QP1A 1RULH 5E8OA 1A4KA 1NMAH 1X5KA 2VSDA 3TIDB 4PYGA 4Q6IB 3NVQA 4KQ3L 5JUEH 2FIRT 4MHHI 2HH0H 1WITA 3J7HA 2V17L 3B2UC 3BISA 3T65B 2EE6A 4ZTPH 3MC0A 3VWKD 1LO2L 3TA3A 4F7PB 3V4PL 4TSCL 1YJDH 3MX0A 4QRPB 1WK0A 5T1DL 5D72L 3NTCH 1S9WB 3NFPB 3OB0K 2N4IA 4HJ0C 4PJCA 5DVOA 3D85D 2VDQL 4E5XB 4MJ5B 2ZOKA 5AAMA 1K2DA 4WFHD 1FNEB 1HDMB 5TDNA 1AKJD 1OD7A 3QQ9C 2Z4QA 4Q9RH 1OM3L 2X41A 5EBLB 1IGTA 1GZQA 2VDMH 4HKJB 5GS0D 3RTQD 1MHCB 4P3DB 4UU9B 3VXSB 1CGXA 1VADB 1MELA 1P2CA 1OCWH 1INQB 3LKNB 1JPST 3EFFB 5TQ0H 2CDFB 2XICA 1XFPA 3BIAX 5EULV 2ZCHH 2DS4A 1X4XA 4M48H 3IKCB 3DVGB 2CQVA 4NQXA 3MLZH 3V52H 5F1IA 3ARFC 3OR7B 1JHKH 2J8OA 5HHQA 5DDHB 4NWTH 4IRJD 3MLRL 4ONHA 1A21A 1FCCA 1B0RB 2YKLH 1KTRL 2UZIH 3L3DA 2V17H 1JK8B 4HIIA 4UV4L 1MCBA 3L3OB 2HH0L 2AJ3B 2VDPH 1GGUA 4ODVH 5L88H 1YPZB 3MYZA 3EYOA 4GUPB 4PBXA 3OAUL 3T8XB 4P4KC 2AS5M 1TJIH 3U2SB 4IEFB 3VFPA 2C4XA 1D5MA 4MMZC 2W0PA 4ELMB 1FYTA 1FDLL 4HXBL 3GBLA 4G3YL 5GGVY 1MHHA 3CSYA 2P43B 4O51B 1D5ZB 4L8SB 4HX1A 2A73A 4RZCA 3C8DA 5E4EB 1E6JL 1L0YA 1I1RA 1MWAB 5GRUL 4ZFGL 1KN2L 3DLQR 4ZD3H 4RAUB 3QUMB 5DEGA 4U1GC 3JVGC 3TPKA 3AMKA 3WIFA 1ZAGA 2Z31B 1FZOB 3P4MA 1KTKE 5IROA 4JFFD 5D1ZC 3PABB 4NQEA 5DGQA 2KDGA 3KPOA 3TN0B 3E2HC 2PXYB 1I4FB 4PJDB 5GRZA 3B9KC 3GSRB 5CBEA 2W0LA 1PG7W 5HHNB 4H1LA 2ATPA 2SEBB 2BVEA 3L7FA 1ORSA 3WD5L 2X4SB 2BNRD 3BZFB 2DRUA 4YE4H 4HAGA 4QCIB 4BUGA 4LSTH 1F4AA 4PJEF 4PJ5D 5ICYA 1IGIL 5EUKA 2VL5B 4MDJB 4HQQH 2UV3A 4PRIA 3RGHA 4Y5YA 5EO9A 4Q6IA 4KJPD 2AAVA 3UPCA 4Z8FL 1MI5E 3OX8A 5SWQA 2HN7B 3TNNB 3WXWL 3RVXC 4HFWA 3VJ6A 5I30H 1KUMA 3ARDB 2CUHA 4LOUD 5IW6B 3FFCB 3SKMA 2X4QB 1NCNA 1S9XA 4XCCH 5EWIL 4GMSH 2P8LB 1QD0A 4M1CC 3VFVB 4A2MA 1WBXA 3D3VE 4KUZH 1J0HA 4KPHH 3WIIL 4EOWL 4KY1H 1HDMA 2E9JA 5K33A 3WBDA 3V79C 4WHDA 3UAJC 4QRQA 3MLTB 1UGNA 1D6VH 1DQMH 2BXZA 2VABB 3GSOA 2PO6B 2QJDA 4GQ9L 4FQ2L 4TUJA 1EZVY 3O6FA 43C9A 4OLXL 5TFSH 4G8IB 3ARUA 1NCTA 5IM7A 1A1NB 2PW1B 5DDHA 1EERB 3WFHB 4F15B 1IM9B 2XQBH 4OZFG 4QRRB 3V0VB 5F6IB 3X11B 4N0CD 2CO7B 4OGYL 4M7LH 3VMNA 5TDPB 1M05A 4M48L 1X5HA 5L2KE 1QVOB 3EYOB 4G43B 3ULVF 1CXLA 2CMRH 3LEXB 5D7JC 2HJLA 1T1XB 3L3KA 2DYPB 2XWJB 4XP6H 4XNUH 5F7FA 1NUGA 1FYTB 4N0RA 5GGQH 4GKOA 4KKCC 4HK3J 2VRAA 4ZNEA 1QBBA 5IT2L 1IL1A 1DQDL 3QWOA 4KY1L 2Z91B 4OQTA 1KPVB 5CJQL 3D85A 4R26H 4N8PA 3HPLB 4W4OC 3UTSB 1J0ZA 4GG8A 1FZKB 4IRSB 1EBAA 4YBLB 5A2LH 3KPNA 1JNHB 4ODXB 4Q2ZB 5GGTH 5DK0B 4WO4C 3DXAB 4X8XA 2XN9B 5D9SA 3HE6A 4LSUH 4PUBH 5IVXE 1IGFL 3QFJB 4JFHD 3G5XA 2Z31A 4XC1H 1FNHA 3U9UA 5KTEL 3PABA 2AI0L 2OMNA 3N50A 4YJZL 2EYTA 3HE6C 2D7TH 3QNYB 3KWWA 3TZVB 4ETQB 2BNRE 4PJDA 1ZHBB 1N7ML 5DLMH 2B8OT 5T3XL 1F13A 2E3VA 4GRLD 2P4AB 3QDGE 1OQOA 2HFFB 4WTZG 4QCIA 1A9BB 4DKFH 2J3SA 5JXED 2NXZC 2YD4A 5ICYB 2DDQL 5GPRA 2ID5A 3WSQL 3SE4A 2FDBP 1XGQA 3THMH 2P5WB 4JHWL 4OQ1A 5T33L 2JF1A 4EXKA 4BSWB 3UBXB 1IC5H 2FHCA 1TTFA 4OZ4A 5B21A 4R96B 4L29B 3VRLF 5JIKA 1WZKA 1CFTA 4IRZL 5CZVH 5DMKB 1AQKL 4FTVE 2CGRL 2YHGA 3PWLB 4MYWB 1CL7I 3BQUB 1EVTC 2JCCA 3PNWB 5E7FA 1GC1L 1WGOA 4PLNC 2WIIA 4TSAL 4NQCA 5FA4B 4PG2A 4JVWA 4LEXH 4XXDB 1TETL 1WLHA 3UYRL 1LO5B 2NY4D 1G7LB 1MJ8L 2GI7A 4XP1H 3OXSA 1I3RA 1I7UA 3RY6C 3JTSB 4EN3D 3NGBC 5A2KH 5KW9H 5FYJH 4GO6B 2P46B 2Z0BA 3L5IA 2VWEC 5LCVH 2X09A 2VKXA 2W9DH 3MLTA 2A6DA 4EEEA 4HD9A 3MV8D 1NAMA 4OM1L 3MRBB 4JDTL 1ZV5A 2VLKA 1MCDA 2VYRE 4KAQL 5CCKH 1ZT4B 3BIKA 5KANI 2HTKD 4TUJB 1CD1B 4PB0L 5T3XD 3O6LH 3U7YL 3CX5J 3JWOH 1C08A 3P30L 3QI9B 3MODH 1N59B 1JHLL 1LP9F 3HI6L 3VXNB 2A0LC 2N56A 1LP9B 2G60L 5ADPH 4ZPVB 3QA3A 4KI5C 1PZ5B 1L7IL 2HRPH 1U58B 3QWRD 2IALB 3FOLB 4U05A 2BDNH 2G75A 1QLRB 4LCYA 4MQXC 3N85H 1FORH 4WUUE 3QIBB 5E1AA 1UM5H 1VACA 2MTPA 2APTA 4H0GA 1KIRA 3QEUB 3OXRA 1LO4L 4HWUA 2N7BA 3S5LA 1GXEA 5DTFB 3ECBA 1JTTA 3PWPE 5J4MA 3GI9H 3FFDA 1JWMA 3W2DH 4OV5B 3SBWA 1Q72H 1UH4A 2NZIA 3MRFB 4EDWH 1JNHA 3FZUD 4LCCB 1MFAL 3CK0L 2X7LB 4JY6A 3G5XB 1Q0XL 5IVNA 4PJ9D 3CGTA 2AK4A 5DZOA 1IGJB 2X4TA 4G9FB 4PJAF 1FSKB 1QSFD 5FFLA 1HHHB 2VZ1A 3D3VA 2P8MA 4NRZB 3ZKND 1TJIL 1JGVH 4LLYB 2W0FA 3WFDH 4Q9QH 1CZ8L 2VQUA 3QNZB 4U1LA 1CXHA 4I3SL 3U0WH 4JGMA 3LKRA 2J4WL 2DQTH 4NZDA 4UTBL 4JDZA 3MGOA 5F7DA 5F96H 3KPQA 3PWUB 1HYSC 5AYUH 1ZA3B 1AR1C 1A6WH 4UUJB 2FHFA 3OWEA 4RSVA 1OAKH 1KT2B 4MD4A 4ORGA 3SPVA 4OZHA 4XRCA 1Z0MA 3WN5B 3KPTA 4XWGH 4WU5A 1TJHH 1BREA 4U6YA 3GI8H 3HAEA 4CVXA 2O61B 3O4LB 4YIQA 2X4PA 4HIXL 4ZSOA 2VITA 5IV2B 1A1MA 5FGBC 2FO4A 3BN9C 3UTTE 5CGYC 3BGAA 3JWDH 5HI4D 3G6AB 5ESAA 5IB2B 1JPGA 4U4BA 5HHOB 3UX9B 3UTTA 4JN2A 3QWQB 2W65B 5HGHB 5IVZB 4KI5D 4Z7OE 1NGQH 2R69L 5MERB 2X05A 1BAFL 4JB9H 3RWGA 3QDAA 5ENWA 1P84J 1BX2A 4QHMA 5EG6C 8FABB 4LQFH 5T3ZH 3SY0A 1L6XA 4ZDHB 1Z2KA 4X7SH 3E8UH 5I1AB 5EOTA 4P2CG 3EOYG 3CSPA 3IVKA 3UJTL 4OIIL 3O6LL 1MEXL 4ZTPL 5IG7B 3AVEA 4XPHH 1KGCE 4DEPB 2DTSA 4K8RH 1DQTA 3P4LA 1LK3H 4U6HB 5L6YH 1FFQA 5FO8B 3EOAA 4PY8J 1V7ML 3T2PA 1MAJA 2ADGB 2NXZD 3VI3E 3CX2A 1DTUA 4OUOA 5DJ6A 4IJ3C 4ZAKC 3ORJA 1A6VL 2FD6H 3L9RA 3LH2L 1IAKA 3RBGA 3TYGL 3FQUA 4P57B 1JPFA 2R2HA 3E8UL 3BRFA 2Q86A 5BRZA 3H3KA 4K9EC 1QFWI 4GBXA 4YHPB 3WJLC 1HXYA 4LMQI 1WF5A 3B5GA 5E8NB 1XR9B 4L8SC 4MZ3A 1TXKA 3AM8C 1M7DB 3STZB 4GW1B 1YEKL 1CDYA 1RJZA 1SYVA 3T09A 1G7QA 3FAWA 4M6NL 1F97A 3VRIB 1N2RB 4AT6B 1U8LA 2DQJH 4M43L 4MVBD 4UT6H 3T4YB 3G5VB 3EZ8A 5DO2D 4PR5A 3UXFA 1FC2D 3AS0A 1AGFB 3G08A 5ID0A 5DD0H 5FM5O 2B2XH 2GTZB 4RGMB 5IK3B 5D1XB 4HGWB 4BSVA 4IDJL 4NRZA 4WFEE 2WWKO 4JFED 5AYUL 4KTDL 4Z5RA 3WLWD 3B5TA 4NNYB 2W0FB 2WUBL 2OJEB 2V5RA 4MJ6B 4OCLC 1RUPL 3CMOL 5FGCB 1KNOA 1D5BB 1J1OL 5I1KL 4X80H 3WO3B 3REWB 3MNVB 4ZUVB 1ONQB 1G7MA 4WIQA 4J6RH 1JMXA 4M7ZB 2NX5B 2YN3A 3HC0B 5F7UA 1CN4A 4GRMA 3IDGB 4J8RB 4F7TB 3OHXB 5FK9A 4UTAH 4ORGB 2XKSA 5KSUA 2H45A 4PJCB 3A6OA 3TP4A 4D3CL 2AXGA 3FKUS 4S1DD 4W6WB 4RGND 3CXDH 2ZOKB 3JUYA 4L8DB 2VLRE 1V3JA 4PD4J 3F62A 5AZ2L 3IFNL 3H6JA 4NQCE 3BDYL 3UAJD 3V6ZA 3QEGL 1J88A 1Q9KB 2HVJA 4PJ8B 5B39A 2FR4B 1Z9OA 3BIBX 1S7UA 2DKMA 3CVHL 2APXA 3CU1A 5C07A 1BOYA 1KJVB 2EEBA 4OZFA 1C12B 2CLVA 4JANB 4MJIA 2IFFH 5IVZA 4MJ5A 4KMLB 4AY0A 4EDXA 1A6ZA 4L3CA 5DFVD 3ULUL 3VFRA 3NCJH 4XNMA 4JFZH 3K4ZA 2ERJB 4XPTL 3VXTB 4MA1B 4OCYL 4BK5A 1WIPA 4ELMF 4FQXB 1AHWC 4TOYL 1PKOA 1XCQA 3W9EA 4EUPA 5ICZA 5H8DA 3RY4A 4F3FB 4FQCH 1QUNA 3MA7B 3PQYB 4ONHB 4NJAL 2Y6SC 1CWVA 1ZWIA 2LVCA 2CDFA 5AYQA 3ULSA 4N68A 2V7HA 3BHBA 4FXKA 4FXGB 1EUUA 4HIIB 5E08L 4U6HA 3CU7A 3QUYD 2PETA 5FO8A 3IKCA 2QQLH 1CLOH 4GRLA 2GY5A 4OBRA 1OGTB 3MBXL 3MO1A 1X5JA 4WVRA 1NDMB 1ZOXA 1KTLB 4HKXA 4EVNB 5C0BB 1I1CA 4JQVA 3I6KA 1IZKA 1XF2A 4NHUA 4NNPL 4XMKH 1G6RA 4TSBL 5I6XC 4PGJA 2XY2A 3FFCE 4MA3B 1I3VA 3L3OA 2VLJA 1UWEL 1MCJA 1K8IA 5CP7A 3VGEA 3VD5A 1M7DA 5I8CB 2CUIA 4NZRH 2Q8AH 5FUZH 1I1AC 5FUCE 5GJTL 2NXYC 5HXMA 1WIOA 4Y16D 2JLLA 5C07D 1TETH 3UYRH 5T5FH 3O45B 4HXAL 4OZGF 2MQ0A 3KLAA 4YDIH 4J3OC 4JN1L 4FQIL 3BH9B 2BP3A 2BC4B 2Y23A 1FLRH 4HX1B 4P59L 1EFXA 5LJYH 3DMMD 4Y19E 1K8DB 4P5KA 3T77B 2DQHL 1GZPA 2JJSC 2X4SA 3CVIH 1O0VA 3M8OL 4LSTL 5DRXA 1DFBL 4HGWA 3EDJA 4JZOB 2V2WB 1IKFH 4PTUA 2PF6A 1YECH 4MDJA 4HS8L 3NA9H 5IEKB 1JWSA 5EZIL 3MLVL 5GGSB 2FO1A 3PWNB 3LD8C 4YPGB 2DWDB 1CK0L 3QIWD 4MMXC 4YE4L 5DS8A 3HC4H 1G7MB 4Z7UF 2BY3A 3DURB 4H88L 3RUGA 5D8JL 3FFCA 5C2BH 3UPRB 2B0SL 2BSRA 1T22B 1PAMA 1LE9A 3FB5A 1WC7B 1A14L 3VFVA 2IPUK 1FBIL 3SEPA 1MCNA 5D4QA 5EO9B 4QXTA 1E6JH 2CRIA 2HKFH 3KYNB 4XWOD 3VXSD 1I7ZB 1FFPA 5IOPB 3JZ7A 4N0FB 5I2IA 3EJZD 2XYCA 4Y5XB 1HH9A 3AMLA 3JWDC 1XF5B 5CGYD 1ERNA 2BSSB 3TBWA 3SKMB 1G7IA 4UNUA 3EOBA 1J05B 1MFCH 1DUYB 4JREC 4TVPL 4X0KA 1S5HA 4NFBA 5KSBA 4F2MB 1OP9A 2X6MA 3N1GC 2R23A 1PFCA 3QI9C 5LKNA 2FBJH 3X17A 4QRSB 3SE8H 3O2WL 1J8HB 1RK0B 2W0KA 4KKLD 2EDQA 2XZZA 4RFOH 1RMFH 3A6CH 5BVPL 1ZTXH 2A9ML 4I77L 1BJ1H 3GJFK 4XNZB 1K6QH 1CVRA 2D4DA 4MA1C 4HMEA 1TENA 4JFXA 4M7LL 2KBGA 4KI5E 3TNMB 2BSTB 3A6BH 4HZLB 1XGPB 3X11A 3IRZA 1J86A 4P99A 4Y16C 1IAIM 3P9LB 1FV1B 4X9BA 1BP3B 3FQNB 4QWWC 3WHE1 3LIZH 2DBLL 1JGEA 2HT4D 2R0WH 3CFBB 3QEHB 2AJVH 1KCUH 1WVZA 2VQTA 1JUFB 3SGDH 4K2UH 3ARGC 4EVNA 1NCBL 1CLZL 1N8ZA 1T1XA 1F4XL 1G1CA 4JZJB 1XF2B 3UO1L 1NBYB 3QXTA 3LPFA 1MFNA 5TPWL 4M1DL 1QFPA 5E2VH 4P5MB 1UC6A 1S7WA 2PO6C 3UJIL 1RUKH 1Y6MR 1RZKL 1GGYA 3KPRE 4X5XB 5I8OH 4M6OH 2GHWB 4NKMA 2VWEE 3VGHA 4JKWA 3QQ4B 3IFLL 2ARWA 2OL3A 2X1XR 3MJ6A 5ALCH 1S7QA 1A6UL 3MJ8B 4NKQB 5C0JA 35C8L 3OR6B 3REVB 2A6KB 1FAKT 3BGFB 3CDCA 4XVJH 3BQUD 3H0TA 2VLJE 4HMDA 3TVMA 3GO1H 1MVUB 1C7TA 1OWWA 4P48A 2XXCB 1TDQA 3U9UB 3VU2A 3QWOB 4XCCL 3OKEB 1FVEB 4XVUD 4W4OA 2VZ3A 4P46C 2RFXB 3HPLA 3RVUC 3LRGA 3DMMC 5GQBA 5C0IA 3KPNB 1AO7D 4NOBA 2G2RA 2XN9A 1TVHA 4JG1L 1OAZL 3LHPH 4KHXL 3MROA 1P7KB 4P3WA 3V5KA 1MUJB 4KK6D 1WWAX 1NGZA 2EYTB 3QNYA 4UNVA 1MCCA 5DRZA 3WO4B 4KVCL 1IM3A 3NIGE 2KQNA 4HWBL 1CD0A 1CYGA 2B20A 4GKZB 5DS8B 4D0BA 5EU6D 4I48A 4HJGA 3BP5B 3WFEH 3ABZA 1PSKH 2EZ0D 2NY2B 3CX5K 3DURA 4XP5H 2WIMA 3NCFB 5I66A 1AXSB 4YBQD 2DI9A 1RZFH 2X4UB 4U33A 2FJHB 2A1WH 5BXFB 3RWCA 3RDTD 4O2CA 2AJUH 1UVQB 4L1DA 1WC7A 2YEZB 2X4RB 2IEPA 2ZG1A 4M61B 2R39A 3QHFH 2P5WA 1TIUA 3RTQA 3GEWB 1A1OA 3Q5YA 4PTTB 2IG2L 3I75B 1RUQH 4BQ8A 3WFCH 3GSUB 4LBEB 3TPUA 4MCYB 4Q0XL 1CICD 2KL6A 4YHKH 4DCQB 1BD2A 2FRGP 4OTXL 3SDYL 4WUKL 3BRDA 4WJ5A 4F8QA 1ZGLB 1EHXA 3TBWB 1YUHA 4Z7UA 3RDTC 1QTYT 1FYTD 3MA9H 2NTFA 3BEWA 3B83A 3FT3A 2BY1A 3MRMB 1HHJA 3L95B 5JHDB 2WIIB 5KSAA 3OPZH 2YPLE 3JV0A 4Y2DD 2VLRD 5KVMC 4RNRA 5KVFL 2LU7A 4HG4K 5HDOA 1CD1A 2DL9A 3RI5F 3R0NA 5EU5B 4UIMA 5IW3A 5DMIH 4OF6A 1DBJH 2Q3AA 2IH3B 5C92A 4DW2L 3QWRA 2N1KA 3PDOB 4WUKH 4G7YL 2YD6A 1MJ7H 2VAAB 1ZS8A 4ZPVA 1NPUA 5EBWB 4G6ML 3BZ4A 4L3ED 4HGKC 2XWTA 2X1PA 3VW3L 2CPCA 4HUXB 3RVVD 4K3JH 2A1WL 4Q74A 1NCDH 1YA5A 1J11A 1CXEA 4JZJA 3GJEA 4LDLB 1J1PL 1KB5A 1AY1H 1U91A 2OZ4H 3F58H 3H3PL 5HVHC 4HWBH 2DQCH 2HFEA 3NIFF 1VFAA 5CWSA 5D5MF 3DARA 1XIWA 1RAMA 2BVPB 4ZUTA 4HC1A 2VDML 3EDDA 4X9IA 1S3KH 3CLFH 1OGAD 4PJ7F 4PJ7A 1FAIH 1KFAL 4KKCD 1XIWC 2Z35A 2GKIA 2DQUH 3EZJB 4ODHL 1L9NA 3HMWH 3DYMA 4KQ4L 3MLSL 1AFVH 1QRND 4I3RL 2DM4A 3VXMD 3G6DH 3KXFA 2EC8A 1K4CB 5T1DH 3WUWG 1GSMA 3FFDB 1UB6B 5H37G 4AQ1B 3U36B 4HBCL 2RFXA 3MV7B 5C9JB 4JR9L 5K9JL 4YGVA 4QHKI 1KLUA 1KCRH 5C0IB 4UTBH 4G9FE 4XNYL 4V2BA 1RIHL 3QNZA 3QXDA 1IMHC 3IFOB 1MQKL 2BOBA 4R2GB 4OI8A 1QZ1A 2X7LA 4JY6B 4DAGL 3LQAL 1FIGH 4LDEB 3MGOB 5F7DB 2BHUA 3BAEH 3FO9B 4UDUA 1DQLH 2Q6WB 4GRLC 1CBVH 1FO0A 1PEZA 1HHHA 1TPXB 5DRZB 1PX3A 3BUYB 4JY4B 5F1KC 4PJIF 4PFEA 1DQQB 3BKCL 2ZCKL 4I48B 3Q6GL 1IT9H 2G5RA 3FJTA 1RZIA 1SY6A 3HLAA 1CCZA 3NN8A 4KJQD 1CI5A 2QHLA 1B6UA 5BO1H 2X1QA 1W0WB 5B8CB 4P3CL 5ANMB 1T04B 3MBEC 3ALPA 4JO2L 1KXQE 4PIRF 3H9SB 3SE3A 1B4JH 2I25N 2CIKA 4MWFB 5B38A 1JYXA 2VDKL 1RZ7H 3MUZ1 5MI0C 1J18A 1OAYL 4OGXH 5A40E 4O5LL 1FNGA 2EXYD 3GK8H 3I2CL 1I9JH 4L3AA 3RKPA 2CR6A 4TVPE 1ZHNB 4NC1E 3RWFA 4LSQL 2OP4L 3P0GB 3HR6A 4K71B 1CLCA 3NAAH 1IAIL 3WS3B 1JFQL 4N0YH 4UV7H 2GK2A 4V1DD 1T1WB 4IRSD 4ZSOB 4MS8D 1ZTXL 4ESKA 2NNAA 5DJCB 4DKAA 4TRPH 4UAOC 3MRNA 5EOTB 4XC3H 5B22A 3ES6A 4PRPD 2XG4A 4KJPC 2ENSA 1NC4A 1QSZA 3V0AC 1BEYH 4LCUA 4AL8L 3ULVL 2X2YA 4ELKB 5I1GH 4GXVH 3UZQA 4M3JA 4KTEL 4XVUC 4NZTH 1MI5D 3DJ9A 1BZ7B 4N5EC 3DETD 4TYUA 3V6OC 5C6TL 1BVLB 2EO9A 3OAZK 4P2YA 1RJYB 4DZ8B 3QRGL 1FBIH 3FO1B 1F6LL 4LCIL 4AIOA 1WCQA 4KFZC 3T4AB 4HWEH 2EZ0C 4WFED 2KKQA 5A16B 3EOAB 1A9EA 1F90L 1XR9A 4M1CD 1B2WH 4IIQB 5I19L 3P77B 3QEQD 3T8XA 4G8EA 4XP1L 4CAGA 3GKZA 4EI6B 1LK2B 5CJBA 3VRIA 3MRPA 2WV3A 2AK1L 1H3PH 4FHBD 1GJIA 1GGIH 1KC5H 4LCWA 1V7NL 4JM2F 3ZSTA 5I8KH 1Y0LA 4HUKB 1S8DB 1JNLH 4S0SD 5D7LD 5T1KD 1RZGB 1CDHA 4XCEA 3UJJL 1F3DJ 4ZOEA 3KXFB 3PL6A 2YD7A 2VSCA 4NQCD 5D1XA 2VDLL 3C6LA 3LQAC 5T33H 3O2VH 1UB6A 4HKBB 5HHOD 1NMBL 4LEOB 3FHQA 5HI5C 1KELH 2YOCA 1SY6H 4WUUD 4B41A 1XGUB 3HG1A 1FH5L 3MJ9H 1N64H 2PXYA 3QCTH 2ESVD 2DLGA 4BH8A 4K7FB 3WIHA 5AG9A 2Z93A 2APVA 1CG9B 3VFSA 2NX5A 2DQEH 4ODWB 4Z95L 2VXVH 1KOAA 2QQQA 3B3IA 3QO1B 3RNKB 4X4YB 4Z6AT 2CK0H 4P5TD 4RAHA 2OSLA 3TT3H 1P5VA 3JUZA 2UWEA 1VEMA 4C58B 1VHPA 4ODUB 3H9YA 3MRJA 5EIVA 2IQAB 3STLA 3V4UL 5I17B 1U95A 1ONQA 4M6ML 3OKDA 5ANMA 5SWQB 4H1LH 2NLJA 3EO9L 4KTEH 3BJLA 3LKSA 1LDSA 3CPLA 1GOHA 3D39B 4R90L 1BPVA 1EFXD 4G9FD 3KYAA 5ADOH 4BFIB 3RWFB 4XVSL 5L7XH 2ZSVB 4L8DA 1HILB 4B0MM 2PTUA 4L3CB 4PJIA 3MLUL 2FB4L 1UFUA 4K71C 4OCYH 2DTMH 4X6CE 3QCUH 3X3FH 3CIQA 5HYQB 3TA3C 5ISZE 3MA7A 4PJHF 2XTJC 5I75B 4QGYA 2QQKH 4KROB 1OLLA 1I1FA 3S4SG 1I9JL 2BRRH 1BZ9A 3HNVH 4EDXB 1Z6JT 2V7HB 3BHBB 4FXGA 2NPLX 3VFRB 4KWUA 1U3HA 4LCCC 5ACZA 4XVSH 5L7XL 2AEWA 1JVKA 5ID1B 2NY2D 2I9LB 4AIZB 3K2UL 1PVHA 4OFYA 3MO1B 1KIQA 4LLDA 1NDMA 4HKXB 4NC2B 2EDNA 5C0BA 4OCXH 5HGDB 5KVDL 3NH7H 3WFHA 1II4E 4XBEH 1HEZA 1I1YA 1XMWA 2OR9H 2NY3B 1ZWIB 3I02B 5D7JD 4BJLA 2JCCF 1H8OA 1H8SA 4JRXA 1MREL 4P5TA 3HC3L 2NY2C 3BGMA 2HTLD 3U7AA 3WL9B 3O6MH 1HI6A 5HDBF 5JOFB 4YFLF 5EO1A 1OARL 1YY8B 2OMBA 3VCLA 5IMMA 3MRPB 2C1OB 4HIJB 4HKZB 2VXVL 4PP1C 1RHFA 2XWJA 3KLAB 4ZPTA 4LCWB 4YDKH 4MHHG 2P47B 2A77L 3BH9A 4KTDH 1U3HD 3RP1A 3WKML 4I5BA 4JFYA 3UTSA 4WCYH 1U8HA 4XCEB 5E03A 5BVJB 4P5KB 3GMQA 2UZXB 3QP3A 2ITDB 1AKJB 3LPGA 5KS9E 4BFEA 1K3IA 4R0LA 4U7MA 3G9AB 2ZUYA 3WUZA 1QSEA 3TO4B 4HIHA 5I1LB 1U2CA 3TA3D 4PJAA 2YXFA 1FQ9C 1IGIH 4UOW0 3FTGA 4QHNA 5F7EH 4D94A 3MGTB 4ZMAT 4YBHA 2Y4SA 3O2DA 4NBYB 3RUGB 2DWEA 4YFDB 4G6FB 5BV7L 4X6DB 2OS7A 1FVDB 3BYTA 2MPAH 1AD9A 1T22A 3DGGA 4ZYKA 5HYJE 2HT2C 4JEGB 4DGIL 2EIDA 4M8VA 2AV1B 3NPSB 3PWNA 5CP3A 4YPGA 3SDAA 2F19L 2F15A 5CJOL 4X4XA 2R9HC 3LKSB 3VWKC 5I8EB 5HY9B 2Y6SD 5HHPA 5FM4A 4S1QL 5I1EL 4YNYB 1D9KB 1KB5H 2W9EH 3ARPA 1G7LA 4QRSA 3RA7L 4Q9CA 5JQHC 3MR9B 5FKPA 2Z4QB 2FX8H 5TE6H 1YJDC 4H8WH 1HH9B 1IC7H 5LGJB 5D71L 3RWEB 2XTJE 2VXSH 4LLWA 3FB6A 1G7IB 4YHOH 1IAIH 2J6EL 4LAQL 1GC1C 5KVEH 3RJDA 4FFZH 1IAII 2YKLL 4G8FA 1EAPA 4MD0B 1BZ9B 5J11C 2VLKB 2UWEF 5EZJA 1M6OA 4AEHH 4JM2A 1MCSA 3B43A 2GK0B 2YRLA 4Z77B 3V0WH 4MAYD 2A2QT 4ONFH 4TTDD 1H0DB 1YQVL 3BEVA 2FX9H 1N8ZB 1L9MA 2OJZH 3QI9A 5HBBA 2CIIA 1NMCC 4JO2H 1D6EA 1NGWA 4UQ2A 2V9RA 3C09B 4OGZA 1HSAB 4KVCH 1MFBL 4YEEA 4ZS7H 5EUOB 3Q48A 1HXMB 4DAGH 4OB5H 1CE1H 2HKHH 5EO1B 3ZT7A 2OL3B 1R6VA 1Q9OB 3FB7A 4JG1H 1QFWL 1NLDL 1NBYA 1DVFD 4LLQA 1AGBB 1KBGL 2VDQH 4H8WL 3TESA 1X5AA 3CZFB 3HE7A 4P5MA 2FX8L 3IJSA 3Q3GB 3R0MA 3ARGA 4L4VE 4JO3L 4X5XA 5IB3B 2PR4H 2YC1B 3EYSL 3MREA 4R3SB 3MRFA 1MWAA 4OF0A 1RPQA 1UWXK 2ZUQC 3X14B 3QEQE 2ITDA 2DKUA 1EJ6A 5C0JB 2O5YH 3MRQA 1F4WL 2QL1A 3HB3C 5I1LA 3TVMB 1AE6L 4O02H 2J7LA 5B3NA 4RQQB 2J5LC 5CILL 3OKKB 1IGJA 4RMQA 3AROA 5B38G 2NR6D 1UEMA 1HKLH 1YMME 1X44A 3MZGB 2DQCL 5KS9A 1CICA 2Y07H 3AAZA 1EGJL 4ETYA 4G6KH 1QSFE 2IF7A 3RGVB 3O9WA 2P5WD 4PGEA 1XH3B 4HJ0D 4XNXL 1I9EA 1GGTA 4QKXB 4RRPG 1FVDA 4U2YA 2DJUA 1UVQA 1BF8A 2VL5A 5EU4B 4KK5C 4M61A 4EN3C 3RAJH 3GHBH 1A1OB 4HFUL 4PTTA 4X8JA 1L7IH 1CGTA 2HRPL 2HWZL 3MGAA 3GMRB 1FL3B 2ADJA 4RGOH 5IB4B 2O5ZH 5F9JA 5KBNC 4HFWB 4PLJC 3IJHB 4WFFE 4I4WB 3EYVB 2RB8A 3KPRB 4WJ5B 4EKXA 5TDOB 5HY9A 3HE7D 1OTTC 1P1ZA 4G6MH 1EHLH 2A6JA 3VFMA 5JW4N 2P8LA 3ARDC 4NYLB 1F4YH 1HHJB 3P0YL 3SQOL 1J5OH 3AGVA 2NY7H 1D9KA 1CD9B 1IEAA 4DOHB 4F80A 2D0HA 1JV5B 2CKBB 5CFHA 2C3VA 5DHYA 3VGAB 2XOTA 1TTUA 4F9PC 1M7XA 1Q9LA 3RZCC 1X5ZA 1S7SA 1F6AB 3ARQA 5DK2A 4TUOA 1CGSH 1OGAE 3OKMA 4S1QH 5JTWA 1ZS8B 3MA9L 5HI4C 4YDLB 2HRLA 4NO5B 3F7PC 4JM2B 4D8PB 1EO7A 4TSAH 2GK0A 3L1OH 3SJVD 2KQMA 4Y7MA 1MCPH 5LBSH 4NUGL 3QXWA 3QB7C 5IQ9B 1JMZA 3F5WA 5CZVL 2E7BA 1QPXA 12E8L 1B90A 3O8XC 3V0VA 5MEND 1NGPL 2F54A 4OF8A 3BZ4B 1IAKB 3BKMH 4ONGH 4JFFB 4NO3B 3MCLL 3GMNB 3P0VL 4O58L 1R3JB 3PGCA 5FXCH 1MJJB 5E5MB 1SBSH 2QLVB 3RVVC 4JPWH 4P9HC 4XAWL 1KB5B 1P9MC 3NFSL 5E6YA 2XRAL 1RJZB 3ZKNC 4NO0A 1JNJA 1F4WH 4LLUA 1K4CA 3OJVC 5CWSB 3P11L 2Z91A 5JHLL 3U36A 4JKLA 1A7RH 4NN5C 2ICWB 3SDDD 3UTQA 3P4OB 2NYYC 2NY4B 5D2NA 2FIKA 3KVQA 4LGRB 1IAOB 2F5BL 2KZ1B 5CAYB 2QTEA 4JY5H 4O2EB 4P46D 2G5BA 4GG6B 1FGNL 5FCUH 3EJJX 2B1AL 1D3CA 4XVJL 2RCSH 3FO9A 1FZMA 3AREA 3LVEA 1MHPL 1U8MB 4OIBA 4FZ8L 5E70A 5F9WB 2KH2B 3CFKB 2XN9E 3BO8A 2QR0A 3QCVL 3VGBA 4MJ6A 3UZEA 1WWCA 3AREC 2HFFA 5DGRA 2VISA 3REWA 1HSBA 4NC1C 7CGTA 4I0CC 1KJ2A 1CFVL 4HUWB 3S88L 1CQYA 2HT2D 2EIZB 3MV11 5B38B 1Z9SA 3ET9F 3BYYA 5T5NG 2CH8A 3K80A 4M6AA 3GMRA 3UBXA 3OG6B 5IB4A 2ZWLT 4R96A 3HLAB 1P69B 2YBRB 2DI8A 4OLYH 1KN4L 5DMKA 1MCEA 1VPOH 5FDWA 4KJYB 1E6OL 4JQVC 5IJVA 2XWBB 4QNPF 3V6ZB 5I1IL 5CEZH 4NYLA 3PNWA 1H5BC 4X5WB 2QQNH 4PY7A 4GRWE 1CF8L 1EMTL 1K6QL 2PXYD 1OSZB 2FHBA 3GSNA 4OZFB 1CR9L 3O2WH 1I3UA 4PRBB 4H20L 1HNFA 4WGWB 3WDIA 3QEQA 1A7NH 2AQ2A 4Q6YA 1BZ7A 3MJ9A 1QPPA 4R9HA 1BVLA 3ZHDA 3BIKB 3B9KD 4APQC 2DQDL 4LPXA 1KPUA 3D2UB 3EDEA 2Z8RA 3TLRA 1DL7H 4FXKB 2H1PL 3EJZC 1JRHH 3FHAA 4ELKA 2H6PB 1C08B 5F3BB 1I1AB 4B50A 1N3NB 3L3JA 1AD0B 2B7DT 4LK4A 3P73A 3O3BA 5C7XH 4NN7C 1CK0H 1EEZB 5D1XD 3VG0L 3C08L 4RWYH 3V7AG 2GSGB 1A3LH 1HCFX 4Z7OF 4KKBC 4WFGD 2WUBH 3JWOC 5F7EL 3T4AA 3LOWA 3GM8A 1YEGH 5BJTB 5D6DC 4TQEL 5A16A 1OVZA 2NY6B 5DSCB 4AYFA 1FFNB 5E24E 1CR9H 4BH7A 5KOVC 2K7PA 32C2B 2QQNL 3O2VL 3LS4L 5KZCD 2AEPH 1A6AB 3WFBL 5FOJA 1DSFH 4YHZL 2B4CL 1YEEL 5D5MB 1JZ3A 3GK8L 4Y5YC 4JJ5A 4Z9KB 3LMJH 1S8DA 2IPTL 3EJYC 2V5SA 5H2BA 1Y6NR 1KG0B 5TH2B 1YYMH 1K8DA 3BD5A 3T77A 4O2EA 4RBPH 2F8XC 5E9DB 3FN0L 2Q8AL 2Z93B 5E2TL 1S9KC 4N9GA 2BCKB 3VMOA 1NGXA 4OCSL 5DJYA 4LLMB 4X4YA 4G9FA 5JA9A 5D2NE 2IH1A 4G8GB 1IQDA 1U8IA 5F7KC 1XGUA 3SDXA 5IEKA 4C56D 5EN2A 1DBAL 2YWZA 4WU7B 2UVEA 2VQ1B 1FIGL 2CRMA 4HPYL 4WENB 1F45A 3ULUF 4ODWA 3CPLB 3K4DA 3VD7A 1CVSC 5CJ5A 3ILQD 3BSZH 1N6VA 4X4ZA 2YSSB 4JFPB 2V5YA 1R5WA 2UWEB 2AJYH 3DYOA 4LLVB 1UJ3C 3LV3B 4ZFOL 4BFIA 3TIDA 4XRCB 2HJFB 4RMUA 4JO3H 1FVCA 2IQAA 3HUJF 3QUXC 4LPYA 4J3XA 4NBZB 2MNUA 2BNQB 3CUPA 3PWPD 4JHAL 2WZPD 3O4LA 4KJYA 1BEYL 3HE7C 5I2IB 3B8SA 3SCMC 5C0NC 3LN5A 4PYHA 3EFDH 1E4XH 5F1SA 4WV1C 1UWGL 4CRPA 2BSSA 4NQED 3D69A 5F1NB 3B2UD 5DJ2A 3QR2A 3EOBB 1S7TA 2X4OB 5I1JH 2NY3C 4HWZB 4X0KB 4XP9L 1S3KL 3CLFL 4TRPL 2W65A 4OUUA 3U4BL 3T1WA 4K3GA 3D9AL 4NN6C 2DLHA 2ZG3A 5I18H 1RHHB 1KJ3L 1BX2B 4QHMB 5TQ2L 4QT5A 3VE0A 3KXFD 3SY0B 25C8H 3BW9B 3CFDB 3M1BA 4LLDB 4OM0L 3K0WA 2ZJSL 5JXAL 5EFIB 2AV7A 2AJZA 3ZKMD 5KZCB 4BFBD 1GIGL 1F3JA 2BSTA 2FCBA 1XGPA 3QEGH 5IG7A 4TVPD 3P2TA 5GRVK 4M8QA 4P2OC 3MCKB 2AW2A 1A7QL 3CFBA 3QEHA 5ESVB 4NQXB 4J3SA 5E94B 5F96L 4D3CH 3LDBB 4Z7VB 3CJJA 2QSCL 4I18C 3WL9A 5IKCA 5JOFA 2GJJA 3O3BB 4OI9A 2QHRH 5SWZE 4PJXA 3WJJC 4P23A 5D96C 3UEZA 1B0RA 1NMAL 1XAUA 5IJKA 1QRNA 3QT2A 1FJ1B 5LAXA 1CGSL 1MQKH 4U1KB 3UTPE 2B4CC 1UH3A 4G5ZH 4P2QA 1NKRA 1CDUA 3ZKXC 5DSCA 4FQHA 5BVJA 4NKMB 3BD3A 1XF4B 2PTTB 4JFDB 5J7CC 3VFPB 5IMMB 5I15H 2MHAB 2R0ZH 1C5CL 4ELMA 4X4ME 3RKDD 3KDMA 1VFMA 3G5VA 3HNTL 4MXVF 2DLFL 3KNBB 1IGMH 2C1PA 2A73B 2Y06L 2GITA 2JJTA 3AY4A 5H2BB 3G5YA 1MRCL 4GAJH 43CAA 4P2RA 3MLYH 1AKJA 3GSXB 3RUGF 4GLRI 2P8PA 3SDCB 1ZT7A 5GISH 2EH7H 2DWEB 3LAFA 5MENB 5C09D 3ZTNL 1MUJA 2YUWA 3BD4A 2OR7A 2N7AA 2X40A 3D39D 1HHIA 3TYGH 2HG5B 1EO8L 1CGVA 5SV3A 5L8JB 4NO0D 2IBGA 1KCVH 4Z0XB 2VQ1A 3R8BB 3QO0B 1ORSB 2ZUSA 2YWYA 3T0EE 3NIDE 3G04A 4MLIA 3OGOE 4JAMB 3ZHKA 4J2XA 3OHXA 3RX7A 2VDOL 5FHBL 4L3EB 4EIGB 5FYLD 5C08A 4L5FH 4LLVA 3AS2A 2OK0L 4DW2H 3MOAH 4DTGL 1WAAE 2VLME 4LARH 1C16B 1FYHB 2NZ9D 4JO1H 4K8RD 3RWEA 5IW6A 1BZQK 3I50L 5F1NA 1DN2A 3TO2A 3BP4A 4RMTA 3RVTC 1OARH 5C07B 2I24N 5FYKE 5T3ZL 4MVBC 1TNNA 1J8KA 2D03H 3QUXD 4OUUB 4G8FB 2CO6B 1RUAH 4YX2H 1YN7B 3L5WB 4R4BA 5CD3A 1I9IL 3ZDXE 2YK1L 3I6LE 4LEXL 4XNMB 4WRLA 4H5SA 4PJXF 1M4KA 3C6SB 1SM3H 1T03H 5IB5B 1H0DA 4LLWB 3L7EB 4EZMA 4GXUM 1IEHA 1FE8L 3FB6B 4OJFL 2Y06H 4WW2C 5EZOL 4X6DE 4IRZH 4MLSA 1SEBB 1UT9A 2VAAA 1DBBH 4NRYB 4WW2A 1HSAA 5HHMD 5C09A 3BPLC 4RMVA 2BRRL 3HNVL 3VXUD