4XNQB

Antibody hemagglutinin complexes
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
217
Chain Sequence
b'QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Light chain
molecule tags Viral protein/immune system
source organism Homo sapiens
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
total genus 45
structure length 217
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB01
5CIPB 2G9HB 1ZLWH 4W6XB 4Y5XC 2CKBB 2ZJSL 4ZAKB 3BQUC 3M1BB 5AWNH 4K8RD 1CL7L 2BVEA 3BMWA 3GK8H 3RKDC 2B5IC 4MVBC 4XNXH 2IAMB 4GSDL 4PS4L 3CLFH 2BXZA 4NJAH 3MLXL 5D96B 3PXHA 4LSQL 4XNYH 3TJHD 4KROB 5HYJE 4LLVA 3C08L 3X3FH 2YBRB 2YC1B 3F6LA 1P4LB 2FHBA 5F88A 3LN5A 3H42L 4JHAL 5DRZA 3CFDA 5F96H 5T1KD 1I1FB 4LU5L 4X7EC 4NN7C 3QUXA 3MLVH 2FYYA 1A6UH 4BQCA 1ZT7B 4TUJB 4FS0A 1CD0A 4DVRL 4FG6C 4NC2B 1EMTL 1UH2A 3C5JA 3L3IB 3GKWH 3FB8B 5E2VL 2G60H 2VDPL 4X6EB 3D2UA 1DDHA 1JUFB 3SKNB 3VD7A 4DN3H 1NMAL 5ESQB 4NRYB 1RV6X 1CD8A 5K93A 5ILTH 1EERB 3VXOA 3PV6A 3E6FA 3WIFA 5IFHL 3U79A 4O5LL 2P5EA 4XWGL 3EO9L 4AEEA 5D2LF 5IBLD 4YWGH 3JWOC 4QXTB 5I75C 1SEBB 1RJCA 1CCZA 3U9UB 4I18C 1IGIL 2PYFA 5JIIA 4DAGL 3KAAA 4NRXB 5HHXL 5HI3D 2R4SH 2VXQH 3MRPA 4KKCC 1CGVA 5DRNB 1B3JA 3ARGB 4WJ5A 4MVBD 3O6LL 5B39G 4I2XE 1F3JB 5C0EB 1MWAH 3PWNB 1C5DA 3VXQB 4ONHB 1NGQL 3SDXB 1JWSB 1OQXA 4JG1H 1KLGA 4TUKH 4PJ5A 4U1IA 4GW4B 1BD2D 2X4OB 3D85D 3ME0A 4XBPB 3CC5B 5IWLC 4JPIB 4M7KL 3S35L 3WS6A 1C5CH 1RULL 4FFWC 4P4KC 2DTSA 3IS0X 1WC7A 3RFZC 4YK4B 4ALAH 2AJVL 3FHQA 1YMMA 3BEWA 1W8NA 3BUYB 3HKFA 2CKBH 2BSRA 2WV3A 3T2OA 5DLMH 5HDQL 1VFBA 2VDOL 1MVFA 2Y36H 2F15A 3HE6C 4DFIA 4CVWA 1OD9A 4HDIB 4MA8H 2GSIA 4OD3L 1QFOA 3SHSA 4PJEF 5L0QB 3VRJA 5J6HA 5HHNA 2YSSA 3CLEH 1AO7B 4WUUB 2HAZA 3RX8A 3T77A 2BNUA 4MNQD 2MTPA 4FQPA 5D1XA 4JZJC 1XF1A 2UY6A 4M1CD 4PRPE 4WFEE 3BO8B 3VA2C 3G04A 1LWRA 3IU3A 4FZEL 2VDRL 4HBCH 3VFTA 3IDYB 4KH2A 1EUTA 1A6AA 3EGSB 3S8WA 5CZXD 2VZSA 1HYRC 2GJJA 1P1ZA 5DTFA 2XACC 3BIKB 3WIHL 1KB5A 4MDJB 4EQ2A 3AVEA 3CXDL 1UQSB 1SM3H 1YNTB 2DQEH 3P11H 4HQQL 3RWGB 3DVFA 5CZVH 1WZMA 2J8UE 5JMOC 1KOAA 1BVKB 2XOTA 3O2VL 3TBVA 5I9QB 3TYFA 4EJ1C 15C8H 5IWLA 3U6RA 2ZKHL 1VFAB 3RNKA 3DRQA 2YZ1A 5FV1L 4OD2A 5EBWB 3JZ7A 4Z0XA 4OCYL 3T0EA 1WAAE 3A6CH 2V5TA 1RURL 1SEBA 4WDIB 3PIQA 5FA3B 1FE8H 1A6PA 1NFDA 2AK4E 2HLFC 1Q9LB 3UJIH 5FB8A 3TN0C 3WXVH 1LO5B 4YBLB 2NZ9C 1UM5H 4MNQB 4C56A 3I6LE 4ZDHB 2W9LA 5GZOD 1AXSA 2FJHA 5J1SC 5GRJH 3FQXB 1WFUA 1EVUA 1E28B 5C0DA 3QIUC 4IOIB 4XP6L 3U4EB 3Q2CA 4K3DH 1KELH 3UZEA 4K23H 4RA0C 1DSFH 3QQ4B 3L7FA 4Q6IA 2FO1A 4DUWA 4ZNEA 4KPHL 4MA3A 4ODBD 4GUPB 3H9HB 2Z31D 1Z3GH 5IHUL 2WIIA 4OIBA 1MY5A 4S10A 3CZFA 43CAB 2VIRB 4YO0A 1WUNT 4OGYL 5EDXA 3ZSTA 2PR4L 5JQ6H 5I1IH 3CX2A 1Q9LA 5FB8B 1ZHNB 4J23A 4XP9L 5D7JA 3RA7H 2QKIB 4MGXA 3BPLB 2BVUA 2VL5B 2FHFA 2EDQA 1T6WA 4I18B 2R1YB 1U8LA 4S1RH 3QDMA 4G9FD 3GRWA 3CSYA 4ZFZB 1UH3A 3PWUB 1Y0LA 5L88L 3MRFB 4TVPE 3QXVA 3ULUE 1UZ6F 4N8CL 4LIQE 4JFHE 3MV7A 5KN5B 1KJ2A 2J4WH 1QLFA 4Z7NF 5EFIB 3GI9H 1G9ML 3ULUF 5JOEA 3BDBA 1I3RB 4G42A 4GRWB 3TA3D 3UO1L 3RNQB 2X7LB 4NM4L 1JRHH 5EZJB 5HSFA 5MI0B 3ELAT 3PG2A 3SQBA 3RI5F 2AJYL 3MQIA 5LBSH 2A83A 4XMLH 3LD8B 5FHAH 5F6IC 4WO4C 3QWRD 1HH6B 1QD0A 2VUYA 3C5ZB 4KRPD 2HFEB 1IEAB 1RZIA 3H7BB 4U6HA 4TSAH 2UZYB 3SJVD 2BC4A 1F3JA 1U95A 1T89C 2HH0L 3OKNB 4NKIH 4Z76B 4F15B 1RIUL 5C0BB 4OTXH 1IM9D 1RZ8A 4I13B 1NFKA 3DI2B 1JGVL 5ADOL 1BGXL 2WNGA 3T3PF 1CXKA 1XGPB 4HXAL 4OZIA 5F9AC 5B8CB 3TT3H 4K3HA 3MODH 2E9IA 4AEFA 4I0PB 1PGRB 3BP6A 4Q9RH 4TN9A 4BH7B 3FQTA 3RNQA 1KJVB 1BOYA 3PL6C 4MXWH 3U7WH 1FZMB 1QVOA 2ZUQB 1V7NH 3OHXA 2IPKA 5T1KB 1EBAA 4YDKH 5C0DB 3VXME 4Y88A 3REWB 1M71A 2DTML 3WKML 3ARBA 1DUYB 4U3HA 5DT1H 2EXWD 4NRZB 5FK9A 1SQ2N 1RJYB 3QEHB 1FSKC 1L4IA 1BVZA 4AENB 3G6JF 4GFTB 1F8TL 3CSPA 3ZSSA 1U3HB 3MV9E 4KDTC 5CP3H 5BV7L 1XZ0B 4DTGL 3V5DA 1I7RA 4HWUA 5HI5C 2MFNA 4XZUB 3SKMA 2IPTL 1NAKL 4MJ6B 3DV6B 4Z18A 2FB4H 1NLBL 1P69B 3QJHA 5CBAA 1PKOA 1BF2A 3LB6D 5IBUB 1EBPA 3TH3T 1J0HA 2IAMD 3H3PL 1DJSA 1VGKB 1LDSA 2JELL 4WENB 1SJXA 4WFHE 1BEYL 4J3XA 4OFYA 2OMBA 1G9NL 4PGCA 3QEHA 2DM4A 3S4SA 1ZWIB 1T80A 1BVKA 1NAMB 5JW5B 5C0FA 4Q9CA 1WBXB 3RIFK 1ZHBB 5J0BA 2EIBA 2QSVA 4KY1L 3GHEL 3WIIL 4JFHD 2AS5M 1FSKB 2AJUL 4R9HA 5IK3A 5I71C 3TESA 4HKJA 5KTEL 2LFGA 1AGEB 3AMKA 2R0KH 4XWGH 3O3BB 3BN9D 5IHZA 2CRIA 2VXVH 4PJ7A 4Z8FH 1KT2B 2CR3A 4U7MA 1TETH 2VLRB 4AIOA 4PJ5E 4U2ZA 4X7FC 3DJ9A 3QFDB 3PDOA 3K0WA 5FXCH 4JFED 2IQ9L 4P46A 5F71A 3FFDA 2P48B 3NCYP 1LE5A 4Q6YA 1W72H 2WMPA 3B2UD 2IH3B 3C5SB 1AJ7H 4PJ5D 1IAKB 4I2XA 2XTJC 5CEZE 2NPLX 1R5WA 3EZ8A 2HVKA 4HUMB 1DBAL 1DVFB 3LKQA 1IM3B 1MEXH 5TF1L 1JN6A 3LZFL 5GGRA 4CW1A 1YC8A 4ELMF 3NPSC 2IAMC 4XI5C 2LQRA 5CGYC 5J56B 1U3HA 3TVMB 3VFGH 4LSUH 4OLUL 4NBYB 1RFDL 2EYTA 2X4TA 3IRPX 4NUJA 2NY3B 4YAQB 3QR2A 3DV6A 1GPOL 1H3XA 5DJ6A 3MJ9A 4UI2A 2LE9A 4ELME 4C57C 1CXIA 4X80L 2F8OA 3MUJA 3ZE1F 3RZCD 3DUUA 3D25B 5DD6A 3O2WH 4RFOH 2WUBH 1MFBL 4WCYH 4PJ5B 4U1IB 2B1AH 3MRBA 4MB4A 3BZFB 3QG6B 1B2WL 1MI5D 3KWWA 3VXNA 4Y5VB 2X4NB 3BEVA 5CJXC 4DN3L 3L3OA 4XPTH 2X89D 4ZUUA 2IFFL 1RZ8B 2CKNA 4RGNB 5FOBB 4PJXA 5E5MA 3HI6L 3HS0B 3LQAL 5GS3A 4KWUA 5E99H 4QHUB 1MCFA 3FFCD 2APWA 4FQXC 1BHGA 2E7CA 1IGFH 2ZOKA 3LY6A 3V5HA 1L7IL 4GQPH 4Q97A 3INUH 1JIBA 5F7UA 2PO6B 3I02B 3WD5H 4Y2DD 4MAYA 3EJJX 1DTUA 5F7MC 4EDWL 3H3KA 4NQCE 4HGWB 2G5BA 5K9QI 2LABA 2PTVA 5JOPD 4I0PD 1TCRB 1Z5LB 2VH5L 2YHGA 3N9GH 3TJEH 3TH2T 1NEZG 4P59L 4JPWH 3RWJA 1FVCA 2CRMA 3QDJB 4NO0A 4P2OA 3UC0H 4L4VB 4KKBD 1AC6A 3E3QC 3IDXH 1DEDA 4Y4FD 3NTCL 5L2KB 2Y5EA 1XGQA 3KYKH 2FX7L 3B9VA 3T8XB 5GJSH 2KPNA 1WGOA 3OXRB 4N0FA 3ROOB 5J13C 4ETQB 3P0VH 3RVVC 1UXWB 4OI9A 3VFMA 5LQBH 1UACH 3C5ZD 5KSAC 3PDGA 4YDIL 3WIHA 4Y5XA 1BQLH 1I75A 4R4BA 4DVRH 4NUGH 1QLRA 3FO9A 3IDIA 1FC1A 3BVNB 5GIRB 5AUMB 5HHOE 5JHDE 4DVBB 3FHAA 3QXAB 3NFNB 4J12A 4M8VA 3IKCA 4J2XA 1QA9B 1FFOA 2BCKB 4G43A 1JE6A 5EOTA 4LSQH 4XNYL 2CIIB 1P2CB 4DK3A 3CFCL 4OUUA 2VXSL 5EBMA 4DGVH 1IARB 1S9VB 5T5FH 1X5FA 2FEDC 4ZTPL 2WLYA 4NN7B 3MMEB 3K4AA 2BNQB 1A6ZB 4KMQA 4HCRA 1IC5H 1IAMA 3KPOB 3W9EB 2AEQL 4L9DA 1Z2KA 3RWCA 4LDOB 3RI5K 1ZGLP 1UM6H 1AKJD 4TTDC 4MA3B 2V2XA 2J4WL 1ZEAL 3WIFB 5CJXA 2B4CH 3FOMA 2V6HA 3HE6D 1JPTL 3NCEB 5E7FA 1JF5A 3GO1H 1F4HA 3MJ8A 5LBSL 4KJWD 4M6OH 4HPOL 4M9PA 4MAUH 4OZGB 3U46A 2ZSVB 3O3AA 2VC2L 5F1NB 2HFGL 5ID1A 1A64A 1U3ZA 4LPWA 4IM8A 4N5UA 3ARGA 4G6AD 4FMKA 1T1ZB 5ECJE 5KG9B 4JKKA 5DUML 3O4LD 1RIUH 2PTTB 3DXAE 4LKCB 2FJFB 3HMWH 5I18L 1JGLH 3QXUA 3GUTB 1U93A 2ID5A 4WNQB 4S1SL 2G2RB 4XH2B 1HWGB 2VKWA 3FT4A 5C0NC 5DMYA 4G80B 5L2KA 4G42B 3KR3H 3CAFA 3L9RB 4XC3H 5ADPH 2HT3D 2GKIA 4HKXA 3RJDA 4ELMA 1LK3H 2J12B 5D7SH 5B39A 4LNRB 1EHNA 4MSWB 4U6TA 3C5ZA 3WKMH 3ZMRA 3DURB 1S9XA 4HK0B 4M1CC 3VXSD 1UZ8B 3U0WL 4R96B 4ZOCA 2YRLA 4UT6L 4D2NA 3KPNA 4WHYH 2IBGA 3BH8B 3NZHH 4NQUA 1LD9A 2IEPA 4YR6A 3MBXL 5C7XH 2APXA 1F4YL 4GAGH 4HS6A 4R7NB 1CWVA 1CR9H 2ESVE 3MOBL 4NKMB 3SDXE 3RBSA 1FQ9C 3VFSB 3G04B 5GS2D 4JR9H 2K1MA 3MV9D 4P57B 3SO5A 3VGBA 3QPQC 3EYUH 1VENA 2DD8H 3I85A 3PGDB 3WDHA 4E0RA 1C5DB 3VXQA 2ADFH 3W9EA 1J87A 4NM4H 5I30H 4WJ5B 2EXWC 2OYPA 4F2MA 3X12A 4HS8H 4GMTL 4JM4H 5IQ9B 4GW4A 3OQ3B 4HBCL 4O2EA 1K9TA 2QLVB 4XP5L 4CJ1A 2D4DA 1IBGL 3HNTH 4D0BA 4K71B 4QF1B 3BZEA 1G7QB 3UXFA 3NZ8A 1HK6A 1DN0A 3GHEH 1DQMH 2Q3ZA 3WUWA 4NNPH 1VEMA 3HUJA 3STBA 3NCJH 4NKMA 4MJ6A 2P24B 1NCWH 1OT1A 1N26A 3Q6FA 2Y07L 1FFPB 4YGVB 3HC3H 8FABB 2APBA 4LK4A 2DS4A 4ZO9A 4QO1A 1J1XH 2J3SA 5J89A 3G5XA 5L6YH 2R0KL 1IAII 4X6BA 4BKLA 1L9MA 4ZFFB 2VLJB 2WBJB 2BFVL 5E00B 3CH8A 3QZWG 2IBZX 5D7LE 1H15B 3D3VB 4QEGA 1Y6MR 3RWFB 5EU5B 4NC1E 1WSST 1OP9A 2YD9A 3DNKA 1KUMA 4P5KB 1S9KC 4WUUE 4JDTL 3D0LB 4L4TE 5C6TH 5HHME 1NL0L 4YQXH 4LLDA 4Z95L 2DLTA 2XTLA 1R24A 1OGAE 1YZZA 4L1HA 1KTLB 4EIZC 4PY8I 4HK3N 3GMLB 5K9JH 1QHOA 4MWFB 3UYOD 1HEZB 3GRWL 5CMAA 5EZOL 2AI0L 3I9GL 4PJGB 3SGJC 1NANH 3SY0B 3LKOA 1JYNA 5DVOA 2XT1B 1MCEA 4K71C 4BJLA 1OGAD 2BOBB 5DZNA 1UZ8A 3H9SA 5CUSL 3TIEB 1I8LA 1WWCA 4HZAA 4E41A 1C7TA 3MRQA 2Q87A 3T0XA 4I5BA 4WHDA 2VLJA 4ZUVA 2EECA 2GJ6A 4EVNA 1IAOB 4POZD 3BGAA 4KXZH 3W0WD 3W0WA 4C83A 1U36A 3LEVL 4KMTH 1UG9A 3U6RB 4PRAA 4R7DB 1FLTX 1Q1JL 2EXYD 2NY2D 3GSOB 1FYTA 3U0PB 3H6JA 3V7AE 2MOVA 2W9DL 3KYNA 5IR1A 4EIGB 1WBZB 2EDNA 2YWYA 1RZKL 2Z31B 5KZCD 4JY5H 4G3YH 2H32A 4I2XB 1MCRA 1MCLA 1NFDB 2OQJB 4GH7B 3MNWA 3I3BA 3U82B 3S34L 2ITDA 5LWYL 4TOYL 2F54D 3JWOH 1V3LA 5H35B 2BOBA 2YMXL 2OL3H 5J1AB 4YBHA 5GS2H 2BC4B 1RJLB 3HZVB 3VFUA 2NY6C 2FIRT 5L2KD 1YEDA 4ODSH 4NCC1 3TIDB 2FNBA 5GGUB 5HHNB 1RUKL 4TSAL 4PRDA 4JZJA 1DBKL 1EXUA 4GQ9H 1G7LA 3HZYA 2DMCA 1P9MC 4I0PA 3V0VA 3LRGA 3INUL 2Z31A 1HDMA 3QQ9D 4Z7UA 5HI4D 2ORBL 5B3NA 4I77H 4PJXF 1Z0MA 3BP5A 1B0GB 1NKOA 4LLYB 5KOMC 4XNZC 3LH2L 1FL5B 1Z9OA 3C60C 1LNUB 3VH8G 3BJLA 1X4ZA 4NGHL 5C0CB 4KV5E 4JAMA 2WP3T 2VLKD 3C6LD 5F89A 4EUPG 4L9LA 4BQBA 1EZVX 1T66C 1PZ5B 2VJXA 4WI6A 3G5ZB 3D0LA 4ZUUB 4YXKH 5DEFB 2ADIA 2W0LA 1J5OH 4YHPA 5E94B 4EI6B 1CBVH 2CH8A 3ZKMD 2W0KA 1BEYH 1D9KB 1UKTA 3F7VB 2V7NB 3ULVE 4UQ2A 4LARH 1X5HA 3ZDZE 4RIRB 5GRXG 5EBGA 43C9A 1FNEA 4Y16A 3ULVC 5HVHC 2X10A 3O4OC 5IB2A 5J9PA 2XZQH 3BKMH 4PRIA 2Q8BH 3QULA 3VGHA 4E0RB 1JGEA 7CGTA 3W2DL 3U4BH 4BZYA 2NY4D 1UJ3C 4P3DA 2F58H 2HT2D 4O02H 4U33A 2P45B 5CLTA 4E9LA 1KJMA 1WISA 5T5FL 2F53A 3F12B 1T4KB 2DJ4A 3U48A 4PBVC 1ZWIA 1QSFA 3IJHB 4PLNC 2WWMC 1UXSA 2Z35B 4U31A 1TFHA 2VQUA 5M94B 4X83A 4PV8A 2DQUH 1GGUA 4O4YH 3QHFH 3BO8A 3LKNA 4I9WE 3C08H 5TDNA 4MS8D 5IM7B 5HHQB 3VMPA 3UTTE 4JZNB 1G9MC 1Q9KA 1KF9B 1X5IA 1RUPH 4ZFFA 3V0AC 5F96L 4LSRH 4HPYH 5FO9B 3FAWA 4TSCL 1MEXL 5TF1H 1QBBA 3WNMA 3KPPB 4POUB 5I1KH 5ITFA 1BFOA 2AJZA 4OKVB 3ARBD 1AGBB 2D4FA 1QR4A 5KTEH 3P4OB 2ICEB 4KQ3L 5CINL 4NN5B 3FONB 4N0YH 4X4XB 3DUHA 3KPRE 2XWBA 4L4TB 3CVIL 4P9HH 3VWJD 5B4MC 3FQWB 4PV8B 4KZEL 1CS6A 4PJCB 4FP8H 5E2VH 5GGTH 5I6XC 4YFEA 4WW2F 1YPZE 5DUPH 3KS0H 4YHKH 1IQDA 4F9PA 4I3RH 5ACZB 3LRHA 1RZIB 3H7BA 5BS0E 1CE1H 3IFNL 1UKSA 4JFDE 3QDGB 4BSWB 7FABH 4FFYL 4P2QD 4HH9B 2A2QT 3MLZL 1BQHB 5CD5D 4G6FD 5FKPA 4PB0L 1ZTXL 3QPQD 4PJ7F 5D5MB 3QQ4A 5TH2A 1EFQA 3WFZA 1YY8A 3D3VD 4KTEL 1JRHI 2XNAB 1NC4A 3FCTA 4ZPVA 5EULV 2FHCA 4L29A 3QZWB 4XCYA 2IF7A 5FO8A 2VIRA 3P3YA 2G5RA 4XGZA 4M9OA 2NY0D 5HGGS 3ZKXC 2HG5A 5IMMB 2F8VA 5D7JD 3V6OA 1UH4A 3DGCR 4ZTPH 5BV7C 1MCDA 3MCG1 4HUVB 2C7UA 3MLRL 3RGHA 2YPLB 3QO1B 2BNQE 5B38B 3UX9B 1A6UL 1OB1B 4GKSA 1CGWA 1MCWW 2VDNL 5CEXA 4DKEL 2C3WA 4GS7C 3G6JE 3JWDC 3BP7B 5LAXA 3L9RA 5F97E 1C5CL 1RULH 1FRGL 5FOBA 1ZT4A 1RI8A 1KCSH 4WU5A 5EU3B 3L3HB 4PLJC 2B4CL 4L8CB 1BD2E 3IU4L 5DD0L 4K8RC 1XR9A 2J8UF 4C4KT 1QACA 1ZVSB 1KEGH 3FCTB 1RUML 5C8JA 3OKLA 4EEEA 3BYTA 4NWTH 5E08L 1S9YA 2X42A 5E9DB 5H37G 2NCMA 1BX2B 3TPUA 3BZDA 4JHBA 2I07B 4CMHB 3ROLA 1KIQA 2P5EE 2C7UB 4FQIL 3VXPB 2FX9H 1FL5A 4FRWA 1J0IA 4GRLA 2JB6B 1ZLVH 1VADB 3HR5A 5KBNC 4JQIL 4KUCD 1TPXB 4KI5E 2M8XA 1RZFL 3BP7A 5LAXB 3S4SB 1IKNA 4NNYA 4KK9D 4F8TA 3CVHL 1D5XA 2DQIL 4OF5A 3IJSA 4HV8A 1KN2H 4R2GD 5C9JA 4X7TA 4XP4H 3TBWB 3TO4D 2IH1B 3WN5B 3RP1A 1JJUA 3TCLB 5DMJB 1TQBC 4KKLC 3EKCA 3GHBL 2EC8A 4JRXB 4TPRH 5GJSL 1I7TB 3WO4B 1VFMA 1D5IL 3DLQR 4NBZB 3EOAB 4OIIH 1AGFB 3CU7A 3RWIB 5AAWA 3LB6C 1RZGA 4I9WD 1LO3L 2XKNA 3FOLB 3FQUB 2X4PA 3G5VB 3QXWA 4PP2B 3KDMB 4IMKC 1RJYA 3NIDE 3CMOL 1HI6B 5DGQA 4P23A 4I48A 2PTUA 5DYOB 4ODUB 2R1WA 3BDYL 4K3EL 2GY7B 3ALWA 4X6DB 4P5TD 4U0RC 4OFPA 2QJDA 2BDNL 5KANG 4UILH 3IDYC 1K6QH 4OCWL 4XZUA 5BZDB 2XZAH 4XP6H 3VFWA 5E8PA 3WS3B 5GS0H 4UTBH 1HHIB 3QI9A 1B88A 5TDOB 2QQLH 2B1HL 1BIIB 1CK0H 1OAZH 1D5BA 2YPLA 3QO1A 3U7YL 5DJAA 1S7XB 4ELKB 5C0RL 4K55A 2J7LA 4JFZH 2X1XR 2VE6B 2DKMA 4OJFL 5FGCB 3A67H 1R3LA 1ZOXA 3PHSA 1XCTB 5C6WH 4PLKD 3RVVD 1DQJB 1Q0YL 1MFAH 5JQHC 5I1IL 2A1WH 2BVOB 5F9JA 2GK0B 1AFVH 2OL3L 4GW5A 1A21A 2KH2B 2P8PA 2YPKB 4BFBD 3CXDH 2PXYA 2GT9B 4Q6IC 1GZPA 1CU4L 4G8IA 3EOBA 1UWGL 5DD5H 2D31A 2W0FA 5AZ2L 4O2FA 3WNKA 5J8OA 1MCQA 2ZKHH 3UTPD 5JNYB 3O8XD 1D5BB 1NBVL 4F7EA 2ITCA 1NC2A 3BPCA 3GIZH 4FZ8H 1MIML 4RNRA 5I76A 3P9WB 3RVXC 1VEPA 5J6GB 4PJIA 5J3HD 3PWPD 3JTSB 1J0YA 4QXTA 5I16B 5A16A 1FBIH 2G75A 4MXQC 2AP2A 1U8OB 3W0WE 4MMZC 3U36B 1YA5A 1K3IA 1S9XB 3EO0A 3QXTA 4RSVA 2YPKA 3MLWH 5BCAA 2BVQA 4LHQB 3B5TA 4F58L 4F7TA 4J3TA 4PJDE 3GIVB 2V2XB 4NKIL 2CRZA 5EU6E 3EBAA 5FDWA 1NFDF 4PD4K 1HILA 1DVFA 3LKQB 3C5ZC 1JGVH 2EE9A 4KK6C 2DLFH 5DFTA 3EYFA 2E7MA 4JN2A 4IOFD 2AXJA 4GG6B 1PD6A 4CBPA 4PJEE 1K3ZA 5EPMB 4UT9L 4XRCA 2VLJD 3C6SA 4LLUA 1T2QL 4YHZH 4QGYA 2XFXB 3FO1B 3S5LB 4LFHD 4WHTA 2VRAA 4XPBL 3WUWG 3IDNA 3LEYH 3SBWA 4GAYB 3BEWB 1QSFD 3JTTB 4R4ND 4FQJL 4AH2B 3HC3L 4B41A 2Q3AA 2X40A 2C4FU 2MHAB 4XXCA 1QYGH 5T3XL 2VDKH 4P99A 4N8CH 1HH9B 4X7SH 4HHAB 4DVBA 4HMDA 2KZWA 5BVPH 3BZ4A 2YMXH 4LFHG 3WFHB 1BD2B 3P4NA 3AM8C 1S7TB 5DEGA 1J86A 2E6PA 4XWOC 3HG1A 4JFFE 1T0MA 4GMTH 4JM4L 3TN0D 1C12A 4LLWB 1NAKH 4JDVA 2GAZB 3BGFC 3BPNB 4GRLC 2FB4L 3P9LA 1V7ML 2GTZB 5A40E 4KJPC 4EDXA 1DQML 1PG7X 1RUPL 1IGCL 1PKQE 2EDEA 3C2SA 3MNVA 3MV9B 4K2UL 3A6BL 4XHJC 3WN5A 1NDGA 1YQ2A 3LHPL 3G5YA 1K2DB 5GGSB 2NNAB 3WNOA 1N2RB 4OT1L 1AD0B 4ENEC 2MPAL 4M7ZB 3AY4A 1DBBL 1FH5H 4S11A 2Y06H 5TE6L 5D2NC 4MMXC 3ARFD 5GSVA 1WWBX 2Y25A 3MJ8B 5C0IA 3NABH 1T0MB 5BMFH 3L95A 1F3DH 4Z7QF 5BQ7A 1G0DA 2P8LA 5GGRY 3B2VH 1QRNB 1KACB 3GMOA 4P2RA 4Z95H 4JFDB 5HHQA 4LSTH 1FGNH 1IZKA 1T1ZA 4X4YB 3GM8A 1PG7L 3MV9A 2H32H 3BAEH 3FQXA 3S96A 4NQDA 4P23C 1HYSD 4S1DC 3WBDA 3BGFB 3BPNC 1HILB 4K9EH 2RFXB 2KUTA 3LPWA 1ED3B 3V4VL 5CUSH 3V0WL 3PWPA 3ZKXB 1A9BB 3CFBB 4L8SC 5GSRA 2HJKA 2WSKA 4Z0BL 2EDBA 3VD4A 4W4NA 5FYKU 2XTJE 4OI8A 1X4XA 4RDQG 4HJJL 1CD9B 3BH9B 5E00A 3VFPB 1FNAA 4QT5A 2I27N 3BN9C 4LNVA 1G84A 1HN1A 3CH1A 3D48R 3H3PH 1P1ZB 4EZMA 1W0VB 1VPOH 2QSCH 4AMKL 4PJHE 2K3TA 1G7IA 2QEJA 5IVXB 4RX4A 5D72H 3NFPA 4GO6B 3C87A 1I8MB 5CP3A 1U0QA 5T1LB 1R3IH 4PRID 1RZ7L 3BZ4B 4O2FB 1NCAL 5J57B 1QNZL 1WIOA 2FO4B 3BWAB 5ALBL 5DD0H 1WZ1L 4YZFF 3TO2A 4LIQL 4CL7A 1RUMH 2AABH 4FQQA 2K7PA 4RDQF 1WFTA 1J5OL 2BSTA 1I3RA 4AQOA 1ES0A 1TJIL 2X7LA 5EZJA 4H26B 3L3KA 1LP9B 2DKUA 4WV1B 4NQXB 4KQ3H 2R23A 3S97C 3MACH 1BIHA 2OSLB 4QT5B 3RY6A 1O5DT 1HH6A 4P9HL 4ZS7H 2NY5H 2C4XA 1A6TB 2GYSA 3WSQH 3IETB 3OXSA 4LRNL 4KDWA 3KXFA 5I1AA 4WO4D 4GUPA 2VXQL 4PJDF 5EG6C 2O61A 2FJFA 2VR9A 3JBG7 4JFFB 4G5ZL 4X5WB 3PWJA 4ZFGH 1X5YA 4JGUA 3OF6D 4RAUB 4F7PB 3TC9A 3QUMA 5CZKA 5I1LB 4V1DE 2VL4A 4C56D 3QCUH 2Z93A 4C59B 2W38A 4YXKL 4PB0H 3RZCA 1F58L 1CFSA 2BNRE 1BJ8A 3F5WA 4JG0H 4V2CB 4XHJD 5EOQL 4MAYD 5J1AA 3LQZB 2HWZH 5C0CE 1UVQB 5BZWA 4X4YA 3QULB 1UWXK 4CAGA 4QWWC 3SCMD 4LHUG 4N8VG 5K33A 4ZODA 5KSAD 2J8UB 5DRNA 2X1WL 2AERT 5IEHA 5C07B 2YK1H 5IG7B 2X09A 5C0CD 3E6HA 5EU7C 4MLSA 1T2XA 2XZQL 4OZ4B 2X4UA 4NC0B 1QSFB 3IJHA 1JBJA 3GSXB 1NCDH 1LD9B 5GGSY 3MRFA 5D1QB 4U05A 4Y4KA 3EYQC 5LJYH 3OKDB 3O8XC 2Z91B 3IS1X 3LDBB 2F58L 4YFLF 3PIQB 3SDDB 3KPLA 3ZE0E 3PNWB 4WWKD 2YUXA 4N0YL 2GFBA 4MXVE 5HHMD 3Q1SL 4AEHL 2VABB 4PRPB 2EO9A 1XCQB 3CVIH 1U6AH 4XCNB 5I19L 3IDJB 4F7MA 5HGAB 3KHOA 3H9SB 3TIEA 5C0CA 1WCBB 5DVMA 1INQB 1HZHH 1U95B 1ZLVK 3P0YH 3FAXA 5DUPL 5EIVA 2LU7A 5C0BD 1IEBB 2ZUWA 4ZOEA 5DUBA 3W9DB 4N8PA 1EH9A 1AH1A 2D03L 4OB5H 1U8IA 4Q6IB 4R4FL 4NP4L 1DEEB 1ACZA 5FYLL 1QPXA 1T20B 4G9FB 2P4AB 2R2HB 1I7ZA 2UZIL 2EDXA 1IC7H 3B3IB 2Z91A 4FQLH 1A7PL 4KAQL 2G9HA 2XYCA 2V5MA 1N0LA 1BZ9B 4LSPH 5IF0A 4M3JA 4FFVD 4HGMA 1LE9B 1LEGA 4OV5B 1JF6A 3BHBB 1WCBA 3PGFL 3ULUC 4M48H 1REIA 2I24N 5JLZB 4N0CD 4QYOA 3DOSA 4MQ7B 3JV4B 2H2SC 3D39B 4OCNC 2A0LC 5IB5A 4IRSB 1EFXD 3GSVB 4Y4KC 1A14H 3JSSA 5IHBA 2HT3C 1U2CA 1OGAB 3RWGA 1F02I 5MEQB 4PIRF 5L8JB 1ZA3A 1SYSB 2B39A 2K7QA 5C0ND 2Z31C 2BHYA 4WTWA 1RHHA 1F2XK 5T1DH 1GOGA 1O0VA 3TFKD 3OR6A 5GJTH 3U30C 5FA3A 1W2KT 3RL1B 4P9ML 5F1IB 2DLFL 3B8YA 1A0QL 4OLZH 1LEKA 1D6VH 4OCWH 1A1MA 5IVOA 5FDYA 5GS0L 4OZ4A 1UWEH 5E6YA 3GSXA 4PJIB 5ADPL 1U8NB 4R7DA 4GBXA 4PJ9D 5F3HB 2HT2C 3VW3H 4UNTA 2FX8L 4UOW1 3R06A 5IROA 1RVFH 5MEPB 1N59B 1RU9H 4BQ8A 1ACYH 1PX4A 3I2CL 4M8QB 5ANMA 1NGYA 4D8PA 2LAAA 1XGYH 1BBJB 2XWJA 4LVOC 3N1PC 5F1KC 3GBNL 1T03H 1JHLH 1JHKH 2OSLA 1JRHL 3AROA 4Y7MA 1O7VA 5INDB 1P6FA 3F6IA 3GO1L 2AKRA 3B6SA 5E08H 4Y4KD 3CIQA 4NC1C 5EUOB 5GRJL 4M6OL 2FATH 3S7GA 5HI3C 5TQ0H 1N4XH 3P2TA 1J1OH 2RCSL 1C8PA 2X1OA 1Y0LB 5DJ2B 3RGVA 1DSFL 2V2WA 4M5ZH 1N5AB 4FZ8L 1EFXB 1PYWB 1IC1A 1KCUL 1CDUA 2AJ3A 4XCCH 4NNXA 3T0DA 1HCVA 2ZOKB 3H0TB 3T2NH 4XNMB 1BFTA 3OG4B 5IFJA 5HHOB 3CVHH 2CUHA 5JHDB 1FBIL 5DMKB 1Y6NR 3DROA 1SVZA 3QIBD 2NXYD 1F4WH 3DETD 1KC5H 4Q9RL 3N1GC 1U8HB 3LS5H 2XWTA 1JPGB 4R0LB 4X8JB 3MRDA 1JNNL 3UTQA 3BE1H 1S5HA 2BVPA 3TVMA 1KSRA 2FBOJ 3QFJA 1GRWA 2AV1B 5LXGH 5CD5C 1IKFH 3QEGH 4OJFH 5BOPA 3T0VA 5KVEH 2ZCHH 4QHNA 3GM0A 2Y07H 2EEBA 5FYJH 1Q0YH 5DJ6B 3SGKC 5ACMA 4PJCA 5D1XB 4Y16D 2UZXB 5HYJA 2W65B 4UT9H 5I8EB 4ZMAT 3QIWC 3VRIB 3U9PL 1OWRM 4PJBF 4XBGB 3VXPA 3WMSA 5IT2L 4XAKD 3BDYH 3S36H 4U0RB 2F74B 2DBLH 4LLMA 5MENB 5DMGD 3TPUB 2RJMA 1HXMA 2HA1A 2R0WH 1MHCA 4NZRL 2F53D 4NO2B 4P4RA 3VWKA 2NLJA 4HJJH 4DKFL 3SJVA 2FH8A 1OAZL 1CVRA 1KJMB 4NZTL 5BVPL 2YD5A 4OTXL 1BAFL 2W9EL 4POZC 1JZ8A 4LVNC 5CP7A 4YDJA 2VKXA 4M7LL 3C9NB 2PXYB 1L0QA 3UYRL 1ZGLM 1RUAH 2I60H 3HE6A 2F54A 2FL5A 4IRZL 5BVJA 4U1JA 4GG6E 1DZBA 3TGXA 4H25B 4NHCH 3OF6A 3GMQB 1AXSB 4KK6D 4QRRE 4RA3A 4P3CH 4WW2B 4ZOBA 4UDTA 4I48B 3SQOL 2R1XA 2YD6A 2XZCL 3RWJB 3CFJA 1VGKA 4EKXA 1JF1B 3ARTA 1QFHA 4M5YL 2R56L 3VI4E 2OR8A 4YHMH 5F7FA 5C3LD 4OQTA 5F7WC 2GUOA 3LAFA 5F7EH 5FUOH 3FT2B 1MIMH 3SCMA 3VFWB 4WO4B 1JZ4A 4IIQA 1AD9A 1T5XB 5IESL 4OCRL 2CMRL 5C09A 2JIXA 1KTDA 2YN3A 3S37L 3QNXA 4LSDA 4U1JB 4HX1A 4OCSL 1OW0C 4OF7A 5DI8B 4G7VL 1IL1B 1P7QA 3ZKMC 4Y5YC 2CLRA 1DQJA 5ETUB 1XH3B 4XB7A 1CFVL 4P2QE 2Z8SA 3ESVF 3MRKB 3BQUD 3L3OB 1BP3B 4XVTL 4XRCB 1BECA 4AM0B 3M1BA 5CILH 1K4CA 2EE3A 5JIPA 4Q9QL 5CIPA 2YXMA 3TT1H 4JM2C 3QHZH 2NW3B 4U1LA 3RKPA 1RK0A 2R0ZL 1E4KC 1FNHA 4RFEA 2BMKA 4IIQB 2E7HA 4LAQL 4JCMA 2H9GB 2ARJQ 2R0LL 3C5SA 1N0XL 4G6AC 5HI4C 3B9EA 5F88B 3LN9A 5GS1A 4XX1E 4H5SA 1HINL 1RZJC 5FGCE 3TM6A 1JWSA 4HUVA 4XVSL 1WZLA 5HVWA 3C60B 5AEAA 1CGTA 4MHHG 3JTSA 2L4OA 5L7XL 5LGHL 4RGNE 4BELD 2YRPA 4AL8L 1XR8A 4X7SL 3Q1SH 4AEHH 5I76B 2ZJSH 4JPIA 5K9OB 3H9ZA 4D94A 4HXBL 2YWZA 1PAMA 2YKLL 3GI8H 3NA4A 3QJFB 3AAZB 2EDFA 3V52L 3ULVD 1F97A 2AJ3B 1T21A 2IFFH 2N56A 3D39D 3U36A 1MJ8H 2H2PD 3E3QE 5DHVA 5I17A 3B2VL 4HT1H 4HUUA 3IAQA 1AKJB 3SGDH 4WWID 4JKWA 4LP5A 4LKCA 4O2EB 3NFNA 5BV7B 1II4E 3EOTL 5J6HB 4N0CC 4CU8A 5IEKB 2QQQA 1Y18B 2IFGA 5GSVB 3LZFH 3M8OL 4LHJB 2OS7A 2X70A 3FB7A 4QRSA 3IB4A 2PYFB 2VDML 3F65A 3KPLB 1A9EA 5EZIH 3VXTA 2MPAH 5EBMB 5EC2A 5EPMA 4YDLC 1AP2A 4WO4A 2QADD 5EC1B 3DUSB 1EEYB 1TTGA 5DRXB 3WL9A 1HSAA 4JLRA 5F1SA 3UEZA 4Q9BA 4GRLD 3IFLH 1S8DB 1CIUA 2HYMA 2YA2A 3O45A 6CGTA 4CVUA 5CSZB 3W9DA 4Z7VA 4OUOA 3STZB 2A73A 4AMKH 5IW1A 4LCCA 5JNYA 2IANE 4Y19A 2VB5A 3KPNB 1F00I 4OLXH 1DBJH 3BH8A 1L7TL 3LPFA 4HLZG 4NQSB 1J10A 4HIXH 1MFBH 1T7VA 5I1DB 4M02A 4MA7L 4NCC2 4N1CA 2X4PB 4JO3H 4K94C 4LIQH 4EOWH 4M43L 1MPAL 1JZ6A 5HHVL 1DUZB 2R4SL 2UUDK 4E5XB 4RAVA 2EDYA 1CFQA 1PDKA 1TXKA 3BPLC 4RFEB 4L8BB 5D8JL 2UV3A 4X6DA 1XGRA 4OGXL 1N8ZB 4N9GA 5FO7B 4HAGA 1S7UA 1NGQH 2A0LD 3DX7A 4PV9A 1R5VA 4WWKB 4C83B 1L7IH 2NY5L 1U93B 1ZA6B 1KXVC 3VW3L 1BIIA 4OF3A 5FKAA 1IE5A 3L7EB 4P0DA 1J12A 1T0NB 1NC4D 4FTVA 4UIKH 3KPRD 4NFCA 3VXRD 4LMQE 1CXEA 1XAUA 1GOFA 3Q3GA 4ZNCD 1H5BB 5I1GL 1IGJB 3B5GA 5GRUL 1JHKL 5FYJE 2QQNH 1SMAA 2AABL 1LK2A 4U49A 1A7BA 4P2RB 5EIQA 1MI5B 2IH3A 4WI5A 1MRDH 1HKFA 4ZPTA 2IMMA 4QNPE 4PJIE 5JDSB 1GIGL 5L9DH 3KPRA 3TYFB 2YD2A 4Y4FC 3RWCB 4LBEA 5ESAB 2NMSA 1NC2D 3NACH 1OAQL 1E4XL 3L5XL 4XPHH 1OAUH 3WFCH 4HULB 3ZZ1A 3CPLB 4YK4C 4F9LA 4M7ZC 5GGTL 1ULVA 3HG1B 4H0HB 3OX8A 3QDME 4KHTL 1R24B 4BZ1L 2GTWB 3QG7H 3T0EB 4P4KA 2PO6C 4UIMA 2ATPB 4LCWD 4E41B 3WL9B 1KC5L 3MA7A 1U3HD 3MRQB 5SX5H 4LRIA 3QCUL 1I1YB 2BK8A 1XIWB 3UMTA 2HLAB 4I4WA 3O41B 1CL7H 4JKMA 4LP4A 2NW2A 3RWEA 3GGWA 3MLSL 4RGMC 4M00A 1IKFL 2FIKB 4PJAB 5FYLE 3GSOA 1HHJA 4K3JL 3VXUA 5IVXA 3DMMD 3CLFL 4YHPB 3VRJB 3L3JA 2RB8A 5FYJL 3QUMH 2WINA 2RAMA 2F53E 3HTLX 5DFVD 2YPLE 1PYWA 5DA0B 3RY4A 4WI7A 2VZVA 3DHJA 5FGBC 3OX8B 2NTSP 1U3YA 5M7QA 1WBZA 4RMTA 1MH5B 1MNUL 4HIHA 1JZ5A 1EJOH 3D0VA 4LHUA 3WKNA 2X6MA 4GAJL 1KCLA 2HP4A 1CDYA 4V1DD 5SV3A 4C56E 5IHLB 3MX0A 3QJFA 4R97B 3OAUH 5IJKA 4X6BB 4IS6A 3U2SB 5I6XB 3NPSB 3RWHA 4DKEH 1HWHB 5GHWH 1A6AB 3DMMA 3OBAA 1CFNA 2CK2A 4DWHA 2VSDA 4LF3B 3ZT7A 4X5WA 4U3XA 4P5KA 3WFBL 2FEEI 2YC1A 4NZTH 1KTRL 1HZHL 3UTOA 5C2UB 4LEXH 4XPGL 3F7QA 4WI2A 4V1DA 5F3BB 3H9SE 2R29H 4MWFA 5K9KB 3FB7B 2Z93B 2FATL 4IHOA 2OXGA 1SYVA 4PTTA 5LG1A 2FBJH 3SKMB 5IB4A 4KKNA 4XBPA 4DZ8B 1A4KB 4YPJA 5BXFB 3KVQA 5BJTB 3AB0C 5B22A 1I8LC 4U6HB 3DUSA 3P30L 3RTQA 1HSAB 4J3OC 3F58L 1KIPA 4P2OC 2VXTH 2X4QB 1HOCA 2XA8L 1E27B 3OJDB 1YMHB 5EWIH 4X7DC 1MAKA 3FQNB 2WBJD 4YBQC 1CN4A 1IGMH 2Z8WC 3C2AH 2A73B 3EDJA 4O58L 1ZS8A 1BFOB 1RZKC 2AJZB 4OCYH 1FJ1B 3X12B 2FSEB 4FQ1L 2HTLC 3LQAC 4R97C 4OQTL 3BWUC 1MY7A 4WI9A 3D3VE 1C16A 3TZVA 5IVZB 2GSIB 1G9MH 3IFPA 2HFFB 3G6AB 4RIRA 4F7CA 3V4PL 1U8MB 1URLA 1NGPH 1M6OA 4PJHA 4PJFF 4V1DB 5F3BA 1D5IH 4PJ9C 3O6FA 5DJXA 1KCKA 2ZCHL 1QG3A 1JGEB 4ZTOH 4U1HA 35C8H 4PB9H 1AIFB 4PJAE 4YUEH 3LRSA 1CLYL 5J9PB 1BJMA 3F7RA 1EO5A 1FLRL 1HQ4B 4ALAL 4KKCD 4KPHH 4OD1H 1LO4H 2EDTA 3QPXL 4PTUB 2YD4A 2DQHH 3TIDA 2QQKL 4K3EH 3KYMB 4N90E 2AQ1A 3JWDL 3VFOA 1KLGB 1IGYA 4RMQA 3JWNC 4PJCF 2ZOLA 5CEYA 4NPYA 2VAJA 2PR4H 2R2HA 2X9YA 1XZ0A 4H1LH 4UZGA 1U8MA 3SGKA 4Z0XB 4HCRH 2ILLA 1NBQA 4NQEE 4PG9A 4RQQA 2XN9A 5AG8A 4QRRD 1QLEL 4ODTL 5TGBB 2EDJA 5DHVH 3SO3C 4UTAL 1TMCB 5KS9A 1M4KA 4M6MH 1UJ3B 4WW1A 3MGTB 5DT1L 2EXYC 2NY2C 4AIZB 4P2RE 1OGAA 2IALA 2P49B 4PUBH 3J7HA 4S0SD 1T83C 5IB5B 4GXVH 1C08B 3GI8L 4MD0A 1UEYA 3THMH 3BPOC 3O9WD 4LCWA 4XPBH 4QTIL 1AXIB 5GRYA 4RMVA 2BX5A 4LEOB 1AY1L 1WWAX 2IG2L 4J1UB 4MA1C 4NQCB 5DS8A 3CZFB 2XN9E 4J3VA 4F9LC 3BOVA 1V3KA 2XN9B 1M7DB 1OSPL 4G8FA 4GRWE 2I07A 2IPUK 2HH0H 5ICXA 1GHFL 3MA9H 1KIQB 5ESVA 4RISH 1S9WB 1L0YA 4HZLB 5GISH 3ARDD 3BT2L 1U8IB 2AV7A 5BW7C 5EU6B 4PJ7B 2H3NB 4D0DB 2CJUH 3VG0L 4Y4HB 1B4JL 2CUMA 5FAAA 1S5IH 2C1OB 1XF2A 4OLVL 1KJ2B 5CBEA 1BAFH 2W9EH 4O2CA 3S3JA 4Z77B 2D2OA 5AYUH 5D7KD 2DJUA 2JJTC 1FZJA 3G6DL 4Z7QE 5JQ6L 4FMFA 5D7IA 5KVDH 3MFFA 4HLZH 3CDFA 4JCLA 3ARWA 4LAQH 1MCOH 4MA7H 4QWWD 2UYLA 3HC0A 1FNFA 2X70B 4QRSB 2VLKE 5CJ8A 5IFAL 1DL7H 4G6MH 4MAYC 4L4VA 4M43H 3O9WC 3NABL 1Q8MA 9CGTA 4GG8B 2E3VA 3MRCA 4NCDA 4P2QA 4U1NB 1FV1A 4NNXB 3VDAA 3VGGA 3E1F1 1ZT1A 4MXQD 3T2PA 1WEJH 5DRXA 2HJFB 4GXUM 5HPMB 1WT5C 5E6ID 5MERB 1N5AA 2VDKL 2NY4B 5B8CA 4X9IA 5HTSA 1I8KB 2VN4A 3G9AB 4OFVA 1V05A 3NGBB 5DURB 4U1SB 5F1IA 3K3QA 1CE6B 2YKLH 1GC1C 3IGAA 5TPWH 2WP3O 5DMKA 5JTWA 3NCBB 3ISWA 5JORB 5AUMA 4PJ9B 5D2LB 3ULVF 4KJQC 2ERJC 1G7MA 1Q94A 2QSQA 5DVNA 3BXNA 4EN3A 5B3JE 5AG9A 3OPZH 2YD3A 4OUUB 3QYCA 2YS4A 4AT6B 5EZLB 1WF5A 5CEZD 2IH1A 1U8PA 4OZGF 2WQ8A 1HSBA 1KENH 1NMCB 5I1KL 1SVCP 1VFAA 1A6WH 1I4FB 5CCKH 1W0YT 1KEML 1G6RB 1MRFH 4EXPX 1DE4A 4F3FA 5DK2A 5DA4A 4YJZL 1E4JA 1OLLA 4JHWH 3LSOB 3JVGA 3GSUA 3OKEB 3VCLB 5KSVB 3CDYA 3IGAB 3NACL 2B0SL 1ZA6A 1XFPA 1OAUL 2F74A 4OLYH 1N0XH 3PWVB 2DL2A 3IVKA 3F8UB 3HZMA 3O9WA 4M6NL 1S7WA 2ATKB 4JFQA 2BSED 1XIWC 3U4BL 1KYOK 4B53A 5FECB 5J6GA 3P4LA 3HPLB 5HGDB 3LKPA 2ZUVA 4XP1L 1CE1L 3IFNH 5IKCB 1UB6A 4YDJB 3UJJL 4HUKB 3MRNB 4G7VH 5C07D 7FABL 4AL8H 1FN4A 1UB5B 2NW3A 1CIDA 1YUHB 4UNUA 5ID1B 1MCKA 2D9CA 1ZA3B 4ERSH 4ZS7L 4YAQA 3LIZH 4BH7A 1F8TH 1KFAL 5C09E 3BJ91 4JO3L 4WU7A 3O6ML 4JDZB 4UB0H 2F54B 2WZPD 1MJ8L 1MVUB 2HN7A 3MO1A 5KSVA 3UPAA 5D1ZB 2H8PB 2NY0B 4J8RA 2OZ4L 4NKDA 3MYJA 3BGMA 5TQ2L 1ZHKB 2J6EL 2R0LH 2ESVD 2EDRA 1MHEB 5GS1C 1FFOB 2BCKA 1F2QA 4TRPH 1R3LB 2DI8A 5F7NC 2GJ6E 3FFCA 3PWUA 5D93B 5EIIB 1VB9A 3QUYB 4Y1AD 3P0VL 4Q58C 4FXKB 4MZ2A 4ZXBB 4Z78A 3H9SD 1VDGA 1I7RB 4PJHF 5F70A 5E8DH 1EXUB 3SE9L 2OZ4A 4U2YA 1J05B 2FEDD 4NUGL 3NH7H 1H8OA 3T3MF 1RZ7H 2WUBL 3FRPA 4A6YH 1BVLA 5DI8A 4JDZA 3OZ9H 1HHJB 3U7WL 1AGFA 4QXGL 4JKPH 4XPTL 5DHYA 2R2EB 1YEIL 1QFWI 3CDGA 3IXAA 2FH6A 3V2AR 1TJIH 3DBXA 3QIBA 1VKXA 1A1OB 2DYPB 4Z7WB 3GJFB 2VITB 1X44A 1FVCB 1ZHKA 2DKSA 2HKFH 1JMXA 4MHHI 3FTGB 3AU1A 3HCVB 2PF6A 4PJAF 2I26N 3L3DB 4R26L 4G7YH 1OAYH 4O51A 4EDXB 1MI5E 4Z78B 1IC4L 4IS6B 2XA8H 2CRYA 4NDMB 5CJBA 3U2SA 4L8CA 3P0YL 4OZIB 1YMMB 4U1LB 1NMBL 2DAVA 4MQXD 3QI9C 4JRYD 2O93L 3DGGB 3N9GL 4TVSa 4UUJB 4H25A 5GIRA 3GIVA 3QNZB 5IBLC 1FZMA 4RMSA 3X3GH 1HKLH 1Z9MA 2P5ED 2R4RL 4XC1L 3OAZH 1KIRB 3NTCH 2C3XA 5HD8C 1RMFH 4LLQB 3OAZK 4MQTB 1VESA 1KCVL 1S5HB 2BVPB 4N90D 3MBED 4R6UA 4Y2DC 1A22B 2JELH 1JPST 2O5XH 4HPOH 3OJVC 4ZD3H 1AQDA 3DRTA 2YD1A 4XPFH 4TUOA 2VC2H 4FXLA 5TJWK 2HKHL 3D18A 4YC2B 1CICA 4YH6A 3VXUD 1TJGH 4L8BA 4HIXL 1AD9B 1T5XA 4PLOB 3VG9B 4LVOB 2BNQA 3V5DB 4Y5VC 1KLUB 5EORL 2DQTH 3ZDXE 4QTHA 5GGTA 3ZE2E 2CO6B 5HHVH 4X7CC 1MVUA 4UOJA 3ILQD 3DVGA 3QIBC 3LKRB 1QBML 1X6LA 4ZUTB 5KVMC 3P73B 4WRLA 1X5XA 4GW1A 4X80H 4HLJA 1A9EB 2Q7YB 4LPYA 1MCBA 5HHPA 2GAZA 2QQLL 4HIJB 3HNSH 4NO2A 4Y19D 2IANB 1JGUL 4XVUD 1DQDL 1FZKB 1JCKA 2DQJL 2VZOA 2CLZB 1XGUB 4UQ3A 1A3LL 2A9NH 1PVHA 4U1HB 3ZE1E 2EICA 2X4TB 2ZNXA 1J18A 3ARPA 3AS2A 4QGTA 1MFAL 4ETQA 3GBML 1D6VL 3GMRA 3I6GA 1U8QB 1AJ7L 3D87B 2C3VB 5D1XC 4MJ5B 4LASH 4QOKE 12E8L 4QTHB 5IP4A 5T1LA 4YC2C 3TN0A 1HHIA 4YDVB 3W82A 1T66D 4F2MB 4MX7B 1KXTB 1PY4A 1QUNA 1E6OH 5MP6L 3VXMA 4WEBH 3UBXG 3DHMA 4JO2L 5E56A 3S88L 4NHUB 2NYYD 5BO1H 3EYUL 4B5EA 4RWYH 1TZIA 1BFSA 2P46B 3VWJA 5E2TH 3AAZA 4UQ3B 1SMOA 3MLPA 1NGPL 4GW5B 1YEEH 2VXUL 1JGLL 3BT2H 3FRUB 2AGJL 3ET9F 5DZLA 1VACB 4PJBA 2OJEA 5CLWA 2R2BA 2CDFA 4PJAA 1PJ9A 1K6QL 2ADJB 4QKXB 3KPTA 3CD4A 3MLTB 4J4PD 4OBRA 2D31B 4CDGC 4K9EC 25C8H 2CJUL 1T7ZA 5D2NB 1LP9F 2JKXA 3O2WL 5CJOL 5BS0B 5KOVC 4GMSL 4F57L 4LLAA 1T89A 4LPCA 4WUKL 3U7AA 3SDAA 1FO0L 1NPUA 1FFRA 1OCWH 1AQKL 3X11B 5IMOA 1CICC 5FA4A 3KYOB 4A2MA 2PKDA 4GRMB 2BRQA 1NDMB 1W0VA 1BWWA 3NCCB 5D6CA 4HF5L 2FJHB 2FECI 3L3IA 3ZE0F 1YPZF 2P5WB 4HWNA 1AC0A 3HE7D 4U1GC 3GMPA 3MROA 3PHOA 5FUCC 5KW9H 1VFOA 2P47B 4DK6A 3AFLA 1WV7T 5IG7A 3P30H 1BQHG 3LKRA 3QFJD 3RAJH 3RTQC 3NAAL 1QLEH 2GJ6B 5MEOB 4LCIL 4LGSB 1I8MA 2Y5TA 4EXKA 5F72S 3HUJF 2M2DA 3BD4A 4M6ML 1LO0L 4QRRA 1K4DA 1OWWA 2XN9D 2AK1H 4JR9L 4G8GD 1NBVH 2JJTA 1P2CA 5K9KA 5F9WC 5CJQH 4JM2F 4KUZL 1FYHB 3D1MC 3QWOB 2ARJA 4XAWH 3KYOA 3BFOA 3D69A 4J6RH 5JR1H 4X7TB 3MNWB 4HMEA 1DLHA 3B9KA 3UBXB 5KANI 4ZTOL 3RUGA 4XP5H 1OGTA 2YEZA 3HRZB 1QP1A 4MA1B 5LGJB 5EU5A 3D9AH 3IETA 2MCG1 4UUJA 1YNTA 2APVA 2F53B 1CFBA 1F45A 3C09B 1AXTL 1RUQH 1V8HA 3LHPH 5EO9A 2V2TA 1K5NA 1CFTA 2DQHL 5AD0B 3G6AA 4QRRB 4JY5L 1A7QH 2OJZL 4ZNEE 4Z7UB 3QUMB 1S7SB 3FN9A 1IGML 3C2AL 4PP2A 1A7RH 2H26B 3UTZB 1F4WL 5HY9A 4FQ1H 5C1MB 3RUGE 1T0PB 3GMNB 3H8NA 1ZLUH 1VCAA 4CN4A 2BSRB 5JW4M 1S5IL 2VISA 3O81A 2A38A 1WC7B 1INDH 4HC1A 4BUGA 4JDTH 1P7KB 2BY1A 4HQQH 4PJ8C 4ZUWA 4KGJA 5CEZH 3NFPB 2X4UB 5CKGA 1YN7B 5D96C 2AAVA 4UDUA 1MCPL 3GUTA 1FGNL 5DMIL 2NXZC 1PZ5A 4RAHA 3SDAB 5DC0A 3RZCC 1RHHB 1FPTH 1G7QA 1AGCB 5IV2A 4KI1A 3ZHDA 5E2WH 2CLZA 5T1KA 4HIIA 4X9FA 1F90H 2LVCA 4PY8J 1B6DA 3REWA 2GK0A 2OZ4H 1FGVL 4JFXB 5INCB 1D5MA 4HKJB 3QB7C 3MRGA 2XY1A 4DKFH 1NUNB 1ZS8B 5ENWA 1AO7E 4YHLL 4MJ5A 4XVTH 4BM7A 4NZJA 2ADFL 2W9DH 1KJ3H 3VGFA 2X9XA 5EO0A 5FM4A 1JWMA 3SE9H 5HDOA 1PG7W 1LGVA 4YPGB 2HJKB 1TVHB 3K1DA 4TOYH 3WLWC 5KSUA 3MSPA 4Y8AA 1FL3B 3OZ9L 2D7MA 2P7TA 1J0ZA 4QXGH 1Q9KB 4OIAA 5IJKC 1PQZB 1R5IB 2DRUA 5DJZA 3K46A 4L3CB 3GSVA 2AK4A 3KYMA 2RR3A 4RGMB 5EUOA 1AGBA 4KI5D 4PD4J 1MHEA 5GXBB 1DBKH 2WQRA 4PJ7E 3U4EA 4H88H 1JUFA 3NZHL 4CKVX 1IFHL 1LEIA 3O4OB 3FB5A 3GEWB 4M61A 3ULSB 3FQWA 4JQXC 3PQYE 2BHUA 3SDDA 2EYTB 3CFIC 1MAMH 4P5MB 3FZUC 5F8RC 1NL0H 4YQXL 4HUXA 5HHMB 1H3UA 1EX0A 4KJWC 5JPNB 2EZ0C 1KB5L 2ICES 3FKUS 3UAJD 5K9JL 3VG0H 1R3HA 4HPYL 2GJZB 2Z9TA 3ZL4L 4BSVA 2R69L 1A1OA 3QUXC 2BXYA 2YPVL 3GGWB 4G6KH 2IAND 4HS8L 5KSAB 2E8YA 5D6DC 2W60A 5D7LB 4OF6A 3SDXA 3HE7C 3LMJL 4Y89A 1ZT1B 4QHMB 4HWBL 4JFOA 1M6OB 1QNZH 1S7TA 2CUIA 2AJSH 4E42B 4JZJB 1KN4L 2H45A 5DDHA 2M26A 3NCJL 1QBLL 4I3RL 2WAHA 3V95A 4P2CG 4EQ3A 3PF2A 3QJHB 5CBAB 4C56B 1MRFL 4XGZB 4ZDHA 5SWSB 2G5BB 3W11D 3JVGC 3GZKA 5IB1A 2A83B 1I9IH 3T4YB 4G8EA 4N0UB 3RWDA 1KJ2H 5TF0A 4A6YL 4U1MA 1DP0A 4HUNB 3IJYA 3G5VA 3V6FA 2UWEF 4EOWL 3SDCA 4ODHH 3FO0H 5CBEB 4BSJA 1GGBL 5GQBA 43CAA 2BNUB 3CSGA 1Q38A 4U6XA 1H8SA 1SY6L 5FM8A 5KSBA 4JRYB 4LSRL 4KTYA 4YHOL 5JA9A 3E8UL 3T1WA 1F58H 5EOQH 4F7MB 2CK0L 1MFCH 3O6FD 3KPSA 4TNWF 2PO6D 1Q9WB 3ZHLA 4GSDH 1L6XA 5EU4B 3RRQA 5C6PB 5TE7L 3T4YA 1YMHA 2FGZA 3LD8C 4YX2L 1JHTA 4X5XB 4NO5A 2R1XB 4XTRC 4CVZB 1FRGH 3D3VA 2CIIA 5GGUA 5DUBB 2L7UA 5ICYB 5TQ2H 1KTKE 3HZKB 2PW2B 3ULSA 1SEQL 1HKLL 4L1DA 1A1NB 1T5WA 4QXWA 3MGOB 4LEOA 5F9JB 3KJ4B 5IVZA 3CMGA 3FT2A 2A77L 1CLCA 1NC4B 3SCMB 1ONQA 4J7RA 3MJ7B 3RPIA 5H2BA 1N64L 1ORQA 3LEXA 4Y2DB 4XP1H 5IW6A 1CLOH 4LVEA 5LKNA 2XIDA 4HGWA 1A5FH 1EMTH 4P48A 3PV7A 4XBGA 3V8CA 3SY0A 2BVTA 2WUCL 3O6KH 3TBTA 2ZUYA 1OF2B 1D9KD 2LVEA 4RGND 4LDEB 3SDYL 4PGCB 3EJYD 3GNML 1E6JL 1DFBH 4M62H 3DXAB 4IRSA 3RIAF 3QH3B 2Y72A 1MOEA 3RY5A 2D9QB 1ZLUK 3C9NA 1EEUA 3K4DA 1EFXA 4P23B 3J8F7 4HIEA 4LPXA 1MCWM 4U1KA 1OAYL 4MNHB 2DQDL 4LSVL 1P53A 2DN7A 2P7TB 4WV1A 4XTRD 1DVFD 3DYMA 2R23B 3AMLA 3Q0HA 4PJ8D 2DQFA 3WO3B 3AREB 1JV5A 2UYLB 3HPLA 2DLIA 3HC0B 1XF3A 3IJYB 3O8XB 4XT1C 1TVBA 3B8SA 1H0DA 2H41A 2YUWA 3DARA 3IDGA 2X9WA 4LASL 1TZHA 2L7JA 4FFZH 3TO4A 4FQXD 2EDHA 1QTYT 4PJFB 1BZ7B 2P8PB 1YEIH 4PJBE 1RIVH 3FB5B 4G8GE 1IMHC 3MXVH 1E6OL 1A6ZA 5MP6H 5B8CC 3FT3A 3PP4H 2UVEA 1MHHA 1CDHA 4XB8A 1GC1L 4S0TD 3QNXB 5DRWA 5I0ZA 4JFYB 5D1ZA 2FX9L 1AKJA 3ILPB 4ZS6C 3T0EE 2QADC 5DQDH 3EOBB 4G8IB 3EYVA 2VQ1B 3SPVB 4YHIB 5E1HB 4BZ1H 2NY7H 4OZHE 1YNKL 3MC0A 2CLRB 5ETUA 4RBPK 1NBZA 2FBJL 3E6HB 1EPFA 3OAYH 5CS7A 3LS5L 1PSKH 1RK0B 3CX5J 4JJ5A 2KQMA 3FB6A 1BZ7A 1KYOJ 4DW2L 4IMLB 2GCYB 4P5TB 4GOSA 4OBSA 5JW4Q 5I8KH 1EHXA 1CGUA 32C2B 4FQHA 1U8OA 4MJ2A 4J3WA 5DD1L 4H5SB 4FNLH 1F3RB 4XPAL 4PRPA 4ZO6A 5TDOA 2VDRH 5IW1B 4NRYA 1S9YB 5E9DA 1T6VN 1I9EA 4P59H 3FN0H 3DUUB 4BUHA 3UBXI 3OHXB 2CXGA 4QRTB 3QO0B 3MRIA 1IEHA 3VD5A 3MRHB 1A2YA 4G80A 3IDXL 3TO4C 4IJ3B 5FECA 2DWDB 1XCTA 4NZUL 1G9EA 3NAAH 4WFHD 4IRJC 3I6KB 1LVEA 2VLKA 3C6LA 1ZLSL 4L3EE 1Y6KR 3GMNA 3WLBB 5BOZG 1N4XL 1T21B 1EDQA 4MSWA 3DV4B 3DURA 4HK0A 4WIQA 3M07A 3UDWA 4JFDA 5C9JB 1OAXH 5JZ7D 1RURH 5LCVL 2WK2A 2VDQH 2JB5L 4CVXA 1MJ7L 1TJHL 5KZCB 4F33A 4K8RL 1FORL 3TN0B 1CXLA 2Y7QA 3NFSH 2VXUH 5IF0B 1LE9A 4JRXA 1IM3A 1NGZB 4BFEA 1GYAA 5IM7A 2Q1EA 3QAZB 2EE2A 1TZHB 2B7DT 1T0NA 3V4UH 3IAPA 3MRKA 1GCFA 3D39A 4LLQA 4OZHF 5F9OH 5SWZE 2XKNB 4XCEA 2FYYB 1EEYA 4TUKL 2NY5C 4G9DA 1Z3GL 2NY6B 2PN5A 2XICA 1XR9B 2VTFA 5L8KB 1LO2L 2DDQH 3WNNA 2DQIH 4JO2H 1MRCH 3N06B 2A74B 3CCHB 1GZQB 4M3KB 2DLGA 3S88H 4CVXB 5JOFB 3VDCA 1FE8L 3GIZL 1BFVH 1N7MH 3MYZA 1DVFC 5HYQB 4MJ4A 5IK3B 5FHBH 1JGDA 3WHE1 5HGHA 4OFIA 1FVEA 1WBYB 2VDOH 3ARFC 3O9WB 4PJFE 1SHMA 3KYNB 5IR1B 2ZWLT 3QA3A 1QA9A 5A3ID 3VI3E 1WFOA 4OCSH 4G43B 1OTUC 1Q9OA 4PRHD 2I5YH 5M95B 4PJDA 5DR5H 1MUJA 3REVA 5D6CB 4QHUA 4GAYA 3UTSE 3SDAC 3ZL4H 5E8EB 5EA0H 3ZT6A 3TYGL 3OKMB 4PRHE 4KVNH 4MNHA 4LCCC 4Q9QH 5GISL 4KK5D 1U8QA 1ZV5A 1KXQE 1I8IA 3EUUA 5JOFA 2I60L 1DBBH 4OGYH 4UILL 2ERJB 4RFNB 1ZHLA 1T7XA 2A9MH 2I9TA 3HFML 5C0AA 2EDOA 3VD3A 3AREA 4L3AA 4M61B 2BJML 3ECBB 4HG4K 5F7KC 1DQLH 4AG4L 1BF8A 2DMKA 4NO0B 4X4MA 3CC5A 3GB7A 4NIKB 1C5BL 4GKZA 4MNGE 1T1XB 1BGXH 4IDLA 1KPUA 1UZ6E 3DV4A 2CDEB 3O4LA 4NHUA 3D69B 3VWJB 1TENA 2V2WB 5BZWB 3MNVB 1MHPH 5F7EL 1NGWA 3LN4B 2P5WD 1P9MA 4I0PC 5BW7A 3MLTA 4Y16C 5H8DA 4JO1H 2Y7QB 3WXWL 1NUGA 3H2WA 3WXVL 4Z7VB 5CSBA 1DL7L 4G6ML 4WFGD 5ESQA 2OJEB 3STLA 4F8QA 3BDXA 5GPRA 3ARUA 4Z0BH 5E6ZA 3VXSE 3SPVA 4QHMA 4YE4H 3N0PB 3KLHC 2G2RA 3QG6A 3L3GA 4JEGB 4JN2B 3VA6A 1VFUA 1ZGLA 3ARYA 5DJCA 4YHOH 4MCYB 3WYRA 2P5WA 4UMGA 4GKZB 2Q6WA 3BW9B 4UNVA 1LQSR 2VL5A 3MV7D 3IJSB 4HV8B 1NDMA 2EC9T 2QSCL 1GXEA 2KL6A 1EAPB 3G5XB 3HS0A 3DYPA 3TT3L 2P1YA 3VXUB 1A7RL 1FO0A 4GKNA 3V7MA 4Y4FA 1FH5L 3IDMA 5HVGB 5T3ZD 4JRYE 3MV7E 4UTBL 1WIPA 3QT2A 4GRWH 2YBRA 2FWOA 4K7FB 4EUPH 5FGSA 3W39B 4YHLH 1KB9J 1ZXQA 1DQQB 3QWRA 5FYKL 3VXMB 1KIRA 1Q0XL 3MV11 2JTDA 1T2JA 3QUXB 3T0EC 5CCKL 3MJGX 2HRPL 1JPFB 2NTFA 4MJIB 3R1GL 3MACL 4JRYA 4N5ED 1A3RL 1YECL 3SE8H 2DWEA 3TZVC 4D0CB 2Q6WB 4A6YA 1AIFA 4LRNH 1B4RA 1I8IB 4KKLD 1ETZB 1NAMH 1U2HA 2AJUH 1DFBL 5DEFA 4G9FE 3QDMD 5D8JH 2NNAA 1GVIA 3O3DA 5GGQH 1KV3A 2ZP0T 4FA8A 1T3FB 5FYKE 4QCIA 3VWKD 1YYLH 3ARED 1I85A 3B2UC 5HBBA 4UQ2B 2Q7YA 5HHPB 4KDVA 1UKQA 4HWEL 2DQDH 3VFVB 4WUUA 3WJJA 3G08B 1FNGA 1JMZA 1ZSDA 3MNZA 2F5BL 1VPOL 4JHZA 4ZUSA 5F9WB 4OZIF 1DBML 5EOCL 3MA7B 4G9DB 1G9NH 3TNMB 1N6QL 5A2KH 2VABA 5DF0A 1INEH 1XIWD 5DQ9B 5JUEH 2VN7A 4UDUB 1H3PL 4H1LA 1B90A 4G6JH 2WBWB 3KLAA 4JHAH 1EGJH 1AE6L 1P7KA 1KTDB 1X7QB 2NR6D 2Y9RT 2D0GA 2CK0H 1BPVA 4F7CB 3HAEB 1UA6L 1LEIB 2PXYC 5I1LA 1WVZA 1FVEB 2QBWA 4WDIA 1NC2B 4KZDL 4GLRI 4XCFH 5I15L 2BRRH 1AHWC 4JQVC 4TVPD 2IQAB 1U3HC 3K1KC 5D93C 5SWSD 3ZT5A 1M7IA 3KYAA 1G7HB 4OLUH 2IGFL 3SKJH 2Z8VC 4ZUSB 1T1WA 2HG5B 2VDPH 1M7DA 4FFVC 3WJLA 2JJUA 4F37F 2NY3D 3S6CA 4Z5RB 3TZVD 2ED7A 4Y4FB 5ICZB 2C3GA 4DZBB 1W72L 2NY0C 4FQJH 5LGJA 5HYSG 4OB5L 3ULUH 4AJ0A 2V5RA 2VLLB 8CGTA 3G5ZA 4X6EA 3QP3A 2X44D 4B50A 1EK3A 1FG2B 2NX5E 1YDPB 2DQGL 3LIZL 5BS0A 5CEYB 4YFDB 5IBTH 3DYOA 4ODHL 4NN6B 3E6FB 5D1QD 2NX5D 1X5GA 3EFFA 2DWEB 5I74C 5D71H 4KHXH 4YEEA 4D0CA 3HMXL 4DEPB 1GGBH 5KS9B 1VGEL 1FL3A 3LMJH 5H35A 3FN3A 4LCUB 4PG9B 5E70A 4TSBL 4WHTB 5DFVC 1W0WA 1RIHH 2UY7A 5GRUH 2DJSA 3IF1A 1CG9B 3LN4A 4GAJH 2HT4C 4U1MB 2HTKC 4L3CA 4PGDA 4PR5A 3MBEA 3RHWK 2VLRA 5FYLD 3RU8L 4YIQA 3C09C 3P77B 2VH5H 2C5DC 1N59A 1FV1B 1E4KA 1OAXL 3TJEL 4ZPVB 4LVNB 5I19H 4QRQA 3C8DA 3LCYA 5F3HA 4F7PA 4ZSOB 1KTLA 5DEGB 4QRUA 1G7LB 1MIEH 1MFDL 2X4RA 3EFFB 2HVKB 2GY5A 1A0QH 4OLZL 4MLIA 4XBEL 2ARJB 5I8CB 3VG9C 3X3FL 1FL6B 2OMNA 5F8QC 1F6FB 4ZFOB 4FQXA 4LDLB 4JO4H 1FFQA 4HBQA 1UWEL 5GRVK 3BXNB 5D7LD 3HNSL 5HVFB 4RGOH 4MJIE 4KVCH 4L3EB 1CLZH 5C07A 3HLAA 3OG6B 1JGUH 3WSQL 1YJDH 3MLVL 3BN3B 4K3JH 1JTOA 1U42A 3SBWC 2V7NA 1A7OL 2BY0A 2C26A 5EU6A 5SWQA 5TE7H 4QRPA 1PBYA 1G1YA 2CGRH 3CFCH 3OKKB 1G7HA 1XGYL 4NT6B 1BFVL 1N7ML 3NIFF 3OTTA 3QNYA 4M48L 1SEQH 4PRIB 4WY7L 5J4MA 5DD6B 1FNEB 1IQDB 4DW2H 4RRPG 5I8KL 3WDJA 4BFGA 1OOAA 3WHXA 3O3EA 4BZ2H 5J3HC 2O5XL 5C08B 3MUGB 3V5KB 3F12A 4XPAH 5EU6D 4YDIH 1P4BH 2MQ3A 5IHZB 5D72L 4WHYG 3UTQB 3JV6A 1OM3L 1R3IL 2ZCKL 2HJFA 4JE4B 5FK9B 4JN1L 5MERA 1K8DA 4MDIB 3TBWA 5FKAB 1IGIH 4FP8L 4WGWB 1CT8B 5HHXH 2Z35A 4NZDA 2BSSA 2BY2A 1NCUA 2XA3A 3RIFF 3I75A 5I1CH 3ARRA 1FNGB 1QBMH 2B5IB 3O6LH 4PRBA 2JIXB 4LLYA 1MWAL 4NQCD 4U6YA 4J4PA 1GC1H 2W0FB 3CSBA 2ADGB 4NO5B 1JNHA 2HJLA 2VMFA 2X2YA 4HJ0C 3DO7B 5E6IB 3S98A 3HPJA 1AR2A 5ENWB 3RGVD 4OKVA 2DQJH 4JY6B 4OV6F 4UV7L 4PG2C 3WE6A 3KS0J 1ORSB 2B2XL 1ACYL 3I2CH 2WLZA 2PW2A 4N68A 3K8MA 2F19H 3CPLA 2WM0A 4KRPB 3U0PA 3U0TA 1CXHA 1HYSC 2P8MA 3N1QC 1VSCA 3PWLA 3V4PH 4CADA 3WIHH 3NMEA 3KHQA 4CGTA 2CKBL 3UYPA 1BVLB 1SM3L 2DQEL 3P11L 2ZG1A 1IC7L 5IW6B 1OPGH 5JZ7C 3HE6B 3T09A 1I1AB 3ABZA 2VDNH 4XX1G 1AHWA 5DWUH 4G8EB 4N0UA 4MA8L 3RWDB 1BQHA 3QIBB 3RX7A 3DO7A 1IEBA 3ECBA 2DYPA 4Z7WA 1ZANL 4EUPB 2RIKA 1IM9A 1YUHA 1RJZB 5FHBL 3MRLB 3KJ6H 2BNQD 5E6IC 4J6RL 2LV4A 3C6LC 4LOUD 1YY8B 2AVGA 3U4AA 1A4JB 2VXSH 3SOBH 3QNYB 1M05A 5I8OH 3CK0H 4U1GB 1P5UA 3WHE0 3MOQA 1KELL 1NCCH 3KR3L 3LKNB 4FQIH 2OR9L 2NXYB 3BHBA 4UBDD 4WU7B 1S78D 5D5MF 4WHCA 5HHOD 5JHDD 2VQTA 4CRPA 2E7BA 5C08A 3QO0A 3TYGH 1Q94B 4NQVB 3EZJB 3FZUD 5DD1H 4AM0A 3MYJB 4P4RB 1ZAGA 4XWOD 3SGEI 5TDPB 1J1PL 3MRMB 5I1JH 5FYKD 5CEXB 4NSKA 2V17H 2GSGB 3VXSB 3BSZH 1ZEAH 4PRNA 4XP4L 4YIQB 4HWZB 4Z6AT 4XP9H 3ZLQC 1MJJB 3ZYOA 1ZVSA 4LPVA 3MRLA 3GKZA 3SE4C 4H8WH 3QDJE 2W92A 1YEFH 4Y4HA 2CMRH 1SBSL 4ZS6D 2WIMA 1XGPA 3ILPA 4CMMB 1I3GL 3O4LE 4PRBB 5HGBB 5DRWB 4DZ8A 5GGQL 5CSZA 1WEJL 1MCPH 43C9B 4WNQA 3MXWH 3QDJD 5D1XD 4ZYKA 3UDWC 1KJVA 2A6JB 4K23L 1H3WM 1KPVB 3OL2A 1F3DJ 5J12B 3GBNH 1EUUA 1T03L 3PGFH 4ZFOA 3EYVB 2PYED 3MFFB 4JFQB 1GGIH 3ZDYE 4GJTB 3KGRA 1JYWA 5EOTB 3MRDB 3NFSL 2RHEA 4HKBA 5I18H 1YEGL 1TQCB 4XXCC 2OTUA 3ARDA 2ICWI 4IEFB 2GCYA 4P5TA 5FUCE 3IFOB 1C16B 3QEQB 1CFQB 3MCKA 3SCMC 3TV3L 1ND0A 4JPKH 2XNAA 2ZUUA 2IBZY 3IFPB 1CDBA 2I5YL 5D7JC 4FN0A 1YEHH 3DGGA 5SWSE 3E2HB 1TTUA 2DIBA 4NHCL 4D9LH 1CK0L 2JJSC 1IJ9A 5D7SL 5EA0L 3RVTC 3SGJA 4WWKA 4K94L 3DX8A 3F7PC 4TQEH 4DCQA 4QHKJ 5HGHB 4X8XA 5D5ME 5L7XH 2FRGP 3O8XA 5L8LB 4K7PX 2R56H 3RVXD 3MRIB 4RNRB 4PTUA 1I1FA 5IEKA 5DJ0A 3QDGE 2JCCA 2Q7NA 5I75B 4I3SH 1G7JB 4JLRB 4OQ1A 4S2SA 3PGDA 1K8DB 4MDIA 1EHLH 1AQDB 3DRTB 1CR9L 3QEGL 2R1WB 1ADQH 5IBUG 4YBLC 4HT1L 1G1CA 1JZ7A 3DVGB 1TIUA 5E8OB 5DR5L 2XQYK 5DVLA 1YECH 5IQ9A 1AR1D 5KS9E 4ZOAA 1R3JB 3LSOA 1J7VR 2DD8L 3QXAA 4LL9A 3RL1A 4P3WA 5T3XD 4HIJA 1IFHH 2ADGA 2JJVA 5IT2H 2EH7L 1OF2A 2A6IA 1NAML 1TNNA 2OTPA 3HUJB 1A1MB 2VO5A 1IQWH 3P9MA 3D39E 3VE0B 2P5EB 4HC1L 2EYRB 1MLBB 4RAVB 3RQ3A 3TLRA 3DWTA 4MB5A 3I50L 3UPCA 4YXHH 2OCFD 2D7TH 2W59A 3HA0A 4WTZA 3O4LB 1QRKA 2VLRE 1S3KL 4DJMA 2I25N 4JGMA 1G7JA 1IRAY 5A1AA 5I73C 4FOMA 4LNRA 4BKLB 3MLUH 4ZO7A 1S9VA 2D0FA 1X5KA 2GIYA 3MRPB 1FIGL 5AZEL 2RFXA 5DS8B 3S5LG 1ED3A 1I7TA 2FLRT 3MV01 1P4LA 5E8DL 5C09B 4WUUD 5GRZA 4PJ8A 3KPOA 5L6YL 2E7LA 4MQSB 5JHLL 2VUOA 4M7LT 5JUEL 5JMRA 5TFSH 2DI9A 4PJEB 3JWOL 4J8RB 4NKDB 2NXYC 2AJSL 4OZFH 5JIKA 1OB1A 1V5JA 1MIEL 4JY4B 3FOMB 2J1KA 3X13A 3DSNA 5C0AD 1MLBA 3MCKB 3QEQA 1GPOH 3QWOA 1CICB 1ERNA 4PJDB 1UCBH 2N1KA 2VWEC 1IAIL 2J88L 4GBXD 1QYGL 2ZSWA 5I15H 1DN2A 2R2BB 4XNQA 5IB3A 5A2FA 5JDSA 1PW3A 3HRZA 3EOTH 2FL5B 1UGNA 4WCYL 4YHYC 4KVCL 5BVJB 4APQA 4R8WL 3FMGH 3M8OH 3T0ED 3LKSA 3QUZB 4OI7A 4UIKL 4NQVA 3DX9A 5D2NA 2CGRL 3WFEH 3DBXB 1VKXB 5MI0C 4MD5B 4OZHB 3FT4B 5C0JA 3ZDXF 1EEQA 3VGDA 2VDLH 4YNYB 1I1YA 2YR3A 5F6IB 1MJJA 1FVDB 5FA4B 2XRAH 4OAWA 2R69H 1UWXH 3GMOB 4KJPD 5IBTL 2EH8H 2XFXA 3F62A 3RDTC 4B0MM 4OKDA 5ID0A 5KVFL 3GSQB 5E8OA 4O4YL 1G6RL 4S1QL 1VEOA 3CSYB 2OP4H 4YX2H 1R5VB 3VRIA 4LCYB 1OM3H 4M7JH 3L5WA 2MHAA 4HFWB 4PLJD 1K85A 5TE6H 3RGVC 1JVKA 3PL6A 4TSBH 3T04D 1GAFH 2DLHA 4EBQH 2CIKA 4Z7UE 5HJ3B 4HJ0D 3MGAA 4XNUL 2OM5A 2A77H 3V0VB 1WZKA 1I7ZB 5IOPA 4AQ1B 5I1CL 2EDWA 2UUDH 3I6LD 3Q48A 4NQED 4XHQA 1XGTB 2FR4B 5DK0A 3BH9A 4G6FB 4M5YH 5EZLA 2E6QA 5DO2C 1I9IL 2AXGB 1SY6A 3BUYA 3VXUE 4BYHA 3OXRA 4N0FB 3ARDC 2RBLA 1N5YH 1LP9E 2LTQB 2DYPD 3V5KA 1MFDH 1A3LH 2CDFB 3B83A 1Q72L 5DK2B 2DQUL 5C0BA 4HDIA 3FO0L 2AQ3A 3QHFL 4CU6A 1IKNC 4XBEH 3NIGE 3HR6A 3BPOB 1G6VK 5EO1B 3T2QA 4OCLC 1JWMB 4NGHH 1H3PH 4JO4L 12E8H 2Z0BA 5D6DA 1V3JA 4GG6A 3RL2B 4Z7UF 3OR7A 1ZTXH 3O11A 2XQBL 2FJGB 5ALCH 2CDEA 3RDTA 4UIMB 1P6AB 4ZD3L 1JPSH 3NA9L 2VDMH 3IDNB 4ZAKD 1GIGH 2UWEA 2J8HA 4ZAKA 4YGVA 4JQVA 1QZ1A 4KDTA 3Q5OA 3HPJB 3SJVE 2B1AL 1NEUA 3TBYB 1JYXA 2R1YA 2N4IA 4NQDB 5FYJD 4ZFZA 1S7UB 4LAJH 1GGYA 4ONFL 5GZNC 4NQTA 2OTWA 3WCYA 2COQA 5C07E 4HS6B 4MAUL 1RAMA 3GJFK 4LHUD 1UACL 1A9BA 2H6PA 2HFGH 4FTVE 1GOHA 1A5FL 1OARL 1QKZH 1TLKA 3BW9A 2WWKT 4HXBH 5DUMH 3K8KA 1K4CB 5IV2B 3BP5B 4Y5YA 1TZIB 5F7DB 2C1PA 5IQ7L 1FO0H 1NGXB 3EYQD 3ZYZA 1HNGA 3SKUD 4ODXA 3GSNA 5CAYB 1YNLH 3RUGB 1R3KB 4PYHA 3QUML 1N2RA 2H9GA 5DMGC 4Y4HD 3STZA 4PLKC 4MNQE 3BSZL 2GHWB 1E28A 2D3VA 3FJTA 3M17B 4IOIA 1DDHB 3QEQD 4YPGA 4OF0A 1SYSA 2VZ3A 4WFED 4BK4A 2XV6B 2BVYA 2MCPH 2FX7H 4YO0B 1P7QD 4LCIH 1RZFH 1CGSL 2FEEL 2FGWL 2ZUSA 2Z92B 2FR4A 15C8L 4NN5C 3AU1B 3SDAD 5D1QC 1KBGH 3HNVL 4LLUB 1QRNA 3BESR 1TQCC 1WCQA 1D6EA 1KCSL 1QEWB 4AIXA 4I3GA 3FN0L 5TE4L 5B39B 4YDLB 5FCUH 1KEGL 3GMPB 1YN7A 4DZBA 4TULH 1UJ3A 4WW1B 1KT2A 4XPGH 5DTFB 2DMBA 4ZFOL 5EOCJ 3HZVA 3VFUB 4Y1AA 5SWZB 2CLVA 3PP4L 4U6VH 3QUZA 3O0RH 4QHNB 5L9DL 2NY3C 5DURD 4WGVB 4MD0B 4DQOL 1I3UA 1K8IB 3DRQB 2VDQL 3CU1A 4R7NA 1CLZL 3CMOH 1MJ7H 3BX7C 1UVQA 1IZJA 5ICXB 1IGJA 2ICWJ 3S37X 1AQKH 1FORH 2XXCB 5EWIL 1A7OH 3KJ6L 4C55A 1LEGB 4OV5A 1N6UA 3OKOB 1QPPA 1CDIA 3KG5A 4O58H 2QSTA 4DN4L 3R4DA 4R2GC 2XZAL 3KLAB 1HNFA 1OAKH 2EKSB 1IAOA 4CDHA 5FYLH 2B1HH 1K2DA 2D7PA 1IEAA 4FQ2H 1VFBB 3PQYB 2OTUB 3ARDB 3T65B 3UTPE 4QTIH 1LK3L 2ENSA 1ZK9A 4JFOB 4PP1D 4WVRA 3UZQA 1MREL 2WW8A 4S1RL 5SWZA 3NIGF 2DIAA 5EO9B 1TNMA 1ZHBA 5D1QA 5A43C 5CD3B 1D9KA 2NY2B 3L1OL 4J3SA 4AEIL 4DOHB 5ITBL 1SJHB 3WEXA 4RQQB 1QVOB 3R8BB 1INQA 5IB4B 3WJLC 2IPKB 5I1GH 1QFWH 4NRXA 3PHQB 2P24A 3O3UN 4DEPC 1MCIA 3UTSB 4XAWL 2QQKH 5HPOA 4KJYB 5C7XL 3K74B 4P3DB 3CDCA 3FRPG 3QFJB 2NYYC 5I73B 3PQYD 4WW2A 3NIFE 4HH9A 5DWUL 3HE7B 5SWQB 1I7UB 4ZQKB 3QH3A 3BIKA 4YXLH 2P43B 3QCVH 4JQIH 3B3IA 1FN4B 1UB5A 1WTLA 4HGKC 4OLVH 2OI9C 5GJTL 1EV2E 2UWEE 3HZYB 2PCPB 1OVZA 1SJEB 3OGCA 4JFZL 5JPNA 3MNZB 3AS3A 4MD4A 4QHLB 5F1OB 5DJXB 3B9DA 3AY4C 4PJGE 4PREB 2KKQA 3C8KB 1CG9A 2H2SD 2P42B 3FOLA 2HMID 2BNRD 5HI5D