4XNQB

Antibody hemagglutinin complexes
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
217
Chain Sequence
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords H5.3 Light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 217
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB01
4N8CL 1DBML 3EKCA 4LPXA 5HI3D 3D2UD 4HZLB 2GSIA 4IJ3B 3HS0A 3L5WA 4HULB 2H1PL 1I7TB 4M4RA 2VLRB 1RZFL 1P2CA 2R9HD 4KZEH 5JR1H 1L9NA 4EDXA 2OL3B 4TULH 3RZCD 4XNUL 4YHIA 3BQUA 1EAPB 4HJGA 2RQ8A 3HUJB 4MCZA 3T4AA 3ZL4L 4XWGL 2Z4QB 2UUDK 4Z7QE 3LN4A 1CLOL 3NFNB 5FYKE 1ZGLB 2NY5H 3I6GA 3VDAA 3SDYH 4H20H 3FFCD 5ID0B 1HH9B 5KVEL 2Y36L 4P4KB 4K7PL 2R56H 4J23A 3MREA 3QDJD 2ENSA 3O8XD 3HZMA 4JRWA 2NXZC 3CPLB 1PDKA 1NAMH 3D69A 4GXVH 4HXAL 4N0FB 3W2DH 4LVHC 4QXWA 2BERA 3CLEL 4P5KA 2P44B 5HHOE 3O9WA 1NQBA 2ITDA 4S1RH 2AEIT 3VXUB 4PR5A 8CGTA 3BZDA 4O00A 4RDQG 4WENB 1ND0A 5CS7A 4LSUL 4EXKA 4RIRA 1WWBX 4G3YL 4YLQT 4M7KH 3WNMA 5DT1H 1OLLA 1PEZA 1VFMA 3Q48A 1RUAH 3SQOL 4U1HA 4LLMA 1KCVH 3HC0B 4HV8A 4XNZC 2DQCH 3C8HA 3O3UN 2C3VA 5E7BA 4K71B 3LB6D 2VQTA 3FKUS 4XPHH 1IBGH 5C0AD 3U0TB 1O7VA 3F7PC 1ZANL 1WITA 3FONB 4HIIB 3E6FA 5C7XH 1R3KA 2UYLA 4OF0A 5LBSL 4U1NA 3SE8H 1W72L 1CDBA 4DUWA 4YJZL 4Z7UA 2P48B 5JW5B 4JPIA 3WXVH 4GG6F 2CK0H 3PL6A 4I4WB 1RZJL 2VLKE 2ADGB 1ED3A 4NN5B 1T7VA 2C7UB 1EEUA 4L4TA 3KPNA 3ARTA 1MCRA 5I66A 4OF7A 4UB0H 1T80A 2AXFB 2HT2C 1BBJA 5CGTA 1KIQB 2WWMC 4X6FA 3OV6A 5E2VL 3RWDA 3WHXA 5JW4R 1C7SA 1J8HE 4LQFH 3FRPG 5DD3L 4F33A 5J7CC 3ZKMC 2VZVA 4KDVA 4JJ5B 5JIHA 5SWZB 3ALXA 3QI9A 4FTVB 1MELA 1CGSH 1TPXC 3PQYB 2Q87A 1NC4D 5DFVC 3BH9A 3SDCB 5C07A 4NZJA 4LFHD 2HJFA 4WHTB 4DGVL 4OCYL 3QWQB 3GSOA 5EC1B 3B5TA 3OAUH 4KGJA 2JCCA 1U8PA 1AXSA 2R1XB 4HMDA 4N0UE 5GGRB 3ILPB 4YE4L 2GJ6B 1REIA 4PGEB 1FFNA 43C9B 1FO0H 3TFKC 5CWSB 1MCWW 3PHOB 2N56A 2ARJQ 1NFDB 1JRHL 3MJGX 4PGBB 1MFDL 2P5EA 3S4SG 4OLVL 1R6VA 4RNRB 3VWJD 3IKKA 1DQLH 4PJ5E 2R0WL 3CGTA 3W82A 5HYSG 5EPMA 3E2HC 4DN3L 5GS1A 3OPZH 2ZKHH 3BGFC 5HHVH 4GRMA 4TN9A 2VDPL 3L3KA 1RD6A 2VL5A 5E9DB 1RZ8A 2VLRD 1QBLH 2YKLH 2AK1L 3FRUA 2BNRE 3MGOB 2HVJA 1R5WB 3FB7A 2D0HA 1XGPB 5DRZA 4WTXA 2AGJH 5DVMA 3MRIB 4QHNA 1RUQH 1U8QA 4NPYA 5LGKA 4GFTB 4HCRH 1ITCA 1VA9A 3BUYA 3IF1B 4MLSA 1IGIL 2XWBA 2FEEI 5DQDL 4K9EC 4P4KD 1E4KC 2PYEA 1T1ZB 1PX3A 3FT4A 5ESVA 4EUPA 2B5IC 3PJSB 1JP5A 4MQSB 1FP5A 3IAGC 5SWQB 3PHQB 1N26A 3O6FB 4TVPL 2PKDA 4XX1E 3VJ6A 1X44A 3I2CH 1HH6B 4Z76B 2VE6A 3BVNA 3DIFB 3O0RL 3S35X 3EJZC 4JFPA 2BVQA 4L29B 1PKQE 4GAYB 1RUMH 2IPTL 2X4QB 3FOMA 5KSAB 3VXUD 3C2AL 2XY1A 3TO4D 1DVFC 1DE4B 2EDWA 3LDBB 4M9OA 2WP3O 5GS3A 3GK8H 4C83B 4PY8J 4ELMB 1MWAA 1BHGA 2WBKA 3M8OL 1RZ7H 2I9LB 4OI7A 4HGWA 4NO2B 1IGFH 4KK8C 4HLJA 1FRGL 4BH8A 4WW2F 1DUYA 5JIKA 4JM2F 2VERN 2NY3B 4CU7A 5TDNB 1FDLL 3JTSA 4GS7C 3VI3F 1AGCA 1DDHA 5DD5H 4MAUL 3G9AB 4PJ8B 4M5ZL 3MJ9H 3F58H 3QCUH 4NZUL 5DJXA 4PJEA 1AO7A 4HMCA 3I75A 1JZ2A 5T1LA 1NGPH 3SOBL 1HWHB 3MNZA 4PRPD 3D85B 1JMXA 2GCYB 5TPWL 2B4CL 4J1UB 2A77H 2YPLA 3RVTD 5EO0B 1PQZA 1WWWX 3MLTA 4OZIE 4HPOH 4OT1L 1EVTC 4NWTH 1KC5L 4LKXA 3NZ8B 1KENH 2Q76B 3QUMH 3OTTA 2ZSVA 3CVHB 1WCBB 3DX9B 3MPCA 3NAAL 4R4FH 5ESQA 5IBLC 4RZCA 5SWZD 4FTVD 1FYHB 1LNUB 3PDOA 3PQYD 1S8DA 3DX6B 3SDCD 4V2CB 3QCVH 5IM7B 1ZLWH 1S5HA 2E6QA 3UTPE 5FB8A 1R3HA 3L7FA 3WMSA 3SDAC 3MRFA 3V0AC 1P69B 4DJMA 5IKCB 5ITFA 1NGYA 2GJ6D 2XG5A 4YHZH 4NBYB 2X89D 2OTPA 1FE8H 2YMXH 3K8KA 5J57B 2FIRT 5HHQB 4G6ML 3WUWG 4MNGB 3T0VA 4FFVD 1T04B 3MRPA 3TIDA 4F7EB 3LEVL 1BGXH 5EU6A 4RBPK 3WKMH 2VITA 1IEBA 2NY1B 5T5FH 1XR8B 2V17L 4QYOA 2ARJA 1W72A 5DQ9A 4LCWA 2XXCB 5E9DD 3E6HB 1LEKA 1MHHA 1ES0B 1WFTA 3JWOC 3T8XB 1SJHA 1I9JL 1P6FA 4HQQH 2C26A 3ARWA 3BD4A 3LY6A 4F9LC 1OF2B 4HS3B 5GSVB 1LP9F 4PRNA 1CE6B 3KYMB 4PV8A 3WL9B 2AQ1A 4OFDA 1YECH 3NA4A 4U1JB 3K3QA 2RGSA 3MO1B 32C2B 3O6FD 4FNLL 4PP2B 4OLZH 3TNNB 3TPUA 3KNBA 3HE6C 5C9KA 3W9DB 1QNZL 1VEOA 5IHZB 3IXTA 1MHEB 5IW1A 3FN3A 5I76B 1P7KB 3F7YA 4L3AA 5KSAD 1P6AB 4YGVB 3C5JB 5F6HI 2ZCLH 1AGBB 4HS6A 4FQXB 3CLFL 4NRXA 3WFZA 1NUNB 1OP5K 5CFHA 2NZIA 2VL4A 4UOW1 4YDJA 3SKUD 4JZJA 4F3FA 1IAKB 5E2UH 5GRUH 4KJWC 4XB7A 2NY3D 2XPGA 1K2DA 2O5YL 2EEAA 4N0CC 3QDME 5EU4B 3QUZB 4YDVA 4PJ8D 4JJHA 2YRPA 4JFHD 2XIDA 1TZGH 3Q5TA 1QPPA 4UNUA 5DMGC 1E28B 2JB6A 2B1AH 2HJKA 4NKDB 2AJUL 1JZ6A 3DXAE 1HSBA 2HKHH 1FL3B 1EX0A 2VMFA 3D85D 3WN5B 4UIKH 5E1HB 4L3CB 4R90H 1MFEH 2M1KA 1J5OH 3RY4A 4M6OL 3T3PE 3GMQB 3BUTA 4IMLB 4QCIA 4WEUD 3S34L 2R29L 2OTUB 4QHKJ 5E8DH 2H3NA 1QLFB 4G9FA 5I9QC 1P5UA 5C8JB 4EN3C 4OJFH 1M05A 4QHLB 3RWEB 2JTDA 1XGRA 4H5SA 1OTSD 3KYNB 3VRIA 3HLAA 3PWPA 4R26H 5I74C 1UVQA 4ZXBB 1IAIL 3N1FC 2F5AH 1GOHA 1LO0H 2X4SB 4XPTL 2NY0C 4WEMB 1CF8H 3K81A 1KPVA 2ED7A 4UT6L 1FSKB 4G8FB 3I6LE 5HI3C 4XCFH 3FO9B 1CLZL 1KLUA 4Y1AB 4HGMA 4XXCA 4D9QE 1KPRA 2PW2B 5EUOF 5D5ME 5F9OH 1HILB 3RGVA 5DR5L 3K4AA 4KJPC 2FGWH 5D96B 4D0CB 4XCCH 3R8QA 4JKPH 4PG2C 1ZVYA 4HF5H 4TTDC 5IB3A 5F7EH 2WQRA 4QXTB 4X6CF 5MEOB 4HPYL 4PJHE 5DRNA 3OAZK 4PJ7F 4O2FA 4UI2A 4KJQD 3PP4L 4LLYA 2NY1D 3BWAB 5DJZB 4N9OB 4YNYA 4P46B 4NIKB 2FYYB 1KN2H 1XGTA 4FZ8L 1BOYA 3SO5A 5H2BB 4QOKA 4PJDB 4BQ8A 2OYPA 1MI5E 1CFTA 3GSXA 3QQ4A 1YEKL 3O8XC 1TQBB 3SJVB 4MA3B 3MLXH 3DPBA 5EZJA 4EQ3A 3KLHD 2P7TA 3RPKA 4NN7B 5GJTL 3AU1B 3FB6B 1P1ZB 1PG7H 1BZ7B 1ROWA 4YXHH 2VXUL 1FIGL 3MOBH 4AK1A 5ADOH 1F13A 3KYOA 1EO5A 4PGCB 4W68A 1K4DB 2W1NA 3OX8B 4U6XB 3MC0A 4LK4A 3VFNB 1OAYH 5T3ZH 1CXFA 4G6KL 3V7AE 1CICA 2B2XL 1E4XH 3ZYZA 2HVKA 5L2KB 4JRXB 3RA7L 3SE3C 2YK1L 1A6ZB 3VH8A 1MJ8L 5F7UA 4HHAB 2J6EH 1ZAGA 4P59L 1SHMA 4OLXH 4NQCA 3S9DB 2Z93A 5CJXA 1P7QB 4UV4L 5C0EB 1NEZB 4CU8A 5IFHL 4FQXD 4KDTC 5TF0A 1EHNA 3FL7A 3HZKB 1XGQA 3KWWA 3TVMA 5J11C 1F58H 4KVNH 3BGMA 1HHGB 2DQJH 4XVTH 3FQUA 5T1KB 1ZOXA 2X70A 4Y5YC 1G0XA 2Y06L 4V2BA 2A9ML 4AEHL 3DHJA 5E1AB 5KSVB 4FQPA 3FTGB 3C5ZC 5IWLA 1X5JA 4ZYKA 4XXDA 4ODWB 4ZSOB 1IZKA 5JXED 3QUZD 3KPQA 4CADA 1AI1H 2ERJB 4XPBL 4QKXB 1IM3B 2MFNA 2XY2A 3O11B 4DZ8A 5JW4M 5C0DA 1I3RB 3MGTA 4OZFB 1HZHL 1H3UA 3HKFA 2WUCH 2DM2A 4KHTL 5FK9A 1BBDL 1OD7A 3P4OA 4DCQB 3O3BB 4MS8C 4X98B 2BNUB 4GMSH 1YYMH 1BFSA 1MAML 3HC4H 3EFFB 3VRLF 3H7BA 1B6UA 4WU5B 2ZOLB 5CINH 1UACH 3CFIC 1CDIA 2I9TA 4NQXA 3WFBL 4OCMC 2A6DB 2XT1B 4X6DF 3VGDA 4P5MA 1OTUD 4LSSL 1QSEB 1W8OA 2D31A 1A6TB 4MJIA 1YNLL 4RRPA 4ZXBD 4Z7UE 3T04D 4GBXC 4L4VB 1IFHH 4X5WA 5JPMB 1KCKA 5EBMB 1QFWH 3PP3H 2JJTC 4LLQB 4RGMC 2V7HA 1GOGA 4Y1AD 1XCQA 3GMPB 4JM2A 2YBRB 1G7QB 2CUIA 1LMKA 4WWKA 4ENED 1HXYB 3EO1B 2PYFA 1FYTB 4PJFB 1NFIA 3MRRB 3TLRA 1I3VA 1C1EH 3GNMH 3EDEA 4ODHH 3EDJA 1MHCA 4HUUB 2BVOB 2H41A 1FVEA 4TUOB 1T66D 4JAMA 5C07E 1GAFH 3ZZ1A 4BFIA 1A7OL 2FJHA 1T2QH 5JORA 4BZ1L 5GGRY 2X7LB 3F65A 4LGSB 2AJSH 1IEAB 2PO6B 4P46D 5I19L 1MCSA 5FFLA 1ORQB 2FECL 2KDGA 3DVNB 1WFNA 3NZHL 3S88H 3GDBA 1AD9A 3CSPA 2IG2L 3UTOA 4Q9RH 2F8VA 1JPSH 1XZ0A 3ZKQD 3SJVD 2XKSA 3JV0A 1F5WA 4XNMB 5ICZA 2P5EE 3DVGB 3PDDA 5HPOA 2WWKT 1Q0XL 2F58L 5F9JA 1MJ7H 4KKNA 3SGKC 5F7FA 3T1WA 1FBIH 2Y4SA 2N4IA 1GPOH 2VLLB 1WWAX 3TO4C 5IB2B 2APFA 1NGZA 4WI6A 3ECBA 5CKGA 4I9WE 1HOCA 4OD2A 2EIZA 5HJ3B 1HYSC 1TJHL 4QWWD 4LCCB 5MEPB 5F89B 2V2WA 4R4ND 5F1IB 2BSSA 3X11A 3QIUB 5L2KD 4JRXD 1N7MH 4YHNB 1H3PH 2ED9A 4F7MA 5K9JL 2I24N 3OKEB 3JV6B 4URTB 4PJ9C 1C8PA 5L7XH 1P7QD 3U0PB 1KLGB 3HNVL 5IV2A 2PR4L 1JTTA 1ZHKA 2PYEE 4XC3L 1VGEL 1UM6L 4KWUA 7CGTA 2V7NB 3A6CL 5T1KD 3U1SL 4YXKH 1WC7B 1XH3A 2YC1A 3RVTC 4PJBF 2J12B 4HWBH 3T4AB 3HFMH 5C6PB 1I7RA 1H3WM 2CDGB 2D7MA 5B3NA 4IDJL 3DSNA 5GRVL 3LN4B 5ISZA 1ZLVK 2XACC 5DA4A 4XP9H 4CKVX 3QNXB 1A7QL 2R4SH 3ZTNH 5E70A 2YUXA 4LGRB 3JUYA 1MRFL 3BEVB 3SPVA 3RUGA 3T0AA 2NX5E 4FFZH 2CR3A 3U9UB 4J12A 3SDCC 2HFEB 4GG8B 4TNWF 1F4XH 1I8MB 2VABB 4ODBD 1J0ZA 1QLEL 5T3ZE 1CFNA 2V9QA 3BP6A 1H8SA 1CL7I 4LCYA 5DUBA 4G42B 4I48B 3AVEA 5IVXF 4YAQA 1QEWA 4GAJL 5CZKA 2EC9U 4DAGL 4PJEE 1AO7E 5IMKB 1J0JA 4NFBA 1U3HA 4RIRB 4LFHG 3TP4A 1EA9C 4HKXB 1U9KA 1QSED 3ZTJG 4AQOA 1QOKA 3QNZA 2YPLE 1GH7A 4OIIH 2NQCA 5EU3A 2R69L 4DW2L 3OKDA 3MODH 4XMPL 3T3MF 5KVFL 4LLMB 3L3DB 4PJGB 4WRLA 4GRWF 3RVVD 5DMIH 2O5ZL 4WY7L 1CWVA 4GQ9L 1X7QB 3I02B 4XNXH 1L0XA 4AENA 1FZMB 5A2LH 2FJFA 5DC4B 3ULUF 1FYTD 3GJFA 5CUSL 3O2WL 3F5WB 4I5BB 1T7WA 2GSGA 3TZVC 3Q1SH 1F90H 5E5MB 2W38A 4UNVA 5FM5M 1HHIB 2ESVB 3PWVB 3ABZA 4TSBH 4ONOA 3QEHA 2XTJB 3DOSA 4L4TB 1JPST 4NWUL 3O6FC 4WGWB 4M93C 3KPRA 4UTBL 2E9BA 1F02I 1BX2A 1QR1A 1ZA6B 2DQEH 4X6FB 2NY7H 4HIXL 2CO7B 4JHAL 3KG5A 3UTSB 1XIWC 4G7YL 1GGIL 1K8IA 1IC7H 1R5VA 2I5YH 4JN1L 5EU6E 1LO4L 2FH6A 1CG9A 1J87A 3BOVA 3G5ZB 3VFGL 2AAVA 3IFOB 4CMHB 3ILQD 4JCMA 1D9KC 1MCOH 1U8PB 5FYLD 1AXSB 5BXFB 4OV6F 4QXUL 3B9KA 2DN7A 2JB5L 3IETB 1DQDL 2OP4L 3QIUD 4RDQF 2Y9RT 3STLA 4OCXH 4F7TB 4S0SD 4S10A 5D7LB 1WBXA 2NY3C 2YS4A 1DQJA 5FHAL 3JSSA 2DYPA 3RDTA 4JFYB 1Z2KA 2R15A 4PJ8C 2AEQL 2BOBB 3U2SA 3SCMA 1R3LA 3BYYA 3MLSL 4IMKA 2EIBA 1NCCL 4XVUC 1RZ8B 5GZND 3RL1B 3VG0L 3OKNA 5D4QA 3V79C 1MCLA 4C57C 1AY1L 3OG4B 4NQEB 3A6BL 3S36X 4JO2H 4LVOB 4EIZC 4QHNB 1NCDL 3D48R 4H0IA 4ZO7A 5F8RC 5D7JC 1A4JA 3WJLC 2VXSH 2EIEA 2K9UA 4M8VA 5IK3A 1SEBB 3FT4B 5MENA 4EUPB 1OTSC 3BPOC 1IZJA 2BNQA 4LLVA 2CDFB 2AEPL 1RJLB 1NLDL 4GOSA 4LEXH 5AYUL 2VE6B 4OB5H 2YEZA 3CVHH 1JNLL 4IEFB 1N5YH 2A83A 5EIIB 2AJZA 2YWYA 5E6ZA 3QUYA 2HKFH 1VKXB 5E99L 2ZOKA 3O9WD 2EDKA 4KI5D 3GIVB 3VGBA 4XAWH 4Q9QH 2A6JA 4JFEA 4JQXA 3BKML 1AJ7H 2EXYD 3OR6B 3EGSB 2RB8A 3INUL 3IVKB 2ZUWA 4RGNE 1FH5H 4X7CC 5FYJU 3TNMB 1EEZB 2F54A 2Z91B 1G9NH 4KJQC 1DUYB 3FAXA 4C4KT 3BP4A 4XAKD 4G9FE 2VXQH 2WUBH 2VH5H 2NW3B 1JF1B 3CMOH 3NFSH 1BZQK 4KKCC 4ACPA 4M7ZB 3TWCH 3V5HA 4EBQL 3GJFK 4FZEH 4UDTA 3MRHB 4B0MM 5E8OB 3PWPE 2BHZA 1KJ2L 3HR5A 3I75B 4CN1A 1NGWB 1JGEA 3EOAA 3MNZB 4KRLB 3KLHC 2HWZH 5GPRA 4IM8A 3KXFE 2ESVD 4ODSL 3FFDA 2BRQA 3X3GH 2MPAH 1FFPA 2EKSB 4IRSA 1CD1B 1MJUL 3PL6D 3MRKB 2X1WL 5T1MB 2XTJD 4F58H 3MXVH 4L4TD 1T7YA 1A0QL 1YEHL 1S7VB 5HD8C 1OY3B 4W81A 4W4OC 1Q0YL 3L3HA 2NY4B 2X4PA 4POZD 3IXAB 1SM3L 4M1DL 5D7IF 4D9LH 3GIZH 5E2TL 3P4NB 4NFCA 3M45A 4TQEL 2Y7QB 5FB8B 3L7FB 4XH2A 3MRFB 5ALBL 3HAEA 1Q38A 4NO5A 3SEPA 5BVPH 1BVLB 4QOKE 1A7PL 1S7RB 5EZLB 5BQ7A 5I30H 3BZ4A 1IQDB 3MNWB 1SEQL 4UOJA 4FQ2L 2P46B 5B38B 1UZ8A 4HIHB 4E42A 1T20B 3W9EA 8FABA 5D7LD 3QUXA 4IOIB 1FAIL 4WEBL 3S35L 3OKMB 4YX2H 3EDFA 2E27H 5IEKB 1HQ4A 1VFBB 3F7RA 5JXEC 3QUZC 4E9LA 1ZWIB 1NL0L 3LH2H 1J05A 2F19L 2VITB 3HR6A 2BMKB 4ZNEA 5B8CA 1R5IB 2WV3A 5DQ9B 4G7VH 4NM8H 4AZ8A 4OCRL 1BF2A 3NCMA 5D93B 3PXHA 4OIBA 3QG6B 1V5JA 1A6AB 4LHUG 3QDGA 4QO1A 4NQED 3SDXF 1AGEB 1T21A 3RNKA 2VLJA 1MRCH 4LGPB 3QWRA 2A38A 2R1WB 4NQCE 3RKDD 2OS7A 1BQUA 1OAUL 2ZCHL 4HWEL 3MR9A 3OKOB 1I3GH 3RU8H 3RY5A 5GIRA 2VR4A 2QQQA 5D9SA 5EFIA 5ADPH 1ZHLA 5A40E 5E0QA 5ALCL 4U1IB 4ZXBC 4S1QL 5DDHA 3O2VL 2VWEE 5JXAH 3KNBB 4I2XB 3U9PH 2KUTA 1D6VH 2DQIH 1MIEH 3VFPB 5F7NC 4Z78A 2R4RL 1OGAA 1P4IL 4WI7A 1A9EA 3F7YB 4PJCA 5I1HL 4HD9A 5A2JH 2WLZA 3KPOB 4ENEC 4X9HA 4IOSD 5K9OA 1WAAF 4AIXA 5DRXA 1UWEL 4ELME 1KJVB 2E5EA 2LTQC 4P9MH 1T66C 2J8HA 3BDYH 4PLKD 4KC3B 3MRDA 5C3TA 3HPJB 4R96A 2V2XB 1GSMA 1BIIB 2IPKB 3C08H 3VI4F 3U30B 2Z31A 3D0VA 1H8OA 4K8RC 2NXYB 1A7RH 3H3PL 4P46C 2ORBL 3TYFA 1MLCA 1IVLA 2FCBA 1EO8L 3MFFA 4JDVB 3MSPA 5E5UB 1JI1A 3BXNB 3OAYH 3MRNB 4PRBB 4ZPVA 2B8OT 2HJKB 3V8CA 4GKNB 1TQBC 4MJIE 1UXWA 2X4RB 5CHNB 3L95B 5IB1B 2R2HB 3IYLW 3MRJA 2IH3B 1F11B 5JOPD 1MCJA 5D6DA 4NN7C 3MNVA 3CDYA 5I1EL 1G9MH 5DI8A 3UJJL 4F9PC 1YJDH 4UQ2B 2WBJB 4Y2DB 4AYFA 2IBGA 4JQIH 3WFEL 1JNHB 4OGZA 1X6NA 4FFYL 3L3IB 4X6EA 4NSKB 4QWWC 1FIEA 3NCEB 1T2XA 1ZHBB 4R4NC 4J2XA 3H3BC 1XGRB 1V7ML 2MHAB 4MDJB 3WIHL 4WUUB 2NY4D 5L9DL 4L1DA 3GBNH 5DUML 2XWJA 3GSQB 2W9LA 4N0YL 2ZJSH 3V5DB 3MLRL 5IP4A 3BH8A 5KAQF 4WV1A 4S0TD 2FX9H 4BA8A 1A1NA 1U93B 2P8PB 4Y19A 1A8JH 1CK0L 1F8TH 2ITCA 4MNGE 4ODUB 3SGEI 1AHWC 5EBLB 1ETZA 2FO4A 4UINH 1KNOA 2OJZL 3J8F7 5IUSA 2NLJA 4GJTB 1JV5B 3S98A 1FZJB 3H9SB 1KJ2A 1IQWH 1IGTB 2X05A 4JGUA 1N59B 4PJXE 3ROOB 5EOCH 4GG6B 4LCWD 5TE4H 4P9HH 1KEGL 3RWIA 2W9EH 5DJDA 4C56A 2UUDH 5D2LF 4LNRA 3GKWL 4EQ2A 4LCIH 4NQSB 4K23H 5BMFL 4KAQH 2F9BT 1J7VR 4ZTOL 4PRDA 5I1DB 4OZFH 1U8HA 4MAYB 2CLVB 4ONHA 1X5GA 3QHZL 1TDQA 1WZMA 4YR6A 2HFTA 1BJ8A 1YUHA 1RZKC 3REVB 3ARYA 5DJ6A 1HWGB 1IL1B 4Z0BL 1S7TB 4WI8A 3LQAH 4M6ML 3OJVC 1A6VL 2DQGL 4J4PA 4PJAA 1AC0A 1FCGA 3AXLA 2QKIB 5HGDA 3DTXA 5IBTL 3B9EA 4PY8I 4GAGL 3N85L 4ZUUB 3RKPA 3HI5L 1QBBA 5ISZE 3LIZL 1O0VA 2NPLX 2Z93B 3IFLH 1IGYA 5DVNA 1LE9A 4JO1L 1Y0LA 1KN4L 5DSCA 4RWYL 4TSAH 4MD5A 4XPGH 2BFVH 3RUGE 4LKCB 2Y5EA 4LRNL 3FQUB 1TJIL 1JUFA 2BJML 3HE7A 4PLNC 3ZE1F 2A1WH 1H5BC 3IKCB 4XBPA 3QCTH 3UZEA 1XMWA 4XXDB 2I25N 2EO9A 4Q2ZA 4Z8FH 1L4IA 5ITBL 5A2FA 5GS0C 4DZ8B 1EUTA 1CIUA 1YQ2A 4Y16B 3QH3A 4OFVA 1IC5L 4XCEA 5BS0B 2DB8A 4HJ0C 1G7JA 3JUZA 3QDHA 2LABA 5JHLL 3DRQB 3PGCA 4BK5A 5E08H 5D2NC 1X5KA 2GQHA 4G5ZH 4TNWK 4WI2A 2WBJD 4Y2DD 2QHLA 2BCKA 3ILQC 2VZSA 1J0HA 4TVPD 3VXMA 3VW3L 2YPVH 2HLAB 2QR0A 3QFJB 2BZDA 5TGBA 3L3GA 2DI8A 1Q72L 4WCYL 5C08A 5SX4H 1RUKL 3EYVB 3W11C 1KTKE 1E6JH 3P0VL 3MXWL 2FEEL 3FB8B 5FYLH 2HFGH 1YMMA 3QHTC 1AQDA 5JLZB 4X5WB 3NFPA 2XRAL 3VMPA 2FATH 3LS5L 3HRZB 4XNYL 3R06B 4X8JA 3BE1L 3M1BA 2Q20A 4WW2B 4N1EA 1MQKH 5IQ9A 4JM2B 1J0IA 1JWMA 3OJ2C 1XF1A 4KV5E 1YQVL 4CAGA 5FYKU 2YD4A 2PYFB 4I77H 1NFKA 1AR2A 5CEYA 3RGVD 2CSPA 1NEZG 1UB6B 1IILE 1YY8B 3T2NL 3VD9A 2X1OA 3G5VB 4BFIB 1I1AA 2B0SL 3H9SD 3GZKA 2E8ZA 4P2QB 5AD0B 2D7NA 3IS1X 4EXPX 3H0TB 4DUVA 1MVUB 3L5JA 3K1KC 4PJDE 5IB5B 4FQJL 1NDMB 2FHFA 2DWEB 4NP4H 4OD1H 3U0WL 3FQXB 1JHLL 5EU5A 4F8QA 5FF6B 1CXIA 1IKNA 1JGVL 1I8KA 1U8KA 1NC2A 3BX7C 3O9WC 3I85A 2YA1A 4G8GE 4IDLA 5HHMB 3OKLB 3FCTA 3CUPB 5D7IA 3WIHA 1NGZB 3MUGB 4O2CA 3X13B 1IAOA 1QFWM 3PWUB 1GCFA 2AJYL 3KPPA 1INQB 3TT3L 2BHUA 3WLBB 1MUJA 4LLUA 4I3SH 2UWEF 1P7HL 3X11B 5IQ7H 5F7LB 5EWIL 2X4NA 4LU5L 3LKQA 3LD8B 4C59B 2W9DH 1EJOL 2ZUQB 3TF7C 4LAQH 3EUUA 5GRJL 4O9HL 4AT6A 4WI4A 2H2PD 3CVIL 3LKRB 1N0LA 4KQ3L 2H8PB 4WGVB 3OGOE 1UCBL 5JIPA 3DROB 1U8JB 2BNQE 4RMRA 4Z7VE 1KCUH 2QHRL 1RZGA 5EN2B 2IBBA 3NABH 4YDIH 1I9RL 3AAZA 3QPXL 3IDGA 1I7ZA 3KR3H 3TA3B 2YA2A 5F1OB 1MFCL 3PL6C 1AXTL 3MCG1 1WT5C 1GHFL 2OZ4L 3PV7A 4MMZC 1YYLH 1ACZA 5A43C 2R8SH 4JFEE 4Z0XA 1OAXH 3EOTH 4YDKH 5FUCC 5T33H 1LP9B 3ZHDA 4DZBA 4Z77A 4Y16D 3U46A 5C0ND 3NACH 5MERB 4QTIL 4Y4HA 1OSZA 3X17A 4QHKI 3KLAA 2QADD 4POZC 2VDQH 3SPVB 1FZKA 2NNAB 2DWDB 1ONQB 3H9HB 1AGDB 1DJSA 4OQTL 3ZT5A 4CMHC 1JWUB 4HFUH 1E27B 4LBEA 4LCYB 1J0KA 4YAQB 3QFJD 4LARH 1QEWB 4HBCH 5DEFA 3HMWH 3JZ7A 4BQCA 4RFOL 2X4TA 2X44D 1U8OB 5FA4B 4I3RH 4GW1B 1UZ6E 3JVGC 1RIUL 3KPLA 2HMIC 4TNVF 5TF1L 3KJ4B 5JUEL 4L4VE 1Y18B 3B2UC 3QNZB 4JY4B 3RVWD 3O2DH 3B8SA 5FUOH 3G6JF 3O4LA 1A1MB 1QZ1A 5DQJA 5GS1C 4LSTH 4OKVB 3GO1H 2ZG1A 5FECB 4J3SA 5IW6A 4JM2D 3CAFA 4PJFE 3F7VA 4FMFA 1OM3H 2BK8A 5FOBA 4IHOA 2DLFL 1MAKA 3GMRA 3GJFB 1QRNE 5DD0H 1NKOA 5C0FB 5TQ0L 15C8L 4RBPH 2AXGB 4YH6A 4LVOC 4UT7H 4ONFL 1TENA 5I6XC 1MF2L 3T1FA 3WNPA 3DRTB 3VDCA 1XF3A 4LEOA 1QACA 5GSRB 4P2QD 1N6UA 5D7SL 3P4LA 3U6RA 3RWCA 1A22B 5MI0B 4DGIH 2Z92A 1RIVL 4UT9L 4Z95L 4JVPA 1G7LA 1HKLL 2BC4A 2M26A 1BQHA 4FP8L 3EYFB 4K2UL 4BZYA 1OSPH 4X6BB 3G5XA 3CFKB 4QRPA 5F88A 5I1CH 4X4XA 4I0KA 4RISL 3U7WH 4DTGL 3KYKL 3BSZH 5IESH 1F3RB 1CG9B 1KG0A 3MCLH 5HHMD 4HMEA 1HHJB 4OQ1A 1RK1B 1MFBL 4ZNEE 2GK0A 4ZUWA 4HH9A 5HDLA 2E7MA 3VXRA 3U4EB 1LEGB 4ETYA 2FIKB 1ZT1B 3SBWA 4JY5L 3QDGE 1B88A 1L0YA 2IGFH 2VLJE 2BY2A 5J8OA 4G6JH 1J1OL 1HDMA 1UM4H 4U1SB 5EUOB 1T22B 3V7MA 4M1GH 2ZCKH 1DQQB 4OF6A 4KZDL 4IRZL 1Z3GH 5FYJL 1OP5H 3LV3A 4M7ZC 1KB9K 2OJEB 5I1GH 2W0FA 1AQKL 4X6CB 3DBXA 4ZFOL 1E4XI 4PJ7B 5HYJB 2H1PH 1RZFH 3VU2A 4LLDA 1LD9A 3IJYA 3OKNB 5I1IL 1BD2A 4M61A 4Y5VB 2QQKH 1HQRB 3PWJA 1YPZA 5DK0B 3TA3D 1OGAE 2ZUTA 1CFQB 3MV7B 3QO0A 1CGTA 4KTEH 5D2LA 1CFVL 1P53A 2EYTA 3QJFA 4XI5D 4PJCE 4B50A 4LSRH 1CLOH 4U1GC 2IALA 3WDHA 5SWSB 4ZUTB 3UP1A 4K94L 2PTTB 3MRCA 1JGLL 4P2OB 1QVOB 5IK3B 2EIDA 4EDWL 5MENB 3QXTA 4HSQA 1G6RL 1CDGA 2OXHA 1MY5A 5TQ2H 4X4MA 1CE1L 5HGHB 4I1NB 2EH8L 5CEXA 1OAZL 5EOQH 1WUNT 2EDHA 4N5EC 4JREC 1GC1L 1DN2A 2F8OA 3QUYB 2X42A 2UZXB 3VFSB 4AQ1B 4CMMA 3KYAA 5C9JA 5KZCB 3OGCB 4UMGA 1UG9A 5HI4D 3T4YB 4DQOH 1NANH 2HH0L 3UYPA 2Z35B 2VDLH 1DBAL 3HC3L 1ZEAL 4KJYA 1HEZB 2UY6A 2J4WL 1EFXA 4XCNB 5IMMB 1CXLA 1QA9B 4MNQB 3BKJH 2YD6A 5TH2A 1AP2A 7FABL 1CTNA 1XGYL 1F6AA 3GBMH 4M43L 3IDIA 4Y4KB 1RZJC 2R1YA 4XNQB 5JO5B 3QEQB 2OZ4A 4B53A 1BREA 3OAZH 4NC0B 2CDEB 1GZPB 1JGEB 1AR1D 1KLFA 5LBSH 3GMNB 1EEYA 4H1LA 4PP1D 2UZIH 1FHGA 4P2YA 3QEGH 5FUZH 2WIIB 1D5XA 2X09A 3BAEH 4PRHA 2PCPB 1LDPH 4ODXA 3KPRD 2APXA 4Y19E 4PLJD 1NBYB 3UTSE 3DWTA 1OCWH 3D25B 3EYSH 4BH7A 4RFEB 2GFBA 4RA3A 1KEMH 2XN9A 2A0LD 3D39A 4X6DB 3S36L 4EUPG 1ULVA 3WXWL 5JA8B 3T0DA 3HNTL 1MFAL 1BVKA 2GTWA 3CC5A 3GSWA 4NO5B 1TETH 4TOYL 3V9FA 4Y89A 2X1XR 1NPUA 1MCPL 5CIPA 1KFAH 5TE6H 4E41A 4YE4H 4QRRA 4C56E 4O2EA 4YWGL 3B9KD 1K4CA 2P42B 4OIAA 1DBJL 1NCWL 5T3XE 5FO7A 3U30C 4MXQD 8FABB 5CBEA 3QUXB 4JGJA 3WE6B 2K3TA 4POYA 5J89A 4AH2B 5GGUB 4KTYA 1EMTL 1AGFB 4ZTPH 5IFAL 4FFWD 3UBXB 1IM9A 4OZGA 3AREB 3ROLA 1EXUA 3WIFA 4BQ9A 43CAB 5HYJD 2R0KL 5B8CB 4OCWL 1A14H 1SJXA 4PJAE 3PGFH 3BO8A 5D1ZB 1A64A 4RGNC 4X7EC 4E0RA 5FKAA 1L6ZA 3NCJL 3ARGB 3GEWB 1Q9WB 3MV7D 3L9RA 3B5GA 1JHTA 1UJ3A 3WO4C 4X80L 3ALPA 5SWSD 4KROB 3KVQA 4NBXB 1QLRA 1DBKL 3ZDZF 1QUNA 1IGIH 5DQDH 5K9KB 4FQHA 4LPVA 3KPSB 4P2OD 3WYRA 4S1SH 1EPFA 5EO9A 1DLHB 5MEND 4QNPE 4M1CC 1ACYL 4TVPH 3O81A 1NMAH 3GSUA 4N8PA 3LVEA 5DDHB 3VA6A 3SKJL 3ARSA 1A02N 2DI9A 5ACMA 3K2MC 4UILH 3QPQD 4FQQB 3O3DA 4FXKA 4POUB 4ZAKA 4Y88A 2UWEA 4NO3A 3O6LL 3IGAA 3LRHA 3QUYD 2FSEB 5KSBF 4XXCC 1I8IA 5KZCD 1D5MB 3C2AH 3G08A 1T7XA 1P9MA 4JHWL 3V6OC 3PWNA 4LLWA 3RGVC 3S96B 3VFWA 4XZUA 1FL5A 3QQ9D 4FABH 2DJ4A 1I7UA 3QB7C 4ODTL 4GW5A 4P3DA 2F54D 5JTWA 4Z7QF 2P49B 1BQSA 3VXME 1LE5B 1DBBH 1HCFX 1BFVH 4PJBB 4FOMA 1F2QA 4GKZA 1C5CL 3LKNB 1YEEL 4JO4H 2XQBH 5C08E 3BEWB 4G6FB 4Q9CA 4ELKB 5IHUL 4Y4KD 3NPSC 4GRLA 3QEQD 1U95B 3JTTA 3IU3A 3LS4L 2D9CA 4HS8L 3MJ7B 4KMTL 4DKEL 4WNQA 2B4CH 1HIML 2VXVH 4JPVL 4OCSL 5F70A 3FO1A 5MP6H 5DI8B 3MLPA 2EYRA 1K85A 3P0YH 1UYWH 2CLZA 1VSCA 2JJSA 1G6RA 2YPKA 2F74A 4XBEL 3VCLA 1FNEA 5C0RL 2X9XA 4Y4FA 3NIDE 1FNSL 5F7YC 3GSRA 5IVXB 4MSWB 3GI8L 1CICC 3MLWL 5GRXG 5IMLB 2PW1B 3LHPH 5DEGB 3CDFA 2IPUK 4NNYB 1OARH 2D03H 3FHQA 3QNYB 4X7TB 5CJXC 1S9XB 3QO1A 1PG7X 3P3YA 2XZAL 3BP5A 1FPTH 4WV1B 2ICWB 4GRWB 1SYSB 3ARBA 5JOEA 3DJ9A 5CLWA 1VEMA 2AV1A 2VWEC 3SDDA 4M3JA 2C5DC 4JKMA 3LN5B 1RFDL 1ZLUK 1P4LB 3QUXD 5IWLC 1EBAA 1ZHNB 4U6YA 5C92A 4R4BA 3RPIA 3DYPA 4NJAL 3VXPB 5IR1A 3CNKA 1KNOB 4NUJA 3X3FL 4J8RA 2VO5A 1KJ2B 3ARED 4X7SL 1OOAA 2V17H 3CSBA 5DK2A 5C0NC 3ULVH 1LO2L 4IIQB 2QADC 1FFQA 5BJTB 5D1ZD 5LAXA 1J11A 5CLTA 5BW7A 3MV11 4J3WA 3ARGD 4MDIA 5E4EC 4ZFGH 2C3WA 2WAHA 1ADQL 3HZYB 3RAJH 1ZLVH 4U1LB 1EIBA 3H42L 5DGRA 4NRZA 5GRYA 3O3EA 4KROD 3MLZH 4KQ4H 1TLKA 2R2EB 4FXLA 2Y6SD 3KPSD 4N90D 4XVSL 2XYCA 2CK2A 1C08A 2XZQH 3QAZB 5JNYA 2OLDA 5F3BA 5F1NB 5BRZE 3HZVA 1QSFB 3RVWC 5FGCE 4DOHB 2R0LL 3WFCL 2XKNA 1LK3L 3DTXB 4EVNA 2DTMH 1XFPA 2MKWA 3T2PA 2ZP0T 4JM2C 3TBSA 3BKYL 1E4JA 3WD5H 3JV4A 4WWKC 1T1WA 4PBWD 3V2AR 5F71A 1MHPL 5DSCB 4NO0B 5D71L 2JLLA 3OKKA 4K3EL 1X5FA 1PFCA 4BKLA 5EZOL 4AEFA 2EXWC 3QQ3B 3MUZ1 3G6DL 3MRGA 4AL8H 3QIBA 5FYKL 4Y8AA 2XNAA 1JNJA 1GVIA 4HKZB 4XBPB 4HIJB 4GKOA 2K7PA 5KVDH 4HLZG 3DMMA 2YD1A 3O41A 4G6FD 2ZG2A 4Z7OE 3BMWA 5IIEB 3B8YA 3EDKA 4BFGA 5LXGL 3S37H 4I18B 3KDMA 3Q3GB 3M17A 4D9RD 2DMCA 3DUSB 3BIAX 3H6JA 1QRKA 4XGZB 3NN8B 1VACA 1NGQH 4EI5A 2X6MA 4M6OH 1LO5B 1Z6JT 5IVZB 4QF1B 4CVXA 1JFQH 2BXZA 3GGWB 4XMKL 4WHYG 3CX2A 5C0IA 5FO9A 2XFXB 2K7QA 1SVCP 3L3GB 1R24A 1R3IL 2AJ3A 4ISVA 2Q6WB 3MBXL 4WUUE 2IJ0C 3MROA 1YY9D 4FRWA 3D9AL 4LASL 4TNVK 4GLRH 4UDUB 3LD8C 3KJ6L 1IAIH 2XOTA 2IQAA 3N9GL 1YMMB 3QFDA 2Y5TA 1BOGA 1S7UA 1UGNA 4HIEA 4OBRA 1SYVB 3G04B 3NA9L 1NAKH 5JW4Q 3O6KL 3UTTA 1CLZH 4KPHL 3GB7B 3AROA 2NCMA 1EGJH 4HEPG 3LEXB 4UQ3A 4PPTA 2HFFB 5DJ8A 4KY1H 3VH8G 4ZS7L 2PTVA 1KSRA 5GGTL 4E5XB 2MMXA 1UXSA 4QRPE 3DX8A 4DVBB 5HYSB 3ES6A 3ULUD 2FX8L 5JHDB 4XI5C 1GGBL 3KS0J 1INDH 4BK4A 3GUTA 2BVPA 3OXSB 1JF6A 2C1PB 2D0FA 1FN4B 5J4MA 4OZIF 1YMHA 1MPAH 4QHMA 1PYWA 2QTEA 5DEZA 4A2MA 4M7JL 1F6LL 2VDOH 1KPUA 4O5LL 4YIQA 2BHYA 2BP3A 2ADJA 1ZKAA 3OZ9L 4YFDB 2J8UA 1G1YA 5GHWL 3QZWA 1YC7A 2GJZB 4ZO9A 3C8KA 4AMKH 1HKFA 1VFAB 4YHLH 1MLBB 2DTSA 3RWGB 1U8KB 2NY6C 1NC2B 2RHEA 2FHBA 4JFFA 4QXGH 2AW2A 2BRRL 4NNPL 5D7IB 5HI4C 1U3HC 2G5RA 3M07A 1LILA 1ORSA 5ERWB 3TT1H 2VQ1A 1PY4A 3S5LB 3C2SA 1YDPA 4K55A 4NKIH 1HE7A 1FVCA 1WV7T 1MIMH 3KPPB 1BD2E 2COQA 1QSFD 4F57L 4L9DA 1WBZA 4U49A 3OSKA 1OQXA 4LLUB 1U2HA 4OSUL 1YPZE 5EA0H 5JDJA 1MCEA 3VE0B 4L8CA 1S7XB 3STZA 3SY0A 3DV6B 4P59H 1CBVH 1TCRB 2IWGA 2NXZB 3MYJA 5FIEA 3WS3A 4RGOL 5D70L 1L9MA 2UY7A 4NO0D 3ETBF 3U7YL 4AJ0A 1JYVA 4X4ME 1AR1C 1JTPA 2FX7L 1L6XA 3BP7A 1R0AH 4OLYL 3ULVE 4RAUA 4HX1B 1INEH 4XBGA 1VHPA 5KN5B 1AD0B 1I4FB 4OV5A 1ZT7A 2OQJB 3WEXA 1A2YB 2W91A 5DLML 2VZ1A 1R3JB 4LF3A 4XP1H 3SDXB 5K93A 1CI5A 1T1XA 1RVFL 5CILH 2Y07L 4XNZB 4HUXB 5MEQB 1ADQA 4DZBB 4KRPB 1KELL 4O4YL 1VGKA 2IFFH 1OSZB 3KLAB 5GJSL 3WIIH 4HWNA 4XCYA 3R1GL 5KG9B 3KGRA 5F96H 3X14B 3P9LA 2X10A 3EYOB 1NMCB 2AABL 4P5TB 5DRWB 3ARDB 2EZ0C 1F3JB 2XWTA 4P4RA 4J3XA 4LBEB 3GHEL 2IBZY 4GUPA 4MCYB 3IJHA 5DEFB 1S78D 5AUMB 2H32H 2YSSB 3B9KC 1SY6A 4G9DB 3CJJA 3X12A 1A6UH 4KZEL 2M2DA 5JR1L 4V1DE 1F97A 1YMMD 3DO7A 3CK0H 3RDTC 4OUUB 2G75B 3GRWA 3O4LB 2AVGA 2VC2H 1D5IH 4PRHE 4X9GA 1JPGA 2FL5B 3SCMC 4KUZH 1EUUA 2H2SD 4UU9A 5IW6B 3SDYL 1M4KA 3VFRB 3WUWB 4H20L 4LSQH 1MREH 3WKNA 1JNNH 3W0WB 2R56L 2DDQH 3LMJH 3L7EA 3D39E 2XN9E 5JHDD 2XTLA 3MUHL 4NQVB 3FQTA 2RFXB 5HHPA 3CFDA 1NAML 5IB4B 3MJ8B 3V52H 4GXVL 3W2DL 3MMEA 3MBEA 4P2OC 5I19H 2AK4B 4E41E 4QRRE 4JPKH 3CFEA 5HHOA 4S1RL 5BZWA 2FHCA 4IS6A 3E2HB 2WINB 1UKQA 4M7KL 3WNNA 3QPQC 5DT1L 1LVEA 3BDXA 1OVZA 4WDIB 4Z7WF 1RUAL 1G0DA 3VFTB 5F88B 3WO3B 4CNIB 3BIKA 1WLHA 4FQIH 2X4OB 3GHBH 1KCVL 3QUYC 1NC2D 3RY6A 3VA2C 5HY9A 5CZXC 4CVZA 3FO2A 4OZGE 2FB4L 1XF4A 3T08A 2F8XC 1C5DA 2V5RA 2DQCL 2DIBA 3CCHB 4JQXC 5DJAB 1H15A 2DKMA 4QGYA 3VXRB 1JGDB 2GAZA 1IBGL 5D5MF 4RMQA 3Q6FB 4HUVA 3JV5A 4OGYH 3QQ9C 5HHNA 2FGZA 5KSUB 4WU7A 4KTDH 1CZ8L 1V3MA 2KQNA 5TJWK 2B5IB 4RX4A 5I1LB 5C7XL 4ZFFA 1EEQA 4PYHA 4L8SA 4MWFB 3SE8L 3KHOA 4PJHF 5ANMA 3MJ6A 4EEEA 2NXZD 3PHSA 4RQQA 2CK0L 2SEBB 5GGTA 1V8HA 5LCVH 2E9WA 3V0VB 2F53A 1ZTXH 4UB0L 1O7SA 1A6WH 2XZCH 5DHYA 3A6CH 1DVFB 4CUCA 1II4E 4MNHB 5IBUG 4QRSA 4OLEA 2HJLB 3TBVB 4LIQH 4LQFL 3LAFA 5FO8B 1MCQA 4IRSC 5DVKA 4XTRC 3MZTA 1CGSL 5D2LB 3CZJA 1IC4H 1BFOA 3A67H 1XAUA 3LQZB 5ETUA 1XR9A 1QO3B 3OAUL 4GS7B 4KRPD 12E8H 2D4FA 5LGHH 4ZUSA 1FG2B 1OAQH 4JANA 1D5BB 4LCUB 4PGDA 1D3CA 3MV8E 1FO0L 2GTZA 4U1KB 3OG6B 1ZS8A 3RWHB 4HUWB 4UUJA 1AKJA 4P5TD 3QA3A 4OTXH 3ARDD 5IF0B 5DTFA 2VZ3A 1DQLL 4P23A 2H26A 1G7IB 3SKOA 4J6RH 4W4NA 3OPZL 4BUGA 5FA3A 2ZKHL 1JZ4A 1WIUA 5HHVL 4MXWL 5ENWA 5I18H 3TO2A 2OMBA 3EO9H 2WM0A 4MX7B 3E3QE 1QBLL 2W65B 2YKLL 1GIGH 3GMMA 1DUZB 1Q9OA 3QUXC 1X9QA 2HT2D 3NGBB 1CLYH 2WWMD 2D0GA 1KIRB 1CD8A 1B0GA 1NDGB 1UB5B 4WI9A 3O4LD 1RUQL 1T0NA 1X5AA 2O5ZH 4HCRL 4WY7H 5SX4I 5DFVD 5H94A 5B8CC 3FRPA 1RHHA 2FDBP 3SDAB 3GSNL 3DUUA 1TQCB 3IDNB 4PV9B 1TVHA 4YGAB 3O2WH 3W0WD 4JB9H 5E00B 2CXKA 3B3IA 5C0GB 5J6HB 4HKBA 4B7IA 2QLVB 3TH4T 4QRUA 4H1LB 3ZDXE 3TFKD 4X99B 4DWHA 4KROC 4PRAA 4APQA 2WK2A 1T1YA 4GO6B 5F7KC 4EKXA 4G43B 1RUML 3MRLB 3T0EA 2AK4D 4FXGA 2NTFA 1CXEA 4L5FH 4QLRA 5JW3H 1T4KB 3WFHB 3L1OL 3S4SA 5IG7B 3LQMA 4KKBC 1Q9LA 5L2JB 4X4YB 4Z7UF 2FBJL 1VADB 1PD6A 3K0WA 1RZ7L 4NDMA 1IGFL 1XEDA 4ZDHA 1RJZB 4CDGC 5GS0L 4R97B 4HDIB 5J13C 1T6VN 3VFGH 4WI5A 1WBYA 1XF2A 5GRWA 5ICXB 2ATPB 3O4OC 3GSWB 5DD5L 4NKMB 5AG9A 3NCFB 3VXRD 5CEZD 3V6FB 5MHSD 5I75C 2VAJA 3MJ9L 3F58L 3QCUL 5CKAA 4IRJA 3HCVA 4O2EB 1HXMA 1NGPL 4TRPH 1A9BA 4AEEA 3LKSB 1IGJA 1ZV5A 5FO7B 3C5SB 4X5XB 4D8PB 1EH9A 5HDQH 2A77L 3HE6B 2XA3A 2JCCF 2NR6D 5TDPA 1T3FB 3P4MB 5F1SA 5JDSB 1OT1A 4WFFD 1H0DA 4Y5XA 1KGCD 3TBYA 1N3NA 2AJXL 3MLSH 2BSTA 4HPOL 4NWTL 1TVBA 2QBWA 3EJYD 3OF6A 5C0CA 1D5ZA 1D6EA 1KENL 1DVFD 3UAJD 3QUML 1NAMA 5D6DC 2G2RB 4F15B 4R4FL 4OF5A 3S3JA 1KCRH 4YC2B 1YC8A 4WFHD 5H35B 1F4WH 1NCDH 2VN4A 3QCVL 5C0BB 3UPAA 1PBYA 1QKZH 5H37H 5CAYB 1QLRB 1CDHA 2WP3T 3VFOB 1CFSA 5J1AB 3P77A 4OFPA 5F6IC 3R4DA 4M62H 5DYOB 5FAAA 4P57A 3VD3A 4YHZL 1OB1B 5IEHA 3S3SA 5A3IC 2AEPH 3GSUB 1FE8L 2YMXL 3BPLC 1T5XA 4HAGA 2O93L 1PX4A 3SGDI 3OR7A 4NUGH 1S7QB 1DR9A 1JNLH 5FDWB 2UWEB 5CD3B 1BGXL 1YEDB 3IGAB 3WKML 3F6IA 4JG1H 4WV1C 5HYQB 3PGDB 5T5FL 3CXDH 2V9TA 1C12B 2P8LA 2ZUSA 1KOAA 2WQ8A 2LU7A 3LRGA 3TBTB 4EN3B 4R3SA 2FLRT 1TTGA 4JN2A 2OK0H 4MQTB 4RAVB 3LKOB 4PIRF 4KRMB 4JZNB 4HQQL 4P3DB 4ZFOB 2Q3AA 3D0LB 5I74B 1WZ1H 1GZQA 1EFQA 3ULUH 3LRSB 3RWFB 5JPNB 4IIQC 1UH2A 1UA6H 4XPAH 3GJEB 3DGGB 1YECL 3FQRA 1BECA 3IDXH 4D0DA 1RAMA 3N0PB 4KHXH 4OLZL 3C6SA 4U7KA 3TBWB 2XQYG 4GSDH 4JFDB 4ODSH 5HGAB 3K74B 3G5YA 1QFPA 2CRIA 2D7PA 4FG6C 3UTTE 4NNXA 3RBGA 4PJEF 3QAZC 2CPCA 4TUJB 2F74B 2APWA 1TJGH 2R23B 1VFOA 3VXSA 3RWJA 3CDGA 4NHCH 2YXFA 4OM1H 4KDWA 4YZFE 5E2UL 2DQTH 5GRUL 4P48A 2OSLA 2CKBB 2I07A 1M71A 4OFYD 4YFLI 5DMKB 4CGTA 1PLGH 4HXBL 2CKNA 3B9AA 3B9VA 3G6JB 2KPNA 3D3VA 3TIEA 3T77B 1A7PH 5A2KH 5BV7H 1TZGL 4K3GA 2B1AL 5AZ2H 4FQ2H 2H9GA 5JMRA 2HKHL 3HE7C 4HCRA 4UIKL 4R90L 5TDOB 3PV6B 2DICA 3S35H 1KXTB 1FCCA 1X5XA 4EI6B 4QTHB 4JFFE 4NJ9H 4CW1A 1JJUA 3MV9B 5IFJA 5E8DL 3P73A 4I18C 2WZPD 5FHBH 4HFWB 3AMLA 4OJFL 4HK0A 3CH1B 4OCRH 3OB0K 5IVOA 4X4ZA 3TCXA 4YO0A 3SKNB 5J11B 3MLVH 5EUKA 3G6AA 3IDJA 3TN0A 1YNTB 2F5AL 1LO0L 4YHMH 1JK8A 1KT2B 4KJWD 3C5ZB 2ZCHH 1S78C 4XCFL 3V5KA 5IT2H 1B0WA 1U91B 3BZEB 2RBLA 3FQNA 4WJ5B 1J8KA 2XG4A 1SJEB 4M6NH 1DN0A 4HKJA 3QIWB 5F9OL 3LN9A 4ZQKA 2MQ3A 4I3GA 5CP7B 2FGWL 4I0PA 4XCCL 2LFGA 2FD6H 4JKPL 4HF5L 4ZAKD 4ZPTA 1U8MB 3I9GH 4MD4A 3ORJA 5F7EL 4GT7A 3U4BL 5IVNA 3MJ9A 4EVNB 1CD0A 5EO1A 5I1HH 4FHBD 3QQNA 4F7CA 1KN2L 3B83A 5ACZB 4JRYB 4ZUVB 5FYJD 1NKRA 1A7NH 1HHKA 1RK0A 1I1AC 4GXUM 4AIOA 5TE7H 4H8WH 3MLXL 1QPXA 3L6FB 1W8NA 4N9GB 4L3EB 2XZZA 4GBXB 3QUMA 3IDUA 1EO8H 1PG7L 1NANI 3CFBB 4YXHL 3NTCH 4G80A 5I2IA 4WW1B 2AP2A 5J6GB 1KJMA 2IAMB 4RGMB 2A9NL 3MOBL 1A3RH 1RUPL 1SJVA 1WTLA 3MOAH 3KDMB 1TZHA 1OAYL 5T3ZL 1DTUA 5BCAA 4JFDD 5E8NA 1E4XL 4NYLA 5I1EH 1IKNC 4KJPD 1XCTB 2X4UB 4TTDD 5CJOH 2J6EL 4OZ4A 1KB5B 1F4YH 4OLXL 4K3JL 1T7ZA 1UFUA 3HG1B 2AQ3A 4FFYH 1G7MB 5IVXE 1LDSA 5I16B 3O45B 1XF5A 1R24B 2AJ3B 4ISVB 3AY4C 1DEEB 4MVBD 1F58L 4KVNL 2DQJL 4L9LA 4WI3A 4XVTL 1MCFA 1DLFH 5ILTH 4NT6B 2G9HA 1CIDA 3QFDB 1FJ1B 4N0YH 2O5XH 1AXIB 2IANB 1EHLH 3MCKA 3I3DA 4NQDA 5KANI 1KYOK 1RJYB 3TO4B 3MACH 4AM0A 1IE5A 2NW2A 1N8ZA 3JBG7 5AYQA 3RNQA 2FWOB 5E94A 4OLUH 3FT3A 2WUCL 3VXNA 5IW3A 5IJKA 1ZGLP 5EC2B 1CT8A 2GUOB 4S2SB 5KS9A 4F9LA 2ADIB 4R7DA 3WNKA 4GMSL 4F2MA 1YYML 1K6QH 1UKSA 3HC4L 3MLUH 3MV9D 4KRPC 4PJ9B 3AM8A 4JFQB 3L3JA 1DFBL 5CINL 1UACL 3UTZB 1HI6A 4M48L 3W39A 4YDLC 4RCAA 3KAAA 4MD0A 1Y6MR 3ZKXC 4U0RC 5FCUH 5ID1B 1FNAA 4PRPB 1NMCC 4P5TC 5ANME 5ESAB 4X0KB 5L8JB 3ARDC 3SN6N 5E6IA 1IFHL 5FKPA 5SV4A 1QFWL 5I8EA 3CX5J 3C5ZD 4DKAA 1OWWA 1B0RA 1JWSA 4NKOB 2F53E 4YPGA 2OTWA 2VQ1B 1EAJA 2RIKA 5BZDA 5I1AA 3QUKB 3QIWD 3MA7A 3A6OA 4QRQB 4X9BA 2AV7B 2DLHA 2EYSA 4ODHL 3E1F1 3U36B 5C0JA 4FMKA 5EOTB 5IOPB 1GAFL 5IBTH 4GAGH 4WFGD 3O3AA 1YZZA 5K9QG 3HI1A 1G6VK 2R2BB 4MS8D 2AJSL 2BOCA 1O5DT 1KN4H 1S7WA 3L3OB 2IH1B 4JRYD 2Q7NA 3B6SB 4P2RA 4PRIA 1IRAY 3LSOA 3S88L 3N1GC 1WEJH 3MZGB 4OAWA 4Q9RL 1JPSL 4PJIA 3QULA 3KPMB 2CIKB 1MJ7L 3N1PC 4OZHA 5CBAB 4L3ED 3FO0H 3VXQA 4GBXD 3BPCA 1FBIL 1BEYH 5DD6A 3F8UB 1M7DB 3ARFA 2IAMD 1I3UA 1V7NH 4Z6AT 1BJ1H 3C6LA 5F3HB 4G8EA 1AIFA 2EH7H 2VDMH 1PSKH 5IHLB 5IJVB 3OHXA 4CN4A 4XCYB 1NBVH 1N7ML 4YHYC 1H3PL 3TZVB 3RTQA 5KTEH 4PTTB 5L7XL 3TJEH 1J9CT 3HG1D 3VW3H 4GH7B 2XWTB 4BSJA 4M03A 2P24A 4JY6A 2E9IA 2GK2A 3D2UA 4LSPH 2QV2A 2MCG1 4HG4J 2DLIA 5KSBB 3CH8A 1M7XA 4M93B 2H6PA 1H9VA 4YXKL 5DGQA 5CEZH 3RZCA 1KULA 3S5LG 1W0WA 1RULH 2NR6C 4HWBL 4K9EH 3WCYA 3HFML 4JFXB 2XRAH 1XIWB 3TCLA 2IAND 3T0EE 3QEUB 1KYOJ 2FZ3A 3MRMA 1JPGB 3FQWA 3EO0B 3OXRA 3ME0A 3FMGH 3EJYC 3FFCA 3UAJC 2R4SL 1U3JA 3ZTNL 3D1MC 1D9KB 1B2WH 2GEEA 4JCLA 2A6IA 4WWID 1EZVX 4HWZB 3GMLA 3QDJA 4TUKH 1HYSD 4ZS6C 4FFZL 1DL7H 3CD4A 3RBSA 3O8XA 2NX5A 1F4XL 1T0MB 2DIAA 2JIXB 1YEIL 1DSFH 5JMOC 3WDIA 1DCLA 4PJ9D 2OX5A 1ZA3B 4LHUB 2VZOA 5HHOB 4FQJH 1I9EA 2DKSA 2Q7YB 4JLRA 2VZUA 4BQ6A 1U92B 2J6EA 2E7LA 4MQ7B 4OIIL 3F12A 3FOLA 1MH5B 5DJCA 4JPWH 1JGVH 3MODL 4FQCH 5DA0B 4X7FC 4CVZB 5DMIL 1FZOB 1FVDA 1I1FB 2OR9H 4XNXL 1H15B 5C0CE 2A74B 2I60H 4K3DH 4M8QA 1S5IH 2GAZB 4KDTA 5D7JB 2HG5B 3NGBC 1MJJA 3FB5A 4FQLH 1JYWA 1U58A 3DSFH 1LWRA 3BPOB 4HBQA 3Q1SL 1YN6A 3T65B 4O02L 1I9IL 5HPMB 1HSAB 4Y5YA 4R6UA 4WFEE 4TPRH 5I1KL 4TSBL 1UQSA 5E8PB 5D6CA 4PJXF 1LK2B 1TQCC 4MJ6B 2VLKB 2DQFB 1UCBH 4LMQE 1BZ9B 1ZSDB 1Q94B 3PIQB 4R0LA 3I50H 5DHYB 5C3LD 2O61B 2DQEL 2NY7L 1M7IA 1DZBA 3D18A 4Z5RB 1J8HB 1YEJL 1AXTH 2I5YL 1JPFA 4CBPA 1NC4A 1GHFH 1BFOB 2YD8A 3DX7B 3RL2B 1S7SA 1A4KA 4OFKA 5EDXA 3VXTB 3UTQB 1MCOL 2P5WE 3DETC 5ICYA 3LEYH 2LAAA 4AG4H 4MQXD 4X9FA 2G5BA 4N0UB 1H3TA 1QQDB 2YZ8A 1KXVC 3IJSB 4R97C 2ICCA 4OCXL 1KTLA 1PZUB 1E4WH 2Q86A 3IDYC 1U8NB 1ZS8B 3TZVD 4Q6IA 1AKJB 5C6TH 3HPLB 1BQHG 1K8DA 3P9MA 3VWJA 3ARUA 3PWLB 4JR9H 5C09E 4XC1L 3JWOH 4F7PA 5B39A 9CGTA 1KIUA 4U33A 4PJ5B 5D7KD 3RUGF 1KTDB 1I7TA 3TO2B 3DI3B 2VLRA 4BFEA 5JUEH 2OL3A 1EAPA 1RZIB 2BNRB 3HUJA 3KLDA 5DJ2B 1B0GB 1XIWD 3DV4A 2Z4QA 2ARWA 5KAQG 2VR9A 3NFNA 1YNKH 1X5IA 1ZGLA 1DQMH 2B39A 2VJXA 4DEPB 5DHVB 1UADC 3VXSE 1F6FB 2VXSL 5FYKD 5ID0A 1ZLUH 1PY9A 1L7IH 4P4KA 4OGAD 1FGVH 5TFSH 3SQBA 3BJLA 1D9KD 4F15C 2DLFH 4QY8A 2MWCA 1P4BH 2V2TB 5TQ0H 1SBSH 4YC2C 4LEXL 4YUEH 3T2QA 2ZSWB 1UJ3C 4OB5L 2JIXD 4RSVA 1QSZA 1HHHB 3CPLA 5INCB 3CVHL 4PRAB 1N5YL 4JFZH 4N0FA 1FNGB 3PABB 3D3VE 4LHUD 1PKQB 3LKPB 2J1KA 3VXUA 5HHOD 4XAWL 4UT9H 1N6QH 4Q9QL 4ZFZB 1HKLH 3NVQA 3HHRB 2B20A 4BSVB 5B3JE 2PXYB 4XVUD 4FP8H 4NOFA 1FH5L 2J8OA 3CSGA 3L5HA 4ZAKC 2KL6A 3UEZA 1U8IB 4DTGH 2ZNWA 3HC0A 1QR4A 1QFUL 1IGCH 3I6KB 1Z5LB 1G9NL 5B21A 5GQBA 1WCQA 4D2NA 2VXQL 2WUBL 1TZIB 2VH5L 4KV5F 3CMOL 4H25B 3NFSL 4PBXA 5AWNH 2MCPH 5D7JD 3RJDA 3U0TA 4HWBA 5C2BH 3SHSA 3GSVB 4LP5A 5E6YA 4IRJB 3FONA 1KIPB 4HIIA 5E8EB 4RX4D 4HC1H 3QWOB 3R0MA 2HWZL 3RZWA 5JW5A 3KXFA 2MPAL 2ZPKH 3DURB 4I4WA 2ADGA 2C7UA 4F58L 5SX5K 5EG6C 3TBYB 2VLKD 2Z8WC 1N3NB 4GRLC 2CLRB 1IJ9A 1I8LC 4OZIB 1KIQA 1N5AB 1X5HA 4K94C 4JFOB 4XVJH 2VIRB 2LTQB 3RJQB 4F80A 4JJ5A 5SWZA 1J8HD 4FTVA 2F5BH 2HN7B 3SDCA 2JJSC 4PG9B 5CSZA 3VD7A 4WTWA 3GIZL 1T5WB 2WW8A 4Y4FC 5EC1A 2VSDA 1GRWA 2APVA 3MGAA 2GT9B 5BVPL 4H1LG 2R1XA 3FAWA 4MVBC 5GGRA 2GJ6A 4KKCD 1VESA 3PP3K 5I30L 1NBZB 1GC1C 4PGEA 4ZODA 2X89A 4PB9H 1W0YT 43C9A 2YA0A 3V0WH 5CWSA 1PKOA 3PHOA 3WFDH 1NFDA 4PGBA 1RV6X 1AKJD 1K5NB 2X1PA 2Q8BH 3RX7A 1EHXA 5D8JH 2E27L 4RNRA 3LH2L 5DJYA 3BHBB 4PJ5D 3L5IA 1FV1B 2WBWB 2CKBH 4JHZA 4Z7VF 4QT5B 5CCKH 5E9DA 1BIHA 2DM7A 2IPUG 4G7VL 4NM8L 5DJ0B 3SDDC 3MGOA 3MRQB 5HD8D 2RCSH 1CXKA 1DBAH 1R5WA 1XGPA 1G1CA 2BNRD 4H26B 3MRIA 1MRCL 3EOYG 1T2JA 2BXYA 3ULSB 1IC1A 3IF1A 4QEGA 1JHKH 1I3GL 3RU8L 1T1ZA 2YD5A 3PJSA 3IRZA 5BW7C 1NCNA 5ADPL 3VFVB 5ABDE 4NN6B 5SWQA 3PHQA 3O6FA 4DVRH 3MTRA 5GS2D 1HH6A 4Z76A 3C6SB 3U9PL 1AHWB 1W0VB 1D6VL 1NSNH 2DQIL 3TV3H 1MIEL 4L29A 4GAYA 2AKRB 3GMOB 2XKUA 4NQDE 5GGSB 2X4QA 5KSAA 2LU4A 4G8IB 2JELH 1SQ2N 1DE4A 1FO0B 1UZ6F 2ICEB 4YBLB 3QIWC 1KCSH 4HJJH 4R2GB 3HA0A 1T6WA 3EOBB 2PXYD 4CVWA 4ELMA 4P9ML 4NHUB 4YHPB 2I9LA 4NO2A 4JGMA 5E2WH 5KS9E 3QJHB 4A6YB 3C08L 4U6HA 4LL9A 5TDNA 1A7RL 5CJQL 5J1TC 1QG3A 4TOYH 4PJFF 4PJ8A 1JPTL 1MCPH 4UIMB 1P84J 4LSVH 4OI9A 1T83C 3QDMB 1S3KH 4KK6C 4IRJD 3QIBC 3ZTJH 5HVHB 3QXVA 1DBJH 1NCWH 1OGTB 3D85A 2GCYA 3DXAB 3QXDB 2ZUYA 5JQ6H 2DM3A 4J1UA 2P8MB 1UC6A 1G9ML 2DL9A 3GSNB 1YJDL 25C8L 4K07A 4K7FB 5ELIA 5EO0A 3DMMC 3V95A 2IAMC 3OJDB 2BY1A 4JQIL 5HI5C 5E95B 3V6ZB 2R0KH 3NCBB 3OF6D 5I73C 2Q76A 3CVHA 3H8NA 1WCBA 4EI5C 3DX9A 4DKFH 2IF7A 4MJ4A 3B2VH 4W6YB 1CYGA 3GBNL 1LNUA 4NRYB 5C0BE 3DX6A 2ED8A 1V05A 4XPFH 5IM7A 1S9WB 1HNGA 2YD3A 4ESKA 1MQ8A 2OL3H 2VRAA 2ZJSL 4Z7WB 3OB8A 5DZLA 4U1MB 5K59E 1H5BB 4K8RD 1DBKH 2V9RA 3UTPD 1YEGH 4YHOH 1YN7A 4NQUA 5IKCA 1H3VA 2DLEA 5J3HC 4P2RE 4PRIE 1KB5H 2FX9L 3QXAB 2X1QA 3WLWD 3S37X 1ZT4A 2FJGB 1B4JL 4JDTL 1F8TL 5HHQA 5M94B 4PJIE 5D5MB 5I8CB 4LPTA 4MNGA 4OZHE 1KCLA 1EDQA 4ZNCD 3SE9H 4CL7A 4UINL 4GKSA 1T04A 4F7EA 4NC1C 3O6LH 5D2NB 5FDYA 3NIFF 4PREB 4PJHB 1IQWL 1PAMA 1XR8A 2W60B 3TH2T 1QHOA 4R9HA 1ZVSB 5EOCL 3E6HA 4P9HL 4PJXA 2GITB 1ES0A 3T8XA 5HDOA 2BSED 2NYYC 3CXHK 1P5VA 3VG9C 4LCIL 1MI5B 4K23L 4KAQL 1A3LH 4WTZA 4PY7B 4R7NA 1OF2A 3CU1A 4PJCF 1T03H 2VLME 4HS3A 5GSVA 4PLOB 4ORGB 4OLWH 1KUMA 1BAFL 5HVFB 3KYMA 2GYSA 3WL9A 3EHBD 2DL2A 2BVTA 4U1JA 2GSIB 5IHUH 3HS0B 3L5WB 3MO1A 4MZ3A 32C2A 3LQAL 4L4JA 1P2CB 4PP2A 3TNNA 2YUWA 5I15L 1NCTA 4KMTH 4EDXB 4YHIB 3BQUB 3HMXH 4HJGB 3W9DA 4MCZB 5IHZA 1MHEA 5I76A 1P7KA 2G60H 3UBXI 4YGVA 3C5JA 4XBEH 3FFCE 1AGBA 2DMBA 3I6GB 4H0GA 4DKDC 4FQXA 4KK5D 2GW5A 3BYTA 1EO7A 1XF5B 3ARQA 4TSAL 3RI5F 4R2GD 3REWA 3QDJE 1Y6KR 1IAKA 3MREB 4HK3J 3GI9H 3UO1L 3HZMB 2AJVH 5FGRA 3DLQR 2FEDC 2A1WL 2J5LB 2BVUA 4LPUA 4BUHA 3D69B 3QCTL 3VGFA 4C58B 4CRPA 5EU4A 4Z8FL 3QUZA 4P5KB 4ERSL 3O9WB 1WWCA 2ITDB 3QDMD 5AZEH 1E28A 4NKDA 4PR5B 2YZ1A 1RPQA 2V5YA 1ND0B 4AM0B 1CL7H 1FL3A 3WUZA 3WN5A 4L3CA 1RFDH 3DXAD 2Q1EA 3VXNB 5E08L 1UWXH 3GMQA 2VB5A 4IMLA 4U1HB 4G5ZL 5FEBA 4HV8B 2OTUA 1X4XA 1QLFA 2YPVL 2C3VB 3EYUL 5C8JA 5E24E 5C0AE 1BWMA 3L5XH 4MQXC 4QHLA 2LAGB 3RWEA 4ZOEA 1A21A 5DUPH 3HNSL 4GAFB 3KYNA 1N4XH 1E6JL 3E6FB 1R3KB 2UYLB 4HW6A 5FYLL 4U1NB 2HYMA 3E8UL 2X4SA 3PXJA 4Z7UB 1RMFH 4JPIB 1VDGA 4LDEB 5BVJA 4G8FA 4XP4H 2YUVA 3PL6B 1DP0A 3FO9A 3K2UH 3ZDYE 1ED3B 1N64H 4Y1AA 3I6LD 4XVSH 1MQKL 1OT2A 3KPNB 5I66B 4JO3L 3BRDA 4OCLC 5GS0D 2PW2A 3UJTH 1HILA 1FORH 4PS4H 5L88H 2DQUH 4I77L 1BBJB 4D9QD 3RWDB 3WHXB 3WNLA 4D0CA 2EYSB 1OP3H 4HJ0D 3AC0A 2Q8AH 1A6PA 4F33B 5GISH 4QXTA 2X9WA 3QI9B 3Q5OA 5MEOA 1NJ9A 3BH9B 5C07B 2HJFB 4M00A 2N7BA 3BWAA 5DJZA 4AIZA 3BW9A 4P46A 2X41A 4OGAC 3GSOB 5DFTA 2FYYA 2QJDA 4PJAF 2JCCB 1S7WB 4K3EH 3CXHJ 5H2BA 2EDDA 4PJDA 3HB3C 1FC1A 2XA8H 4GQPH 1FFNB 4XMLL 1TTUA 4OAWB 2OBGA 3SJVA 1MI5D 4NP4L 3W11D 4MA3A 4LRIC 4YFLF 5L0QB 2P5EB 3MBEC 3MLYH 3AU1A 3FB6A 3VXQB 1P1ZA 5SV3A 4F9PA 1BZ7A 5DD6B 4OF3A 5EPMB 5GS1B 4G8GA 4LDOB 2VLRE 3N06B 2DQHH 4QNPF 1LO3H 2CMRH 4GRMB 4O51A 3L3KB 1BQLL 4PGCA 2VL5B 1K4DA 3OX8A 1JBJA 4U6XA 3VFNA 3FRUB 3N50A 4I3SL 3HUJE 2MOVA 4MXVE 2HVJB 5L2KA 5IQ7L 3BQUD 3FB7B 4JRXA 5CGYC 5DRZB 3RY6C 1A6ZA 4HHAA 2DBLH 3BPNC 2W9DL 4XP5H 2DD8H 5I6XB 1U8QB 4NPYB 4LAQL 1AE6H 1P7QA 2YN5A 3BUYB 5IMOA 3TPKA 3V4PH 1NEZA 5C0EA 4TTGA 1BVZA 2XICA 3UYRL 4J3TA 2XWBB 3HZKA 3Q0HA 4PGJA 2PYEB 5ESVB 1HHGA 1KCUL 5T1KA 3D9AH 4OM0L 4LASH 4Z7VA 3VJ6B 3NABL 4YDIL 2RAMA 4KRNA 3BVNB 1MCKA 5E1AA 5KSVA 3KR3L 3FTGA 3NA9H 4JFPB 2CGRH 4ODWA 2BVQB 4ZSOA 1AC6A 3FQWB 2R8SL 3VXUE 3FOMB 1IM3A 4YK4C 3O11A 3EOTL 1I3RA 4YDKL 5T33L 3CMGA 4OZFA 3NACL 4UV7L 3IFNL 3T2OA 3WNOA 4IBLT 5D72L 3WJJA 2VDQL 1MWAB 1FAKT 4GW4A 4HGWB 1D7FA 5I1JH 2NX5B 4DCQA 4BH8B 1JGUH 2BDNH 4X98A 2BNUA 5CGMA 4P3CH 2XXMB 3EFFA 5J1SC 3JTSB 2X9YA 4YHKL 1AGCB 1DDHB 3NIDF 4LARL 4WU5A 1VERA 1IT9H 2ZOLA 4HBCL 3HMWL 2D7TL 2ATKA 3MYZA 2HTLC 1H3XA 4GMTH 35C8H 3OZ9H 5DJXB 4PJEB 1AO7B 2A6DA 1I1YA 1NLBL 5T1LB 1QSEA 1A6TA 3WV0A 5LQBH 4L4VA 3O2DL 5JPMA 3P30H 4MJ2A 3VMNA 5FUOL 2YPLB 5EBMA 2QQLH 4LLQA 3W5NA 3AS1A 4LSTL 1PQZB 5I71C 2N1KA 3GO1L 5T3XL 3UPRA 3GMPA 3I3BA 5E56A 1G7QA 1FVDB 3MLTB 4U1GB 3THML 4M8QB 1HXYA 3EO1A 1OM3L 4LKXB 4MA7H 1U6AH 1FYTA 4PJFA 3MRRA 1GGYA 5DD0L 2PETA 2ZSVB 4HUUA 5SWZE 1U41A 1Z9MA 1QRNA 2BVOA 4FTVE 4M7LH 5ESQB 3PQYE 4TUOA 5BOPA 4UT7L 4RZCB 4EJ1C 3IU4H 3QI9D 5DD1H 3PDOB 1S8DB 4HUNB 5C07D 4DEPC 2X7LA 1CLCA 4P2CG 1S5HB 1R3HB 1UQSB 1IEAA 2PO6A 2C9AA 5JQHC 2APBA 4TSCH 1ORQA 4JREB 2GJ6E 1AFVH 5ITFB 1NGYB 3DVNA 4UTAH 3C09C 1WICA 1CDCA 5DHVH 2FBOJ 1NFDE 2HMID 3DECA 1OSPL 4APQC 2WLYA 2ZUXA 1OTTD 3IAPA 5I1CL 2P5ED 3B2UD 3TESA 5GRZA 3U7WL 1A47A 1JPFB 3P11L 3MRPB 3TIDB 4Z7NF 5IESL 3LOWA 5L8LB 2VLLA 5EU6B 1RVFH 5IB2A 1IEBB 3BN3B 5E9DE 4W70A 4KUCF 4JM4H 4B7LA 4QYOB 2ARJB 1W72B 2PXYC 4LCWB 5HJ3A 1LEKB 2QSCH 1MHHB 4LCCA 5MEPA 5F89A 4I9WD 4W6WB 5F1IA 3QIUA 1SJHB 2IGFL 2R0ZH 4YHNA 4G6JL 1UM4L 3WHE0 3OKEA 3JV6A 2ZCKL 5CP3H 4PRNB 3U0PA 1KLGA 4PV8B 3ESVF 5KSBE 1URLA 4IRJC 2PYED 2V7NA 4OD3H 2NY5C 1NMBL 1WC7A 2HA1A 3ISWA 3TPUB 2QQNH 5GGSY 2QQKL 1QHPA 3VGAB 4KTEL 2CRYA 1NCBH 2CDGA 3QR2A 3AS2A 3DV4B 3IXTB 4MJ5A 5IW1B 4Y5XC 2B1HH 4LSRL 3MRBA 1VFUA 5FV2A 1E6OH 4Z7OF 1UEMA 3QNXA 4HS6B 2BY0A 2OMNA 1GGCH 4NRXB 4QY8B 3BEVA 4YDJB 4N8VA 1PG7W 1YEFH 3U9UA 4JZJB 3ARPA 5TQ2L 4F3FB 2HFEA 4GG8A 1I8MA 2NX5D 1Y6NR 4DUXA 2VABA 2JJWA 3OJMB 5EOQL 3OB0H 3IT8D 2XPGB 4G42A 1K2DB 4I48A 4F37F 5T3ZD 3WLWC 4JFHE 3MA9H 4A2LA 4YDVB 5IMKA 1T89C 3DNKA 5A1AA 3UDWA 1JCKA 5GRVK 1AO7D 2JB6B 3TEUA 4HKXA 1RSFA 4K8RH 4LMQI 2AXJA 5T1LD 4DQOL 2ENYA 1HSBB 2VDLL 5FXCH 5EORL 4RGNB 1CGYA 1J18A 2YPLD 3RIFF 3L3DA 4PJGA 4QCIB 5GGVL 3WS6A 1Q1JH 5JOFA 2FB4H 2LVEA 3ALWA 2EICA 3BRFA 1F00I 1X7QA 3I02A 3WO4B 4HT1L 5M7QA 2H3NB 4EOWH 3BKJL 4G9FB 1FZMA 4NZTL 1X5LA 2F15A 4JVWA 4M7LT 3GBML 4YXLH 1M05B 3T0XA 3NBNA 3F5WA 1CZ8H 4I5BA 1ZMYA 4NGHH 4H5SB 1A5FH 3VRIB 3BRGC 3HLAB 3PWPB 5E5MA 1UVQB 3W5MA 1HHIA 2ESVA 3BGAA 3PWVA 5HHXH 2UZIL 1V3LA 2PN5A 3KXFB 2VUOA 1KPVB 1MEXH 3QEGL 3EHBC 4LVEA 5FUZL 1WT5A 2HT4D 4N5ED 3BAEL 1KLUB 1LDPL 4NN6C 2OXGA 4U2ZA 2YN3A 4U4BA 1KPRB 1ZA6A 5I8OH 3RGVB 1OCWL 3IFPA 3EYSL 3UTSA 3U4AA 2JE8A 1FC2D 5E4IA 3QP3A 5EBWA 1KEML 2CO6B 2DI7A 5IB3B 1OLZA 2NTSP 3SGEH 4Z18A 3G5ZA 5CSZB 5EU6D 5DRNB 4O2FB 4KK5C 2XQYK 4RMWA 2P1YA 3IFOA 4YBLC 4LLYB 1SMOA 4XX1G 1TETL 4YNYB 4R2GC 1XGTB 3O2DA 5BXFA 1KFAL 5TE6L 4UZGA 3IETA 3DVIA 1YPZF 4QOKB 4DGYH 1UCTA 3MX0A 3JVGA 1CFTB 1Q8MA 3GSXB 3NPSB 3QQ4B 4LPWA 3U7AA 4F7TA 2CD0A 2CR6A 5D7LA 3RHWF 3UYOD 3BD3A 1VPOL 5EZJB 2P7TB 4LPYA 4JFYA 5KW9H 4ZTPL 1WQVT 2BOBA 4LP4A 2CJUH 5DJYB 4A6YH 2YRZA 3UXFA 4MXWH 4D3CH 5HVHC 3KYOB 1A14L 3SE4C 3ZE0E 3RL1A 1MCHA 3PGFL 3F62A 1NBQA 5EOCJ 4JG0H 1RZKH 3ULVF 1TCMA 3O6MH 1Z9LA 1OW0A 1CICB 2HVKB 4NQEA 1N0XH 4ODVH 2OR7A 1U3ZA 3VH8B 3ZLQC 1FL6A 5C2UB 3UJIH 2J3SA 3JWNC 5I8KH 4CU6A 4NQCB 2EDLA 1UM5H 3NIGE 4PB0L 3GSNH 3BJ91 1SEBA 4S1SL 1XGQB 3KWWB 3QXUA 2ADFH 3TVMB 2XV6B 5HVWA 5I17A 3BGMB 2CDFA 1NMAL 1RJLA 3TN0C 2J88L 2X70B 5DC9B 4UILL 1HINH 3UMTA 1KBGL 5EIIA 2OCFD 2VDNH 4WHDA 1IGML 4ZYKB 2VDKH 2IMMA 1VKXA 5T1DH 3GIVA 3KPQB 4CADB 2YD2A 5C0DB 1EVUA 3MGTB 3L1OH 3OR6A 3EGSA 3H3KA 3RI5K 3IVKA 2FBJH 4I0PC 2QADB 1WVZA 4FABL 4L8BA 1QBML 4RGND 3TNMA 5FK9B 5GS0H 1EEZA 2Z91A 5E4EB 1J10A 3P4OB 4U6HB 5INDA 1DBBL 1IEHA 2NW3A 1JF1A 1TNMA 4Q9BA 5EU7E 1J1PH 1BFVL 3H7BB 4G9FD 5EBGA 3WSQH 4X83A 3FN0H 2APTA 1WIOA 4JO4L 2XQBL 3MRHA 2I9TB 4NQXB 5E8OA 5GZOD 1J1XH 1NGWA 1RURH 4P5MB 2DKUA 3PWPD 4M1CD 4EIGB 4MJIB 2D31B 3DVFA 1B90A 1BM3L 2VXVL 3TYGH 2EKSA 3KXFD 5MP6L 1CD1A 3MRKA 5KOMC 3P0YL 1UYWL 4Y1AE 5T1MA 2NZ9D 2AJXH 2V7HB 1NH6A 1MNUH 1XCQB 3QHFH 4KVCH 1S7VA 2D3VA 4U6VL 1W2KT 1K9TA 4WWKB 4QHUA 2DLTA 1NFIB 3BQUC 5CZVH 1OWRM 1MHCB 3IXAA 3LHPL 4RFNC 1FVEB 5KJRH 4JAMB 3KHQA 4XP6H 3RVUD 4OZGF 1OARL 2D03L 2FJHB 1OAKH 3P4NA 4JQVA 5JORB 2Y7QA 2HRPH 3AB0C 2Z8VC 4YQXL 3C8DA 2DOCA 4JDZA 1BVLA 1FPTL 1YN7B 1UWGH 6FABH 4WUKH 1S7RA 5EZLA 2Z8SA 1IQDA 4L9LC 5DS8A 4QOKD 3MNWA 4XT1C 1ZT4B 3SJVE 3U79A 5B38A 1AD9B 4HIHA 1T20A 1XZ0B 2J5LC 5ICZB 4IOIA 2HT3D 3OKMA 5E5RB 5F9JB 4GKSB 5IEKA 1VFBA 1ZWIA 3BKCH 2BMKA 4KKLC 3ECBB 1R5IA 2PTUA 3ULVL 1S9KC 2ZWLT 4ZOBA 1OD9A 2EDTA 1HOCB 4NFDA 4OD2B 4PJXB 2EIZB 5IJKC 5L2KE 1MCWM 3QG6A 4JRXE 1A6AA 2V2WB 2BSSB 1CICD 4ZFGL 1AGEA 1RIHH 3RAJL 4R7NB 4Q74A 2R1WA 4F7MB 2OI9C 3ZE2E 5DWUH 3AM8C 3EW3B 4NQCD 3GKZA 3MLZL 3V4UL 4KQ4L 5IV2B 3OKOA 2EDOA 1ZHKB 3U83A 2XZQL 3TVMD 4U1IA 3MOQA 5EZIH 1S9VA 4I2XA 5BRZA 1WFOA 5E6IC 1XH3B 2YC1B 3UX9B 3VFPA 1ZGLM 5LWYH 4ZSOE 1N6VA 2B7DT 1I7RB 3IAQA 3Q6GH 2DTML 1IKFH 1NCAH 1FGNL 4J3OC 3WD5L 1RU9H 3KPOA 5ISZB 5CSBA 5DC0A 1KJVA 3CFCH 3REWB 2VSCA 4M5YH 1A1OA 3RUGB 3HPJA 3QI9C 2V2XA 4RMTA 1BIIA 4AL8L 2IPKA 4XRCA 3SGJA 2HTKC 1VB9A 3BT2H 4YEEA 2DAVA 1CFNB 3BP6B 5DUBB 4JDVA 4HXBH 5KVDL 3VXOA 2NY6B 3BXNA 1EK3A 3MRNA 4PRBA 4GKNA 1QSEE 3S37L 3EYQD 1U3HB 2C3HA 2X4RA 5CHNA 3L95A 5IB1A 2R2HA 4MJID 1OPGH 2IH3A 1F11A 5L0QC 1OTTC 3ZDXF 1NGQL 4K7PY 3HI6H 5EU3B 4UQ2A 5IGXL 2WBJA 3OKDB 4Y2DA 3B43A 1JFQL 2L0DA 3ARFC 2IQ9H 3MQIA 5IBUB 3C6LC 1JNHA 3L3IA 4NSKA 1FYTE 4AENB 4WWKD 1ZHBA 2FJFB 3KLSA 4I0CC 2MHAA 4MDJA 4WUUA 4B41A 2GSGB