4XNQB

Antibody hemagglutinin complexes
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
217
Chain Sequence
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords H5.3 Light chain
total genus 45
structure length 217
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnqB01
5C6WH 5J6HB 1WTLA 3SDXF 1QBLL 4UT9H 1DEEB 1Z5LB 2JJWA 2DBJA 4LHUG 3TBTA 5C0JB 3DGGB 4MA8H 4KK8C 4J3TA 2A6JB 5GGQH 1MJUL 4M5ZL 1MFDH 3Q6FB 4QRUA 3UEZA 1AHWB 1IC5H 4LQFL 3C60B 3OR6B 4HKBA 5CJOH 2N7AA 5LAXB 1AXSA 4QHLA 3QCTH 1OSZA 5TGBA 4XPAH 1FCCA 4LK4A 1RHHB 4PRPA 3K4AA 5I8CA 1RUKL 1K4CA 1PBYA 4LAQL 2D7OA 3WIHH 4UQ3B 4O51A 4FQCH 4J4PC 4JFEE 2PETA 2HFGL 4X7CC 4Q6IA 4PJ9C 4MB4A 4GXUN 5KVEH 1C1EH 3BKMH 3FZUC 2DI9A 4JZJC 1HQ4B 3QDGE 5JPMA 5AWNH 3OL2A 4TVPL 1JWMB 4EN3B 5HYJB 1A7OL 1PAMA 3K46A 3ULUH 3L3IB 1QLEL 4OKVA 3BPLC 3HE6D 3ZKND 1ZV5A 2DQFB 4ZAKD 1LO0L 2ICWJ 1NFDE 2PW1B 2GAZA 5JZ7D 2G60L 5JXEC 1I7RB 2X4NB 3X11B 1X7QA 3BN9D 4APQD 3ZYZA 3OX8A 5I74B 4UTBH 5IJVA 4N8VB 2DQUH 4P5TA 2VLJD 4XMKL 5EU4B 5C0DA 5FYLL 4LOUD 4QKXB 4I9WD 4RDQF 1T7XA 5C08D 2IMMA 5KSBB 3HI5L 2FGZA 3U4AA 2DQTH 4KV5E 2Y25A 1RZJC 1HDMA 5DR5L 4D0BB 5C0BD 1CBVL 3T0EE 3O2DA 4JM2A 2EDJA 5HHXL 3C87A 1RUKH 4X6BA 4OT1L 4QHNA 3TNMB 2AEWA 1GPOL 4PP1C 5TFSL 3TLRA 2W1NA 3T4AA 4X80L 1DBML 2NY5L 1KSRA 5CUSL 2FO4A 3EOAB 1BVLA 1F02I 4GBXB 1GIGH 5CHNA 2ICWA 5DJYB 2E7LA 2FSEA 3T8XB 3BP4B 4JRXD 5CBEB 4LPCA 2VRAA 4Z7UF 4P49A 5HTSA 4U1SB 2P42B 4G3YL 3TN0C 3ZTJH 1QFWM 2BVOB 1U91A 4NZDA 1V7MH 1UQSA 2V9TA 2P5EA 3IFOB 1KV3A 1FH5L 4U1MB 1HHGB 4JJ5A 3VD3A 3GKWH 3I6GB 2I9TA 1QLFA 3EFDH 1DQML 3C2AL 3L95B 1FAKT 1QA9A 1MHPH 2ORBH 3DV6A 3RY5A 3N85H 1Q0XL 3NCCB 4MNGB 4IRJB 2R1YB 5AD0A 1X6LA 1TJHH 2WWMD 3MGOA 3GDBA 1HNGA 2E9JA 5KJRH 1T20A 2B2XL 4TNWK 1GSMA 4LLUB 5F97E 4BZ2L 1L6XA 4YXKH 3A6CL 1NFDB 3EUUA 5TPWH 2WK2A 5C0IB 2MCG1 1ED3B 3MLRH 5IHZB 4XVUC 3QRGH 1DBKH 1EDQA 4POYA 1JRHH 1JZ2A 3ZKNC 3T2NH 1JYWA 1BJ8A 2QHLA 3EIFA 3BKYH 1HI6B 3PV6B 4OZ4B 4NN7B 5DF0A 5C0AA 4OZGB 3MLVL 3V0WL 1DSFH 5HYSA 2OMNA 7FABL 5LGJB 2ZUQC 3F58L 4MA7L 1RUAL 1F13A 1WZ1H 5CJBA 2DQDL 1TZGH 4KI5E 2EIZB 3TFKC 2GITB 4H0HB 3S36X 1D5BB 1S7UA 4MYWB 5CP7A 5DXWA 5IQ7L 3QG6B 1BX2A 4I4WA 3VMPA 5FO8B 5LBSH 4AG4L 2AERT 4M48H 3AU1B 4PG2A 1RURH 2HKFL 2CIIB 2VL4A 3QUZA 4Q74A 4N5UA 4WO4B 5IMLA 4R2GD 1T4KA 1UWXH 4CNIB 3QQNA 1U3HC 3KWWB 1RK0A 2BJMH 3VFRA 3TCLB 3ARGA 1PX3A 2XG4A 3MUGB 4PJXB 5L7XH 4P59H 4WI4A 4XC3H 5MENB 4AT6A 5BS0E 2F54B 4X6BB 3TNMA 4H1LH 4RGMB 1CDBA 1A3LH 2X05A 2H2SD 2Y06H 1J86A 2IADA 4WO4C 4NRYA 1CYGA 5FGCB 1KEGH 1PG7W 3PGDA 4OIIH 2GY7B 1MFCH 2XYCA 2H1PH 1WJ3A 1Y6MR 5CP3A 2JJSA 2ATKB 3OAZK 3I50L 4HUXA 4L9LC 4EN3D 3SE4C 4LPTA 5TDOA 3L6FA 2HN7A 4Y5VA 2ITCA 1JK8B 2IH3A 1LNUB 4ZAKB 2VN7A 3D2UA 1A7QH 5CSGA 3HZMB 2AXGA 1XR8B 2Y7QB 4DOHB 3IJYA 3W82A 1FO0A 4V1DE 2ADGB 3RU8L 6CGTA 4XVTH 3N1QC 5E8EB 3OF6A 4DFIA 1E6OL 4HS6B 3CUPA 1J8HA 3KS0H 3V4UL 4NZUL 3ZYJA 5FKPA 3ZL4H 3TC9A 2R2CA 4X6DB 3EYUH 4XWGH 5E8NB 4PLKD 4CKVX 2BHUA 5F44A 2PO6D 2VXSL 5K9QI 3V0AC 3T3MF 5DD5H 1FLRL 1FJ1A 2UZIH 4KJYA 2Q6WB 5GS1C 2AK1H 4QF1A 3A6BH 1FFPA 4M7LT 5IW6A 4LSUH 5DHYB 4N8CH 4MZ2A 4IHOB 4LSRH 1YECL 4Z7OF 2BSTA 1H3TA 3SDAC 5L2KA 4EDWH 2DIAA 2FJHB 1KCVH 3B9KB 5DURD 5I8KL 4MNHB 5FAAA 4EQ3A 4PJEE 4F7TA 3RZWA 1Z5LA 4JCLA 4OV5A 4G9DA 4DN4H 3QCVH 4OZGF 5EOCJ 3FRUA 5FA4B 2C3XA 4DZBA 3OBAA 3RDTC 5LG1A 2BFVH 1S9XA 2X4UA 3G5YB 4LKCA 4Z95H 3ULUC 1U8JB 2V5YA 3QIWC 2EDFA 2YPLA 4N0FB 1AQDA 2O26U 2BOCB 1A7PH 2X10A 5ITFB 3U0PA 5HSFA 2YD5A 1LE9A 4ODBD 5E2VL 2YWYA 3RWFA 1E4KC 3LEXB 2DTSA 2E8ZA 2VLKD 4LHJB 3KJ6L 3NFPA 43C9A 1J0HA 2C1PA 1XH3A 4NP4L 3I9GL 4NM8H 2ARWA 3TNNA 1I1YB 1CXIA 2W65B 5DK0A 4LSDA 1OT2A 1N59B 3WE6B 4TSAH 3JTTB 2IANA 2HFEB 3VXRD 2ZG2A 3V8CA 3O0RH 4MNQB 1MJ8L 1S5HB 4MXWL 1IQDA 3UYRL 4L8DB 2XWJB 5DS8A 4JZJA 4L3EE 3ZYOA 4FFYL 1QFUH 2JB5H 3QPXL 4HS3A 3H9SA 5HPMA 1CLOH 1TNMA 3CX5K 2C3HA 4GRMB 3RPIB 4Y5XC 3BSZL 1JPGB 2HKHH 3KHQA 3KR3H 4U6YB 3L3KB 5ESQA 2ATPB 4JM2F 4HJGB 2JIXA 1CGSH 3DX9B 1DQTA 2ATKA 2X89A 5EORL 5B3JE 4TVPH 4WV1C 5TDOB 5B38A 4PJGA 3PL6C 5D7KD 4U31A 1NGQL 4P23B 4QYOA 1S7VB 2IH1B 4NC0B 1MUJB 2YPLD 3STZB 2HFGH 5GRUL 3U36B 3IXTB 3GNMH 1KJMA 4FQCL 1SYVA 5FCSH 1RVFL 3TZVB 4YHPB 4EQ2A 3HB3D 5D7IE 1JP5A 3F7YA 2BRQA 3T0VA 1S3KL 3QIUA 5TF0A 3CUPB 4OCWH 5DVKA 5T5FH 4FQXA 3PWPA 4OUUA 4P4KC 3LHPH 4M7ZB 4MJ6A 4KUZL 1T80A 1T1XB 4XCFH 5CZVL 2BCKA 5CEZE 5KJRL 3UTTB 5C86A 1S7XB 1JGUL 4XXDB 4NCDA 2BVQA 4KROD 2UZXB 1X5GA 3WNNA 4OI8A 1S7TB 3FT3B 3TBYB 3OTTA 1AR2A 4HWUA 5J3HD 2IWGA 1UM4H 1X5IA 3BPOB 5IW6B 3IAPA 1DQMH 5C0AD 1TFHA 4DGYL 4JKPL 1S9YB 3GKWL 1Y0LB 5EU3A 3DGCR 2DQJL 1YEIL 4WWKD 1AGBA 1RZ7L 1IQWH 2R29L 2PYEE 3SQBA 3BDXA 4KUCD 1INQB 3HR5B 4D9RE 4L3AA 5HHQB 4Z7VB 2FEEI 1ONQB 4GAGH 3DX8B 3BDYH 5KANI 1WZMA 1D6VL 4N8VG 2PXYB 5EOCH 4PRPD 1YEJL 1T1ZA 5D1QC 3IDIA 4GS7B 5HDQL 2B1HH 1OD9A 4QLRA 5E94A 3MBEB 3UTPD 4HIIB 4BKLB 4DVBB 5I76B 1B90A 1WFOA 4Q9BA 2F53D 3NH7H 4YXLL 1SJEA 1WEJH 2IALA 3EYOB 1I1YA 2WUBH 4UV7H 5D2NA 3SDAA 3LD8B 1GHFL 2IPKB 1ORQA 4RGNB 3GMOA 4OM0L 2V9QA 3IDYB 4GG6E 3SN6N 3S3SA 1JMZA 1U0QA 4M1CC 5DK3A 1I8MA 2COQA 5IW3A 1U92A 1IARB 2FYYA 3VFMA 4OLWL 25C8H 5ENWA 3BZEB 5MEOB 5L88H 5ICZB 3LKSB 3CFCH 1YDPB 3BKCH 1CGSL 1I7ZB 5DC4B 1X4XA 2DQUL 2FEDD 5DFTA 3NFSH 2UYLA 3MV8A 5EA0H 4JVPA 4P5MA 3OGCA 5C0IA 1JYNA 2P24B 4WI3A 1CLOL 1CFBA 1FNGB 4C4KO 3SOBH 2FEEL 3F62A 5BO1L 4J4PD 5D7JA 4WUUD 5B39A 1OAYL 3ZE1E 5TE6L 4JY6B 4HJGA 1RK0B 3R0NA 5CBEA 4MXWH 2F5AL 2XRAL 2NNAB 3GSNH 3B9DA 1YYMH 1BOGB 2ADIB 5AWNL 4OJFH 3GRWL 3U7YH 5K9KB 1A0QL 1J0ZA 5IEHA 1GZQA 4GUPB 1DQLH 3BQUB 2E7HA 4PGEB 4GG6F 4U1MA 1FGVH 3GO1L 3W39B 2VXVH 5FO7B 1U6AH 2ZKHH 5KVFH 3L3HA 2G2RA 3I9GH 1UA6H 2HAZA 4P2CG 2DQIH 5A16A 1ZVSA 2AGJH 5C9JB 2BVTA 3QDJE 3K8MA 3MRJB 4HBQA 3FT2B 3L5HA 1AE6H 2NY6D 5KVFL 3Q1SL 3EKCA 5D2LF 2YD7A 2Q8BH 4MA8L 4UTAL 4YBHA 4U49A 4YO0B 5DVLA 2AV1A 4FTVD 5J06A 1ZANL 4L4VA 4ORZC 4DKFH 1OM3H 1QSZA 1VGEL 5D5MA 4RGOL 3HPLB 4BELD 5F9OH 3BRDA 1CVSC 2Z31C 4NQTA 4S10A 4H0GA 1Y0LA 4K7PX 3IFNH 1OAYH 4L9LA 4HFWA 1MCRA 3WJJA 5SV4A 4P2QD 4N5EC 2YC1A 5JPNA 1FQ9C 3PWPD 4IDJL 5GS0H 4YX2H 4UU9B 4J6RL 4ZUSB 5KG9A 4TUKL 4R7NA 1IEAA 1W0WA 3D48R 1BD2B 5DD5L 3HMXH 4H25B 3QNXA 4P23D 4HWEL 3TV3H 3MA7B 1E4XH 3CXDL 3KPRB 3ARXA 4LSTH 2Q7YB 5DRWA 2XN9D 4O2EB 2NY0C 3N50A 2IEPA 5ICYA 4G8EB 1F6LL 3IFPB 2W9EL 2DLEA 1DBJH 4P9ML 4CDHA 3WLWD 3S4SG 2BERA 3SDCB 1WLHA 2EH7L 3VW3L 5F71A 4Z77A 3HC0B 4WTXA 5E4EB 3O3BB 4M7LL 1XGPA 3D85B 2R0WL 2F19H 4GMTL 1U92B 1MH5A 5H2BA 3VI4F 2J8UF 2VO5A 5FGBC 3SKOB 3VGAB 5DFWH 3QFJB 4XMPL 1KIPB 3CPLB 4YHKL 2GI7A 5FYKD 4YFLF 1OAQH 4X5XA 1HILA 5BZWA 1IGFL 3PDGA 4PRHD 3I85A 5CWSB 4BQ9A 4F37F 1IKNA 1YUHB 5BRZD 1HH9A 1MREL 4QCIB 5L6YH 5CZKA 4Y19A 1U9KA 5FOBA 5FHAL 3OZ9H 1DUZA 4R90H 4TNVK 3VJ6A 3QULA 2AXFA 5CHNB 1GGTA 2FH6A 2H45A 1BQLL 3PHSA 2R2HB 1C08B 4JFFB 4EUPH 3IFLL 1PG7X 3DTXA 3CVHA 1LNUA 4ZAKA 3BZFB 3MLSH 4DAGL 3OWEA 4L3ED 1L6ZA 3WNLA 1UM5H 3SCMC 2H9GB 2YD8A 3HZVA 5GISL 5GS0D 1LO3H 2P44B 4FQIH 2ARJA 5KW9H 5CAYB 5ERWB 3P4OB 1RULH 4R2GC 3SY0A 1OHQA 3GFUA 2VIRB 1UCTA 1KN2L 4NJ9L 1J8KA 4JO4H 4HWZA 2X1OA 3E2HC 3GHBL 3PG2A 1VESA 3UAJC 1KCUL 1GRWA 5E2WH 2APVA 2XA8L 3WHXA 5ACLA 4F58H 5C2UB 5IESH 1V3MA 1P7HL 1NMCC 1L0QA 1I9IL 3ECBA 4G80A 4PD4K 3T0EC 3TZVA 2CIKB 1DANT 1EEUA 4MA1C 3C60A 3OR6A 1EHNA 1FFNA 3BWUC 1XGUB 3K7UA 3T2NL 3VXOA 4S1SL 1MFBL 1HK6A 4M6ML 1WFNA 4R7NB 2WBJA 3D18A 3D25B 2B8OT 3GSRB 4PJCA 3L3KA 4IJ3C 2H6PB 4G9FE 3PWPE 4K8RL 2X4RB 2NX5A 1J12A 5IG7B 2YK1L 3QWRA 4P57A 4PLOB 4HIEB 2X4PB 4YHML 2D3VA 3ARVA 5I1GL 3CU7A 2D0HA 1S5IH 5TE7L 3IFPA 1A7BA 3ZSTA 1N2RB 3P0GB 1MQKH 1X5XA 2A9NL 1F90L 2I5YL 3RU8H 4FZEH 3TNNB 1NDGA 1P4IH 3MXWH 3QHFL 5DC9B 4ETQA 2FO4B 4PR5A 4IJ3B 1X5AA 4YHZH 1T0NA 5KVMC 2WBWB 4QRTB 1I9IH 4XP5L 5T5NG 4Z7WA 2PTVA 3EZJB 2AQ3A 3QZWA 4NQDD 4YR6A 1MCHA 5JDJA 3DVNB 5DJCA 3S3PA 1Q94B 4JAMB 3MMEA 1QPPA 3IXAB 1VERA 2IPTH 4JFDA 4RX4D 4PV9B 1W72H 4HWBA 4GMSL 1TJIL 1YZZA 2IADB 4DEPC 3IF1B 1FVEB 5F8RC 1S7WA 5TFSH 3RVWC 4OGZA 4HBCL 2N7BA 2XT1B 1MF2L 3TO4D 4LNRB 4PJDE 3WFDL 2BP3A 1CZ8L 3BIKA 2BSSB 1NGWB 1G1CA 5BRZA 2RR3A 5B4MC 3FJTA 1CR9L 1KELL 1HOCA 4ODWB 1N7MH 5FCUL 4HGWA 4ZTOL 4E42B 4KROB 1MCNA 2V5MA 4X4ME 5FGBA 3C9NB 1NANH 4JHBA 4KI5C 3ZLQC 4MQXC 2EXYD 4P48A 4FXLA 3S36H 1NDMB 1U8PA 2G75A 2X70B 3QUYD 4MJID 1BBJA 2GQHA 1J5OL 1CVRA 3SE9H 5HDLA 1K4DA 5BXFB 4BYHA 3UTOA 5DJ8A 4C83B 5FUCC 4R3SA 2EIZA 2O5XH 3GUTA 3VGFA 1MCSA 4M6AA 3DX6B 2C4XA 3ALXA 4LFHD 5T1KB 4B41A 3D0VA 3NPSB 4XNQB 1PVHA 1YPZF 2NW2B 3ZT6A 1K6QH 3EJJX 3MJGX 5TGBB 3V79C 4QNPE 1IT9H 4Y7MA 3NCYS 1OCWH 1OAKL 2WP3O 4I2XB 5E6IB 5IR1A 3QDMD 2ZUQB 3ZE0E 5D7LD 2BNQE 4FQIL 4JN2B 4G6MH 1F3RB 3C5ZC 3FRUB 1I1FA 5CFHA 4JRWA 4O9HL 1DUYB 2B39A 4JB9H 4M8QB 2EIEA 3LKOB 1J1OH 1QFWH 1WTGT 2VITA 4NKOB 4YE4H 5ITFA 4ZUTA 4YUEL 1ZLSH 4U1LA 4Q6IC 2DQHH 4LPWA 3WUWG 5GS0L 4FTVA 3MV9A 1KXVC 2P47B 4HBCH 5EH1A 3C5ZB 3QQ9C 4DKAA 5MI0B 1QR1A 4A6YA 3BKJH 4NKMB 2A2QT 3B9AA 5JW4R 3RJQB 4D2NA 3GBNL 4GMSH 1QBMH 1T0PB 1L4IA 3BZEA 3ZDXF 4QRPA 1QKZL 4YHKH 5JA8B 1E4WH 2DF3A 4JFDE 5J7CC 3TH4T 4YK4C 3MV8B 1D5ZB 1GIGL 1X5ZA 1OSPL 5C0BA 2E9IA 5C3TA 3LRSB 2XICA 4KKCC 4EKXA 4RFOL 1CCZA 1FE8H 4M7LH 4WWKC 4CN6A 5E9DE 5C0FB 2XXCB 5H8DA 3MRDA 4LVHC 1JGDA 3SHSA 3MFFB 3VXNA 2R23B 4QHMB 3RWDA 4LHQB 1HXYA 3CCHB 3PJSB 4WU5B 1WBXB 2CQVA 2W9EH 4KWUA 5ABDE 2AV7A 3DBXB 3KPPB 2XFXA 3GJFH 1NEZB 5KBNC 5DJXA 4YJZL 4YZFE 4LSTL 2FZ3B 1FZJB 3I02A 5CIPB 1ZSDB 3WHE0 4OI7A 2HJFB 3VU2A 3GMNB 4PJ5B 5DZNA 4K9EC 2IH3B 2YD1A 4KTYA 3RGVC 2NX5E 4QTIH 3DROA 2AABL 3S3JA 3MV9D 1HH9B 3TIDB 4FS0A 3LKRB 3TVMA 3T09A 5CINH 1U8QA 4HJ0D 4F7MB 1OW0A 2R69L 3L5IA 1PQZB 4MNGE 3ULVF 5IHBA 5L88L 3CVHB 5TDPB 1OM3L 3CXHJ 3UDWA 1UCBH 4ZD3L 1NAMA 1P2CB 4F80A 3BKML 3ARWA 4E5XB 5E03A 1RZ8B 5EULV 5DJDB 1AY1H 1EZVY 4NQUA 4UDTA 5ELIA 1HKFA 2FJFB 4UUJA 5D2LE 4GAYA 2AEQL 1II4E 2HH0L 3PV6A 4OZ4A 4BH8A 5DQJB 1BD2D 3QI9C 5I71C 5IFHL 3CSBA 1A6WL 3ME0A 3HTLX 2DMKA 1AIFA 3DI2B 5JW5A 2DI7A 2BVPA 2FX7H 4KZEL 3WXVL 1KT2B 4WCYL 3CMOL 3D6GA 4JANA 4OV5B 3IT8D 3VI4E 3QDME 4S1RL 1EO8H 1VCAA 1N5AB 5C0GA 3S5LB 1FGVL 4LBEA 1DN2A 1QYGH 1XIWC 4ZO9A 1DQLL 1AFVL 4ZUTB 2VDKH 2IQAB 4NRZA 1Z2KA 3HI5H 1MQ8A 4XXDA 3SDXE 1YN6A 2P8PA 1DQDH 5EIIB 5IGXL 3O2WL 4R9HA 5HPMB 2FL5A 3B6SA 2NY0D 3W9EA 3RNKB 1RHFA 2GSIA 1SBSL 2R9HD 5D1ZC 3SOBL 1UWGL 3C2SA 4PUBL 2A1WH 3KPOA 4PJCB 3TESA 5AAWA 2K9UA 5CD3B 2RFXA 4KY1L 2ED7A 6FABH 3VFUA 4P5TD 1MCOL 4PJ9D 3IU3B 1DCLA 5I17B 4HWZB 4NNYA 3LKSA 5JXAH 25C8L 5F9JB 4XCCL 4F7CB 4U0QB 3MSPA 1N0LA 3HMXA 3MRNA 2QADD 3EYQC 5CEXB 3PDDA 1RZJL 4LCCB 3WYRA 1BQHG 4MAYD 4IBLT 2D7MA 5FO8A 3O9WB 3UTQA 1BJ1H 4YDIH 4CADA 2AJZB 1RJLA 2R23A 2OJZL 4H26B 3WNMA 5D1ZA 5IFAL 1VFBB 4YH6A 1NMAH 3BH8A 3WN5C 4WV1B 2DOCA 4HH9B 1QSFA 3ARDA 1J0KA 3U6RA 1J1PH 1V3LA 1MIEL 1CD8A 3TV3L 2GK0B 1C7TA 3O41B 1F4XL 2Z8VC 2E6QA 3OXRA 4LPUA 2OL3A 1A7NH 4MWFB 3NBNA 4M9OA 5TQ2L 1QZ1A 1DVFA 3J7HA 3IDNB 3IETA 1RQ5A 1A6ZB 3LB6D 4UNTA 4X7SL 3JTSA 3SGDH 5L8LB 4IDLA 1ZE3C 5FF6B 5HI5C 1XCQB 3UTSD 1WIOA 4F37K 2P24A 4HAGA 5DYOA 3MLWH 5IQ9B 4AMKL 1TCMA 2AI0H 1OPGH 1T03L 4Z7QE 4TSCL 3E1F1 2EECA 4CVWA 3B9VA 3GSOA 4P4RB 1M4KA 2R2EB 1XIWD 1PY4A 2CR6A 1L0YA 4OF7A 3RWHB 3MR9B 3VWKC 1EO8L 5JXED 1IGTA 1JN6A 3TN0D 2LAGB 4L9LB 3TYGH 5CJQH 2NY6B 4KFZC 4FQQA 1S3KH 3IDJA 2FHCA 5IHUL 5C9JA 1A6VL 3VGHA 2A74B 1O7SA 2VXQL 5K9JL 3VFMB 1QUNA 2KZ1B 1QEWA 2OS7A 1K6QL 1IZKA 5CEYA 4PJIA 3CZFB 1NGXB 1GGIH 1OGTA 1N2RA 5B38B 4E42A 1A2YB 1BZ7A 4RWYL 2O5XL 4OKVB 4OF5A 4LU5L 1A4JA 4UT6H 3L1OL 4OD1H 5JHDE 1IAIM 4GQPH 5JQ6H 1YNTA 1G9MC 2O5YH 3LQZB 5GRWA 3W9DB 1MHHB 1GGCL 1I7RA 2X4NA 1HQRB 4LSRL 2V2WB 4RA0C 4UIMB 1TVBB 2QSCL 3T0AA 3MLXL 2UVEA 5GS1B 3G6DH 2ITDB 3QZWB 3O3BA 1NCBL 4KPHH 3D3VA 4CMHB 1D5IH 1ZT1B 2ZOLA 4POUB 4UU9A 3ARED 1WWCA 2CDGA 3WEXA 2HH0H 4I9WE 1MFAL 1BVZA 4JKMA 1QSEE 3B9EA 1IM9B 4C58B 4QRQB 4HW6A 3H3PL 3RWIB 2BNUB 3JVGA 2YD6A 1SEQL 2VDQL 4A6YB 4XCYA 3WFDH 5FUZL 3V6OC 4HLZH 1TITA 3IDMB 3O3EB 5ACZB 4GT7A 1T6VN 4IRSA 2EDOA 3VXRA 5GGVH 5C09D 1ACYH 3V2AR 5B8CB 5ILTH 4PJGE 2QQKL 3QQ4B 4NQCA 1SVCP 5TH2B 1WT5A 3LMJH 1IGIL 3EYVA 2WUCL 1P7QB 1KLGB 4YAQB 3CC5B 4JG1L 3OJMB 2A6DA 5BOZG 4KQ4H 4IOFD 5CILL 5DJ0A 3VWKD 1DE4A 3JTSB 3X3FH 3HG1A 4LEOA 1OWWA 1CICB 2F9BT 1K8IA 4GRLC 2I24N 3DYMA 1UWEL 2X9WA 3C6SA 5I19L 1RIUL 4NBZB 4ZYKB 5JMRA 1KCSL 4Y8DC 3GJFB 1Z6JT 4K8RC 2NY4C 1BVKA 1ZGLM 4NQED 1L0XA 1NUNB 3GMNA 4FQ2H 4TUOB 1T5WB 4WJ5A 4P46D 4PTUB 1E6JL 4QYOB 4FQ1H 3L3OA 1EGJA 3OJDB 3N1GC 4P2QA 3IXTA 2VDNL 4OLEA 3ZKXC 5C0BB 4KTDL 3L9RA 1ED3A 5JOPE 4G7VH 4KRPC 3Q48A 1FIEA 3PL6B 4CMMB 4HFWB 1XFPA 1YN7B 2NY4B 3LS5L 5DFVC 4HKJB 3S97C 3D85A 1BGXH 4I3SL 1RZKL 4R4BB 3OKDB 4IIQC 4BH7A 5GGSA 4HUVA 1JV5A 3FQXB 4MS8C 5F7MC 1U2HA 1XIWA 4RFEA 1GC1H 4P9HL 4ODUA 2K7QA 2AQ2A 3R06A 3S34H 1F42A 4CJ0A 3OF6D 2PYEB 4KI5D 5ITBH 5DJ6A 4ZUUA 4LPYA 2VKXA 5TQ0H 2WV3A 1B88A 3MJ9A 3VD5A 1QFWI 1ZK9A 4ZS6D 1KGCD 3MRGA 3P30H 1I4FA 2VH5H 1LEGA 4D8PA 3WIFA 4NQSA 2JB5L 1QFUL 4QOKD 3MLRL 5F3BB 1LHZA 5FOJA 2VDNH 4ALAH 4R4FL 3VFSA 1AP2A 1MAJA 2H32A 4Z7UB 3RWCB 2CLVA 3QSKB 3QXDA 3M17B 4ZNEA 1VKXA 4ZTOH 2BY1A 5IB4A 1CFQA 1IT9L 3QFJA 3HG1E 4OKDA 1UJ3B 2BNUA 2CR3A 3U0TA 3FQTA 3D9AH 2IANE 4FQLH 4XH2B 2BOBA 2YD2A 1IGCL 2PXYC 1IE5A 1MRDL 1KUMA 1QSEA 2VIRA 1NFIA 2NYYD 4U1NA 3D69B 2Y72A 1P1ZB 3VRJB 5LGKA 3O4LA 3BZ4B 1DUZB 1JWSA 1K85A 2XNAA 4EOWL 2GCYA 5D7JC 1NGYA 4ZPVA 1GJIA 3LD8C 3MRBA 1JHKL 3EDDA 1IGIH 5JA9A 3RVTC 3P9LA 2ESVA 2C26A 3SDDA 3QQ9D 4KZDL 1S78C 1WCQA 1MEXH 1GXEA 2OI9B 5FYKL 2DDQL 3OJVC 5KS9A 1JL8A 1NMAL 1U58A 4KK9C 1MVUA 1K4DB 1PX4A 3P4MA 2BDNH 3JV0A 2JJTA 2VZ3A 4JY6A 4BK5A 2VZVA 1M7XA 1IFHL 1DBKL 4G6AC 1JNJA 4HULB 5FYKH 1MEXL 3INUL 4QRSB 1IEHA 4OGXH 3T0XA 3OKMB 3FFDA 4O58H 3IETB 2AJUH 5DQJA 4W70A 4QXUH 1G6VK 4XCNB 5ADPL 3NN8A 5J9PA 2ZCHH 1A6AB 3SDDC 4GSDH 1KNOA 4MXVF 3PE9A 1Q0XH 5JPNB 1BWWA 2YXFA 4HEME 1CTNA 5J6GA 2FB4H 1A6UH 5C09B 4NZJA 4Z7WB 1XF3A 2WINB 3EO9H 4TOYL 3IFNL 1WBZA 1MCIA 2VUYA 1YQVH 2R1XA 4PREB 1NCTA 1RIHH 2QHRH 3F7RA 1GZPA 1RZGA 2Z8RA 5ESVB 3DO7A 5AUMB 1FDLL 3U9PL 3IVKA 1C08A 1F6FB 4OLXL 2XA8H 3RWHA 3LPFA 5E2WL 3GHBH 4OB5H 1U8HA 2M1KA 5KAQF 4LSSH 1JHLL 3QIUD 1S9WB 4LLQB 3HPLA 4NWUL 1ZOXA 5H37G 4HF5L 1KBGL 4ODVH 5J3HC 5LXGL 4AM0B 3QJFA 4FQQB 4WUUA 1XGYL 2DICA 4K07A 1NBQA 1A1NA 3QHZL 5FGCE 4NN6B 1F6AB 4NKIL 1D5IL 2OR7A 4Z7UE 1NGWA 3VGBA 4X80H 1I1AD 1WFTA 1EXUA 2BMKB 1T2XA 4N90D 4MXQC 1IBGH 1MFBH 2XIDA 3EJYD 1KIQA 1UZ6E 3P30L 1X5YA 1FHGA 2VDLH 4X6FB 5GZNC 3UP1A 2MSPA 4GBXD 4KKBC 5JHDD 1EK3A 3L1OH 3VXRE 1JF1A 3BP6A 4DEPB 5FYLH 4F58L 4P9HH 1TZIB 2MHAB 4KJWC 3UO1L 3S96B 3RIFK 3KDMA 2R69H 3L7FB 2VWEE 5DMIH 5HYSB 2W9LA 1EAJA 4NDMB 5AZ2H 4J3VA 3H3BC 5BQ7A 5JNYA 4BA8A 4U6XA 3NACL 3EHBD 1FFOA 1R3KA 4HGMA 2DM4A 3GBLA 4JGUA 3VH8A 2EE3A 4KROC 1C16A 4MGXA 4WI5A 1JMXA 3I02B 5CIPA 2RHEA 3RAJH 2DQDH 4B53A 1IGMH 2A9ML 2DWEA 4KH2A 1MUJA 2YKLL 5BW7C 2OZ4L 4WY7H 3A0OA 3ULVC 3CVHH 3MLSL 3RKPA 2OXHA 4DAGH 5MERA 2X9XA 3G08A 1C5CL 3W11D 2Y23A 4XI5D 1CL7H 4JGMA 3LEVL 5DK2B 5IEKB 1P4LB 2HWZL 2FATH 3QEQA 2HJLA 4HG4J 3VJ6B 5T1LA 4K55A 3STLB 4LQFH 3T0WA 4I3GA 4P0DA 4TRPH 3DECA 4W6WB 4J3UA 1FPTH 1SY6L 2P8LB 4HX1B 3P0YL 1YEKL 1PEWA 3LRHA 3HMXL 1YEEL 1S7SB 2QKIA 2C4FU 3KG5A 1FIGH 1KEMH 1REIA 1QKZH 1L9MA 5GHWH 3BH9B 4BH8B 2IBBA 2GJ6E 2DRUA 3DRQA 4NNPL 5I66B 4G5ZH 4TRPL 5AZ2L 4DGVH 4FQXC 3FB8A 2X6MA 4B7IA 3C5SA 3BO8A 1E28A 3FRPA 1DEEA 2FR4A 5IBUB 3RVVD 4DK3A 4L4TD 1V7ML 4RZCB 3Q5OA 4P57B 1INQA 3MYJA 1ADQH 4MXQD 1F3DH 4G9FB 2SEBB 4GXUM 3X13A 2CGRH 2JE8A 1YEHH 4PRAA 4ZFFA 3CVHL 4YAQA 4GG8A 4UTAH 1NLBH 2OZ4H 5D2LA 2AKRB 1LO5B 2YA2A 2GTWA 3Q1SH 3LKQB 5TJWK 4LDEB 2PTUA 1J05A 1CFTA 2F74A 4NIKB 1I9EA 1AD9A 1CICA 5BV7L 3RL2B 1YYLL 3D3VB 4UBDC 2HTKD 1LO4H 3DBXA 3KLDA 3KPPA 4MA1B 3DRTA 2R8SL 5DJXB 3JXAA 1U3HD 5ANMB 5DR5H 2NR6D 1CBVH 3NTCH 1T21B 4U1JA 3MCKA 3CD4A 3V9FA 1UH2A 3DXAD 3CLEL 1AJ7H 3MRNB 3RA7L 4WWKB 4QO1A 5C2BL 1IC7H 2VDKL 1KIUA 5I0ZA 3L9RB 4KMTH 1X5KA 3NTCL 1B0RA 3B8SA 4XMLH 2HVJA 1NH6A 2R56L 1YJDC 3AREA 4OF6A 1KC5H 4FQPA 3CMOH 1XGQB 1A47A 5HVHC 1YMME 4JRYD 4X6CB 1QFHA 5GGSB 4Q58C 3MV7D 4XRCA 2VLJE 5J56B 3SKNA 4HUKB 1MLBB 3UPRA 4P46B 3HHRB 2V2XA 4PJHE 5C07A 3CFEA 5BJTB 3MV8E 2G75B 4OCSH 2IG2H 3H9HB 5CD5D 2OJEB 3MJ7A 3WIHL 1JGEA 2ZWLT 1N4XH 1CDYA 4DCQB 1FDLH 4OZFA 5JMOC 1R5WA 4V2BA 1RJLB 1DQQB 2XNAB 2XTJE 1A4KB 3QG7L 2D7NA 5SWZD 1CFSA 1J10A 5GGQL 1KXTB 2FBJH 2IQAA 3LIZH 5I16A 4X7SH 4KKAD 3OSKA 1AGEA 1FZOA 3F7VB 5IV2A 5DQ9A 3VRIA 4PGDB 1L7TH 4PBVC 3GIZL 1F4XH 1YEKH 2BC4A 4J1UA 4NO3A 4OLWH 3VXSD 1P6AB 4XPFL 4I77H 2ID5A 1F97A 5E1AB 5MENE 4U05A 1CL7I 3TWCL 4X4ZA 1AI1H 3WO3B 2IQ9L 5FF6A 4U1GB 3MXWL 5EBMA 4PFEA 2DKMA 4DGYH 3WO4B 4LHUB 2DM3A 5EUOB 5HYFA 1XIWB 4UAOB 4U2ZA 1Q9LB 3IU3A 3V95A 5I17A 1QHOA 1B0GA 2WAHA 4I18B 5D7IA 4P3DB 4XTRD 3EZ8A 3TN0B 1S7VA 2IH1A 3CFBA 4O00A 5EZIH 5E1HB 3MLPA 5HYJE 3MBXH 1GVIA 4UI2A 2VAJA 4YGAB 3MRBB 4M3KB 1BP3B 1LDPL 2W0FA 3KPSD 5DO2D 1ODAA 5I0DA 1D6VH 3GSVB 1EGJH 3PNWA 4OLVH 1KTKE 3RI5F 4BJLA 1E4WL 2FL5B 3VXUE 1MAMH 4I18C 3TIDA 2HJKA 1U8OA 3MRRB 3ES6B 4XPTH 2J6EA 5E7FA 1UWGH 5I75B 1H15B 3BEVB 4NWTL 1BQUA 1A7QL 2KBGA 4TPRH 3OAUL 4A6YH 3FQNB 5AD0B 3MRQB 2A6JA 1WGOA 3TYFA 4HWBL 5FYJH 2GTZA 3HUJE 5KSUA 1NCDH 1EJOL 5EBLB 1ZLSL 1EEQA 3L3DA 4YIQB 3H3KA 5ID1A 4Y19D 1F6AA 1RZKH 3SEPA 4OFPA 2GW5A 5DC0A 3V5KA 4CU7A 4Q6IB 2F58L 3VWJA 2PNDA 5CMAB 1S7QA 4JM2C 3GMRB 5TE4H 1A6WH 4Z7WE 1SEBA 4PGJA 3C6LA 5IF0A 2QSTA 4FQ1L 4PJ5A 2BVOA 3VXTA 3UPRB 1YA5A 3KAAA 2VOTA 5JTWA 2D9CA 5A3IC 3RVXC 1KELH 1CR9H 1JHLH 1ZA6A 1R3JA 3FN9A 3HAEB 5D7JD 3WDJA 5IVXB 1DVFB 3FQUA 3KLAB 4AEFA 5KSAA 3BX7C 2WWKT 3QCUL 3RWEB 2C1OA 4K2UL 3V6FB 5IWLA 2VDOH 3MRPA 4DCQA 4G8FA 1FVDB 2Q86B 1T2QH 2A83B 3QUMH 2DS4A 2KH2B 4K3JH 2NY3C 4A6YL 2W9DH 3BYYA 2VDRL 4W4NA 2PF6A 5D8JL 4ODXB 1EFQA 4U33A 1W72L 1N64L 2FYYB 3QUZB 4I3SH 1VHPA 3T04D 4LVHB 35C8H 5DQDH 3LRGA 3PHOA 4KUCF 5IQ7H 1AO7A 4FFYH 5EO1A 4NZTL 5JW4Q 5LVEA 2X1PA 4OCNC 2EC9T 3OKNA 5F7EH 3WUZA 3W9DA 3EYFA 5EO0B 1WZ1L 4AENA 1FNSL 4KDWA 7FABH 5EZIL 4JFFD 4KXZI 3FO1A 4HS6A 4LEXL 1P4IL 1J87A 3UZQA 1QFOA 3O2DH 5EUOA 1HEZB 1DR9A 1A8JH 3ZTNH 4NDMA 4P3WA 1OARL 1I1RA 3MOBL 1OP3H 4AY0A 4Z6AT 3MLTB 2IQ9H 3ARYA 2QSVA 3KYAA 4Y5YA 5I9QB 1FJ1B 4FQHB 3PWJA 3HE7D 4JRXA 5C0CE 3ARFB 1F58H 5DD0L 1JUFA 3E3QC 4NQCE 5A16B 3H7BB 4LLWB 3BEWB 3DJ9A 4YHLH 1I85A 2ZCKH 3CDGB 5HGAB 3QXUA 1TENA 3PGCB 4G8IB 3J8F7 4J6RH 1LEKA 1QA9B 3N85L 3RWJA 3MLXH 3R4DA 5INDA 1MHHA 5IB1A 4BFIB 1XCQA 1FVCA 3LMJL 1JPSL 3K8LA 2YBRA 2ZP0T 2VQUA 1CXLA 2CKBB 2HTLD 5GGVL 1LDSA 4QRTA 4HIJB 4JM2D 5DUML 4P2RD 2XACC 4PJHF 4NC1C 1A1MA 2AXJA 3C5ZD 2FH8A 1YECH 2B7DT 5D9SA 1GGIL 3AGVA 3QCUH 3MRLB 4U3HA 4O2FA 3AUVA 3SDDD 4RFEB 2J8UA 1KN2H 4NJ9H 1K8IB 4YPGA 3T1FA 3RTQC 3B9KC 4NT6A 3VXSB 3CJJA 3W0WE 1U8LA 2VXSH 1CFNA 2VSCA 1UKTA 4JQVC 3DRQB 3V7AG 1H3GA 3IF1A 4FFZL 5A2LH 3VXMD 5E8PA 4M62H 2WZPD 5TE4L 1RD6A 5IBTH 1ZHLA 4QXWA 1GAFH 4UQ2A 2KPNA 1KCLA 3PXJA 3LDBB 1T21A 4U1JB 4PS4H 4DK6A 4G8GB 2W0KA 1MWAA 2Q3AA 3JV5A 1UENA 2ILLA 4P59L 1H8NA 3S8WA 3L3IA 4C56E 4JDTL 1IC7L 1JPTL 5IMOB 3AS0A 5FYLE 1LP9E 1FNHA 3HCVA 5D6CB 4U4BA 2YSSB 2GY5A 3CVIL 2P5WB 3X11A 2OR9H 4FN0A 2WNGA 1CGVA 1KCUH 2EKJA 2CIIA 1T7VA 2KQMA 5F1KC 3OAUH 1Q0YL 4JFOA 1PGRB 1XGQA 3K81A 4Y4FA 1YMMD 4DTGL 4KRLB 1BZ9A 3CH1A 5F1NB 3MUY1 4PY8I 2EEAA 5DJ8B 4C83A 5GZND 1QSFB 3DVGA 4LOUC 1EX0A 1J9CT 4Y2DC 3NFSL 4MQTB 1QLEH 1HHIA 4LIQL 2GJ6A 1A7NL 2MMXA 4NQDB 5I1HH 1TZGL 4KK8D 4IM8A 5A2IH 1TTGA 1ZAGA 1RZIA 4KJWD 4P4KB 1LO2L 1E6JH 4FNLH 2OTUB 3O3DA 3WIFB 4H1LG 1WISA 5E8OB 3C5JA 3FB6B 4PJBF 5J11B 4HJJH 3Q0HA 5EBWA 4WTZG 3GSWB 2NQCA 1XMWA 1RURL 5IMKA 3X3GH 2EDBA 3AS1A 1NBZB 5KSAD 5KAQG 4BZ2H 1KENL 5IV2B 1F11B 4L29A 4RAVB 5I6XB 4NHCH 2H9GA 4CVXA 1MCOH 3ULVD 3FQRB 2BVYA 1AKJA 4Z0BH 3C6LD 3FTGB 4UINL 5HHVH 5MEND 2Z91B 4X7EC 4NO5B 5JLZB 4YDKL 2E9WA 4D3CL 5DEFA 4ONFH 5TF1L 3TJHD 2ESVD 1RUAH 1YY9D 1CXFA 5IGXH 1T1WA 3QHFH 4RGOH 2VQ1A 3VFSB 1CD0A 1F90H 1BX2B 2I5YH 4X9IA 1WSST 5LWYH 1UXWB 3MNZB 1OGTB 4O2FB 3NGBB 5D96C 5DEGA 4N0CD 5BZDA 4AH2A 2X89D 4JFDD 5DQ9B 5GRJL 2YKLH 2XV6B 2A9MH 4XCCH 4KUZH 1CDJA 1ZHBB 5IMMA 1QVOB 3PDOA 3ES6A 3IU4L 3MTRA 4F15B 2V2TB 1F3DJ 2OM5A 5DRXB 4DVRH 3QIBB 4HT1L 4PJGB 4LCWD 1P9MC 1MWAB 4LRIA 3FFDB 1X5LA 1VFOA 4N0YH 2DQTL 4RMWA 1NGYB 4ZPVB 4GS7C 4I77L 4NKDA 4P5TC 1ZHNB 1AGFA 1UXSA 2LFGA 3ARGC 3QDMA 4P2OB 5ID1B 1YNLH 3BHBA 1T1ZB 4XC1H 1AFVH 3VFPB 3HI1B 3KR3L 4LRNL 4JFOB 3VE0A 2L7JA 3PNWB 2MNUA 2IBZY 2AABH 2NR6C 4X6DE 1U8NA 2EDHA 3QEHB 4WUUE 1P9MA 4OUOA 4L4VE 1FN4B 3IYLW 3VFWA 4R7DA 3RUGA 4TVPD 3WD5H 4N0UE 4OZIE 3O0RL 3L3HB 2YA1A 4Y0GA 4JPWH 4MMXC 3I6KA 3GMMA 5GGRY 2E3VA 5IB2B 2LVEA 3I84A 2ERJC 4X98A 1AD0B 1KPUB 2R9HC 3IFLH 2ZSWA 3IKCA 1W8NA 5FV2A 2BMKA 1AXTL 4MSWA 2FR4B 4P3DA 3KPMB 5K59F 2AJ3B 5TE6H 1FE8L 1HOCB 4U1HA 1NBZA 4OZFG 3LKPA 4JANB 2W65A 5KS9E 2PYEA 1I8KB 1W0VA 1I3UA 3L3GA 3O11B 4JR9H 2EDNA 2FSEB 4Y2DA 3KYNA 2PW1A 1AKJB 1EHAA 2VZSA 4LRNH 3U0WL 2VE6B 2E5EA 1I3GL 2QLVB 3MO1B 3BE1H 4XNXH 1KYOK 1MIMH 1F3JA 1U8OB 5C2BH 3UYOD 4WDIB 4JQIL 4P3CL 4XX1E 3T77A 4FQJH 3VDAA 3OXSB 2DQGL 5KVEL 1SBBA 2GSIB 1UB6B 1LP9A 4Y89A 1S9XB 2X4UB 3QXAB 3PIQA 2F8XC 4CN4A 1JPGA 43CAB 4KKAC 3TYFB 1HDMB 3DX9A 1U3JA 1G6RH 4BSVA 3ARSA 2V9RA 1JWMA 4EN3A 1TPXC 4L1DA 1WAAF 4JFPB 1MFDL 1TXKA 1BREA 5IM7B 1I9RH 1DVFD 3QIWA 4LCWA 4XZUB 4XCEA 2GTWB 3PUCA 2J6EH 4KAQH 3R8BB 5T1MB 3OKOA 1EFXB 1XF4B 3K74B 3ARDD 5EFIA 3S37H 4F7TB 3SGKC 5I1CL 1YC7A 4LMQE 2BNQB 1SBSH 3U83A 4JG0L 1XF3B 4XTRC 5B21A 1RJZA 4RNRA 5LGHH 4XVJH 3RDTD 4GJTB 3BGFC 3SKOA 4KV5F 1WZKA 2P8MA 2NY0B 3AREC 1LEIA 3DURA 3W0WD 1QPXA 4A2LA 1UM4L 2VR5A 5D72L 3JV6B 4ZPTA 1QLFB 4AJ0A 4DVBA 1FYTB 1ZVHA 1QFWL 4RFNB 5HD8D 2CRZA 5CCKL 2Q8BL 4X8JA 1TMCB 4FXGB 5T5NF 4WFGD 4Y1AD 4KMQA 3ISWA 1JBJA 5T3XL 4GRWB 1OTSD 3EDKA 4ONHB 2CLZA 4L9DA 2NY3D 3STLA 4OCRL 5I30L 4ZFFB 1NPUA 3OKLB 5FYLD 3KS0J 3QFDB 1A3RH 4MB5A 5L7XL 1KJVB 3OHXA 5CZXD 1B4JH 3QI9A 2QKIB 1M7IB 4BZYA 3MRLA 3CPLA 3KHOA 4WY7L 5ITBL 3AXLB 5E5RB 4NQEB 2X2YA 3FMGH 1JGLH 3B2VL 4MD5B 5EZJA 2R1XB 1RIVL 1MLCA 1DBBL 3HE7B 3HNSL 3BSZH 2BVQB 4K7FB 4JRXB 3TBYA 2CDEB 4JHAH 1R3KB 1ZSDA 5CP7B 4Z7QF 3L3JA 3ZDZE 5IW1A 3S36L 1NGXA 5EZOL 3Q6GH 1AQKH 5K9OA 1I7ZA 1KXQE 1TZHA 3KYKH 3MRJA 2EEDA 1GL4B 2XKNA 4IEFB 4EDXB 3CFDA 5F93C 4M1DH 5IROC 3L5WB 1WEJL 3MV01 4PY7B 2O93L 4YDVB 4OV6F 4NM8L 2V5SA 5EU6A 5FUOH 2NTSP 2EH8H 4KJPD 3PP4H 3M8OL 4L8CB 3F12A 1VB9A 2KKQA 1M71A 3QHZH 4TVSa 1TJIH 3QNZB 3HMWL 5F7EL 4HIIA 4EIZC 3IB4A 1P5VA 3P2TA 3DUUB 3H0TA 4ZFGH 4NWUH 4G80B 3RDTA 4LMQI 2LVCA 1K4CB 5HD8C 4ZS6C 1XGUA 2XN9A 1JTOA 3MNVB 4WHYG 1WAAA 2QQNL 5DWUL 4Z18A 4M02A 5ISZB 3VXRB 3BZFA 1FL6A 4H25A 5KN5B 5C70A 5ICZA 3EO9L 4YBLC 4P46C 1R5IB 3RWGA 4NPYB 4RIRA 4JFZH 2GUOB 4FZEL 5LQBH 3HZVB 3DURB 1RMFH 3LOWA 3NZ8B 1ZA6B 5F89B 4NSKB 3B6SB 4N0FA 1S5IL 3H3PH 4YHLL 3ARBA 5CZXC 1A1OA 4MD0B 5E1AA 5ADPH 1MFCL 1MFAH 3U30C 4JB9L 1PKOA 5KZCB 2GEEA 1EUUA 3P73A 1OY3B 4QNPF 5IOPB 3PV7A 1IEBA 3EDEA 1I8IB 4OCWL 3T65A 1MWAH 3ULSA 3G6DL 4H1LA 1ULVA 4OM1L 1UM5L 1QBBA 2DYPD 1W0YT 3REVA 2X4OB 4JKWA 2AK4E 4Y2DD 4M5YH 4GLRH 4ZXBB 1JF5A 3QI9D 4LIQH 1V7NH 3PL6A 4CMMA 3D25A 3QDJB 1FVEA 1J8HB 3SE4A 3MRCA 2WLYA 3WSQL 2ADIA 3HFMH 5FEBA 3LS5H 3ZMRA 2ATPA 2DMCA 3GJFK 3NCMA 3V4VH 1BAFL 2E6PA 5H94A 1QG3A 1T2QL 3VFOB 3CVIH 1QNZH 3MODH 2F74B 3BP5A 2A38A 1UM6L 2P5EE 4XC3L 4JFQB 2DI8A 1RJYA 4EDXA 1N7ML 5FCUH 4MXVE 4ZDHB 3HNTH 5HVGB 5MP6L 2NYYC 1EEYB 1Q9WB 4IRZH 4WHCA 3FT2A 2NXYC 2IFFL 4PJBA 1QHPA 3QDHA 5EZLA 1KTDB 3VDCA 3UJTH 3MJ6A 2V7HB 4KKNA 4OM1H 5DRNA 1UG9A 3FO1B 5BS0A 2A73B 2X4SB 3QCTL 1CIDA 3MYJB 4NM4H 2PO6B 5L6YL 1AR1C 4QXTA 3RNQB 4M48L 5GGTH 2OK0L 2YZ8A 1B6UA 5D7SL 2GJZA 2UZYB 3RHWK 2XKSA 2YD4A 3MLUL 4U1LB 2QADC 2XZZA 2A77H 5CCKH 3U0PB 1BPVA 4JFXB 2Z31D 3ARTA 4OZHB 1ZTXL 1JNLL 4G6FD 3LSOB 1KOAA 3L3DB 4IRSC 3GMMB 4LCUA 1AD0A 1KPUA 3VD7A 4WHDA 1K8DA 1FORL 1TQCB 4MA7H 3EO1B 1FH5H 4PJIE 4BSWA 2R15A 1X6NA 4XRCB 2F8OA 3AFLA 4PV8A 5LGHL 3GMRA 4R26H 1CQYA 3BZ4A 4R97B 3ILQD 1JPSH 2QQNH 1ONQA 3IS1X 1NSNH 2RJMA 3JV4A 3JTTA 1ZANH 3DX7A 5EN2A 1HILB 1SEQH 2VDQH 5FKAA 3P9MB 3P0VH 4LFHG 3QG6A 5TE7H 2NY1C 5F7NC 2QSQA 2DTMH 2YS4A 3PWUA 3WBDA 1FG2B 5GQBA 4HIXL 4MQSB 4OCMC 5EWIL 1LDPH 4PGZA 5C0AE 1UVQB 3VWJC 2ADFL 5HY9A 1I75A 3MZGB 5DEZA 1T2JA 2GSGB 3UC0L 4BKLA 5FB8B 3M8OH 3FFCA 4PRIA 1CFNB 1FN4A 4TUKH 2R0LL 4M93B 3TVMC 2NW3A 1H3UA 2ORBL 3QXAA 3FN0L 4OLUL 2FZ3A 4HS8L 1F4HA 4MNQE 5I19H 3LKNB 2OMBA 1ZT7A 3TWCH 3H7BA 4RRPA 1HHKA 2EYTB 3ESVF 4OBRA 4P46A 4UT6L 2FCBA 3S35X 5HVHB 5GIRB 1DQDL 4ZAKC 3DROB 3HPJB 3QXWA 1NBVH 3GSUA 4HDIB 1NGPH 3GSNA 4GFTB 3BE1L 4XNXL 1MCEA 4L5FH 2AAVA 5JIHA 1G7PB 2XTJC 3UTPE 3IDGB 4K23H 3NMEA 4XCEB 4JO4L 4F8QA 1NLDL 4LNVA 1FNGA 5EG6C 1MCFA 3E6HB 4JFYB 3BW9A 4KVCH 4P9HC 2GT9A 3UROR 4WCYH 4BM7A 4LLDA 2VDRH 1CFSB 3WXWL 4ZODA 2Y06L 2ZNWA 5ID0B 3NIGE 1HXMB 2I07B 4JFHE 3OHXB 3ZHDA 2EE9A 2MQ0A 3B2VH 4NQXA 3R1GL 3TZVD 2VXVL 1GGUA 4JQXC 1YEHL 4N5ED 4YXLH 1FV1B 3CX2A 1RHHA 4IRSD 4PJ8C 5BVPL 3ZKQD 3DETC 3QJHA 4FXGA 4RISL 3FB6A 1N5AA 4Z7VA 5C0GB 4X9BA 5E99H 5HDBF 5E70A 1IC4L 5GS2H 5L0QB 3QIWB 1IVLA 3DMMB 3WO4C 1GGCH 3RTQB 1EFXD 1NLDH 3W5MA 4O02H 1XF2B 3QQ3B 3T0ED 1CT8B 3QI9B 5I71B 3V5KB 4XC1L 4WW1B 3WLWC 2B5IC 5DHVH 8CGTA 1W72A 2R2BA 4HWBH 4XPBL 4OZHF 1U8LB 4APQC 3QDJD 4PJ8A 2AJSH 1RZ7H 5HHOD 3WNOA 3BESR 3FQWB 3QUYB 3DHJA 1C1EL 2AV7B 2NY2D 2FECI 4X7DC 3MACL 3KXFE 1CU4L 1OD7A 3DMMC 1HHIB 2EH7H 3VW3H 1MRCH 3GSQB 3NFNA 4D9LL 4NQDA 3TPUB 2HJFA 3NZHH 3VXPA 1LO4L 1IKFL 2G5RA 3DX6A 1D5MA 4GXVH 3VFNA 4FTVE 4QGTA 4Y16B 2BSRA 3ZYIA 4NN7C 3O3DB 4AEEA 2OCFD 4V1DD 3SCMD 1YEJH 3CXDH 5EOQH 5GGTA 4P5MB 1MHEA 4KC3B 4LSPH 4AH2B 2VNCA 5D6CA 5J89A 1K5NA 3MCLL 2DTML 2L4OA 3EJZC 4W6XB 3CDGA 2XKNB 3OKKB 1ZLVH 4GXVL 3P0VL 3IJHA 1G7JA 3FFCB 3HC4H 4PRIB 4H20L 3V7MA 5TDPA 4OFIA 4Y4KA 5DRZB 4C56B 4M7KH 3NAAH 4K8RD 3O3UN 4ODHL 4MA3B 4PJ7F 3RJDA 2I25N 1EVTC 3LH2L 5BVJA 4DQOH 2PTTB 1A9EA 5CJ5A 1JGVH 1MH5B 3UAJD 2VABA 4NSKA 3OR7A 5CS7A 3ARPA 4EBQL 5F9OL 1PY9A 1CDGA 5EOTB 5TF1H 1OTTC 2BOBB 5F9JA 3MZTA 1QFPA 2XWJA 3DUSA 3RWEA 5HHVL 3MC0A 3IRZA 5DUBA 3ZE0F 1QYGL 2X41A 3D2UD 4TSBH 2AK4A 1P1ZA 1KT2A 5CJXC 4DWHA 4LNRA 2XFXB 1IC4H 1FZKB 5T1KA 1VFMA 3NIFE 3L3JB 1WT5C 3MRHA 2BHZA 4XBEL 3GJEB 1A9BA 1JI2A 1YJDH 3M45A 4Z7NE 4L4TE 1QSVA 1XGYH 3BOVA 3LEVH 4GKNB 3IDXL 1OCWL 3BN3B 2GK0A 2F8VA 4XT1C 2FRGP 2VLKE 4JFHD 4OCYH 2ICEA 4V2CB 3L95A 3HC0A 5DEFB 3U9PH 5A2KH 1S8DB 2EO9A 2CDFB 5GXBB 3GRWA 4ERSH 5HI4D 3QIBA 2CUMA 4PRDB 3SKMB 3GMPB 4QRPE 4AL8H 5I1KL 5I1LB 5I18H 3AB0C 3KPSB 5BO1H 3I6LE 5SX4H 2J8UB 2PKDA 2ZUVA 1OF2A 1OW0C 2VR9A 4O2EA 2E7CA 4Z7OE 3O2WH 1J88A 3VFPA 4XWOC 4ODTL 3NA4A 3TT1H 2Y1VA 4ZXBA 1VFBA 1Q9WA 4KGJA 4HK3N 5T1MA 4M00A 3BH8B 1M05A 3AB0B 5KZCD 3VXUA 3QIBC 5EO9A 2DL2A 2PN5A 1FVCB 2YD3A 3D87B 3RKDD 4YHOL 1DFBL 3VH8G 1TVDA 4LSUL 4S1RH 4HT1H 2R8SH 1U8KB 5GSRA 4NP4H 5K9QG 4RBPK 2YPLE 4GOSA 1UKSA 1XCTB 1ZLUK 3RVUD 1T3FB 3RIAK 4RFOH 2I27N 3RVTD 4EI5A 4F2MA 2ADFH 3U82B 2X44D 4LDOB 2FJFA 2JF1A 5DYOB 4S0TD 4Z95L 4ZFZB 1JNHA 4QRRA 2C3GA 3EO1A 3KPMA 4ZD3H 3QAZB 5D2NC 3EYOA 5CEZD 4IMLB 1KIQB 3KWWA 5IVOA 4XBGA 4RRPG 3GBNH 2VYRE 3LEYL 1Z9MA 3D3VE 3S98A 1IAOB 5E00A 5HYJA 4RBPH 4GRLB 4MJ4A 1UGNA 2P5WE 2R0KL 3PWLB 3QIWD 2VQ1B 5HI3C 5SWZE 4N1HB 2DAVA 4LGRB 3JUZA 1MQKL 1NAMH 4WWID 3LKRA 1HHJA 5T1KD 4PRHB 4FFWC 5BZDB 4OGAC 3RVXD 2CLRB 2BVEA 2UUDK 2CSPA 5EBWB 3SO5A 4LL9A 3IKCB 1FPTL 1SY6H 1K3ZA 5HYEA 3QISA 5B8CC 3Q3GA 4OGXL 4WW2A 2NZIA 3ZKXB 2VLLA 3V4UH 4XP9H 3O8XC 2ENYA 2EYRB 1E6OH 5T3XE 3OXRB 5E2TH 3BP5B 5EIQA 1UYWL 3LQMA 3KXFA 5HJ3A 1Z3GH 3GB7A 4V1DB 3MRFA 5TQ0L 1YNTB 5F21B 4FNLL 3UYPA 1YPZE 2G2RB 2Z31B 3QDMB 1ES0A 5FDYA 5J1SC 2EDQA 2GAZB 3GSXB 1NFDF 5EFIB 1UVQA 4YPJA 5AYUL 3KNBB 2OL3H 3GMLB 1LMKA 2W60A 1B4RA 1A22B 3QDGD 4YDVA 4I0PA 4M1GH 1YEFH 1G7IA 3BXNA 1EBPA 4XNZC 4OIIL 4S1DD 2R1WB 3QA3A 3C8KA 2NY5C 4Y1AA 1ZT4B 3NIDE 4PJAF 4BSVB 3KJ4C 3LKNA 3RVUC 3IFOA 4DKEH 4XCYB 3I75A 4IOIB 2MPAL 3MV7A 3I2CL 4NKQB 2BY2A 4M7ZC 5SX5H 3DIFB 4KK5D 1KULA 2FDBP 2VLRA 4GQ9H 1BOYA 3MOAL 3GSNB 3TBVA 1B4JL 1TCRB 1NCNA 4UV4L 3BIKB 5C9KA 3VWKA 5ALBH 1UYWH 3CSYB 1CZ8H 3S6CA 4WENB 4WFFE 2XZAH 4YC2B 2OYPA 1NCCH 1KCKA 1IEAB 1W0WB 1CXHA 2V5TA 4G42A 5IBTL 1UEYA 2EDYA 2EZ0D 2YXMA 1EVUA 1Q9OA 3DYOA 3T08A 2VTFA 3QUXB 3NZ8A 1IC1A 2I07A 3VCLB 5EIVA 5F6HJ 4RFNC 3T2PA 3ARBB 5BOPA 1KCRH 4W4OA 4ZPTB 3BD5A 3QWQB 1JYXA 5ISZD 2BFVL 3PWNA 4G7YH 4JZOA 5JZ7C 3O6FC 4OLXH 4U1NB 1QBAA 4KHTL 1PZ5A 3UJJL 2KQNA 3HZKA 1QO3B 4XGZB 2A74A 1XZ0B 2H26A 3FB7A 1KCVL 5HHME 1D5MB 2MCPL 1A6ZA 4O4YH 2DIJA 2H32B 3DUHA 3B4NA 2DLFL 4OF8A 1ETZB 2O61A 1ZHNA 1Y6NR 5GPRA 1CE1H 3BUTA 5I1AA 5L2JB 3QXVA 1KN4L 2H3NA 5I1GH 4RAUA 1G9NC 5F89A 5C92A 4YHPA 3SKJL 4WGVB 2GT9B 1IAII 5JR1H 3LQZA 1U95A 4OZIA 5ESQB 5CJXA 3GIVB 3G04B 1N0XH 5EC2A 3OB8A 3OKOB 1QR4A 3V8OA 5GGSY 1IFHH 1KTLA 4M1CD 1DLHB 4PYGA 5HHXH 3ZTNL 4QRSA 5EUKB 1B3JA 1UZ8B 4TN9A 4WFHD 3OR7B 4CN1A 4ZUUB 5ANME 4XCNA 3FL7A 1A3QA 4OCXL 2OSLA 3RTQD 3VXQA 3P9WB 5T3ZD 3GI9L 4Q9RH 3VWJD 3T0EB 4X99A 1U93A 5FM8A 5GGUB 2UUDH 1VGEH 1AQKL 1Y6KR 1F00I 2IPTL 5HI5D 1PYWB 2DLGA 2IBGA 2JK5B 5CGYD 4WI7A 1Z3GL 3WFBL 3SY0B 4S11A 3ZO0A 4EOWH 1DTUA 1RULL 3A67H 3MOQA 4Z8FH 3REWA 3QDJA 4PJ8D 4PY7A 2QQKH 1L7IL 3QQ4A 4YFDB 1MCPL 4EUPG 3EO0A 3ULUL 4LLYA 4NN6C 3WJJC 5E5UB 5CEZL 3ECBB 1X5FA 5HHNB 5LJYH 3QFDA 4G6JH 4MD0A 1PSKH 4QHLB 2EIBA 2OQJB 2VAAA 3MV7B 2VDMH 4KHXH 1HZHL 4WUKL 3DI3B 4HUUA 4WDIA 1F4WH 1QR1B 3T0DA 5HYQB 1OOAA 3NPZB 2PYFB 5HHQA 3B5HA 1OAZL 5EBGA 2XG5A 1EEYA 1HWGB 2R0KH 3MNVA 3OZ9L 4XMKH 4ALAL 1U3HA 3B3IA 3D0LB 4OSUH 3BMVA 3RL1A 4XP6L 5JDSA 2FX9L 3RQ3A 4HUXB 2CK0H 4OZHE 1RZGB 2DQFA 4XMLL 3V5HA 1WWAX 1JVKA 1MCJA 1SMOA 3B9KA 4XMPH 2R4RH 3IJHB 4JPKL 1QBLH 4N8PA 4RMUA 4XBPB 4LASL 4F7MA 4I48B 1JWUB 4ETQB 2RAMA 5FK9A 2AEPL 1H15A 4AM0A 5EU7E 4MAYA 1OGAE 3CLEH 1I1AA 4BFBD 3P4NA 1WBYA 2P7TA 5ADOL 3L5WA 1TETH 4GRWE 5CJ8A 3VXMA 2DWDB 2VC2H 4J8RB 4PJ9A 5CD3A 2CDGB 3O6MH 1DBJL 4P9MH 5JW4M 2VERN 3C6LC 4PB9H 4ORGB 5KOVC 1O7VA 3SDCC 1CGXA 1QTYT 4JFQA 2CXGA 3HPJA 2YRPA 2NLJB 3G08B 5E2JA 3PWVA 4PGCA 2X40A 5F8QC 2HRPL 2Z9TA 3QBTB 3ZSSA 2VWEC 2VQTA 3GIVA 4HSQA 4HZLB 5BV7C 1G9NH 4ZG1A 2CDEA 4H26A 5EU7C 3IDUA 5E00B 4HXBH 3RZCB 1ERNA 1MCBA 2J3SA 5AAMA 5IBLC 4F7EB 4Z0XB 1ZLVK 2OXGA 4YO0A 3NPSC 3WMSA 1U8JA 4JPVH 3QEUB 1FO0B 5C0EB 3UBXA 2NXYB 3FTGA 5IHLB 4GAYB 3BRGC 1NKOA 2J88H 3EJZD 3U0WH 4UINH 1ITCA 4O5LL 1CWVA 1XF5A 1K2DA 3KPTA 3X12B 3P0YH 2PO6C 4WI2A 2DKUA 4KZEH 5JW5B 2HMID 3EYSH 2ESVE 2GFBA 2NZ9D 2HLFC 2HJLB 1WC7B 1IGJB 2HP4A 4M3JA 4QF1B 5KSVA 4NJAH 3EO0B 2RQ8A 4JREC 1AHWC 2LU4A 2B0SH 1JF1B 4PLKC 4HJJL 4BUHA 4PG9B 4OT1H 3PWLA 2ICWI 4Q9QH 1T7ZA 3K0WA 4U1SA 2J5LB 3TA3D 5J6GB 1VEOA 4QHKJ 4CW1B 3FB5B 4P5KA 5F7HA 5EORH 1RSFA 3SJVA 3P4MB 1A7RL 6FABL 2C4FT 4EI6A 4EN3C 4M9PA 3IVKB 4PRNB 4MWFA 5DA4A 5A1AA 4FZ8H 1JUFB 5DRWB 2NY1B 3QPXH 5IB5B 3QUZD 1U42A 4P23A 3CFJB 1C12A 5GGRB 5MERB 5EU6D 5H94B 2HRPH 2F53A 3WNKA 4KDTC 4NRXB 4P2OA 4RWYH 2J4WL 4U6VL 1NBVL 1SYVB 4S0SD 1Q72L 1ZXQA 3SDCA 2DIBA 1I4FB 4F9LC 1MJ8H 3NABH 3BIBX 4Q0XL 3O4LB 2AJZA 3WE6A 1VGKA 2QEJA 5C08A 4BZ1H 1HKLL 2FHFA 4OFDA 4MDJA 4MJ6B 3FN0H 4OLUH 1FYTE 5LGJA 2RCSL 4PJ9B 5IHUH 2GUOA 1E4XI 3BH9A 5CBAB 4Y1AB 3ZZ1A 2B1HL 3MV7E 4OIBA 3KYMB 2Z0BA 4QRUB 2Q3ZA 1BLNA 3HE6A 2NTFA 3WL9B 4WWKA 4LLQA 2Z93B 4ODVL 5EWIH 2MKWA 2ZOKB 3LCYA 3QB7C 5ALCH 3QIBD 2PXYD 3MUJA 1ZLUH 1ZKAA 4X98B 4DW2L 4O02L 2ARJB 2FWOA 4FHBD 4GAGL 5I74C 4LCUB 5IOPA 2IPUK 2A0LD 1DQJA 1J8HE 1I8IA 3C08H 1LE5A 4PRAB 4NC2B 2DQJH 3VI3E 5B8CA 1KB9K 2L7UA 1MJ7H 4UILH 4AQOA 2CUIA 2Z35B 3BZDA 3HB3C 4N8CL 5IIEB 4PB0L 4HGKC 3NCEB 2EDLA 3KPLB 3MJ8B 3QH3A 2EXWC 1MRFH 2AK1L 4UAOC 4PJBB 2OX5A 3BGMA 4P2OD 1OTUC 2GK2A 5DFVD 4Q9QL 5F7DB 3HG1B 4LEOB 4E0RB 3SE3A 1JGEB 3MLUH 1OP5K 1F58L 2VXTH 3PQYD 5F6IB 1NC2B 4HPOL 4QXGH 1IGJA 1D5BA 4J3OC 2P8LA 5DHXB 3U48A 2XKUA 4LARL 2XWBB 3I75B 4IOIA 2B1AH 1CXEA 4XVTL 1RZIB 4P4KA 4FRWA 5ENWB 1RZ8A 1OAUH 3WIIH 4HD9A 2Y07L 1FFNB 2CKNA 4Y5VC 3NCJH 2YHGA 1NGPL 1UM6H 2RGSA 2F53E 32C2B 3VXOB 5SWZA 5JXAL 4QY8A 5EOCL 5EO9B 3I50H 2ADGA 3SPVA 1CF8L 2YPVH 2EIDA 1PKQA 3FQWA 2L0DA 2BY0A 4KQ3H 5FA4A 3UCRA 4F9LA 3MUGA 3BW9B 3VXUD 3SGEH 3N9GH 3EFFB 3MRQA 4L4VB 1QBML 3NFNB 2CJUL 3VGGA 1JNNL 4ZOEA 1R6VA 1T3FA 1PLGL 4GW1A 5E0QA 1N0XL 1LO5A 4KJPC 4K3JL 5C07D 3UYRH 3UO1H 4F33B 3WFCL 4Z7VE 5DVNA 2VDOL 1SJEB 4H8WC 1KN4H 3O9WC 2KDGA 5EU6E 4K9EL 2I9TB 3ILPB 4WI6A 1FAIH 3B2UD 2VDLL 4O4YL 1X4ZA 2E27H 3T4YB 3U1SH 1SEBB 2BX5A 5D1XD 3MCKB 1F2XK 1A6TB 1UH4A 4X6FA 1KLGA 2DBLL 3UJIL 4G9FA 4RGMC 1SVZA 3FQNA 1TQCC 2F58H 4LGPB 3S88L 1KB5H 1IQDB 1SYSA 3P9MA 4PJCE 2AJXL 3IJYB 1JPFA 1MHCB 3KLAA 4HKXB 5KSAB 1AQDB 3BP6B 1RVFH 1KBGH 1TQBB 1RFDH 1XR9A 1G0DA 5LXGH 1JNLH 1QVOA 2RBLA 3WUWA 4MQXD 4X0KB 1CFTB 1XGRA 5IUSA 4QHUB 5DJYA 1VEMA 5EZJB 2C3VA 2AK4B 1KB5L 4PTTA 4LGSB 1SHMA 1ND0A 2C1PB 4GLRI 1RIHL 2QHRL 3VWJB 2FIRT 4TOYH 1U3HB 3B3IB 1TQBC 3VFTA 2Z35A 4YLQT 3C8DA 5HVFB 1J1XL 3HRZA 4BSJA 1KJMB 5CKAA 4LLVB 1INEH 1LK2A 2P1YA 1JZ3A 3U46A 4NO2B 3MOAH 3JWNC 1EGJL 5DVMA 1OP3K 4G7VL 2VJXA 5K93A 3LVEA 4YXKL 3GSXA 4ZFGL 4NN5B 4QXUL 4L8DA 2DB8A 2JJVA 3QIUB 4B0MM 2NY6C 4AEHH 1N6QH 3VG0H 1CE6B 2NY3B 2X7LB 5DD0H 2X4QB 4K8RH 4YDLC 2WIIB 4TUJA 2M2DA 3H9SB 4Y4KD 3ARFC 1MNUH 1WCBA 1P4BH 3U4BH 1JTPA 1NUGA 3MOBH 4BH7B 2YZ1A 3QA3B 3NOIA 3RGVB 4WFED 1AGEB 1FZOB 2Y5TA 3ROOB 4DUVA 4H8WH 3KGRA 4LP5A 4NN5C 4WNQA 5HGGS 4LIQE 1I3RB 5AYUH 3BEWA 5E2VH 5TDNA 3O45B 5E08H 5CP3H 3BJLA 4JJHA 5JHDB 1HINH 5DI8B 2BVUA 3OAZH 3VDBA 1A21A 1JHKH 3BWAA 4WU7B 4KQ4L 5EZOH 3SPVB 5EBMB 3OPZL 5D1XA 1E28B 3PP3H 5DJ2B 3B2UC 5DQDL 3CZJA 4ZSOB 3LIZL 2BK8A 1HEZA 1VFAA 3ARZA 3PGFL 1QEWB 1CGUA 1ZA3A 3QG7H 4QRPB 1S9KC 1WUNT 1R3JB 3HAEA 1DBBH 2LTQB 3DPBA 4TNVF 3F7VA 3F6IA 2ITCB 2N4IA 4PGBA 3VG0L 5IKCA 3UTSE 1J05B 5CGYC 3BD4A 2VLME 5C0EA 1KLUA 4QGYA 1MAKA 4CW1A 4NFDA 2FIKA 3PWNB 4MCZB 4URTB 1YNKH 1D3CA 5ERWA 3EHBC 3DLQR 5E2UL 1YEDA 4OFKA 4UILL 4R90L 3X12A 3QUXD 4XWGL 2LTQC 2H26B 5E8NA 5I15H 4Y4FC 2NMSA 1Q9LA 3LEYH 1YMHB 1CDHA 2VMFA 3BISA 4X6DF 1LILA 3G5ZA 3N1PC 4IRJD 3H9HA 4I0KA 5I1DB 3PWVB 4BQBA 4ZS7L 2Q6WA 3HE6C 1D7FA 1R5WB 5DDHA 1JE6A 1JCKA 2GJJA 4RQQB 5DMYA 1MJJB 4Y5XB 1UKQA 5JW3H 4Y4FB 3BN9C 4JFEA 3DOSA 1ZMYA 1HH6A 1VPOL 3GBMH 4FP8H 4HJ0C 3CXHK 3KPNB 3V0WH 3PQYA 4OQTH 1ZT4A 4LCCC 4Z78B 2UWEF 4PRNA 4OZGE 4GKOA 3S37L 1J7VR 1A6VH 5CBAA 1J5OH 1FAIL 5GSVA 2LAAA 5J11C 2FBOJ 4K9EH 3N1FC 3QZWG 5DJ0B 3RX8A 1XF1A 4CU8A 1Q1JL 3MRFB 1KIRA 1IC5L 5TPWL 1C12B 4JO3L 2OJEA 5B22A 2DWEB 4O51B 1VA9A 3ABZA 2P5ED 1UB5B 4L4TB 3QO0B 1EAPB 1PLGH 5F1OB 1JNNH 2CJUH 4G9FD 5J6HA 2BJML 4YX2L 5IK3A 1MHPL 1KCSH 1IRAY 1VADB 1ADQL 1CI5A 1YEFL 1SJXA 3FAXA 4RAVA 2IC2A 5DT1H 5DJCB 4AMKH 4M6OH 4PGDA 5EC1B 1Z9SA 3QNYB 4UOW1 4HAFA 1U8HB 3MRIB 5I8EB 4HC1H 3DXAB 1XR8A 2Y7QA 1I3VA 4G3YH 1AXSB 1LP9F 1R3LA 5IVXE 1WAAE 3D1MC 3AMLA 4LCYA 5HGHA 3LSOA 3W0WB 3Q5YA 3GSRA 1RUPH 2MTPA 1FBIH 1S8DA 2HRLA 3F7PC 2IAMC 1I8MB 3CFIC 3G5XB 5FM5O 2B0SL 2B4CC 2BOCA 5IBLD 1MFEH 3SE8L 1LE5B 1FNLA 2AGJL 2H2PD 1A5FL 1J0JA 4FFVD 5IJKC 5IKCB 2A9NH 1FBIL 4O5LH 4RDQG 1NCAH 4JY5L 2FIKB 3FQRA 3QRGL 5KSBE 1H5BB 4XXCA 1D9KD 4JHZA 5CD5C 4LAJH 4GBXA 1I1AB 3QXTA 4RSVA 2APXA 2HMIC 2F5AH 2XRAH 4HIJA 4M6OL 4P5TB 4YNYB 1I85C 3KPRE 2VITB 4LLMA 5CLTA 3MQIA 1NUDA 2AVGA 2F54E 1T1WB 4M7KL 3NGBC 4G6FB 2QSCH 4HPYH 4HQQH 2E7BA 3EDFA 5ICXB 2Q87A 5EA0L 4DW2H 4KAQL 3GKZA 5IVNA 4ZO8A 4EUPB 2ZUWA 5DVOA 4F15C 2R1YA 2V17L 2CH8A 5ISZA 2WWMC 3QULB 5JW4N 3AROA 1FO0H 2D9QB 4HGWB 4QOKA 3PQYB 1G6RL 4ESKA 3GHEL 5DK0B 1EHXA 3VMNA 2ICWB 3IDYC 3H8NA 2A0LC 1FL3A 5IIEA 1AO7D 2AKRA 2ICCA 2JCCB 2MFNA 4JDZB 5F7WC 1ZS8A 2V17H 5JIKA 1XR9B 3IU4H 1KGCE 5IFHH 1LO3L 5L2KE 3QEQD 4AQ1B 3UTSB 4NOBA 2DQIL 4TVPE 4U6VH 3SDDB 1FL5A 4PJAA 5BXFA 3VCLA 3TT1L 2ZJSH 2DYPA 2AQ1A 3LQAH 4FXKA 4NT6B 5SWSD 4ETYA 3TCXA 3TJEL 1G7QA 5CWSA 1KACB 3ZKSD 1R3IH 5D71L 3D0LA 5DJZB 1UCBL 5E8PB 4DOHE 1IGYA 2EDDA 4GW5B 5JOFB 4ZOAA 3RHWF 1JF6A 3CX5J 1F8TL 1T66C 2D7TL 4AIXA 4PJ5D 4U0RB 2BY3A 2X9YA 1NJ9B 1ACZA 1FRGH 1CD1A 4U1KA 3VRIB 4D3CH 3G6JF 2F5BL 4WUKH 1I7UB 4U1IA 3OGCB 1KEML 2ZPKH 4IIQA 3DV4A 2KUTA 3I6KB 3HR5A 4OD3L 3BKCL 2CKBA 3SQOL 4OD2B 5EPMA 4ZFOB 4WEUD 4XCFL 5CZVH 2ITDA 1PKQE 1KENH 1WBZB 3LKOA 1DJSA 2H6PA 5C09E 1P2CA 3V52H 1EBAA 1OAXH 4F57H 2FATL 4AIZA 2HWZH 1QD0A 3MLZH 3CFEB 4ELMF 3CDFA 4RX4A 5IFAH 1BZ7B 1RUML 2A6IA 2D7QA 3CFBB 3WNPA 3U79A 4XNZB 4LLWA 5A3ID 5C6TL 1X44A 2C7UA 5GRUH 3VXQB 2GYSA 2VE6A 4KZDH 2ED8A 4X99B 4PR5B 4Q7DA 1TVBA 2FLRT 5EZLB 5A2JH 1TLKA 5FOBB 5KTEH 1HIMH 1XF4A 3KJ4B 1OSPH 3SDAD 2CRYA 3AREB 1KJ2H 3T3PF 4MDJB 4L8SA 5GS3A 3GM8A 4KGLA 4KY1H 5DHVB 2LQRA 2P7TB 3OKYA 4F7EA 4YHIB 1E4KA 4UT9L 4K94H 1UXWA 4E41E 4TTDC 4WEBH 5E8DH 1S7RB 5HDOA 3MCG1 3UC0H 3I3DA 3MRDB 3RFZC 5HYJD 2WP3T 3MV9E 3A6OA 4PJEA 1ZHBA 4JFPA 1B6DA 1OB1B 3F8UB 3KYOB 2NLJA 1S7WB 4DKFL 5EC2B 4GRLD 4QRRD 1MI5A 5I76A 3ETBF 3LEXA 2DJ4A 2NNAA 2V2TA 2ENSA 1NCAL 4JY5H 3NCYP 3T3ME 1DQJB 1NSNL 4O9HH 4HCRA 5D1QA 2ZUTA 4XGZA 3RY6A 1IBGL 5JUEH 1TETL 2D03L 1ZGLP 4LBEB 4KDVA 2R4SH 3TBWB 4I5BA 2EEBA 3BPNC 1FFQA 2V7NA 4TULH 5T33H 3O9WD 2FJHA 1QOKA 4RQQA 4F7PB 1FFRA 2KZWA 1MCQA 4HF5H 3VFGH 4JFDB 4MNHA 1ORSA 5IJVB 3TGXA 4PPTA 4P5KB 1PQZA 3S4SB 1G7QB 1FYTA 4OB5L 1BF2A 2Q76B 3PIQB 1FYHB 4OJFL 3U7YL 2Q86A 3ROLA 3VA2C 4X8JB 1SMAA 1HSAB 1P4LA 3QCVL 4QWWD 5KS9F 1YYML 1WFUA 1QRND 4NFBA 5IG7A 3FFCD 2DBLH 2VR4A 4PRID 2PUQT 4OIAA 3RY6C 2GFBB 1CGTA 5IT2H 4QRPD 1LE9B 3ZHKA 3TN0A 4Z5RA 3BT2H 2APWA 3UJTL 3W39A 3GSUB 3R06B 4YIQA 4F7CA 3A6BL 4MVBD 1JRHI 3HG1D 5DJ6B 1S78D 1X9QA 4G43A 4XHJC 3ULUF 4QT5B 3E6FA 1K3IA 1G84A 1FNEA 2AJ3A 1FSKC 1Q1JH 3MRRA 4J3XA 1R0AL 1BAFH 3D5OF 4BUGA 4OM0H 3BEVA 3HKFA 5C0NC 4M7JL 4HKZB 2IJ0C 5HI3D 1OARH 2YR3A 4ODUB 3GUTB 2P8PB 3L7EB 4CGTA 4GAJL 1IGTB 1RIUH 4HG4K 3VMOA 2VZ1A 3W9EB 2DQCL 3DUUA 3CFJA 3FT3A 5GGRA 3MRGB 4Z77B 4LCYB 4ODSL 2EO1A 1BFTA 9CGTA 2DQEH 4Y4KC 1V8HA 4U6YA 5F9DC 2H8PB 4PRBB 2I60H 4XNMB 1NFIB 1CG9B 3O8XD 5D1ZD 3EOTL 3EAKA 5MHSE 1R5VA 4PS4L 1N64H 2ADJB 1EO7A 4B5EA 1KEGL 2UY7A 1IQWL 2R29H 4X5XB 4JQVA 2NXZB 4MAYC 2VLRD 5E5MB 2VXUL 1TTUA 3EYFB 1S5HA 3O11A 3SDXA 5C0CD 2EZ0C 2P5WD 4JKPH 1E4JA 1MCDA 1IGCH 4AEHL 1N6QL 1KFAH 3QNYA 4MD5A 4PJ7B 1GOHA 3FQUB 3BI9X 3KYOA 1CLCA 4QCIA 5KVDH 4MLIA 4FTVB 1MLCB 1YNKL 2D4DA 3QUYA 3AY4C 4PLJC 3G6AA 1P5UA 4QHMA 4PJFE 4R3SB 5T3ZH 3SGJA 5HGHB 5BMFH 3DTXB 3QDGA 1MJ7L 1DBAL 2VKWA 3PWJB 1Q38A 4X4XA 4XB8A 3GMQB 3IDNA 5BW7A 4I5BB 4GBXC 3BP7A 2VH5L 1NEZG 4PRPE 2R0ZL 2GIYA 3CFKB 1A6AA 2XZCH 3GNML 3TF7C 1A4JB 1QLRA 3MGTB 3HI1A 1U8QB 1QACA 1N3NA 1ZWIA 1PKQB 1CGYA 4UDUA 3S34L 4UIKH 3H9ZA 4W6YB 15C8L 5D7SH 1GC1L 2Z4QA 4ONHA 3CLFH 3MRCB 2EE6A 3I3BA 4J23A 2DM2A 1PG7H 1Y18B 3ARUA 3O8XA 1ZGLB 3F12B 4LVOC 4XPHL 4X9HA 2HKHL 3RZCA 4FG6C 3UTTE 5C0ND 5F88B 2RCSH 5FHBH 5FGRA 4YXHH 3V7AE 3WS3A 1U41A 5DD6B 1AC6A 1FC2D 1ZEAL 3WV0A 3UTSA 4UV4H 3JBG7 3NA9L 3VG9C 5DMKA 4IOSD 5ICXA 2IMNA 4X9FA 4RAHA 1RJYB 5C6PB 5D7IF 5DSCA 3W11C 1D9KB 4GKSB 4POZD 3TJHC 4XP4H 4IMKC 4K71B 2QV2A 4H88H 1BVKB 1KG0B 1MCWM 5E8DL 2YPKA 5B3NA 2WBKA 1CICD 5BRZB 1BQLH 1P53A 5CKGA 1WCBB 5BS0D 1M1SA 5HVWA 2E8YA 4UT7L 5FYJU 2F53B 5F9WB 5HGBA 1Q9OB 4LCWB 4XZUA 4Y2OA 3UDWC 4U1KB 3K2UH 5C0BE 4OZHA 4E5XA 4K71C 3JVGC 3W2DH 3MFFA 4F3FA 5D2NE 4UOJA 1VGKB 1A7PL 3AXLA 4LVNB 3O45A 5HGDB 4JG1H 5DURB 2IGFH 2J5LC 1A3RL 3MYZA 3VD4A 1A02N 2GHWB 1DEDA 4H5SA 5F9WC 5K9KA 3MLZL 4UQ2B 1R5VB 4DN4L 1J1PL 1OAXL 4N1EA 4JO2L 1OF2B 2X42A 2X4SA 5FDWB 2NY5H 2W59A 4JRXE 5IROA 3S9DB 2VXTL 1BLNB 3WL9A 5MHSD 4JM4H 3BKYL 5FYKU 1YDPA 4PP2A 4S2SA 2GJZB 5IBUG 4AEIL 2CMRL 5L2KB 1CFVH 1JPFB 1MHCA 4Z7VF 1X7QB 2XZQL 3C5JB 5K9OB 4WGWB 5I73C 4QOKB 3WKML 1KJ2B 4PJFA 1P84K 3G6JE 1RPQA 3EYVB 3OJ2C 4QY8B 1U8KA 3PP3K 3K1DA 1QRKA 3QEQB 4NPYA 3ULUD 1NAMB 1TIUA 4PJDB 3ZDZF 4JG0H 3H2WA 4ZUWB 1MI5D 2XTJB 2ZCLL 2AS5M 2P43B 5C3LD 3QHTC 3N9GL 3IXAA 3RX7A 3KPSE 5I73B 5ESAB 3D39E 4FXKB 3V0VB 5JQ6L 4QRRE 3CGTA 3LQAL 2V6HA 3CDYA 1G7PA 1U93B 5K33A 1KTDA 3DHMA 3ARBD 4HFUH 4QHKI 3BHBB 3RA7H 4HHAA 3MBXL 3H42L 1V3JA 2X7LA 1I7TB 4FQXD 1KLFA 5DD3H 4D0CB 4TUJB 1EZVX 1VFAB 5J1AB 4M8VA 1HH6B 3BP4A 1NAKH 4XNUH 4Z76A 2VXQH 3MNZA 3K3QA 4P2QB 4R8WH 4F57L 3NVQA 4JHWL 5ADOH 4S1QH 4HPOH 4QXGL 2O5ZL 4LLYB 4JLRB 2P5EB 2CLRA 4X4MA 5A40E 5CJQL 4NYLA 1NQBA 4R0LA 5TDNB 1JTTA 5J1TC 4PRHE 3SQOH 1JZ5A 1TNNA 4XPGL 2R4RL 4JPKH 5C0FA 3C5SB 3RRQA 5BRZE 4ZSOE 1DL7L 3IJSB 3O81A 3PWPB 4OUUB 3JWOL 3G5XA 1CLZH 4MD4A 1INDH 5GJSH 3VRJA 2CKBL 4MJIA 3CSPA 3LY6A 5E99L 3OKEA 4MX7A 2PW2B 1GH7A 4U1HB