4XNUH

X-ray structure of drosophila dopamine transporter in complex with nisoxetine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
216
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of Drosophila dopamine transporter in complex with nisoxetine and reboxetine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Integral membrane protein-dopamine transporter
total genus 43
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnuH01
3P2TA 5CEYB 5E5RB 5E8PA 4G42B 4AIOA 1AY1H 5JZ7C 3GKZA 3QDGB 3GKWH 2B1HH 3HI6L 1J88A 1F13A 5KSVB 1T2QH 4R0LC 2XN9A 1T1YA 5DJ8B 5K59F 2CJUH 2R1YA 4P4KB 4GW4B 5DC4B 1LP9A 3RDTB 3PWPB 5D5ME 3S35H 3O6KL 2AQ2A 3DX6B 1RZIA 4XTRC 3W82A 1F4AA 4OCYH 3PL6B 5DJDB 3C5JB 3HMWH 4PLJD 1X6NA 3GMRB 4AH2B 4LQ1A 4YGVA 5CJQL 2Q87A 1BD2E 4LKCB 4POUB 1K6QH 1QOKA 1RZ7L 3MV7E 4LLUA 4P3DB 1YPZF 1GHFH 1RIHH 3CVIH 3ZDXF 1VADB 1IC5H 4RCAA 4O2EA 3N0PB 5GISL 3IS0X 5CGYD 2H26B 3IJYB 1S7QB 2AXHA 1ZLWH 3R06B 1C08B 2WUBL 4PJ5A 1JMZA 1EXUB 4BZ2L 4AL8L 3VG9B 3EJYD 5MEQA 3A6BH 4PRPE 1KJMA 1F4XH 5K9QG 4I5BB 3NIGE 5FGBC 5E9DA 2E7LC 2R56L 3HNSH 1KG0A 3LV3B 2PYFA 1X7QB 3CCHA 1CT8A 4XH2B 4DN4H 3ALWA 3MYJB 1T5XA 5IJVA 1B0RB 2AEQH 2LAAA 4P2YA 5EIIA 3RZWA 5D6CB 3O45A 1EGJL 5C8JB 2XOTA 3ARGC 4E42B 2XKSA 4LHUB 4AMKH 1B0WA 2P5WD 2VLLB 1ADQH 1EEUA 4YX2L 5ADPH 3DETD 1CFSB 4DK3A 1FE8L 2LTQC 3NPSB 1YECH 3MJ8A 2DBJA 2PR4L 3DSNA 4M4RA 2CSPA 2A6IA 4C56E 3TIEA 1H3XA 3N1FC 2EH7H 4L3CB 1E4KA 4MNQD 3RIFK 3B8SA 4WUUE 4LPTA 1GJIA 2IALA 4XCYB 5DQDH 4NNYB 1K85A 1P9MA 5I8EA 5IHBA 1YEDB 1Z0NA 4OF5A 1FZKB 4FZEH 1J0JA 3B3IA 5JHDD 3U4BL 3TA3D 4QCIA 3WXWL 5IFHL 2QQKH 1HNGA 4IDJH 3GHBH 2QQLH 1WAAA 4H20H 4J6RL 5EORH 3BESR 3U9UA 2FX9L 3QWOB 15C8H 4R97B 1R5VB 4HC1L 1JRHI 4K3EH 4ZAKB 3QBTB 3QUKB 1UH3A 4XI5D 4FZ8L 3QXAB 5BZDB 1CICC 4P49A 4Z77A 3QG6A 4LP5A 5FA3A 1CBVH 4GAGL 3ROOA 3SE8H 3DO7A 3F12A 3Q2CA 4WW1A 4PREB 2OL3A 2AGJH 5HHQA 5HGAA 1A6ZA 1YJDH 2F5BH 2FZ3A 1CK0H 2HKFL 3HE6B 4PV9B 1OP3H 1ND0A 5BS0A 1S3KH 4YFLI 2IAMD 1VACB 3FB8A 1MY5A 3TWCL 1U2CA 5J6GB 1G7MA 1HINL 2C4XA 5KW9H 5JW4R 5D1XD 3TA3C 3MRDA 2UWEF 4IRZL 3PWNB 5F1IB 4NKIL 4E41D 2PO6C 2O5ZH 4HS3A 3MUGB 4FQCL 1YPZE 4JKPH 4KC3B 4ZYKB 1EFXB 5C0FA 3L3DA 3D0LA 1XF3A 1TJHL 5H35B 3SBWA 3V5HA 1JGVL 4CVXA 4XZUB 4DUVA 5MEPB 3KLDA 3RA7H 2XACC 3RBSA 2YC1B 2Y36H 1AXTL 1ZHKA 5FB8B 1DE4A 4M1DH 3CLFH 1UA6H 4JHWH 3V0VA 3QNYB 3IFNH 2XTJB 3KPNA 4LCUB 4W6XB 1YEEH 3L5WA 1PYWA 4NFBA 3SCMC 2HT3D 2V5YA 3UO1H 5HHNB 2CUIA 3C60B 1PW3A 3OXRB 4WFFD 4Y2OA 2NY5C 2X4TA 1BBDH 4LLVA 4HGKC 1LK2A 5D2LB 1V5JA 3V52L 4K2UH 4Q6YA 4KZDH 4NN6B 1YMMB 1LNUA 2R0ZH 4FQHB 1CLCA 3OG6B 1Z3GL 5BJTB 3V0VB 3R1GL 5A16B 4I4WB 4ODTH 2BOCB 4GQ9L 2W91A 2VO5A 1U8IA 5IB5A 1MIMH 1I3RA 2B4CC 5F7YC 3PGFL 3WFHB 3SDXE 5ERWB 1NJ9B 1OT1A 2VC2L 5EU4A 1D5MB 4ZUSA 2JJVA 5DK0B 1KENL 5GGRY 4KQ3L 2VITB 3F7YA 3I6GA 2AXGB 5I71C 1DUYB 5EA0H 4I2XE 3TEUA 3MGTA 2I07B 4UAOB 1IQDA 4NRXB 3BN9C 5IG7B 1RD6A 2AJYL 2VLJE 1MJ7L 1FYTA 1JF1B 5EU6D 3MCLL 4MNHA 4MXQC 2UYLB 5F89B 4HFUH 1KN2H 5B8CB 1T7XA 2X1WL 3ILPA 4YHYB 4X99B 1QSFB 4MHHI 2GSIB 5ALBH 5AAWA 3PWVB 2YPLD 2EYRA 2Q7YA 4S1SH 3SDAB 1T2JA 5DGRA 4MZ3A 1VKXA 1RUPL 4BQ8A 1BVKA 1WQVT 3ROOB 3RVXC 3TT3L 1U8JA 4U1NB 5CEZH 3T0XA 4RAUA 1OSZB 2AV7B 1KJ3L 3BUYB 2QSVA 4A2LA 4XC1L 3D1MC 4PJFF 5FUCE 1JHKH 5I75B 4P2RA 3MLUL 1VCAA 3ULUH 2GIYA 1Y6NR 1NBZA 1QP1A 3U9UB 4K3HA 2J8UE 4U7KA 4RAHA 2BCKB 2XZAL 3VXSD 3CDYA 3WS3A 3W9EA 3MLTB 1WEJH 2XA8L 1AJ7H 3B3IB 3JXAA 3MACL 4WEBL 5KVFL 3RWEB 1KJVB 2W92A 1IL1B 5JXAH 3SDCB 1QBLL 1NCWL 1I9JL 5IT2L 1EVUA 1U0QA 2QTEA 3WFZA 1IM3B 1Q38A 1DQDL 3AREB 5E9DE 2OZ4H 2QKIA 4JN1H 3QHZL 1P4LB 3LPGA 3T2PA 3NTCL 5DJ6A 1IILE 1MRCH 4LSSH 1HHIA 4OLYL 4Q6IC 5E7FA 4HPOH 4AG4H 4I0PD 2W0LA 3BH9B 4LHUA 1HN1A 4GBXB 2HRPL 4Y88A 4YDVB 1LK3L 3VWJC 2BVPB 5ACZA 3HC0B 4Y8DC 1CT8B 4OLUH 2VSDA 5F3HB 2V2TA 3BKMH 1KG0B 5EBLA 2NY2C 3V7MA 3NFSL 5E9DB 3ZYOA 3KLAA 5CILH 4LAQH 5JW3H 4BQ9A 5GRYA 5DC9B 4Q9CA 4MB3A 1KELL 3S35L 2H26A 3O6KH 3GJEB 3VCLA 5AYUL 3BQUC 1MELA 4HGWB 5C0CA 5C6WH 2DQDL 4X4XB 3DVGA 4WTWA 5CLWA 2JK5A 2JELL 3HMXA 1I1AB 1FFPB 3PIQA 2YZ1A 2NNAB 4R96A 4GLRH 4BK5A 4P9MH 4F37K 3KLHC 1IM3A 1T66C 2PNDA 1KGCD 3QULB 2MPAL 2BDNH 3OWEA 2ZSWB 2XV6B 2HT2C 3BKYL 4WI9A 1CQKA 3BIKB 1JHLH 3OX8A 5FUCC 2G5RA 1FQ9C 3DX6A 2GITB 4JEGB 3KWWA 4X7TA 3KYOA 5GISH 5I17A 1JZ7A 1OSPL 3ARGD 4BZ2H 4LCWD 1T1YB 4AL8H 2VDLH 2YPLE 4XBPA 3AB0B 4DN3H 4ISVA 3ZTNL 3UTQB 1ZLUK 4G8IB 2R1XB 3VFVA 3BZEB 4Y4FB 1UEMA 1NMCC 1UM4H 2LU7A 2NX5E 1NBZB 1XR9A 2IBBA 3MNVB 3P4MB 2OXGA 2FECI 4CN1A 3MO1B 5D70L 5TDOB 2B39A 2B20A 3VXSE 2OK0L 1ADQL 2NXYB 2Y6SC 4YX2H 5ADPL 1ZAGA 2EZ0C 1FNLA 4R4BB 2Z4QB 4U6HB 2KH2B 2EKSB 3SKMB 3JWDL 1M7IB 1SMOA 3ESUF 5KOMC 3H7BA 3I3DA 4EBQH 1P2CB 4GAYA 5J11C 5D8JH 1JTOA 1JK8A 4RMTA 3KR3H 1FO0A 3JV4B 3B2UD 3VGAC 1U8OB 4M03A 2MOVA 2XFXA 5GZOD 4JFYA 2HKHL 1FYHB 5C0IA 4KRNA 4B7LA 4AZ8A 2YK1H 1OAQL 1D3CA 1DUYA 4BSWA 1OB1B 3KGRA 4ORZC 4UDTA 3BPOB 4N1CA 2X7LB 4NQCE 5TFSH 1F6LL 3LRGA 1Q72L 2HFEA 4GMSL 2PXYD 3SGEI 4H8WL 5ERWA 1IAIM 3GIZH 3IRZA 3S3PA 1M4KA 4ONGH 1QFWM 1U8IB 5EO1B 1BZ7B 4XNYL 3CAFA 4PJHB 1F4HA 5CUSH 3MOAL 3P0GB 3QAZC 4LSQL 4UIMB 4Q74A 4IMLB 2DYPB 2X4OA 5TE4L 3PV7A 1DVFA 1Y6MR 2E3VA 4S1RH 3WJJA 2H32H 4KI5E 4PRID 1CD1B 4RA3A 5D1ZB 3R8BB 2AJ3A 3T0BA 1AD0A 4XVSH 1HH6A 4NGHH 2YR3A 2E27L 3B9VA 4JRYD 4NYLA 5C9KA 5HI3D 4GBXD 5IEHB 1AXSA 5DVKA 4GXVL 4ORGA 1P5VA 2ATKA 5L2KB 5EIQA 1AQKH 4WJ5A 2VZSA 4HCRA 2LV4A 3FO1A 4NKIH 5M94B 1F11B 1KTDB 3DVIA 4JKKA 3G5XB 4LEOB 4A6YB 5HD8D 3FN0H 4GS7C 1BFVH 4XCFL 2VLMD 3MJ9H 3DIFB 2BVTA 2AKRA 3HR5B 2DLFL 1RZ8A 4YHYC 5FYJL 2R8SH 4ZYKA 3LEVL 2NXZC 3DGCR 1JPTH 3QCUH 4B41A 2WM0A 4L4VB 5SWZA 4HIXL 2G5BA 4OGYL 1D6VL 3WFCL 1FNAA 2GJ6D 4RISH 5CWSB 4PV9A 1CIDA 1I1FB 4W4OC 1RZJL 3SKOA 1YC7A 3CDGB 4XHQA 4QRQA 4NO5B 5F6IB 1P53A 4WI4A 3F12B 4JDTH 5F7WC 1VPOL 4HK3N 4PR5B 4U1SB 5IWLA 3QEUB 4OZGF 4QKXB 5IMOB 5BZDA 4FRWA 1BZQK 1FC1A 1QBMH 4FQ2H 3KPRD 2PCPB 5I1KH 4GQ9H 5HSFA 5C3LD 3QWOA 4JJ5A 4AQOA 1HHJA 5DURD 4ZFZA 2YD5A 1A8JH 3HZYA 4QHKJ 5F7HA 1A14H 3PGFH 1BD2A 1QSFD 3NIDE 1NFIA 1ZHBB 2CD0A 3DOSA 3PQYE 1RJYB 4V1DD 1H15A 4WWKC 3DRQB 4KQ3H 4WFGE 4XBGA 1E4WH 3G6JA 4JDVB 3BFOA 2L0DA 4XX1E 5EU3B 4LSTL 2VQTA 1EA9C 4NHUB 5I9QC 3FAWA 5KSBB 1TZGL 4YNYA 4C4KO 4GKNB 4YXHL 3AC0A 4DZBA 3U48A 4HG4J 5BZWA 1NAKL 2X4QB 3THML 2BERA 4Y5YB 3ZE0E 3PP3H 4LU5H 1FL3B 1KTRL 4B7IA 3QEGL 2H6PA 2GFBB 1I4FA 3QP3A 5E8NB 5GGSB 4XVJL 1ZWIA 1P1ZB 4D0CA 1I3GL 4G3YL 2LTQB 1H5BB 4F8QA 5I16B 4I77L 1NGPL 5T5FH 3EZJB 4Y4KD 5D6CA 3E6HB 5DDHA 1JHKL 3UTPE 4F7PB 1AGDA 1JPSL 8FABA 3O3AB 4FQXD 1FVEA 2DD8H 3DRTB 5EOTB 1NAMB 1QTYT 4UDUB 3IAPA 3H3KA 2XZAH 5CSGA 3GMLA 2HH0L 3IDIB 1MJ8L 4H8WC 1Z5LA 4LVHB 4XCCH 4WY7L 3SDXF 1WSST 4OD3H 3MACH 4WEBH 3QRGH 2ZUSA 5FO7B 1HHHA 2DI9A 3T4YA 1MEXL 3IFLH 2IPUK 1OD9A 3CUPB 5JXAL 5D72H 4QOKD 1A7BA 3HI1A 5CEZE 5E6ZA 5D2NC 4Y19B 5IT2H 2NY1B 2Z91B 1UC6A 3VXUA 2OP4L 4MMXC 5C0BA 1I8MA 3FO9B 3KJ4B 3CH1B 3CSYB 4AH2A 3FL7A 4X80L 5L9DL 3QUYD 1YEKL 5E9DD 1JZ2A 3IDUA 5HPMB 2OJZL 4R7DA 4KGLA 4PJCB 1CGYA 3C5JA 4JFPB 5HGBB 1BJ1H 3JV6A 3J8F7 1U8PB 5C09A 4OIIH 3RTQD 4NQEE 1E0OB 1U8HB 5CJOL 3BGFB 4WHDA 3ZYZA 4ODHL 5DRZA 4QLRA 4AG4L 4MX7B 3CMOH 3UTZA 4MX7A 5ALCH 2ZPKH 5HYJD 1NGQL 3RZCB 4TNWF 2FGZA 1RK0B 1TNMA 3QQ4B 3UTSD 2LQRA 3H8NA 3H7LA 1A7PH 3HB3D 4NN7C 2AXJA 5A2IH 3BKML 3O3EA 1HK6A 2N56A 2A74A 4OAWB 4P5TB 4MNQA 2ED8A 4V2BA 2Z31B 5I15H 4M6ML 1EV2E 4K7PX 5JLZA 1N6QH 5DD1L 4OLWL 1F90H 3T0EA 2ICCA 2FJHB 2W9EL 1CTOA 3L7EB 2HLAB 1YY9D 3OKLB 2P5ED 3BP6A 3QDGD 4YXKL 3U79A 4F33B 1FNHA 2XN9E 3KHOA 1KYOJ 1PKQA 3MV9D 1IKFL 1I7ZA 3QIUA 3WO4B 3BVNA 3DRTA 5EPMA 3ZKXB 3UP1A 3VFPB 4P9ML 3A6CH 3F62A 1NUDA 4X6FA 4Z76B 3HB3C 5DDHB 5FOBA 4EOWL 3ZE0F 3GI8L 1G9MH 5CJXA 4LPCA 3O3BA 1ZT4B 3ZO0A 1VERA 1P1ZA 3OKEA 3NCMA 5CIPB 5F97E 4Y4KA 2AVGA 3V5KA 4M43H 1B0GB 4YAQA 3DV6B 1FYTE 2R2HA 4XXDB 4U1IA 1LO4L 3KJ6H 1R3LA 4NO2B 3S4SG 3PJSA 2X4QA 1TENA 4QF1A 4PY7A 1NMAL 4HLZG 1EMTH 1H9VA 4L8CA 1Q9OA 4M93B 2FD6L 2RCSH 5D70H 3ZKMD 1BJ8A 1QSEB 3O2VH 4OLXL 1TJIH 4KTEH 1GAFL 3E2HB 4P2CG 1QLRB 2AK4B 5CIPH 5TDNB 4BYHA 5KSAA 1UB5A 1RZFH 2X89A 4TQEL 3O9WB 3NAAL 2BVQA 2DLHA 4Z95L 2EIZA 3RUGA 4OD1H 4OTXL 3FKUS 2RGSA 4DGYH 1BJ1J 4YPGB 3WHE0 1E6JL 1CFQB 4FG6C 1A9EA 4D3CL 1JZ4A 2XA3A 4LCIL 4PRIB 1B4RA 3K3QA 3HHRB 3D2UB 25C8H 1OARL 2JLLA 4OLZH 4M7ZB 5LWYL 4JGMA 4OLVH 4ELKB 5IEKA 3WNMA 3C6LB 5HYSA 1P6AB 2ZSVA 3GBML 4PRPB 4Y5VC 2OLDA 2L7UA 1HI6A 3SKOB 4UT9H 1QRNA 5I75C 2N7BA 5DQ9B 1DEEA 2GSGA 1MFEH 3BISA 2CRMA 1LDPH 3AU1B 9CGTA 4KDWA 3MLZL 4G80A 4PG9B 5MENE 3IKCA 3UYRH 2ZCLL 5CUSL 2QLVB 3MV9A 5TF0A 5C2BL 1WFTA 3MA7A 1DEEB 4XAWL 4F9PC 2WWMC 3N85H 2ZG1A 1XGRB 1AP2A 4MD4A 3FQUA 3H9HA 1A6AA 3I6LD 3AVEA 2H9GA 1IGCL 3KPPB 2VXQL 1CXLA 5MEOA 2RR3A 5B21A 4GW5B 3QDJD 3U0TA 4RGNC 1KCVH 4YHOH 5DMIL 3ISWA 1T83A 2NR6C 3G5XA 3W0WD 5J9PB 4EJ1C 2A6KB 2DN7A 4QRUA 4GXVH 1FDLL 4PRIA 2DM3A 1AQKL 2AERT 4I18B 1CLZH 1AXSB 1V7NH 3BP5A 1YPZB 1U9KA 4G6JH 1HYSD 5TF1H 3HUJE 4YHZH 1UWEL 3CFBA 2FNBA 2Q86A 2YS4A 5BRZB 3GSNL 2R8SL 4HUXB 4LSRL 2WWMD 2GYSA 2AK4A 3PDDA 5TDNA 2X9WA 5TE6H 5DXWA 5C08E 1T89C 4KROD 3N1PC 4V1DB 3KYKH 5FGSA 1LE5A 5FUOL 4PY7B 1OPGH 3I3EA 1FGNH 4PJAE 5J6HA 1SY6A 4JPWH 2IQAA 2F53D 4WUUA 1RZJH 3U4EB 5EU6A 2JJTA 2K9UA 1KPRA 4JDTL 4RBPK 5CIPA 1KULA 3WFDL 3V4PL 2P5WE 3QO1B 4AEFA 4FQ2L 4KY1L 1MWAH 2C5DC 1X5ZA 3RY6A 1S9XA 3EDEA 4HK3J 2PW2A 3LS4H 4FG6D 4S1QH 4ELME 5GRUL 3GSXB 1X5GA 5KJRH 1PKQB 4H88L 5IB4A 1F6AA 3BDYH 3EO0A 2DQIL 3PGCA 1YMMD 1E4WL 1RJLB 1TIUA 2EXYC 2IANB 4L3AA 2Z4QA 4QXGH 3V6ZA 4LSTH 5DMKB 4OZ4A 3C5ZD 4KQ4L 4K7PY 3BWUC 4PB0L 4XNMB 1OCWL 3QWRA 4U6VL 2EDFA 1EHNA 3VXQB 3MNVA 1IJ9A 3E3QE 5KN5A 1CFVL 4RGMB 5HGDA 4HS8H 5DJXA 1T2XA 3V6OA 5HY9B 1GGIL 2X42A 4PRHA 1EX0A 3SKJH 5IV2B 4F57H 3G9AB 4X7TB 3BWAA 3GSWB 3O11B 1DLHB 5EBWA 3W0WA 4RFNB 3REVA 5F8QC 4OI9A 4L8BA 4JKWA 4LLQB 3QDHA 3SO3C 1MH5B 2X70A 2LVCA 5J11B 1ZTXH 2HH0H 3H9SD 4PRAB 4C59B 3IAGC 2B0SL 3VFWB 1IBGL 1T21A 7FABH 4HGWA 4Y5XC 4MA7L 3V5DB 5IQ9B 4NQEB 2J8HA 4YXLH 3GK8H 4PTUA 3I50H 5D72L 1ZLWK 5FO7A 4TNWK 1MCIA 1ZA6A 4G7VL 3KG5A 5FCUL 2Y7QA 1ZVYA 4I3GA 3UJIH 4GRWF 5IB4B 3IDIA 4HQQH 1SBSL 2WUCL 4P46D 2AJSH 1R5IB 5TGBA 3OB0K 1LEIB 2P49B 2PYEB 5DD5L 4J3OC 4EQ2A 2X6MA 3QI9B 1XZ0A 3B9KA 4ODHH 5DD6A 1FN4A 2NZ9C 3AREC 3SDYL 3BEWA 5D2LF 1T0PB 1ZWIB 5FYKL 5C0JB 1GGCL 1PBYA 1KPRB 4X98B 1AIFB 3MZTA 2R9HD 4TUOA 2QSCL 5FGCE 4D0BB 1A1MA 1A7NL 3G6JE 1OLZA 3RWJB 3CH8A 2ADFL 2ITCA 5JW5B 1S7WB 3G5ZB 1KLGA 2BY1A 3TBYB 3JWOL 3O4LA 3ARDC 5IJKC 2BC4A 4J3SA 1CE6A 3U9PL 5J4MA 4JHAL 1RU9H 1YYMH 3ARDB 3RX7A 3VRJB 1ETZA 5DRNB 1GGUA 4PJDF 5IOPA 1F90L 3K4DA 4KI5F 2XT1B 3MJ7B 4WI8A 4M9OA 1BREA 1AR1D 4UILH 3BJLA 3HG1B 5GSRB 2VAJA 3WDHA 4QRRD 3KYMA 1LP9F 1D9KD 4OQTA 3P11H 4PBWD 3R0MA 4PYGA 5D7IB 1I9EA 1WT5A 2D0FA 3ARBC 3A6CL 3D3VA 3K4AA 4Q2ZA 3SE9H 3MODL 3FO2B 4EOWH 1FP5A 1G9ML 1QSED 1WWCA 4CMHB 1NGXA 4R3SB 4Z5RA 2FLRT 3QEUA 1LD9A 1JV5B 1KB5B 1KNOA 2XXCB 1AGCA 4PP2A 1RMFL 4EUPH 4I0PC 3CDGA 4LASL 1VKXB 3A0OA 1SJHA 1MCSA 1B6DA 4ZNCD 2E8ZA 4KRPD 2YN3A 1KB5L 2NX5B 3KJ6L 4JZNB 3D6GA 4OJFH 3VFSA 2IADA 1INEL 1MCPH 1KYOK 4OCXL 1EMTL 5HGHA 3EOYG 3CXDL 4PG9A 1D9KC 4RMVA 1FYTB 5I1GH 1NCAH 1MREL 4KUCD 3MA9L 4U1LA 2AJZA 1MPAH 2VDKH 5DHVA 4PYHA 4QRSB 4PUBH 4KK6D 2VXVL 4TRPH 1ACZA 4P2OB 1EEYB 3SDDB 2HFGH 4QHLA 5T1LA 4JGJA 4OTXH 1AXIB 5EU4B 4OQTL 4LEXH 3TJHC 1XGUA 5SWSA 4LEOA 4A6YA 4IRSD 1FZOB 4NJ9L 4R7NA 1MCJA 1WBXA 2XPGA 4LCIH 3WLWD 2C9AA 4LQFH 5HHME 1BP3B 5BJTA 4FQHA 4TUKL 3FB7B 2XG4A 1I7UB 1MFBH 1GPOL 3F6IA 3T77A 3SDCC 4LMQI 5D1ZA 3GGWB 4F7MB 3LKQA 4DKEL 4H26A 4UT9L 3T2NH 3MV11 1TMCB 3DVFA 3DYPA 4IOFD 3EOTL 4LVOB 4UIMA 3FB7A 4LCYB 1CDUA 1H5BC 1UWXK 4WI3A 3BO8A 4FQQA 2JE8A 2LVEA 2AJUH 1NCBH 5DI8A 2CK0H 4W6WB 3NVQA 4XAWH 1NC2D 3MBEB 3M17B 3N85L 4GLRI 4KKCC 4CVXB 3QUXC 4PGCA 3H0TB 4QT5B 5F9OL 4F7CA 1W2KT 1JNNL 3QUXB 3I6LE 2IAMB 1A4JB 3BOVA 1KTLB 5C0EB 1KCVL 4YHOL 4XB8A 5F71A 2XRAL 4HLZH 3VXOB 1ZSDA 5L8JB 1MJJB 2GY7B 4EEEA 4N0RA 4XPHL 4RX4A 5LVEA 2CPCA 5HHXL 1N5YL 1G6RA 5JOPE 1CLZL 1V7NL 2FIKA 3SDXB 5I1AA 1NDMB 3SGKA 1DLFL 1F4WL 2NX5A 2HFFB 5BS0B 3OZ9L 1ONQB 3IJHB 4PJGB 5JIKA 4NC2B 3GSNH 4U6HA 5KZCD 4G8GB 4ODSH 1IGYB 3K81A 4XP6H 4XXCC 2V5MA 1LD9B 3OAUL 1EEZA 4KJWD 4X9GA 5DO2C 2WMPA 4NT6B 1P7KB 3F7VA 2V7HA 3BP4B 1CVSC 1FFRA 4PRHE 2FEDC 5FUOH 1WTLA 1JIBA 1QLFA 4WHTA 4HBCH 5I1DB 3EFDH 2D03L 4LK4A 3RPKA 3KYMB 5HYIA 3JTSA 2MWCA 1WWAX 4TTGA 3GMOA 3WEXA 3IDXL 1V3MA 2DI8A 5JIHA 3EFFA 2DF3A 1OM3H 4PJCE 3KYOB 3MJ7A 1FIEA 1QR4A 2Y06L 3EOAA 1RJZB 4Z7UF 3VI4F 2NPLX 1QRNE 1U8PA 4TOYH 1V3LA 2C3GA 2VUYA 4HW6A 5HPOA 3K1KC 5GRUH 2VZVA 3ARGA 4P5KA 1KLGB 1KPUA 3F58L 4Q0XH 2Y23A 5EH1A 4LOUD 1MF2L 1L0YA 2C3WA 5C0CB 4DUWA 3ZE2F 5KVDL 4KQ4H 1A6WH 3T4YB 3FRUB 1P4IH 4M1GH 3FTGA 4XNUL 3SDDD 2CRYA 3OV6A 4QHKI 3QI9A 4L29B 4OCSH 3I84A 1KLUB 3ARYA 1JF6A 1B0RA 4G6AC 5IW1A 3DTXB 1ZA3B 1S8DA 2G9HB 5EOTA 2V2TB 3CCHB 1LEKB 1LO5A 1NGZB 1RK1B 1YN6A 1T1ZB 2NTFA 3HC0A 3TV3L 1KJMB 4MNGE 2DLEA 4M48L 2NW3A 4GRLB 1OW0C 4X7SH 1MFDL 3R06A 2NTSP 4G5ZL 3BPLC 4P57A 5CJXC 4MCYB 1MJUH 5IF0A 1VADA 3TJEH 2VUOA 5E5MA 4ZMAT 2H6PB 4XB7A 2R29L 4M7KL 2DKMA 3ZKSD 2VDPL 5CEZD 2GT9B 3T1WA 1MLBA 4HF5L 4BM7A 1FL3A 3OKNB 4PFEA 1MAKA 4ZO9A 5D96C 3VXPA 1XGPA 3HE6C 5DS8A 3ARGB 4P5KB 4P4KC 2YUXA 4BQ6A 4FTVE 5SX4I 2DQGH 1IAOB 1L9MA 5DLMH 1IBGH 3FB5B 2WW8A 2R0WH 2H32B 4UOW0 3T09A 4MWFB 1K9TA 2BRRH 4LLYA 3VFGH 3PWPA 2NYYC 4XBGB 1T7ZA 3ARED 5EBMB 1CGWA 1NBVL 5KSVA 4MQ7A 1SBSH 5ENWA 3WBDA 2VAAA 3QXUA 3T3PF 4NRYA 4NBYB 3HI6H 2P45B 3BQUB 1G9EA 4Z18A 2B5IB 1FV1A 2EDXA 4LSUH 1EEZB 4IS6A 4ZO6A 3SDYH 1HHKA 3GNML 5LXGH 3FHQA 2K1MA 1GGCH 4M1CC 4N68A 2BVOA 4NHCL 2OR7A 2EDQA 5GS2H 1S78C 4RMQA 3BZ4B 1ONQA 3D3VE 3O4OC 1LWRA 3O3UN 3ULUE 1NUFA 3JWOH 1CL7L 4JAMA 4YBHA 1PG7L 3NPSC 3MXWH 4MJID 3Q1SL 1JWUA 3SEPA 3QQNA 4MD0A 4Z7VE 2K3TA 2VWEE 2B7DT 2R1WA 2EXWC 5C0EA 1FGVH 3NGBC 3QO1A 5DHVH 3MOBL 4P2QD 2MKLC 1FFQA 3G6DH 4L9LA 4I0KA 3K2UH 1EO5A 1U42A 1KJ2L 2Z0BA 2IF7A 3F6LA 4JO1L 3BRDA 1INQA 5IJKA 1KEML 4MQXC 3S37L 1F11A 1KTDA 2WBKA 3GMMA 2O5XH 4HWBA 1YNTA 1QG3A 4JFXA 4GMTL 4ZSOA 1DL7H 3GM0A 4PJ9B 5DYOB 4C55A 2BRQA 5I1EL 4HGMA 5EO0B 3U0WL 3PGDA 2VDMH 3OTTA 4Y19D 1MRFH 1QKZH 3MMEB 3VD9A 5D2NB 3GGWA 3OXRA 1ORSA 3CFKA 3ZDZE 1U41A 4G9FD 1RUAH 3NIFF 1EERB 2Q8AH 2Q76B 4I0PA 2OM5A 1BVZA 2KZ1B 1FLTX 4GQPH 1GIGH 2ICWA 3PP4H 5HHVH 1Z0MA 1DE4B 2BHYA 3RWHA 1ZHKB 3MA9H 1ZGLB 3MLRH 5ABDE 4E5XB 2ERJC 3RHWK 4HG4K 4Y16A 3MRHA 1JPFA 3BX7C 2AQ3A 4LHUD 4RQQA 4YWGL 4G9FE 3ULSA 2VDQH 1D5IH 3NCJH 4LEXL 3B6SB 2QQKL 3O2DH 4XHJD 5GRJH 5JHDE 4RGMC 4U1LB 2RIKA 1R3IH 2ARJB 2CRIA 2YSSA 2F54E 3IKCB 4LQFL 1G7MB 4G8EA 4MAYC 1RULH 2DICA 1FO0B 3CU1A 1QACA 4OZHF 2HVKB 4HJGB 4OCWH 5BO1H 4GAGH 2R2BA 3HI5H 1IE5A 3BZ4A 3RL2A 1SJHB 1NFKA 3W9DA 4Y4HD 43C9B 4PREA 3MOQA 2AGJL 3QCTL 4KAQH 4ZFFA 2BVEA 5IFAH 3EOTH 1JGEA 2IMNA 1UM6H 1EAJA 4ZQKA 4CU7A 4F3FB 4PJGE 2FX7L 3QUKA 1NCDH 2EIDA 5IB2B 5GRXG 4YHIA 5KW9L 2XQYK 1R5VA 2AJUL 4LDEB 4AENB 1ES0A 3B2UC 4K9EH 2O5ZL 4FQCH 5BS0D 1MFCH 5ENWB 1RJCA 3GSUA 1BGXL 1A6UL 4YBLB 4Z7VF 4UUJA 3TVMB 5F9OH 2XTLA 1JNNH 5F96L 4LLYB 3KWWB 3CNKA 4Y2DD 3O41B 1JI2A 1G6RL 1BWWA 1CE1L 4NOBA 4ZPTB 5INCA 5ISZB 5SV3A 4XPHH 1N64L 4G6KL 1RUKH 5I71B 1LO0H 4L3CA 2NNAA 1CR9H 4R96B 1L9NA 4OB5H 5C0AD 3WXVH 1ZT1B 1JP5A 3VI3E 3L1OH 3OZ9H 4FXGA 4PJ7A 4XP5H 1H3PL 3TH3T 4IIQC 5GIRA 4FFZL 2NMSA 4WDIB 1NFDE 3NZHH 5LBSL 1AIFA 5IQ7H 5KSBF 5E70A 3V52H 1BQHB 5GPRA 1KIUA 1F02I 2Y25A 5C0BD 4QRRE 5JXEA 4IJ3C 3L3JB 2NW3B 3P4OB 3DNKA 3HTLX 4KMTH 5IMLB 5JDJA 4OFIA 3NMEA 4Q9QH 1T1ZA 3P30H 4HIIB 1S8DB 2G9HA 4JHBA 1CGSH 1CWVA 3RWCB 2VC2H 2VIRA 2BVPA 1LVEA 4LCWB 4LPXA 3IDMB 4CUCA 4ESKA 1EXUA 1GOGA 4X6DE 2JB6B 1FZMA 3FTGB 4BFIA 4FQPA 3HUJA 1DP0A 3FRUA 4OZIA 3EDDA 2GQHA 3O4OB 4A6YL 5C09E 1RHFA 5D7JC 3BSZL 3AS3A 4WGWB 2HLFD 3CC5A 1F3JB 4F37F 1UWGH 1J8KA 1PSKL 3KPLA 1KIPB 3F58H 3LB6C 5ALBL 4W4OA 1RZGA 1SQ2N 2ICWJ 3QZWG 4M6NL 4S1SL 1QO3A 4YHMH 1FNGB 5D7LA 2PF6A 1RJZA 2MNUA 3W0WB 3LQAC 3O11A 5J3HD 3WCYA 4JFEE 4EIZC 1BQSA 5C08B 3MV7B 1M71A 1LP9B 5DJ8A 3V6OC 2XN9B 5C09B 4KXZH 5I0DA 5HGBA 2JCCE 4PJ9C 3B4NA 5MERB 1HILB 3GJFB 1K8DB 4RGOH 3CH1A 2LABA 4NKMA 4FQXC 5KN5B 4G42A 1HWGB 2CMRL 4LLMB 4F15B 1G9NC 3V7AE 3IDGB 5TE7H 2PXYB 3VGGA 2WBJC 4OF6A 4NO3A 3BUYA 4X7SL 1MFDH 1MI5D 3IETA 1OSZA 2AV7A 2Q3AA 1F58L 1NAML 2VR9A 2HAZA 2O5YL 3ZYJA 2EDLA 3FQRB 5C70A 4J3UA 5KVGL 4AIXA 5C07B 2EYTA 2JCCB 3QHZH 3MUJA 1CDYA 1MHPL 4Z7WF 3KPSD 5E2JA 3HE7D 3MV8A 2C3VB 3MRFA 1NDGB 5BCAA 1MRCL 2EEDA 3RPIA 4FN0A 3SE3C 5CBAA 2A6JA 2QQQA 3QDMA 4HIEA 3S3JA 1OD7A 1KTLA 4LLDB 5E6ID 4QT5A 4F7CB 1DDHA 1G7JA 5F1NA 2HJLA 3K1DA 1UB6B 3FQTB 3KPRE 2WBJD 2VL5B 1WICA 4ETYA 4U1KA 5CAYB 3CLEH 4GSDH 4F15C 4HIJB 4MJ5B 5JW3L 1K4DA 1LE5B 4XP4L 4V1DA 4BA8A 4Y4KC 3BAEH 3OSKA 1KB9J 1V8HA 4DJMA 2YKLL 1SYVA 4XPAL 1SVCP 4Z7VB 2VTFA 5BV7L 4BUHA 4KUZH 1TJGL 4P9HH 3QDJE 3WJLA 3DYOA 4BQCA 2X4TB 3HN3A 4U33A 1ORSB 3CFKB 3UTSB 4NHCH 4P3CL 4GUPA 3G6JB 4JDVA 2DQDH 2DQTL 3QIBC 5FHAL 2ESVA 2O26U 1XGQA 5GZOC 3WE6B 5EO0A 4KU1A 3HZYB 1CL7H 1S9KC 3O2WH 3NCFB 1T20A 1TTUA 4AQ1B 4D2NA 3WIHA 5FB8A 1T03H 3GMMB 1LILA 2A6KA 4R26H 1N8ZB 5IMOA 4X5WA 4NP4H 4L8DB 3GSQA 4L3ED 4GOSA 2YA0A 3QHFL 3AMLA 3RL1A 3CJJA 3MRMB 4NQCD 4DN3L 5J56B 2MQCA 1Q9KB 2CLZA 1KEMH 3O3DB 4HWBH 4QRPA 5D1QA 3KPQA 4OIBA 1CI5A 2AJXH 1EAPA 1EVTC 3S37X 1G0XA 2O5XL 3MRDB 4P4RB 4JR9L 4C83A 4N0FA 2F54D 5E4IA 1R0AH 4FQ1L 3WIFB 4L4VA 4L9LC 3IB4A 2A1WH 4J1UA 4M3JA 4OGAC 3ORJA 2HRLA 5E1HB 3MRMA 3TBVA 3UC0H 2FO4B 2XYCA 2HVJA 4WW1B 1FL6B 1AGCB 1UFUA 2VXTH 4L8DA 4ELKA 5D8JL 5AZ2L 2XG5A 5M7QA 5D96B 4ZAKA 1A2YA 2E9WA 2P42B 3FO2A 3QA3A 3VXUE 3OGOE 4WUKH 3W39B 1ERNA 3I6KA 5IMKA 2DQHH 3RIAK 3PNWB 1QR1B 4HIHB 4HWNA 1VFBA 5L6YH 4HBQA 3KDMB 4YWGH 4WFFE 1OP5K 2X4UB 4GMSH 5FGRA 5IFJB 4G43A 1OP9A 1KLFA 1AKJA 4LPVA 5D7IE 3BEVB 2X05A 1SYVB 4JO2H 4MWFA 4CDHA 1ZLVH 2WWKT 5E6IA 3RFZC 3TCXA 3LKOA 4HDIB 3VXMD 1IAOA 2CGRH 5FK9B 2V2XA 2UWEA 4DW2H 4HIJA 1BZ7A 1XGPB 3VWKB 3G5ZA 3D85D 2W9LA 3MJ8B 1D6EA 1MLBB 5BRZE 1A1MB 3RVWD 3V5KB 4PG2A 4N0YL 3TVMC 2HJLB 1FBIL 3D5OF 5E5MB 1J8HD 4OT1L 1DDHB 4XVSL 5F9AC 5ELIA 4X6EB 1A5FH 4BSWB 5BV7C 2YHGA 4I3SH 2P8PA 1H0DB 4IOIB 4E42A 1T4KB 4QNPE 4LDOB 1XEDA 5DZLA 4JG0H 5TGBB 4PJCF 2R0KL 3UBXG 5FFLA 2VLKB 4YDJA 3UTTD 4FTVA 1I7ZB 3FN0L 1JK8B 1MFCL 3RI5K 1CG9A 1XGTA 4IIQB 2I9TA 2GJ6B 3D25A 4NO0A 3UAJD 3DBXA 1A47A 5DRXA 4I18C 3SOBL 4WENB 5ETUA 4NOFA 3DI3B 4HV8B 3K7UA 3LEVH 3U6RA 4Y4HC 4DAGL 5IQ9A 1FYTD 1CFTB 1KXVC 4MNQB 1T21B 4OAWA 4M8QA 1IKNA 5CJBA 3WFCH 4E0RB 2G60H 4AIZA 4MQTB 1YMHB 3WXVL 5KSBE 5LGJB 3EO1A 1XGYL 1SYSA 4RISL 3MNWA 1AD9B 3MSPA 3RZCA 3B5TA 5EBWB 3EOAB 1Q8MA 4LMQE 3UTZB 5CSZA 2EDDA 5AD0B 4GW4A 1C12A 4PRHB 3O6FA 5H2BA 5SX5H 4PB9L 3OL2A 1PJ9A 5EU7E 3JV6B 3ARRA 1YNLL 4MNQE 4Q9QL 5ID0A 3MNWB 1FRGH 3MLWL 2ZJSH 3KPLB 2R2EB 5EN2A 1I9IH 4RFOL 1DQML 4WI7A 1HZHH 1LE9B 3DVGB 5IVOA 1WT5C 1CFTA 5ICZA 1KF9B 1FVDA 2IPUG 3MXVL 4I48A 5CHNA 2OTUB 3U6RB 2K7QA 4BFIB 3LQAL 3GMPB 2DM4A 3HAEB 3NGBB 3IVKA 3VMPA 4KKCD 2GJ6A 1RVFL 4P5TC 1NDMA 4WWKA 4JCMA 3ECBA 2VLKA 4YDJB 4LU5L 1E4JA 3UBXB 4HS6B 2QQNL 3TH4T 4YDVA 3TJHD 1S9XB 5GGTL 4PJ5D 3LKSB 1I3GH 3DURA 2FJGB 4G3YH 3RJDA 1W72H 5A3ID 5D6DA 1A4JA 4NQVA 1HHIB 4MDIA 3L6FA 4OZIF 3BGFC 5GIRB 1HQRB 4WVRA 1MRDL 4N8VB 3WUWB 1A22B 1WBZB 2CDEB 3D39D 3B9KC 3L3HB 2UWEB 4D9RD 1JGDA 4LSVH 4M5YH 5FF6B 3VFNB 2RBLA 3L7FB 4OD3L 5KTEL 1P69B 3QRGL 2EE9A 5FHBL 3HC4L 1F58H 1ZLUH 3FB6A 4K7PL 4LHQB 3IFLL 3NZ8A 2O5YH 3BDBA 4NQDE 1KJVA 4LRIA 5L8KB 1SEBB 2FR4B 5BRZA 3G5VB 5JMOC 4LARL 3JVGA 1TTGA 4UQ3A 3ZKNC 4PJXF 5L88H 3WO4C 1OQOA 1SMAA 1AE6L 4PLNC 3QDJB 1YPZA 3PNWA 4MYWB 4WFEE 1QR1A 1XMWA 1NFDF 3I6KB 1L7TL 4I18A 5IMKB 4EQ3A 2IQ9H 4JJ5B 1IRAY 4FQJL 2Z35A 3MQIA 4F7EA 3T1FA 3RDTC 2QSTA 4ZXBA 4OIIL 1QYGL 1WTGT 4M9PA 3VGFA 2WP3T 4MD5B 1L0XA 2WQ8A 3O4LE 1C5CL 4RAUB 3V0AC 3CMOL 3M1BB 1W8OA 4QRQB 4ALAL 3BKJL 1D7FA 5T5NG 3SDAA 1U8NB 1A6AB 4XMLH 2BJMH 2XNAA 1RZJC 3OAZK 1A7PL 3LS5H 4GSDL 5FDWA 1T7VA 5JUEH 2F19H 2E7LA 1HDMA 3WS6C 3WFBH 4M6MH 2J8UF 5C2UB 2X4SB 4XPAH 1KCRL 1FPTH 5BV7H 5D1QB 4KUZL 2XNAB 5E03A 4Y1AD 1YY8B 4X83A 2HT4D 3VD7A 1U8NA 2JJUA 3OF6A 5E1AA 3RL1B 3UJJL 4TNVK 3V8CA 1UACH 5CZKA 2ZSVB 5JO5B 5DSCA 1PX4A 5BVJB 3P9WB 1EHLL 1JV5A 1E6OL 2OMNA 2H45A 5GGTA 4W68A 4DOHB 2D7NA 4MXQD 2P7TA 5JOFA 4R0LB 2J2ZA 1AGEA 4XXCA 4YHKH 3S36L 1FIGH 4N90D 4MSWB 2CRZA 2YD3A 4PJFA 4IRJA 5EU7C 1YJDC 3QIUD 4PJDB 4WU7A 3U82B 1SEBA 2Q8BH 3UTSA 3QHFH 2FR4A 1FG9C 3O9WA 1YNKH 2EDNA 2CK2A 5E56A 1DQLH 5BMFL 5IOPB 3DV4B 2RHEA 4K7FA 3U7YH 3FCTB 3SHSA 3T65A 2AEWA 5EO1A 4PJAF 3GMNB 4U1KB 4ODXB 2ZCHH 1GAFH 1WBZA 3D2UD 4XBEH 4Y16C 4LGSB 3DUUB 5D2NE 2GUOB 2NW2A 5SX4H 1B0GA 3MC0A 4D0BA 4OZFA 1RV6X 1I8IB 1NL0H 4Z95H 5F1NB 2ZUQC 1WIPA 2BNRE 4FHBD 4MDIB 5CGMA 4KJQC 4ZTOH 4NQVB 5LGKA 3PWUA 4NQDD 1ZLSH 3RUGF 1FN4B 4J12A 1OF2A 2OR8A 5F1IA 5J1AA 5C0IB 1JWUB 2ZUTA 5DK2A 5I76B 3PUCA 1CICA 4FXKB 3OAYH 1RUMH 3FB8B 4YDKH 1CCZA 3VJ6B 2WANA 4F7TA 3BW9B 4KHTL 3G08B 3PWJB 1MVFA 2Y7QB 4LSPL 2X1QA 1F5WA 3GMPA 3BUTA 2E9IA 1G7IB 5E4EB 3VFMB 1HHKB 5JHDB 4OKDA 5EOQH 5DF0A 1FVCA 3W11C 1INDH 1JNLL 3V4UH 2ED7A 5FGBA 3GSOA 3UYRL 3VFWA 5DA0B 2ZCLH 3INUH 4XNQA 4DW2L 4XAKD 5C2BH 1VENA 1T0MA 3BZEA 3LQZA 1REIA 4LLQA 3RAJH 4HKZB 4OUOA 4MQ7B 3JUYA 1BQUA 3ZL4H 3DJ9A 4FXLA 3EHBC 2Y5TB 3S5LA 3A67H 5FEBA 2UV3A 2VLRA 5J3HC 4XCYA 1HSBB 3EYOB 2ENSA 1QO3B 4GRMA 3QULA 4Y89A 5ICXA 2IBZX 2VMFA 4FFWD 4JG0L 4XVUC 1U8KB 2R0KH 3DMMC 5EUKB 3FO9A 3WLWC 2DM2A 1IGMH 2MKWA 3CC5B 3HNTL 1AHWB 1WUNT 4YR6A 5T3ZH 2FJFA 2NXZD 3C2AL 3HZVA 4M7JL 3SOBH 4H5SB 1SJEB 1NUGA 1B90A 5D7LD 3BD4A 3RX8A 1XH3B 2VLLA 4D9LH 4DAGH 1FZMB 1U8LA 3LDBC 5ETUB 5GRVL 4L4TD 3RGVC 3STZB 2V17L 3HRZA 1H8OA 1HSAA 2I9TB 2VIRB 1ZEAH 3MYJA 2DI7A 4PJEB 1RPQA 4IRSA 5T1KD 4FTVB 4NZUL 4HIIA 3R8QA 1NGZA 1RK1A 5HYQB 1CZ8L 4EXKA 1FNEB 1RFDL 2YRZA 5J12B 4WFGD 4DGVL 3E6HA 5EZOL 2CQVA 3O81A 4IOIA 1KV3A 4GAJH 1J1XH 2DIAA 5I1JL 3GB7A 1OTUC 4ENED 1RY7B 4N9GA 2X40A 4FABL 1KCSH 4ONOA 4JN2B 4NPYA 2VLRE 3O9WC 2YUWA 1YNLH 1W0VB 3GBNH 3HMWL 5J6HB 2QKIB 4YGVB 3TZVD 5C0AE 4JRXB 1DQMH 2V2XB 1K6QL 3OG4B 3BDYL 5F7LB 1XR8A 3PL6A 1CLYH 32C2B 3BT2L 5INCB 3IF1B 4YNYB 3D9AH 4YO0A 2CKBA 2F53B 2CKBH 1PKQE 3MXVH 1D5XA 1ROWA 1TTFA 2DDQL 5EU5A 1MCRA 5EU3A 5BW7C 1F8TH 3D85B 2X4UA 2W0PA 2YWZA 4GS7B 1J1PH 3KDMA 3WIIH 3PP3K 4P2OD 3A6BL 4IM8A 1A4KA 4OI7A 1DANU 5INDB 1WC7B 4HS8L 3ZE2E 2NZIA 2A38A 5EB9A 2C1OB 3VXUD 4EI5A 2DQJL 4N0UB 2OQJB 2AEQL 4PTTA 4RGNE 1IEAA 4Z8FH 4GG8B 3L3OB 2GKIA 2PCPA 3IKKA 3QUMH 4NT6A 4RFEA 3DPBA 4AMKL 4F57L 1YY9C 3QJHA 3U1SH 2VLKD 3ZHKA 4KK8C 1DJSA 2H9GB 3LZFH 2Q7YB 1JHTB 3FQUB 2ATPA 4J1UB 4AM0A 2HFFA 4MS8D 5SWSE 4LSVL 1TCRB 1IGFL 5HXMA 1BLNA 4N0FB 3RY5A 3G5YA 1VESA 5FHBH 4JPKL 3HC4H 4K23L 2DIBA 2NY4B 1MJJA 5FCSH 5F88A 4QRPB 4R2GC 4NUJB 3QR2A 2KBGA 2QADC 5E99L 3QUXA 3CXHJ 3BHBB 1RZ8B 1HIMH 1JWMB 1ZGLP 4UNVA 6FABH 1EPFA 4K8RH 2PW1A 4HQQL 1NJ9A 4NRZA 2OTPA 2WUCH 1NMBH 3OKDA 4E5XA 4X6BA 3GHBL 2BX5A 4HUUB 4Y5XA 5D1QD 5E8DL 2EC9U 5IK3A 1EZVX 1P5UA 2VN4A 4RWHA 3BI9X 2ICWB 1E4XI 3BDXA 1IM9D 3H9SB 3F5WA 4YQXL 1C5CH 2YD4A 2J1KA 1RZKH 1HH6B 4KHXH 4HWZA 3EHBD 5TQ0L 5I8OH 1A7NH 5D7JB 3CD4A 2WINA 2ADFH 4L4TB 2APVA 5DUML 3G6JF 4P23C 5DFWH 4KTDL 1WZ1L 1TQBB 5JUEL 3LSOA 2F19L 1T0NA 1A3RL 4ZAKD 4L8CB 4KKNA 1DUZA 1IARB 2E7BA 2XPGB 4G8GD 4Y4FC 3WFBL 3U30B 3TBWB 5B39G 1M7DA 1CF8H 3OKDB 3QCVH 3HMXL 1FORH 2YPVH 5MEPA 2EICA 4Y4KB 3SDDA 1UACL 3ABZA 3DO3A 1ZKAA 5F70A 4D8PB 4MJ4A 4FQXB 3RWDA 1MQKH 5MI0C 2AJZB 2Y36L 4X7DC 5I74B 3MFFA 4QXTB 5FKPB 1J5OL 1NDGA 2ZCKH 3H42L 1OAKH 3CLFL 1UA6L 5MHSD 1ITBB 5T1MB 1VACA 2D3VA 3DX8B 1VFUA 5CD3A 5C07A 2YPLA 2CIIB 1M7IA 3VFOA 2OL3B 2B1AL 2BVOB 1IAIH 4GKZB 4PP2B 3E0GA 35C8H 1KNOB 4HK0A 3KPSB 4N1EA 2DIJA 2B4CH 3QXAA 2NY0B 3HLAB 3W2DL 5ADOL 2OZ4A 4NO3B 1Z3GH 1GC1H 1IEAB 2D4DA 1TDQA 1LGVA 3QG7H 4OSUH 1AGBA 5JPMA 4OZHB 1NCAL 3JVGC 1GOHA 1TITA 4QHNB 4NFDA 2ZCHL 2VAAB 2VDKL 3VFVB 1KFAL 1A4KB 2A77H 4WHYH 3DMMB 4R6UA 4HXAH 3X14A 2HFGL 1UM5L 5DT1H 1DBML 4OV6F 3QPQC 5T3XD 5EU5B 2BFVH 3I2CH 3EKCA 1DQQA 5ACMA 5EA0L 4AK1A 3EYSL 2NY6C 2PETA 3E8UH 2ZSWA 4P48A 2P5EE 2BNUA 3VRJA 3HR6A 3FB5A 3IJSA 3LKRB 4DEPB 3TBYA 5I1IL 1N4XH 2A6IB 5D1XC 5C0BB 3PQYB 1I8MB 1JFQH 5JPNA 4JPVL 2BSRA 2EC8A 3T08A 3QQ9D 3AS1A 5IB3B 4NJAL 1MLCB 4M8VA 2V9QA 4GH7B 4UT7L 1RIUL 4GXUM 4B0MM 1MAJA 2JB6A 1MUJB 3DGGB 4OFKA 3HC3H 3EDFA 3GMLB 3NA9L 3WNKA 1LO5B 2CK0L 3MGOB 5L2KE 3ALPA 3RAJL 4PJEA 3EO9H 3ES6B 5IMLA 5IW1B 4JM4L 4F7PA 1WEJL 3ZL4L 5E8EA 4OI8A 1H5BA 4UTAH 5GGSA 5J1TC 3QDAA 4G9FA 3V5DA 1UZ8A 4R4ND 4WDIA 1V3KA 3SKNA 5IESH 3S9DB 1TZHA 5EOCL 1WAAF 3F8UB 5HHPA 1IC1A 1OGTA 1N5YH 3P40A 3WV0A 3D87B 3IDYB 4FQIH 3N1GC 4HEPG 1TVHA 4PJEE 4JN1L 3O0RH 1WCQA 1J0YA 1URLA 5GGRB 3EJZD 5IVNA 1GZQA 5ISZA 3JZ7A 3REVB 3AROA 4LSSL 4GKNA 4S10A 4RX4D 1UH4A 3GSWA 5BVPH 2BY0A 4CMMA 3MUZ1 2OBGA 3CFCH 3OAUH 3VFRA 4D9LL 2W60A 3EFFB 4OBRA 3UTTB 5I73B 2EXWD 3O8XC 5T33L 3BPNC 4G6FD 1ZEAL 4E41A 1NCUA 5I19L 4HKZA 3P4LA 5DGQA 3L95B 2F5AH 5TDPA 1H3UA 1JI1A 4ZSOE 5JQ6H 4LBEA 3ARPA 4DGVH 4R4NC 3IDXH 1XFPA 1OTTD 4GAJL 4OFPA 5T3ZE 3J7HA 1G7IA 3O2DA 5FYJE 5KZCB 5JW4M 4IHOB 2VYRE 1KCSL 3IXAA 1RJLA 2V5SA 5DVNA 5JMRA 3W9DB 3WNLA 2EYRB 2R2BB 3BW9A 2NY0D 3C9NA 4ZPVA 3S88H 5KOVC 4O00A 5T1MA 3WUZA 5EZIL 3MGAA 1P7HL 3LHPH 4DFIA 1MF2H 2IGFL 5I76A 3VH8G 1WZMA 3OR6B 2D0HA 4NBZB 3BT2H 4QXTA 5J1AB 2X44D 5E00A 1C7TA 4JFDB 1HYRC 1ZSDB 1AO7D 2OCFD 6CGTA 4MA8H 3UPCA 1CXKA 5AG9A 2BOBA 1A64A 2VLJA 1G1YA 1CDCA 1H3GA 4XRCA 1D5MA 1G7HB 1Q0XL 3L3KB 2VZUA 1MCFA 4H0HB 4JRYA 2ATKB 4EXPX 3FRPA 4FQQB 4Q9RH 5H37G 4M48H 3RI5F 3LSOB 5AZEH 5JOEA 2H2PD 5IHUL 4JFEA 2N4IA 2NQCA 4LPUA 3JV0A 5LG1A 5DD0L 3LKQB 2PXYC 4HWZB 2J88L 1MCDA 5HHNA 4N0CC 3S96A 4JPIB 5FM5O 2ENYA 1F3DJ 3DI2B 1I9RL 3F5WB 1I7UA 5IW6B 1B6UA 4HMCA 3WL9A 4JQVA 4U31A 4MSWA 1RHHA 2I5YH 1HH9A 4WU5A 1YNTB 1ZK9A 5IK3B 1BEYH 4Y5XB 4NC1C 4R7NB 4C56B 2ZUVA 3P4NB 5SWSB 4NNXB 4NQDB 2H2SD 2R15A 3I02A 3O4LD 3VFGL 3IU4H 3SKUD 5T1LB 4JY6B 2HFEB 5EULV 2V2WA 4WO4D 5IROA 6FABL 5E1AB 5DC0A 1MCBA 3SCMD 2HT4C 5CFHA 4BH7B 2AV1B 1QFUH 3GIZL 3S8WA 3FQXA 3MPCA 2D7QA 5GRVK 1G9NL 2JCCF 1FG2B 1HDMB 4PRBB 3QNZA 4ZODA 3CMGA 4B53A 3GNMH 5LXGL 3HZKA 3VD4A 2ATPB 2MCG1 1A6ZB 1G7QA 3MV01 2DMKA 3VD5A 2Z93B 4S0TD 2XKUA 1EEQA 2HJFB 1G6VK 1KB5A 2IH3A 4HX1A 3ZKMC 1WZ1H 1NLDL 1BM3L 1CYGA 4LVNB 3P4MA 4U1GC 1VB9A 2E6PA 3D3VB 2C1OA 3QT2A 1YEGL 5J8OA 4X6CE 2UY7A 1U93B 4U6XA 1YEIL 3BE1L 3QDJA 3QCVL 3HMXH 3SO3B 1M05A 3MOBH 2FDBP 4ZOBA 1FZKA 1YEDA 4WI2A 2EIZB 4K94L 4M1CD 3K2UL 4NKOA 5HDQL 1A3LH 1UB5B 1D5XB 4P0DA 5C6TL 1MQKL 2F53A 1K5NB 4M5ZH 3KAAA 3ARFA 1P4BH 4M62L 1LMKA 4HKXA 1ETZB 3BPCA 2APTA 3DMMD 1OAKL 5HDBE 4OGYH 1AH1A 5BXFB 1D6VH 3RGVB 4U3HA 4P23D 4JRXA 3U0WH 4V2CB 1AI1H 1PEWA 2ITCB 3HE7A 3OKNA 5JW5A 2CKNA 2R2HB 2A0LD 43CAB 1KIRA 3O6ML 4KKAC 3ROLA 1FFOB 2AK4E 3HUJF 5J89A 1PD6A 4OM1H 3L6FB 1IAIL 1MCOH 3MRRA 3PHSA 3TO4C 4Z0BL 4P59L 35C8L 1DBBL 2YZ8A 1JE6A 4MCYA 3GJEA 4CKVX 3GFUA 4KV5F 8CGTA 3NIFE 5ADOH 1PVHA 5ICYA 3H9ZA 2HT2D 4LSDA 4LRNH 3PP4L 3KPOA 2F8XC 1AR2A 4X6FB 1C1EH 1X4ZA 3KLAB 3KPSE 3C8KA 2VN7A 1R5IA 3VFPA 4P46B 3HS0B 4JVWA 5IBTL 3ECBB 3PE9A 4I9WE 4O58L 1JZ6A 4PJ9D 2Y72A 4XNZB 3VRLF 5J13C 3C5ZC 2CDFB 2VDQL 4Z7UB 5HI5C 4BFEA 2GK0A 3QUZB 1S7QA 2BFVL 3I2CL 1A9BB 3UPRB 1H8SA 3UEZA 4WO4C 1XF2B 12E8H 5E2UL 3T0EB 5GRJL 2Z31A 5LGHH 4PRHD 2E7MA 4Z7OF 4YR6B 1ZE3C 1PKOA 5I1HL 5D71L 1ZGLM 5CP3H 3SJVE 4L5FH 5EUKA 5C07D 5EN2B 4DFHA 4OKVA 3STLA 5T1KA 5FECA 1BFSA 5IUSA 5IROC 5ID0B 3OKYA 5C0RL 3U83A 4F2MB 4TVPE 3OB0H 1HHGA 1JMXA 3SDCA 4LCWE 1SJXA 4D0DB 5EZJA 1HSBA 1RZIB 1C12B 1DLHA 3IAQA 5D6DC 4EDWH 4DKAA 1L7IL 3BWAB 4KAQL 4NJAH 4X6DB 3S5LB 2XTJD 3V4VL 4L3EA 4A2MA 2FX7H 3WEXB 1NCDL 2VWEC 3HC3L 5F21B 3RY4A 3TYFA 5L7XH 5HY9A 1ACYL 3FQNA 2HTLC 1T6WA 3ZLQC 3NN8B 1NCCH 5DHYA 5KS9B 5HGDB 1A6VL 1YMHA 2E8YA 5LGJA 3EO9L 1PZUB 2YPKA 4OF3A 3DXAE 3CSPA 4WY7H 3RJQB 4MAYA 5GHWL 3B5GA 3QEQA 4NZDA 5F96H 1OWRM 3SDDC 1IAMA 2RFXA 4QTHB 1UWXH 3OPZH 1A3QA 2HMID 4OZ4B 1DN0B 5EZLB 3U0PA 4EVNA 1CE1H 1DFBH 5E6IC 4UT6H 5EOCH 3RVUC 3UJTL 1V3JA 1F6AB 2OSLB 4U2YA 1X5IA 3VJ6A 4D94A 4NWTH 5B8CA 4FQIL 1OP5H 3WMSA 1RSFA 2UYLA 5F89A 2OJEA 3CZFB 4X4YB 1YEKH 4KH2A 3GSXA 4QRPD 3PL6D 3DROB 5DK2B 4EI6A 2J5LB 2PW2B 4BQBA 3NZHL 4P2RE 3TZVC 5C92A 5DD3L 5K33A 1IQDB 4NRXA 2D7PA 4XCEB 2I07A 1BF8A 3PHQB 4Z78B 3PWUB 4BZ1L 2J8UB 2VQ1B 3ARWA 5SWZE 4UQ2A 1W8NA 5JHLH 4KMTL 5EU6B 3UTOA 3RVWC 5I19H 2GUOA 3MBEA 2NW2B 2UZIH 3P30L 1FNSL 3GMNA 1NEZA 2FBOJ 3TA3B 4DZBB 3BO8B 2IAMC 3HFMH 2ESVE 2HJKB 5SWQA 3K80A 5D5MB 3IDJB 2OTWB 1MCCA 4KUCF 4NHUA 4DQOH 3EGSB 2VKXA 4A6YH 1LK2B 5D2LA 2FX8L 4EN3D 4U1MA 4G43B 5MI0B 1TLKA 3QUMB 4WU7B 1JGLH 4XI5C 4NQUA 3OR7A 3T77B 4MB5A 4WW2F 1OP3K 4HIHA 2HTKC 1BD2B 1UXWB 4PJFB 1PSKH 3BP5B 5L8LB 3W39A 4Y4FD 1U8MB 3IFOB 1BX2A 4CVWA 4JLRA 4PJIB 1F45A 2F53E 3QA3B 3QIBB 1E28B 4XZUA 3JWDC 2HVJB 1BQLL 3KPPA 2WIIB 3FQWA 3TLRA 1I1AC 1I1CA 4CN6A 1FJ1A 5CKAA 1UYWL 3ULUC 5T1LD 5GS1B 4Q9RL 1OAZH 4Y7MA 2DAVA 5SWSD 3W11D 3N9GH 3QIWC 4FMKA 4OLXH 5GS0H 5DD0H 3BKCL 4YHLH 3NAAH 1U91A 4OD1L 2EECA 5FM4A 1SEQL 4KK6C 1P7QB 2I25N 2RAMA 5IIEB 1F42A 5C0DA 1JN6A 3L3GB 2YN5A 1OT2A 1NCNA 1TVBA 3X3GL 4U1HB 5L2KA 4D3CH 2IJ0C 3CDFA 1QSZA 2DOCA 1X5YA 2CR3A 5D7IA 4LCCC 5DJZA 1NBQA 4JY4B 2NY7L 4YIQA 3T4AA 4LCCB 2CUMA 1I1AD 3B43A 2ADIB 3LN5B 1MHHB 2NY3D 3B5HA 3FFDB 5GSRA 1OVZA 5KSAB 3DUSA 1QFUL 5C3TA 1QLRA 2D7MA 1MFEL 1G7LA 5EC1B 2YD2A 3P0YH 2IWGA 5D5MA 1IT9H 4JY5L 3N1QC 4OZGB 4PJIA 4QF1B 5F7MC 3L3HA 2ORBH 2GI7A 3GJFK 2XZQL 2YRPA 2ADJB 2P46B 3AY4C 3DLQR 1KEGH 2VDOH 4P9HL 1HQRA 3NCYP 2Q3ZA 3RVVC 4NN5C 1IGCH 2VDRH 4K3DL 4URTB 2DQTH 4ZD3L 1CGXA 4AYFA 5DD6B 2A6JB 1YEFH 1NLDH 4HMEA 4MLIA 4HAGA 1TFHA 5CBEA 1NC2A 3O2WL 5SWQB 4NWUH 1IC4H 1U8OA 3K74B 3QDMD 1YEGH 1IGIH 4QRPE 3JV4A 2VZOA 2EYTB 2JCCA 3OJVC 4FNLL 4K07A 4WWKB 4F58H 1J0IA 5MEQB 3FMGH 3IVKB 3BP6B 4F33A 1ZA6B 4WTXA 4K94H 4EVNB 3X3FL 2D4FA 5FYKE 2QADD 4R9HA 2BY3A 2J8UA 2D7TH 2DKSA 4UTBH 4RA0C 5TDOA 3RKDC 3QXVA 2PXYA 4HHAB 4YZFF 3ZMRA 5E24E 2HFTA 1R0AL 3H9SE 1JNHA 4ZOCA 1NH6A 4NKMB 4QGYA 3GJFA 5DHYB 2J6EA 4CNIB 2BHZA 4FQLL 5HYEA 4L8BB 1E4KC 1RK0A 1T1XB 2H41A 3JWNC 5H2BB 2OR9L 4TVPD 4IMKC 2KUTA 3T3ME 1KPVA 1M71B 3RWIB 4L3EB 2ICWI 4Q6IA 4JANB 1QFWI 4XC3H 4X6DA 5DRZB 2R1YB 4LIQL 4BH8B 4IEFB 1CXHA 1CLOL 1RZGB 3BH8A 4QYOB 5ILTL 1VGEL 4PIRF 4TULL 5K9OB 4RIRA 3TESA 4NZRH 4AEHH 4R90H 5HI4C 3EYVA 5T1KB 4O58H 5KS9A 4O9HH 1EH9A 5CS7A 5L6YL 4H88H 5E2WL 2AW2A 3KS0J 2BNRA 3BZFA 4Y2DA 2C3XA 4NZTH 3CUPA 2SEBB 2AEPH 4PB0H 4HV8A 3QUZA 1NSNL 3S36X 4FFYH 1GGBH 1RIVH 4U6VH 4Z7UA 2IANA 4PY8J 1MFAH 1T89A 3PGCB 2APXA 5TQ2L 1YMME 3CX5K 5ECJE 1UJ3A 1IKNC 4KKBD 4AEIH 5D71H 3RWCA 3L5XH 5C0BE 5LCVL 4CVZA 1CFVH 2QL1A 2GHWB 1CXFA 1FVEB 2EO9A 5C0RH 4JFFD 5ESAB 2DRUA 4NQED 1A6PA 3UXFA 5F7DB 3D18B 3KPRA 1EFXD 4WTZG 3WHXB 2NY5L 1NC4D 3BJ91 3GMQB 1O7VA 1U58B 5TH2A 2YEZB 4ZFGH 2P5WB 2IQAB 1QLEH 1WFOA 1HKLL 3VWKA 4GKSA 3LN4A 3AREA 3ILQC 1Z6JT 4KKBC 4X4ZA 4LLAA 5GHWH 5DJYA 4HKXB 2GTZA 3T0VA 4M6OH 5C71A 1WBYB 5DURB 1D5ZB 2XWTB 3RGVD 1JGUL 1HXYB 3VGAB 2CLRB 3MLPA 3M07A 3QPQD 1GH7A 2E5EA 4NKOB 2P24A 5GGQH 1U3ZA 4G7VH 4K71C 4UT6L 4FP8L 4J7RA 3ARFC 2VLJD 4PLKD 4H1LH 1FFOA 1RZKC 3MR9A 4HEME 1VFOA 3M45A 5AEAA 2CXGA 4HZLB 5I30L 2AJSL 1ES0B 3TO2A 1X3DA 4TSCH 5BXFA 1ZHNB 3CX2A 3QXTA 3WD5H 2DLGA 4MA1B 1GOFA 4TUJB 4OCLC 4U1NA 3EAKA 3WNOA 5D1ZC 3FOLA 5FYKH 1FL6A 1GGTA 4LLWA 2QSCH 2DQFA 5J13B 3RL2B 1JTPA 1A6TA 4U1GB 3S4SB 1JWSB 2UZIL 5CWSA 1FRGL 3EUUA 3MLWH 1VFMA 4L1HA 4U6XB 5CJQH 5HGGS 2PYED 3MV9B 1U6AL 2I60L 3MRKA 4MHHG 4EDXA 5CJ5A 1A7QH 4G80B 1GHFL 3RRQA 4NSKA 1RIHL 5IG7A 2AK4D 2FEEL 2GSGB 1Q94A 4HX1B 1RURH 3O3DA 4DQOL 1WWWX 3QJFB 1WGOA 1TPXC 5B4MC 4WW2B 3LQAH 4OF8A 2HJFA 4DGIH 3SQBA 5HYSB 5CCKL 1R3KA 2HT3C 3QEHB 4KFZC 3UCRA 1ZMYA 5D1ZD 3I02B 5AUMA 1FAIH 1C7SA 1I3RB 4MXWL 3CFIC 3RWHB 2WK2A 1SVZA 2QQNH 2BOCA 3SE9L 3TBTB 5J1SC 4GG6F 3SQOH 5IEHA 1LNUB 4AY0A 2PTVA 3HG1D 2F9BT 4E41E 1MNUL 3GKWL 2B1HL 3D69B 1CFNA 4OFYD 4PJ8B 1FFNA 3S98A 3G6AB 2Z8SA 3MRPA 4KKLD 3RUGB 1CD1A 3C60A 2V2WB 1QEWA 5ID1B 4O2FA 4QWWD 4JY6A 1PYWB 4KJQD 4Z7VA 2PR4H 4JM2F 4JQVC 5DJ2A 3CSBA 3MROA 5IVXB 1DBJH 2NY4C 2YA1A 4J3TA 2AQ1A 1OAZL 3CXDH 1XT5A 4WU5B 5HDOA 5I1GL 4MJ5A 1MREH 1FSKC 5CEXA 4K7PH 4LGPB 3MUHL 3PXHA 3FQTA 3EBAA 5CINL 3BPNB 4XPFL 3IXTB 3T2OA 5JQHC 1SEQH 3SGEH 3L3DB 4BKLB 3O3BB 5HVHC 3KXFD 5CBAB 3RPIB 4FQJH 2WBWB 3OR6A 4JFYB 3GSVA 1PZ5B 2VISB 5BW7A 5D7KE 5DQJB 4PP1D 2DM7A 1U3HC 3ULUD 3ZTJG 4X7FC 4DOHE 3HNSL 2NY7H 1EDQA 2FZ3B 3L3KA 3T0ED 5DR5L 2OX5A 1G7HA 2FATL 3OKLA 3IXAB 2VLKE 3BXNA 4OUUB 2C7UA 2BOBB 4PJBE 1GGYA 1YEHH 1JUFA 3LH2H 3IETB 5JLZB 3MO1A 1N6UA 4PJHE 4MB4A 1A7OH 4OGXL 5FGCB 3GHEH 1CGUA 2B2XL 4Y5YC 3BQUA 2X4NA 5DEFB 1UQSA 1T3FB 3H2WA 1FE8H 2A74B 3HRPA 3P73B 3U7WL 4IRZH 4X5LA 1HILA 4ZS7H 3AB0C 1AGFB 1KCRH 4CN4A 2GJZA 4XPTL 3FN3A 5MERA 4JKPL 2F54A 2FSEA 3QQ4A 5CMAA 1X5JA 1TJHH 1KOAA 5IR1B 2DQCL 4GAFB 2N7AA 2MHAA 5I8EB 2WWKO 2QHRH 3MV7A 3S5LG 3MZGB 1V7ML 1OGAB 5DQDL 3VFRB 4CMMB 3D39E 2XZZA 2ICEA 2XN9D 2VSCA 2PO6D 3VE0B 4U1JB 3S36H 5HHXH 1NEUA 1X4YA 1IGIL 1T80A 3S97C 4ODBD 3ZSSA 5DS8B 4WV1C 2YRLA 5TDPB 1F4WH 4H20L 1LO3L 5EORL 4CW1A 2FX9H 3FMGL 1GSMA 3VMOA 2IH1A 1MQ8A 1GXEA 1BBDL 5IF0B 1KC5H 5EDXA 4FZ8H 5L2JA 3HUJB 5DJ0B 2XWBA 1XF4B 2R0ZL 5E8EB 3H3PH 3O45B 5C8JA 3RWFB 5HD8C 3MRLA 3VDCA 4ODTL 1QRND 1E27A 1GZQB 5DFVD 2ERJB 3JWOC 3BN3B 5F3HA 5ITBL 1B3JA 2PYFB 3VXSA 4G6MH 5ACZB 3QIWA 4U0RC 1KENH 3LRSA 5CP7A 2D7OA 3DETC 3ZHDA 4ZTOL 1UZ8B 4UAOC 1ZLSL 4KJPD 5D7SL 4D0CB 1NGYA 2RQ8A 5IB3A 3C5SB 3OAZH 4TOYL 5FYLL 5DJ6B 1CLOH 4MA3A 3Q6GH 5ILTH 4MCZA 5CP7B 1VGEH 4FXGB 4PJ7B 1JGVH 3R0NA 3PQYA 2FH6A 2W0FA 5LQBL 3MBEC 1HNFA 1IM9A 2OXHA 1N5AB 2YMXL 2EE3A 2A83A 4KHTH 1HKFA 4P46C 3MRLB 2OL3L 3RWFA 5C0ND 3IFNL 3LN9A 1YEEL 4HKJA 4L4VE 4I0CC 1J1OL 1K4CB 4CRPA 4UI2A 4JHZA 3RDTA 3MRGA 1MFAL 4XC1H 5DEZA 5TQ2H 3TVMA 3UO1L 5JNYA 1MI5A 4OCSL 3MLTA 1YC8A 2DS4A 4WHTB 1M7XA 1PEZA 2DJSA 1EO8H 1QLFB 2JF1A 5CEYA 3SGDH 3TV3H 1CGVA 4YHIB 5IB2A 2FLBT 4WIQA 3WIHH 2ICEB 3MREA 3X12B 4PJBA 3KPSA 3L3IB 1U8JB 1MWAB 1KN4L 2BZDA 2NY5H 1BVKB 2XKNB 4XP1H 3TJEL 4NO5A 3EYQC 1I9JH 3UTPD 4X9BA 3UPAA 2X4RA 4X99A 3NFPA 1QLEL 2GJZB 4K3JL 2OZ4L 3QAZB 3ZDZF 1F3DH 5MHSE 2CIKB 5T3ZL 2A9NH 3C2AH 5SWZB 1SM3H 1JNJA 1FLRH 4M6OL 4JRXE 2IFFH 3UYPA 1G7PA 2BRRL 1BAFH 1SJVA 1Y18B 1N59B 3VFUA 3QUYA 3H0TA 3CFEA 7CGTA 2HWZL 3DIFA 1YZZA 1NBVH 1T5WB 2HRPH 1RUPH 4FP8H 1LK3H 4PGCB 4Y16B 4WRLA 1II4E 3B83A 2MTPA 3RP1A 3NCCB 1R5WB 5DI8B 3NFSH 5F93C 5FM8A 5F9DC 3QDME 1PGRB 5LKNA 3IGAB 1QD0A 3EZ8A 4WO4A 3ARBB 1OAUH 5I1JH 3MNZB 2Q76A 4I0PB 4G6FB 4UU9A 2AS5M 2VXUL 4HCRH 4ELMB 2C1PA 2EEAA 5KVFH 4Q58C 1J05B 1TQBC 2R4SH 4I13B 3H9SA 3LMJH 4K3GA 1S9VB 3QNYA 4ZNEA 1PG7H 2I9LA 1C5BH 1NCWH 1F4YH 2V6HA 2UVEA 3BKYH 4DVBA 2VJXA 4HUUA 3D9AL 2APWA 4X6BB 2ITDB 1RURL 5DJ2B 4L4TA 4M6AA 1OSPH 5I2IA 3TIDB 1F8TL 3V5HB 2DL9A 4DGIL 3IRPX 1QEWB 2NLJB 2VDLL 3WIIL 1XF3B 4JFFB 2QR0A 3BIAX 1KJ2H 4RSVA 5HHOB 1FFNB 4OLYH 4QRSA 4OM0L 1CFNB 4M7ZC 4BSVA 3MUGA 4HPOL 5ITFB 3UZVB 3S37H 4N8PA 4MD0B 2FL5A 3VXTB 3NABH 3VGEA 5B3JE 2BK8A 3WKMH 4Z8FL 4GMTH 5E8OB 1BECA 2XIDA 4JAMB 3SQOL 5J6GA 4HZAA 5LAXA 3NFNB 2CLVA 3VFSB 4GBXC 4P2QB 2VDML 4GAYB 1AQDB 1ND0B 2VQUA 3PF2A 1MNUH 4TSAL 5HGAB 4X9IA 3QEHA 3EDKA 3SKMA 1J9CT 4H0IA 2NZ9D 3VXNB 3CFEB 3JWDH 1Q1JL 1KELH 3AAZB 3D0VA 5FA3B 2FGWL 2VKWA 3QQ9C 4R3SA 4Z5RB 4LF3A 1DBJL 1NBYA 1KCKA 2FWOB 4R97C 3X17A 3L3OA 2H3NB 3LY6A 1F97A 5HHVL 4PTTB 4JKMA 3VGDA 4TVSa 4FMFA 2NY2D 4Z6AT 4J4PA 2JELH 4ZUWB 3OF6D 4HPYH 2N1KA 5E08H 5CINH 1C5DA 2FRGP 3ARXA 3PV6B 1WK0A 4XBPB 4MJIE 5EBMA 3VDBA 2DQFB 3D85A 4H8WH 2DTMH 3U36A 1Y0LB 4J3VA 3QFDB 1BWMA 3O2DL 3OX8B 3OKOB 4TUJA 1ED3B 3MBXH 4RFEB 4XNYH 4XX1G 5DRNA 4JREB 3CVHL 5F7EH 3SJVA 3UX9B 1MIEH 4QRRA 3B9AA 1RULL 1FFPA 3DARA 1UKQA 1HCFX 2JK5B 5A2JH 2MMXA 1WC7A 4S1RL 1W0VA 5HI4D 1RZKL 3WYRA 4XVUD 3HI5L 5HHMB 2FATH 5GRWA 3VRIA 5TQ0H 5I8OL 3QCTH 3GB7B 2PTUA 5KBNC 2AJVL 3RBGA 2H2PC 2CKBB 1I7TA 2J5LC 1A7OL 4OGXH 1A3RH 3EYUH 3VU2A 32C2A 4YJZL 2BXZA 1FNEA 3AS0A 3U7WH 1N3NA 3P77A 2O61B 3DTXA 5DZNA 4XPTH 3KR3L 2UZYB 1JL8A 4I5BA 2GAZA 1A6UH 2P5WA 3STZA 4C57C 2DQCH 2AABH 4RGND 3BQUD 3HAEH 4TPRL 5FYJH 4JN2A 3RWGB 4N9GB 1V7MH 4PTUB 2YK1L 1OAQH 3CFDA 1N0XL 1JPTL 4Z7WE 1OTTC 3CVHA 2FJFB 4O02L 5TFSL 1RUKL 4NCC1 3LRSB 4YHPA 4PRAA 5KS9E 1P4LA 1OTSC 3D39B 5ESAA 1KPUB 2X70B 3NCBB 2DJ4A 3T0DA 1MHCB 3L1OL 4JZJC 1LO3H 4Z7WA 4WNQB 2E9JA 5DJDA 4FFZH 2B1AH 4GT7A 2WLYA 4XCNA 1UJ3B 3MOAH 1PLGH 3RQ3A 1QFWL 1XIWB 3I85A 3RWEA 1QBML 1GC1L 2AXFB 1U8QB 5I1KL 3TT1L 5ESVB 1XF5A 4KXZI 3FN9A 4LL9A 3HNVH 3AGVA 3TN0C 1LO2H 2WQRA 5FAAA 5ITBH 1A14L 5HYJB 2RB8A 3FO0H 2A77L 3SJVD 3BP7B 4P2RB 1R3HB 5I1LA 4U1JA 4HXAL 5ICXB 3MV7D 3S34H 4CBPA 2KKQA 1Z9OA 4X8JB 1FVCB 4BH8A 4JQXA 4F8TA 3O8XD 2WZPD 5EFIB 2XTJE 2Y5TA 1BFVL 4XCFH 4WI5A 4YXHH 2FHFA 3BSZH 4PJGA 3QIWD 1BBJA 1VGKA 2J4WL 3UDWC 1X4XA 2UUDH 3ILPB 1NAKH 3E3QC 1S7UA 4CNIA 5I1IH 1N4XL 3LQZB 4PJDE 3SDXA 4DVRL 1CICB 2P5EB 4YBLC 1OAYL 3OHXB 1JF1A 1S7VA 5E2TH 4HIXH 1KCUL 4JFHE 4W70A 1OF2B 4O51B 5KVEL 5DJAB 4EUPA 4DZ8B 2J7LA 5FIEA 1J1OH 1FHGA 1UXSB 1T1WB 2A73A 1U3JA 3TF7C 5A3IC 2PN5A 5DK0A 4LPYA 1A1OB 4OZFB 1BVLB 3NA9H 3I9GH 3M17A 1VPOH 3ULVC 4TSBH 4PLOB 2R23B 4ZO8A 4RGOL 1D9KB 4JM4H 4XCCL 3CK0H 5TE7L 4RNRA 5DTFB 3UDWA 3RNKA 1KT2B 3WIHL 5KANG 5KG9A 1NAMH 3ZT5A 4TYUA 1KN4H 4XP1L 1QZ1A 4BKLA 4NM4L 5IESL 4X0KA 5DVLA 4DKDC 1I8IA 4Y19E 3QH3A 2EDRA 2H8PB 4R8WL 4X80H 5L9DH 5EWIH 1U3HB 3MCKB 4ODXA 5GRZA 3SPVB 3E6FB 4KRPB 5D5MF 1CL7I 3T65B 4LVNC 2A9NL 4G8GE 4OZGA 4YEFA 4U7MA 4U2ZA 1E4XL 3FT2B 5CJOH 2YC1A 3ARBD 1Q9LB 2IFFL 3TH2T 3V2AR 1F6FB 4Q9BA 4XVTL 1XCTA 5HJ3B 4QTIL 4QHLB 5ALCL 1CD8A 2D2OA 4P2OA 1GZPB 3B2VL 2BMKA 3FFCE 2X89D 4GG6E 1DBKL 3H9HB 5T3XH 4PJ8A 1WV7T 2ADIA 3EIFA 3LN5A 4HS3B 1W0WB 3MA7B 4I77H 1NGPH 5T5FL 4YIQB 3T4AB 4PGBA 4PP1C 3MJGX 4AT6B 5TPWL 5CGTA 3PWPE 4G7YL 3GO1H 2CH8A 4U1HA 5DD1H 4KV5E 4LNVA 1FL5A 1OAUL 1VEPA 2DD8L 1TJGH 1BZ9A 4KTYA 4EI5D 5HHQB 1HI6B 1MJ8H 1UKSA 4RFNC 2DLTA 4P2QE 4WV1B 1MHEB 3LD8B 3E1F1 3MRQB 1DTUA 1IKFH 2L7JA 1NGXB 4TTDD 5EZIH 4BFBD 1HEZA 4OZFG 1U36A 4NBXB 1CDJA 1IEHA 3TNNA 1T03L 5MEND 3PL6C 4R26L 1AO7E 1DEDA 2VH5L 5EUOE 3HG1E 1FC2D 3TGXA 1D5BA 4GRWB 2NCMA 1I1YA 4MNGA 3WNPA 2HN7B 2K7PA 2IG2L 4LFHD 4KRLB 1Q0XH 4NUGH 1X5KA 3SDCD 3KXFA 4OM0H 5E7BA 2A9ML 3UMTA 1QSEA 3QUXD 2P47B 3MLYH 3TNMA 2ZPKL 1Q9OB 1ZHLA 4JM2B 4NO0D 2Z35B 4FQ1H 5B39A 3LEYH 5HTSA 3LB6D 2CDEA 2A1WL 4U1IB 1UXWA 4N8VA 1QSEE 3WUWA 4YAQB 3AM8C 3OQ3B 1RZFL 5GS1C 4TSAH 2HTLD 4PS4L 3W5NA 5CZVH 3TFKC 3KHQA 3LPFA 5FKAB 1RQ5A 3BEWB 5MP6L 4K71B 4U1MB 4NQXA 2FGWH 2W9EH 4PGDA 3MV9E 1E6JH 3SDAC 5ACLA 4GW1A 1QFHA 2BVUA 4Z76A 3QDGE 4QRTA 4WUUD 1S5HA 1P84K 2VE6A 4FTVD 4OLZL 3LN4B 1NEZB 5T3ZD 4NQSB 1CN4A 3IU4L 2PUQT 2IMMA 4IBLT 4ODVH 1C08A 2X10A 1Q0YH 3GI8H 2VQ1A 4I8DA 1FSKB 1YDPA 2YD9A 3WHXA 4Z78A 4NQEA 4P5MA 3HZMB 4ZUUB 1LDPL 4DZ8A 4Z7OE 1JZ5A 4G8FA 2Z92B 3MV8E 1G9NH 2MQ3A 3BMVA 4P5TA 4WGVB 1MIEL 5J7CC 1LE9A 1TQCB 4EI6B 5GGVH 1YQ2A 2EYSB 1LO4H 1KSRA 4G9DA 1ZANL 3C6LD 1VGKB 2VXQH 3LPWA 4CADB 3AXLB 4UB0L 1S7TB 1SHMA 4YC2C 5AD0A 3WKNA 2BNQB 3P9MB 2WLZA 3O2VL 5EZLA 1TJIL 4KTEL 3JBG7 4I3SL 4I48B 5CHNB 2RFXB 4QTHA 4TQEH 4GJTB 4Y2DB 4X8JA 3EYUL 1MCQA 3MLVL 1ADQA 1ZT7B 4WCYH 5FA4A 3QDGA 4R7DB 3BP7A 4HMDA 3QPXH 5ESQB 5HYJA 2IPKA 4FFWC 4NFCA 3VWJB 5TF1L 2IBGA 4G6AD 3X13A 4YHZL 5K9OA 4OQ1A 4Y19A 3FQNB 1NC4A 2AABL 3TYFB 5HDQH 1A3LL 2WBJB 4WTZA 2PTTB 1AFVH 4UIKH 1OARH 1NLBH 1N0XH 4LVHC 4Q6IB 5LWYH 5TE6L 1IMHC 3SE4A 2R69H 4M62H 2ZUYA 4XPBH 4Y5VB 5DRXB 4MLSA 4O02H 3GBMH 5EZJB 5F6IC 3KYKL 2CDGA 5CSBA 3KLHD 4QY8A 4WWKD 2P8MA 4MJ2A 3ALXA 1NAMA 1FGNL 1MHCA 4JPWL 4EN3B 2EYSA 3FAXA 3GZKA 3STLB 5IGXL 2FYYB 3D39A 1X9QA 2F74A 4M8QB 4OM1L 3GI9H 1IGTB 1YQVH 2QHLA 4MQXD 2VOTA 3PQYD 5BRZD 1PLGL 1H0DA 3BMWA 4YZFE 1GRWA 1VEMA 1A02N 3CFDB 4MJ6B 4KY1H 2FO1A 2Y1VA 2GK0B 5IVXF 1MCWW 4JFDE 3TT1H 4RRPA 3U4EA 1S7XB 3HNVL 1CG9B 1PAMA 4IIQA 4JQIL 5IBTH 3RDTD 5DMIH 4PV8B 3UTTE 3TO4A 5JZ7D 1HZHL 4P46A 4CAGA 2VE6B 3LDBB 1FDLH 5KAQF 3LEXB 4JG1H 4PRNB 1IC7H 5IKCB 2EIEA 3KPMB 3VW3L 4MAUL 1TETH 1F2QA 4PLKC 3ARFD 4Q7DA 4F9LA 5E2UH 4HUXA 3CFJB 1QNZL 4JDZB 5IFJA 2G2RB 2C3HA 1UWEH 5A40E 2D9CA 5HYFA 1PDKA 2BY2A 5F7KC 4POZD 1RAMA 4JO3H 2J4WH 3ROLB 1VFBB 1KIRB 2HYMA 1HXMB 1QSFE 1QPXA 4ZFZB 3LKNB 1OAYH 5FK9A 1UGNA 2Y5EA 4QRRB 1KCUH 1J86A 3B9KD 3PDOA 1UADC 4LKXB 2VABA 5C0AA 4GG6A 4EDWL 4H25A 3P0VL 5E6IB 1L7IH 3RIAF 3RNQB 3V8OA 1I3VA 3K46A 4X4ME 4AJ0A 5K9KA 3ULUF 3BEVA 5JIPA 3DUSB 1EJOL 4E9LA 5ISZD 5DVMA 1JPGB 3BGAA 3JTTB 4KMLB 5L7XL 1QA9B 2Z9TA 4QXUL 3Q3GB 2Q6WB 2X1OA 2APFA 3CZJA