4XOBA

Crystal structure of a fimh*dsf complex from e.coli k12 with bound heptyl alpha-d-mannopyrannoside
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Cell adhesion
total genus 49
structure length 279
sequence length 279
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xobA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xobA02
1N0LB 2XG5B 3BFQG 4XOEA 4BUQA 5AAPA 2VCOA 5LNEA 5FS5A 2J2ZB 5AALA 4XO9A 5LNGA 3ME0B 1KIUB 3BWUF 4J3OH 2XG4B 3MCYA 4AV4A 5IQNA 5F3FA 4X5RA 1UWFA 3ZL2A 1PDKB 3SQBB 4XODA 5ABZA 1TR7A 5FWRA 4XOAA 3JWNH 3JWNE 4AV0A 4AVJA 5FLUA 1ZE3H 2W07B 2UY6B 4LOVA 3ZPDA 5F2FA 4AUUA 4CSSA 1KLFB 4XOBA 2JTYA 5CGBA 1QUNB 4CA4A 4J3OF 5IQMA 4J3OG 3BFWA 2JMRA 4CSTA 4XOCA 4XO8A 3ZL1A 4AUYA 4X5PA 1N12A 4X5QA 5IQOA 5AB1A 5JQIB 3RFZA 4AUJA 4AVIA 4AVKA 4X50A 2WMPB 4AVHA 5FX3A 3JWNG 2UY7B 4ATTA 4AV5A
chains in the Genus database with same CATH superfamily
2HX8A 4LHQB 1TETL 2HTLD 2RBLA 2TSBA 4GQZA 4U1NB 5E23A 3IFLH 4E41A 1BVZA 3GMPB 3ISWA 2B1HL 5AW9B 5L2KB 1TUPA 3HN3A 3SKNA 3ARYA 4HMCA 4MDIB 3L48A 3WE1A 4DEWA 4DP2X 1RPUA 3A4FA 4KKLD 2CDEB 5FYKL 5DWUL 3DO7A 1G9EA 4PRDB 1EGJL 5GRXG 2BSTA 3WHXA 1JZ7A 3MRDA 4M5SA 1AR1B 4J8RA 1RUAH 2WWKO 5DDHB 4G9DA 4JY5L 3QZPA 2H3NB 3ASNB 4K3JH 3ATBA 3EJYC 5C07D 5DA4A 4PREA 2QQNL 1AI1H 4FXGB 2X6MA 3WU1A 2UY7A 3O4LA 1HE7A 1VKXA 1I3GL 1T1XB 3FDWA 3BW9A 5KSAB 1UOLA 4AK2A 3K5RA 4M93B 2V7HB 4Y19E 2PTVA 2XN1A 3WIFA 4MNGA 1FO0A 5MI0C 3SPHA 1NCAL 5HDQH 3K6SB 5CM1A 1WLHA 1IKOP 2HUEA 5EFIA 5D2NB 2KH2B 4XGZA 2PO6A 1ZK5A 1DBAL 3NP4A 5E8PA 1MHPL 2X05A 1UM6H 3S2CA 3K81A 3LQZA 2DQFA 1T3FA 1NEZA 3DETD 5KVEH 4F3FB 5F3HB 3CFKA 3VH8A 3X3GH 1OAYL 1WITA 1X5MA 2G75B 5MEPB 3U46B 4NRZA 3D2UA 1CL7I 2C9UA 5T1KB 1IL1B 2YZ1A 3BAEH 4WFGD 3F7VB 2VISA 1S7VB 3LRHA 3I3EA 4GRLC 5IHZB 1ZY9A 1T7YA 2ZX8A 3DSFL 3R0MA 5BV7C 3FULA 3FTSA 3P3UA 4M5ZL 1KFGA 4JZOA 4UM8A 2IV8A 4WSGA 4J3SA 1K5WA 1UWEL 5CBAA 4AQ1A 1BM3L 2H32B 2QFRA 1CVSC 3CN2A 3LKQA 1IGFH 4QF1B 4NO0A 4BA0A 1YEDA 3ET9F 3F5WA 1XZ0A 2H9GB 4HUVA 1DQKA 2V3EA 1U93B 1DUYB 5EOQH 5TDOA 1HYRC 3SDXB 3UYPA 3IMRA 1KCBA 1U8KB 1BWMA 2J72A 1JPST 1IEBA 2GJ6E 5D5MB 3VRJB 3C60C 4Z7UA 2ITCB 3WGVB 4HUXB 3MRCB 4HOWA 1FZJB 4ZW7A 5FFGA 4WGKA 2YLHA 3CDGB 1Q9KA 3FCUB 1R33A 5GRYA 1A6VL 3ESMA 2CRYA 1IJNA 1EFXD 1EFQA 1ASQA 3M86A 3X17A 1ILSA 3VB9A 1IM3A 2AV1B 1O7DC 3V6ZB 6CGTA 1KWKA 4EOWH 1B3IA 1I1FB 2X4PB 3HE6D 5B21A 4CBPA 3QUKA 4JHVA 2B77A 4MHHI 2L7JA 1AHKA 1WBXB 3THML 1PW3A 1KLGB 2A6IA 4O00A 2JJSA 1A9EB 5FIEA 5D7IF 1KIPB 2QMJA 3DA0A 2CIIB 1J1PL 2DWEA 3G5XA 4GPVA 5LBSL 5HYSB 5KVDE 4OVUA 5HYQA 3JTTB 3HNSH 5C08B 1AZNA 4K8RC 1XCQA 4Y9CA 2YKLH 3LD8B 1I1YA 1V8HA 1AR1C 1QSEA 3P02A 2CDFB 1HOCA 4UIKH 4A7QA 1ACYH 3QDMA 4M1GH 1CI5A 1AGEA 2VSCA 4ICXA 1UZ8B 4GRWB 2CKBA 2BSBA 4GOSA 4LCUA 4ONHB 4PV9A 5E5MA 5FHAL 3DLQR 4FXGC 2JKWA 5DD6B 3TPKA 4AMXA 5D93B 3ULSA 2EAEA 3CVHL 4H0GA 4KO7A 3SPGA 5KSAC 2XN0A 2GK2A 4LL4A 3SHSA 5E5UB 4M93C 3MFGB 3D3VA 3L4XA 1ZT4B 5AZ2H 3PGCA 1HTYA 5D2NC 3PABB 5CCJA 2J88H 4XN9A 5D1QE 3VGBA 2X4OB 2YEVB 1EHLH 4ZX5A 1J1OH 4X6DF 1IUZA 4PRAB 4DFIA 4WHDA 4X5LA 1OO2A 4X9BA 4ZZKA 3OKDB 3CH1B 4PY7A 5ANHA 1AKJA 1CFNB 4FD0A 3LPPA 4R7NB 2BY3A 4BE6A 3NN8A 3C2AH 3J8F7 5F1IA 3B9KA 1ED3A 1MNUL 4ZO9A 1P6WA 1NPNA 1QUNB 2F7PA 3FSAA 3MZTA 3ESVF 4ODWB 5KYUB 3GZPA 3MLVL 2IOIA 4DPRA 3RGHA 4QYAA 4MAUL 4UYPA 3MNMA 2YPVA 3AQDA 1KTBA 4GUCA 1BAFH 4XOCA 1W2KT 1FRGH 1WAAA 2CJ3A 4D7PA 1RUKL 2Z4TA 1SYVA 4HIPA 3EJCA 4QRFA 3RI5F 3T6XA 3KPPA 1XH3B 2RQ8A 5C0CA 3UGUA 3L3GB 2BOLA 1Q0EA 3S35H 2NR6D 3LRKA 1U8MA 2F61A 1W72L 2QV4A 3IDMB 5C07A 1KXTA 3WCYA 5J6GA 1FF5A 1JBJA 4ZW8A 4OFVA 4JDVA 1E7VA 2W60B 1UD6A 4EDXA 1E6JL 3I02B 3C5JA 3LH2L 4XPFH 1I3VA 2LT9A 4YIQB 1S8DB 1LD9B 3CBRA 3GMOB 1J5OH 2WNWA 4ADGA 4PJEB 5F89A 3WS6A 3DTXA 1SOXA 2PTTA 3H9YA 3EUUA 3QIUA 3Q2CA 4AI7A 4HHAB 1D3CA 1DBJH 1KTLB 2H4EA 3BWAA 4M1DH 3GPEA 3ZR6A 1ETB1 2A6DA 4IHOA 3VYPA 4P2YA 4PW3A 3WENA 1UWXH 2WMPA 4LZKA 1FVCA 1SNRA 5EZIH 3FT3A 4P2RE 4HZ1A 1AJ7H 4ZPVA 1MELA 1OANA 4YUEH 1TZ8A 2IFFH 5CJBA 2ZXQA 1S2EA 3Q3GB 1VERA 4JFOB 4QXWA 4X4ZA 4BWUA 3N1MC 4KK6C 1OM9A 1KBVA 4JE0A 4R5VA 1AR2A 1LP9A 2CDGA 3SOBH 3MNDA 4RMRA 3HZVB 4LE8A 4XBGB 3V4VH 5CCKH 4K7FB 3L4YA 3SE8H 3SQOL 5I1LB 2EYRB 4FFTA 3VM7A 2BVOA 1EZLA 5IG7B 4R9HA 4HV8B 3LD8C 5HGBB 5DSCB 1QBLL 2HJFA 4ZOCA 2C26A 5HHMD 3PHOB 5E2WH 3TN0D 3DUSA 3MXVL 3VWJB 2D4DA 1KWGA 2RHEA 4LXFA 3RA7L 3TBVA 3VE0A 1RVFL 1TZIB 4QHKJ 1VFMA 3TP4A 5D93C 5KVGE 2FGWH 1U33A 4RX4A 2ESVE 1KCWA 3QNZA 1Y18A 4TVPD 3U30C 3HAEH 3PJNA 3INUL 3IF1A 4JFWA 5LG1A 2IANE 3FHAA 3GJFB 4G6AC 2NNAB 3BZ5A 5E9DE 2VABA 2FLMA 3ZXAC 3GKWH 3T0XA 3GHEL 1R46A 1PG7H 1OTSC 3DTDA 3TIEB 5TDPB 3OKEA 2DEXX 3P73A 4R7XA 3HE6A 4D8PB 5FOJA 1EEUA 1GGIL 4FA7B 1E4XH 4F5CE 4NQDD 1BG1A 1CLYL 4P2OA 4RAVA 4GBXA 3ZKMD 2NPLX 15C8H 2DRUA 2QMKA 1RMFH 1TU2B 2A9MH 2JELH 5JOFB 5JHLH 1XGUA 4I8DA 2CPUA 3UTPE 3FQRB 3MNVA 5MEQB 3QDJA 3MSPA 4LSUL 5DGRA 4H44C 2CMRH 2A6KB 3FB8B 5GZND 4RMQA 3PDDA 3WFCH 3VD4A 1CE6B 4XNBA 8FABA 4XPTH 4L8CA 1UATA 3RNQB 4ETQA 5T5FA 4LLWA 4Y9GA 2CBPA 2WTPA 2X89D 1XAKA 5ESVB 2CE6A 1DJHA 4YNYB 3GJEB 4S2SB 3FRPB 2Q9OA 2WNKA 1SF3A 1WHPA 1YECL 4F7TA 2HWZH 1Q0XH 4ODUA 4KVCL 3GIVB 3DV6B 3GJFK 4UANA 4MAZA 1FCCA 1B6UA 4U7MA 5J7CC 1AHWA 2CJSA 4PJ7B 5HJBA 5K9KB 1IEHA 1DDHA 4NCC2 1PQZA 1IAKA 1O5DT 1QO3A 3PP4L 3L2NA 4Y4HA 5DC0A 1KGCE 4JPQA 2AJYL 1QASA 4P3CL 2V2WB 4R0LB 2IPKA 1E28B 4KGJA 2F68X 3MOBL 3ABZA 2LLGA 5J4MA 4P5KB 3IJEB 1HYSC 3WTVA 3UMTA 1BQLH 5EC1A 4JNXA 4TNWF 5KVGH 4WKXA 1BJMA 3G5VB 2EEDA 1I8LA 4AEHH 3B2XA 2H2PD 3PNWB 1OGAA 2ICES 2OXGA 1BX2A 1PF3A 1XZWA 3OGCB 2EVFA 2XQ0A 1GJUA 4PLOB 1T0NB 5IB2B 3CMGA 4NENA 4S1SH 5GRZA 3CSBA 1PDKB 2H26B 2GT9A 3CSGA 4Q9CA 2XKSA 4X9HA 2ITDA 3FF7A 3ULUL 4YSAA 1OHQA 1JRHL 2F08A 2YGVA 3DXAA 4PGDB 4OCNC 3VGEA 3DKHA 4ZUUB 3BXNB 1N6UA 5D7LE 5G4OA 3IXTA 1XCTA 2XFXB 3DX8A 3WNNA 3EFDH 4OGAC 1QWUA 1H3UA 3VXTB 1R19A 3PE9A 1ZSDB 1FDLH 4TUOA 4YR6A 2V9UA 2FEDD 4LCWD 3D9AH 4IKNA 3ZSSA 4ICWA 1PLBA 3S5LG 3OHXB 1A3QA 4JPWL 2F8OA 2DQTL 2IVFC 4W9FC 3VWJC 1I3RA 5AKSA 3AQZA 3WJJC 4Q2ZB 5J3HC 2P9RA 1PAMA 3IFNL 4GKSB 4Y1AE 3WEXB 2OYPA 1M9WA 4BKLB 4PJGA 4HH8A 4JPIA 4FTDA 3DGDA 3WELA 1CR9H 1VIWA 2BJMH 3ZKNC 4NHCL 1BVKB 3UDWC 2X38A 1BBDH 1N59A 3K74B 5I73B 2OJEA 3WYRA 1NGWB 3ATFA 4G8FB 3WN5B 4XXWC 5L7XH 4Y19A 1GTFA 5D7EA 4MA8L 4JHBA 2V17H 5I8KH 1QYGH 1R3LA 3BUPA 3HPLA 5BRZE 5AB9A 2DPKA 2EDRA 2OMTA 2N0KA 2XN9D 2C5DC 1JI2A 5B4MD 4YWGH 5DI8B 2VUOA 4QTIL 4DH2A 1WSST 1QLEH 5ANME 4RA3A 4WTWA 4NOFA 2FQEA 4XMLL 3AJ7A 1OOWA 4EIUA 4S1RH 3VD9A 3ROOA 2O61B 3QNXB 3L5WB 4J4PD 3FFCD 4EN3A 3QCTH 1S5HA 1SHMA 1EVTC 2GFBA 1BW8A 3S7GA 2R0LL 3FL7A 3KWXA 3AWGA 1JGVL 1ZVHA 4PJXE 1JPGA 1E6OL 5D4HA 4MJ5B 4HKBB 3MQIA 4N2OA 1A7PL 3QVAA 3SGDH 2WIIA 1P5UB 1CTOA 1BLIA 5JR1L 2ZG2A 3D39E 1Q4NX 1RZKL 4OF3A 3QUMH 4GRMB 4OT1L 3UAAA 4OGYH 3RJDA 1JIBA 3L6FA 1OHZA 4LSPL 2Q76B 4O2CB 2LLLA 5EO9B 3FN3A 3E1ZA 4AMKH 3BP5A 3UTQB 4GMSL 1QKZL 4H1LB 1NGQL 4P5TD 2VDRB 1IC1A 3F05A 5LWYH 2ADGA 4LDOB 1SDAB 4P49A 3TA3B 3BCFA 4XXDB 1MJ7L 2BCKB 2QR0A 1S3RA 4XODA 1NC4D 1DJIA 2HFEB 1CT8A 1G9MH 1JK9B 1FNLA 3DJ9A 4G1EB 4ONFL 3ZE2E 4JPKL 1A6UH 3O6FA 4BV1A 2C1PA 1FE8H 3LKPB 2N0MA 4NBZB 2Z7UA 2DLHA 3U0PB 1PY9A 2RMNA 4JY6A 3GDCA 5DMGD 5ITFB 5HD8C 1E43A 2F53A 4Y9BA 3W2DL 5T3ZH 4ACTA 1JWMB 5BS0D 2HRPL 1NCGA 3JT0A 5GRWA 4WO4A 3TZVA 3BN9D 5FKPA 5IJBC 2NQDA 3X1NA 1P4LB 3DHMA 5BOZG 4XNUH 2XV3A 3GSNL 2AABH 5HDOA 1Y6NR 3IBEA 4HCRL 4XAWL 2EIZB 3T2NL 4A6YL 1U8NA 4E5XA 3V79C 3GBML 4LPYA 5TE4L 3GHBH 1PZAA 4FFZH 4W9GC 4E9RA 4J23A 2XPGB 3SQBA 5ICYA 2GTWB 4ZS7L 3MUUA 4DGIH 4Z3TA 1BGXL 4OAWA 2WLKA 3QFJE 1QSFD 1XXDC 3OL2A 3S88L 3ATEA 3OHXC 4K7PH 2AJZA 3CDFA 2IQ9L 2E59A 1HQRA 1PLGH 4ISVA 4UIMA 3E8VA 1BHGA 4PWHA 4BWTA 4OZIA 4FTVB 4N2NA 2QEJA 3FAWA 4FXKA 5EMYA 4LO9A 2N1KA 1QA9B 1S7WB 1K85A 5IFJB 4CVUA 2YWYA 3MRBA 4MS8C 4G6JL 4LCVA 5I82A 3K6FA 1RZ7L 5IKCB 4ODXA 2WVUA 2BFGA 2MTAA 3RQ3A 5B8CA 2OKMA 1U8IB 1NCCH 4L37A 5I73C 1UM5H 4PJIB 1LWJA 3P0VL 4X6CA 3HPJA 3WN5C 3CLWA 4MS6A 3GEFA 3QUZD 4KDTC 3SE3C 3NAAH 2I25N 1LE5A 4U1MB 3TEUA 1HXMA 2FJFB 1DR9A 3MLZH 1NBZB 4XWOC 3TBBA 5I5IA 4MA1C 4NYLB 4X5XB 4Y5VB 5C6TH 3CHOA 5D1QA 1LWRA 4OFIA 1EK3A 1ZHNB 3ASOB 3V4PB 4Z7QB 3OKOB 3SDYL 1NQBA 3V4VA 5LHDA 3LB6D 3TV8A 3PWUB 4WY7L 1AIFB 3DI2B 3QIWA 5C0BD 5FOBB 2KPWA 1KOAA 2CHXA 3D69A 4P57B 1N5AB 4P06A 5FYKE 4L29B 2UWEA 1CJYA 1EO8L 2Y36L 1RZJH 4U7SA 2XG4B 3WSQH 3ZTNH 2IADA 2O6FA 3LVTA 1AQ8A 1FZOA 1PZDA 2W38A 3BDXA 4MNQD 4F8OA 1SJHB 4HXBH 1QLRB 4APQB 3MJ7A 1P5UC 3BP7A 5DHXB 4ZFGL 5IJVA 2QKSA 2EVIA 1FHGA 4BQ6A 2H1PL 4PRPE 3ECWA 3HAEA 3Q6FB 3WEAA 3WY1A 3ILQC 1T22B 2EEXA 2QQKL 1ASPA 4KTEH 4XXCC 5EO0B 1L9PA 3BYTA 2W95A 2XOTA 1W15A 2KT6A 3VWKB 4IU2B 1NKGA 4Y2DA 1MCBA 2FR4B 2KS0A 2MCAA 1N6QH 4FNLL 3MA9L 4HPOH 3V7AG 4BFIB 5C92A 3NRFA 6FABL 1QR4A 1DVFD 3U83A 1DL7L 2BZCA 2QFPA 2WKGA 2CU9A 5LBVA 2NZIA 5CJOL 1HHHB 2NW2A 4BELD 3TA3C 4ZFFB 5FUOL 2DL2A 2CLZA 2XN9A 3O3DB 2R23A 4QRUB 2JXMB 1UHVA 4F37K 5HYJD 2NUTB 3CXDL 2XSKA 2R0ZL 4OGQC 2WQAA 2RGSA 3HZKA 4DO6A 1A4JB 2WXRA 3KJ6L 4ZRGA 5C3IA 4CMMA 1KENH 4X6BB 1EAJA 4KRNA 3O3AB 5IF0A 4MVBC 3L9EA 4XNXL 3IDJA 3FFCA 1HAUA 2FB4L 4J3OF 4ELMF 2NLJA 3HI1B 2A2QT 4GKNB 5FAAA 2OMYA 1FNFA 4M7LH 4NQUA 3ZX1A 5GRJH 3ZQXA 4W9ZA 4HIIA 4LSVH 4XB8A 4YGVB 4P9HL 3BX7C 3CFEB 3P9LA 5E8NB 2WOBA 1HSAB 3F8UB 1N12A 3EO9L 4KPHL 2G5UA 2AQQA 1X9QA 3KPLA 4NO3A 1TETH 1ERNA 4EO5A 4X7TB 2B1HH 1EBPA 2OMXB 2QBWA 4AUJA 2ZCHL 2X4UB 1MQKH 4AVIA 5HY9B 3MGOA 4R4BA 3B2MA 3CG8A 4RGNB 4JFPA 1IT9L 5FYKH 5DWUH 1VFOA 3JV6B 1EGJH 2EZ0C 1FORL 2G0KA 4JZJB 5BCAA 3P3YA 3EJQA 3LV3B 1OW0C 4TNVK 4KTDL 4MXWH 4DUXA 3ARUA 4L3EA 4JRYE 3O6LH 2P5EE 5F1NA 3ROLB 2QQNH 4EUPH 1ASOA 3I6LD 3WG7B 1N8OE 4OKVB 4KMTH 3EOAB 5E9DA 5EO1B 2E4TA 1KJMA 1I3GH 1RU9L 1SHWA 4JKNA 1C9SA 1BYPA 2JKRM 4OKDA 5I66A 1S9XA 4HEPG 5I8EA 5F7HA 2DQJL 1VEPA 4Y5VC 3WAKA 3NBNA 2DIEA 1ANUA 5DZAA 1OT1A 5DMKA 1NCAH 2EDJA 2GAZB 3ZDXF 3OKLA 3W39B 3BVXA 4FL4B 2X1XR 4MZRA 1DBAH 1OGSA 1NC2D 2GC7C 1CQYA 1MHPH 4OQTH 4Y4KD 1U92B 5AYTA 2IBZY 4MMYB 4P23A 1OAZL 2PYEA 5IIEA 4FFWC 1W6WA 1OY3B 2G9KA 3RL2B 5AD0A 1VF5C 4TULL 3EH3B 5GGSA 1A1MA 4BBWA 3TVMD 5DZLA 1JGDA 4JFDA 1ROWA 2IPTL 3A24A 3G5ZA 4APQC 1KBKA 5DQJA 4Z9KB 4M5ZH 4WGWB 1S7TA 4WEUD 2ERJB 2K45A 5L9DH 1UWEH 1CF8L 4N0FA 2BVTA 4B9ZA 2LU5A 5FO8A 1E9PB 3VWKC 3QXDB 5IBLC 2JB6A 1GMEA 2VE6B 2FIKA 3N40P 3PDOA 3ZPDA 4BSWB 5DS1A 4AWJC 3EUDA 4BZ1L 4JQVA 1FL6B 3A23A 4DP5X 2VZSA 4KDVA 3EZ8A 3NFSH 1E4KA 1UA7A 5F1SA 1G1YA 1KPRB 5E6SB 4EKJA 3PNRB 3VXMD 4Z3GA 2ZT9C 3QQ3A 2EDWA 1MRCL 1T21A 4FG4A 4JO1L 1NCWL 1Z7JA 4Z7VB 1A6VH 1WGOA 2IGTA 4OIFA 4Y5XB 4ECNA 2QGDA 4HCIA 3K2KA 4KJPC 3CXFA 1AP2A 1Q1JL 1SYSB 5GHWL 5D8JL 2XIIA 2APVA 1GXEA 3P9MA 1DVUA 4HALA 1EERB 2X40A 3MRQA 3SPIA 4LRIA 3I6KB 2A3TA 1F41A 2X10A 4FZ8L 1I7RB 4FHKA 5CP7A 3QUMA 3GINA 2DJMA 1RERA 2YD9A 4E9SA 1AO7B 1KGJA 2G0LA 1NL0H 5IHHA 1USQA 2WLIB 3KYOA 4WEBH 4ZDHB 3KJ4B 5B39G 2XZAH 1G7QB 4PLKD 2AC0A 4ABVA 4F1ZA 4RGNC 1HHGA 3Q1SL 2A74B 2QTEA 1GJIA 2XQYK 3MA7A 4JZJC 4PRBB 3QUXD 3DPDA 4MD5A 2D3LA 1XR8A 4NQSB 3FCSB 2DWYA 3HRZB 4YHLL 1KG0B 4A2LA 4WHTA 4XCCH 5FHAH 2XBTA 2YPLD 4G8GD 3Q8BA 2LFGA 4WHYH 2WHVA 2FGZA 3C6LD 1ZVNA 3Q2WA 1F6LL 3LRSA 3P69A 3MHZA 4NNYA 4K07A 1T83C 2MHAB 2VO5A 3MXWH 4RRPA 2J7LA 2WO2B 5HDLA 5BRZA 3K4DA 5AKRA 5DEGA 2DV6A 4BINA 4FL4C 2OXHB 4NJAL 3T3MF 3IGAB 4BFJA 2VLJB 5ICXA 3TX4A 4FFZA 1I4FB 1JZ5A 3NACL 1XO8A 4QLRA 3ZR5A 4EVNA 1BD2B 4WK2B 5E5RB 4JFED 2OW7A 3QB7C 4TQ8A 3QQ4B 4ZSOA 5T1LD 3RILA 1SGKA 4PP2B 2R1YA 3C6SB 4OUOA 1C1EH 2YD1A 3CLFL 1NBQA 5SWZB 1ZE3H 4XAKD 1I1CA 1ZGLB 4QTHB 3MO1A 3KGUA 4PJXA 1YEIL 3HUJA 3IMTA 4WO0A 1OSZB 2I85A 5DO2C 4FNRA 3QRBA 4WW2A 3S96A 2ERJC 1S9KC 1PS3A 2LU4A 3WUWG 2ICWB 3D39A 4MQXC 5IR1B 3SE4A 2FAUA 1XL4A 4DETA 1I7ZA 4QRPA 1C7TA 2NY4D 3B3IA 4J3UA 4QY8A 4X4YB 1FFOB 3BAYA 3D5OF 1YDPB 1CK0L 1MW1A 1C5BL 1E6JH 3NCYS 5KSBA 2WQSA 2DQEL 5DUBA 1OGTA 2IBZX 4NPKA 4EI6A 5CO1A 4LKXB 4TNFA 4O5LL 5F72S 2X4QB 3C5ZD 3HB3B 4K15A 5A2LH 2XTJE 3DX3A 4E0RB 4KJYA 5ETUB 2OYLA 4BSVA 2P1YA 5IV2B 4GIAA 4L8BA 2CD0A 2BRQA 3GSQA 4AGQA 4F33A 1ACCA 1L3WA 4PIRF 4JJOA 3SDAB 3FTGB 4LBEA 5CKGA 4NXKA 1KJ2H 5INDA 3O0LA 3HR5B 4UBDC 3BZEA 2ZCLH 3IXAA 4PJ9A 3CCHA 3S97C 1JUFA 5DSCA 5JQHC 1TQSA 3QFDA 4OY9A 5CWSB 2WQVA 4IGBD 2VDKB 2DM4A 1M9SA 5TQ0L 2DTML 4A7TA 3W9DA 3KS0J 4JDEA 4KO5A 3CZNA 5FECB 3LS5L 3KJ4C 2IJ0C 3LQAL 4NAQA 3M7OA 1KJVB 1IFGA 1Y0LB 3RU8H 2UXGA 3IE4A 5DJZB 1G43A 4Q6IB 2FNWA 3EH1A 5E2JA 3SQOH 1CXHA 2A74C 4R90H 3HC2A 1JD7A 4DVRH 1QBLH 2Q2LA 4XNMA 3X13A 3RPKA 4RZCB 5CINL 5FYJD 3P4LA 2SODB 3HRZC 4KNUA 4P07A 3BESR 4MTMA 3T8MA 1L9OA 2VL5A 4U6XA 1RVFH 1U91A 4IRZL 4URTB 1RI8A 4Y88A 3VI3E 1ZDQA 3HW7A 4I2XE 1GZHC 3IJHA 3ARQA 2CR0A 5GS3A 2UZIH 1V3MA 1INQA 1TVBA 1MXDA 1JVKA 2BOCB 1L9RA 2X6UA 3INUH 3NOIA 2VDLH 4AYFA 2R51A 2Q5BA 4KMLB 2GCYB 4AYEC 4P4KD 4U1LA 4Y5YB 1UZGA 3RVUD 4PJAB 1N18A 3BP4A 3ULUE 2QADB 1AOZA 5GGUA 3DVGA 4DHLA 1DQJB 3GBLA 4YHZH 1GGIH 4UUJA 1MI5D 1RFDL 2CK0H 2D9QB 3MV8B 3MDJA 1F97A 4N0UB 3LDBB 2BSEA 1UB6B 3B2UD 2DQUL 4KJQC 3QYCA 1Z5HA 5KS9B 4LDLB 1EGJA 1MIMH 2QZQA 2IMNA 2QJDA 3ARGD 3GS0A 4JRXA 4KTGA 3U0TB 2Y2TA 4GG6B 2XKNB 5EIVA 5I5MA 3RL1B 1ONQA 1FYTD 1I8KB 2DQGH 4C55A 1WC7A 4MASA 5DLLA 2X12A 5HJDA 3RIFF 4EUPA 1YEKL 2NXYD 3PWNA 4GYBA 3W37A 2I9TA 1VGEH 3WY4A 5DHDA 5T3XH 1FC2D 5E0FA 2AQTA 1WE5A 4NLAA 4YHNA 3CWGA 2ZSWA 5GPRA 2K78A 1CFMA 3UTOA 1F45A 1SJEA 2DBJA 1HX0A 4G6MH 1YECH 5GJTH 4AX3A 4ZG1A 4YLQT 1EV2E 1MAKA 1U3HB 5LJYH 1F13A 4A55A 2FNBA 1URIA 4NPYB 1IMHC 2NX5D 3PP4H 1MVUA 1QPXA 3G6DL 4U2ZA 2AJYH 2OTWA 3GM8A 3HB3C 3BGMB 3POHA 3VRIA 5J56B 1R1CA 4DZ8B 5DUPL 3MOBH 5CD3A 3JYCA 1U8OB 4DK6A 1MLCB 2WLYA 1KXQA 5EUOB 3DIDA 3E80A 1P7BA 3M46A 2ZP9A 3R4RA 3FT9A 1Y1DA 2VCOA 4HH9A 3SDAC 1QSVA 2OJ1A 2JJTA 3EH2A 1ZAGA 2HLFD 3C5SB 3CZLA 4KQ3H 2AS5M 2NYKA 3V5DA 2QVMA 2IXQB 5GIRB 3DRQB 5BUPA 1N0XH 2IWFA 1JDCA 1E5ZA 1WQVT 3MBED 3MYJA 1ZJAA 2OL3L 4KVNL 4UTBH 1K9TA 3ULUH 1PLAA 1P6FA 3BVNA 1QTPA 2X1QA 3VD0A 4N25A 3IRZA 4BFBD 2A1WL 2J8UB 2VR8A 1R3IL 1XF3A 3AQYA 4R4ND 4Q6IC 5KYYB 5KAQG 1QI5A 1GPOL 1XGRB 2DLEA 3R8BB 1X5JA 4JHZA 3DURA 4J28A 4N90D 4RSYA 5D1ZB 4UDTB 4C58B 1IC5H 2ZG3A 3DMMD 2Z1KA 5E9NA 4FQXD 4TOYH 3MODL 3EGSA 5EWIL 2GQHA 4G82A 3LKRB 1QABA 4JPWH 4XN1A 5MERA 1SUHA 1W0WA 2OLDA 1SJMA 2HSIA 2VIRB 4XRCA 4HIXH 5JDJA 4IK7A 1H3TA 1AGBA 3EH4B 3MX0B 4L0PB 4QRTB 2P5EA 1NCNA 3ALWA 4XCNA 3HZMB 2VM9A 2FL5B 2AJXL 1ZGLM 1CICD 4NHCH 4DK5A 2HVBA 1HHIB 1ZA6A 3IU3A 3VYNA 4C56D 2VMEA 1JN6B 2KUTA 3RWDA 4H26A 5I1AA 5CR8A 2F15A 4N2AA 4Y5YC 1DTUA 1BFOA 3O11A 2QADC 1EVUA 1EAQA 2XX1A 1BZEA 2ADYA 1YQ2A 5FK9B 3TH4T 3UGXA 2JKIS 2HJKB 3ARFD 4KROB 5IMMB 3A6BL 4LSRH 1RK1B 4QTIH 3N91A 5K9OA 3X14B 3LDBC 4NZRL 3AACA 2G9HB 2YFNA 4UNIA 5DRNA 4XMLH 2BCMA 3OMNB 5GSVA 4ZXBD 2HFFB 1BQHG 1T1ZB 4HPHA 3AQXA 3T08A 3N41B 1D6VH 3DSNA 3II2A 3TCTA 2VLRB 4OF6A 4HUWB 4ZT1A 4PS4L 2YQ3A 3CBJB 2CUAA 2FEEI 5FV2A 1JTTA 4PPTA 4Y4FD 1J12A 4XI5C 5K5YA 2IWEA 1WA1X 2N56A 5C6WH 1U8PB 1SDDA 2GSIA 5IM7B 4YLCA 4UV4L 4KJWD 3AMKA 5LAPA 4MD0A 2W9LA 3PU7A 3HZYB 1U3HC 3MRRA 4LSPH 1G4MA 4IKIA 3FU7B 5T8IA 3L1OL 2E5EA 2L7EA 1RZ8A 2ATAA 5KJRL 5MENE 1TTRA 4P4KA 7PCYA 1T7XA 4PB9L 4Y2OA 3DX6A 2PCPB 1K2DB 1KTDB 3KYAA 3KEHA 1VGKA 5ABDE 4CU7A 2GBVA 3GBEA 4PGJA 4QRSB 1X5XA 4PRHB 3LXBA 3MREA 5DS8A 4HDIA 2G5BA 2IPUG 3AS0A 3OKYA 4JPKH 5AL0A 1FGVH 5IQNA 2B3IA 2NUPB 2GHZA 3DOHA 4TUKH 1REIA 1YNKH 3BUBA 5AUMA 1ESOA 4J7RA 4YDMA 3W2DH 5C0EA 1CL7L 2P5PA 4FFVC 4NZDA 1J8KA 5FO9B 2OCFD 2Z35A 4RH4A 3SJVB 2EYSB 1JYNA 4OCXL 3M07A 1W72A 1NIAA 3S37X 2EINB 3Q8FA 2JIXA 4KKBD 2QVFB 4JLRA 4AIXA 2BVEA 2L3BA 4GUPB 4QXUL 4HCRH 4A6YH 5J1AB 3GMQA 4FABL 1S9WA 3GBMH 1QI4A 5D1ZC 1I9JL 2YSSB 1PZ3A 1Z0NA 5EDXA 1NFAA 4YXKH 1BGXH 3UERA 4HUCA 4QHNB 5EF2A 1AFVH 2BVQB 3B2VL 3BJ91 2IQ9H 2QGCA 5IROD 3ILPB 5HVGB 3T77A 1RULH 3QGVA 4WI4A 4HIJA 3OJ2C 4KKPA 1A7RH 3RBGA 1JWSB 5HGAA 3K8LA 4G6JH 3V9CA 2YUXA 2IOMA 2AQNA 2EACA 4YLBA 1F5WA 4YHKH 3L1FA 3FUFA 4P99A 2PKDA 1HAWA 3D4YA 2YWZA 2DMKA 3ETBJ 2Z0UA 3L5JA 4L4TA 4P59H 4E41B 2BRRL 5JZ7D 3SKNB 2NZ9C 2AK4D 3BUDA 4H20L 1WO2A 3ARBA 4RIRA 3DO7B 4KROC 4ZW5A 2BSTB 3WHXB 2BM3A 3MRDB 4UMGA 5DK2A 4J8RB 1QVOA 3GGWA 4G9DB 5DJ6A 3GXNA 5IWLA 2VSMB 2G2RA 3ZE2F 3LRLA 3OG6B 2GBAA 3MN8A 1ND0A 1WTLA 2FSEA 3QPQD 4PREB 5HHXH 1G7PA 3SDCD 4I0CC 5I15H 2A9DA 4NP9A 3P30L 2CUIA 2UY7B 5CGYC 2H2SC 3QW9A 4L1HA 3O4LB 3QR0A 1VKXB 5F0PB 4IBQA 3BW9B 3LCYA 3V5KA 3KL5A 3WIFB 4MNGB 1FO0B 3Q5TA 2XBDA 1AC6A 1XBDA 1KY7A 1LEGA 4QOKE 5EFIB 2JTDA 3ZKQD 4ZFGH 4XGZB 2PO6B 3T71A 2H1PH 1HU8A 5E8PB 4UM9D 3AWFA 2HH0L 1YHPA 2C3WA 4OLVH 3UTSE 3M88A 4M62H 1FG2B 2QQKH 3BGAA 1PJ9A 3LQZB 1Z3GH 2DQFB 2LAGB 1T3FB 1NEZB 3E6HA 4AQEA 3R18A 3B6SA 1IGML 3CFKB 2RFXA 4LK4A 1USZA 4UQ9A 3VH8B 4G42A 4FNLH 2I5YH 3MA9H 4NRZB 3D2UB 1KT2A 2AAAA 4PYGA 3ZYZA 1N5YH 1II4E 4OJFL 4U0RB 6FABH 2BHUA 1KGWA 3VFTA 2BOBA 1A7QL 1E5UI 2DF3A 2MCMA 4HLZH 2R8SH 1X9RA 1CDJA 4JR9L 4Z7WF 4JZOB 4UQAA 1U3NA 4UM8B 1R24A 2DL9A 2VDOB 2YN3A 2OMBA 5CGTA 5CBAB 4AQ1B 4OLXH 3LKQB 1D5IH 3KH3A 1WAEA 1FQ9C 2L4OA 4JL1A 4WCYH 3CNKA 3G04A 3KJ6H 4Y8AA 2IDSA 4NO0B 4E36A 5FGRA 3N85L 2B3RA 1YEDB 3F5WB 1XZ0B 3A47A 3IN0A 4EJ1C 3EXLA 4HUVB 3O9WA 5TDOB 4MJ4A 3GMRA 2C9RA 3LEVL 3UYPB 4EI5A 3OQ3B 3ESNA 1IEBB 5CZVH 4I3SL 5F9WB 1N68A 4J3OD 4Z7UB 3ZHDA 4MGXA 4OLZH 3NK3A 1YYMH 1E4WL 5HI3C 1R6VA 4JQIL 3PP3K 4KPHH 3WTSA 3C08H 4W9KC 1LEIA 5A3ID 1Q9KB 2OS7A 3FT4A 5EBGA 2YLKA 3MRLA 3NCFB 1UOWA 3NABL 4LARL 4P04A 2ZCHH 5AW7B 3RP1A 3UAJA 1BEXA 3HEIB 1IT9H 2FWOA 1IM3B 1WRFA 2OYMA 5IJKC 5KJ7E 3TO2A 1FORH 2VDRL 1NWOA 2A9AA 1T66C 1IGIH 3N43B 3QDGD 4GT0A 4JDTL 5CZRA 2VM4A 2KZ1B 2FRGP 3VI3A 3QUKB 2EE9A 4PY8J 2WJ5A 1C08A 4I48A 5I23A 4PV8A 3OAUL 4ZMOA 1MJUL 3DX4A 3CVBA 1YVLA 4YO0A 2A6IB 1U41A 4TLTA 5I74B 3MMEA 1S46A 3VD2A 5IB5A 2WVVA 2DWEB 3G5XB 4GSUA 2RTTA 2V33A 1AGCA 2OR7A 1IVLA 5HYQB 1JGEA 2ENSA 1FPTL 1HIMH 4PRIE 2ALWA 2FX7H 1B2WL 1XCQB 1OP5H 3WI9A 2DYRB 3Q8EA 1I1YB 4N9OB 2BNRD 4FJ6A 4NQCD 4MWFA 1QSEB 2BLFA 3ASWA 1JF1A 1HOCB 5GGRA 1TZGL 1A14L 3QDMB 4YN3A 1AGEB 4IKLA 4KRLB 1BMZA 1F2XK 4LCUB 4PV9B 3BVUA 2P47B 5E5MB 5B1BB 5C0GB 3DX1A 1OAZH 3VUAA 1IILE 1D5MA 1N4XL 3C9NA 3ULSB 4TULH 2HN7A 4GEJA 4H8PA 1Z6JT 4D0DA 3S35X 3DJTA 4Z76A 3L4ZA 3D3VB 4NPJA 3PGCB 1MCWM 1YMMD 2CLRA 3CUPA 4QI3A 5C3TA 43CAA 2PO6C 4I89A 3L5XL 4RISL 4GB9A 1NICA 1NIBA 1XGTA 3UC2A 4AQOA 4QHUA 4AEFA 4I0PD 3BWUC 4PY7B 4L2YA 4X98A 1AKJB 3CFDA 3D25A 4BYHA 4KO6A 3NN8B 2OCCB 1MAJA 1JNNH 4U0RC 1RY7B 5F1IB 5M7QA 3B9KB 1ED3B 3SEPA 1B4JL 2J12B 2GC4C 4AYBA 12E8L 4JKPH 5AOKA 4XOAA 4E9WA 3T5WA 4Q7DA 3SOTA 2W8CA 1SYVB 5C09E 3V4PL 1GCFA 3FXIC 5DVOA 4X4XA 5C0CB 3KPPB 4JO1H 4AQ1C 2V6HA 3NQIA 5L2KE 1U8MB 4ETYA 2OSWA 5I6MA 3A3YB 1KXTB 3MV7D 4Y7MA 5J6GB 1JV2A 3CFQA 3KCWA 5C0AD 1WISA 4N3TA 5BQDA 4JDVB 3GZQA 4GAGL 4EDXB 1CCZA 3C5JB 4FZ8H 1QQDA 2E9IA 1U9KA 5F9WC 3BISA 1G6RL 3BAJA 2AHIA 3QEGL 2I32A 5CIPH 1HS6A 2AF2A 2R9HC 1T7ZA 3VXRD 1PIFA 3D87B 2XQBH 5F89B 2ZX6A 5FDWA 5EU6A 3DTXB 4N6QA 2PTTB 3JQOB 3CZKA 5E1AA 4GAFB 4IKKA 3QIUB 1SQ2N 5B7EA 3OLGA 1O6VA 2E9GA 4F92B 3BWAB 2F1AA 5F96L 2CGZA 3D50A 3ZTJG 2A6DB 3QDAA 4IHOB 5IW3A 1JD9A 2N7AA 1U21A 5D2NE 2LVEA 2WMPB 4MA7L 4NOBA 5IFHL 4KHTL 1FVCB 4AGMA 2JFCA 3CZUB 1RIUH 3A4EA 1SXAA 1J9QA 1SY6L 3FT3B 4ZPVB 3TFKD 1ET7A 2VW4A 2OM5A 3NTCH 1SQMA 3OWRA 5KBMA 1Z2KA 5BZWA 2JJSC 4K94L 5J89A 3WDJA 4UI2A 5I74C 3N6YA 1TTCA 5JLZA 4IEFA 4NB7A 4AENB 1LP9B 2CDGB 1NOAA 2MQ0A 1MW2A 1NTDA 4XVTL 2Z0BA 2BVOB 1CDCA 3FSZA 3ZDZB 5BZDA 1I1AD 4KI5C 4L4VE 2HJFB 1M71A 2GJ6D 3QJFA 3DUSB 4NJAH 3BQVA 4HCRA 5CEZL 4A6YA 3P77A 4WSJA 2N59A 3SBWA 3TBVB 5L0QC 3VE0B 5HYSG 5CEYA 3PHSA 2XXFA 3O8XA 5C7XL 4ZPTA 1WD9A 2O5YL 3K6DA 3N55A 4IYKA 5IT2L 4PHXA 1NBVL 1L9SA 2NT0A 3HE7D 3S5YA 5HDBB 2HKHL 2G3NA 2EDMA 3QNZB 1Y18B 1UGNA 4ODSH 3OV6A 5IQ9A 1BEYL 3IF1B 3SDXE 5E6RB 2B5IB 5C0DA 5CILL 4PD4J 2VABB 4WUUD 5D5ME 1YEIH 4HEME 3SO5A 5ADOL 1GIGL 2X53A 2OR9L 4M00A 2IQAA 2JB5H 2YKKA 2EH7H 3OKEB 1TKWA 3P73B 3PQYA 5JIDA 4ZW3A 3Q05A 3ZE0E 5C9KA 2WVSA 2JCWA 4P2OB 3VQ2C 4RAVB 4GBXB 5AEAA 3Q06A 1L3NA 1CGVA 5F7NC 4KHXL 3IAQA 1RURL 1XGUB 1TCRA 3B9KC 3DARA 2EP6A 2J5LB 3AZUA 3MNVB 1GSMA 3QDJB 4PFEA 5I17A 1OARH 3GLDA 3BVTA 4UINL 4DP7X 4OD1H 4ES8A 2AEQH 3MLRL 1XXFC 8FABB 4NFCA 4OD2A 4L8CB 4O5LH 1U95A 1CXFA 1OAJA 4J3TA 5E1HB 4ETQB 3EW3B 4LLWB 3O0RH 4AQ8A 4PS3A 1MEXL 2VQUA 3A4AA 3D09A 3B7SA 5C08E 4KQ0A 3QULA 4F7TB 4BK4A 2COQA 1DDTA 4NX0A 2WPGA 3N42B 4ODUB 4Q9QL 3ZIMA 3CZGA 1AHWB 4FQIL 1L0QA 1OL0A 2HAZA 2E3VA 3CHXA 5EORH 1DDHB 1E4XI 1FLRL 1PQZB 2VJXA 1CD0A 1IAKB 1QO3B 4A7GA 3MRJA 4Y4HB 2XHNA 4ALAC 4IJ3B 3OMIB 1T5WA 1NCIA 2QHRL 1N26A 1Q9LA 2DTMH 2IPKB 3RURA 3N44F 3WS6C 3U0WH 1FIEA 2AITA 2E47A 3HOGA 3OVUB 2UXVA 3QIUC 3FMGH 1X7QA 1SLUA 4XP4H 3RVWC 5EC1B 1MFUA 1AH1A 3SIKA 2F6AA 3RIAF 1EJ8A 1XH2A 1OGAB 2OXGB 1WWAX 9PCYA 1BX2B 5F6HJ 1T1YA 2X44D 1MAML 5CINH 1D5XA 4ILDA 1OIOA 2E56A 2J56A 1H5BA 4UNUA 1PKQE 2GT9B 2PW1A 3BKYL 4HX1A 2H8PA 2X1PA 3PDGA 1Z9MA 4XO9A 5L4IA 2ITDB 3KWVA 4S0SD 3G3LA 3DXAB 4ZK8A 4B7LA 1YA5A 7CGTA 2O72A 3IXTB 1XCTB 3QJTB 3U7WL 3DX8B 4CJ0A 3NGBB 2FD6H 5C0ND 1F4AA 4RAUA 5IJDC 4TUOB 4YR6B 4QJ4B 4Z7OB 2CO7A 2DQHL 4B95C 3GB7A 4Z1PA 5ALBL 4KKAC 1CLVA 5I18H 3OTTA 2GI0A 4H8VA 3KXFD 1I3RB 4JUTA 4UCFA 4AC2A 4ZODA 3QUHA 1JWUA 5D4IA 2J2ZA 3VMOA 4B7IA 1U8CA 2B8OT 2ZWKA 4KTYA 1RFDH 5IQ7H 4PJFE 5CGMA 4PJGB 1YNLH 2BY1A 4JPIB 1B4LA 2DQUH 3IJYA 4EN2A 2B5IC 1N59B 4MJIE 2OJEB 1DQVA 1KDJA 1NH6A 3TO4A 2AAVA 4Y19B 4G83A 3C8KA 3MZGB 1R3LB 2O6EA 4P2RD 3EFFA 3FN9A 2GHWB 3HPLB 1CMOA 3BQUD 2JKSA 2OMTB 2WN2A 4POYA 2BWQA 3HE6C 3TYFA 3LXUX 4YSTA 4ZMVA 1X6NA 1OSEA 4P2OC 3UTSA 4NT6A 2V8MA 4GBXC 3EJSA 3V0IA 3UX9B 3GYRA 3S34L 2J5LC 1NCOA 1AGDA 2X9YA 3NFNA 4MB1A 2J4WH 3QORA 5KVFL 3FTUA 3ROOB 3VXSA 4CSTA 1T7WA 4EN3B 1TTUA 3LY6A 1R0AH 1S5HB 2GFBB 1R4XA 5BZXA 4OD3H 1JPGB 2F54A 3T2OA 5DUPH 5GS0L 3ARDD 1MXGA 2HFGL 1ET8A 1YAZA 1QZ1A 2WIIB 4M48H 2ESVD 1T4WA 4Y89A 2YAFA 2VN5A 2NDGA 4MZ3A 2V3DA 1HCVA 5IHUH 1RHFA 3NA9H 3L6FB 2IAND 5PAZA 1AHWC 3IETA 4WWPA 5BW7A 4NNXA 3BP5B 1RJZA 4Y4HC 4WUUA 2R0KL 4ZI8A 1DQML 4IJ3C 2OL3H 4KVNH 2ADGB 3FRPG 2A5UA 1WZAA 3OLDA 2HMID 5DFAA 1KELH 3B8SA 3CZSA 4F57L 2A1WH 2OW6A 1BVLA 5E6ID 4FQJL 2FTAA 1WFIA 1R3IH 2QDVA 2QR0B 1TXKA 4BZ1A 1G94A 4X83A 5CBEA 3I84A 4PGEA 4C47A 1CT8B 3MC0A 3OC5A 1I8LC 4DAGL 3WNMA 3O6FB 2C1PB 1CLOL 3MODH 4UDUA 5EWIH 1A2YA 4JY6B 1LO4H 2VDNL 2F53B 4JREB 4ZX4A 3VXUA 4G9FA 3ZQ9A 1F00I 2FCBA 4G72B 4DCQA 1EMTL 4WO4B 4BSJA 3TZVB 5FKPB 1BSIA 4LGSB 3RAJH 3UMNA 5DJ8A 3FH7A 3KCPA 4PM1A 3WV0A 3WMPA 2JQMA 2D3VA 5DHYA 3NGBC 3VGHA 3FTWA 1U8NB 4E5XB 3ETBF 1O0VA 1Z3RA 3PFUA 1OAUL 4XX1E 4YSDA 1HT6A 5ID1A 5B3SB 5ICYB 3SQBB 3MOQA 3WXVL 4QIRA 4WUKL 1MCOL 2VLKA 4OAWB 5DD0L 2DB8A 3X1GA 1ZXQA 2I27N 3VG0L 3ZT7A 2XRAL 3S36X 2AJZB 1S78D 3KPOA 5CIPA 1HQRB 4ISVB 4NWUH 4K5LA 3ARPA 4UIMB 1KGCD 4V33A 2YGQA 2D7QA 4KY2A 1A7OL 3TV3L 1EJOL 1P7QA 5C9JA 4P46A 3T0ED 4OZIB 4FXKB 1WEJL 3PL6D 2H1LM 1OPGH 4LP5A 3MRBB 5FM5M 1D2OA 1WUZA 1I8IA 1XGYL 4ODXB 5B8CB 1KCVL 35C8H 1GR7A 2EC9T 1X5FA 4L37B 4X6CB 3UCQA 3HPJB 3RY4A 2ETWA 1LE5B 5EUKA 3TOPA 5KOVC 3V10A 1DCLA 2P8MA 3FQ4A 3NJMA 4OFDA 4QXGL 2DI9A 1HXMB 2YGNA 3WDIA 4JN2A 4PS4H 4IIZA 4HOZA 1CVRA 5D1QB 3ZUNC 4ZMQA 1A6AA 3RYMA 5DHVA 3FZUC 3SZKC 3JWOL 4PGBA 5GZOA 5D7LD 3TC9A 4X7EC 4UV4H 3V4VB 5KSVA 4QWWC 4UT7H 3QIWB 1Q9WA 2AZUA 2DD8L 1KGIA 2R83A 3D69B 2FBJL 1QACA 1OTUD 4GKOA 4L9DA 1KFAL 2PP9A 3KPNA 3QNFA 4UQ3A 4EN3C 4LMQI 1DVZA 2UWEB 3L1OH 4WAFA 2ZXWB 4IDJL 4LPCA 5EZOH 5DYOA 4P2QA 5A6LA 1YJDL 4XX5A 4JFHD 2IDTA 4KXCA 1SHSA 2UUDH 5T33L 2IADB 3IGUA 1WDAA 3JZYA 4KK9C 5C09A 1FZOB 3BWZA 4Y1AD 4GFTB 3BLBA 5FYLL 3MJ7B 5CR1A 3BP7B 1PX4A 5IJVB 2W94A 1TJHL 3DK0A 3UIZA 3HAEB 3GSXA 1VLXA 3AG3B 3RWIA 4A7SA 5DRWA 4JJ5A 4QKXB 3W1ZA 4ODTL 1OVZA 1UWXK 2XJKA 1R5WA 3TJHC 2VXUL 5D2LF 4EZMA 4Y2DB 1A22B 1KJ3L 4XNYL 3RGVD 4MYWB 1T2QL 5JYLA 4UTCA 1HNGA 2ZOLA 3WIHL 4N2FA 1CYXA 2VQ4A 3MV9D 4OCXH 1HKLL 3OXRA 2NW2B 3AS2A 4UOZA 1DBKL 5I24A 1PCXA 2CLZB 1RP8A 2XN9B 1KN4L 2R23B 2WW8A 4FABH 3B8YA 2CGRL 5KAQF 1BA9A 5MHSD 3N1QC 1JE6A 3O6FC 4H1LG 1L6ZA 1ORSA 3HZKB 1TYEB 1F6AA 3B2VH 3OAYH 3PWLA 4CMMB 1JG9A 3KPTA 4JREC 4X4ME 3OF6D 5IF0B 3QQDB 2Q8AL 4OZ4A 5DFVC 1QX1A 3IDJB 3H42H 4WO4C 3FFCB 3TZVC 4IS6A 2NLJB 4H25A 1N7ML 1WVZA 2OMYB 1DJYA 4XPHL 4HIIB 4AM0Q 3HNTL 5ITBH 4JK0D 3ARDA 2NZ1A 3WXWH 3F62A 3P9LB 3EZJB 5F7FA 3TIDA 1A3RL 1AQDA 4C4UA 3KPLB 4NO3B 5B1CA 4I3RL 1TQUA 3LPOA 1Y07A 1MDAA 2WZ6A 2BRRH 3E8UL 1H0DA 1TJMA 2X4TA 1NCDH 4L4VA 5F1OB 3MGOB 4R4BB 5H37A 1MCLA 5I5JA 4NO2A 1FL5A 5H4YA 4JFPB 1Q9OA 4E9XA 4FXKC 2CIKA 3ZHFA 4M43L 3SY0A 5L2JA 4YMPA 3OZKA 3HFML 1LK3H 1KTKE 3T65A 1YPZA 2Z9TA 4L3EB 5B8CC 2ALAA 4KX9A 5F1NB 3D2TA 3V2AR 2Q10A 3RWEA 1E50A 3ULVL 1RUML 2DM3A 2DWDA 5AOZA 5EA0L 3PRZA 3GBDA 5LCVH 5E9DB 4WTXA 3OM3B 1KJMB 5I1EH 1BQKA 1VDGA 3U4BH 1S9XB 5I66B 5I8EB 5FUZL 3JZ7A 4YHPA 5D1QC 1AG0A 1OLZA 5DMKB 1G9NL 3MJ6A 1A7NL 3OKLB 3Q9PA 4JY4A 3BAIA 4WWKA 1HESA 3EDEA 1GYAA 3T1FA 3V5HA 2HH0H 1B88A 1UTDA 4P23B 2X2IA 4I77L 3TCXA 1IBBA 3WEMA 2PYEB 5IIEB 1F42A 3FFDA 3QFJD 5AD0B 5E2VL 4XO5A 5B38A 1IBZA 5ADPH 5GGSB 2D7NA 1A1MB 1OP9A 1NDGA 2K3TA 1CBVL 2BIPA 2FHFA 2GSGA 4DUVA 4HJJL 1JGDB 4JFDB 3AVEA 3FRUA 2ADIA 1PAZA 5IK3A 2F2HA 3G5ZB 1A7QH 5IEHA 5LNGA 2X28A 6PCYA 3FF8A 5DQJB 1MWAL 1RZGA 4JFVA 3D0LA 4W9LC 5GGVY 1KIRA 3HCVA 1S7TB 1MREL 2WAQA 3QG7H 5E6YA 4N0FB 2VWEC 5FO8B 2ZUSA 2H1XA 1BVOA 4Y2DC 3HG1E 2JB6B 3EYVA 3FC8A 1GAFL 2FIKB 2BMKA 3PDOB 4FLOA 3N85H 4GO6B 4IRSD 1IFHL 3CN1A 3P11H 3CC1A 3IMWA 3VG9B 3LEVH 1FP5A 1KDIA 3HR6A 1UH2A 4P5RA 3MLWL 1A4BA 2DWTA 1T4KA 1P4BL 3M8OH 1QLEB 2BP3A 5A2IH 3HKZA 1KTJA 3QQ3B 2WKLA 1WV7T 1T21B 1TTAA 3B1TA 4PJIE 2FYVA 2CCWA 2YGPA 3BRFA 2AQ3A 3NABH 3DOIA 3GI8L 3SCMD 4PLJC 3WAJA 4KV5E 4Q14A 2X7LA 1AP2B 2FYYA 1A66A 3F7LA 1GZPA 1CO1A 4NZUL 3P9MB 4W81A 4QRRA 3Q5OA 2WD0A 3MRQB 1PKQA 1CDUA 1MFEL 4U0QB 3R1GL 3WFBH 2PR4L 3D4ZA 3STLA 5CSGA 3ZHNA 4CU8A 1N8ZA 5D6DA 1RHHA 1NDMA 5CP7B 4LLYA 1YNTA 3QUMB 5LBGA 3E3QC 4PRPD 5E51A 1GW0A 3OAUH 1MJUH 5E94A 3KYOB 3QHZL 2EE2A 3OGOE 1FYHB 5I0WA 5JPMA 5HP5A 5EHFA 3FHEA 4A2EA 4KU1A 5I9QB 1CIDA 1HHGB 3DOSA 5ERWA 1B2WH 2OL3A 3SBRA 5HI4D 2Q20A 3MA7B 3KWUA 3T3PE 5IQOA 4MD5B 3F2LA 1XR8B 2FX9L 2J6WA 1A14H 5BMFH 1OF0A 3ELAT 4J3VA 4PJFA 2XWTA 4WHTB 4CSZA 2JV6A 2PPAA 4X50A 1OE3A 1V10A 4PQXA 5DYFA 3K7UA 2P46B 3DX2A 3LRSB 4MJIA 4XZ4A 4R83A 1DP0A 5DCCA 3W0WA 1AAJA 3W5NA 4NUGH 1MWOA 1T6WA 3RKDD 4Z7NE 5C2BL 3KPQA 5BRZB 3KPRD 4LEXH 4M4PA 5DEGB 4AW7A 3BFQG 2LABA 3UYRH 4HPYL 4PP1C 3I2CL 4RISH 1N64H 3W11D 2PP7A 2WBKA 1CC3A 5ICXB 4P23C 5I0DA 4EVNB 4M5YH 1I82A 3BUTA 2J71A 4ZSOB 4WK4B 1OE2A 2WC7A 2R1YB 3TWCH 4B9FA 2WWMD 3BAKA 5BQ7A 1E4HA 2FSDA 2I7SA 3CJJA 3KVPA 1QAWA 4UOW0 4YDKH 2EDHA 1B4JH 4Y16A 5CEZE 1WYJA 3MO1B 12E8H 1KB5H 2VRKA 3TH2T 4PJXB 1FNAA 1UM4L 3HUJB 1H6TA 2J55A 2WLNA 5LN4A 4ZS6D 4WW2B 1FAIH 3S96B 2MEJB 1SFHA 4JRYD 3D39B 1QBML 5GQBA 2X3AA 3K3QA 5EULV 1SFDA 3IAPA 2F7QA 1I7ZB 4QRPB 3VU1A 5IUCA 2VXVH 3X1FA 3B3IB 1YEJH 1D9KA 1IM9A 3ZMRA 4QY8B 4FNSA 3VG9C 4GAGH 2ZNXA 2HRGA 3POCA 4OQ1A 1H3PL 3V0VA 5KSBB 1BFVL 2WB7A 1E4KC 4LDCA 5E7BA 5DUBB 1OGTB 4EI6B 1ZTMA 1G6RH 3RUGA 3F65A 1FO0L 2EQDA 3QIBA 1ZANH 3AS3A 1SUJA 4L8SA 1F4XL 3S3JA 3EF7A 1F02I 4AUUA 5E8EA 4CSSA 3HBQA 2P4AB 2AQ2A 2JWYA 2WNXA 3PJSA 4KJYB 4BSVB 2AZAA 4Z3HA 4B3VA 4L8BB 2QHLA 3GSQB 2B0SL 4F33B 3GUFA 5F96H 4U3HA 5INDB 4LBEB 4LRIC 2YOCA 2ZXDA 5B3JE 2EJ1A 1JZ4A 3BZEB 4AIOA 4MA7H 3IXAB 4PJ9B 4KHTH 5A43C 3CCHB 5G4MA 2PABA 4ENED 5IFHH 1JUFB 1SY6H 2ITEA 3DX7A 5D71L 5HI5D 1LQSR 1SF5A 3QFDB 3ZL1A 4ZAKB 5F6IB 4MSWA 3AAZA 4YAQA 3W9DB 4JDEB 1VPOH 2NYYD 3QISA 4K94H 3S4SA 1LO5A 2NY3D 5HYEA 2QQLH 3MRFA 4A63A 2WXQA 3HA0A 5I9QC 4OGXH 4JJHA 2QGBA 2VL4A 3B7YA 1A0QH 5FX3A 1ZHBA 2RR3A 3OLIA 4XNMB 1QD0A 3X13B 1UCBH 3O3EA 1BQRA 4G11A 3QHFL 1E9QA 4WZ9A 2VL5B 4DKEL 4Z5RA 4U6XB 1U91B 1O9VA 2B7DT 2CBMA 5IT2H 4YXLL 3IJHB 5D1XE 2BWIA 2HKHH 1FN4A 2WQWA 2BFVL 3GSOA 4JPVL 3IKKA 1TVBB 1BEYH 1KEGH 5KW9L 4AYFB 5CILH 2WKOF 2Z8RA 3X1EA 1TNNA 1G4RA 4U1LB 4FQ1H 3BP4B 1G7IA 5GGUB 3DVGB 3ZMEA 2H6UA 4NSKA 3Q13A 1CQKA 3CV5A 3N0PB 1DQLL 2TAAA 4NWTL 3ZL4L 2AGJL 4BFGA 3HN5A 4Z7VE 4UUJB 2XU9A 3RDTD 5AVZB 4YBHA 1SOSA 2WLMA 3RX5A 3S0PA 8CGTA 4N8PA 4HBCH 1DVXA 4YXHL 4JRXB 3DC0A 3UFIA 3MRMA 5LKNA 1T6BX 3Q43A 3CVIL 4LLUA 2FT6A 1ONQB 3MLRH 1AO7E 4WW2C 5DRXA 1E27A 1G87A 1OZTG 1WC7B 2FLBT 4NUQA 1ULVA 1QRNA 4F2ME 4EUPB 2YAHA 4NFDA 3SE4C 3PWNB 2I9TB 3G08A 4IBLT 1IC7H 2CKBL 2JJVA 5CN1A 5LCVA 1MEXH 4LFHG 4YHNB 3F58H 2ZSWB 3JV0A 1SJEB 5I26A 4DKFH 3OAZH 2ENQA 4MNHA 5E99L 4AL8C 3EDFA 4AJ0A 4PJ5E 1MSPA 1XWVA 3B9DA 3NYKA 5L6YL 1WWCA 2WB1A 3JWDH 4DN3H 4X6FA 1DUZA 1FLRH 2PXYD 4CDGC 1ITCA 1MVUB 3LPFA 2M83A 5F7BA 2MCPL 2FEEL 1DZ0A 2H5UA 2OTWB 1JVOA 2ID5A 3VRIB 2B9AA 2NY6B 2GG1A 1GYUA 5CD3B 3UTTA 1T03H 4M9PA 5K9QG 4FKKA 4IOSA 3QQ9D 3PWPD 1ZIAA 3T2QA 4WF7A 3HVDA 5KVFE 1HILA 1RZJC 4RDBA 5FGCB 1WS7A 3K6IA 5D5MF 5AB1A 2B14A 4X4MA 1AXTH 3S3CB 1IIIA 3ORJA 3V5DB 4PJ9C 2APXA 3QA3A 3HHMA 1PZ5A 1DCEA 2VLJE 5F6IC 3BKYH 4JVUA 3MYJB 4FDWA 1BD2E 1XF4A 3T9WA 1KYFA 3BVNB 5CCHE 4HD9A 1NGXA 4WI9A 4TL5A 2HVJA 1XF3B 3U7WH 4KUZL 2NNRA 4RRPM 3VACA 4JO5A 4JO3L 1TLKA 4CADB 3DURB 4LHUA 3UYOD 5JPNA 1S7QA 4LAQL 3US1A 2CR3A 1ACXA 1B3JA 3EGSB 3SKOA 1KBWA 5MERB 1FIGH 2Z91A 4W6XB 4EBQL 1W0WB 5I1KH 4RZKA 4JQIA 2EUVA 2OZ4L 2NNXA 4XRCB 3UJTH 4L3FA 5TFSL 1DANT 1NPJA 1AGBB 2XTJD 5BXFA 3QH3A 2P5EB 1AKPA 3VXPA 4XCNB 2GUOA 1ECZA 3GMMA 4GP8B 5EEVA 3RHWK 2XICA 1TG8A 3QEQD 3KMDA 3VNYA 3PCYA 1ZA6B 2VJ0A 3IU3B 4F80A 2HT2D 3RWDB 4MCMA 4H26B 5I1AB 4G3YL 2VXTL 4GRWF 3VYOA 1BFOB 2HT3C 1JZJA 3ISYA 3O11B 2EXTA 2K0RA 5F7DA 2Y72A 4H5SA 4P3DA 3L45A 3ZHLA 1UQSA 1LMKA 1A5FL 5EEWA 3OJVC 4U6YA 5KZCD 2OP4L 5K9OB 1NCHA 3SE6A 4G7VH 3EGDA 4JX0A 5DQDH 3ZZ1A 3IDYB 3D18A 4KH9A 2BH0A 5DRNB 4LRNL 1RCYA 4PLKC 2J44A 5GSVB 5MP6L 4CC0A 5KVFH 3EOTL 1VACB 2AANA 3DSNB 3IS0X 1KZYA 4XN2A 3GBNH 1BZOA 5D7JD 2Z3FA 1EH9A 4EDWL 1JZ3A 4ZX6A 3LZRA 4DPAX 3ZRFC 1PGRB 4NM8L 1I53A 2WO4A 2HFGH 4UNVA 4WTQA 3SKJH 2B16A 2N7BA 1SDDB 3FNKA 2GSIB 4JHWL 1O6SA 1AOHA 3ZYJA 4KDWA 3HG1A 1BVNT 1BYOA 1PY0A 1WHOA 5F88A 4MD0B 3N06B 2DAVA 3EBAA 3LQMA 3MRRB 4WHCA 1IBDA 1R3JA 3KR3L 4BQ9A 1RZ8B 4P4KB 1DQMH 1EBAA 5EIIA 1UACL 3IGLA 4Y2OB 4YHMH 3DX6B 2DKSA 5AVVB 2NY6C 3PY9A 3QG6A 5ISZD 4F57H 1VGKB 4FQJH 4HK0A 3VB8A 2GK0A 4X80H 4F91B 3MREB 1MCSA 4U1SA 5DS8B 2M8XA 4HDIB 2G5BB 1BREA 4NZFA 1TVHA 5F1KC 3S37L 2JJTC 4DAGH 1TMCB 2NSMA 3UL4A 1KB5A 5EPMA 2OK0L 3ES6A 4WJ5A 3VRLF 4PJAE 2YSTA 5CLYA 1QFPA 2VDNH 5AUMB 5E8DH 2BX5A 5E5LA 2K3HA 5C0EB 1TTBA 4PJEF 4TF4A 1EEZA 2Z35B 1EMTH 3R7RA 3OKNA 4KRPD 1W72B 2E4FA 5IJCC 2JIXB 3MV8E 4JLRB 1OCRB 2NXYB 3GMQB 3D48R 1D7CA 1S9WB 3AXIA 1OAUH 5KS9E 4U31A 2CRIA 3WXVH 1I8MA 1MCOH 4Z18A 3N1GC 3UTZA 2NNFA 2FBRA 4GG6E 3MYZA 4JM2A 1G6RA 2W9DH 5DEZA 1MVYA 5G55A 5F3FA 5IW1A 2EEBA 3T77B 3VVWA 3JUZA 1EJOH 4HIJB 4U4IA 1AXIB 1UM6L 1J11A 5ECGA 5HGAB 1C8QA 5KVEL 3MV11 3GI9L 2NQCA 3NUKA 1J8HD 1WCBA 2AK1H 4G71B 4K5NA 3VO0A 1C5CL 2NY1D 1CFVL 3ECQA 4CMHC 3BAEL 3A22A 1NOFA 4L4TB 1SY6A 4XC1L 4QXGH 1UT2A 4WU5A 3NJNA 2RH0A 3R0NA 2DN7A 4PLNC 3ARBB 4RIRB 2N3JA 4HIHA 4Q56A 1DLHA 3SPVA 1FGNL 1IGCH 2VZ3A 1T2JA 5EUOE 3WO3B 5DK2B 1QVOB 4UQEA 2XWRA 3JWOH 3GGWB 2GSMB 2XZCH 4QNPE 4M61A 2G2RB 4UMSA 3IDYC 3UPAA 1ND0B 2FSEB 2CUHA 3APDA 4D0CA 3APNA 1G7PB 2AQ1A 2W0FA 3RWHA 3WTUA 2XX0A 1CDBA 1GA2A 2FBJH 2Y25A 4RGMB 3VA2C 5EOQL 2UZXA 1KFAH 1Z9PA 1ZPUA 5ALCH 3BFWA 3PV6A 4XE0A 4IDJH 1Q72H 3CPLA 4MXQD 1YJDH 3V5KB 3TPUA 2JCCE 2XACC 3W3BA 3NK4A 3FQWA 4N20A 1LEGB 5FYLH 4DGWC 1TJHH 4EMZA 1GSKA 3AREA 5E4OA 1JL8A 3ULVE 2CM6A 1CFQA 3UGEA 5KBDA 4X7FC 2QELA 2G4EA 4ODTH 2F7RA 2BP0A 3E6HB 1IIKA 1NPUA 3LN4A 1H8SA 1NAKL 3B6SB 1ZT1A 5EB9A 2VXUH 2RFXB 4F2EA 2A99A 2C34A 2UYLB 4G42B 1KJ3H 4JKWA 2BDNH 4PMFA 3VDAA 4DP0X 4EOWL 2R39A 1KT2B 1T2QH 1TNMA 4P4KC 1HE8A 3EDDA 3UH8A 4ZFOL 3WIHH 2DOCA 4HC1H 5HGHA 1TQTA 2WTRA 3FH5A 4TUJA 1HKLH 4MLSA 1ZKAA 4N85A 3VFTB 5LNDA 1FC1A 2BOBB 2DKMA 1DBKH 4FRWA 4K3EL 2ZSVA 4U6VL 1EUTA 3RTQA 1KN4H 1MHEA 2BNQE 2CGRH 3CH8A 5F44A 5AW4B 1ZE3C 4PJ7F 3HNSL 1MY5A 1R24B 3UOAB 1JZ6A 4NQEA 4YX2H 1RK0A 1QW8A 5AVXB 4ZYKA 1GGBL 1OB1A 1Z9OA 4HF5H 3QR2A 2YKLL 3WUZA 3EXJA 2DYPA 4AQEB 3G04B 4HJ0D 1A1OA 1IE4A 4Z7IA 2J1WA 1BFTA 2IH3A 2DLGA 2Z31A 4IK6A 3H7LA 2ILLA 4UIKL 1DBML 2EKJA 1ACYL 2E6QA 3O9WB 4Z3EA 3G9VA 3GMRB 4ZOEA 4EI5B 4ZTPL 1N7MH 3B37A 3L4UA 3H2QA 2NXYC 2XETA 1JGLL 4N5EC 5B3NA 1NFDA 1WZMA 2RQEA 3QWOA 2HTKC 1LEIB 1A3RH 3FT4B 2DQMA 3MRLB 1F56A 1FWXA 4IBSA 2A4CA 2VLRE 3E8UH 4TVPL 5MEND 1B4RA 2FWOB 1NIEA 4OR1A 3NIDB 3TO2B 4MBOA 1XD1A 2Y69B 3M1BA 4HWBH 4M43H 4XB3A 3VX1A 3HC3L 1FH5H 4XMZA 3OJMB 1GHFL 1DO5A 4MQ7A 4V1DE 3VI3B 4FN0A 4I48B 1C08B 5D1XA 4PV8B 2VC2L 3NESA 5I6OA 3C2AL 4YO0B 4KNTA 3WJMA 5CD5D 2XQYA 3OB8A 4XP9H 3MMEB 5IB5B 2WVVB 2B39A 5AVYB 3QRFM 3H9SE 1AGCB 4QAWA 2HLFC 1JGEB 4KK8D 1VA9A 4N2IA 1W8OA 1FRGL 3ARBC 3CU1A 2UVFA 4KUCF 5GGQL 5AW0B 1G9NH 3FB7A 3SDDD 4MWFB 5HHOA 4LP8A 4PRHE 4XHJC 3S35L 5GGRB 1JF1B 5IWLC 3NSXA 2V7NA 1BP3B 2BP8A 3ARVA 4BFFA 5E6UB 2PWFA 2DIBA 4I77H 2NOYA 4RGMC 2AXHA 4OUUA 1D5MB 3C9NB 3VFUA 4QLWA 1F86A 4DO5A 2P26A 1EHAA 4XPFL 2HN7B 2CA3A 2MNJB 4AYSA 4D0DB 3SJVE 2B2XH 3DJZA 4Z76B 3F6JA 2QVKA 3L4WA 2LE9A 2XYCA 1E2VA 2ZAHA 3CGTA 5BRPA 3CUPB 2CLRB 4F2MA 43CAB 1MWAH 4LASL 4HUUA 3MLTA 5FW7A 1BXXA 4LLAA 1OCWH 3ULAB 1MREH 4E42A 1XGTB 3DYOA 3LYRA 4NQTA 3VD1A 1G1CA 4WWNA 2VERA 4PMEA 1DBJL 4M1DL 3KZ8A 4QHUB 4K5MA 1QG3A 4HIEA 4FXLA 3DPBA 3QO0A 4X98B 1GAFH 3CFDB 3KYMA 3D25B 3P3RA 4PJ5A 3KLHC 1IFHH 2P42B 3SKUD 4QAMB 1XIWD 3GS4A 4L0YA 4PJ8D 3QI9A 2KKQA 3EIFA 2IFFL 3IWUA 3SYAA 3ZE1B 4EZLA 3WKMH 3MLWH 3BDBA 1ZPLA 3BMWA 3D85D 1INDL 3B2PA 1NCUA 3FQ2A 4YDJA 4L05A 3RDJA 1NEZG 2MPAH 4HHWA 4IMKA 1P4BH 3CDCA 2IC2A 1I7TA 3RRQA 3VH8G 1ZS2A 4X4XB 3SOBL 3NJIA 3V4VL 4POZC 4N0CC 1ECYA 4E41E 3QUYA 2JQAA 4AJWA 1WJ3A 4UF7C 3QEUA 5LLIC 4UAOB 3NJXA 1JV2B 2CZNA 3GSWA 4NKDA 1XFPA 2IALA 4OW6A 4EI5C 1PPIA 1MFEH 5TF0A 2XWZA 1U8HA 4OGZA 1QQDB 2Q87A 3L3OA 4QOKD 2AEPH 3GUTA 3U36A 2K4AA 4ZMXA 2FGWL 4GAAA 4ZUWA 4FCAA 3A67H 4IRJD 4YSUA 2ZE0A 4JCLA 3FQNA 2BINA 4G7YL 5FDWB 5EU6B 2RA1A 3GXMA 5K93A 1YC7A 4FNPA 5E1AB 4EEEA 4UQBA 1X5LA 3LPGA 3GKWL 4B9JA 2QPDB 3H4FA 3IU4L 1AE6L 3UAJC 1AZBA 1H6UA 5ENWA 4QJ5B 3REVA 5AB2A 5SWSE 2MCG1 5TF1H 4MNGE 1TZHA 3ZVVA 4G1MA 1AYRA 3K4AA 5IOKA 1WG3A 4GY4A 1E4XL 1K5NA 4Z95L 2JTYA 5IP4A 2ZCZA 15C8L 1RMFL 2A9ML 2JELL 5JHLL 1XT5A 5BZWB 3VQMA 1T5XA 3ZGHA 3N50A 3QXTA 2C4FT 2CMRL 4K5PA 1RD6A 5JLZB 4IEFB 4TTGA 1HH9A 1M6UA 3ESPA 4JKKA 5A40E 7TAAA 3UZVA 3ULUC 2WXJA 3KLAA 2OA9A 1JJUA 4XPTL 5BZDB 5C2BH 3PXHA 4PJCE 4QR7A 4ZMPA 3O3BA 4LKCA 1M71B 3ZJAA 4UAHA 3QJFB 1UJTA 2Y3AA 4F7EA 5J06A 4A6YB 3P77B 2VDQH 2VERN 4OU3A 3WMSA 1YY9C 4PJIF 3EJYD 1JMZA 3IDNA 2YIHA 3P4NA 3UADA 3O8XB 4ZPTB 2Y5TA 4KV5F 4YBLB 2HWZL 4NERA 5HHQA 3KPSE 5E56A 5I6PA 4JO2L 3Q5YA 4YZFF 5IQ9B 4ZUVA 3ZKSD 4Z7QF 5C0DB 2VB5A 3VCLA 5LNEA 4F37F 1DBBL 4Z7UE 4I87A 3DGCR 2VITA 1PEZA 2HG0A 2IQAB 3PWJA 3T6WA 2ZUQB 1TKWB 1V3JA 2Y6TE 3PQYB 1H3XA 3EYFA 2QSQA 1QBMH 5AYQA 1U2YA 5CJ5A 1OZUA 2XZQH 4PG9A 3MLYH 5H8DA 4KO9A 5FYJU 2BSDA 1SJVA 4PCSA 4B96A 4HK3J 1FNGA 1TCRB 4PRID 2MQGA 1MFDH 2E6PA 2Y1YA 1B9KA 4JANA 4M1CC 1H3PH 3VFOA 5I17B 2O4EA 1OAQL 2KBGA 4EQ3A 4GRLD 1V54B 3IEAA 3NJLA 5FEBA 5JTWA 2FIRT 2R7EA 2HVKA 2GY5A 4NC1E 4OD2B 3TONA 3GXFA 1U95B 3GRWL 3UBHA 3IAGC 3EFDL 3KE0A 4CDHA 1K6QH 2ZXCA 1OWWA 3MVSA 2Y22A 5DR5L 1FDLL 5JXEA 3JWNH 3DIFA 4FC3E 4AEEA 4UAOC 3L9RA 2ZKYA 1AS7A 4LPUA 3QULB 2Y2YA 2X6AA 3U2JA 4TNVF 4X4KA 5CZXC 1QSEE 1HNYA 4OFYA 1JZHA 2Y1ZA 3IT8D 1XTLA 3C60D 3QDME 5JIKA 3MUHL 2YGOA 3ML8A 2OULB 4M3HA 4Q0XL 1PD0A 3MRJB 4IQHA 4B41A 1T5WB 1Q9LB 2E86A 4WFFD 4DGYH 1CR9L 2GBUA 3NIFE 2X09A 4Q4IA 2FHBA 3FCBA 4H40A 5F7UA 1X7QB 2KZBA 3OZ9L 4Z78A 3WIHA 1J9TA 1QYGL 4HC1A 3GLEA 2QPSA 5CUSL 5KYWA 1T1YB 3FCGA 4GAJL 1OT2A 1D5XB 3QHFH 2VLLA 1H5BB 4QRBA 2PW1B 3HC0A 1P2CA 1IX2A 2H8PB 2EE6A 4HX1B 4BCZA 4DKEH 2YMOA 3RVXC 4MX7A 43C9A 1ETZA 2WYIA 4WFED 3SKMA 2WCPA 3MKGA 4R7DA 4YDVA 5L2KD 4S1RL 2WP3T 4JPVH 2MH4A 4RAUB 4K8RD 2XI9A 3LNDA 3T0VA 3JVGA 5KW9H 2UXTA 2WANA 4DP4X 2CO7B 4AV5A 3BIKA 1AR1D 1QPKA 1M05A 4W6YB 3GB7B 4S1DC 3TF4A 1WAAE 4B9GA 4CAGA 2VDML 1M7XA 4XH2A 3SBWC 3CFUA 1J5CA 1DQLH 3ZL4H 2AGJH 3O8XC 5LG6A 1JWUB 2EUXA 2J2ZB 1M56B 4YBLC 1U8CB 4X8XA 1L0XA 2IAMA 5C07E 4GRWH 5DVKA 2P5WA 5TH2A 4PGZA 5KSAD 1J9CT 4ABUA 5CLWA 1FJ1A 3IJYB 2Y7QA 3T4YA 4HJUA 5LWYL 3KM2A 3PUUA 2WVTA 3HLKA 4HWBA 2JCCA 1WBZA 3TO4B 2FH6A 2OQJA 2N01B 3C8KB 2W65A 3EFFB 1FZMA 1W6LA 2D73A 2ZUQC 1DQQA 4QHPA 1E65A 4KY1L 1VEMA 3U6XA 3TYFB 4P48A 1G9ML 4TQPA 1UZ6E 2YJQA 1UUNA 4P9MH 3UTSB 3VI4E 1BOYA 4NT6B 3CIAA 1IEAA 4JGMA 1CF1A 2YQ2A 5SWQA 2D2CC 4N6RA 4HS6A 4E9TA 2WLJA 5T1KD 1HJBC 1AGDB 4YPJA 3NFNB 5E99H 3QORB 3SYOA 3U1PA 1OD7A 5F9DC 3VXSB 5D7KD 5FLUA 3QAZB 3CTTA 3KLSA 2G5RA 2F54B 4Y0GA 4AQ8C 2BNQA 3S8GB 4FFZL 2OMZA 4HKJA 4YEFA 4DGIL 5LN8A 1LP9E 1VZIA 1YEHL 2WGXA 5DJAA 4HW6A 3QPKA 1PNCA 4MB4A 1ZIBA 1JXKA 1HC1A 5J0BA 1PLGL 3IMVA 3F64A 4HS3A 4F9LA 3GO1H 2P44B 3IETB 1WT5A 2EH8H 1MWAA 2XY1A 5IQMA 4NNXB 1RXLA 2P80A 3W38A 1IZKA 1RJZB 3O6KH 3ZDWA 4WUUB 4Z7VF 1YEFH 4CBZA 5ICZA 1S3KH 1G7LB 3ZW3A 3ESUF 1J0YA 2YS4A 4JBSA 1DANU 4FFYL 5HDBE 3COOA 1SXNA 1BVLB 1NCCL 3QWRD 2CHNA 2V5MA 4KUZH 3ZK0A 4EF3A 5CBEB 5FGBA 3NAAL 4PGEB 4JO3H 4MQSB 4W9EC 1OP5K 1GJWA 3CX5K 5T1MA 4LAQH 3WNPA 5J13B 1XQ4A 2UVEA 1E40A 1XCWA 3M17A 4UDUB 4O9HH 5J6SA 1A2YB 5HJGA 4NN7B 4APXA 1H5BC 3B34A 3VXUB 4G9FB 4XP1L 3BFOA 2OZ4H 4NJ9H 4Q4EA 4DCQB 4V1DA 3AABA 3S36L 2RIKA 1T2XA 5TFSH 1TQBC 1CFSA 4N26A 5H4ZA 5DJ8B 4KK6D 1QR1A 1RP9A 3KCPB 1BZDA 4M4RA 4XT1C 3MRNA 5DHYB 4L0ZA 5C08D 5AW6B 5ID1B 3HG3A 3H9SA 1M42A 4LSDA 4MAYA 1RZJL 3RNKA 2VLKB 3WSQL 4HUKB 3ZTNL 3RZCA 4G3YH 2VXTH 2HG5A 1F0LA 3KPOB 4P9HC 5CIPB 1BJ1J 1J87A 3RB5A 4I9WE 1P7QB 5C9JB 4P46B 1ZS8A 5I6KA 5DUJA 2EUWA 3DTUB 2ZKXA 1KN2H 1I8IB 5FM5O 3J07A 4MLIA 3VFVA 1NEPA 4HPOL 1QMUA 4G6AD 4FYSA 3TT3L 1CLZH 3CK0H 3GRGA 3EOTH 4FA8A 3HFFA 4MDRA 2CO1A 1MLBA 3TO4C 5DJXA 4OZFH 2P8MB 1IFRA 3Q2NA 1OTSD 4HGMA 2OJZH 1EXUA 5AVSB 2EIDA 5AG9A 4JN2B 4OB5H 4L5FL 3GSVA 4EDWH 5G4NA 5KVEE 4R2GB 5HHNA 1JNLL 1A6AB 4YC2B 5H35A 5DHVB 2Q1EA 3LSOA 3CHSA 4UOW1 1PJWA 4PGBB 4JHWH 3KLLA 4FLHA 2YEQA 3CSTA 1XL6A 3QFGA 1BJ8A 4FI8A 5ICUA 5KSVB 1MQ8A 1F1AA 1AXSA 1Q9WB 1U58A 3QORC 5DD3H 1OKEA 5HYFA 4YQXH 3DUHA 4CGUB 1MJJA 4UQ3B 5A2BA 3KPNB 3QAZC 5FR3A 1CGSH 4M7LL 1JV5A 1X6LA 4P2QB 5DYOB 5GRJL 4U1HA 3CQPA 5EBLA 5E9AA 4LSVL 3TEXA 3DXAE 5F7MC 3ZKXB 1SLVA 5C09B 4W6WB 2BZDA 4HK3N 4UT6H 1SRDA 4G6FB 1H8LA 3FOMA 3D33A 1JK8A 1LO2L 3A6CH 1OD9A 3GSXB 3IDGA 1MQKL 3S37H 4Z7OE 3RWIB 4OV5A 5DRWB 4JJ5B 4G5AA 4TTDC 5FFLA 2OK0H 1F8TL 1R5WB 1WA2X 4XNQA 5BW7C 2L0DA 4M7KH 4M9OA 5SX4I 5C71A 1Q94A 2NT1A 4R6UA 2CHZA 2ZOLB 4MXWL 1BV8A 1AMYA 1HCFX 4K3HA 3O6LL 3OXRB 4JN1H 4XN5A 4PJGE 4TQHA 1HYSD 2IGLA 3V0WL 1J9RA 2Y9RT 2O6CA 1IAIH 1TT6A 4KMTL 4OIBA 3RJQB 2D8KA 3RPBA 3DDFA 4C54A 4JFFA 1XSIA 5EOTA 5J13C 3OC8A 5TQ2H 1ORSB 5SWSA 3KBFA 3LHPL 1F6AB 4NN7C 3HI5L 3C8DA 4JG1L 1I9IH 3V0GA 2XC8A 4OZ4B 3MUJA 1GC1L 4L3CA 1ES0A 4TNEA 4HP5A 1H8NA 1TDQA 4OQTL 4IS6B 4XCYA 4H25B 2DTSA 1LXMA 2YUWA 5A2AA 1ID5I 3GI9H 1TENA 2W80C 1KNOA 4OGAD 2K7PA 1TJGL 3QCVH 1ZVYA 3TIDB 2CRZA 1AQDB 1C5CH 1M2OA 1CFVH 2FEJA 2DBLL 3HG4A 4JFQA 3VWJD 4PJCA 4XC1H 4L4VB 1H0DB 2X4TB 3ARWA 5HHME 3TBSA 3L7FA 4NO2B 1FL5B 2BSSA 5AFAA 1Q9OB 1FGNH 4E5XG 4P46C 4X7DC 2CIKB 3AU0A 5F9JA 4IU3A 5L9DL 3SY0B 5L2JB 1V55B 4GIOA 4PHZA 1DZBA 4HLEA 4FQCH 3T65B 1YPZB 3QARA 4NS0A 1QZNA 4XP6H 3ZKND 3SBPA 3KPSA 2XT1B 2R69H 3FQTA 4PJAF 2MPVA 4TVPE 3RWEB 3AITA 3MACH 2DWDB 1BXAA 4XBMA 3ZOAA 3NFSL 4HFUH 5AG8A 2X4PA 4R2GC 4YHPB 3ZO9A 4YC2C 1HHKA 2G3MA 1G7HA 3V0FA 1IBYA 4JY4B 3K6OA 4A7UA 1JYWA 2JLPA 5GZOC 1B6DA 3ZE0B 4WWKB 4AK1A 5KS9F 1YY8A 4NQDE 1ZDSA 4I85A 3T1FB 2ZP0T 3V5HB 4GG6F 2ZX7A 2ZOUA 4M7LT 4TXVB 1AGFA 1WIUA 2FX8L 3CFBA 2JQZA 4WWOA 1NAKH 3PG2A 5C0NC 2JI3A 3FFDB 4JEGB 2V5YA 4TQIA 3VM5A 2F53E 1KC5L 3US9A 5B38B 4YDIH 5DUML 4PCYA 5E2UH 3CFCL 2ATKA 4GXFA 4A04A 1NDGB 1OV8A 1NBYA 3DDGA 1S7RA 4JUSA 2GSGB 3ZKXC 1HH6A 4LB8A 2F0CA 2V2TA 5IK3B 1NL0L 3FRUB 2ADIB 3CSPA 5IEHB 3GSUA 4WEBL 4U6VH 4K3EH 5LGYA 3VTTA 1RZGB 4ONHA 1IJ9A 1M4KA 1QTSA 3QDHA 5IEKA 1KIRB 2XZAL 5DMYA 3HCVB 2NY0B 2J1XA 1SBBA 4HETA 4QGYA 2AVFA 2VZTA 1VAHA 1EQWA 3FBKA 1GGBH 1YQVL 1F1GA 3RVTC 4AT6A 3EYVB 1JXJA 5IOPA 2BMKB 1SDYA 1DBMH 2GTZA 4DGVH 5EUOF 2R2BA 4OZIE 1MIEH 1CU4L 2ZJSL 4OZGE 3HAEG 4XCCL 4ZTPH 2X4OA 3INOA 3RWJA 5J6HA 2QSCL 2ZF8A 2ROYA 1T4KB 2PW2A 3JYBA 1JGLH 4BUHA 1ADWA 4FE9A 1ZLSL 2HLAA 5HPMA 3U30B