4XOBA

Crystal structure of a fimh*dsf complex from e.coli k12 with bound heptyl alpha-d-mannopyrannoside
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Cell adhesion
molecule keywords Protein FimH
total genus 49
structure length 279
sequence length 279
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xobA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xobA02
4AUUA 4X5QA 5FS5A 4XO9A 4AVHA 2JMRA 4J3OH 5LNGA 4X5RA 4XOEA 4AV5A 3JWNE 1TR7A 5LNEA 4XOCA 5FLUA 5IQMA 3ME0B 4XOAA 4CSSA 2XG5B 3JWNH 1UWFA 5AALA 4AV0A 4CSTA 2UY7B 1KLFB 4X5PA 3BFQG 5CGBA 4AV4A 2XG4B 4J3OF 1N12A 3JWNG 5AB1A 5IQOA 4BUQA 4CA4A 3ZL1A 4XO8A 2J2ZB 5F3FA 1PDKB 1QUNB 5FWRA 4AVJA 3RFZA 1N0LB 3BFWA 2JTYA 4X50A 3ZPDA 4ATTA 2W07B 1ZE3H 5IQNA 3SQBB 4AUJA 5ABZA 5JQIB 4AVIA 5F2FA 4AVKA 3BWUF 5AAPA 3MCYA 4LOVA 4XODA 4XOBA 4AUYA 3ZL2A 2UY6B 4J3OG 5FX3A 2VCOA 2WMPB 1KIUB
chains in the Genus database with same CATH superfamily
1R6VA 3MFGB 3IJEB 4MD0B 1K85A 1GGCL 5I5MA 5M7QA 3JWNE 4QPEA 4PJXA 3RVTD 2DRUA 1X7SA 3DXAD 4LHQB 3BUIA 1IL1B 5DJCB 2ZCZA 3WNLA 1RXLA 3FHEA 1PPIA 4F33B 3U4EB 4A2MA 1U3YA 1FDLL 1FF5A 4OI7A 1LJMA 2AGJH 4JREB 2Q10A 4KKBC 2CIIB 1EO8L 3GPSA 3SKNA 4IBVA 4PJAA 2WBWB 3TBWB 3BLBA 3UZVA 2DTML 5AYTA 2W94A 1FNLA 3D0AA 1DCEA 3L4VA 1E2ZA 4JFOA 5DI8B 3ELAT 2A74B 5EMYA 1JE6A 3ZTNL 5DZ9A 5IG7A 3DVGB 4MXVF 1T1YB 3FKUS 1YECH 5BRQA 4TTGA 3VXMD 3VXUB 1RURH 1WCBA 5I1DB 1YY9D 2YXWA 4LEXL 2IO5A 2AQ2A 3EFFB 3NA9L 4F2MA 4F80A 1J1XH 1NCCL 4I0CC 4FF9A 1CDCA 1A6WL 1OQXA 2I5YH 4N8VA 1W0YT 1DVTA 2VMJA 3E6HB 2AQ3A 1HSAB 4HJ1A 4I3SL 4GW5A 1FWXA 3FO9A 4ISVA 3QJTB 4TUUA 4HH8A 3OM3B 2O72A 2X4TA 1AGBB 3OQ3B 4LLVB 2R69A 3VVWA 3LS4H 2H8PA 4O4YL 1TTBA 2VO5A 2BIIA 2ZTBA 4N5EC 1ZK5A 4JHAL 1VADA 3QO1B 4HKBA 1LEGB 4HWBL 3WFEH 3RIFK 2VN7A 3AQZA 4R0LC 4MZRA 2X4OA 1JXGA 2Y24A 5JOEA 4AZUA 1B0GB 4UOJA 1ZAGA 3Q13A 4AQ1C 3GK8H 3O4OC 4WGVB 2XHNA 3CLEH 4NZRL 1BG1A 3STZA 1A3ZA 1BCIA 1FC1A 4HFUL 1JVLA 4L8CB 1EFXB 3J7HA 1B0GA 3IDGA 4WUUA 3VYOA 1ZT4B 3IGAB 2PXYC 1EUTA 4KPHH 5BXFB 4HK0A 3PHQA 4OU3A 4BQBA 5IVXF 1L5GB 1TUPA 4TPRH 5SWSA 1R1CA 1XGPA 3VM5A 4IIQC 3D39D 5ID0A 1UCBL 2JKIS 1X4ZA 2G60L 5EUOF 5LNDA 5FHBH 2X6CA 3EYOB 3LQZB 1B4LA 2WHVA 3LS5L 5D93C 1WTGT 3FQXA 2OMTB 1V10A 2WVUA 2YUWA 4DOHE 1ECYA 4DKEL 2CBPA 4N0CD 1X5YA 5BQ7A 1EMTH 1R34A 1CGUA 4U1SB 1HQ4B 4ANUA 4WFFE 2WNWA 4OCRL 1G7HB 3U4BL 1DHKA 1DQLL 1F11A 1V7ML 3GB7B 3P11H 2WNKA 5FYKU 2AFNA 3VQLA 4HOXA 3BUQA 4LQFH 1CLYL 2W07B 3K2UL 1IMHC 4F2FA 1DVFD 4NZUL 1DBKL 4KZEH 2PPFA 2EDJA 3REVB 2LAGB 4KNTA 2W07A 3KYNA 1SQMA 4KKAD 4LESA 2EKSB 5J8OA 4GFXA 1G7LB 5DQJB 3JSSA 5DHVA 3WS3A 2XG4A 4XPHH 1ZCRA 5A43C 3E1F1 3TN0C 4LLUA 4CN4A 1MLBB 3BZ4B 3WS6C 1SEQH 4R84A 2EVJA 4HHWA 2C26A 3GRWA 4R4FH 3VWJB 2F1AA 4OZHF 3SPVA 1P2CA 3QDMB 5FM5O 4HT1L 2BXZA 4LF3A 1P4LA 2RR3A 2ZWKA 4K5LA 4U1HA 4XMZA 1QACA 2JCCE 2OXHA 1PLCA 2BXYA 2NNAB 2CJUH 3QAZB 3W38A 1IGML 1QYGH 3DSFH 2OZ4A 2AEIT 5ANMA 4WI2A 1JF1B 3H2QA 3PWPD 4PVLA 4Z0BL 3BKYH 3AAZB 3FT3A 3OKNA 3TBSA 1FNGB 5TE7H 4EDXB 5EUOE 5DC9B 3L2NA 1MXDA 3L48A 4XOCA 5CD5C 1IGTB 3N40P 3WKYA 1G94A 3P3UA 3TH2T 2YD4A 2EDDA 2G9KA 2XSKA 1ES0B 1KYFA 4WTXA 2B08A 5CUSH 2ITFA 3PQYD 1PW3A 1UM5H 2GABA 5H8DA 1PGRB 1RULH 1QWHA 5TE4L 4JN1L 4HJIA 4L4TE 2N59A 7PAZA 4PS4H 2P5WE 4GRWH 3WE6B 1XV8A 4K3DL 4UTAA 1NBCA 1OAZH 1REIA 4LIQL 1IBFA 3A23A 5BJTA 4TTDD 2GITA 3PHSA 4A6YH 5JW4M 2RACA 4X6FB 5TFSL 5L0QB 2OL3L 3CVHH 1HXMA 5FCUH 1R5WA 4Z77B 4WNJA 1LXMA 3WY4A 4DGIH 2JB5H 1BFVH 1XD1A 1B0WA 3F84A 1BQSA 4TSAH 4YMPA 1SMAA 1BZ7A 1I3RA 1TZHA 3HUJE 3O4LB 4WWKB 4Y1SA 4IU2B 5IEKB 1Q4NX 3VYNA 2Y7QB 5DCCA 1A02N 4Z77A 2K8MA 5EZOL 1JPSH 4JRYD 1Q9KB 4NZUH 2XV2A 1ZHKB 4XTRD 3UBXB 4JQIH 2BY2A 4KY2A 2AXFB 2E9IA 4ZAKB 3UG4A 4FFYA 3ZKMC 2VUKA 1UXLA 3EJCA 1JPFA 3QNXB 1BHGA 1LO5B 1ESOA 4KKQA 3U2SB 1BREA 3T2QA 5L7XL 4AT6A 4WO4D 4G6FB 4WUUB 5IJKC 3ATBA 1E4JA 3L9BA 1GHFH 1UA7A 4G80B 4DN4H 2DEYX 3DIFB 1JTTA 2DQMA 1DE4B 2Y3AA 3P0GB 2ED9A 4L8SC 4EI5A 3RL1B 2HJKA 4V2CB 1PZ2A 3G6DH 5JW4Q 3AXIA 4MZ3A 4FTVD 2YQ2A 4M8VA 3L3HA 5L4FA 3UAJA 4GW4B 4F91B 1AQMA 3CZKA 4LSSH 4YNYB 1DJYA 4MD4B 2BVOA 3QXAA 4KUCD 4KAQH 5CCKH 2JQZA 2VDRL 3BIKA 1S7WA 4ZT1A 3P4LA 3EJJX 4GUPB 3K6FA 1SZNA 2DEXX 2R4SH 4FQQB 4K3EL 3E8UL 5T3XH 1TZ8A 4I85A 2H26A 3BUDA 4LVOB 3GZOA 4XRCA 3AUVA 4WEBH 5JQIB 3N43B 4KGJA 4WTZA 4AEIL 2VMFA 4RMTA 1WUNT 3F5WA 3S3CB 4AE1A 1DQIA 4H8QA 2GG1A 3LV3A 2NYZA 1E67A 4IBLT 4NIKB 3ZKNC 4MCMA 1DQMH 2H0EA 2YRZA 1Q0YL 3KBFA 1P7QB 1RZIA 1S7TB 2K4WA 4WENB 2FIKA 4X80H 5EIIG 1V7NL 1CBVL 3VFVB 1J05A 3VXNB 2AQNA 5BMFL 1BLNA 1IAIM 4QRRE 5CD3B 1P5UA 3VFRA 1AGDB 5HSFA 1BF8A 3BN9C 3P54A 2EEDA 4FTDA 4M7JH 5LO7A 5HYJD 2DMBA 2XN0A 5HVFB 2C9UA 4Y9BA 3QNZB 3KWWB 3PP3H 4P5RA 3WO4B 1UUNA 1EJ8A 3LJ3A 3ZL2A 3H7BA 2EDXA 2EABA 1UZGA 4FYTA 5IROD 1NMBH 3HVDA 43CAB 5D1ZA 2VR7A 4QY8B 3SBRA 3S97C 1KIPB 4UM8A 3PQYB 4C56D 5HYIA 3E2HC 1MI5D 3IJHA 4X4ME 1WBYA 5D7SL 2YMXH 3RVWC 4OZHA 2XPGA 1GZPB 4HMDA 5IW3A 2X4NA 2E75C 3X17A 4L3AA 5EULV 3U79A 4Y7OC 2YAFA 4GXVH 3LKQB 1GKOA 2IH1B 2JF1A 4FXGB 4N87A 1CFSB 3KWXA 4MASA 4XOBA 1I31A 4XXWC 3NCJL 1ZGLA 5EOCH 1T6VN 3F58L 4KVCH 4KVNL 4QTIL 5EU6D 5LBSL 4IBTA 3DMMD 1LK3L 5IMMB 5JHMA 4FCAA 2F5BL 3T3PB 2NX5A 2PWHA 3UTZB 1G84A 5L6YH 1YEHH 1VADB 3QO1A 2G9HB 2APSA 2VDOH 4PEEA 4CL7A 5D2LB 5E00B 1NAMA 2PO6B 4ODHL 1NGWA 3O9WA 3I2CL 2BPBA 5C9KA 2HRLA 4L3ED 2GJZB 3P4MA 4Z7NE 4XCEA 2D0FA 4WHTA 1AXTH 4S1SL 4TLKA 4AEHH 5EORH 1RZGB 3B37A 5F7AA 1GGCH 4QR7A 4W70A 4AIEA 1UM4L 1VFBA 4FMFA 1F4XH 2F1BA 5BMFH 2FWSA 2ADFL 4QXVA 2X2JA 5HHQA 3QWRD 3G9VA 2DEWX 5EO9A 3WL9A 3QDJB 4FNSA 4RNRA 1H15B 4YZWA 4R7DA 2XWRA 3D3VB 4JX0A 5J57B 4MB3A 4AENA 1EZSA 1N59B 2NY0D 1E4HA 3QIUC 3GMQA 3G5YA 4FKEA 4I48B 5JW5B 3MA9H 3N41F 4U7MA 2ZAGA 3WO3B 5DRWB 4Y9FA 4G82A 1S9XB 3CX2A 2G3MA 3NIGE 3U7WL 3SBPA 5F9JB 1GIGL 3LZFH 4QHNB 1Q90A 3HI1A 3QQ9C 4RAVA 1PJWA 4YDZA 3FAXA 4NRZA 3TZVB 4OLXH 4RGNE 1A65A 4NXKA 3HFFA 1AANA 3DC0A 4Z7QF 3MRQA 5JPNB 1JGVL 4WI6A 2OX5A 2DLGA 2WXMA 3G6DL 1LVEA 1MFDH 4I3GA 5KVFE 2J71A 5E7BA 2YN3A 1D6VH 1Q9LB 4BZ2L 2FQDA 3DRTA 4EN3B 2IMNA 3DJSA 4OLYH 3PGCB 4HEME 5HHNB 1TZGL 4MGXA 2R4SL 4QXWA 5T3XL 2HLAA 3DRTB 4KFZC 3GZKA 1UEMA 4NN6C 4LLDA 1JUFB 1RUMH 4R4BA 2AAAA 2WCGA 1UURA 3PGCA 2H32H 4BHUA 3T3MB 1ZV9A 3LNHA 1R3JB 3QYNA 3BO8B 3WG7B 3OSVA 2WOYA 2O61A 3L13A 4JZNA 3KNBA 4NFDA 5INCA 3AABA 3RI5K 1M42A 1J0KA 3KPPB 1UADC 4DPBX 3QJQB 4NZTL 4Y1AE 3ARFC 3HC2A 3L95B 2OK0H 4AYBA 4A55A 5DC0A 3LKPB 1RU9L 3BT2L 5GGRB 2I24N 2WBKA 5B8CA 2VZ1A 1I3GH 3V0JA 3QUXD 2P5WB 3T08A 3V95A 2OA9A 4JLRA 4QHNA 1QI5A 4TNVK 4UIMA 3QIBD 2J8OA 3KH4A 4FQHA 1RUQH 4IJ3C 2G5UA 5BUPA 3UYOD 3M45A 1M71A 3TYFA 3CHQA 2EECA 1G7IB 4IIQA 1OOAA 4JFEE 1KPRA 2QSTA 3OKKB 4RFNB 3VD3A 5M94B 1XBRA 4KTYA 1XGRA 5GGUB 4ZDHB 4DFHA 1NL0H 3BJ91 2W0FA 2Y9RT 3WO4C 1ZE3H 4LPWA 5DUBA 5GGQL 1U93A 1S4IA 4N1HB 4IMLB 1IEAA 5TH2A 1TMQA 2V7NA 5EC1B 4QOKE 5IVXE 4ECNA 4PGJA 5CWSB 1NGQH 4JFSA 5GXBB 1SHWA 1FZOA 5EB9A 3TNMA 3LKNB 1FBIH 1YPZF 1RJLB 4PREB 3E2HB 2GFBA 3OJVC 1GC1L 1B4JL 3NABL 3RRQA 1HXMB 5EHFA 4CN6A 2NY6D 4DVBB 1J10A 4OT1L 3ULUE 3B6SA 2Q7YB 3NCMA 2A99A 3EH4B 4X9BA 4ABUA 4ABWA 4ZZFA 1H19A 4PWIA 4XMPH 2DWDA 4WV1B 2M83A 4EUPG 4QYOB 4AQ8A 2B3IA 4LDLB 4ANWA 1T5XA 4I5BA 3RDTB 3OHMB 4P5MB 4JKWA 1NUNB 1LK2A 3D2UB 4FFYL 2VZOA 4RETB 2DIJA 3P73B 4HVBA 1JNJA 1E3ZA 3DECA 3FQUA 2QHRL 2GIMA 3VE0B 2AK4D 3Q1EA 5K39A 1TDQA 3GQFA 4U1NB 4BHUI 4XC3L 2IAMC 2E7MA 5BS0D 3AU0A 3LHPH 5EN2A 3IJHB 3FN3A 3OR7A 2L8AA 1JP5A 9PCYA 4TN9A 3TV8A 1C16B 4GKNA 4H26A 2WINA 2ZUSA 3TA3B 3OMAB 1CIUA 1SLWA 1HL9A 2E86A 3KW7A 3QR0A 3MRHA 3BPOC 2E6QA 1FN4B 1PU0A 5I26A 1VRSA 3Q6FA 4L8BB 5SWQB 5IREA 3N0PB 5IMLA 2G75A 1SXCA 1DLHA 5B3NA 4OI9A 1YMMB 2R56H 3OWRA 3SQRA 5DJAA 3II2A 1WWBX 1JN6A 3PFUA 3NQKA 4A7UA 3NIFF 3O2DA 1NFDE 3T0EA 1PTZA 1Z32X 4M1GH 2XI9A 5FDWB 1VESA 2WAQA 1SOSA 3HC0A 4FJZA 4UT6L 4KVPA 4ERSH 2Y7OA 5EUKB 1E6OH 1CLVA 1KLUA 1KF9B 3P77B 1FJ1B 2XFXA 3F5WB 1C7TA 4AY0A 2I60L 3P11L 5I1JH 1AD9B 3MLXH 2Q86A 4PMFA 4U4BA 5T5FL 1MI5B 3DA0A 3M17A 1OTTC 4R0LA 5BZWA 3MV8D 3HA0A 3VFOA 3VGEA 2GAZB 4N0FA 2N0KA 4AMXA 2HLAB 1CICA 4KNQA 4HLJA 4Z7NF 5L0QC 3DTDA 2CRYA 2ENQA 4P5TB 5DJ0B 1RMFL 4IBUA 3JTTA 5DD1L 1ZXQA 3UG3A 1YHPA 1JYNA 3L16A 4CBZA 1UHVA 2FZ3A 4DWHA 1GGYA 4LE8A 2ZUUA 3B2VL 3D39B 5GISL 1NIFA 2A6JB 5FYJH 1XF2B 5KYYA 1Q9OA 4QGTA 3SO3C 4AQZA 3DJ9A 2QVTA 4ZMVA 3E1ZA 1UA6H 1S9YB 4X5RA 1ZRUA 5JW3L 4XI5D 1I75A 3B1UA 1JZFA 1TIUA 4FKHA 4C59B 3AQDA 3UJTH 4IOFD 1D2PA 2Y25A 3HE7D 4ONFH 4OCLC 1YC7A 4PJHB 2AMUA 5HDLA 2VQTA 2PR4H 3BVWA 5MEOB 1W91A 4LLMA 1CTOA 2Q3AA 3HMXL 3EJSA 4H20H 3SE9H 3QI9B 1YA5A 3SQBB 4L18A 1RUQL 2HRHA 3EO1A 3ZYZA 4KY1L 4HU8A 3KPLA 4K8RC 2W8CA 3GHEH 3QHTC 4FG0A 2YRLA 1U33A 1HQRA 5HXMA 3HZVB 4JMXA 5JOFB 3CZJA 4WFHE 3M07A 4P5TC 3UFIA 1SN2A 2ZYRA 3DKHA 4Q6YA 4XXCA 4ZPVA 1E5ZA 1YEFH 5TGBA 3SB3A 4XB8A 5F0MB 2YAEA 3I9GL 1T1ZA 3G5XA 2B4CL 3MV8B 4IKJA 2GFBB 1UA3A 3W81A 1KLFA 3EDDA 4GY4A 1U0QA 4IU2A 5GRZA 5IEKA 5KSAA 5AAMA 3D18B 1TZIB 2WYHA 3G6JF 4M7KH 5TQ0H 4KTEH 1VEOA 1IC7H 1OF2A 2WQVA 1WQVT 2JVUA 3DUSB 2YARA 4JUTA 3C09B 5L6YL 1EV2E 1L7TH 1Q0YH 4PU2A 1JFQH 1EDQA 3N40F 5I15L 1V3KA 3OX8A 2IOOA 2QKSA 4IRSA 1J1PH 2HMID 2R0WL 4XB3A 3ULSA 2G3ZA 4B9JA 1RP9A 2Q8AH 3RP1A 1Y18B 4YPGA 3VFGL 4PR5A 3PFQA 1JMXA 3BZEB 3V55A 2XY1A 1F02I 3OWEA 2WSKA 4LK4A 2APXA 1MCSA 4HKZA 3GMOB 3OLIA 4ZX5A 5C0EA 1HZKA 5FUCE 4XC1L 3OJ2C 2FSEB 3N85L 2R0ZL 3ELQA 2P1YA 1A3QA 2C9QA 1AYOA 2X6MA 4OFKA 4LLMB 3NSFA 4N0RA 4OB5H 4Y4KC 3TA3D 5HY9B 2E27H 5EEXA 4O58H 4N0UE 3VXOA 1AG6A 5J6GB 1QA9A 2H32B 4YHYC 4QRTA 4L48A 1YPZA 2Z91A 4KITB 4OZIE 5CINL 5IB3B 3GI9L 2GJ6D 3A47A 5I6LA 1T1WA 5F1IA 4YHKH 3FQTA 8CGTA 4GW4A 2VL5B 5IHUH 5ESQB 4DP0X 3CHRA 3T3MF 3KEHA 2P48B 4GT0A 3VI3E 4YSPA 3QNYB 4ZFGH 4MMZC 5C71A 4I4WB 5FO8B 3UO1L 3Q6FB 3ILPB 4L8BA 5SWQA 1DVXA 5DSCA 5MEPB 4ZUVA 5SX4I 5HDOA 3BVNB 5FHAH 2UZIH 5D7KD 3G7TA 5EWIL 5ADOL 5LXGL 2XETA 3K72A 4PJGA 2AJSL 4PHZA 4L4VD 4OGAD 3GSWB 1V3MA 1AXIB 4DKDC 2J1WA 4AEIH 5KVDE 3WTTA 1J11A 1FYTA 5D2LE 2FIKB 3KJ6L 4X9HA 3P73A 3EH1A 2NY6B 4TNVF 1U8NB 2HLFC 1BZ9B 3BW9B 3UBFA 5C0BE 4TMPA 5DC4B 5FF6A 4B9GA 2FECI 4F24A 1IT9H 1T20A 3LQMA 2NR6C 1LP9F 1EWHA 4QYAA 5C8JA 1Z3RA 4PJ5E 4U49A 1ZLDA 3C6EA 1OSZA 1T7XA 4Z7VE 1XF5B 4AH2A 3DI2B 4CVWA 2MQGA 1ZHLB 2EEBA 4RDBA 4HS3A 2DQFB 3MRJA 3CZFB 4MX7A 1PCXA 4JO3L 5IWLC 4DCQA 1BOYA 4JQXA 4X7TB 5GSVA 3VXME 1XF5A 3L4YA 4ZS6D 3UEZA 1FN4A 1UXMA 1JGIA 5E9DA 3VXPA 3H3KA 5FYLD 4ODSH 2Y36H 1IIKA 1CICC 2HTKD 4NT6B 3D9AH 5AZ2L 3NQIA 4TTDC 5DS1A 3T2PA 4H8VA 1XAKA 3MA9L 3QJOA 4ZDHA 2C34A 3LB6C 5CJQH 2GHZA 3TZVC 4PTUA 4D0DA 2DWEA 2GTWB 4FI8A 4GQRA 3CSGA 4ZFOB 4PHXA 3CC5A 3VXRD 2RQEA 1WC7A 1XF1A 4JCLA 3VDCA 3MC0A 3MLPA 3UERA 5FPIA 4A7QA 4LCCA 5FKAA 4AQEA 4UQ9A 5FO7A 1VIWA 3ARGD 1RY7B 3DV6A 3LKSB 2X1XR 3LRGA 3QARA 1WBXB 4OZFH 1TF4A 5D96B 1O5PA 1F90L 1WDAA 3GJFA 3N44B 3O4LE 4RMSA 1KCUH 1SXAA 5GSRA 5GS2D 1KBBA 3GXMA 3RUGE 5I24A 4Z23A 2UZIL 1T66D 1XEDA 5ACZB 2WQAA 3GI8L 2VDOL 4EN3D 4UINH 3HI6H 3U0TB 1LDSA 1LL1A 2VDLH 5AEAA 1J0YA 4OGYL 4WGWB 3VTMA 2QHLA 4KKZA 3CMOH 4AIXA 4J8QA 3TN0D 4OZGF 1JS4A 3KLSA 4PJ8B 1YVLA 2OMVB 3QI9D 1U8QA 4XWGL 2XTJD 5KVFL 3E8UH 3AY2A 4Y2DA 5HGDA 5BRZE 43C9B 3U2JA 4YHNA 4O5LH 5L2JA 4XBEL 5ALBL 3KPTA 1CGYA 3F7VB 1IAIH 1AIFA 2ICWA 1F5WA 5TE7L 3N41B 5BO0D 1U3ZA 2XQYG 4XBMA 2YC1A 1TZAA 3V6BR 1S3KL 1E2VA 5TF1H 2XU9A 2IALB 3QDGB 4RIRB 1BQHG 3VFMB 2J25A 1QSED 4TVPH 4HULB 5JO5A 4AYEC 1E4XH 3L3DA 3VXUE 4NPYB 3TZVA 4LHUD 4PQXA 3SCMB 2VLLB 2UVFA 3T04D 3T77A 2EH7L 4BCYA 1C5DB 2DWSA 2KUTA 4G1EA 2ZXAA 2FX8H 3CFJB 5D7LD 3QQNA 5C6PB 4PJXB 4R3SB 2CIKB 4L2LA 3F8UB 4KTEL 4K7PH 5DFVD 4AQOA 1FFOA 5DQDL 4MVBC 1YN7B 3P2DA 4JJHA 2D8KA 3S2CA 2ADIB 3VB9A 3ZTJH 5EU3A 4HIPA 5GS0L 3MNZB 1CI3M 5IQ9A 2VCOA 1G7QB 4TVPE 4W9EC 2PPAA 4FFWC 5F8RC 3X12A 2XN1A 3FB7A 3GXNA 2J6EA 3HG0A 2DQDL 3JVFC 5GIRB 1E8YA 4OLYL 1XGPB 5DURB 1JUFA 5AENA 2PPDA 2EXWD 4F7CA 1IE4A 1U8CB 3LRSB 4W9HC 1A9VA 3OGCA 4GI6A 4N86A 3O6KL 2LOEA 2OTWB 3UXFA 3PL6D 4LT7A 5G4OA 1A4CA 1SHSA 4QOKB 4ELME 5IVXB 2C3VB 3CDGB 5F1OB 1IC5H 1NCGA 1PMYA 1UWEL 2O5XH 4POZD 2KQNA 1AQHA 4X5WB 4YE0A 5DR5H 1JPGB 4UUJA 2IAMB 2DWXA 2Q7NA 4AEEA 2CO3A 4MAUL 4EQ2A 5C0AA 2X9WA 5E1HB 2NY2C 2QGDA 1WD8A 1INQB 3ECQA 4HIJB 5I1IL 1PKQA 2DYRB 3BT2H 1WAAE 3MCLL 3TBVB 1TQSA 2HX7A 1X44A 2FGWL 4OZGB 5C09B 3RFRA 4CSZA 3HMXA 1KUMA 1F3DH 1HHJA 5K33A 4AVIA 1QNZH 5TF0A 5J1TC 4WK0B 3CLEL 4NZRH 4JHWL 1MELA 2OMBA 3IKCB 2ESVD 4M48H 2CZNA 4O51B 1GOFA 5FDYA 2WPGA 2NXYC 3ZE1E 3BSZL 1NCOA 4HAGA 3AREA 4JPIB 1UOVA 1QFPA 3GRWL 3PWLB 5JW4R 1NUGA 2A1WL 1I3RB 1I85A 1TZHB 3O4LA 5DD5H 3RY4A 3JV6A 3TBCA 4D7BA 2VN3A 4DO4A 1L0PA 4XXDA 2VXSL 4OIIL 4XO8A 2A4CA 3O45B 1QBBA 4PLJC 5J3HD 1XH3A 4WU5B 3FRUB 1DQJA 3RNKA 1C5BH 3Q8AA 4ZMNA 2V7HB 4D0BA 5DQDH 1R33A 2Y1ZA 4FNRA 1QPKA 4DKEH 4JFHE 5C0FA 4ZW3A 3UBXG 2B7DT 2YD0A 4G9FA 1ZVSA 2IGFL 1H6UA 2WUBH 1DCLA 1FH5L 1J5CA 4JAMA 2N7SA 4NM4L 1X6LA 4UV4L 5LXVA 1V7MH 2GTZB 1FI8C 3TIDB 1D6VL 1NIDA 5JIMA 3QZLA 4KXBA 1E90A 25C8L 4WFED 4IGBA 2FO8A 3U30B 4JO8A 5DUPL 1MFCH 2AJXH 1KELH 2VDQH 2VXUH 3DYOA 4LLYB 3QXAB 4FQIH 2BIQA 3WUWA 1TO4A 4X83A 4E5XA 4B27A 3WN6A 1T80A 1RUAH 4UT7H 5DMIH 4H88L 1MFEL 3BXNA 4KHTL 1YMMA 3BKCH 4NKDB 4BKLB 4G42A 2H1LM 2EZ0D 2R0KL 5C0BA 4AOFA 2CXGA 1JN6B 1LP9B 4TF4A 3NIFB 4JPSA 4PLKC 1OARL 4L3EB 4YUEH 3IDJB 4UINL 3CCHA 1SMOA 3M8OH 5C07D 3DX8A 3OL2A 5C0BB 2VC2H 4KMLB 1WFOA 2XWTA 4UV7H 5IEHB 5DJCA 5BO1L 3UJJL 2RD0A 3FYEB 1GGBL 1MVUA 4FTVE 2IH3B 3T65A 5DEJA 2PETA 4NX0A 3TH3T 1DDTA 2VE6A 4N2OA 3FO1B 3DDGA 2WC7A 3DHJA 5EIIB 4JFZH 1QVOA 1S9VB 3CHXA 1BVLA 3CN3A 1ETA1 1OM3H 3VXUD 3Q7JA 2J3SA 3FB6B 5BW7A 5C09E 2VL4A 3TNNA 4HJGA 3RTQB 5D4HA 4GKZB 2E6JA 5E6ZA 4BXSV 5ID1A 5F6HI 4EE2A 4KXDA 3O81A 4KZDH 1CU4L 3IK2A 3EYOA 1ZHLA 3TJPA 2FD6H 3I9AA 5DWUH 1TQVA 3NGBB 4XMUA 3FQXB 5C6TH 2UY7B 1FCGA 2WXIA 4Y8AA 3MJ9A 2BHFA 4HWNA 5AL0A 1GZHC 5HDQH 5E1IA 3QUMA 4JO3H 4LP5A 4JM4L 3S88L 3RAJL 1CTMA 1HAUA 2QGBA 3MFFB 1CUOA 3FUHA 4M1DL 1R3IL 3DK2A 1VSCA 4QI3A 1OALA 1HXYA 3FUFA 4P99A 4PY8I 2HG0A 4N9GA 3A6BH 4OM0H 3FTWA 3UTPE 2BFGA 3VNZA 4RFOL 2WXJA 4MNQA 5AG8A 1FO0B 4B9ZA 3CC5B 2FJGB 3OXRA 5DJXB 2QQKL 3FB7B 1U95B 3OV6A 1J1OH 5A3ID 3HKFA 3GT6A 4NQEE 3KDMA 5TDNB 2OR7A 4RGMB 3OLDA 3ZTDC 1ZHKA 4YFDB 1HSBB 3CSBA 1YSOA 2R23B 3E7JA 3OC5A 2VDNL 2EDEA 2KLRA 5KBKA 2HFEA 1WTLA 3QDMA 3CD4A 5E7FA 5GGRA 5GRJL 3QIUB 1LQSR 2ZWSA 2CUHA 1QSFD 5JQHC 3U36B 4L1TA 3EGXA 1I3VA 3EO9L 3FQRA 3CZFA 1PQZB 2AI0H 1SFHA 3BDBA 4HV8A 1L9OA 3FO0L 4BFFA 1OP4A 4BWWA 1PLGH 5C0DB 3HB3D 1NAKH 2JLPA 4CUCA 3PGFH 5DRXB 1IIIA 2EDHA 4Q97A 1WCBB 5JYMA 5AW4B 1WVZA 5GS3A 3BQUB 4N2DA 3WEBA 3WMQA 3ZYIA 5LWYL 4Z7UE 4CKQA 2BIHA 2BWIA 2R69H 2R0WH 1A9BA 1NOAA 1ZY9A 4G59C 6PAZA 3QT2A 2ICWB 1QLRB 4LEEA 5DJDA 3I3EA 5KVMC 2GJJA 3UGEA 3HFML 1A7QL 1E4XI 4UIKL 3I50L 5F7DB 1A3RL 3B7YA 3L9RA 5L2KB 1MEXH 4MA3B 3RPKA 4OI8A 1JRHH 3EO0B 5F1NB 3TYGH 1HWWA 4WNSA 3KLLA 2DMKA 3IEAA 2QPSA 4KK6D 4NN6B 1YEJH 1NGWB 1T03H 8PAZA 1WF5A 1Q9LA 4O02L 2IDFA 3L3OA 1DQQB 1FVEA 2J57A 4MQTB 4NUJA 3U30C 2MRYA 2ALWA 1YEKL 1MJUL 3V7AG 2CIKA 5E4IA 4NYLB 4U1HB 3X14A 2A74C 3FRUA 4JRXD 1TPXB 4P59L 4NENB 4IHOB 2G4EA 3LTVA 2WXFA 4BSWB 4FX5A 2WYZA 1DLFL 1BF2A 3VVVA 4RGOH 1PKOA 4B53A 4AYDC 1SLVA 1SVCP 2HH0H 3SPHA 4QXTB 3Q2LA 4E5XG 4P2RB 3KXFB 4WJ5B 3C6LA 4GKLA 4HGKC 1QBLL 4PR5B 2DZEA 1ZEAH 1IAII 2FATH 4I48A 4GO6B 4CA4A 4CVZB 3ATDA 5JW5A 1NSNH 4KTDL 5CJOL 4Q9QL 1U92B 4DZBA 3HG3A 2Z9TA 5IMKA 1NUFA 4UM8B 5B39G 4WSGA 2BOBA 2VJXA 4KY1H 2DJUA 3TIEA 1R3HB 3B9KC 3O3AA 2FNWA 4X6EA 1LO3H 1YEIH 3BQUD 4JR9H 4P48A 2DYPD 1UJ3B 4O2FB 4LB8A 5B3SB 4G8EB 2VUOA 3ARDC 3TZVD 4PRBA 3S37H 5IR1B 1DBBH 1YAIA 1UWEH 1KN4H 4ODUA 4PV8B 4R7NA 4UILL 1U3HA 3EF7A 3OGOE 1ROWA 2J4WL 4M61A 4R90L 2GITB 2BCMA 5TQ0L 5TE4H 4XGZA 4M7KL 5DZLA 2BP3A 2QL1A 3BQVA 3N50A 4ZS6C 4GQQA 1KT2A 4MVBD 5CZVL 3GXDA 2ZQKA 2R7EB 1MCWM 3FSZA 3TFBA 4QJ4B 4AW7A 4L1LA 3L81A 2ROYA 3OR6B 4YXLL 3FU7A 4N28A 2X4PA 4Z8FL 2A9CA 4MRBA 5C0JA 2UXGA 5E9AA 4KNUA 3EUDA 3GO1L 5GS2H 5DK0A 1U8NA 4MNQB 3ARXA 2O30A 4M6MH 4LXFA 2EO7A 1YQVH 4F7KA 2XZCH 3E0GA 5GGTL 5GS1A 3GMPB 3RVUC 4YHOH 3KXFA 4MSWA 1EVUA 4PBVC 3N9GL 3VM7A 2QSCH 4YDJB 2HLFD 5DRNA 1QEWA 3C6LC 2DKUA 4AGMA 3IGKA 3RWFA 4NN7C 4ONHA 2GB2A 1QHQA 2WQSA 3GM0A 5I75C 1ZT7B 2XTSA 1QRKA 1S9YA 2ED6A 2KYIA 4EUPB 5EEWA 4OJCA 5HJDA 3V0HA 2XTJC 3F64A 4QRBA 3BUYB 1UWGL 2FWUA 5LG6A 2BDNH 5K59E 4PPTA 1NFKA 2XLLA 1CFMA 1D3CA 3TX4A 1A8JH 2H45A 3RHWF 2KLTA 3QGVA 2HKAA 5DZNA 4ZUWB 1GYCA 4JM2F 4RCAA 4X4XB 3GBMH 2YO3A 3VCLA 3VMPA 1IC5L 4JNXA 5F9OL 2IH9A 3MLRL 3QXDB 1G6RA 4JR9L 4PGDA 3SCMD 3IJ8A 5T5NG 3REVA 3V4VA 4EKXA 4X8GA 5D1QA 3C2AH 2K6ZA 3DOSA 3EGDA 4LASL 5A3IC 2AANA 5K93A 1HZHH 3FF7A 3WIIH 3TEWA 3ULVL 4M62H 1AHKA 3QJVB 4FXLA 3CFBA 4K7PX 4XGZB 3W37A 3UCRA 1IGYA 1QI3A 2ENJA 2YAQA 2BP8B 3GXTA 1OEZW 2NSXA 1D7BA 2IV9A 2N3JA 4F9PC 2N1TE 3VD4A 4Y2DC 5HDBE 2KH2B 1NC4D 3MGTB 3ZDZB 4Y88A 1U2HA 3SDDB 5CLWA 1P1ZB 2IAAC 2XFGB 3B2UD 4K7FA 2OYPA 2DBLL 5ICZA 4HEMA 3GXFA 3MV8E 2L0DA 3D3VA 3KM2A 2CPUA 4FLHA 4LFHG 3OZ9H 4B96A 3PDDA 1J9SA 2X0UA 1L5GA 4G3YL 1OTUD 1PEWA 1JHTA 4PP1C 2JKXA 3CU7A 4KQ4L 3WFZA 3RFZB 3CK0L 1MCQA 2CBMA 3QULB 4M43L 3TEXA 1HXKA 1G7IA 3IMRA 2WCPA 1JHKH 4PCKA 1CLZH 3DX9A 3D12B 5E2JA 1MFDL 3MLWL 1TYEB 4OQTL 2G5BB 4YBLB 4M5ZL 4CJ1A 3OKDA 5J89A 2EAEA 4QHPA 3TEZA 4N8PA 4GKSB 1E2WA 1MIML 2YPLB 3EH5B 4F15B 2H1XA 4Q9QH 2YEZA 3PXJA 2BSED 5A7BA 2H4EA 3AADB 5DEGA 1OP3K 4P57A 4NT6A 1YMMD 1LEGA 3L2MA 1VEMA 1KMGA 1RL1A 1RIVL 3GI8H 4N2NA 3MYJB 1WFUA 3D3VE 4DTGH 3NCBB 5I6MA 4JY6A 3MGTA 1NC4B 4OFQA 5LJYH 3WFBL 4MJHA 1OPGH 5AW6B 2MCPL 5IK3A 2P7TA 1KJVA 4I2XE 3FT4B 3K3QA 1S9KC 4NRXB 2AJYL 3BDXA 3RWEA 1DEDA 2R8SH 4GPVA 2EDQA 4AM0B 4H1LH 1YNKL 1BDYA 2EDNA 3LIZA 3H4HA 4H8WH 4Q6IB 5DRZA 1PZAA 3LRKA 5EG6C 4IRJA 3EOTH 4HLEA 3IJ7A 5EBGA 2FGZA 2W9DH 5L9DL 1YCSA 4GIOA 2CIIA 2P5PA 1KTKE 4FNQA 1S7RA 2VABA 3QUMH 4OD2B 5D2NA 2X09A 2BP0B 2QPUA 3QE5A 3GTNA 4EPSA 3L95A 2GCYA 5CN1A 4XOEA 5F9JA 4FQJH 1PZCA 4P23A 4QHLB 3DNKA 4Z9KB 5FV2A 1MRFL 2R0LL 4UT6A 4GP8B 4HLZH 1N6QL 1NGPH 3O41A 1IM9A 1BBJA 1B6UA 1D6EB 2CO6A 5E8OB 4YSCA 4MMZB 3FU5A 3LS5H 5C0GA 2YD6A 1N0XL 2KERA 4J12A 2CGYA 5A2JH 2Z91B 4LPCA 2V9RA 5FC9A 4YK4C 3RDTC 1T0NB 4FQCL 4B9YA 2YGPA 4P8QA 4I1PA 2OP4L 5T8IA 1J9CT 3AVEA 5AKTA 4JPVH 3FU7B 4FQ2L 1EO8H 2LAAA 4X4KA 3DOSB 1KCSL 5I1EL 3OTTA 4LARH 2O6FA 4HUXB 4E9QA 1HC1A 3B9AA 1S9WB 4F7EB 5IF0A 2IPKA 1HTYA 3ERXA 5AVRB 1OO2A 3D2UA 4WZ9A 3UTZA 4ONGH 4DO5A 2A5UA 4MB1A 1OF0A 3A6BL 3CZUB 2R0KH 4YFLF 3SPJA 1BMZA 1XMWA 1HKLL 1HNFA 2YEQA 1DUYB 1NDGA 2PLTA 1OSEA 3SIKA 1YYMH 2DWDB 4WV1A 3UC0H 1IO4C 4EDWH 2TAAA 2FX7H 5HHXH 5ESAB 2X87A 5DK2A 2F58L 1FLRH 1E43A 4HX1B 4X99B 5L8KB 3D1MC 2OSWA 5KYUA 4QCIA 2K3HA 3MGOB 4AT6B 3P9MB 4U6XA 4MNGB 5SX5K 1G1CA 4PGBA 4PS7A 4TUKH 4XAWL 1UG9A 4H26B 4TNFA 4ABQA 5GJSL 3ZPDA 2M2DA 4AX3A 5E6IB 1HINL 5HYEA 3PL6C 4PWEA 5IJKA 5HDWA 1C9SA 3DJTA 3V79C 2E8ZA 4A1RA 2P5EB 3ZT7A 3MBED 5E6IA 4FA6A 1M71B 3TYFB 2IQAA 4YQXL 2H9GA 2GI7A 3ESVF 4V1DD 5D71L 1LHZA 3OKKA 4PJHA 4LFHD 4JGMA 2MNUA 2XV3A 1R5WB 1RI8A 4F93B 2KQMA 4FFWD 1LO2H 1JZEA 2R1XA 3BKML 2NX5B 4Z6AT 1FH2A 2GEEA 5E4OA 4PWGA 4M56A 3EJQA 3GLZA 5LB1A 1A6AB 2BVQA 2VXTH 3FB8A 4YBLC 3WEAA 4NUJB 1EDYA 1KXQA 1MJ7L 2GT9A 5CZKA 1IC7L 2YRBA 1RMFH 4G6AC 4NYLA 5SWZB 4NKMA 3WI9A 4NJAH 2B9BA 4N1EA 2WAHA 3HG1A 1P4IH 4HDIB 2VXTL 3ABLB 3QR2A 3EOBA 5DT1H 3SD2A 5L88H 2R4RL 1NMAL 1VAHA 4N20A 1TFPA 2AVFA 1DQDL 2LU5A 3C8KB 3LRSA 4A04A 5AALA 4EIUA 2UXTA 4HEPA 2PO6C 1BZDA 4J3OF 1BM7A 5GRXG 4DKTA 4EJ1C 2D7MA 2OR8A 1OAXH 5E8NB 3ZDXE 2ADGA 4PJ8C 1CTNA 4LARL 1BWMA 1BVLB 5D4IA 2LVCA 3ARVA 5EDXA 2JCWA 1J1OL 4OJEH 1OB1B 3QCUH 4YJZL 2FJUB 1QWNA 4U1GC 4UOZA 3NSXA 4CGUB 1L9PA 2OAAA 3VX0A 3HLAB 5IW6A 3Q48A 3SE9L 5AW3B 1T7YA 1OWRM 1IBYA 3BPCB 3IJ9A 4OLVL 5E9DB 5F3BB 4NO3B 5L2KD 2IAMD 3H7BB 3N6YA 1QHPA 4I77L 3WIAA 4JKKA 4NRZB 3VWKA 2XZQL 4QRSA 3FQ4A 4GBXA 4JPKL 4V11A 5CEZE 1FIGH 2MQCA 3P3YA 2WWMC 3FT9A 2MJWA 3CFUA 3VI4B 1WFIA 2VDMH 4GBXB 4PJ5B 4ZD3L 1HZLA 1S46A 4MJIB 3ZE0E 1MJ8H 4PJGF 5IHZB 1D9KC 2E0PA 1ZTMA 2E9JA 3VFMA 2FYYB 1J8HE 3F3HA 3LV3B 4H1LG 4WW2C 2VLRB 3NJNA 5SWSE 3P3SA 1QBAA 3G5VA 1NFIA 3O11B 4PW3A 3TLRA 4XVSL 4PS4L 3MUZ1 4QWWD 1SJEA 5CEZL 2ZUQC 1X7QA 3K1KC 5IT2L 1BJMA 1BQHB 2I9LB 2MKLC 2XCMC 2A9DA 1G87A 1YZZA 2WKOF 1J5OH 2CQVA 2W9EH 2M8XA 4WWKA 2ZP8A 2VN5A 3BX7C 5E5UB 4E9WA 1AOZA 1ILSA 4KJYB 4XMLL 2XIDA 4U1GB 3WSQL 5I8CB 2FR4B 1NAMB 2PO6A 1INDL 1G7JA 5CP3A 1AVAA 2WNGA 1B2WH 4MNQE 5IJCC 1Y1DA 1KCLA 5F88B 5C0FB 4XN5A 4NQSB 2GEQA 5C3TA 3RDTA 4PJ6A 1UZ6E 2C3XA 2MQ3A 5DMGD 3WSQH 4D9RE 3RHWK 3ZE0B 4CVXA 3BESR 2ARJB 2BNQD 2VO8A 1F56A 1CXHA 3TWYA 2EVHA 2XZCL 4AK2A 4CC4C 5CBEA 1RPUA 4ZTPH 1UFUA 1Y0LA 1FORH 2X4SB 3OAZK 5E1GA 5AWNH 1KYDA 3GTTA 1L9SA 5IFJB 2OMXA 2V8MA 4ZMXA 2DJMA 5F7YC 1FFPB 4G6MH 2UY6A 5D5MA 5KSVB 4P3CL 1NLBL 2D03H 3AGVA 3OHXB 3OVUB 3D05A 2DQHL 2NR6D 3I6KB 2IH1A 4FXGA 2NTSP 1U9KA 3A22A 4EI5C 1DJIA 1GHFL 3A21A 4MXQD 4WCYH 5AWNL 4U6YA 3LHPL 4YHPB 2FYYA 1AQ8A 3U0PB 3CVIH 4M9PA 1UWYA 3RIKA 2XQBL 1IAKA 2Y72A 12E8H 1QFUH 4I9WD 4PJ7A 1ZWIA 2A7BA 3AT9A 1KGWA 3SOBL 3QEQD 1A1MA 4W9ZA 2R29A 3VQ1C 4ENZA 3EYSL 2CMRH 4M29A 1EJ6A 2ICES 3O9WB 4LOFA 3D87B 5FYKL 2ZF8A 5DS8B 4ODVL 1K9TA 3CVDA 3S35X 4ILDA 4XCFH 2M1KA 1DUYA 5G55A 4BSVB 1ED3A 4ZMQA 3DVNB 3IM1A 3T0AA 3NTCH 2XWJB 4JDVA 3VAEA 4JY5L 3CVBA 2VR3A 4KKLC 5IT2H 4L3EE 2OJEB 4YDMA 1UACH 3EG9A 3PHOA 2C1OB 3T5WA 1R3JA 1X5HA 3SDDC 4OJFL 4XNUL 5DJYB 2OXGB 5KSUA 4LL4A 1UJ3C 1NKRA 3QQ9D 4XNYH 1YQVL 1TVHB 3KLHD 3KCWA 4JN1H 3LN5B 4ODTH 4EVNB 4AYSA 5KW9H 2EVIA 1UT9A 3RWJB 4TQIA 1G0DA 3L1OL 4WDIA 2DQGL 5CJQL 5JXEA 1M9SA 4LCIH 4MBRA 2EEFA 4HIHA 3CAFA 5IBLC 5C0CE 3PAYA 2XN9D 1KIRA 1KB5L 1XGZA 1U58B 3SYPA 4HSCX 4XXCC 4Y2OB 4B97A 3I85A 2VDNB 3QNYA 1BQRA 4QRTB 3TVMA 1GGUA 1O0VA 3IDYC 2X6BA 1C5DA 4KDTC 4M1CD 3L5HA 5JMOC 1T1WB 2ZX9A 5LAPA 3CXFA 4I0PD 3LNDA 4TUOB 2ZG1A 3LRHA 2XKNA 4LP4A 2IWGA 3DOHA 1KCUL 1G7LA 4XP9L 3UO8B 2B1AL 5A40E 5C9JA 2QQNH 3PWLA 3MLTA 3IMBA 3NA4A 4P5TD 3VFVA 2DQDH 5GZOC 4I87A 5E6RB 2Q86B 1ML0A 3DX3A 3OD3A 4N5UA 4GO8A 4NO5B 5C3IA 3X13A 4AM0A 2X4OB 3G6JE 5HYJA 5LGKA 4LCWB 3NCYS 4ZMZA 4XNAA 4XVSH 2BC4A 2N01B 1DVZA 3FFCB 3OKLB 4F7TB 5D70L 2LQRA 4E41B 1N9PA 4Q74A 1WA2X 3VJ6A 4YL9A 2FBOJ 4HOMA 2EQDA 4ORZC 1HI6A 2J8HA 3CSYB 5D5ME 3HE7C 4EI5D 1PS3A 4QJ3B 6TAAA 1Q38A 4OIBA 3BUYA 4NI3A 1HCYA 4QLRA 3SYAA 1DQKA 2ESVB 1KGCE 1S5HA 5ID0B 2RGSA 3UAJD 4K5NA 1X5GA 4PY7B 4XN7A 1KN4L 1WAAA 5JHDE 2XA3A 2IWFA 3QUZD 3ULAB 1DBAH 4QOKA 5IVXA 5HJBA 5DUMH 4XHJD 2OK0L 2EVFA 5ISZA 3P1VA 1IX2A 4DKAA 5LHDA 3SO3B 1YY8A 3VTAA 5BJTB 4IRZL 4X7DC 4DETA 3TIEB 1BA9A 5D2NC 3NFNA 2VLMD 4N3TA 4WW1B 4JM2D 3KYKH 4MB5A 2PKDA 2NZ9C 3I74A 2L7UA 4Y4HA 4KDVA 4KJWD 2CR0A 1EXUB 3CUPA 2X4RA 3T8XA 2EXYD 4XBEH 5ALBH 4NZDA 3ES6B 2JJTC 3H9SE 1MCPH 1XCQA 3L3IB 1EHAA 2FDBP 5FOBB 2H2PC 3MV9B 4MRCA 5C6TL 3VG0L 3WYRA 5PCYA 3RU8L 4MJID 1L9TA 2A4EA 2DLFH 5HYSA 2GYSA 5CGYD 4AITA 4F8LA 4NRYA 4XVTL 4E9VA 4XN9A 1LO2L 1A0QL 1QBMH 1FL6A 2Y3NA 1IAOB 5BZZA 2BIPA 3DPBA 4EIBA 4G8GE 2YD8A 4MJ6A 4HZLB 5I1EH 1PZ3A 3LEVL 4FNUA 4Z7WF 3CDFA 2Z8SA 4RQQA 1J9TA 5D72L 1J8KA 2GBUA 4C56B 4UQAA 1IBDA 4G7YL 3CDGA 1AGCB 1AGFA 5E4EC 3BZEA 3HS0B 1AKJA 4K15A 1O7SA 4NXSA 1G0YR 4NPKA 1C08A 2AKRB 4JANA 3MJWA 5BV7L 1J48A 3V0GA 2JTDA 5FW6A 5E2TH 3JTBA 2AJXL 4NB7A 3DVGA 1CFBA 1AKJB 2QADB 5DUPH 3GFUA 4PM1A 3VXRA 1HQ4A 3GIZL 4HD5A 2R39A 4J3OC 4YR6A 3UMNA 4WEBL 1GVIA 1QLEL 1GY2A 4F8PA 4NQQA 1J86A 5I66B 3GSRA 4X9YA 3GM8A 5KUKA 3APCA 4NP4L 3TONA 1KIRB 1RZ8B 5DUML 5E8OA 1TJMA 4FHKA 2XNAA 4YHLH 4JUSA 3F7YA 3MV9A 5J6SA 3RGVC 1MRFH 2P8PB 2XTJE 4JJOA 4N8CL 3AROA 1TTCA 1KN2H 1XCTA 1BBDH 3U1SH 2J12B 1CF8L 4ZUSA 2XKSA 2ZOOA 2XWZA 4O2EA 4FQCH 4GAGH 4L8CA 2D7QA 3L45A 1MCPL 1S8DB 3GMNA 3L3OC 1ZT4A 3IGAA 4XNXH 2J2ZB 1QOKA 1OM3L 1A7OL 2IGFH 1BJ1H 3CFKB 4M1GL 4YDKH 2BIOA 2VQ1B 3FYIB 3MBXH 3IGFA 4ODXB 1AGFB 3IRCA 4GAGL 4C54A 3C08L 4ZFZB 2MFNA 1WEJL 4M3HA 1LK2B 4XVTH 5I82A 4OZGE 4MWFB 4M8UA 1V05A 1SXSA 1KJ2B 5T1LA 4Z3FA 1CWVA 3QEQB 3U6RB 4J4PC 1NINA 4AV4A 3BMVA 1JZHA 1N64L 4GAJH 5CD5D 4L9LC 1FLRL 3E6HA 1N2RA 2NDGA 4YHZH 2FEJA 4OV6F 4N6RA 4Z7WB 1VACA 4MMXB 1Q72L 4KHTH 1SDAB 5FYJL 4UM9B 3ESNA 4ZRGA 3VFGH 4JRXE 4NDMA 5FWQA 5HPOA 1NM4A 1FNSL 5FA4A 3SQOL 1P84J 1RZ7L 2VLRA 2VLKE 4KJQC 1ZE3C 2YPLE 2D7NA 2MCPH 3N85H 4U1IA 4E0RA 5KOVC 1KOAA 1YNKH 4QRUB 3BWSA 5JLZB 3DURB 2RCSH 1HK6A 2VRAA 2OZ4H 1GCYA 2FHCA 3NESA 4G6JL 2RTTA 1RP8A 1HXYB 1KIQB 1UM4H 4LVNC 5I73B 2EDBA 3BDYL 2DY2A 1CC3A 1T6BX 4YDIL 4E2OA 3BVNA 1KGCD 3PL6A 3CXDH 2C9XA 3MLZH 4G7VL 2P44B 4NCC2 4OM1H 3BKYL 1LMIA 3B7SA 1VFMA 2IC2A 1WBZA 2Y4SA 1JPTH 1JZ4A 4JZOA 4UT7L 1R4XA 2AV1B 4JO5A 4LKCB 5CSZB 1GOHA 4M8QA 4QRRA 3O2VH 4HF5L 5LGJA 2C9AA 1YJDC 2UYLB 1UC6A 3LY6A 2AITA 1P4LB 3SDCC 4Q4IA 1A25A 3PP3K 2IANA 5DWUL 1RULL 3MRPA 4KHXH 2I60H 2BNRE 2OV0A 3BIBX 4TNWK 5I1JL 2Z4TA 1LMKA 4UAOC 5D7IF 5BVJB 4BH8A 1LO0L 4YDLB 2I32A 3C09C 3D30A 3PAUA 4DGVH 1MG2C 1URIA 1TVHA 4AGOA 5DLML 5AZEH 3LXUX 3NZ8B 3HAEA 1AR1B 3GXIA 3EYFB 4RMWA 5I1DA 1U8HA 1V5JA 4N0UB 1E3XA 4LO9A 3QJZA 3CHPA 3NFSH 2HFFB 2QTVA 3ASOB 3SY0B 2ZUYA 1MHCA 3ZHLA 4BK5C 5EF0A 1IVTA 2VITB 4G43B 1PD6A 3ZMEA 1I53A 4Y1AB 1CGVA 4MMXA 5EZJB 3IVKB 4X4XA 4QXUH 1ADWA 4ZOAA 1CXKA 4Y4KB 4FNTA 2SEBA 1QPPA 2B3RA 3MCG1 3P2TA 3V52H 5CR1A 3CZSA 1CLCA 4N2IA 1CFNA 4PJ9C 3DBXB 1BLNB 3QI9C 2P26A 3C87A 3O6ML 2GK2A 4OZ4B 5J11B 4YLCA 2GJPA 3FFOA 3WLWC 1WZLA 1KB3A 3IJEA 4MD0A 4X6DE 3D08A 3HBGA 3KL5A 1PAMA 5DD6B 4FZEL 5E8NA 2XQYA 1QBLH 3LEXA 1LO4H 5DMYA 1T66C 1S8DA 4JQVA 4QO1A 2JI2A 2A9BA 4EN2A 2J21A 2MTPA 2CO2A 3RWGB 4JFDA 1PEZA 3STLA 3NZUA 5CU9A 3K6NA 3H1ZA 2E4FA 3LXCA 4V1DB 2HN7B 4U2ZA 2XBZA 4AC2A 4A2FA 3QUYD 2WKGA 4XPBL 1JPGA 3MV7A 4MMYB 2WZPD 4FMVA 2FWOA 1CDYA 1HHKB 3RJOA 3VFPB 4QHKJ 2ZNWA 1OTUC 3G5ZA 5CILL 3BHBB 5HVGB 1R9FA 1NGQL 3GKWH 3GSNL 3FBKA 5LGHL 3WKQA 3CLFL 2FX8L 4I13B 5D1XB 5KW9L 2WVTA 1RU9H 1QO3A 5DVNA 5CWSA 3A24A 4YFEA 1DANT 3MRNA 5DLMH 3CK0H 1I4FB 1PZDA 1CR9H 1NCWH 3DO4A 1NLBH 2D03L 5D7IB 4GXUN 2GJRA 3QO0A 1YO4A 3LH8A 4GAYB 1IGYB 3IJYB 1UUSA 1USZA 4KGLA 1RZFH 3QDHA 4FS0A 3D9AL 4PJ9A 5EUOA 3WOVA 1HOEA 4P0DA 2CO7A 3MUGA 3KWVA 4Z76B 5I0ZA 3NEXA 3CFDB 2ADFH 2BMKB 1RD6A 4HC1H 4NO0A 3V52L 4BSWA 4F7PA 3FCBA 3Q1SL 2H6PA 3BVTA 2WKLA 1FFOB 4L5FE 1H5BB 4LLQB 1DEEA 2WBJC 5DK2B 3TBWA 2VERA 3MDJA 2WLYA 4N2FA 3O6MH 4GQ9H 4Y4FC 1BD2D 1FL6B 1IBBA 2F18A 1UD4A 3RU8H 3ZQ9A 2CDEB 3UIZA 1WYJA 3HR5A 1HFUA 3U0WL 3PJSB 1AE6H 1J88A 1HDMB 1LILA 3TCTA 4G1MB 5D7EA 2BDNL 4PTTA 2O61B 1G6RL 2F1EA 4MAUH 3G5YB 2V3DA 1CFTA 1SLUA 3IS1X 3S4SA 4HKJA 2CKBA 1EHXA 1ZS8B 3MRBA 4L2YA 3T2OA 1SM3L 5IHUL 4OFYD 3TA3A 4XXWA 5SX4H 1TU2A 1GZQB 4DPCX 5E9NA 5EOCL 1ZLVK 4DK3A 4PB9H 2V0AA 4UQ3A 3RNQA 4ETYA 5FS5A 3LIZH 4GSXA 5ACMA 3UCQA 3ZY7A 5DURD 3ZRCC 4JG0L 4MS6A 4JFFE 3VFUB 2WLIB 5AB0A 3K71B 4PI2A 3BUBA 3ZTEA 1IM9B 1D6EA 2F7PA 3GEFA 3O0RH 3ILPA 2CK2A 3BH8B 3MCKA 3B5GA 2B0SH 4JCWA 3TCLB 1LEIA 2YJQA 4XWGH 4HHGA 1L3WA 3QZMA 2XC8A 4LDOB 5IJDC 4H44C 2APVA 4PVNA 1D5ZB 2GT9B 2N4IA 8FABB 4XTRC 4DVRH 4NKMB 4S1SH 1ZS2A 1AXTL 2ZF9A 3AM8A 1A6ZA 1ZA6A 4G8IA 5F96L 1YJDL 3UBHA 3N9GH 3FU6A 5EF3A 3FT2A 1NDMB 4UF7C 4ZS7H 4LHUB 3MOQA 1DEEB 2WXPA 2EDTA 2HMIC 5IOPB 2HRPL 4Z76A 1T1XB 4A37A 3UAFA 1TJHL 3FFCE 1PY0A 3RWIB 2VH5L 3H8NA 2DQUH 4IJ3B 2AABH 3L5WA 3ATAA 4Z1PA 1KENH 4DP2X 2UVEA 2GK0A 3T1FB 3BWZA 2FYVA 4LSTL 4JDZB 2CLVB 5E94B 3T3PE 5D96C 4LAJH 3VA6A 3VA2C 1IFGA 4UU9A 4V2BA 3FQUB 5GSVB 1DQLH 1W0VB 4AQAA 4AKOA 1VZHA 1ET7A 3P9MA 4GI8A 4OY9A 4JRWA 3HS0C 5HGAB 2NUTA 5ISZE 3AT0A 3ARGB 2BFVH 5FV1L 3SD5A 1F42A 4HIJA 3BCFA 4U31A 3F58H 3L17A 5I6NA 1GAFL 4UDUB 1ZSDA 1IC4H 3IE9A 1SY6A 4N2LA 4D8PA 3VFPA 4HW6A 4QKTA 1CT8B 4BFGA 4P57B 5JIQA 5A6IA 5F2FA 4ZFFB 1GC1C 4Z7QE 2P80A 1BVKA 1DJXA 1DVYA 1U4EA 3HRZB 3QDJE 4CILA 4WUUD 3LIZL 3QG6A 1JPEA 4OCXL 4EIZC 4U7KA 2PUQT 3HG5A 3HRPA 1QLEH 3PDOA 4X98B 3Q5YA 3OMNB 2MMXA 4TUJA 5JIKA 3FU8A 1UOLA 3TT1H 1XGYL 2RA1A 1KPUA 4HIEA 4MA3A 4KKAC 3VGAC 4HCRL 5IB1B 4LLDB 4IQHA 3MJ7B 3EOAB 1Y6MR 5I15H 3EOTL 3IS0X 4UIKH 4LCYB 2C9VA 2Z31D 4UQIM 4JRYB 5B1JA 5J4MA 1HT6A 2OR9H 3HE7B 4JQVC 2AEPH 2V6HA 4WJG3 1JIBA 1V55B 2Q8AL 2WP3O 4CMMA 2OCCB 1UOWA 4QRQB 1KDJA 1AP2A 4E9TA 2EUXA 3LOWA 3MNZA 3DX8B 1ED3B 2GBVA 2DYPA 1NCIA 1Z3GL 2F19H 4B9IA 3QUKA 3LEYH 4YL4A 4Z7OF 1XMEB 4KZ0A 2Q87A 2BIMA 5DJ0A 3UZEC 5B8CB 2FRGP 1AC0A 2VMEA 1U42A 5D1QE 5DD5L 4OIFA 1QBML 3REWB 5CS7A 3DO3A 2YJLA 3CBKB 1OT1A 5C8JB 1DVFA 2Z8RA 2BP0A 3VFTA 2YSSB 4LSTH 5A1AA 4AVKA 4HUUB 3ZZLA 4NNPL 3PNWB 4KU1A 4N85A 4PV9A 4A63A 4E36A 4AL8H 1NMCB 2VR4A 2XXFA 3GMQB 1QX1A 2AJVH 3PF2A 1B3IA 1CDJA 4UDTB 3SDCD 4HIXH 5JXAH 4L0YA 1NIEA 5BV7C 1ZTXE 5BV7H 1USQA 1N67A 1RURL 4IEFB 4KH9A 4NC2B 3VXMB 4F7MA 4JFVA 4Y0GA 4Z7VB 5KJRH 3BIKB 3V5KA 3MNVB 4GRLA 4U0RC 2WXRA 5E5MA 2OBGA 3O3EA 2H41A 3EYQD 2VDNH 4RDQG 1D5MA 3PYCA 4BGLA 2AZAA 4KOBA 2UZYB 4PLOB 2CA3A 1BFSA 2JCCB 5DD1H 5EU7E 5L9DH 4AEFA 1QYGL 3U0WH 2JJSC 4IDJL 4MYWB 5E4EB 4OLZL 1OL0A 3ISRA 4KRNA 1IBZA 4ZQKB 3HZMA 2IWKA 4EO5A 1W0WA 4S2SB 3JV6B 1RUKH 4NKIL 5SWSB 4D9LL 5IM7A 1S7RB 4Q89A 4KFMA 3ZQXA 2FTAA 3IBEA 4JO4L 4ZPTB 4QHUA 3PIQB 5FYJE 3EYVA 2Q76B 4BFBD 1JHTB 3NPZB 1YYLL 5IM7B 3MLUH 4JY5H 2I25N 1W72H 2GI0A 1M7IB 5EU5B 5AFAA 3L5JA 3QDJA 3F7LA 4RNRB 2AV7B 3F12B 1EX0A 2Q1EA 3FN0H 5I1AB 3S3BB 4OLEA 3FO2A 2YXFA 2OJ1A 1MUJB 4L1SA 3UADA 5CEYB 1Q1JH 1HCZA 4HBCL 1JYXA 3ORJA 43CAA 5TFSH 4R96B 4Z95L 5IR1A 1WPCA 4NGHH 4HUNB 3B2PA 4Z7OB 1JGDA 3IJSA 4PV8A 1T0PB 5JHDB 4LSQH 3IF1A 4H5SA 3V5KB 3WJMB 4JVUA 1UB6A 1JRHI 4UAOB 5DFAA 1ZA3B 4I18C 3O3EB 1I7UB 5CP7A 4JFXB 1PG7H 5T1KD 3ZDXB 1YYCA 3SKJL 1S9WA 4KO5A 5IUSA 2R1WB 4XHJC 1NFDF 3QXUA 4JRYE 5I30H 1P7QA 1S7TA 3H6JA 1I1FA 4LHJB 4NZFA 2YGNA 5D1QB 2FEDD 1MNNA 2LR4A 4YZFE 5C97A 1X7TA 5CLXA 2ZOLB 1QRNE 2WM0A 1MI5A 3CFEB 3P4NA 4FFYH 3CFKA 3V4PA 2OCFD 2AK1L 4JFUA 3SBWA 1KLUB 3ARFD 3NCXA 3K72B 4QO1B 5GS0C 4G7SB 4LP8A 1F6FB 5BRPA 5IQ9B 3LXBA 1TZGH 4B95C 5BOZG 1BP3B 5FYKH 1I1CA 4NKQB 3JTSB 3ATEA 3B4NA 3BC9A 4OM1L 3L9EA 5DR5L 3DMMA 1K72A 2HFGH 4XOAA 1U30A 2PCFA 3MV7D 3CXDL 2ZICA 1J0JA 1H0DA 1H8SA 3MVSA 1AZBA 1O9WA 1K8IA 3MNWA 3VFSB 1A4JA 1VERA 5E51A 2ED7A 4BQ8A 3QJFA 3ZE1F 4JHZA 2CJTA 4GMSH 5IWLA 1UM6L 3PU7A 3TBYA 3QPXH 3VXOB 2RJMA 1NCAH 5E2VH 3WJLA 3BISA 5J6GA 1T83A 4WHDA 2GCYB 2NY3B 3QCTL 3ZKXC 3QDGA 1CS6A 1ITBB 2XVLA 3FCSB 4OD1H 4RIRA 5GGVH 4P46B 4YSOA 3ZO9A 1QLRA 2YSTA 4I0PC 4XNUH 3MLUL 3OR7B 5DK3A 2F61A 1X9UA 1E5BA 1SOXA 1EAPA 3L08A 2Z1KA 4DN3L 4U7SA 3T6QC 3EH2A 1TYRA 4JO1H 2HFFA 4GI9A 4Q6KA 1ZDQA 1C8PA 5F7NC 3APFA 1NAKL 4DEPC 4ZSOB 4PG9B 2CLRB 2CO4A 5IV2A 2DQTH 1JXFA 4M6ML 3QUMB 1T89A 1ZSHA 1IILE 2CLZA 4Y2LA 4NQCA 4NO0D 2H26B 4MA1C 4KRLB 5GQBA 2W95A 2ZD0A 4LEOA 2Z65C 4QYOA 1Z3GH 2F19L 2DTMH 4ADGA 1OGAD 3MYJA 4NQEB 2NLJB 4F57H 2FUQA 1PG7L 2EXYC 1UTDA 2PYEE 1I8KA 1KXQE 1N6UA 1SHMA 3QUKB 1TCRA 2AQPA 1JI2A 2YPKB 1KLFB 3OF6A 4X2UA 3S34L 1NBYB 3SJVA 4HFWB 5ICYB 1G1KA 3BLKA 5JPMB 3UYRL 5HYFA 2FJSA 2J88H 3EXLA 4JCMA 1N68A 1QVOB 1R19A 1DO6A 1S9VA 1X5AA 3IU3A 1ZDSA 5KBDA 4DZBB 5ABZA 3W3BA 5ESVA 3R19A 4TM9A 1NMAH 5ACLA 5I0XA 2CRZA 4JFOB 4S0SD 5DI8A 2GSGA 3OHXA 3RZCB 4TSBL 3Q01A 3Q8CA 5FLUA 1S7XA 2W5PA 5DD3H 3KYOA 3IMSA 2XV0A 3MRRB 1NSNL 4KTDH 1XGQA 4YE4L 3EJZD 3B83A 4UIMB 1PFOA 3CWGA 2WLZA 4LSVH 5IFHH 1AGEA 3S5YA 2Q9OA 3OJDB 3N3EA 2QSVA 4GMSL 1ODUA 4MXQC 3QFGA 1WICA 3RYMA 1CFNB 1WCQA 4NQDA 1UXWA 4MMXC 1N18A 1T2QH 4UANA 2X4TB 3FDWA 4EXKA 1P4BL 1XHHA 5KYWA 1C7SA 1EXGA 3DXAA 3BN3B 5DQJA 4QUOA 1MRCL 3WNMA 2IFGA 4Q6IC 5DFVC 3MU3A 4LCWA 4PRIE 3STBA 1MQKH 4UI2A 1SUJA 4Q0XH 3QZPA 4YX2H 4UT9H 2FLBT 2WOBA 4XBGA 1X7QB 5I8KL 1GCFA 3NPSC 5GGSB 1AO7E 4FGMA 4F9LA 3BW9A 3I9IA 1CF8H 4L37B 1A3LL 3ZHFA 3FTUA 3NG5A 3HBQA 2ODIA 3VRIA 4AUYA 1MFBH 4JDVB 5DHMC 5GGSA 4Z8FH 1M2VB 4XPTL 3SDAD 4G8GD 2ERJB 5F44A 1B0RB 4D0CA 1LP9E 2J5LC 3PCYA 3C8HA 1G5GA 2P24A 3HG2A 4Z7VF 3LDBC 2VLRE 3KCPA 2X6VA 3KJ4C 2GSIA 1DDHA 3R8QA 4KO9A 1WE5A 1FZJA 2Y2YA 4HJTA 2SODB 1BVNP 4JE0A 3P30H 3C5SA 4ZFGL 4P46D 4P9ML 4R5XA 3U0PA 2NMSA 3WXWL 1NCBH 2CXKA 2EEAA 5D1XD 1QTYT 2D9QB 3DV4A 2APTA 3H9ZA 4M43H 3P3TA 1SEBA 4P2RD 4HWZB 4NN5B 4TUJB 5HHME 4ALAH 3GSNB 2YEVB 1JWUA 3R0MA 4HIEB 3GBEA 4OZGA 2KKQA 2LFEA 2UZXB 3UJJH 4PRDA 4WNQA 5BO1H 2YMXL 3ARGC 5DJ6A 5MENA 3LSOB 3UJIH 1HH9B 3RGBA 3HZYA 4I2XA 1AS8A 4J8RB 1FG2A 1RJYA 2PWDA 4FTVB 2F74B 1KYOK 3BAJA 1RLBA 1C5CL 2UZYA 4JKLA 4N2EA 5T3ZL 4XAKD 3CDYA 3INOA 2E7DA 2PYEA 5KSAB 1R5IA 1HI6B 1WUZA 4Z7IA 1GMIA 4TRPL 1H6FA 3OKLA 1C5CH 2NY2B 1A6VH 2EINB 3LQZA 3W11D 1G5AA 1EJOH 5EOQH 1I7RB 4FQXD 5T1KB 4JFDB 3B5TA 2VIRB 3IDYB 5T3XE 4G9DA 4POUB 2MQ0A 4LPUA 2F53A 4GO9A 5IB2B 4XO9A 1OD9A 1AYRA 2FO1A 1YQ2A 5C0AE 4HUVA 4MB4A 3TCXA 3LCYA 2F53B 5A7EA 5I0VA 4PIRF 5FM4A 3T4AC 1BFVL 4GG6F 1A1NA 1I1AA 3FQ2A 4Q9BA 4JFED 7FABL 2XN2A 4YXKL 5H2BA 3SPCA 1KEGL 4PP2A 5C9JB 3I9PA 3RTLA 5E70A 4JZJA 4LRIC 1CG9A 2FL5A 2J6WA 3FZUC 3T4YA 4APQA 4FFZH 4G70B 3GZPA 1NGPL 5TD4A 1IZKA 5JQ6H 4Z3EA 1CYWA 2Z6FA 4I2XB 1AD0B 1I1YA 4OGAC 3BOVA 3ZLQC 4EDWL 5MEPA 3DJRA 3U7YL 2ZOTA 5EA0H 2FAUA 4LSPH 4PUBL 4N8UA 3MLVL 3ECBA 3QUXA 3S3SA 4YSSA 2JH2A 1N8ZB 2BY0A 1ETJA 4RAUB 1XGTB 3IDUA 2HVKB 3V5HB 5BS0E 5F89A 4MSWB 4DFIA 3EOAA 1TTUA 4F7CB 4H8UA 3UJIL 1TYJA 4DUWA 1QR1B 4OM0L 4CNIA 4C4BA 5LXGH 1CDGA 5F89B 4P2OA 4BJLA 5EPMA 4N3UA 4CU7A 1GA2A 1I82A 4DTGL 3N42B 4XP4L 1QRNA 1JK8B 3SE4C 1A5FL 4NKOA 2I7SA 4W9GC 2C1OA 3JZ7A 4HLZG 4XNBA 3AACA 3DWTA 1XAUA 1FLTX 3HMXH 4FP8L 1AGCA 4QHLA 3AWEA 5AB1A 1CFTB 3DYMA 1FFQA 1QSFE 1UEYA 4LSVL 1JWSB 5IFHL 4GG8B 4UDUA 2FGWH 3KWTA 2VZ3A 3V6ZA 1YEGH 3QFDA 4WW2B 1BMWA 2DLHA 2R56L 4FRWA 4PRID 1F0LA 4M62L 4XP6L 2XBTA 1QD0A 3P0VH 5DYOA 2G2RA 3V6FA 2PW2A 2X7LA 4PJ8D 1TNNA 2GIXA 1WAEA 2NZIA 4FKKA 2L7JA 4MAYA 5CUSL 2QQLL 3NJJA 3O2DH 1I8IA 4QRUA 1GY1A 4LCIL 1FVDB 2ZKWA 5J1SC 3UPCA 4GSUA 2YXVA 1J0ZA 1EIBA 4FZ8L 4UBDC 1F11B 1O5DT 2FQGA 4PJDF 3MHZA 2DW5A 2UWEE 2VXSH 4JN2B 4OIIH 5IHHA 4R6UA 1AS6A 4LCYA 4GSQA 4MBOA 4MXWL 3UDWA 1I8LC 4RGOL 3Q5OA 1EAJA 1EJFA 2NY3D 1E4WH 1FL3A 4LRNL 4XO5A 3QEGL 2A6KB 1X5KA 3WNJA 2HJFA 2CJSA 1BAWA 3ECBB 3QUXB 2WTPA 3WUZA 3SDXE 1JZIA 1B0IA 5I30L 3ZTJG 4NWTH 2K7PA 3ETBJ 1OVZA 1JXKA 2BY3A 3P3RA 1U8LB 1MOEA 1KGUA 4S1RL 5ICUA 1P5VB 4ZBJA 4G5ZL 1YUHA 2NDFA 4XCFL 1A6UH 5B3JF 4BRJA 2IIJA 3AS2A 2ZOKA 1R24B 1S5HB 3KNBB 2ADJA 2DDQH 1U8LA 3MRMA 5DF0A 4OBSA 4TOYH 4ZFZA 4KQ3H 3RVVC 5B38G 4QDGA 3ARBD 3JV0A 5INDB 5HI5C 1JGLL 1G9NH 1FGVH 4BE6A 4NERA 5F9OH 4X6CF 1RZ7H 3P9LA 3Q8BA 4BFOA 4G8FB 3F7PC 3S36H 2D9CA 5KS9F 1IKNA 15C8L 3QXVA 1SDDB 4WFHD 5CGTA 3TVMC 4Z7QB 3BAYA 5D6DA 4YHPA 1HZHL 4IEFA 3VXMA 4F7MB 1C1EL 4FLOA 1EGJA 3GTVA 1H9DA 1WV7T 2NNRA 3VXPB 5EU6E 3PUCA 1DSWA 4K5PA 4UM9A 2AJUL 5DSCB 1VEPA 1IEHA 1XCTB 1JZ2A 4K3GA 5DUJA 5FECB 4PJ5A 3HNVH 4UOQA 3ABZA 3K5RA 5GGVL 4IKLA 3I75A 4ADJA 2XOTA 3NIGB 4EZKA 5F9WC 5DJ2A 1KJ3L 1KTCA 4LLUB 1AO7B 3HPLB 2IPTL 3WENA 3V2AR 3C08H 1A47A 2AGJL 1Y07A 3T0DA 1Y6KR 2EUVA 1DZBA 3Q3GB 1LWJA 1L7IL 6FABL 4YBQD 3CBRA 2BP8A 2IDCA 4PRIB 3VXTB 1JBJA 2G60H 1TTRA 3G04A 3A4DA 5IIEA 5AD0B 3HE7A 2CDGA 5CCGE 2DD8L 4CMMB 5FGRA 5I0YA 4O00A 3MCYA 4UNVA 3B2UC 4L4VB 1KBKA 1N5YL 1E4WL 3FT0A 2YMTA 3UMTA 4ZI8A 1AQKL 3ULVC 1S2EA 1X9LA 5BQDA 5E95B 2JIXA 4H1LA 2VKXA 3NFSL 5GRYA 4PJ7F 1HHHA 4JFQB 3DROA 3B56A 2GTZA 3TIDA 1GTNA 5IQLA 3S4SB 3RKDC 3SQOH 1IM9D 4RZCA 3VXSB 2X12A 1KZYA 3DUUA 3RBGA 4FC3E 4KI5F 1GYUA 5IVZA 1J9RA 1U8IA 4KQ3L 5ALCL 1S5IH 2M26A 4FP8H 4AZ8A 4CC1A 5CEZD 2B4CC 5I18L 3QWQB 3DO7B 2IQ9L 2BVPB 2OW6A 3GSRB 3KYMB 2GTQA 5A6LA 3DURA 1YPZB 1YNTF 5JZ7D 2Y7LA 3TT3H 2ZCKH 3K6IA 3HJEA 1RUPL 4Y2NA 3QDAA 4DVBA 3MUGB 3KYAA 3LNGA 3UTTB 1JCKA 3FCUB 5AYUL 3NZSA 3SDCB 2QT6A 1P7KB 3D0VA 3VSQA 4C58B 3KGUA 4EOWL 5JHBA 3OPZL 3EFDL 4ZAKA 4JPWH 2VAJA 4F5CE 1EK3A 2ICCA 4JHUA 4IOIA 1JPFB 1TFHA 2KT6A 4M4PA 2HKFL 4P2OC 4L4JA 5GJTL 1S78D 2VLJA 3EO9H 3IPBA 4LOEA 3UTQB 1NAMH 1YEWA 3APNA 1DBJL 1IGJB 1XQ4A 3GLAA 4X99A 3F65A 2PP9A 1FGNH 4APXA 3M7FB 2A6DB 1TCRB 2EJ1A 2YPKA 4HG4J 3GS7A 3UAEA 5J3HC 3FFDA 3I02B 1YEFL 4NQXA 2YGQA 5KBMA 4PJ7E 3VSUA 3W0WE 3LZNA 3JTTB 3MV7B 4I3RH 5BOJA 1JWSA 4IK6A 4E9XA 3FTGA 1L4IA 2LU3A 1T20B 4LSQL 5E6UB 2KPNA 3SBWC 2GUOB 5GGQH 3S37L 4E9YA 3I6SA 4QXUL 3QWOA 3SGDI 4XCCL 2Q2EB 4BFEA 5I1AA 3K71A 2CCLA 5AVVB 1JRHL 3TYGL 3VI4E 1LEIB 1F3JB 2R2BB 4KKNA 4HWZA 2LHAA 4Y19B 4A7GF 1U36A 2ENYA 3QQDB 3INUL 4BZ1H 4DGVL 1X5LA 5MEOA 1KB9K 3FRPG 4IOSA 4NEHB 1KYAA 4YDNA 3D7PA 1CK0L 2ZCLL 5C2BH 1KIUA 3QFJA 2V17H 1F90H 4GQ9L 3P0YL 2IBGA 2O6DA 3RURA 1Q0XL 1R5VA 2OI9B 1WBZB 3AQYA 3GJFH 4AGQA 5B1JC 4N24A 4KVNH 4QTIH 1ASPA 1MHEB 5EBLB 2OXHB 2DM2A 3MYZA 1BYNA 4OAWA 4K9JA 2FQEA 3SKMA 3UO1H 3DSNB 3QXTA 4WEUD 1YMME 1UGNA 5JR1H 1LDPH 3FC8A 3H54A 5EV7A 4R4ND 3S37X 4JPWL 3OMZA 2WN3A 4WW2F 3TT1L 4LNRB 4FQXA 2WD0A 3BH9B 3G5WA 3MTXA 5D1XC 3LN5A 4Q2ZA 4M6OH 3VG9C 3HLAA 5IW6B 3RGHA 3DX0A 1QSEA 4CKVX 2VSDA 5IB2A 2YUVA 4U1MA 2B1HH 4HJ0D 3MRKA 3CDZB 3VMNA 3B2DC 4KAQL 2DL2A 3ULSB 3NN8B 3E9TA 1F18A 2NY0C 3V6OC 5D7LA 3HC4H 1A14L 3TESA 3TO4C 3H56A 2IBZX 3UOAB 3WN5C 2F54B 4B9PA 4G8AC 1SLXA 3KLDA 4DGYH 4APQD 4FI7A 3IU4L 3BHBA 4LOVA 5CBAA 5FECA 3BP6A 4YNYA 4YSRA 2NXZB 3S9DB 1E8XA 4FOMA 4U0QB 5C92A 2ID5A 2AJZB 1PZBA 4P2YA 1KTLA 3D6GA 3MREB 4G6KL 1IAKB 3UIYA 3L3KA 2N56A 3ZOAA 4Y4FA 1IGIL 2AK4B 2D31B 4AK1A 4BGDA 3X11B 3AQXA 3UGXA 4YSAA 3G6JB 3OKEA 5EOTA 2O5NA 2VQ4A 3BKJL 3RWIA 1LO5A 1XH1A 1FO0A 4BM7A 3KWUA 1MNUL 2DICA 1JOIA 3Q5TA 5EOTB 1BYOA 1ONQB 2AJ3B 1NC2A 1EERB 4CADA 2QV2A 1G7QA 3FT4A 3UX9B 3LEXB 4OFIA 3DIDA 4QRFA 4A7TA 4R4NC 2AXFA 5I5JA 2VUYA 2KZ1B 4JQIL 1Q9WB 3HBZA 3EOYG 2NNAA 3NJLA 2H47C 5EBWB 3RVWD 1P5VA 5DA0B 4TULL 3IFPA 3BZ5A 3UTSD 2WJ5A 5CCHE 1M1XA 1KPVA 4FABL 4C4UA 2NR6A 2XQBH 1JYVA 4PJHE 3SEPA 4TQ8A 5DHEA 3ETSA 3M86A 4Z78A 1I9IL 4ZXBA 2QFRA 3C2AL 5IKCB 5GZND 3GNMH 3AMKA 4AI7A 5DJDB 4ELMA 2EIKB 1IARB 1A7PL 2NTFB 2C4FU 4LCUB 4ES9A 2MHAB 2Z92A 4N90D 1SM3H 2V3EA 2VLME 4LKXA 4XCCH 1W8EA 2Z7ZA 4JN2A 2W92A 3QCTH 1L9RA 3GMLA 3QIBB 1XIWA 7CGTA 4LVEA 2O5ZH 5FDWA 3MOBL 2X3AA 5CZXD 1G7HA 3SQBA 2H3KA 3D5OF 4R2GD 1MWAB 1OP3H 3VFNA 1IUZA 4BKSC 3FT2B 4FQLL 3X11A 4MAZA 1ZLEA 4PRNA 4IM8A 3ZU8A 4AXWA 4TNEA 4TUOA 3MODL 3MXVH 3LN4B 1KGYE 4CDHA 1C5BL 1IAOA 3HZMB 4PJBA 5L4JA 2CHWA 4NQVB 3WHE0 3MOAH 1SBBA 4BUHA 4C47A 4DPAX 3PP4H 4OLWH 4G8IB 2Q3XA 4P06A 1I9JL 2CG9X 1XR8B 4HXAH 1PYWB 4UQDA 4LGRB 2X05A 2HFTA 3FTZA 4P2QD 5D6DC 5I8CA 2FR4A 4DGWC 4PG2A 3PP4L 1H15A 4OQTH 4OLWL 3UAAA 4DW2L 1HEZA 4L3CA 3O6FD 4WWPA 2CAKA 1KB5H 5GS1B 5TQ2H 1I7TB 4FAAB 1KJMB 2IV8A 3U1PA 4C83B 1J5HA 4GLRH 3S5LG 4CN1A 3NK4A 5ABDE 4WHCA 1YNTB 4H1LB 3AWGA 3JV4A 1ADQH 3MRBB 5ADPH 1MJ8L 2GC7C 2J5WA 2QR0A 1O75A 5C0RH 4G9FB 1F3JA 4ELMB 5I8EA 1SBSL 2DDQL 2YZ8A 1QLFB 4GEJA 2J5LB 1A22B 5LQBL 3WDHA 3N04A 2Q8BL 4U1KB 2A77H 4FABH 4Z78B 1KCRH 3DTXB 1ZA3A 3HN3A 3GBLA 1G9NL 3A4EA 2QVKA 1U3HB 3IN0A 3JVGC 4WO4C 5DMJB 3L5XH 5G2NA 2QKIA 3FOMB 1I9IH 2H3XC 1EGJH 4D8PB 3GSNH 4XPHL 5DJ2B 5D7KE 4XP6H 1OGTB 2E3VA 3D0LA 3POHA 4LQ1A 4XMLH 3QHZH 1IFHH 1YEGL 2CUIA 4RFNC 4FLRA 4Y1AD 1R5VB 4HGMA 4TQEH 1AG0A 3D4GA 4KPHL 4E68A 3MV8A 3Q8EA 3WFDH 2FK9A 4Y16D 1ZWIB 2F8VA 3ES6A 3HTLX 3RKDD 5IQ7L 1E9PA 2Z7UA 3PV7A 3HPJA 2WQWA 3HNVL 3GSXB 5C09D 4AKQA 4FL4C 3RGVB 4JFFD 1FVCB 3B7RL 1E9PB 1KEML 2QGCA 1H3WM 1DJWA 4ZPTA 4AE0A 5IBUB 3HB3B 3BKJH 1E6OL 1MCFA 5GRUH 2BOCA 2VMCA 4ZJ9A 3HUJB 4ZUUB 2X4SA 4PY7A 2UXFA 1U3NA 4QOKD 3EDEA 1QFWI 5TPWH 2Y5QA 2R2EB 2BNQE 1IC0A 2D2CC 2NXYD 3K1DA 4W9LC 1BD2B 2J8UE 1ZSDB 2IWEA 1MW3A 2ZJSH 2ARJQ 3K80A 4LZKA 2P42B 5I5IA 5F1IB 1MCIA 4MNQD 5CZXC 5CMAA 4JB9H 5TPWL 1DVQA 2F53E 4HHAB 3CPLA 5IP4A 1WGVA 1MAMH 3GHBH 1MPAL 3D09A 3EBAA 2O5XL 2XPGB 3RX5A 4X5PA 2A0LD 4P9HH 3FQNB 5LQBH 3VXRE 1ZLVH 3IFNL 1IEAB 5TH2B 5CF3A 3BPNB 3W9EA 1XZ0B 1A7RL 2VLKD 4JW3A 2AK1H 4I89A 1MNUH 1CE6B 5K1NA 3DPDA 3HOGA 2CJUL 4ZO7A 1OAXL 3NIGF 1BIHA 4LQFL 1VKXA 1ETB1 1MFVA 4MJ6B 2DQEH 2VDPB 1AHWA 1VGEL 1AI1L 5SWZE 1MFNA 2DB8A 5EBLA 2WXKA 4JRLA 1EZVY 3L1GA 1M05A 5F7EH 3BFOA 4PMEA 3GSQB 4KKRA 1U8OB 3TEUA 1LWRA 5I1HL 1GS7A 3BEWB 4X80L 4ETQB 2BZDA 1F1AA 1K8IB 3T3PF 3QQXA 4X7EC 2B59B 4HGWB 1FIGL 3BPCA 5F3BA 5INCB 1UJTA 3O8XB 4XNMA 5EN2B 3ILQC 2X9YA 4MXVE 1FNEB 5HI4D 3RWFB 5EN3A 1U8HB 4N0UA 3O2DL 1A4KA 5DHYB 3WMSA 1NWOA 1SY6H 2R2BA 2OTUA 1A7QH 3ZUCA 1CDUA 1ZIBA 3IWUA 5HHOD 3KR3L 1KY7A 3PAVA 3MRLA 5HHPA 1IGFH 3ENEA 4H2AA 5C0CD 3HMWH 4FQPA 2LFGA 5JIPA 3CPLB 1NANI 2CHXA 1FAKT 1JZDC 2BFVL 3IBOA 1CCZA 2E46A 3B9VA 1NEUA 3DLQR 3FB8B 2ZG2A 4W9IC 5DEGB 5DT1L 5L88L 2DJSA 5HI3D 3O4OB 4YHZL 1GGTA 1BIIA 2RHEA 4NUQA 4P59H 4IRZA 1UT2A 1MVYA 4MJ2A 2TSAA 2FX7L 3N5AA 5HHXL 3BRFA 2E9GA 2JQAA 1YYML 2HAZA 4X6DB 3TNMB 3KPSE