4XONA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xonA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xonA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xonA02
4YZXA 1RU4A 2NTBA 4XLAA 4NK8A 1PE9A 4XLFA 4OZZA 1O8FA 4W8QA 4Z05A 4YZQA 1X0CA 4W8TA 4XKWA 1IB4A 1PXZA 2NSTA 3B90A 4OJOA 4I84A 3B8YA 2VBEA 3UW0A 1DBGA 1O8LA 1DBOA 2X6YA 3GQAA 1O8MA 4U4BA 3LMWA 4W8SA 2QX3A 4XQFA 4OJ6A 3GQ7A 2O17A 4YZ0A 3GQ8A 1H80A 4OZYA 3ZPPA 3B4NA 3WWGA 2Z8GA 2UVEA 3GRHA 4MR0A 2NSPA 2X6XA 3SUCA 1JTAA 4OJLA 1QCXA 4XR6A 4XONA 4U49A 4XOPA 2ODLA 2UVFA 3KRGA 4XL9A 1O8GA 3FY3A 4EW9A 1GQ8A 1O88A 1O8HA 1K5CA 4XLCA 2O0WA 1NHCA 2VJJA 2BSPA 1OGOX 1QJVA 4URRA 1RWRA 1VBLA 2O04A 2O0VA 3VSUA 2VBMA 2X3HA 4XOTA 4XLEA 1IA5A 2EWEA 1BHEA 1JRGA 4YELA 3EQNA 1O8JA 2INVA 1IDJA 4XN3A 3VSVA 4AVZA 2NT6A 2PYGA 4XN0A 2QY1A 1OGMX 3VMVA 4HWVA 4YEJA 4XMYA 1KCCA 1PLUA 4XLHA 4XM3A 1EE6A 2NZMA 4C2LA 2X6WA 3JURA 4OJPA 1CZFA 4YZAA 2X85A 3GQ9A 3EQOA 4W8RA 3VMWA 2INUA 1O8EA 3T9GA 5AMVA 1OFLA 4XORA 2PYHA 1HG8A 2VBKA 4Z06A 2IQ7A 4XKVA 1BN8A 2NT9A 1KTWA 4NK6A 1OOCA 3ZSCA 2NTQA 1WMRA 1O8KA 2QXZA 4PMHA 4XNFA 4MXNA 1RMGA 4Z03A 3VSTA 1IDKA 1AIRA 4OJ5A 2NTPA 2PECA 5C1EA 2O1DA 1O8IA 1O8DA 1OFMA 1XG2A 5C1CA 2VJIA 1KCDA
chains in the Genus database with same CATH superfamily
1IUFA 1I1GA 4TSFA 1VQ8I 1E79A 1T33A 3I59B 2M7BA 3I3LA 4CCKA 2CUZA 2ZITA 4UHTA 2D45A 4S0HB 1ZGAA 1QGZA 1NK3P 2E5ZA 3V76A 2DAOA 2QENA 4Z4UA 1O8FA 3FDYA 1UFMA 4RMNA 4EJWA 3O3KA 2IA0A 1IW7F 2KQRA 1Y6IA 1ZR2A 3B90A 4NC8A 3H36A 3RKYA 3BH4A 1FOXA 3CCSB 1MMNA 4AYBA 2VJ5A 3HPHA 1E3OC 3FPPA 3A35A 4DQKA 5EG0A 2O8XA 3U6KA 3H5AA 3I4PA 2CGPA 5HZAA 2HDWA 1ULYA 2HVRA 2F4MB 1FOWA 3J80K 1WGXA 2W00A 3KP7A 4RD4A 4A12A 2VJ4A 5KK1A 1Z3XA 3TW7A 3K4KA 3NQOA 1HC8A 3PSFA 2K3FA 3LQQA 3JAMK 2STTA 1P4WA 2H94A 1YJ9I 5TISC 1F60A 3N97A 2AHQA 3OYHA 2KDZA 1EWYA 3GQBA 4KKUA 1UB9A 3GFLA 4ESBA 4XKCA 5H20A 5FLMJ 5C44J 1G7RA 1OPCA 4WK8F 4GFBA 3WHBA 1JKPC 2V6CA 2QKLB 1SFOJ 4R8HA 1R4NB 3OEHA 1IDYA 5ICCA 2HDNB 2F5EA 3CJQB 2LBFA 4AIJA 1VQ7I 1RQPA 1MH3A 3G05A 2DT7B 1XGMA 2P7VB 4IHXA 4URRA 1E17A 3GFMA 1QA1A 1RR7A 4IZZA 5CQEA 2EWEA 2IBDA 1I1SA 5GP9A 2OCEA 3CESA 3ZMSA 2IA2A 3LAPA 3OR2C 1N08A 1QX4A 3DXJF 2DO7A 1MSFC 1KU9A 3I59A 4ZGNB 1SANA 1FRQA 5ICGA 4QFMA 4HG2A 3RYPA 2VNHA 3OS0A 3AVWA 1LNWA 2C5HA 3DLLF 2GXGA 4FETA 1JGGA 3QWLA 1K8FA 5KW9A 2K85A 1FEXA 4XM3A 2Y75A 4PGOA 1QUFA 1R5ID 4RLZA 1K7AA 1TWHJ 5IP9J 4B3GA 1YHQB 3WTWC 3BG6A 4IVNA 2W1OA 3GQ9A 4RM3A 4L5JA 4NB5A 3HGGA 2HI3A 6PAXA 3T9GA 3OV8A 5E6TA 5H6RA 4CCLA 3T0YA 4WXDA 3JQRA 3M07A 4M9XA 5LRSA 2PX9A 1TW2A 2VASA 3DEWA 3QFCA 1ZGJA 2EFPA 5HVQC 1GV2A 1Q1HA 1OB0A 3FX3A 3I71A 3Q0UA 1AIRA 3W2WA 2HTSA 2RKHA 3PNVA 4U0YA 2F5DA 1O3SA 4YAFA 1DABA 4UB6C 4HLXA 2VJIA 3GIRA 2PMHA 1W0UA 3S8PA 1A04A 3A8IA 2PIAA 3BJ6A 3ZQQA 1I50J 2EIMH 1IV6A 3KP2A 1QBJA 2FNAA 2VFPA 1VQKI 5FKKA 2KL4A 3CPWB 1S3JA 2ADUA 2Q2EB 1XGNA 2GK6A 5IT3A 4GQNA 3KP3A 1KMHA 2E2JJ 1R7JA 3GF2A 2DI3A 5IPAA 1YX2A 2ID6A 5DCMA 2EINH 3TDZC 1KQ8A 3S2HJ 5JFRA 2CW7A 2DA7A 2XNJA 3LMWA 2QX3A 2P8TA 1E1QA 2K3PA 3O8HA 5GADJ 2R0QC 2IGKA 3LL7A 4ANJA 4J19A 4LLNA 1FDRA 1WORA 2R9VA 5DD8A 3KZZA 1O57A 4IQ4A 4TV7A 2EV0A 4B48A 1RESA 1KK2A 3I55I 1TC3C 3GQ8A 5E1XA 3OYJA 1UELB 3Q9SA 3RY8A 4C2TA 3NWTA 3A1PA 2OTJB 1SM4A 3G71B 2ZXJA 2HOTA 1SVMA 1WJBA 1X2NA 4KT5C 4RS8A 3WTYC 4ZCIA 3HOWJ 1YJWB 2KT0A 4U87A 2KRHA 1FNBA 3BJOA 3EQLF 1TNSA 5IOYA 4EW9A 4HAMA 2QEXB 1ZK8A 1O8HA 5TR9A 2C2WA 2O0WA 3BP8A 3SXYA 1U9NA 3K1NA 2CQ7A 3AG2H 5H6QA 1O4XA 5J3OA 4M4SA 5CQGA 1X2MA 2HOAA 2BEOA 3F22A 3WBJA 1Z67A 2M0CA 4N3NA 2VBTA 4FE4A 1OCCH 2ZMEC 4Q5SF 2Q6IA 2XTYA 5LRRA 3RJPA 2KZVA 1WDTA 2XNDA 3UKGA 2VQGA 2YWFA 1O7LA 2CO5A 4NC6A 3A01B 1P92A 4N9HA 4I2OA 3LMMA 3ZGKA 5HXBA 3AVVA 1OYYA 2JDIA 2LKXA 5FKNA 2QGGA 3M8JA 3P27A 2ZSHB 2V7TA 2VB6A 4R79A 1YW8A 1FZPB 4C3HJ 4WZKA 4KH3A 1BR1A 4BDZA 3W2GA 5JHUA 2CV1A 1ETYA 2CQQA 3COAC 3I58A 2QKMB 4P55A 4U7DA 2E2HJ 1EE6A 1EH7A 1N25A 1YX3A 4C9YA 1PVEA 5FO5A 4OJPA 2VODA 1KK1A 5E8IA 3CCLB 3HOTA 5KAIC 4KISA 3PA2A 3CCEB 2X6OA 2O61A 4YAUA 1ZUNB 1K78A 1OFLA 1KQ9A 1W5CC 4OIPF 1OLTA 4LOCA 1VHOA 2IVMA 1KTWA 2BYVE 3V42A 1FLIA 3S3NA 2MGQA 3VSTA 3FISA 4B4DA 5DUIA 2G0YA 3V7SA 3BTLA 2K02A 1X4OA 2X1CA 2HDDA 1ITYA 4HA8A 3LNNA 3ZQGA 3Q38A 3QRFF 5DCFA 1G7SA 2WZPP 3CCJB 2XGXA 4C0SA 1MJAA 3BR3A 2R5YB 2R7WA 2JUCA 1EXMA 4Z4VA 3E1YE 1EA0A 3H3UA 3VWBA 3CP2A 2O5RA 2NOGA 3BR6A 2GA2A 3DTIA 3HKZA 3F6OA 3H9GA 3W2VA 2PQ8A 4LD5A 4LB6B 4BUPA 2J7KA 4Z05A 2ESNA 1T6ZA 4WZEA 2VKVA 3MZ8A 4BJ6C 3W3CA 2JRMA 1W87A 2OBRA 2BXZA 2V5IA 1IB4A 1QZYA 1VQMB 3M9AA 3TMOA 4I84A 3CO7C 1JA1A 3AVUA 4L5EA 3V7RA 3CC2I 2X6YA 1IN8A 4BBSJ 2ISYA 2MABA 3B6AA 2BVNA 2A6TA 2W85A 3W6VA 1JKQC 2C5BA 3GW2A 4YAOA 4BHPA 2D5VA 2O17A 1AA7A 2FJ1A 3FMRA 3GLXA 1UD5A 2P6TA 1WWXA 2PMZA 3B4NA 2RC4A 2ZL6A 2HQRA 1UJ8A 5BQTA 2IA1A 5D8KB 4HF2A 3KX2A 3T5XA 2Y0MA 5J3LA 2Q1ZB 1JTAA 2W48A 4ZYAA 2V9KA 2L01A 5FLXK 1YITB 3BY6A 5L3CA 5LEKA 3BROA 1QQ1A 2RREA 4Q7JB 2QQ8A 2WSSA 2DOGA 1LJ9A 2UVFA 1FOKA 5ED4A 2QBYB 1LDJA 1IAWA 1VQ5I 3LVBA 2WBMA 3G6EB 1W7PD 4EJTA 3LWFA 4ZCLA 4IRIA 3CD6I 4Z1MA 2W7NA 1HW5A 4Z2YA 5GPAA 2YU3A 4MTEA 4GO1A 1U8BA 4RDLA 1FPQA 1JJ2B 1LDDA 1K9MD 4AIKA 4NQWA 4HNTA 3DBRB 2PN6A 1WPCA 3BH6B 4NCNA 1B23P 1QQIA 2HEOA 5LLQA 3GEZA 5DM7F 2I10A 5ILSA 4XLNF 2BV3A 4UAJA 3JX8A 1MBJA 3WODF 1XSDA 2A5WA 3LSMA 3GTJJ 2HMAA 1XGSA 3LA7A 1YIJI 3RQ4A 4RGRA 4IHTA 4M53A 5FROA 1E62A 2VXDA 2XTWA 4BY7J 3BT9A 1ZHFA 4GYIA 1T08B 1VLOA 1IRXA 5FFXA 4PJLA 2V7QA 5E1ZB 2CFOA 3CJNA 2NV4A 1DUXC 3TO9A 2HVSA 5HDGA 3S14J 2MC3A 4BJ5C 1D0XA 4FX4A 5LGUA 1PP7U 4W8RA 2XAJA 3QFTA 1D5YA 2BM5A 2QSHX 2GLOA 3H9NA 5LHHA 1B1BA 1OFCX 2GBYA 3L2WA 3OJWA 2V26A 2L7FP 1OOCA 3ZSCA 3MKWB 4YEIA 2KPMA 3CB4A 2DA2A 1Y0YA 4RAYA 2DY1A 4MYTA 4Z4RA 1N07A 1YIOA 2PECA 2L2OA 2QDXA 1QVTA 1BBYA 1A6IA 4DOZA 4YIRX 2QBYA 3D1NI 5FNZA 1WJEA 3WNCA 2P0WA 3RZDJ 2AS5F 4LBZA 3CLOA 1T95A 1XC5A 3NWSA 4X8IA 2ZJ2A 4CSWA 4XLAA 2E7WA 3OYLA 3G73A 2R7RA 5BOXA 3AGPA 3C7JA 2H6BA 1Y56A 3Q0WA 3JSPA 5CVUA 2X1EA 4PUSA 5IYPA 3Q3AA 2KRFA 1KQ5A 4X7FA 3CLQA 5FD6A 3OYAA 4KA4A 2EIXA 2VNJA 3ASOH 1J75A 1HCRA 1R5BA 2R7ZJ 3OOUA 2UV1A 3QODA 5E3OA 1ZRFA 3SYJA 2OBSA 4M2LA 3IAS2 1WRJA 2DFEA 2XZLA 2YUHA 4TMVA 2A07F 4G7OF 1V3FA 3S15J 5C4XJ 1IN4A 3IHUA 3QQAA 4B1RA 2QTZA 4G7HF 1H85A 1YLFA 4BNCA 4MQVA 3GYHX 1QGYA 3T8TA 4EM0B 3IKVA 3SHFA 1VQPI 1FNNA 1Z1DA 3WWGA 4FXUA 4ABZA 4NDLA 3OIPA 2LSOA 4GGGA 1I8DA 1PJ6A 2DMQA 3FXUA 3V7AA 1KZLA 3DU1X 1OMIA 1ZRDA 2OV7A 3RIQA 1OR7A 2JA6J 3RSNA 2W6JA 1ERDA 3SFIA 2M87A 2ELHA 2VN2A 3CF5F 1TVCA 1W5SA 2FX3A 1FSHA 3ZIAA 2ODLA 1K8AD 1JKRC 1MBGA 3H35A 4A3GJ 4BKXA 1A36A 2MLGA 3BPVA 3H9QA 2JJ2A 2BY2A 4IPAA 3CMAB 3GBGA 4M6YA 4D1QA 1ZM4A 1NJID 2VT2A 4A0ZA 3NE5B 3F9KA 3VR6A 2OYNA 1AOYA 2W7ZA 4MLOA 5F64A 3JRHA 1KTVA 1IDJA 4I7HA 5EF6A 5JVGF 3JRGA 3I56I 2DOAA 4JRAC 5FRNA 2FBHA 1RKTA 2M30A 3GTMJ 1LEBA 4N3GA 3SQNA 5FA6A 2BXYA 2F48A 1WTHD 3HHGA 3K10A 1JJ6C 1IRZA 2HZTA 4K1XA 4W97A 1BA5A 2GREA 5J47A 4L18B 5IP7J 5BSXA 1T98A 3DQVC 2V4JC 2H6CA 1ZM2A 4Y7CA 1WFXA 1L0OC 2O7OA 2VFNA 1V5FA 4RA2A 1IN6A 1O8GA 1CZFA 2PEXA 3R0AA 1GAQA 1QA3A 2VL8A 2K9NA 3DFGA 5B1AH 2LNBA 1FT9A 5BMZA 1Q1VA 5EMNA 4LC0A 5ILVA 3ECHA 3VMFA 2BM4A 1S8NA 2TDXA 4RLFA 2VBKA 3PO3J 1HKTA 3WE2A 1J09A 4NHJA 5HDKA 3CCQB 1WI9A 3PETA 4BBRJ 3DV8A 3O8GA 4O6JA 4CZZA 2GJKA 2LZJA 2JN9A 1U9OA 3OE7A 2WV1A 2Y69H 3PIPF 1U6GA 2VFMA 1G3WA 2CW8A 1VQLI 2XRLA 3E6BA 1QH0A 3QPSA 1XG2A 1G3TA 2FRHA 3VO2A 2GPJA 4FN5A 3K1MA 4BPRA 1FYKA 3GVKA 2OU2A 2XAFA 1U8RA 4U88A 3ECOA 1TZLA 5FO1A 2Y31A 3Q39A 3HAGA 4E7HA 4AC9A 3MN2A 4AF7A 2ZNZA 1UHSA 3LQRA 2LLKA 2JWTA 2X4HA 4KN7X 2DODA 4D5FA 5JI6A 5A2QK 4K2EA 2GXBA 1P9QC 2H27A 4V19K 2EK5A 3CCSI 2Y30A 2IXSA 3C1DA 3MZHA 3J7ZI 2EH3A 3AL0B 3IRRA 1DBOA 1FY7A 2ZXHA 2W84A 4LBYA 1NH3A 5BSYA 4OJ6A 3CW2A 3G2BA 4UVBA 4P26A 2EB7A 4EM2A 5LHIA 3FM5A 3CZ6A 1RIOH 1R22A 1IRGA 2VKDA 3OEEA 4KKTA 4M6XA 3E97A 2OF7A 3ZQIA 2OTLB 3S3OA 3DBLB 2XF5A 4I99C 4FCYA 3EUAA 4ACBA 2E60A 2FF4A 2VNKA 2XZOA 2WAQN 3LYCA 1FTZA 3L1PA 4WQMA 5J40A 1TQIA 3WTXC 1N05A 1B8IB 1RUOA 5DV5A 3V8JA 2R7UA 3DTEA 3F8CA 1QPIA 3TH0A 5HS9A 2XNCA 4GXOA 1WJFA 1W0KA 1PUFA 3S3MA 2HDCA 5E3NA 1WOOA 1FMVA 1P4XA 1ZR4A 2BV6A 1TWFJ 1W4MA 2HGCA 4LG3A 3CCVB 3RDIA 1IN5A 3GZ5A 4ZYGA 1MBFA 2OCCH 2V1DA 1W5TA 2YPRA 4MEXF 1Y0NA 3GZNB 1G4DA 2LF7A 3HSRA 3R6KA 1Z0XA 4D7NA 4U0WA 4DBQA 3VOEA 1ZG5A 2OA4A 3QYFA 2VNIA 1DG1G 2VBWA 2CV0A 4YC5A 2GWRA 3P9CA 1X3UA 5IT9K 2LR8A 2O0YA 2ACJA 5IYWA 3C18A 4HWVA 1HF0A 2YWEA 4Y13A 2P81A 2BX6A 2E19A 3M3YJ 2WR8A 1P7JA 4HEA2 3TBIA 1EP1B 4G1BA 4A0XA 4Y9RA 1WU8A 1Y0UA 1YHQI 3VO1A 3ERMA 1ZREA 1YFHA 4IEJA 3CF2A 1AKHA 5DNSA 4P9FA 4A93J 2WA0A 1WH5A 2KJBA 1W7PB 3NEUA 1TW3A 1KD1D 3IUOA 4PABA 2BY0A 3DEUA 2VE8A 3ASSA 1UMKA 2FD5A 1HOMA 4KN4X 4MEYF 5FD5A 1P4MA 4H9GA 4PAAA 1MD0A 5FLVA 2JPBA 1P7IA 4KUMA 1MDMA 3AGQA 3K9TA 2IGOA 3IAM2 5F1JA 4MTDA 1T2KA 4WWCA 2PI0A 1UD2A 1WJCA 5TRDA 2DMPA 5CVJA 1Q7YD 2QGUA 1K73D 1X3ZB 3QYEA 3H0GJ 3ZMUA 4BS9A 3AFHA 4CO8A 3JRIA 1O8DA 3O6BB 1TWGJ 4OPWA 2VBYA 1MZBA 3K4MA 1A5JA 4Z4TA 2P3MA 4P96A 1LE8B 3RTRA 4G6TB 2C4UA 4YZXA 1EP2B 3TEDA 2I8DA 1EA3A 3LFUA 3ZCOA 2BZTA 2DN0A 3BQZA 3HJEA 1V54H 3PQKA 5LFAA 1G2HA 2LTPA 4NK8A 2JSCA 3OP1A 2ZFWA 3K69A 2IRFG 2G7HA 5IY5H 4FTHA 1Y0RA 5HOOA 2QA4B 2ETHA 4XLFA 3KE2A 1TWAJ 2XPWA 3L09A 4BL0B 1QGAA 2M8EA 3KEOA 4PJJA 2CBXA 2A61A 3B8YA 3KLNA 1ZKGA 4IOCF 2LREA 2WB1N 2Y2ZA 2KLOA 3IWFA 1WSVA 4IRHA 3FPKA 4H0EA 3TO6A 5JMCB 1RNLA 1T0FC 4HBLA 3SDGA 2CFXA 2MLKA 4IW3B 2LP0A 3M1CA 5D5WB 4PFPA 3TGNA 1HF2A 1LVAA 1QO0D 1XGOA 2XF7A 3HG9A 2XSJC 5EZGA 1T5EA 4G6QA 2CS3A 5J4YA 1N06A 3A1YA 3OW2B 3GRHA 2OTJI 2I5UA 2J8IA 3D0SA 4OAYA 1PP8F 3G71I 4KKSA 4IKFA 1I3AA 5KAFC 2F1LA 1WJDA 3WG9A 2R3SA 2AHOA 2DBBA 1S72I 3BCBA 1YJWI 3ASNH 2A69F 2ZMEA 3CDLA 1IXCA 3OYKA 4V2GA 2CUEA 4PC6A 4MHGA 2QEXI 1N75A 5HLIA 1CLWA 4IRGA 2ID3A 1R1UA 4HX8A 5EGOB 1OGOX 4UZUA 1X1AA 3BZKA 5EEGA 1J9IA 1IDZA 2FNPA 4E7LA 3FWEA 4U7BA 4HSTA 3WTVC 4EV0A 1I5ZA 1YW9A 1PKVA 1D8TA 4L9JA 4AUXA 4Q48A 2R7DA 4UUSA 4BHCA 3HTSB 1IXSB 3RPUA 4WZTA 3CTAA 3BY1A 2EILH 1VQ9B 4ENMA 3EDPA 4XN0A 1JE8A 2XGDA 3SZGA 1XDSA 2IP2A 3KZIC 1H8HA 1QFYA 2CNDA 3TQNA 2LF8A 2V7XA 3LFKA 2XTXA 5L3FA 5DN6A 3CCRI 1XMXA 2H1LA 3HSFA 1QFZA 3E6CC 1ETKA 4BEHB 2CUFA 5HODA 3J80Z 4DNRB 2KMUA 3W6KB 5LEJA 1EP3B 3GVJA 3X2QH 3GX4X 2ZBVA 1GVDA 3CCLI 1J59A 3QSYA 4YZAA 3CCEI 1IUYA 4MYUA 2FEZA 4B44A 5LD2C 1N8RD 1R1TA 1EJ9A 4C3IJ 3W2AA 1O8EA 4A3KJ 3HL2A 3JAMZ 2INUA 4I01A 4XORA 3EUHC 4OOVA 1OYIA 1ETXA 1QRCA 5JLXA 3W2IA 3W2EA 2PFBA 3PUBA 1MNDA 1TYWA 2NYXA 3DWLE 2D74A 2DT5A 5HLTA 1OFDA 2LOOA 1SFKA 3WU0A 3FF5A 2QXZA 5AONA 2C4TA 3CQZJ 2FA5A 1R49A 2CQKA 1RMGA 1GDTA 2NVTJ 2W4SA 4HZFA 3A0HC 3FXLA 5HZBA 3C2HA 2BY1A 3FXJA 1K28D 3BR1A 1NB9A 3ZPLA 2EZKA 1OFMA 2AXTC 3ABKH 1KCDA 3VYUB 3CCJI 2L4AA 2E36A 4AIHA 1OCRH 3CUQB 1U78A 1BLIA 1RU4A 2MH9A 5EGOA 1ODDA 1UG0A 1OCTC 4DBRA 1T6YA 2E1BA 4TMXA 5D5XB 4YDTA 1F43A 3MVPA 3V8KA 2Z99A 4N0BA 3GCMA 4A6EA 4ZDPA 1X0CA 2YR2A 2VPRA 2WJVA 3SFZA 1I18A 3N6ZA 4W8TA 1TBXA 1Y1VJ 1U2RA 2Y0SA 1VQMI 4NBSA 1L1IA 2WY7Q 3SYTA 2JJ1A 4XRSG 4QTRA 2V31A 4ZYEA 4A3CJ 4LGWA 3AL0C 3FJOA 4PC3A 4P9SA 1QRBA 4V2FA 2BY3A 2LY9A 5CJ9A 1S4MA 5HKKA 4W8SA 3HRTA 1SMTA 1ZG3A 2EZHA 2M0MA 2ZO4A 3DTKA 2VPLA 2XB0X 1WHUA 3D5SC 4KIFA 2LMDA 3SEJA 5E3LA 1LUJB 3I54A 3LSHA 3SLNA 4B09A 1MMSA 4BH9A 2W82A 3SKBA 4B4CA 4HIZA 1A6QA 1FSEA 3A4CA 3GFJA 4OU0A 2FXAA 2ICWG 5E8GA 4HF1A 1MSEC 5FKLA 3OYEA 1HZEA 2VZLA 3Q6QA 2CH0A 3HXLA 1IG7A 5J35A 1Z9CA 2CQNA 1W35A 2MD5A 4UV8A 2VT3A 3S17J 4XL9A 2QSFX 4IXAA 3G6EI 2A05A 2HPMA 3E1SA 1QU3A 4O5VA 5GV8A 4NUBA 4ASUA 3OZWA 2LDUA 4EJOA 4PGGA 1RUNA 1D8KA 4OP7A 2CV2A 2CSOA 4XKBA 4WWVA 1FYLA 1E3PA 1LFUP 2KVOA 3QYBA 1D8JA 2GQFA 4P12A 2XV4S 3FKSA 2EZLA 4XSXF 3TDUC 4KIGA 4BY1J 4X7DA 1EFRA 2MFZA 1BHEA 2GIVA 1G6NA 4A3EJ 3QFRA 5D4RA 3P4GA 2PJRB 4M71A 3U1DA 3CCUB 4ACAA 2NS8A 1OHHA 4Y9UA 2OBPA 2ECCA 5B66C 4JBAA 3PVDA 1BOAA 2X9DA 1VQOI 3MKLA 4Y4RA 1WXRA 2E5NA 1RZ4A 1ETWA 2BOLA 5HS7A 5L3DA 2V1UA 1R5NA 4YEJA 2ZZQA 2JA2A 4F3QA 5TJJA 1PLUA 1KQ0A 4YRVA 4OMZA 3RPQA 1I39A 2ZZGA 2VXZA 4FE7A 3MWMA 2GXAA 1WKMA 2GOMA 1DQUA 4Q47A 2DDBA 3JRAA 2L9RA 4PSWA 5K5RA 2DFHA 2DETA 2PLFA 1MBEA 1LKXA 2WADA 1EFUA 2ZBKA 5EEHA 1ZELA 4LLGF 4OINF 2NVQJ 1OQYA 3R6SA 4ZDOA 2OK7A 4M3EA 3MAJA 3EQOA 3F8FA 1TUIA 1J7KA 1IZ1A 1QA2A 2RAEA 3DF8A 1FTTA 3RYRA 3AVXA 1YG2A 1ZYRF 2HLDA 5CVVA 3K4CA 1Z6RA 2HYFA 3FZVA 4RD2A 4NK6A 3JREA 3BY2A 2K86A 4HSRA 1ON1A 4BU2A 4P1VA 1MJ9A 1SC7A 4MGRA 1TTYA 4FT8A 4AYBN 2K4BA 3MHPA 4DQLA 2XT2A 1P6RA 1F9NA 1FP1D 2EA4A 4RCYA 4CYCB 2DJIA 2Q2EA 3KEWA 4OIOF 3RI4A 1JXSA 4I76A 2E7XA 2AQFA 2V6EA 3PENA 5BPIA 3QOPA 4CQJA 1S7OA 3B02A 3DPLC 1R00A 2EZIA 1XFOA 3DU5A 3I4MJ 1YJ9B 1V55H 5GTHC 1PE9A 1WOPA 1ZM9A 4OZZA 1W9XA 4OWRB 1D0YA 2L9SA 3PUFA 5LMZA 1NRKA 2JK3A 1TSPA 2HZDA 4XKWA 3N05A 4OJOA 5DD4A 2DDAA 3QU6A 3PFYA 2BMWA 2BSAA 3S2DJ 4YG2F 4FQGA 3EETA 4JX4A 4CCJA 1Z77A 3A0BC 1UAAA 2WYRA 2H1KA 1VQ7B 4WCGA 2O6WA 1ETOA 2A3SA 4QPOA 5J4VA 4EQQA 4HDVA 3E7LA 4TMTA 4XICA 3ROUA 3J7AO 2QYOA 1U5TB 2ELKA 2V7VA 1DGWY 3HRUA 1IB0A 1W1WE 4OM9A 4Q4ZF 2YX4A 4Z4WA 2DQLA 2X6XA 2XGCA 2KIUA 1I3QJ 2NOJB 4YIFA 4XLPF 3PSSA 3HOXJ 3HEFA 2C78A 4ZV4A 3I4NJ 4GRIA 2E1CA 2Q6LA 1FMWA 3A01A 2R92J 4B43A 2RNJA 2J8KA 5DS9A 2XAQA 2DOEA 3WGIA 2DXIA 5JLWA 3EUKL 2C6YA 4II3A 3Q9VA 5DTDA 3VSUA 3LJYA 1GXQA 2GOXB 1IHMA 1SD4A 3ABUA 1BL0A 5E79C 3PNTA 2LRDA 4G6DA 4YFXF 1BW6A 4DQ2A 5BS6A 5K1YA 1NB0A 2IS2A 3ASQA 1HQCA 1REPC 1R6RA 1VQNB 2VE9A 1OCZH 3OAAA 4UZFA 2FX0A 1G8XA 3H9JA 3OOPA 5LBQA 3D5LA 4YALA 4F93B 3L2UA 1IF1A 4RD6A 1FX0A 2HOEA 1YJNI 4XLHA 2XF6A 1JTXA 2QM3A 1D2EA 4KITB 3CC4B 3KYCB 3ABLH 5LHGA 1K4ZA 2LKPA 3BOQA 3TW6A 4J01A 1KYWA 4E4HA 5F1RA 1S0UA 1ZAOA 3H94A 3K7AJ 2DQRA 3QOEA 4B3XA 2QWWA 3BQYA 4AWXB 4HQEA 4JX5A 1X3WB 2DA4A 3HOZJ 5IK2A 4OPSA 1BW5A 1GLNA 4P22A 1VQKB 5FLXZ 3FXKA 1JJ8C 2R5YA 1QA6A 3HSEA 1BQEA 5F4JA 4M6VA 4YFNF 4RB2C 2G0EA 4CCNA 3CCQI 1LVKA 4S04A 1XPXA 2RV8A 2R7XA 1O8KA 3T53B 4XRSA 2FOWA 3K70D 2R5ZB 4HW0A 1YW7A 1WPKA 1JHFA 4IJAA 1O8IA 1QPMA 1RQRA 2UWMA 1XSVA 2QUFA 4I98B 3K4LA 3CUQC 2NRAC 3I55B 2K7LA 1OB5A 2XC1A 1SVLA 4A2UA 1UD6A 3KFWX 3LSPA 1DGRM 1KONA 3ML6A 1NTCA 4PJNA 3L7WA 5AIQA 3M8FA 1X4PA 4Y3OA 3H92A 2C77A 4A5NA 2RDPA 3AKZA 3IP4B 1V4RA 3NB2A 5B3SH 4W8QA 4QVJA 3A02A 3IL2A 4P1WA 3A8JA 4ESFA 2G7UA 3N4MA 1DARA 5HS8A 3F21A 4G7XA 2M4KA 2Z9OA 3KZYA 1IV8A 3JR9A 3JTGA 1S9HA 2P5LC 2NVXJ 4RGSA 3RCOA 3S1NJ 5CDFA 2TCTA 5F0CA 4ZTFA 1WH7A 1XMKA 2KIQA 5IYCJ 4F92B 2L7MP 3L2VA 1S7AA 1VTNC 1N77A 1H88C 2O9LA 3GTKJ 2OAZA 2DK8A 2F2EA 1I27A 3BR0A 2BN4A 4Y7NJ 2OC6A 3CO6C 3F8MA 1ACIA 1E63A 2IEKA 4RGUA 3VYSB 2ZJQF 1HKQA 1XS9A 1JNYA 3CRZA 1GT0C 4LIVA 2IAIA 1EH6A 4RPDA 3P7NA 2HOSA 1EZGA 3VYRB 4CCMA 2IOUG 2X48A 3A3GA 1TLHB 2M4GA 3WYAA 2BBYA 5JR3A 2V7FA 5IYRA 4RM2A 1O88A 3ZMVA 1Y8RB 3IKTA 1IJEA 5HLGA 3R4KA 3NAWA 1XG1A 3ZBUA 2K9SA 9ANTA 1RI7A 3QP6A 5J1RA 2X3HA 1XX5A 3OPOA 2Q8KA 4PC1A 3TL4X 3CMEB 3E6MA 3ZMDA 3ZPNA 1BI1A 3EQNA 3BCFA 1KJZA 2JA7J 2R7OA 2RNGA 1D0ZA 1M90D 2JVHA 4N4OB 4WZLA 3HRMA 1FX7A 1F4KA 4L0ZB 5HNFA 2IQ7A 2EQRA 2K9MA 4LBVA 1EH8A 3ONUA 1VI0A 4HX4A 1YS7A 2NS7A 1TQPA 4LBWA 4XMYA 4KIBA 4EMSA 1JA0A 5HNHA 2BPOA 2CC2A 1LFPA 3MQ0A 1YI2I 5DS0A 2XGEA 4BHBA 3UNGC 1ZLKA 2BW3B 3CDIA 1R58A 1B2RA 5M5YJ 3FHNA 1UZCA 3DU6A 3OW7A 2L54A 3CC7I 1NHAA 2Y9YA 4EATA 3S1MJ 3E20A 2LFBA 2E1MB 2IJLA 2XASA 3ABMH 4B8XA 3HKZN 2DTZA 4PGHA 5JHFA 3BG9A 1DU0A 4Z06A 4XKVA 5DEQA 2L9VA 3T8RA 3ZP5A 1BX0A 1QVFB 1R23A 3I64A 3OMYA 3CDHA 2NTQA 4RAFA 3JRCA 3T51B 2FQ3A 4UV9A 4P3YA 5L3GA 3H3ZA 2GJPA 1IXRC 2VBVA 3CC2B 3OYMA 3VDXA 4BQAA 1W0JA 3KL9A 1FWZA 4OJ5A 3V4GA 2JQ7A 4CUGA 5F08A 4A3LJ 3FIWA 1A8PA 1BJKA 3OYIA 2XVCA 4RB0A 4OMYA 4UB8C 2V79A 3DKXA 5IP6A 2KJCA 4PK4A 1GJRA 1AU7A 1Q81D 5FKOA 2B7BA 3RIRA 1HVXA 1QVGB 1ENHA 2PMZN 3OS2A 2BGJA 1USSA 2LH9A 3GXOA 1ZG1A 1X19A 3Q3SA 2E34A 1T0FA 1JB9A 1V5VA 1A31A 2M1BA 1VQ4B 2PLYA 3WQZA 3U2QA 1H8AC 2DCUA 1GVJA 3K1PA 4P6YA 3ZZ0A 1PXZA 2DFFA 2FVGA 3QE2A 1OB2A 3WU1B 3CXCB 4J0QA 3UW0A 1P2FA 5CKTA 3ZC3A 4IQJA 4DK1A 1O8MA 3QPLA 4X0GA 1MKMA 3L2QA 1PDNC 2D9RA 2CRGA 4G8XA 3VODA 5CVRA 4LK0F 3PJRA 3GQ7A 2ISZA 2CUJA 1Z3YA 2EV5A 1IRFA 1U5TC 2F4OB 4X1EA 1YS6A 4X0CA 3RZOJ 2VYQA 1V0EA 4G5GA 1WSUA 3MCAA 2LY2A 1JTYA 3JQQA 4R71A 4QLCU 3ZXSA 1W36D 3LQEA 2W24A 4OJLA 4Y52J 4C3JJ 4X7EA 4L5IA 2JA8J 1YIJB 2MSYA 1IC8A 1SFXA 1XN7A 2IPQX 1A35A 1H89C 4YFOA 2L0KA 3P9IA 4Y33A 2DMTA 2FQ4A 3BTCA 4CXFA 1L3LA 1KU7A 3DKWA 4BQOA 4A3DJ 3G4SB 1Z7UA 4YAWA 2CWEA 1B4AA 2Q0OA 1DP7P 1MMDA 3QP5A 2HS5A 3LSKA 1D5VA 2B7CA 2MW8A 1VBLA 2O0VA 4X7CA 1QNTA 3TOAA 5GPCA 4G7ZF 3FMSA 1Y8QB 1BI0A 1MGTA 5KHDA 1XB4A 2OUMA 2OQGA 1R5GA 3JRFA 3L2RA 5C4JJ 1O8JA 2D3LA 2NVYJ 4ESJA 3FXQA 2DA1A 2IGNA 2OPTA 4HOBA 4L8JA 1DU6A 5A2QZ 2PG4A 1COWA 1R36A 4OIRF 4C43A 3T1BA 3VMVA 3K4JA 4HX7A 4RAGA 1HA3A 3DP7A 4EGZA 3F72A 2ZJPF 2XIGA 3EUHA 2V9PA 3ZRGA 1K61A 1S5LC 5JLVC 2L7KA 1ZQ3P 2O8KA 3WNBA 4A3IJ 2HXIA 1LQ1A 2QF7A 4DGWB 3WTSC 3MCZA 2Z33A 2JIZA 1AWCA 1I7PA 2QTLA 2QVOA 2G9WA 3FXMA 2ZFUA 2R7TA 2E1NA 3S1QJ 2LG4A 2VKHA 4LLLA 3F3XA 3DKYA 2R6HA 4MQ9F 4PFOA 3KYLA 1N0UA 4L0YB 1FNMA 1MMAA 3IWZA 2MA3A 3B82A 4RB1A 2YU9J 1LLZA 1R5OA 1WMRA 3M1EA 1TLLA 3K4NA 5DYMA 3JTHA 1IDKA 3FM3A 2EFGA 2YWHA 1QG0A 1JUPA 3JQPA 4D5CA 3VYTB 3VPRA 5C1EA 2O1DA 1EV7A 2ZZEA 2ECBA 2VOPA 3FK6A 3QPTA 1JUSA 5F0HA 4XRFA 1ZGWA 4XK4A 2NTBA 2GQQA 3WTTC 1N78A 3D26A 2JVGA 5L3EA 1RETA 2PMDA 3H5NA 1Z91A 4AC0A 1MNMC 1SVOA 4FX0A 4DZPA 1R9TJ 1DDIA 4HPQA 4CA0A 3GFIA 1BC7C 5IT9Z 3BJAA 4E0FA 2DA6A 1QZZA 2RGVA 3W5VA 4PCQA 2YS9A 2HU9A 3GTQJ 2J5OA 2M45A 5B5EC 4TKOB 1V5GA 1B8IA 4QPQA 2P5VA 3NARA 3F23A 1HW1A 4P3IA 2BVMA 3J81K 3RKQA 3WGGA 1SFUA 4KFCA 3OWTA 2M2EA 4A69C 2AO9A 4ZDLA 4L9VA 1K6OA 3REOA 5FB2A 2Z8GA 4B3FX 4M3DA 2ESHA 4OPOA 3WNDA 1HXDA 4BQQA 2LD5A 2CJJA 1KU3A 3SUCA 1V5EA 5EG0B 4E7SA 2KKOA 1APLC 5E3MA 4Z6YA 4PJMA 1GAWA 5ICEA 4TMWA 1QCXA 2L3DA 2OK8A 1BX1A 3CCMB 2K27A 4XONA 4XOPA 4HNVA 3G1OA 3U2RA 3V8LA 1YQAA 3A8KA 4M73A 1B9MA 1GQ8A 2HKXA 5E20A 5FRMA 2D1HA 2BSPA 1ETVA 3F8NA 2XAHA 4BXFA 1RWRA 4X6AJ 1CQTA 1GUUA 2MBFA 4HNUA 1J9ZA 1DDGA 3OL3A 1IA5A 2YX7A 2YUSA 1B9NA 1FBSA 3BCAA 1W2BB 2ZXWH 2QN6A 3IRQA 3TOBA 2ZSIB 1BN5A 2NAZA 4D0PA 2P7CB 3U6BA 3VSVA 1LPQA 2LBFB 1MH4A 2ZTGA 2Y48A 4RM0A 1XTAA 4DNCA 2FUG2 4IO9F 2BF4A 4E6KG 3OS1A 2A6EF 5J1YA 2KDOA 4L9NA 1W7PA 4G1VA 3Q6RA 2RQQA 1EKEA 3WG7H 3SJZA 3SEQA 1W0TA 1VQLB 1BMFA 1LEAA 1FBUA 2QCOA 2L9NA 3OJXA 4RDJA 4J00A 2DOFA 5F6FA 2XAUA 2ZTNA 3ABTA 1LLWA 2XT4A 2DA3A 4ON0A 2HQAA 2B63J 1J2XA 2X3UA 1R1VA 4RD3A 2QZAA 4XBFA 2E1MC 4RB3C 4ROXA 4I09A 2WAFA 5K5OA 4AM3A 2PYHA 1WI3A 3I9V2 2QQ9A 2YSRA 1LE8A 4UZEA 4RPBA 4QUZA 1Z05A 2CYYA 1JHHA 3M8EA 1DPRA 4I02A 4A3BJ 2DYRH 4RD1A 3DDYA 4YHBA 1E1RA 3KP6A 3R60A 1LB2A 3SZEA 4M1KA 3I0TA 2ZL7A 2X0LA 2XGJA 1SKYB 4WXHA 5JBQA 2ZKZA 2F5CA 5C1CA 4GDFA 1HSJA 2DMNA 2VQHA 1SD6A 2I1LA 1TT5B 4QHYA 4LG0B 1Z7LA 3Q5FA 2VQLA 3P5JA 2FSWA 4DNTB 3BPXA 3VNVA 3LSGA 2WZNA 2KFDA 2DLLA 4PDKA 1BOBA 3VFZA 3ZQHA 4IHSA 1WJAA 2XKOA 3S2WA 4BQNA 3OZUA 5D5VB 4GYGA 1OGIA 4UXNA 3AK5A 5M3MJ 1JT0A 1LM1A 2XAGA 3FK7A 3HOSA 2RC5A 4C30A 1OFEA 1Y39A 3OYNA 1U0JA 2DTRA 2H09A 5IOZA 4DYQA 4ENNA 4CDGA 1NG6A 4OIQF 2OJED 4U4BA 3ZBTA 4DYRA 3BC9A 5GV7A 3FBIB 1VJSA 3H0DA 1OCPA 5M3FJ 1ONVA 1X1PA 2CMPA 4HLYA 2XOKA 2ELJA 1O3QA 3B78A 2OZ6A 4Z4YA 5D8LB 2DU9A 4DZJA 2HCJB 2FOKA 4HF0A 4MR0A 2XB5A 3GTLJ 4KICA 2DK5A 2FBIA 5DCMB 4RCZA 2WJYA 3ISPA 2WAEA 3GTPJ 3FBNB 4XD7A 5KVRA 1K83J 1QUEA 3A03A 4ZZDA 3B8HA 4X07A 4IF4A 1F36A 2LY1A 2R4GA 2EBIA 2CW0F 2QSGX 1OYWA 2J5PA 2L5QA 4KT6A 3WGHA 3ONYA 1YOVB 3KRGA 2QLZA 3HRSA 4A6DA 3FXOA 2VOOA 3LAJA 2MD0A 4WF2A 1R4MB 4XLCA 1TP4A 4A3JJ 2STWA 2BVLA 3K4BA 1XD7A 2DEUA 2COBA 2VI6A 2LKSA 3LOCA 1VFCA 1J5YA 3OYFA 4AVPA 3S16J 1VQ6B 1QJVA 1NG7A 4XOTA 3LSTA 2OQRA 3LSRA 4OAZA 3SJPA 4IHWA 4BEHA 2DA5A 4ZYDA 2FU4A 3A2KA 4XN3A 1E64A 2F3LA 2IT0A 1VQNI 4I0BA 3GZ6A 1AHDP 4C2MJ 4LG0A 3HOVJ 2QQBA 1YITI 3LSJA 2CU7A 2PJPA 3PNYA 2FBKA 1W34A 3MKYB 5EYRA 2DYIA 4P25A 2JJ7A 3HOUJ 1YLOA 3H1CA 3KYDB 2COMA 2ME0A 5E18F 4RBOA 5CVIA 3BWGA 5KSWB 3CC4I 2DIEA 2L02A 4U0VA 3U1KA 2X6WA 1FC3A 5L46A 2P4WA 4A5MA 3K6GA 1IO2A 1DP3A 1MJBA 3VMWA 2O6GE 2HXOA 4MIMA 2EFQA 5F04A 5FJ8J 4A3MJ 4JMQA 2XHKA 2DJNA 1ZARA 3E3VA 3SEZA 3VB2A 5F0FA 1KA8A 5D4SA 4BACA 1SKQA 2L7ZA 1BI3A 3BG5A 3HM5A 3S32A 3CUQA 2D3NA 3W5HA 2GZWA 2D2WA 1XSXA 5HLHA 1X1CA 4E7ZA 2IS4A 2MG4A 3WY9A 3MKZA 1IJFA 3H5RA 2YWGA 1UG2A 5K7ZA 2B0RA 3AVYA 4M9SA 2BGIA 2NTPA 1K78B 4JK1X 1HDPA 3SZPA 2KP6A 4QWQA 3HOYJ 2ZNYA 5C3EJ 2OZUA 4FK8A 1VQ8B 2DFIA 1J0RA 2MH2A 4YCQA 2EPFA 3LNQA 2IS1A 5K7HA 2XEXA 2P6SA 2DERA 2X53S 1E3ZA 3PM1A 1G7CA 3DCFA 3ZQ7A 2A6HF 4I0AA 5JVTA 3SJMA 3T56B 1Q82D 1OKRA 1UHMA 2HVQA 3FXRA 3R0JA 4ZTJA 1GVHA 3RKXA 1S72B 5KNLA 2M7AA 2UUZA 3LA3A 1BI2A 1ETQA 5EJCA 3BDDA 2EV6A 1BC8C 2VLAA 1TL8A 1G7TA 1MBHA 1D1NA 2V1NA 4DIQA 1O8LA 2JTVA 3KP4A 3IH2A 3GVLA 1M1KD 1BR2A 1G3SA 2R93J 4BDYA 1K4TA 4P5OA 3BG7A 4ZJZA 1BM9A 5IYNA 2D1VA 2PBIA 3E0JB 3NAUA 1SD5A 4G7WA 2N8GA 3SY2A 5GAHJ 2VONA 4II2A 1GXPA 1Z6TA 2XDVA 2VC0A 4N4NB 3PL8A 4RGXA 3ZQFA 3K70C 2UZKA 2E1OA 1UD8A 4ZZLA 2DMUA 5GTIC 2ZC2A 1ZH5A 5IYDJ 1D1CA 2E35A 2M3AA 4QSHA 5D5UB 4A3FJ 1NK2P 1FIPA 1TQMA 3K2ZA 4UVCA 3BQJA 2JZYA 3ZMTA 3J7AY 5DSZA 2GA1A 2PJRA 3CCRB 3QPHA 1H0MA 5M5XJ 3BNWA 4OOSA 4Y17A 2MYSA 3H09A 1HA8A 1OJLA 3JU4A 2RQPA 3TP0A 3CJRB 4ASNA 3NRVA 1F5TA 2VBSA 1FIAA 4ZCMA 3BR2A 1C0WA 4GCVA 4FASD 4G9YA 1BPLA 3E6DA 4XLEA 3CMEI 4PC7A 4AIDA 4O3MA 1KC8D 1TNTA 4D7MA 4E7IA 2EJRA 1T39A 3SZTA 3ZN0A 3OY9A 1WSRA 1FNDA 3LA2A 3U9GA 1HKSA 4X06A 1FOYA 1SMYF 3KEQA 1I6HJ 5D6EA 2KZGA 3W2HA 2QY1A 1QRYA 4H4KC 1M1EB 4DJAA 3S1RJ 2GM4A 3WXMA 3MZYA 1UD3A 1KQSB 1CQXA 2DYSH 1O7FA 2ZB9A 1YTYA 1KCCA 2H8WA 2LYCA 4NQWB 1TYXA 4PC2A 1HLVA 3ONQA 2B9SA 4HDUA 4HRIA 1H8EA 3GTGJ 3U21A 3CMAI 1O3TA 5A89A 1YO5C 1X58A 2NS0A 1MW7A 3OYGA 1WZ2A 1XCVA 2R7FA 3R6JA 2JT1A 2EWNA 3BCDA 3GMEA 4OPVA 3D5RC 2MC4A 3KP5A 4N9IA 5K5QA 4CYCA 1E3XA 2QE7A 4BXUA 4QVAA 3LSIA 5THXA 3ZZTA 2WC2A 1XCBA 3I5UA 3RKWA 4QIWN 3K2AA 1ZN2A 1D1BA 2BHYA 1E3HA 3PO2J 2UXXA 2IS6A 1HG8A 2R7QA 3PUMA 4UUVA 3TP3A 3E5UA 4M3FA 2XZPA 1B6AA 3CP8A 2NVUB 3WU2C 3MD2A 5H5JA 2Y0SN 3FKJA 3ZN1A 1R71A 1OGJA 3HYIA 3BZ6A 2VBUA 1BIBA 3PSZA 2EIJH 2AXLA 2EFNA 5TV2A 4BGDA 2W25A 5TGTA 2M9HA 2LC2A 4S05A 4EEFG 2GAUA 5M5WJ 4NBQA 3OFNA 3KLOA 3V7CA 2R7SA 2VIXA 1GV5A 4ITVA 3PIOF 3LO8A 3BR5A 5CLSA 1USTA 3QU3A 3EYIA 3BC8A 1JKOC 4LB5A 1VQ4I 3E5XA 1TTTA 3N90A 2BHZA 3ZR8X 4YZQA 3O2PE 4EGYA 1U5TA 3AG3H 2X1DA 5FO0A 2XRNA 1FRNA 2WWYA 4P9UA 3OL4A 1TYUA 4UNOA 1HBXG 1U2WA 1X1BA 3KCCA 2VC1A 1WP6A 2V7UA 1I6XA 2VQCA 2ZZFA 4TN1A 1ELOA 4EJVA 3JSOA 4XQFA 2W57A 2B7EA 1IJWC 1Z21A 2LVSA 5IYBJ 2JA5J 2OBTA 1FNCA 5HDNA 2JPCA 3IC7A 4I6ZA 4LK1F 3HB9A 1FP2A 4HV5A 4BJTA 4OZYA 1EFCA 5FGMA 1MNEA 2FE3A 2HQNA 3JCUC 2WY8Q 4BE0A 2HNHA 1CNFA 1PJ7A 3MMPA 4F7DA 3K0LA 2EA2A 2NSPA 2VFOA 5BPDA 1D3YA 4G94A 1RR8C 4FISA 3RPUD 2Z16A 2A5YB 4DK0A 4KJZA 1TT0A 1VQOB 4HV6A 3HPGA 4U49A 1B59A 3OKXA 5EZHA 4WX9A 1UD4A 5F4MA 3G4SI 2OD5A 2VBZA 1RC9A 1K5CA 4BXXJ 3ESWB 3ZUGA 5IYQA 2O04A 1QFJA 5E1WA 4PSXA 1GR1A 2KRCA 2OTLI 3HTUA 4IHYA 3I1FA 4AF6A 3AG4H 1VLYA 1BJAA 1T6SA 5D6FA 2INVA 1FJLA 1TYVA 3F6VA 2QZ8A 5H2FC 2WAQA 3HHHA 1V0FA 4AVZA 2NXNB 2K5CA 3DEEA 3ELKA 1WJ5A 1OGMX 1H42A 2CQXA 4IL6C 5F4OA 4CH7A 4M3BA 1DDNA 3ZQLA 2O03A 1FYMA 4F52A 3M4OJ 2P5KA 3ERED 3W5UA 4PJ0C 1W36C 1YYVA 4YFKF 1HSTA 3CCVI 5H59A 1UHWA 1MABA 3KEYA 3W2FA 1R5HA 3CMMA 1H9TA 3EYYA 4HQMA 3M7GA 1E43A 4E7JA 2R5ZA 2R7VA 3GLLA 1F1ZA 1PYVA 4XRMA 1EFTA 4UVAA 3G3ZA 5J6XA 4CGZA 4ENKA 3GTOJ 4JX6A 1ZM3A 5TY0A 4F7ZA 3MFKA 1N0VC 3JW4A 2E2IJ 3L2CA 3SLDA 4OOXA 1PJRA 2DCEA 5DUKA 2XKPA 4PMHA 3HBLA 4XNFA 3PUNA 4YXWA 3CMYA 1IGNA 4Z03A 2BE5F 2B5OA 2F1MA 4E70A 3OYBA 4LFUA 4Z4ZA 3MMYB 4ZC3A 2BM7A 1OISA 2O3FA 1ZTRA 4G12A 2BM0A 1LFBA 2HR3A 4OOIA 3WTZA 2Z1DA 3ULQB 1K4SA 1KK3A 3ML3A 3WTUC 1SD7A 4NC7A 2W6IA 1P4AA 2TRTA 4C2UA 1VNDA 1X1DA 2A68F 2HFHA 3C3WA 4BYYA 4TMZA 2X51A 4KNYA 3WE3A 5J8CA 3FKIJ 2CG4A 1NBMA 3DBHB 4FWTA 2JSPA 1H9GA 2JMWA 1S7EA 4BAYA 4CICA 1DBGA 1G59A 4HE5A 1JUMA 3GQAA 3IH3A 2NNYA 4AD9A 4UY8I 1JT6A 1ORKA 3HIFA 4RAZA 3GO5A 3SDBA 2WV0A 2XPVA 5DM6F 2WPDA 2V9VA 4YIIA 4F91B 1KK0A 4YZ0A 1VF9A 1SEUA 4UUTA 5A8AA 2KIFA 3BG3A 3QAHA 1F20A 5E17F 2Z2SB 5CPRB 5J1UA 4JYKA 4KYWA 2QA4I 2NPFA 1GHCA 1B72B 2BM1A 1IN7A 3OSGA 4RLQA 3OYDA 3DLAA 3CCMI 2RC6A 3PFIA 1QGPA 2M5WA 3F0CA 3ZOBA 4CYDA 4RJLA 1VQ5B 2WB1A 2V7WA 1YJNB 4M3GA 1S6LA 1KYZA 2JRTA 3A3BA 4EM1A 2VJJA 2LK2A 3CD6B 3BZCA 2H8RA 1T38A 2GJRA 4LMYA 4P6VF 3J7YJ 1U3EM 2VBMA 1WOSA 1UMQA 5LGTA 2M34A 3R61A 4MFEA 2ZJRF 1EF4A 5EEAA 4KDPA 3GUDA 1LDKB 1QHGA 3B6CA 3LQ6A 5GAEJ 3TKYA 1PUFB 2CRVA 1T56A 2BW3A 3G1LA 3RQIA 3GVAA 3ISXA 2B0LA 3J81k 2QMUA 4V02C 2F4IA 3C2BA 3P9KA 4EVIA 5ILUA 1RRJA 5FFZA 4A0YA 5EDNA 1XMAA 3W6JB 2XUBA 1BJZA 2XROA 1K6YA 3HC7A 1JGSA 3S93A 2K40A 1MBKA 3EPZA 5K7FA 1O3RA 3Q0VA 4F55A 2Z3YA 2NZMA 4DYCA 4ZH4F 4C2LA 1AIPA 4RD0A 1ZLJA 4CZCA 1WQ2A 2HWVA 2JN6A 3GSIA 2L4MA 3HUGB 1BIAA 3HZJA 5ICFA 1GO2A 1XQBA 3ZMZA 2Q6KA 5AMVA 4D9JA 1ZRCA 4G6IA 1TWCJ 3AAFA 4P2NA 3BLYA 4QV2A 2K9QA 2Y9ZA 3F8BA 2DT6A 1VQ9I 2F43A 1MMGA 2IW5A 4MO7A 4IX7A 1QVUA 2ZL5A 3VNUA 1ON2A 1JI8A 3B73A 2ZCWA 3C2GA 3FMQA 5BNGA 5LGNA 4MXNA 4WXCA 4ZYHA 5KCMA 2HYJA 1B72A 3UR3C 1AKHB 3PA1A 2BGCA 3FHZA 4Y15A 1T6XA 3KETA 4BE2A 3CPXA 2KHMA 3IV5A 4JP0A 2F5FA 4M74A 1CNEA 3OR1C 2DPDA 3ASRA 4EJUA 1BR4A 1Q86D 4HYEA 3PSIA 2RN7A 1CF7B 1MDMB 1K79A 1XB2A 2E1RA 2F4NA 1POGA 3BTJA 4M0LA 1RPWA 3BH7B 2X0KA 3WHCA 2VFQA 4MFDA 1WCMJ 4JQFA 1XE1A 2XSDC 3ASPA 2NSTA 1MIJA 2UXNA 3HGYA 4B47A 4XIDA 1PUEE 4M9ZA 2VBEA 5FL7A 2ME6A 1G3YA 3PQJA 2BM6A 3KIOA 2HKOA 4M72A 2PE3A 5ERIA 3OOCA 3OIQA 2QYUA 2KISA 4CHUA 3OYCA 2DW4A 3VSLA 3BTIA 2NNNA 1Y1WJ 2QQAA 4R1HA 1SAXA 1KU2A 1VZ0A 1H80A 2M5SA 2HQ5A 2M8GX 1VQPB 1VHEA 3ZPPA 1YRNB 2VUMJ 2UVEA 1CGPA 2AQEA 5J8FA 3JRDA 3P26A 4EH1A 2VKEA 5CYVA 4E7KA 4XSZF 2VBXA 4LIUA 3AVTA 3VSKA 3HUGA 4IHVA 2XC7A 4XR6A 5F27A 1AMOA 4IOAF 2HYGD 3OZVA 2E71A 2K9LA 3VEPA 4ETSA 4ZGQB 3FY3A 3SQVA 1SAUA 1HW2A 1UCRA 2RVCA 1YI2B 3IH4A 1KRHA 5FIUA 1NHCA 4BE1A 3OIOA 4PZJA 3ES9A 2HTJA 2ZXIA 4JOMA 4W1UA 3JRBA 4ENJA 1T8IA 1VQ6I 2EIKH 4HE6A 4TT3A 3ZZUA 1OR7C 1E2XA 3DPTA 4U9UA 3CC7B 1FBQA 2WTEA 4KMFA 3H3VK 2IGMA 2ZMEB 1JRGA 4YELA 5AIPA 2DPUA 3HDDA 3I53A 3QFSA 3ASTA 2F5VA 3MEXA 3CJTB 1QHHD 1E0EA 1KGSA 2FMYA 1Q9SA 2NT6A 2PYGA 3I56B 3DPUA 1OCOH 1CF7A 1PJ5A 3AG1H 5FKMA 1DPUA 4KMUX 4Z4SA 3L9FA 2CW5A 4DW6A 2Z5UA 1SFEA 4UUSB 5B6IA 2HPIA 5A88A 2FMLA 5GAGJ 1MRZA 2KIMA 3KPHA 3JURA 1NDHA 2F6CA 1QZEA 2ZBUA 3J81Z 3CUOA 3ZQCA 2X85A 4LITA 2GIZA 2GK7A 4LJZF 2V4DA 5L3BA 4L9TA 1YX5A 3GWZA 2EFOA 1WVRA 2V1XA 2K4JA 3E5QA 1STZA 3CCUI 2EFWA 4CCOA 2X8KA 1D1AA 4X05A 3L00A 1BN8A 2NT9A 2PMUA 1S29A 1VF7A 2XPUA 3TO7A 2CF4A 1YE9A 1YRNA 2Z6BD 4NNJA 5DDGA 1HDDC 3G1MA 3OSFA 2CK3A 2Q6OA 5AN9A 4FHTA 1KZHA 4RDKA 4B3AA 1XDUA 3WBKA 2JUGA 4AU7A 4RDUA 5B1BH 4MNUA 3CCYA 1RKWA
chains in the Genus database with same CATH topology
4TSFA 3GVKA 3K4LA 1E79A 1UD6A 1TZLA 2M7BA 3I3LA 4CCKA 2CUZA 1DGRM 1KONA 4PJNA 3HAGA 4Y3OA 1X4PA 2IS1A 2X53S 1E3ZA 2E5ZA 3AKZA 4E7HA 3IP4B 3T56B 1O8FA 4W8QA 2HVQA 3FDYA 4RMNA 4ZTJA 5KNLA 2M7AA 2UUZA 2KQRA 4P1WA 1Y6IA 1P9QC 3B90A 4NC8A 2VLAA 3BH4A 2IXSA 1MMNA 2V1NA 4AYBA 4DIQA 2VJ5A 3HPHA 3AL0B 3FPPA 2M4KA 3A35A 4G7XA 1DBOA 1O8LA 3GVLA 2ZXHA 1S9HA 1BR2A 3H5AA 2HDWA 3RCOA 2HVRA 4OJ6A 4BDYA 5CDFA 4P5OA 3G2BA 3BG7A 2W00A 4ZJZA 4ZTFA 3E0JB 2VJ4A 4F92B 4G7WA 3CZ6A 3L2VA 1Z3XA 1N77A 2VKDA 3OEEA 4II2A 3K4KA 4KKTA 2XDVA 3PSFA 4N4NB 1UD8A 3PL8A 3S3OA 3K70C 2XF5A 3EUAA 2OC6A 2E60A 3GQBA 3OYHA 1D1CA 2XZOA 3VYSB 2M3AA 4KKUA 4XKCA 4LIVA 3J7AY 2R7UA 3DTEA 3VYRB 2QKLB 4CCMA 2PJRA 3A3GA 1WJFA 1W0KA 3OEHA 2M4GA 3S3MA 3CJQB 2LBFA 1FMVA 2V7FA 1O88A 4RM2A 2MYSA 1HA8A 4LG3A 3G05A 3JU4A 2DT7B 3CJRB 4URRA 4IZZA 4FASD 2X3HA 1BPLA 3OPOA 4XLEA 5CQEA 2EWEA 3TL4X 3ZPNA 3EQNA 3CESA 4E7IA 4DBQA 3BCFA 3OR2C 3OY9A 2R7OA 3QYFA 2RNGA 1D0ZA 2CV0A 2JVHA 4N4OB 5HNFA 2QY1A 4HG2A 2K9MA 4H4KC 3OS0A 4DJAA 1UD3A 4HWVA 4XMYA 1KCCA 2LYCA 4FETA 4NQWB 5HNHA 1LFPA 3ONQA 1H8EA 4HEA2 3TBIA 4HRIA 3U21A 4XM3A 3UNGC 2BW3B 1MW7A 3OYGA 4B3GA 3FHNA 3DU6A 3BCDA 3OW7A 3D5RC 3BG6A 2MC4A 2W1OA 3GQ9A 3CF2A 4EATA 4RM3A 1E3XA 2QE7A 2WA0A 3T9GA 2E1MB 3LSIA 4CCLA 2IS6A 1D1BA 3IUOA 1HG8A 2R7QA 5JHFA 4Z06A 4XKVA 2XZPA 3CP8A 3OMYA 3MD2A 2VASA 2NTQA 3T51B 3FKJA 2IGOA 3IAM2 5HVQC 2GJPA 1OB0A 1UD2A 1WJCA 3OYMA 3VDXA 1AIRA 1W0JA 4OJ5A 3W2WA 3QYEA 4CUGA 3PNVA 4BS9A 3AFHA 4BGDA 1O8DA 5TGTA 3OYIA 2VJIA 2LC2A 3K4MA 3DKXA 3S8PA 3RTRA 4G6TB 4PK4A 3OFNA 4YZXA 2I8DA 1EA3A 3LFUA 3ZCOA 5LFAA 1HVXA 3ZQQA 3OS2A 4NK8A 2LH9A 2R7SA 2VIXA 1X19A 4ITVA 3BC8A 5HOOA 4XLFA 2KL4A 3WQZA 3ZR8X 4YZQA 2Q2EB 2GK6A 2X1DA 4BL0B 4GQNA 1PXZA 3OL4A 1KMHA 1X1BA 1WP6A 4PJJA 3B8YA 3UW0A 2VQCA 2LREA 5CKTA 2ZZFA 2KLOA 2CW7A 4IQJA 4DK1A 1O8MA 3LMWA 4X0GA 2QX3A 3L2QA 1E1QA 4XQFA 2K3PA 1T0FC 1Z21A 2IGKA 3LL7A 4ANJA 3M1CA 3PJRA 2R9VA 2CUJA 3GQ7A 1Z3YA 4IQ4A 4PFPA 4B48A 2XF7A 3HG9A 2XSJC 3GQ8A 1T5EA 3OYJA 4BJTA 4OZYA 1UELB 1V0EA 2CS3A 1MNEA 3A1YA 4BE0A 2WY8Q 4C2TA 2HNHA 2LY2A 3NWTA 3GRHA 2NSPA 4OAYA 3ZXSA 1W36D 4KKSA 4IKFA 4OJLA 3RPUD 1WJDA 1WJBA 2Z16A 4DK0A 3BCBA 4KJZA 1TT0A 4U87A 2KRHA 3HPGA 3OYKA 4U49A 4Y33A 4EW9A 1UD4A 1N75A 4BQOA 1O8HA 1K5CA 2O0WA 1MMDA 1OGOX 3LSKA 4UZUA 1X1AA 1VBLA 2O04A 2O0VA 5CQGA 4PSXA 4E7LA 4U7BA 4HSTA 5KHDA 2KRCA 2OUMA 1PKVA 2KZVA 3L2RA 2XNDA 1O8JA 2D3LA 2VQGA 1VLYA 2INVA 3LMMA 3ZGKA 2WAQA 1V0FA 2IGNA 4AVZA 2JDIA 4L8JA 2K5CA 3DEEA 4XN0A 3M8JA 3SZGA 1COWA 1WJ5A 2ZSHB 2VB6A 1H8HA 4R79A 3K4JA 1OGMX 3VMVA 4CH7A 5DN6A 1BR1A 3ZRGA 4BDZA 2CV1A 4F52A 2L7KA 1W36C 4BEHB 2QKMB 1MABA 1EE6A 3KEYA 4DNRB 2KMUA 1YX3A 4DGWB 4C9YA 3CMMA 3GVJA 2JIZA 4OJPA 4YZAA 3HOTA 4KISA 4B44A 2ZFUA 4E7JA 5LD2C 2R7TA 2R7VA 1E43A 1PYVA 2INUA 2LG4A 2VKHA 3HL2A 1O8EA 3DKYA 1OFLA 4PFOA 3KYLA 4XORA 3EUHC 1MMAA 3PUBA 1MNDA 3DWLE 1OLTA 5HLTA 2LOOA 1KTWA 1SFKA 1PJRA 2DCEA 3V42A 3S3NA 1WMRA 2QXZA 4PMHA 4XNFA 4YXWA 1RMGA 3K4NA 4Z03A 3VSTA 1IDKA 2W4SA 2F1MA 1X4OA 2X1CA 3C2HA 3VYTB 1K28D 5C1EA 2O1DA 3OYBA 3LNNA 3MMYB 4ZC3A 2ZZEA 1OFMA 1KCDA 3VYUB 2WZPP 2Z1DA 2R7WA 1BLIA 1RU4A 2NTBA 3VWBA 1N78A 1UG0A 2JVGA 3CP2A 4NC7A 2O5RA 4DBRA 2E1BA 3H5NA 2W6IA 3HKZA 3DTIA 4C2UA 3H9GA 3W2VA 1X1DA 4BUPA 2X51A 4Z05A 4ZDPA 1X0CA 4BJ6C 4HPQA 3W3CA 4CA0A 2WJVA 4E0FA 1I18A 4W8TA 1NBMA 1IB4A 2Y0SA 2JSPA 2WY7Q 3SYTA 3TMOA 2JJ1A 2V31A 4I84A 3AL0C 1DBGA 2HU9A 1G59A 2X6YA 3GQAA 5HKKA 4W8SA 2MABA 2M0MA 3DTKA 2VPLA 4TKOB 1V5GA 4QPQA 2A6TA 3SDBA 3D5SC 2WPDA 4F91B 2O17A 1AA7A 4YZ0A 1UD5A 3LSHA 2BVMA 3OWTA 2PMZA 2W82A 4ZDLA 3B4NA 2Z8GA 4HIZA 4B3FX 2Z2SB 3KX2A 3A4CA 5CPRB 4BQQA 1V5EA 2Q1ZB 3SUCA 1JTAA 4ZYAA 4E7SA 2V9KA 4PJMA 1HZEA 3OYEA 4RLQA 3OYDA 3DLAA 1QCXA 2CH0A 3HXLA 2RREA 4XONA 4XOPA 2WSSA 2UVFA 4XL9A 4ASUA 1O8GA 2HPMA 3E1SA 2WBMA 1QU3A 2WB1A 4NUBA 1GQ8A 5FRMA 3A3BA 2VJJA 2CV2A 4Z1MA 2BSPA 4XKBA 2W7NA 4BXFA 2GJRA 1RWRA 2KVOA 3QYBA 4HNUA 2VBMA 3OL3A 3FKSA 1IA5A 3BCAA 1BHEA 1EFRA 2MFZA 4HNTA 1WPCA 1LDKB 1QHGA 2ZSIB 2PJRB 2BW3A 3VSVA 2LBFB 1OHHA 2ZTGA 2A5WA 3LSMA 2FUG2 2F4IA 4E6KG 3OS1A 3RQ4A 2KDOA 4Y4RA 2E5NA 5FROA 2BOLA 2VXDA 4YEJA 2RQQA 1K6YA 3HC7A 3S93A 2ZZQA 2JA2A 3SEQA 4F3QA 1PLUA 4YRVA 3EPZA 2ZZGA 2VXZA 4F55A 1IRXA 1BMFA 4PJLA 2V7QA 2CFOA 2NZMA 2L9NA 4C2LA 2GOMA 4J00A 1DQUA 2XAUA 4PSWA 4CZCA 2HVSA 2ZTNA 4BJ5C 1D0XA 1LKXA 2HQAA 2WADA 3HUGB 1ZELA 4ZDOA 3EQOA 4W8RA 2E1MC 5AMVA 4D9JA 2WAFA 4G6IA 2PYHA 3BLYA 3I9V2 3L2WA 2HLDA 2DT6A 3K4CA 2F43A 1MMGA 4NK6A 2V26A 4IX7A 4HSRA 1JI8A 1OOCA 3ZSCA 4BU2A 3C2GA 3MKWB 2KPMA 4MXNA 3DDYA 5KCMA 1E1RA 3UR3C 2DJIA 2PECA 2L2OA 3KEWA 2XGJA 4BE2A 1SKYB 2KHMA 2AQFA 4DOZA 5C1CA 2V6EA 3OR1C 1WJEA 2P0WA 2VQHA 3NWSA 1T95A 1BR4A 1Z7LA 3DPLC 3PSIA 4XLAA 4CSWA 3OYLA 2VQLA 2R7RA 3DU5A 4DNTB 3LSGA 1Y56A 1PE9A 2X1EA 1BOBA 4PUSA 4OZZA 1WJAA 4OWRB 1D0YA 4BQNA 2L9SA 4JQFA 1W9XA 1NRKA 3OYAA 2HZDA 4XKWA 3HOSA 3N05A 4OJOA 4C30A 2NSTA 4B47A 3PFYA 3OYNA 3OOUA 1U0JA 2UV1A 3QODA 4CCJA 2VBEA 5FL7A 1UAAA 3IAS2 3OOCA 1NG6A 4U4BA 3OIQA 2XZLA 4QPOA 3OYCA 3VSLA 3BC9A 3FBIB 1VJSA 3H0DA 2CMPA 1VZ0A 2XOKA 2ELJA 1H80A 1DGWY 2M5SA 3ZPPA 3WWGA 4FXUA 2UVEA 4MR0A 2AQEA 3OIPA 1I8DA 2X6XA 2WJYA 4E7KA 1KZLA 2OV7A 2WAEA 2NOJB 4LIUA 3FBNB 3RSNA 3VSKA 2W6JA 4XD7A 2XC7A 4XR6A 1ERDA 3W2AA 2LY1A 2R4GA 3ZIAA 2L5QA 2K9LA 4GRIA 4KT6A 2ODLA 1FMWA 3FY3A 3KRGA 3H35A 4B43A 1SAUA 3H9QA 2MD0A 2JJ2A 2DXIA 4XLCA 1NHCA 3EUKL 4BE1A 2BVLA 3K4BA 3GBGA 2ZXIA 4II3A 4JOMA 1QJVA 3OYFA 4D1QA 4TT3A 3VSUA 1OR7C 1NG7A 2GOXB 4XOTA 3NE5B 3DPTA 3F9KA 3VR6A 2IGMA 3PNTA 2LRDA 4OAZA 4YELA 1JRGA 4BEHA 4MLOA 3A2KA 2F5VA 1IDJA 4XN3A 2IS2A 1QHHD 1E0EA 1R6RA 3OAAA 2NT6A 2DOAA 2PYGA 3DPUA 5FRNA 1G8XA 3H9JA 3PNYA 3D5LA 1WTHD 3K10A 3MKYB 4F93B 3L2UA 1FX0A 4XLHA 2XF6A 3DQVC 2V4JC 2HPIA 4KITB 1WFXA 2DIEA 1V5FA 2X6WA 3JURA 1CZFA 2F6CA 4J01A 4E4HA 3H94A 3K6GA 2VL8A 2X85A 4LITA 2GK7A 1DP3A 3QOEA 4B3XA 2V4DA 3VMWA 1YX5A 4JMQA 5IK2A 3SEZA 4CCOA 2X8KA 1D1AA 1GLNA 4RLFA 4BACA 4P22A 1BN8A 2IQ7A 2NT9A 2VBKA 3S32A 2D3NA 1J09A 1VF7A 4CCNA 1YE9A 1LVKA 2R7XA 1X1CA 4NNJA 4E7ZA 2IS4A 2CK3A 2Z6BD 1O8KA 3T53B 3MKZA 2GJKA 3H5RA 2LZJA 3K70D 3OE7A 2JUGA 2NTPA 2CW8A 1O8IA 4AU7A 1XG2A 2UWMA 2KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZX A;  1RU4 A;  2NTB A;  4XLA A;  4NK8 A;  1PE9 A;  4XLF A;  4OZZ A;  1O8F A;  4W8Q A;  4Z05 A;  4YZQ A;  1X0C A;  4W8T A;  4XKW A;  1IB4 A;  1PXZ A;  2NST A;  3B90 A;  4OJO A;  4I84 A;  3B8Y A;  2VBE A;  3UW0 A;  1DBG A;  1O8L A;  1DBO A;  2X6Y A;  3GQA A;  1O8M A;  4U4B A;  3LMW A;  4W8S A;  2QX3 A;  4XQF A;  4OJ6 A;  3GQ7 A;  2O17 A;  4YZ0 A;  3GQ8 A;  1H80 A;  4OZY A;  3ZPP A;  3B4N A;  3WWG A;  2Z8G A;  2UVE A;  3GRH A;  4MR0 A;  2NSP A;  2X6X A;  3SUC A;  1JTA A;  4OJL A;  1QCX A;  4XR6 A;  4XON A;  4U49 A;  4XOP A;  2ODL A;  2UVF A;  3KRG A;  4XL9 A;  1O8G A;  3FY3 A;  4EW9 A;  1GQ8 A;  1O88 A;  1O8H A;  1K5C A;  4XLC A;  2O0W A;  1NHC A;  2VJJ A;  2BSP A;  1OGO X;  1QJV A;  4URR A;  1RWR A;  1VBL A;  2O04 A;  2O0V A;  3VSU A;  2VBM A;  2X3H A;  4XOT A;  4XLE A;  1IA5 A;  2EWE A;  1BHE A;  1JRG A;  4YEL A;  3EQN A;  1O8J A;  2INV A;  1IDJ A;  4XN3 A;  3VSV A;  4AVZ A;  2NT6 A;  2PYG A;  4XN0 A;  2QY1 A;  1OGM X;  3VMV A;  4HWV A;  4YEJ A;  4XMY A;  1KCC A;  1PLU A;  4XLH A;  4XM3 A;  1EE6 A;  2NZM A;  4C2L A;  2X6W A;  3JUR A;  4OJP A;  1CZF A;  4YZA A;  2X85 A;  3GQ9 A;  3EQO A;  4W8R A;  3VMW A;  2INU A;  1O8E A;  3T9G A;  5AMV A;  1OFL A;  4XOR A;  2PYH A;  1HG8 A;  2VBK A;  4Z06 A;  2IQ7 A;  4XKV A;  1BN8 A;  2NT9 A;  1KTW A;  4NK6 A;  1OOC A;  3ZSC A;  2NTQ A;  1WMR A;  1O8K A;  2QXZ A;  4PMH A;  4XNF A;  4MXN A;  1RMG A;  4Z03 A;  3VST A;  1IDK A;  1AIR A;  4OJ5 A;  2NTP A;  2PEC A;  5C1E A;  2O1D A;  1O8I A;  1O8D A;  1OFM A;  1XG2 A;  5C1C A;  2VJI A;  1KCD A; 
#chains in the Genus database with same CATH topology
 1IUF A;  1I1G A;  4TSF A;  1VQ8 I;  1E79 A;  1T33 A;  3I59 B;  2M7B A;  3I3L A;  4CCK A;  2CUZ A;  2ZIT A;  4UHT A;  2D45 A;  4S0H B;  1ZGA A;  1QGZ A;  1NK3 P;  2E5Z A;  3V76 A;  2DAO A;  2QEN A;  4Z4U A;  1O8F A;  3FDY A;  1UFM A;  4RMN A;  4EJW A;  3O3K A;  2IA0 A;  1IW7 F;  2KQR A;  1Y6I A;  1ZR2 A;  3B90 A;  4NC8 A;  3H36 A;  3RKY A;  3BH4 A;  1FOX A;  3CCS B;  1MMN A;  4AYB A;  2VJ5 A;  3HPH A;  1E3O C;  3FPP A;  3A35 A;  4DQK A;  5EG0 A;  2O8X A;  3U6K A;  3H5A A;  3I4P A;  2CGP A;  5HZA A;  2HDW A;  1ULY A;  2HVR A;  2F4M B;  1FOW A;  3J80 K;  1WGX A;  2W00 A;  3KP7 A;  4RD4 A;  4A12 A;  2VJ4 A;  5KK1 A;  1Z3X A;  3TW7 A;  3K4K A;  3NQO A;  1HC8 A;  3PSF A;  2K3F A;  3LQQ A;  3JAM K;  2STT A;  1P4W A;  2H94 A;  1YJ9 I;  5TIS C;  1F60 A;  3N97 A;  2AHQ A;  3OYH A;  2KDZ A;  1EWY A;  3GQB A;  4KKU A;  1UB9 A;  3GFL A;  4ESB A;  4XKC A;  5H20 A;  5FLM J;  5C44 J;  1G7R A;  1OPC A;  4WK8 F;  4GFB A;  3WHB A;  1JKP C;  2V6C A;  2QKL B;  1SFO J;  4R8H A;  1R4N B;  3OEH A;  1IDY A;  5ICC A;  2HDN B;  2F5E A;  3CJQ B;  2LBF A;  4AIJ A;  1VQ7 I;  1RQP A;  1MH3 A;  3G05 A;  2DT7 B;  1XGM A;  2P7V B;  4IHX A;  4URR A;  1E17 A;  3GFM A;  1QA1 A;  1RR7 A;  4IZZ A;  5CQE A;  2EWE A;  2IBD A;  1I1S A;  5GP9 A;  2OCE A;  3CES A;  3ZMS A;  2IA2 A;  3LAP A;  3OR2 C;  1N08 A;  1QX4 A;  3DXJ F;  2DO7 A;  1MSF C;  1KU9 A;  3I59 A;  4ZGN B;  1SAN A;  1FRQ A;  5ICG A;  4QFM A;  4HG2 A;  3RYP A;  2VNH A;  3OS0 A;  3AVW A;  1LNW A;  2C5H A;  3DLL F;  2GXG A;  4FET A;  1JGG A;  3QWL A;  1K8F A;  5KW9 A;  2K85 A;  1FEX A;  4XM3 A;  2Y75 A;  4PGO A;  1QUF A;  1R5I D;  4RLZ A;  1K7A A;  1TWH J;  5IP9 J;  4B3G A;  1YHQ B;  3WTW C;  3BG6 A;  4IVN A;  2W1O A;  3GQ9 A;  4RM3 A;  4L5J A;  4NB5 A;  3HGG A;  2HI3 A;  6PAX A;  3T9G A;  3OV8 A;  5E6T A;  5H6R A;  4CCL A;  3T0Y A;  4WXD A;  3JQR A;  3M07 A;  4M9X A;  5LRS A;  2PX9 A;  1TW2 A;  2VAS A;  3DEW A;  3QFC A;  1ZGJ A;  2EFP A;  5HVQ C;  1GV2 A;  1Q1H A;  1OB0 A;  3FX3 A;  3I71 A;  3Q0U A;  1AIR A;  3W2W A;  2HTS A;  2RKH A;  3PNV A;  4U0Y A;  2F5D A;  1O3S A;  4YAF A;  1DAB A;  4UB6 C;  4HLX A;  2VJI A;  3GIR A;  2PMH A;  1W0U A;  3S8P A;  1A04 A;  3A8I A;  2PIA A;  3BJ6 A;  3ZQQ A;  1I50 J;  2EIM H;  1IV6 A;  3KP2 A;  1QBJ A;  2FNA A;  2VFP A;  1VQK I;  5FKK A;  2KL4 A;  3CPW B;  1S3J A;  2ADU A;  2Q2E B;  1XGN A;  2GK6 A;  5IT3 A;  4GQN A;  3KP3 A;  1KMH A;  2E2J J;  1R7J A;  3GF2 A;  2DI3 A;  5IPA A;  1YX2 A;  2ID6 A;  5DCM A;  2EIN H;  3TDZ C;  1KQ8 A;  3S2H J;  5JFR A;  2CW7 A;  2DA7 A;  2XNJ A;  3LMW A;  2QX3 A;  2P8T A;  1E1Q A;  2K3P A;  3O8H A;  5GAD J;  2R0Q C;  2IGK A;  3LL7 A;  4ANJ A;  4J19 A;  4LLN A;  1FDR A;  1WOR A;  2R9V A;  5DD8 A;  3KZZ A;  1O57 A;  4IQ4 A;  4TV7 A;  2EV0 A;  4B48 A;  1RES A;  1KK2 A;  3I55 I;  1TC3 C;  3GQ8 A;  5E1X A;  3OYJ A;  1UEL B;  3Q9S A;  3RY8 A;  4C2T A;  3NWT A;  3A1P A;  2OTJ B;  1SM4 A;  3G71 B;  2ZXJ A;  2HOT A;  1SVM A;  1WJB A;  1X2N A;  4KT5 C;  4RS8 A;  3WTY C;  4ZCI A;  3HOW J;  1YJW B;  2KT0 A;  4U87 A;  2KRH A;  1FNB A;  3BJO A;  3EQL F;  1TNS A;  5IOY A;  4EW9 A;  4HAM A;  2QEX B;  1ZK8 A;  1O8H A;  5TR9 A;  2C2W A;  2O0W A;  3BP8 A;  3SXY A;  1U9N A;  3K1N A;  2CQ7 A;  3AG2 H;  5H6Q A;  1O4X A;  5J3O A;  4M4S A;  5CQG A;  1X2M A;  2HOA A;  2BEO A;  3F22 A;  3WBJ A;  1Z67 A;  2M0C A;  4N3N A;  2VBT A;  4FE4 A;  1OCC H;  2ZME C;  4Q5S F;  2Q6I A;  2XTY A;  5LRR A;  3RJP A;  2KZV A;  1WDT A;  2XND A;  3UKG A;  2VQG A;  2YWF A;  1O7L A;  2CO5 A;  4NC6 A;  3A01 B;  1P92 A;  4N9H A;  4I2O A;  3LMM A;  3ZGK A;  5HXB A;  3AVV A;  1OYY A;  2JDI A;  2LKX A;  5FKN A;  2QGG A;  3M8J A;  3P27 A;  2ZSH B;  2V7T A;  2VB6 A;  4R79 A;  1YW8 A;  1FZP B;  4C3H J;  4WZK A;  4KH3 A;  1BR1 A;  4BDZ A;  3W2G A;  5JHU A;  2CV1 A;  1ETY A;  2CQQ A;  3COA C;  3I58 A;  2QKM B;  4P55 A;  4U7D A;  2E2H J;  1EE6 A;  1EH7 A;  1N25 A;  1YX3 A;  4C9Y A;  1PVE A;  5FO5 A;  4OJP A;  2VOD A;  1KK1 A;  5E8I A;  3CCL B;  3HOT A;  5KAI C;  4KIS A;  3PA2 A;  3CCE B;  2X6O A;  2O61 A;  4YAU A;  1ZUN B;  1K78 A;  1OFL A;  1KQ9 A;  1W5C C;  4OIP F;  1OLT A;  4LOC A;  1VHO A;  2IVM A;  1KTW A;  2BYV E;  3V42 A;  1FLI A;  3S3N A;  2MGQ A;  3VST A;  3FIS A;  4B4D A;  5DUI A;  2G0Y A;  3V7S A;  3BTL A;  2K02 A;  1X4O A;  2X1C A;  2HDD A;  1ITY A;  4HA8 A;  3LNN A;  3ZQG A;  3Q38 A;  3QRF F;  5DCF A;  1G7S A;  2WZP P;  3CCJ B;  2XGX A;  4C0S A;  1MJA A;  3BR3 A;  2R5Y B;  2R7W A;  2JUC A;  1EXM A;  4Z4V A;  3E1Y E;  1EA0 A;  3H3U A;  3VWB A;  3CP2 A;  2O5R A;  2NOG A;  3BR6 A;  2GA2 A;  3DTI A;  3HKZ A;  3F6O A;  3H9G A;  3W2V A;  2PQ8 A;  4LD5 A;  4LB6 B;  4BUP A;  2J7K A;  4Z05 A;  2ESN A;  1T6Z A;  4WZE A;  2VKV A;  3MZ8 A;  4BJ6 C;  3W3C A;  2JRM A;  1W87 A;  2OBR A;  2BXZ A;  2V5I A;  1IB4 A;  1QZY A;  1VQM B;  3M9A A;  3TMO A;  4I84 A;  3CO7 C;  1JA1 A;  3AVU A;  4L5E A;  3V7R A;  3CC2 I;  2X6Y A;  1IN8 A;  4BBS J;  2ISY A;  2MAB A;  3B6A A;  2BVN A;  2A6T A;  2W85 A;  3W6V A;  1JKQ C;  2C5B A;  3GW2 A;  4YAO A;  4BHP A;  2D5V A;  2O17 A;  1AA7 A;  2FJ1 A;  3FMR A;  3GLX A;  1UD5 A;  2P6T A;  1WWX A;  2PMZ A;  3B4N A;  2RC4 A;  2ZL6 A;  2HQR A;  1UJ8 A;  5BQT A;  2IA1 A;  5D8K B;  4HF2 A;  3KX2 A;  3T5X A;  2Y0M A;  5J3L A;  2Q1Z B;  1JTA A;  2W48 A;  4ZYA A;  2V9K A;  2L01 A;  5FLX K;  1YIT B;  3BY6 A;  5L3C A;  5LEK A;  3BRO A;  1QQ1 A;  2RRE A;  4Q7J B;  2QQ8 A;  2WSS A;  2DOG A;  1LJ9 A;  2UVF A;  1FOK A;  5ED4 A;  2QBY B;  1LDJ A;  1IAW A;  1VQ5 I;  3LVB A;  2WBM A;  3G6E B;  1W7P D;  4EJT A;  3LWF A;  4ZCL A;  4IRI A;  3CD6 I;  4Z1M A;  2W7N A;  1HW5 A;  4Z2Y A;  5GPA A;  2YU3 A;  4MTE A;  4GO1 A;  1U8B A;  4RDL A;  1FPQ A;  1JJ2 B;  1LDD A;  1K9M D;  4AIK A;  4NQW A;  4HNT A;  3DBR B;  2PN6 A;  1WPC A;  3BH6 B;  4NCN A;  1B23 P;  1QQI A;  2HEO A;  5LLQ A;  3GEZ A;  5DM7 F;  2I10 A;  5ILS A;  4XLN F;  2BV3 A;  4UAJ A;  3JX8 A;  1MBJ A;  3WOD F;  1XSD A;  2A5W A;  3LSM A;  3GTJ J;  2HMA A;  1XGS A;  3LA7 A;  1YIJ I;  3RQ4 A;  4RGR A;  4IHT A;  4M53 A;  5FRO A;  1E62 A;  2VXD A;  2XTW A;  4BY7 J;  3BT9 A;  1ZHF A;  4GYI A;  1T08 B;  1VLO A;  1IRX A;  5FFX A;  4PJL A;  2V7Q A;  5E1Z B;  2CFO A;  3CJN A;  2NV4 A;  1DUX C;  3TO9 A;  2HVS A;  5HDG A;  3S14 J;  2MC3 A;  4BJ5 C;  1D0X A;  4FX4 A;  5LGU A;  1PP7 U;  4W8R A;  2XAJ A;  3QFT A;  1D5Y A;  2BM5 A;  2QSH X;  2GLO A;  3H9N A;  5LHH A;  1B1B A;  1OFC X;  2GBY A;  3L2W A;  3OJW A;  2V26 A;  2L7F P;  1OOC A;  3ZSC A;  3MKW B;  4YEI A;  2KPM A;  3CB4 A;  2DA2 A;  1Y0Y A;  4RAY A;  2DY1 A;  4MYT A;  4Z4R A;  1N07 A;  1YIO A;  2PEC A;  2L2O A;  2QDX A;  1QVT A;  1BBY A;  1A6I A;  4DOZ A;  4YIR X;  2QBY A;  3D1N I;  5FNZ A;  1WJE A;  3WNC A;  2P0W A;  3RZD J;  2AS5 F;  4LBZ A;  3CLO A;  1T95 A;  1XC5 A;  3NWS A;  4X8I A;  2ZJ2 A;  4CSW A;  4XLA A;  2E7W A;  3OYL A;  3G73 A;  2R7R A;  5BOX A;  3AGP A;  3C7J A;  2H6B A;  1Y56 A;  3Q0W A;  3JSP A;  5CVU A;  2X1E A;  4PUS A;  5IYP A;  3Q3A A;  2KRF A;  1KQ5 A;  4X7F A;  3CLQ A;  5FD6 A;  3OYA A;  4KA4 A;  2EIX A;  2VNJ A;  3ASO H;  1J75 A;  1HCR A;  1R5B A;  2R7Z J;  3OOU A;  2UV1 A;  3QOD A;  5E3O A;  1ZRF A;  3SYJ A;  2OBS A;  4M2L A;  3IAS 2;  1WRJ A;  2DFE A;  2XZL A;  2YUH A;  4TMV A;  2A07 F;  4G7O F;  1V3F A;  3S15 J;  5C4X J;  1IN4 A;  3IHU A;  3QQA A;  4B1R A;  2QTZ A;  4G7H F;  1H85 A;  1YLF A;  4BNC A;  4MQV A;  3GYH X;  1QGY A;  3T8T A;  4EM0 B;  3IKV A;  3SHF A;  1VQP I;  1FNN A;  1Z1D A;  3WWG A;  4FXU A;  4ABZ A;  4NDL A;  3OIP A;  2LSO A;  4GGG A;  1I8D A;  1PJ6 A;  2DMQ A;  3FXU A;  3V7A A;  1KZL A;  3DU1 X;  1OMI A;  1ZRD A;  2OV7 A;  3RIQ A;  1OR7 A;  2JA6 J;  3RSN A;  2W6J A;  1ERD A;  3SFI A;  2M87 A;  2ELH A;  2VN2 A;  3CF5 F;  1TVC A;  1W5S A;  2FX3 A;  1FSH A;  3ZIA A;  2ODL A;  1K8A D;  1JKR C;  1MBG A;  3H35 A;  4A3G J;  4BKX A;  1A36 A;  2MLG A;  3BPV A;  3H9Q A;  2JJ2 A;  2BY2 A;  4IPA A;  3CMA B;  3GBG A;  4M6Y A;  4D1Q A;  1ZM4 A;  1NJI D;  2VT2 A;  4A0Z A;  3NE5 B;  3F9K A;  3VR6 A;  2OYN A;  1AOY A;  2W7Z A;  4MLO A;  5F64 A;  3JRH A;  1KTV A;  1IDJ A;  4I7H A;  5EF6 A;  5JVG F;  3JRG A;  3I56 I;  2DOA A;  4JRA C;  5FRN A;  2FBH A;  1RKT A;  2M30 A;  3GTM J;  1LEB A;  4N3G A;  3SQN A;  5FA6 A;  2BXY A;  2F48 A;  1WTH D;  3HHG A;  3K10 A;  1JJ6 C;  1IRZ A;  2HZT A;  4K1X A;  4W97 A;  1BA5 A;  2GRE A;  5J47 A;  4L18 B;  5IP7 J;  5BSX A;  1T98 A;  3DQV C;  2V4J C;  2H6C A;  1ZM2 A;  4Y7C A;  1WFX A;  1L0O C;  2O7O A;  2VFN A;  1V5F A;  4RA2 A;  1IN6 A;  1O8G A;  1CZF A;  2PEX A;  3R0A A;  1GAQ A;  1QA3 A;  2VL8 A;  2K9N A;  3DFG A;  5B1A H;  2LNB A;  1FT9 A;  5BMZ A;  1Q1V A;  5EMN A;  4LC0 A;  5ILV A;  3ECH A;  3VMF A;  2BM4 A;  1S8N A;  2TDX A;  4RLF A;  2VBK A;  3PO3 J;  1HKT A;  3WE2 A;  1J09 A;  4NHJ A;  5HDK A;  3CCQ B;  1WI9 A;  3PET A;  4BBR J;  3DV8 A;  3O8G A;  4O6J A;  4CZZ A;  2GJK A;  2LZJ A;  2JN9 A;  1U9O A;  3OE7 A;  2WV1 A;  2Y69 H;  3PIP F;  1U6G A;  2VFM A;  1G3W A;  2CW8 A;  1VQL I;  2XRL A;  3E6B A;  1QH0 A;  3QPS A;  1XG2 A;  1G3T A;  2FRH A;  3VO2 A;  2GPJ A;  4FN5 A;  3K1M A;  4BPR A;  1FYK A;  3GVK A;  2OU2 A;  2XAF A;  1U8R A;  4U88 A;  3ECO A;  1TZL A;  5FO1 A;  2Y31 A;  3Q39 A;  3HAG A;  4E7H A;  4AC9 A;  3MN2 A;  4AF7 A;  2ZNZ A;  1UHS A;  3LQR A;  2LLK A;  2JWT A;  2X4H A;  4KN7 X;  2DOD A;  4D5F A;  5JI6 A;  5A2Q K;  4K2E A;  2GXB A;  1P9Q C;  2H27 A;  4V19 K;  2EK5 A;  3CCS I;  2Y30 A;  2IXS A;  3C1D A;  3MZH A;  3J7Z I;  2EH3 A;  3AL0 B;  3IRR A;  1DBO A;  1FY7 A;  2ZXH A;  2W84 A;  4LBY A;  1NH3 A;  5BSY A;  4OJ6 A;  3CW2 A;  3G2B A;  4UVB A;  4P26 A;  2EB7 A;  4EM2 A;  5LHI A;  3FM5 A;  3CZ6 A;  1RIO H;  1R22 A;  1IRG A;  2VKD A;  3OEE A;  4KKT A;  4M6X A;  3E97 A;  2OF7 A;  3ZQI A;  2OTL B;  3S3O A;  3DBL B;  2XF5 A;  4I99 C;  4FCY A;  3EUA A;  4ACB A;  2E60 A;  2FF4 A;  2VNK A;  2XZO A;  2WAQ N;  3LYC A;  1FTZ A;  3L1P A;  4WQM A;  5J40 A;  1TQI A;  3WTX C;  1N05 A;  1B8I B;  1RUO A;  5DV5 A;  3V8J A;  2R7U A;  3DTE A;  3F8C A;  1QPI A;  3TH0 A;  5HS9 A;  2XNC A;  4GXO A;  1WJF A;  1W0K A;  1PUF A;  3S3M A;  2HDC A;  5E3N A;  1WOO A;  1FMV A;  1P4X A;  1ZR4 A;  2BV6 A;  1TWF J;  1W4M A;  2HGC A;  4LG3 A;  3CCV B;  3RDI A;  1IN5 A;  3GZ5 A;  4ZYG A;  1MBF A;  2OCC H;  2V1D A;  1W5T A;  2YPR A;  4MEX F;  1Y0N A;  3GZN B;  1G4D A;  2LF7 A;  3HSR A;  3R6K A;  1Z0X A;  4D7N A;  4U0W A;  4DBQ A;  3VOE A;  1ZG5 A;  2OA4 A;  3QYF A;  2VNI A;  1DG1 G;  2VBW A;  2CV0 A;  4YC5 A;  2GWR A;  3P9C A;  1X3U A;  5IT9 K;  2LR8 A;  2O0Y A;  2ACJ A;  5IYW A;  3C18 A;  4HWV A;  1HF0 A;  2YWE A;  4Y13 A;  2P81 A;  2BX6 A;  2E19 A;  3M3Y J;  2WR8 A;  1P7J A;  4HEA 2;  3TBI A;  1EP1 B;  4G1B A;  4A0X A;  4Y9R A;  1WU8 A;  1Y0U A;  1YHQ I;  3VO1 A;  3ERM A;  1ZRE A;  1YFH A;  4IEJ A;  3CF2 A;  1AKH A;  5DNS A;  4P9F A;  4A93 J;  2WA0 A;  1WH5 A;  2KJB A;  1W7P B;  3NEU A;  1TW3 A;  1KD1 D;  3IUO A;  4PAB A;  2BY0 A;  3DEU A;  2VE8 A;  3ASS A;  1UMK A;  2FD5 A;  1HOM A;  4KN4 X;  4MEY F;  5FD5 A;  1P4M A;  4H9G A;  4PAA A;  1MD0 A;  5FLV A;  2JPB A;  1P7I A;  4KUM A;  1MDM A;  3AGQ A;  3K9T A;  2IGO A;  3IAM 2;  5F1J A;  4MTD A;  1T2K A;  4WWC A;  2PI0 A;  1UD2 A;  1WJC A;  5TRD A;  2DMP A;  5CVJ A;  1Q7Y D;  2QGU A;  1K73 D;  1X3Z B;  3QYE A;  3H0G J;  3ZMU A;  4BS9 A;  3AFH A;  4CO8 A;  3JRI A;  1O8D A;  3O6B B;  1TWG J;  4OPW A;  2VBY A;  1MZB A;  3K4M A;  1A5J A;  4Z4T A;  2P3M A;  4P96 A;  1LE8 B;  3RTR A;  4G6T B;  2C4U A;  4YZX A;  1EP2 B;  3TED A;  2I8D A;  1EA3 A;  3LFU A;  3ZCO A;  2BZT A;  2DN0 A;  3BQZ A;  3HJE A;  1V54 H;  3PQK A;  5LFA A;  1G2H A;  2LTP A;  4NK8 A;  2JSC A;  3OP1 A;  2ZFW A;  3K69 A;  2IRF G;  2G7H A;  5IY5 H;  4FTH A;  1Y0R A;  5HOO A;  2QA4 B;  2ETH A;  4XLF A;  3KE2 A;  1TWA J;  2XPW A;  3L09 A;  4BL0 B;  1QGA A;  2M8E A;  3KEO A;  4PJJ A;  2CBX A;  2A61 A;  3B8Y A;  3KLN A;  1ZKG A;  4IOC F;  2LRE A;  2WB1 N;  2Y2Z A;  2KLO A;  3IWF A;  1WSV A;  4IRH A;  3FPK A;  4H0E A;  3TO6 A;  5JMC B;  1RNL A;  1T0F C;  4HBL A;  3SDG A;  2CFX A;  2MLK A;  4IW3 B;  2LP0 A;  3M1C A;  5D5W B;  4PFP A;  3TGN A;  1HF2 A;  1LVA A;  1QO0 D;  1XGO A;  2XF7 A;  3HG9 A;  2XSJ C;  5EZG A;  1T5E A;  4G6Q A;  2CS3 A;  5J4Y A;  1N06 A;  3A1Y A;  3OW2 B;  3GRH A;  2OTJ I;  2I5U A;  2J8I A;  3D0S A;  4OAY A;  1PP8 F;  3G71 I;  4KKS A;  4IKF A;  1I3A A;  5KAF C;  2F1L A;  1WJD A;  3WG9 A;  2R3S A;  2AHO A;  2DBB A;  1S72 I;  3BCB A;  1YJW I;  3ASN H;  2A69 F;  2ZME A;  3CDL A;  1IXC A;  3OYK A;  4V2G A;  2CUE A;  4PC6 A;  4MHG A;  2QEX I;  1N75 A;  5HLI A;  1CLW A;  4IRG A;  2ID3 A;  1R1U A;  4HX8 A;  5EGO B;  1OGO X;  4UZU A;  1X1A A;  3BZK A;  5EEG A;  1J9I A;  1IDZ A;  2FNP A;  4E7L A;  3FWE A;  4U7B A;  4HST A;  3WTV C;  4EV0 A;  1I5Z A;  1YW9 A;  1PKV A;  1D8T A;  4L9J A;  4AUX A;  4Q48 A;  2R7D A;  4UUS A;  4BHC A;  3HTS B;  1IXS B;  3RPU A;  4WZT A;  3CTA A;  3BY1 A;  2EIL H;  1VQ9 B;  4ENM A;  3EDP A;  4XN0 A;  1JE8 A;  2XGD A;  3SZG A;  1XDS A;  2IP2 A;  3KZI C;  1H8H A;  1QFY A;  2CND A;  3TQN A;  2LF8 A;  2V7X A;  3LFK A;  2XTX A;  5L3F A;  5DN6 A;  3CCR I;  1XMX A;  2H1L A;  3HSF A;  1QFZ A;  3E6C C;  1ETK A;  4BEH B;  2CUF A;  5HOD A;  3J80 Z;  4DNR B;  2KMU A;  3W6K B;  5LEJ A;  1EP3 B;  3GVJ A;  3X2Q H;  3GX4 X;  2ZBV A;  1GVD A;  3CCL I;  1J59 A;  3QSY A;  4YZA A;  3CCE I;  1IUY A;  4MYU A;  2FEZ A;  4B44 A;  5LD2 C;  1N8R D;  1R1T A;  1EJ9 A;  4C3I J;  3W2A A;  1O8E A;  4A3K J;  3HL2 A;  3JAM Z;  2INU A;  4I01 A;  4XOR A;  3EUH C;  4OOV A;  1OYI A;  1ETX A;  1QRC A;  5JLX A;  3W2I A;  3W2E A;  2PFB A;  3PUB A;  1MND A;  1TYW A;  2NYX A;  3DWL E;  2D74 A;  2DT5 A;  5HLT A;  1OFD A;  2LOO A;  1SFK A;  3WU0 A;  3FF5 A;  2QXZ A;  5AON A;  2C4T A;  3CQZ J;  2FA5 A;  1R49 A;  2CQK A;  1RMG A;  1GDT A;  2NVT J;  2W4S A;  4HZF A;  3A0H C;  3FXL A;  5HZB A;  3C2H A;  2BY1 A;  3FXJ A;  1K28 D;  3BR1 A;  1NB9 A;  3ZPL A;  2EZK A;  1OFM A;  2AXT C;  3ABK H;  1KCD A;  3VYU B;  3CCJ I;  2L4A A;  2E36 A;  4AIH A;  1OCR H;  3CUQ B;  1U78 A;  1BLI A;  1RU4 A;  2MH9 A;  5EGO A;  1ODD A;  1UG0 A;  1OCT C;  4DBR A;  1T6Y A;  2E1B A;  4TMX A;  5D5X B;  4YDT A;  1F43 A;  3MVP A;  3V8K A;  2Z99 A;  4N0B A;  3GCM A;  4A6E A;  4ZDP A;  1X0C A;  2YR2 A;  2VPR A;  2WJV A;  3SFZ A;  1I18 A;  3N6Z A;  4W8T A;  1TBX A;  1Y1V J;  1U2R A;  2Y0S A;  1VQM I;  4NBS A;  1L1I A;  2WY7 Q;  3SYT A;  2JJ1 A;  4XRS G;  4QTR A;  2V31 A;  4ZYE A;  4A3C J;  4LGW A;  3AL0 C;  3FJO A;  4PC3 A;  4P9S A;  1QRB A;  4V2F A;  2BY3 A;  2LY9 A;  5CJ9 A;  1S4M A;  5HKK A;  4W8S A;  3HRT A;  1SMT A;  1ZG3 A;  2EZH A;  2M0M A;  2ZO4 A;  3DTK A;  2VPL A;  2XB0 X;  1WHU A;  3D5S C;  4KIF A;  2LMD A;  3SEJ A;  5E3L A;  1LUJ B;  3I54 A;  3LSH A;  3SLN A;  4B09 A;  1MMS A;  4BH9 A;  2W82 A;  3SKB A;  4B4C A;  4HIZ A;  1A6Q A;  1FSE A;  3A4C A;  3GFJ A;  4OU0 A;  2FXA A;  2ICW G;  5E8G A;  4HF1 A;  1MSE C;  5FKL A;  3OYE A;  1HZE A;  2VZL A;  3Q6Q A;  2CH0 A;  3HXL A;  1IG7 A;  5J35 A;  1Z9C A;  2CQN A;  1W35 A;  2MD5 A;  4UV8 A;  2VT3 A;  3S17 J;  4XL9 A;  2QSF X;  4IXA A;  3G6E I;  2A05 A;  2HPM A;  3E1S A;  1QU3 A;  4O5V A;  5GV8 A;  4NUB A;  4ASU A;  3OZW A;  2LDU A;  4EJO A;  4PGG A;  1RUN A;  1D8K A;  4OP7 A;  2CV2 A;  2CSO A;  4XKB A;  4WWV A;  1FYL A;  1E3P A;  1LFU P;  2KVO A;  3QYB A;  1D8J A;  2GQF A;  4P12 A;  2XV4 S;  3FKS A;  2EZL A;  4XSX F;  3TDU C;  4KIG A;  4BY1 J;  4X7D A;  1EFR A;  2MFZ A;  1BHE A;  2GIV A;  1G6N A;  4A3E J;  3QFR A;  5D4R A;  3P4G A;  2PJR B;  4M71 A;  3U1D A;  3CCU B;  4ACA A;  2NS8 A;  1OHH A;  4Y9U A;  2OBP A;  2ECC A;  5B66 C;  4JBA A;  3PVD A;  1BOA A;  2X9D A;  1VQO I;  3MKL A;  4Y4R A;  1WXR A;  2E5N A;  1RZ4 A;  1ETW A;  2BOL A;  5HS7 A;  5L3D A;  2V1U A;  1R5N A;  4YEJ A;  2ZZQ A;  2JA2 A;  4F3Q A;  5TJJ A;  1PLU A;  1KQ0 A;  4YRV A;  4OMZ A;  3RPQ A;  1I39 A;  2ZZG A;  2VXZ A;  4FE7 A;  3MWM A;  2GXA A;  1WKM A;  2GOM A;  1DQU A;  4Q47 A;  2DDB A;  3JRA A;  2L9R A;  4PSW A;  5K5R A;  2DFH A;  2DET A;  2PLF A;  1MBE A;  1LKX A;  2WAD A;  1EFU A;  2ZBK A;  5EEH A;  1ZEL A;  4LLG F;  4OIN F;  2NVQ J;  1OQY A;  3R6S A;  4ZDO A;  2OK7 A;  4M3E A;  3MAJ A;  3EQO A;  3F8F A;  1TUI A;  1J7K A;  1IZ1 A;  1QA2 A;  2RAE A;  3DF8 A;  1FTT A;  3RYR A;  3AVX A;  1YG2 A;  1ZYR F;  2HLD A;  5CVV A;  3K4C A;  1Z6R A;  2HYF A;  3FZV A;  4RD2 A;  4NK6 A;  3JRE A;  3BY2 A;  2K86 A;  4HSR A;  1ON1 A;  4BU2 A;  4P1V A;  1MJ9 A;  1SC7 A;  4MGR A;  1TTY A;  4FT8 A;  4AYB N;  2K4B A;  3MHP A;  4DQL A;  2XT2 A;  1P6R A;  1F9N A;  1FP1 D;  2EA4 A;  4RCY A;  4CYC B;  2DJI A;  2Q2E A;  3KEW A;  4OIO F;  3RI4 A;  1JXS A;  4I76 A;  2E7X A;  2AQF A;  2V6E A;  3PEN A;  5BPI A;  3QOP A;  4CQJ A;  1S7O A;  3B02 A;  3DPL C;  1R00 A;  2EZI A;  1XFO A;  3DU5 A;  3I4M J;  1YJ9 B;  1V55 H;  5GTH C;  1PE9 A;  1WOP A;  1ZM9 A;  4OZZ A;  1W9X A;  4OWR B;  1D0Y A;  2L9S A;  3PUF A;  5LMZ A;  1NRK A;  2JK3 A;  1TSP A;  2HZD A;  4XKW A;  3N05 A;  4OJO A;  5DD4 A;  2DDA A;  3QU6 A;  3PFY A;  2BMW A;  2BSA A;  3S2D J;  4YG2 F;  4FQG A;  3EET A;  4JX4 A;  4CCJ A;  1Z77 A;  3A0B C;  1UAA A;  2WYR A;  2H1K A;  1VQ7 B;  4WCG A;  2O6W A;  1ETO A;  2A3S A;  4QPO A;  5J4V A;  4EQQ A;  4HDV A;  3E7L A;  4TMT A;  4XIC A;  3ROU A;  3J7A O;  2QYO A;  1U5T B;  2ELK A;  2V7V A;  1DGW Y;  3HRU A;  1IB0 A;  1W1W E;  4OM9 A;  4Q4Z F;  2YX4 A;  4Z4W A;  2DQL A;  2X6X A;  2XGC A;  2KIU A;  1I3Q J;  2NOJ B;  4YIF A;  4XLP F;  3PSS A;  3HOX J;  3HEF A;  2C78 A;  4ZV4 A;  3I4N J;  4GRI A;  2E1C A;  2Q6L A;  1FMW A;  3A01 A;  2R92 J;  4B43 A;  2RNJ A;  2J8K A;  5DS9 A;  2XAQ A;  2DOE A;  3WGI A;  2DXI A;  5JLW A;  3EUK L;  2C6Y A;  4II3 A;  3Q9V A;  5DTD A;  3VSU A;  3LJY A;  1GXQ A;  2GOX B;  1IHM A;  1SD4 A;  3ABU A;  1BL0 A;  5E79 C;  3PNT A;  2LRD A;  4G6D A;  4YFX F;  1BW6 A;  4DQ2 A;  5BS6 A;  5K1Y A;  1NB0 A;  2IS2 A;  3ASQ A;  1HQC A;  1REP C;  1R6R A;  1VQN B;  2VE9 A;  1OCZ H;  3OAA A;  4UZF A;  2FX0 A;  1G8X A;  3H9J A;  3OOP A;  5LBQ A;  3D5L A;  4YAL A;  4F93 B;  3L2U A;  1IF1 A;  4RD6 A;  1FX0 A;  2HOE A;  1YJN I;  4XLH A;  2XF6 A;  1JTX A;  2QM3 A;  1D2E A;  4KIT B;  3CC4 B;  3KYC B;  3ABL H;  5LHG A;  1K4Z A;  2LKP A;  3BOQ A;  3TW6 A;  4J01 A;  1KYW A;  4E4H A;  5F1R A;  1S0U A;  1ZAO A;  3H94 A;  3K7A J;  2DQR A;  3QOE A;  4B3X A;  2QWW A;  3BQY A;  4AWX B;  4HQE A;  4JX5 A;  1X3W B;  2DA4 A;  3HOZ J;  5IK2 A;  4OPS A;  1BW5 A;  1GLN A;  4P22 A;  1VQK B;  5FLX Z;  3FXK A;  1JJ8 C;  2R5Y A;  1QA6 A;  3HSE A;  1BQE A;  5F4J A;  4M6V A;  4YFN F;  4RB2 C;  2G0E A;  4CCN A;  3CCQ I;  1LVK A;  4S04 A;  1XPX A;  2RV8 A;  2R7X A;  1O8K A;  3T53 B;  4XRS A;  2FOW A;  3K70 D;  2R5Z B;  4HW0 A;  1YW7 A;  1WPK A;  1JHF A;  4IJA A;  1O8I A;  1QPM A;  1RQR A;  2UWM A;  1XSV A;  2QUF A;  4I98 B;  3K4L A;  3CUQ C;  2NRA C;  3I55 B;  2K7L A;  1OB5 A;  2XC1 A;  1SVL A;  4A2U A;  1UD6 A;  3KFW X;  3LSP A;  1DGR M;  1KON A;  3ML6 A;  1NTC A;  4PJN A;  3L7W A;  5AIQ A;  3M8F A;  1X4P A;  4Y3O A;  3H92 A;  2C77 A;  4A5N A;  2RDP A;  3AKZ A;  3IP4 B;  1V4R A;  3NB2 A;  5B3S H;  4W8Q A;  4QVJ A;  3A02 A;  3IL2 A;  4P1W A;  3A8J A;  4ESF A;  2G7U A;  3N4M A;  1DAR A;  5HS8 A;  3F21 A;  4G7X A;  2M4K A;  2Z9O A;  3KZY A;  1IV8 A;  3JR9 A;  3JTG A;  1S9H A;  2P5L C;  2NVX J;  4RGS A;  3RCO A;  3S1N J;  5CDF A;  2TCT A;  5F0C A;  4ZTF A;  1WH7 A;  1XMK A;  2KIQ A;  5IYC J;  4F92 B;  2L7M P;  3L2V A;  1S7A A;  1VTN C;  1N77 A;  1H88 C;  2O9L A;  3GTK J;  2OAZ A;  2DK8 A;  2F2E A;  1I27 A;  3BR0 A;  2BN4 A;  4Y7N J;  2OC6 A;  3CO6 C;  3F8M A;  1ACI A;  1E63 A;  2IEK A;  4RGU A;  3VYS B;  2ZJQ F;  1HKQ A;  1XS9 A;  1JNY A;  3CRZ A;  1GT0 C;  4LIV A;  2IAI A;  1EH6 A;  4RPD A;  3P7N A;  2HOS A;  1EZG A;  3VYR B;  4CCM A;  2IOU G;  2X48 A;  3A3G A;  1TLH B;  2M4G A;  3WYA A;  2BBY A;  5JR3 A;  2V7F A;  5IYR A;  4RM2 A;  1O88 A;  3ZMV A;  1Y8R B;  3IKT A;  1IJE A;  5HLG A;  3R4K A;  3NAW A;  1XG1 A;  3ZBU A;  2K9S A;  9ANT A;  1RI7 A;  3QP6 A;  5J1R A;  2X3H A;  1XX5 A;  3OPO A;  2Q8K A;  4PC1 A;  3TL4 X;  3CME B;  3E6M A;  3ZMD A;  3ZPN A;  1BI1 A;  3EQN A;  3BCF A;  1KJZ A;  2JA7 J;  2R7O A;  2RNG A;  1D0Z A;  1M90 D;  2JVH A;  4N4O B;  4WZL A;  3HRM A;  1FX7 A;  1F4K A;  4L0Z B;  5HNF A;  2IQ7 A;  2EQR A;  2K9M A;  4LBV A;  1EH8 A;  3ONU A;  1VI0 A;  4HX4 A;  1YS7 A;  2NS7 A;  1TQP A;  4LBW A;  4XMY A;  4KIB A;  4EMS A;  1JA0 A;  5HNH A;  2BPO A;  2CC2 A;  1LFP A;  3MQ0 A;  1YI2 I;  5DS0 A;  2XGE A;  4BHB A;  3UNG C;  1ZLK A;  2BW3 B;  3CDI A;  1R58 A;  1B2R A;  5M5Y J;  3FHN A;  1UZC A;  3DU6 A;  3OW7 A;  2L54 A;  3CC7 I;  1NHA A;  2Y9Y A;  4EAT A;  3S1M J;  3E20 A;  2LFB A;  2E1M B;  2IJL A;  2XAS A;  3ABM H;  4B8X A;  3HKZ N;  2DTZ A;  4PGH A;  5JHF A;  3BG9 A;  1DU0 A;  4Z06 A;  4XKV A;  5DEQ A;  2L9V A;  3T8R A;  3ZP5 A;  1BX0 A;  1QVF B;  1R23 A;  3I64 A;  3OMY A;  3CDH A;  2NTQ A;  4RAF A;  3JRC A;  3T51 B;  2FQ3 A;  4UV9 A;  4P3Y A;  5L3G A;  3H3Z A;  2GJP A;  1IXR C;  2VBV A;  3CC2 B;  3OYM A;  3VDX A;  4BQA A;  1W0J A;  3KL9 A;  1FWZ A;  4OJ5 A;  3V4G A;  2JQ7 A;  4CUG A;  5F08 A;  4A3L J;  3FIW A;  1A8P A;  1BJK A;  3OYI A;  2XVC A;  4RB0 A;  4OMY A;  4UB8 C;  2V79 A;  3DKX A;  5IP6 A;  2KJC A;  4PK4 A;  1GJR A;  1AU7 A;  1Q81 D;  5FKO A;  2B7B A;  3RIR A;  1HVX A;  1QVG B;  1ENH A;  2PMZ N;  3OS2 A;  2BGJ A;  1USS A;  2LH9 A;  3GXO A;  1ZG1 A;  1X19 A;  3Q3S A;  2E34 A;  1T0F A;  1JB9 A;  1V5V A;  1A31 A;  2M1B A;  1VQ4 B;  2PLY A;  3WQZ A;  3U2Q A;  1H8A C;  2DCU A;  1GVJ A;  3K1P A;  4P6Y A;  3ZZ0 A;  1PXZ A;  2DFF A;  2FVG A;  3QE2 A;  1OB2 A;  3WU1 B;  3CXC B;  4J0Q A;  3UW0 A;  1P2F A;  5CKT A;  3ZC3 A;  4IQJ A;  4DK1 A;  1O8M A;  3QPL A;  4X0G A;  1MKM A;  3L2Q A;  1PDN C;  2D9R A;  2CRG A;  4G8X A;  3VOD A;  5CVR A;  4LK0 F;  3PJR A;  3GQ7 A;  2ISZ A;  2CUJ A;  1Z3Y A;  2EV5 A;  1IRF A;  1U5T C;  2F4O B;  4X1E A;  1YS6 A;  4X0C A;  3RZO J;  2VYQ A;  1V0E A;  4G5G A;  1WSU A;  3MCA A;  2LY2 A;  1JTY A;  3JQQ A;  4R71 A;  4QLC U;  3ZXS A;  1W36 D;  3LQE A;  2W24 A;  4OJL A;  4Y52 J;  4C3J J;  4X7E A;  4L5I A;  2JA8 J;  1YIJ B;  2MSY A;  1IC8 A;  1SFX A;  1XN7 A;  2IPQ X;  1A35 A;  1H89 C;  4YFO A;  2L0K A;  3P9I A;  4Y33 A;  2DMT A;  2FQ4 A;  3BTC A;  4CXF A;  1L3L A;  1KU7 A;  3DKW A;  4BQO A;  4A3D J;  3G4S B;  1Z7U A;  4YAW A;  2CWE A;  1B4A A;  2Q0O A;  1DP7 P;  1MMD A;  3QP5 A;  2HS5 A;  3LSK A;  1D5V A;  2B7C A;  2MW8 A;  1VBL A;  2O0V A;  4X7C A;  1QNT A;  3TOA A;  5GPC A;  4G7Z F;  3FMS A;  1Y8Q B;  1BI0 A;  1MGT A;  5KHD A;  1XB4 A;  2OUM A;  2OQG A;  1R5G A;  3JRF A;  3L2R A;  5C4J J;  1O8J A;  2D3L A;  2NVY J;  4ESJ A;  3FXQ A;  2DA1 A;  2IGN A;  2OPT A;  4HOB A;  4L8J A;  1DU6 A;  5A2Q Z;  2PG4 A;  1COW A;  1R36 A;  4OIR F;  4C43 A;  3T1B A;  3VMV A;  3K4J A;  4HX7 A;  4RAG A;  1HA3 A;  3DP7 A;  4EGZ A;  3F72 A;  2ZJP F;  2XIG A;  3EUH A;  2V9P A;  3ZRG A;  1K61 A;  1S5L C;  5JLV C;  2L7K A;  1ZQ3 P;  2O8K A;  3WNB A;  4A3I J;  2HXI A;  1LQ1 A;  2QF7 A;  4DGW B;  3WTS C;  3MCZ A;  2Z33 A;  2JIZ A;  1AWC A;  1I7P A;  2QTL A;  2QVO A;  2G9W A;  3FXM A;  2ZFU A;  2R7T A;  2E1N A;  3S1Q J;  2LG4 A;  2VKH A;  4LLL A;  3F3X A;  3DKY A;  2R6H A;  4MQ9 F;  4PFO A;  3KYL A;  1N0U A;  4L0Y B;  1FNM A;  1MMA A;  3IWZ A;  2MA3 A;  3B82 A;  4RB1 A;  2YU9 J;  1LLZ A;  1R5O A;  1WMR A;  3M1E A;  1TLL A;  3K4N A;  5DYM A;  3JTH A;  1IDK A;  3FM3 A;  2EFG A;  2YWH A;  1QG0 A;  1JUP A;  3JQP A;  4D5C A;  3VYT B;  3VPR A;  5C1E A;  2O1D A;  1EV7 A;  2ZZE A;  2ECB A;  2VOP A;  3FK6 A;  3QPT A;  1JUS A;  5F0H A;  4XRF A;  1ZGW A;  4XK4 A;  2NTB A;  2GQQ A;  3WTT C;  1N78 A;  3D26 A;  2JVG A;  5L3E A;  1RET A;  2PMD A;  3H5N A;  1Z91 A;  4AC0 A;  1MNM C;  1SVO A;  4FX0 A;  4DZP A;  1R9T J;  1DDI A;  4HPQ A;  4CA0 A;  3GFI A;  1BC7 C;  5IT9 Z;  3BJA A;  4E0F A;  2DA6 A;  1QZZ A;  2RGV A;  3W5V A;  4PCQ A;  2YS9 A;  2HU9 A;  3GTQ J;  2J5O A;  2M45 A;  5B5E C;  4TKO B;  1V5G A;  1B8I A;  4QPQ A;  2P5V A;  3NAR A;  3F23 A;  1HW1 A;  4P3I A;  2BVM A;  3J81 K;  3RKQ A;  3WGG A;  1SFU A;  4KFC A;  3OWT A;  2M2E A;  4A69 C;  2AO9 A;  4ZDL A;  4L9V A;  1K6O A;  3REO A;  5FB2 A;  2Z8G A;  4B3F X;  4M3D A;  2ESH A;  4OPO A;  3WND A;  1HXD A;  4BQQ A;  2LD5 A;  2CJJ A;  1KU3 A;  3SUC A;  1V5E A;  5EG0 B;  4E7S A;  2KKO A;  1APL C;  5E3M A;  4Z6Y A;  4PJM A;  1GAW A;  5ICE A;  4TMW A;  1QCX A;  2L3D A;  2OK8 A;  1BX1 A;  3CCM B;  2K27 A;  4XON A;  4XOP A;  4HNV A;  3G1O A;  3U2R A;  3V8L A;  1YQA A;  3A8K A;  4M73 A;  1B9M A;  1GQ8 A;  2HKX A;  5E20 A;  5FRM A;  2D1H A;  2BSP A;  1ETV A;  3F8N A;  2XAH A;  4BXF A;  1RWR A;  4X6A J;  1CQT A;  1GUU A;  2MBF A;  4HNU A;  1J9Z A;  1DDG A;  3OL3 A;  1IA5 A;  2YX7 A;  2YUS A;  1B9N A;  1FBS A;  3BCA A;  1W2B B;  2ZXW H;  2QN6 A;  3IRQ A;  3TOB A;  2ZSI B;  1BN5 A;  2NAZ A;  4D0P A;  2P7C B;  3U6B A;  3VSV A;  1LPQ A;  2LBF B;  1MH4 A;  2ZTG A;  2Y48 A;  4RM0 A;  1XTA A;  4DNC A;  2FUG 2;  4IO9 F;  2BF4 A;  4E6K G;  3OS1 A;  2A6E F;  5J1Y A;  2KDO A;  4L9N A;  1W7P A;  4G1V A;  3Q6R A;  2RQQ A;  1EKE A;  3WG7 H;  3SJZ A;  3SEQ A;  1W0T A;  1VQL B;  1BMF A;  1LEA A;  1FBU A;  2QCO A;  2L9N A;  3OJX A;  4RDJ A;  4J00 A;  2DOF A;  5F6F A;  2XAU A;  2ZTN A;  3ABT A;  1LLW A;  2XT4 A;  2DA3 A;  4ON0 A;  2HQA A;  2B63 J;  1J2X A;  2X3U A;  1R1V A;  4RD3 A;  2QZA A;  4XBF A;  2E1M C;  4RB3 C;  4ROX A;  4I09 A;  2WAF A;  5K5O A;  4AM3 A;  2PYH A;  1WI3 A;  3I9V 2;  2QQ9 A;  2YSR A;  1LE8 A;  4UZE A;  4RPB A;  4QUZ A;  1Z05 A;  2CYY A;  1JHH A;  3M8E A;  1DPR A;  4I02 A;  4A3B J;  2DYR H;  4RD1 A;  3DDY A;  4YHB A;  1E1R A;  3KP6 A;  3R60 A;  1LB2 A;  3SZE A;  4M1K A;  3I0T A;  2ZL7 A;  2X0L A;  2XGJ A;  1SKY B;  4WXH A;  5JBQ A;  2ZKZ A;  2F5C A;  5C1C A;  4GDF A;  1HSJ A;  2DMN A;  2VQH A;  1SD6 A;  2I1L A;  1TT5 B;  4QHY A;  4LG0 B;  1Z7L A;  3Q5F A;  2VQL A;  3P5J A;  2FSW A;  4DNT B;  3BPX A;  3VNV A;  3LSG A;  2WZN A;  2KFD A;  2DLL A;  4PDK A;  1BOB A;  3VFZ A;  3ZQH A;  4IHS A;  1WJA A;  2XKO A;  3S2W A;  4BQN A;  3OZU A;  5D5V B;  4GYG A;  1OGI A;  4UXN A;  3AK5 A;  5M3M J;  1JT0 A;  1LM1 A;  2XAG A;  3FK7 A;  3HOS A;  2RC5 A;  4C30 A;  1OFE A;  1Y39 A;  3OYN A;  1U0J A;  2DTR A;  2H09 A;  5IOZ A;  4DYQ A;  4ENN A;  4CDG A;  1NG6 A;  4OIQ F;  2OJE D;  4U4B A;  3ZBT A;  4DYR A;  3BC9 A;  5GV7 A;  3FBI B;  1VJS A;  3H0D A;  1OCP A;  5M3F J;  1ONV A;  1X1P A;  2CMP A;  4HLY A;  2XOK A;  2ELJ A;  1O3Q A;  3B78 A;  2OZ6 A;  4Z4Y A;  5D8L B;  2DU9 A;  4DZJ A;  2HCJ B;  2FOK A;  4HF0 A;  4MR0 A;  2XB5 A;  3GTL J;  4KIC A;  2DK5 A;  2FBI A;  5DCM B;  4RCZ A;  2WJY A;  3ISP A;  2WAE A;  3GTP J;  3FBN B;  4XD7 A;  5KVR A;  1K83 J;  1QUE A;  3A03 A;  4ZZD A;  3B8H A;  4X07 A;  4IF4 A;  1F36 A;  2LY1 A;  2R4G A;  2EBI A;  2CW0 F;  2QSG X;  1OYW A;  2J5P A;  2L5Q A;  4KT6 A;  3WGH A;  3ONY A;  1YOV B;  3KRG A;  2QLZ A;  3HRS A;  4A6D A;  3FXO A;  2VOO A;  3LAJ A;  2MD0 A;  4WF2 A;  1R4M B;  4XLC A;  1TP4 A;  4A3J J;  2STW A;  2BVL A;  3K4B A;  1XD7 A;  2DEU A;  2COB A;  2VI6 A;  2LKS A;  3LOC A;  1VFC A;  1J5Y A;  3OYF A;  4AVP A;  3S16 J;  1VQ6 B;  1QJV A;  1NG7 A;  4XOT A;  3LST A;  2OQR A;  3LSR A;  4OAZ A;  3SJP A;  4IHW A;  4BEH A;  2DA5 A;  4ZYD A;  2FU4 A;  3A2K A;  4XN3 A;  1E64 A;  2F3L A;  2IT0 A;  1VQN I;  4I0B A;  3GZ6 A;  1AHD P;  4C2M J;  4LG0 A;  3HOV J;  2QQB A;  1YIT I;  3LSJ A;  2CU7 A;  2PJP A;  3PNY A;  2FBK A;  1W34 A;  3MKY B;  5EYR A;  2DYI A;  4P25 A;  2JJ7 A;  3HOU J;  1YLO A;  3H1C A;  3KYD B;  2COM A;  2ME0 A;  5E18 F;  4RBO A;  5CVI A;  3BWG A;  5KSW B;  3CC4 I;  2DIE A;  2L02 A;  4U0V A;  3U1K A;  2X6W A;  1FC3 A;  5L46 A;  2P4W A;  4A5M A;  3K6G A;  1IO2 A;  1DP3 A;  1MJB A;  3VMW A;  2O6G E;  2HXO A;  4MIM A;  2EFQ A;  5F04 A;  5FJ8 J;  4A3M J;  4JMQ A;  2XHK A;  2DJN A;  1ZAR A;  3E3V A;  3SEZ A;  3VB2 A;  5F0F A;  1KA8 A;  5D4S A;  4BAC A;  1SKQ A;  2L7Z A;  1BI3 A;  3BG5 A;  3HM5 A;  3S32 A;  3CUQ A;  2D3N A;  3W5H A;  2GZW A;  2D2W A;  1XSX A;  5HLH A;  1X1C A;  4E7Z A;  2IS4 A;  2MG4 A;  3WY9 A;  3MKZ A;  1IJF A;  3H5R A;  2YWG A;  1UG2 A;  5K7Z A;  2B0R A;  3AVY A;  4M9S A;  2BGI A;  2NTP A;  1K78 B;  4JK1 X;  1HDP A;  3SZP A;  2KP6 A;  4QWQ A;  3HOY J;  2ZNY A;  5C3E J;  2OZU A;  4FK8 A;  1VQ8 B;  2DFI A;  1J0R A;  2MH2 A;  4YCQ A;  2EPF A;  3LNQ A;  2IS1 A;  5K7H A;  2XEX A;  2P6S A;  2DER A;  2X53 S;  1E3Z A;  3PM1 A;  1G7C A;  3DCF A;  3ZQ7 A;  2A6H F;  4I0A A;  5JVT A;  3SJM A;  3T56 B;  1Q82 D;  1OKR A;  1UHM A;  2HVQ A;  3FXR A;  3R0J A;  4ZTJ A;  1GVH A;  3RKX A;  1S72 B;  5KNL A;  2M7A A;  2UUZ A;  3LA3 A;  1BI2 A;  1ETQ A;  5EJC A;  3BDD A;  2EV6 A;  1BC8 C;  2VLA A;  1TL8 A;  1G7T A;  1MBH A;  1D1N A;  2V1N A;  4DIQ A;  1O8L A;  2JTV A;  3KP4 A;  3IH2 A;  3GVL A;  1M1K D;  1BR2 A;  1G3S A;  2R93 J;  4BDY A;  1K4T A;  4P5O A;  3BG7 A;  4ZJZ A;  1BM9 A;  5IYN A;  2D1V A;  2PBI A;  3E0J B;  3NAU A;  1SD5 A;  4G7W A;  2N8G A;  3SY2 A;  5GAH J;  2VON A;  4II2 A;  1GXP A;  1Z6T A;  2XDV A;  2VC0 A;  4N4N B;  3PL8 A;  4RGX A;  3ZQF A;  3K70 C;  2UZK A;  2E1O A;  1UD8 A;  4ZZL A;  2DMU A;  5GTI C;  2ZC2 A;  1ZH5 A;  5IYD J;  1D1C A;  2E35 A;  2M3A A;  4QSH A;  5D5U B;  4A3F J;  1NK2 P;  1FIP A;  1TQM A;  3K2Z A;  4UVC A;  3BQJ A;  2JZY A;  3ZMT A;  3J7A Y;  5DSZ A;  2GA1 A;  2PJR A;  3CCR B;  3QPH A;  1H0M A;  5M5X J;  3BNW A;  4OOS A;  4Y17 A;  2MYS A;  3H09 A;  1HA8 A;  1OJL A;  3JU4 A;  2RQP A;  3TP0 A;  3CJR B;  4ASN A;  3NRV A;  1F5T A;  2VBS A;  1FIA A;  4ZCM A;  3BR2 A;  1C0W A;  4GCV A;  4FAS D;  4G9Y A;  1BPL A;  3E6D A;  4XLE A;  3CME I;  4PC7 A;  4AID A;  4O3M A;  1KC8 D;  1TNT A;  4D7M A;  4E7I A;  2EJR A;  1T39 A;  3SZT A;  3ZN0 A;  3OY9 A;  1WSR A;  1FND A;  3LA2 A;  3U9G A;  1HKS A;  4X06 A;  1FOY A;  1SMY F;  3KEQ A;  1I6H J;  5D6E A;  2KZG A;  3W2H A;  2QY1 A;  1QRY A;  4H4K C;  1M1E B;  4DJA A;  3S1R J;  2GM4 A;  3WXM A;  3MZY A;  1UD3 A;  1KQS B;  1CQX A;  2DYS H;  1O7F A;  2ZB9 A;  1YTY A;  1KCC A;  2H8W A;  2LYC A;  4NQW B;  1TYX A;  4PC2 A;  1HLV A;  3ONQ A;  2B9S A;  4HDU A;  4HRI A;  1H8E A;  3GTG J;  3U21 A;  3CMA I;  1O3T A;  5A89 A;  1YO5 C;  1X58 A;  2NS0 A;  1MW7 A;  3OYG A;  1WZ2 A;  1XCV A;  2R7F A;  3R6J A;  2JT1 A;  2EWN A;  3BCD A;  3GME A;  4OPV A;  3D5R C;  2MC4 A;  3KP5 A;  4N9I A;  5K5Q A;  4CYC A;  1E3X A;  2QE7 A;  4BXU A;  4QVA A;  3LSI A;  5THX A;  3ZZT A;  2WC2 A;  1XCB A;  3I5U A;  3RKW A;  4QIW N;  3K2A A;  1ZN2 A;  1D1B A;  2BHY A;  1E3H A;  3PO2 J;  2UXX A;  2IS6 A;  1HG8 A;  2R7Q A;  3PUM A;  4UUV A;  3TP3 A;  3E5U A;  4M3F A;  2XZP A;  1B6A A;  3CP8 A;  2NVU B;  3WU2 C;  3MD2 A;  5H5J A;  2Y0S N;  3FKJ A;  3ZN1 A;  1R71 A;  1OGJ A;  3HYI A;  3BZ6 A;  2VBU A;  1BIB A;  3PSZ A;  2EIJ H;  2AXL A;  2EFN A;  5TV2 A;  4BGD A;  2W25 A;  5TGT A;  2M9H A;  2LC2 A;  4S05 A;  4EEF G;  2GAU A;  5M5W J;  4NBQ A;  3OFN A;  3KLO A;  3V7C A;  2R7S A;  2VIX A;  1GV5 A;  4ITV A;  3PIO F;  3LO8 A;  3BR5 A;  5CLS A;  1UST A;  3QU3 A;  3EYI A;  3BC8 A;  1JKO C;  4LB5 A;  1VQ4 I;  3E5X A;  1TTT A;  3N90 A;  2BHZ A;  3ZR8 X;  4YZQ A;  3O2P E;  4EGY A;  1U5T A;  3AG3 H;  2X1D A;  5FO0 A;  2XRN A;  1FRN A;  2WWY A;  4P9U A;  3OL4 A;  1TYU A;  4UNO A;  1HBX G;  1U2W A;  1X1B A;  3KCC A;  2VC1 A;  1WP6 A;  2V7U A;  1I6X A;  2VQC A;  2ZZF A;  4TN1 A;  1ELO A;  4EJV A;  3JSO A;  4XQF A;  2W57 A;  2B7E A;  1IJW C;  1Z21 A;  2LVS A;  5IYB J;  2JA5 J;  2OBT A;  1FNC A;  5HDN A;  2JPC A;  3IC7 A;  4I6Z A;  4LK1 F;  3HB9 A;  1FP2 A;  4HV5 A;  4BJT A;  4OZY A;  1EFC A;  5FGM A;  1MNE A;  2FE3 A;  2HQN A;  3JCU C;  2WY8 Q;  4BE0 A;  2HNH A;  1CNF A;  1PJ7 A;  3MMP A;  4F7D A;  3K0L A;  2EA2 A;  2NSP A;  2VFO A;  5BPD A;  1D3Y A;  4G94 A;  1RR8 C;  4FIS A;  3RPU D;  2Z16 A;  2A5Y B;  4DK0 A;  4KJZ A;  1TT0 A;  1VQO B;  4HV6 A;  3HPG A;  4U49 A;  1B59 A;  3OKX A;  5EZH A;  4WX9 A;  1UD4 A;  5F4M A;  3G4S I;  2OD5 A;  2VBZ A;  1RC9 A;  1K5C A;  4BXX J;  3ESW B;  3ZUG A;  5IYQ A;  2O04 A;  1QFJ A;  5E1W A;  4PSX A;  1GR1 A;  2KRC A;  2OTL I;  3HTU A;  4IHY A;  3I1F A;  4AF6 A;  3AG4 H;  1VLY A;  1BJA A;  1T6S A;  5D6F A;  2INV A;  1FJL A;  1TYV A;  3F6V A;  2QZ8 A;  5H2F C;  2WAQ A;  3HHH A;  1V0F A;  4AVZ A;  2NXN B;  2K5C A;  3DEE A;  3ELK A;  1WJ5 A;  1OGM X;  1H42 A;  2CQX A;  4IL6 C;  5F4O A;  4CH7 A;  4M3B A;  1DDN A;  3ZQL A;  2O03 A;  1FYM A;  4F52 A;  3M4O J;  2P5K A;  3ERE D;  3W5U A;  4PJ0 C;  1W36 C;  1YYV A;  4YFK F;  1HST A;  3CCV I;  5H59 A;  1UHW A;  1MAB A;  3KEY A;  3W2F A;  1R5H A;  3CMM A;  1H9T A;  3EYY A;  4HQM A;  3M7G A;  1E43 A;  4E7J A;  2R5Z A;  2R7V A;  3GLL A;  1F1Z A;  1PYV A;  4XRM A;  1EFT A;  4UVA A;  3G3Z A;  5J6X A;  4CGZ A;  4ENK A;  3GTO J;  4JX6 A;  1ZM3 A;  5TY0 A;  4F7Z A;  3MFK A;  1N0V C;  3JW4 A;  2E2I J;  3L2C A;  3SLD A;  4OOX A;  1PJR A;  2DCE A;  5DUK A;  2XKP A;  4PMH A;  3HBL A;  4XNF A;  3PUN A;  4YXW A;  3CMY A;  1IGN A;  4Z03 A;  2BE5 F;  2B5O A;  2F1M A;  4E70 A;  3OYB A;  4LFU A;  4Z4Z A;  3MMY B;  4ZC3 A;  2BM7 A;  1OIS A;  2O3F A;  1ZTR A;  4G12 A;  2BM0 A;  1LFB A;  2HR3 A;  4OOI A;  3WTZ A;  2Z1D A;  3ULQ B;  1K4S A;  1KK3 A;  3ML3 A;  3WTU C;  1SD7 A;  4NC7 A;  2W6I A;  1P4A A;  2TRT A;  4C2U A;  1VND A;  1X1D A;  2A68 F;  2HFH A;  3C3W A;  4BYY A;  4TMZ A;  2X51 A;  4KNY A;  3WE3 A;  5J8C A;  3FKI J;  2CG4 A;  1NBM A;  3DBH B;  4FWT A;  2JSP A;  1H9G A;  2JMW A;  1S7E A;  4BAY A;  4CIC A;  1DBG A;  1G59 A;  4HE5 A;  1JUM A;  3GQA A;  3IH3 A;  2NNY A;  4AD9 A;  4UY8 I;  1JT6 A;  1ORK A;  3HIF A;  4RAZ A;  3GO5 A;  3SDB A;  2WV0 A;  2XPV A;  5DM6 F;  2WPD A;  2V9V A;  4YII A;  4F91 B;  1KK0 A;  4YZ0 A;  1VF9 A;  1SEU A;  4UUT A;  5A8A A;  2KIF A;  3BG3 A;  3QAH A;  1F20 A;  5E17 F;  2Z2S B;  5CPR B;  5J1U A;  4JYK A;  4KYW A;  2QA4 I;  2NPF A;  1GHC A;  1B72 B;  2BM1 A;  1IN7 A;  3OSG A;  4RLQ A;  3OYD A;  3DLA A;  3CCM I;  2RC6 A;  3PFI A;  1QGP A;  2M5W A;  3F0C A;  3ZOB A;  4CYD A;  4RJL A;  1VQ5 B;  2WB1 A;  2V7W A;  1YJN B;  4M3G A;  1S6L A;  1KYZ A;  2JRT A;  3A3B A;  4EM1 A;  2VJJ A;  2LK2 A;  3CD6 B;  3BZC A;  2H8R A;  1T38 A;  2GJR A;  4LMY A;  4P6V F;  3J7Y J;  1U3E M;  2VBM A;  1WOS A;  1UMQ A;  5LGT A;  2M34 A;  3R61 A;  4MFE A;  2ZJR F;  1EF4 A;  5EEA A;  4KDP A;  3GUD A;  1LDK B;  1QHG A;  3B6C A;  3LQ6 A;  5GAE J;  3TKY A;  1PUF B;  2CRV A;  1T56 A;  2BW3 A;  3G1L A;  3RQI A;  3GVA A;  3ISX A;  2B0L A;  3J81 k;  2QMU A;  4V02 C;  2F4I A;  3C2B A;  3P9K A;  4EVI A;  5ILU A;  1RRJ A;  5FFZ A;  4A0Y A;  5EDN A;  1XMA A;  3W6J B;  2XUB A;  1BJZ A;  2XRO A;  1K6Y A;  3HC7 A;  1JGS A;  3S93 A;  2K40 A;  1MBK A;  3EPZ A;  5K7F A;  1O3R A;  3Q0V A;  4F55 A;  2Z3Y A;  2NZM A;  4DYC A;  4ZH4 F;  4C2L A;  1AIP A;  4RD0 A;  1ZLJ A;  4CZC A;  1WQ2 A;  2HWV A;  2JN6 A;  3GSI A;  2L4M A;  3HUG B;  1BIA A;  3HZJ A;  5ICF A;  1GO2 A;  1XQB A;  3ZMZ A;  2Q6K A;  5AMV A;  4D9J A;  1ZRC A;  4G6I A;  1TWC J;  3AAF A;  4P2N A;  3BLY A;  4QV2 A;  2K9Q A;  2Y9Z A;  3F8B A;  2DT6 A;  1VQ9 I;  2F43 A;  1MMG A;  2IW5 A;  4MO7 A;  4IX7 A;  1QVU A;  2ZL5 A;  3VNU A;  1ON2 A;  1JI8 A;  3B73 A;  2ZCW A;  3C2G A;  3FMQ A;  5BNG A;  5LGN A;  4MXN A;  4WXC A;  4ZYH A;  5KCM A;  2HYJ A;  1B72 A;  3UR3 C;  1AKH B;  3PA1 A;  2BGC A;  3FHZ A;  4Y15 A;  1T6X A;  3KET A;  4BE2 A;  3CPX A;  2KHM A;  3IV5 A;  4JP0 A;  2F5F A;  4M74 A;  1CNE A;  3OR1 C;  2DPD A;  3ASR A;  4EJU A;  1BR4 A;  1Q86 D;  4HYE A;  3PSI A;  2RN7 A;  1CF7 B;  1MDM B;  1K79 A;  1XB2 A;  2E1R A;  2F4N A;  1POG A;  3BTJ A;  4M0L A;  1RPW A;  3BH7 B;  2X0K A;  3WHC A;  2VFQ A;  4MFD A;  1WCM J;  4JQF A;  1XE1 A;  2XSD C;  3ASP A;  2NST A;  1MIJ A;  2UXN A;  3HGY A;  4B47 A;  4XID A;  1PUE E;  4M9Z A;  2VBE A;  5FL7 A;  2ME6 A;  1G3Y A;  3PQJ A;  2BM6 A;  3KIO A;  2HKO A;  4M72 A;  2PE3 A;  5ERI A;  3OOC A;  3OIQ A;  2QYU A;  2KIS A;  4CHU A;  3OYC A;  2DW4 A;  3VSL A;  3BTI A;  2NNN A;  1Y1W J;  2QQA A;  4R1H A;  1SAX A;  1KU2 A;  1VZ0 A;  1H80 A;  2M5S A;  2HQ5 A;  2M8G X;  1VQP B;  1VHE A;  3ZPP A;  1YRN B;  2VUM J;  2UVE A;  1CGP A;  2AQE A;  5J8F A;  3JRD A;  3P26 A;  4EH1 A;  2VKE A;  5CYV A;  4E7K A;  4XSZ F;  2VBX A;  4LIU A;  3AVT A;  3VSK A;  3HUG A;  4IHV A;  2XC7 A;  4XR6 A;  5F27 A;  1AMO A;  4IOA F;  2HYG D;  3OZV A;  2E71 A;  2K9L A;  3VEP A;  4ETS A;  4ZGQ B;  3FY3 A;  3SQV A;  1SAU A;  1HW2 A;  1UCR A;  2RVC A;  1YI2 B;  3IH4 A;  1KRH A;  5FIU A;  1NHC A;  4BE1 A;  3OIO A;  4PZJ A;  3ES9 A;  2HTJ A;  2ZXI A;  4JOM A;  4W1U A;  3JRB A;  4ENJ A;  1T8I A;  1VQ6 I;  2EIK H;  4HE6 A;  4TT3 A;  3ZZU A;  1OR7 C;  1E2X A;  3DPT A;  4U9U A;  3CC7 B;  1FBQ A;  2WTE A;  4KMF A;  3H3V K;  2IGM A;  2ZME B;  1JRG A;  4YEL A;  5AIP A;  2DPU A;  3HDD A;  3I53 A;  3QFS A;  3AST A;  2F5V A;  3MEX A;  3CJT B;  1QHH D;  1E0E A;  1KGS A;  2FMY A;  1Q9S A;  2NT6 A;  2PYG A;  3I56 B;  3DPU A;  1OCO H;  1CF7 A;  1PJ5 A;  3AG1 H;  5FKM A;  1DPU A;  4KMU X;  4Z4S A;  3L9F A;  2CW5 A;  4DW6 A;  2Z5U A;  1SFE A;  4UUS B;  5B6I A;  2HPI A;  5A88 A;  2FML A;  5GAG J;  1MRZ A;  2KIM A;  3KPH A;  3JUR A;  1NDH A;  2F6C A;  1QZE A;  2ZBU A;  3J81 Z;  3CUO A;  3ZQC A;  2X85 A;  4LIT A;  2GIZ A;  2GK7 A;  4LJZ F;  2V4D A;  5L3B A;  4L9T A;  1YX5 A;  3GWZ A;  2EFO A;  1WVR A;  2V1X A;  2K4J A;  3E5Q A;  1STZ A;  3CCU I;  2EFW A;  4CCO A;  2X8K A;  1D1A A;  4X05 A;  3L00 A;  1BN8 A;  2NT9 A;  2PMU A;  1S29 A;  1VF7 A;  2XPU A;  3TO7 A;  2CF4 A;  1YE9 A;  1YRN A;  2Z6B D;  4NNJ A;  5DDG A;  1HDD C;  3G1M A;  3OSF A;  2CK3 A;  2Q6O A;  5AN9 A;  4FHT A;  1KZH A;  4RDK A;  4B3A A;  1XDU A;  3WBK A;  2JUG A;  4AU7 A;  4RDU A;  5B1B H;  4MNU A;  3CCY A;  1RKW A; 
#chains in the Genus database with same CATH homology
 4TSF A;  3GVK A;  3K4L A;  1E79 A;  1UD6 A;  1TZL A;  2M7B A;  3I3L A;  4CCK A;  2CUZ A;  1DGR M;  1KON A;  4PJN A;  3HAG A;  4Y3O A;  1X4P A;  2IS1 A;  2X53 S;  1E3Z A;  2E5Z A;  3AKZ A;  4E7H A;  3IP4 B;  3T56 B;  1O8F A;  4W8Q A;  2HVQ A;  3FDY A;  4RMN A;  4ZTJ A;  5KNL A;  2M7A A;  2UUZ A;  2KQR A;  4P1W A;  1Y6I A;  1P9Q C;  3B90 A;  4NC8 A;  2VLA A;  3BH4 A;  2IXS A;  1MMN A;  2V1N A;  4AYB A;  4DIQ A;  2VJ5 A;  3HPH A;  3AL0 B;  3FPP A;  2M4K A;  3A35 A;  4G7X A;  1DBO A;  1O8L A;  3GVL A;  2ZXH A;  1S9H A;  1BR2 A;  3H5A A;  2HDW A;  3RCO A;  2HVR A;  4OJ6 A;  4BDY A;  5CDF A;  4P5O A;  3G2B A;  3BG7 A;  2W00 A;  4ZJZ A;  4ZTF A;  3E0J B;  2VJ4 A;  4F92 B;  4G7W A;  3CZ6 A;  3L2V A;  1Z3X A;  1N77 A;  2VKD A;  3OEE A;  4II2 A;  3K4K A;  4KKT A;  2XDV A;  3PSF A;  4N4N B;  1UD8 A;  3PL8 A;  3S3O A;  3K70 C;  2XF5 A;  3EUA A;  2OC6 A;  2E60 A;  3GQB A;  3OYH A;  1D1C A;  2XZO A;  3VYS B;  2M3A A;  4KKU A;  4XKC A;  4LIV A;  3J7A Y;  2R7U A;  3DTE A;  3VYR B;  2QKL B;  4CCM A;  2PJR A;  3A3G A;  1WJF A;  1W0K A;  3OEH A;  2M4G A;  3S3M A;  3CJQ B;  2LBF A;  1FMV A;  2V7F A;  1O88 A;  4RM2 A;  2MYS A;  1HA8 A;  4LG3 A;  3G05 A;  3JU4 A;  2DT7 B;  3CJR B;  4URR A;  4IZZ A;  4FAS D;  2X3H A;  1BPL A;  3OPO A;  4XLE A;  5CQE A;  2EWE A;  3TL4 X;  3ZPN A;  3EQN A;  3CES A;  4E7I A;  4DBQ A;  3BCF A;  3OR2 C;  3OY9 A;  2R7O A;  3QYF A;  2RNG A;  1D0Z A;  2CV0 A;  2JVH A;  4N4O B;  5HNF A;  2QY1 A;  4HG2 A;  2K9M A;  4H4K C;  3OS0 A;  4DJA A;  1UD3 A;  4HWV A;  4XMY A;  1KCC A;  2LYC A;  4FET A;  4NQW B;  5HNH A;  1LFP A;  3ONQ A;  1H8E A;  4HEA 2;  3TBI A;  4HRI A;  3U21 A;  4XM3 A;  3UNG C;  2BW3 B;  1MW7 A;  3OYG A;  4B3G A;  3FHN A;  3DU6 A;  3BCD A;  3OW7 A;  3D5R C;  3BG6 A;  2MC4 A;  2W1O A;  3GQ9 A;  3CF2 A;  4EAT A;  4RM3 A;  1E3X A;  2QE7 A;  2WA0 A;  3T9G A;  2E1M B;  3LSI A;  4CCL A;  2IS6 A;  1D1B A;  3IUO A;  1HG8 A;  2R7Q A;  5JHF A;  4Z06 A;  4XKV A;  2XZP A;  3CP8 A;  3OMY A;  3MD2 A;  2VAS A;  2NTQ A;  3T51 B;  3FKJ A;  2IGO A;  3IAM 2;  5HVQ C;  2GJP A;  1OB0 A;  1UD2 A;  1WJC A;  3OYM A;  3VDX A;  1AIR A;  1W0J A;  4OJ5 A;  3W2W A;  3QYE A;  4CUG A;  3PNV A;  4BS9 A;  3AFH A;  4BGD A;  1O8D A;  5TGT A;  3OYI A;  2VJI A;  2LC2 A;  3K4M A;  3DKX A;  3S8P A;  3RTR A;  4G6T B;  4PK4 A;  3OFN A;  4YZX A;  2I8D A;  1EA3 A;  3LFU A;  3ZCO A;  5LFA A;  1HVX A;  3ZQQ A;  3OS2 A;  4NK8 A;  2LH9 A;  2R7S A;  2VIX A;  1X19 A;  4ITV A;  3BC8 A;  5HOO A;  4XLF A;  2KL4 A;  3WQZ A;  3ZR8 X;  4YZQ A;  2Q2E B;  2GK6 A;  2X1D A;  4BL0 B;  4GQN A;  1PXZ A;  3OL4 A;  1KMH A;  1X1B A;  1WP6 A;  4PJJ A;  3B8Y A;  3UW0 A;  2VQC A;  2LRE A;  5CKT A;  2ZZF A;  2KLO A;  2CW7 A;  4IQJ A;  4DK1 A;  1O8M A;  3LMW A;  4X0G A;  2QX3 A;  3L2Q A;  1E1Q A;  4XQF A;  2K3P A;  1T0F C;  1Z21 A;  2IGK A;  3LL7 A;  4ANJ A;  3M1C A;  3PJR A;  2R9V A;  2CUJ A;  3GQ7 A;  1Z3Y A;  4IQ4 A;  4PFP A;  4B48 A;  2XF7 A;  3HG9 A;  2XSJ C;  3GQ8 A;  1T5E A;  3OYJ A;  4BJT A;  4OZY A;  1UEL B;  1V0E A;  2CS3 A;  1MNE A;  3A1Y A;  4BE0 A;  2WY8 Q;  4C2T A;  2HNH A;  2LY2 A;  3NWT A;  3GRH A;  2NSP A;  4OAY A;  3ZXS A;  1W36 D;  4KKS A;  4IKF A;  4OJL A;  3RPU D;  1WJD A;  1WJB A;  2Z16 A;  4DK0 A;  3BCB A;  4KJZ A;  1TT0 A;  4U87 A;  2KRH A;  3HPG A;  3OYK A;  4U49 A;  4Y33 A;  4EW9 A;  1UD4 A;  1N75 A;  4BQO A;  1O8H A;  1K5C A;  2O0W A;  1MMD A;  1OGO X;  3LSK A;  4UZU A;  1X1A A;  1VBL A;  2O04 A;  2O0V A;  5CQG A;  4PSX A;  4E7L A;  4U7B A;  4HST A;  5KHD A;  2KRC A;  2OUM A;  1PKV A;  2KZV A;  3L2R A;  2XND A;  1O8J A;  2D3L A;  2VQG A;  1VLY A;  2INV A;  3LMM A;  3ZGK A;  2WAQ A;  1V0F A;  2IGN A;  4AVZ A;  2JDI A;  4L8J A;  2K5C A;  3DEE A;  4XN0 A;  3M8J A;  3SZG A;  1COW A;  1WJ5 A;  2ZSH B;  2VB6 A;  1H8H A;  4R79 A;  3K4J A;  1OGM X;  3VMV A;  4CH7 A;  5DN6 A;  1BR1 A;  3ZRG A;  4BDZ A;  2CV1 A;  4F52 A;  2L7K A;  1W36 C;  4BEH B;  2QKM B;  1MAB A;  1EE6 A;  3KEY A;  4DNR B;  2KMU A;  1YX3 A;  4DGW B;  4C9Y A;  3CMM A;  3GVJ A;  2JIZ A;  4OJP A;  4YZA A;  3HOT A;  4KIS A;  4B44 A;  2ZFU A;  4E7J A;  5LD2 C;  2R7T A;  2R7V A;  1E43 A;  1PYV A;  2INU A;  2LG4 A;  2VKH A;  3HL2 A;  1O8E A;  3DKY A;  1OFL A;  4PFO A;  3KYL A;  4XOR A;  3EUH C;  1MMA A;  3PUB A;  1MND A;  3DWL E;  1OLT A;  5HLT A;  2LOO A;  1KTW A;  1SFK A;  1PJR A;  2DCE A;  3V42 A;  3S3N A;  1WMR A;  2QXZ A;  4PMH A;  4XNF A;  4YXW A;  1RMG A;  3K4N A;  4Z03 A;  3VST A;  1IDK A;  2W4S A;  2F1M A;  1X4O A;  2X1C A;  3C2H A;  3VYT B;  1K28 D;  5C1E A;  2O1D A;  3OYB A;  3LNN A;  3MMY B;  4ZC3 A;  2ZZE A;  1OFM A;  1KCD A;  3VYU B;  2WZP P;  2Z1D A;  2R7W A;  1BLI A;  1RU4 A;  2NTB A;  3VWB A;  1N78 A;  1UG0 A;  2JVG A;  3CP2 A;  4NC7 A;  2O5R A;  4DBR A;  2E1B A;  3H5N A;  2W6I A;  3HKZ A;  3DTI A;  4C2U A;  3H9G A;  3W2V A;  1X1D A;  4BUP A;  2X51 A;  4Z05 A;  4ZDP A;  1X0C A;  4BJ6 C;  4HPQ A;  3W3C A;  4CA0 A;  2WJV A;  4E0F A;  1I18 A;  4W8T A;  1NBM A;  1IB4 A;  2Y0S A;  2JSP A;  2WY7 Q;  3SYT A;  3TMO A;  2JJ1 A;  2V31 A;  4I84 A;  3AL0 C;  1DBG A;  2HU9 A;  1G59 A;  2X6Y A;  3GQA A;  5HKK A;  4W8S A;  2MAB A;  2M0M A;  3DTK A;  2VPL A;  4TKO B;  1V5G A;  4QPQ A;  2A6T A;  3SDB A;  3D5S C;  2WPD A;  4F91 B;  2O17 A;  1AA7 A;  4YZ0 A;  1UD5 A;  3LSH A;  2BVM A;  3OWT A;  2PMZ A;  2W82 A;  4ZDL A;  3B4N A;  2Z8G A;  4HIZ A;  4B3F X;  2Z2S B;  3KX2 A;  3A4C A;  5CPR B;  4BQQ A;  1V5E A;  2Q1Z B;  3SUC A;  1JTA A;  4ZYA A;  4E7S A;  2V9K A;  4PJM A;  1HZE A;  3OYE A;  4RLQ A;  3OYD A;  3DLA A;  1QCX A;  2CH0 A;  3HXL A;  2RRE A;  4XON A;  4XOP A;  2WSS A;  2UVF A;  4XL9 A;  4ASU A;  1O8G A;  2HPM A;  3E1S A;  2WBM A;  1QU3 A;  2WB1 A;  4NUB A;  1GQ8 A;  5FRM A;  3A3B A;  2VJJ A;  2CV2 A;  4Z1M A;  2BSP A;  4XKB A;  2W7N A;  4BXF A;  2GJR A;  1RWR A;  2KVO A;  3QYB A;  4HNU A;  2VBM A;  3OL3 A;  3FKS A;  1IA5 A;  3BCA A;  1BHE A;  1EFR A;  2MFZ A;  4HNT A;  1WPC A;  1LDK B;  1QHG A;  2ZSI B;  2PJR B;  2BW3 A;  3VSV A;  2LBF B;  1OHH A;  2ZTG A;  2A5W A;  3LSM A;  2FUG 2;  2F4I A;  4E6K G;  3OS1 A;  3RQ4 A;  2KDO A;  4Y4R A;  2E5N A;  5FRO A;  2BOL A;  2VXD A;  4YEJ A;  2RQQ A;  1K6Y A;  3HC7 A;  3S93 A;  2ZZQ A;  2JA2 A;  3SEQ A;  4F3Q A;  1PLU A;  4YRV A;  3EPZ A;  2ZZG A;  2VXZ A;  4F55 A;  1IRX A;  1BMF A;  4PJL A;  2V7Q A;  2CFO A;  2NZM A;  2L9N A;  4C2L A;  2GOM A;  4J00 A;  1DQU A;  2XAU A;  4PSW A;  4CZC A;  2HVS A;  2ZTN A;  4BJ5 C;  1D0X A;  1LKX A;  2HQA A;  2WAD A;  3HUG B;  1ZEL A;  4ZDO A;  3EQO A;  4W8R A;  2E1M C;  5AMV A;  4D9J A;  2WAF A;  4G6I A;  2PYH A;  3BLY A;  3I9V 2;  3L2W A;  2HLD A;  2DT6 A;  3K4C A;  2F43 A;  1MMG A;  4NK6 A;  2V26 A;  4IX7 A;  4HSR A;  1JI8 A;  1OOC A;  3ZSC A;  4BU2 A;  3C2G A;  3MKW B;  2KPM A;  4MXN A;  3DDY A;  5KCM A;  1E1R A;  3UR3 C;  2DJI A;  2PEC A;  2L2O A;  3KEW A;  2XGJ A;  4BE2 A;  1SKY B;  2KHM A;  2AQF A;  4DOZ A;  5C1C A;  2V6E A;  3OR1 C;  1WJE A;  2P0W A;  2VQH A;  3NWS A;  1T95 A;  1BR4 A;  1Z7L A;  3DPL C;  3PSI A;  4XLA A;  4CSW A;  3OYL A;  2VQL A;  2R7R A;  3DU5 A;  4DNT B;  3LSG A;  1Y56 A;  1PE9 A;  2X1E A;  1BOB A;  4PUS A;  4OZZ A;  1WJA A;  4OWR B;  1D0Y A;  4BQN A;  2L9S A;  4JQF A;  1W9X A;  1NRK A;  3OYA A;  2HZD A;  4XKW A;  3HOS A;  3N05 A;  4OJO A;  4C30 A;  2NST A;  4B47 A;  3PFY A;  3OYN A;  3OOU A;  1U0J A;  2UV1 A;  3QOD A;  4CCJ A;  2VBE A;  5FL7 A;  1UAA A;  3IAS 2;  3OOC A;  1NG6 A;  4U4B A;  3OIQ A;  2XZL A;  4QPO A;  3OYC A;  3VSL A;  3BC9 A;  3FBI B;  1VJS A;  3H0D A;  2CMP A;  1VZ0 A;  2XOK A;  2ELJ A;  1H80 A;  1DGW Y;  2M5S A;  3ZPP A;  3WWG A;  4FXU A;  2UVE A;  4MR0 A;  2AQE A;  3OIP A;  1I8D A;  2X6X A;  2WJY A;  4E7K A;  1KZL A;  2OV7 A;  2WAE A;  2NOJ B;  4LIU A;  3FBN B;  3RSN A;  3VSK A;  2W6J A;  4XD7 A;  2XC7 A;  4XR6 A;  1ERD A;  3W2A A;  2LY1 A;  2R4G A;  3ZIA A;  2L5Q A;  2K9L A;  4GRI A;  4KT6 A;  2ODL A;  1FMW A;  3FY3 A;  3KRG A;  3H35 A;  4B43 A;  1SAU A;  3H9Q A;  2MD0 A;  2JJ2 A;  2DXI A;  4XLC A;  1NHC A;  3EUK L;  4BE1 A;  2BVL A;  3K4B A;  3GBG A;  2ZXI A;  4II3 A;  4JOM A;  1QJV A;  3OYF A;  4D1Q A;  4TT3 A;  3VSU A;  1OR7 C;  1NG7 A;  2GOX B;  4XOT A;  3NE5 B;  3DPT A;  3F9K A;  3VR6 A;  2IGM A;  3PNT A;  2LRD A;  4OAZ A;  4YEL A;  1JRG A;  4BEH A;  4MLO A;  3A2K A;  2F5V A;  1IDJ A;  4XN3 A;  2IS2 A;  1QHH D;  1E0E A;  1R6R A;  3OAA A;  2NT6 A;  2DOA A;  2PYG A;  3DPU A;  5FRN A;  1G8X A;  3H9J A;  3PNY A;  3D5L A;  1WTH D;  3K10 A;  3MKY B;  4F93 B;  3L2U A;  1FX0 A;  4XLH A;  2XF6 A;  3DQV C;  2V4J C;  2HPI A;  4KIT B;  1WFX A;  2DIE A;  1V5F A;  2X6W A;  3JUR A;  1CZF A;  2F6C A;  4J01 A;  4E4H A;  3H94 A;  3K6G A;  2VL8 A;  2X85 A;  4LIT A;  2GK7 A;  1DP3 A;  3QOE A;  4B3X A;  2V4D A;  3VMW A;  1YX5 A;  4JMQ A;  5IK2 A;  3SEZ A;  4CCO A;  2X8K A;  1D1A A;  1GLN A;  4RLF A;  4BAC A;  4P22 A;  1BN8 A;  2IQ7 A;  2NT9 A;  2VBK A;  3S32 A;  2D3N A;  1J09 A;  1VF7 A;  4CCN A;  1YE9 A;  1LVK A;  2R7X A;  1X1C A;  4NNJ A;  4E7Z A;  2IS4 A;  2CK3 A;  2Z6B D;  1O8K A;  3T53 B;  3MKZ A;  2GJK A;  3H5R A;  2LZJ A;  3K70 D;  3OE7 A;  2JUG A;  2NTP A;  2CW8 A;  1O8I A;  4AU7 A;  1XG2 A;  2UWM A;  2KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...