4XONA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xonA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xonA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xonA02
1JRGA 2PECA 2PYGA 2VBEA 4MXNA 1RWRA 1OGOX 3VMVA 4W8QA 2O0VA 2QX3A 1JTAA 4XKVA 1O8LA 1PXZA 4YELA 1KCCA 4YEJA 1XG2A 2NZMA 2O04A 1O8IA 1O8FA 4W8RA 3VSUA 2BSPA 4OJLA 3VMWA 1BN8A 3EQOA 1O8GA 2NTPA 1K5CA 3GQ8A 4U49A 4YZXA 4Z06A 1GQ8A 4W8TA 2Z8GA 4Z05A 3ZSCA 4XLEA 1WMRA 5AMVA 2X6WA 4XLAA 1BHEA 1DBGA 4HWVA 3ZPPA 2O0WA 2INVA 3EQNA 3GQ7A 2X85A 2QXZA 4XM3A 4XOTA 4OJOA 4W8SA 2VBMA 3B8YA 1OOCA 1QCXA 1QJVA 4PMHA 2VJIA 4AVZA 1O8JA 1KTWA 1O8DA 3LMWA 2EWEA 4OJ6A 3JURA 4OZZA 3FY3A 1IDJA 1OFMA 4XR6A 2UVEA 1PLUA 3GRHA 1HG8A 4OJ5A 4XOPA 2O1DA 4XNFA 4XONA 2NSTA 2UVFA 4OJPA 2NSPA 4MR0A 3B90A 4XLFA 1AIRA 3VSTA 2NTQA 4XN0A 4XORA 2PYHA 1X0CA 3GQAA 3KRGA 1O8KA 2NTBA 4C2LA 2X6YA 4YZAA 3B4NA 1NHCA 2NT6A 4U4BA 1IB4A 4XLHA 1O88A 3WWGA 4NK8A 1H80A 1OFLA 2ODLA 1EE6A 1IA5A 1RMGA 4XKWA 2VBKA 4XQFA 2O17A 3UW0A 3SUCA 4XLCA 4XMYA 1RU4A 4XL9A 1VBLA 1DBOA 4YZQA 5C1EA 1O8EA 1OGMX 2IQ7A 1CZFA 4I84A 3VSVA 5C1CA 1O8HA 4XN3A 2QY1A 3T9GA 1PE9A 4Z03A 2INUA 1KCDA 2X3HA 3GQ9A 2NT9A 4OZYA 1IDKA 4URRA 2X6XA 4YZ0A 2VJJA 4NK6A 4EW9A 1O8MA
chains in the Genus database with same CATH superfamily
5DN6A 2HVRA 1VF7A 4RAYA 4RB1A 1R23A 4RB0A 4L5EA 3CF5F 4MXNA 4M3GA 2FD5A 5EF6A 4RD2A 2W4SA 3KX2A 3MAJA 3JREA 2MABA 1YJ9B 2I8DA 3LSIA 4CCKA 3G1LA 3LMMA 3QSYA 3IKTA 3QE2A 3CLOA 4HSTA 2WTEA 3EUKL 1N05A 1XG2A 4BAYA 2HQ5A 4UZFA 1R1VA 2QEXI 1TWCJ 4AM3A 4CCLA 1REPC 4A0YA 2DYIA 3VSUA 3CCJI 3WU1B 1EFCA 2JSPA 1VQLB 4BHPA 1QVGB 1IG7A 2DCUA 4PSWA 5DD4A 2VLAA 5FKKA 3F8NA 4FCYA 1XB2A 1N8RD 3GVJA 2ZJQF 1K79A 2IBDA 2YU3A 3FM3A 4A3IJ 3AL0C 2OC6A 1JB9A 1LDDA 3D5LA 4LITA 2QGGA 4V2GA 1QA1A 2VPRA 4IZZA 5IYPA 4TKOB 2QQAA 1ETVA 5DUKA 4TMVA 1IHMA 2OBSA 2L7KA 4PUSA 1FLIA 3BNWA 3OOCA 2WZNA 1GV2A 4MTDA 3OYKA 1OR7C 1WXRA 2HTJA 2UV1A 2QMUA 3LSPA 3V42A 1BJKA 4RDJA 4OIPF 1ELOA 2LTPA 1FZPB 3ZRGA 3E5UA 2K27A 3RIRA 4CO8A 4QLCU 1J59A 2XC1A 3W2HA 1GT0C 4HW0A 3TW6A 3AVUA 3QPLA 3ZQCA 5HNHA 3AL0B 4B44A 2ZKZA 1OOCA 3CRZA 4HNVA 1QJVA 4XRSA 2ETHA 4OOIA 2OU2A 2ZITA 3SLDA 3ABMH 3LA3A 5JHUA 3V8KA 2NS8A 2GXGA 2LY2A 3KYDB 3QFRA 1B8IA 2FX0A 1TT0A 3H3VK 2O1DA 1FP1D 2ZZGA 1Z77A 4Y7NJ 4KN4X 4XIDA 1T95A 1X1BA 2ACJA 5M5YJ 4ESBA 3W5VA 3VSTA 2A3SA 1MNEA 1QHGA 2NNYA 3ZCOA 4IHXA 2PYHA 2K85A 1ZREA 3WGIA 1FYMA 4ACAA 4IHVA 2MSYA 4O3MA 2CV2A 3T1BA 2VN2A 4RS8A 4M0LA 2MC3A 1P4MA 5KCMA 1W1WE 4XRSG 4A0ZA 4QVJA 1HC8A 4EM0B 4G5GA 1O88A 5IYBJ 1FDRA 1W34A 4DW6A 2RDPA 1H80A 4R79A 1A36A 3RZDJ 4A93J 1IA5A 3QWLA 4B4CA 1Y6IA 2IEKA 3C2HA 4V2FA 3TMOA 1X4OA 1ZKGA 4IL6C 2R4GA 3M4OJ 1LNWA 2EFQA 1ZTRA 3WTUC 4HX4A 3HOVJ 3NARA 3BH4A 3AVWA 2CJJA 4X07A 1K8FA 1B72A 3U21A 2A05A 2XIGA 4E0FA 3OR2C 1XX5A 3QQAA 1S8NA 3QPHA 4M2LA 3CJQB 3L2VA 1S72B 3V76A 1JJ2B 5K5OA 5KVRA 3MKLA 3WTSC 3WU0A 1IN4A 5CVJA 4L5IA 4PGHA 1U8BA 1IDKA 2GOMA 1WOSA 4OAZA 5B1AH 4AYBA 1YO5C 3SXYA 3WTTC 3ONQA 5F4JA 2V4JC 4BE2A 4CCJA 2PECA 3JX8A 4PDKA 3L2UA 4IQ4A 5DNSA 1RR7A 3KP4A 1ZLKA 3H35A 1CQXA 2OQRA 2BV3A 2OCEA 3U6BA 3A1PA 1VQ7B 2XGJA 3Q9VA 4UAJA 2IA2A 3G4SI 2AS5F 2IS2A 1QHHD 4ENJA 4EJVA 1T98A 3LQ6A 4K1XA 2QGUA 5IYCJ 3SZGA 4HNUA 4KITB 1W0JA 1USSA 4XRMA 1QFZA 1WGXA 1WFXA 4Y33A 3DWLE 3QYBA 3U9GA 1JUSA 2HLDA 2BSAA 1VTNC 1UCRA 3EQOA 2LK2A 5FL7A 2V7WA 3CCVB 3B02A 2LBFB 5E1WA 1O8GA 2UUZA 3TEDA 3S1MJ 2YWGA 3OZUA 2JA2A 1NJID 4BQQA 3RJPA 1FSEA 3DF8A 2WA0A 3BTJA 3KLOA 3PUMA 3KZYA 3R6JA 2BMWA 2CQKA 4MO7A 2BVLA 3FHNA 2LY1A 3FXJA 2Y69H 1LVAA 1FBSA 4A3KJ 1SC7A 1AKHA 1N08A 5H20A 1HW2A 4Y9UA 4Q7JB 1MBFA 1JKRC 1I1GA 1WP6A 2CNDA 2IGMA 4BBSJ 2M3AA 4J19A 2KVOA 2M5SA 1ETXA 1YIJB 2IPQX 3CMEI 3F9KA 2XZPA 5AMVA 4L9NA 1VQPB 2VONA 3KL9A 2QBYA 4V19K 4OZZA 2C4UA 1E3HA 3H0GJ 2IS6A 3FY3A 2QSFX 5D5VB 1N78A 1Y8QB 4HE6A 2B7CA 4WX9A 3DQVC 1HG8A 2DFHA 3PO2J 3ECHA 4OJ5A 4EJWA 1VQ5B 3HEFA 2CF4A 1JUPA 3F0CA 3CC7B 2NSTA 4MR0A 2V6CA 5C44J 4GXOA 4NCNA 3DEUA 2VBWA 5FRNA 3QFCA 4HLYA 3H92A 4ZZDA 3RIQA 5JMCB 2QYOA 3HTUA 1RC9A 2XTYA 1F5TA 5KNLA 1X58A 3W2VA 3GFMA 2DU9A 4U9UA 2VKDA 1TYUA 2XPWA 1IB4A 1FTZA 2Y30A 4G7OF 2Q6KA 2VFNA 1WORA 3FJOA 4YAOA 3W2GA 1QVUA 4BQNA 3J80K 2ODLA 4HZFA 4WK8F 1QGZA 1O57A 1N75A 3PUNA 4IRGA 3I4NJ 4NC8A 2XEXA 4G7ZF 3REOA 3BY2A 2HDNB 1TWHJ 1IZ1A 1BC7C 2XKPA 3VR6A 1VQ8B 2D5VA 1BMFA 2LYCA 2M8EA 4YZQA 2F3LA 2DEUA 3BCBA 1BN5A 3FMRA 3IH2A 2QWWA 1QZZA 4KT6A 1Z05A 3HSRA 2QF7A 3F6OA 1O8HA 2M30A 2C78A 3PL8A 2P3MA 2EFPA 4WZKA 2RNGA 4HLXA 4HBLA 1WJBA 3ZQGA 2DMPA 4GFBA 4HF1A 4PABA 3VSLA 3L2WA 5HLHA 3QU6A 3LSHA 1GUUA 3CO7C 1DU0A 3I55I 2KKOA 3FXOA 1D1NA 3MWMA 4N0BA 1WJCA 3K4MA 5BQTA 4L0YB 1AOYA 1W0TA 3LA2A 1I50J 3WGHA 4AIDA 4W8QA 2WADA 5L3FA 3SLNA 2HPMA 4KNYA 4OU0A 3IV5A 1TQPA 2MD5A 4IJAA 5ICFA 3H0DA 2VBUA 3ASRA 2HXIA 4DBRA 2E19A 5D5UB 2WPDA 1YW9A 3BR0A 1RUOA 4IHSA 1X3ZB 2EIMH 1HDPA 1JE8A 2ISYA 3H09A 2BSPA 2AXLA 4C3IJ 2VUMJ 3CD6I 5C4XJ 2JT1A 2HI3A 2R7XA 4CYCB 1K5CA 3FZVA 1K4ZA 2F1MA 2L9NA 2EFGA 1VQ8I 3G73A 2WJYA 3LOCA 2DODA 3FK6A 3LQRA 4E4HA 1RQPA 1GQ8A 2D2WA 4XLPF 2MFZA 3P4GA 2MLGA 2HDWA 2V9VA 3RPQA 1OB5A 2X1DA 4KYWA 2VNKA 2DO7A 1GO2A 1ZH5A 2NVUB 1G3WA 1QZEA 1HF2A 4BACA 1V4RA 4A5MA 2R0QC 2ME6A 5J8CA 1TWGJ 3QYEA 1OFEA 4DBQA 2X85A 1L3LA 1IN8A 1APLC 3A8JA 2R5YB 2B9SA 1O7LA 3CDIA 3BZ6A 1W2BB 1QCXA 2ZJPF 4B3AA 4CCOA 2K4BA 2QENA 2XAGA 3CC4I 1UHWA 4OMYA 4C30A 1ITYA 4EEFG 4CXFA 1TL8A 4Z4UA 3S2WA 4FISA 4KIGA 4RD3A 1XN7A 2GZWA 1F36A 3HSFA 3E3VA 5HODA 4TMZA 3HPHA 1QRYA 2Y2ZA 3H5AA 4WXHA 1TW3A 2DK5A 3HOZJ 2FUG2 3KCCA 1NB9A 5HXBA 1FTTA 4XKCA 2DAOA 3C2BA 3VB2A 1P7JA 4J01A 4ZTJA 4EJUA 3PO3J 1B8IB 2Q6LA 2R7OA 2DOGA 3GLLA 2GJRA 2HEOA 2XOKA 2OBTA 2KP6A 5F04A 4G6TB 4PJ0C 1Y1WJ 1IRFA 3VYTB 3S15J 4IVNA 1W5CC 3GWZA 4UVBA 1DG1G 3LWFA 5B5EC 1G3SA 4IHWA 4II3A 3GF2A 2PG4A 3IWZA 3TGNA 4NHJA 5CQGA 1TQIA 3SEZA 2BBYA 3KFWX 3O8HA 4HV5A 4CH7A 1YHQB 2B0RA 3ZMUA 4HPQA 3DU6A 4LB6B 2VBKA 2X1CA 3D5RC 2KLOA 1RU4A 1KZHA 1E3PA 2OBRA 3QOEA 3DPLC 3CDHA 1NG6A 3KPHA 1T38A 4G1VA 1EWYA 5H59A 2A61A 2HYJA 3KIOA 5EG0B 3TDZC 4NBSA 3R0AA 4PFPA 1GVDA 3JAMK 2PLYA 3ML3A 3V7SA 5HS7A 2CYYA 1TP4A 3HHHA 1MNDA 3A0BC 2V9KA 4UVAA 1YX3A 2MD0A 4YIIA 2FQ4A 5EYRA 2IS1A 2EBIA 5FGMA 4EGZA 1JI8A 4X8IA 2DXIA 3WG9A 5F0HA 3BG7A 2XUBA 2GWRA 4RDUA 2W7NA 1JTYA 1WJDA 2M7AA 5EEGA 4RMNA 1IGNA 5FB2A 3CCJB 2D9RA 2PYGA 1XDSA 1H0MA 1UMQA 2DMNA 1P92A 1E3XA 1UELB 3WXMA 2JPBA 3J7AO 1K73D 3K7AJ 2EIXA 4X06A 1PXZA 4DYQA 2N8GA 1MABA 4BDYA 2CUEA 1JT0A 3W3CA 4MLOA 3I59A 5CDFA 2OJED 4ON0A 4WF2A 1FNDA 2RNJA 1FEXA 2E34A 2LFBA 4PC6A 1PUEE 2XNCA 1QA2A 3IRRA 3GTOJ 1ZN2A 3TL4X 1MW7A 1OCCH 4NNJA 2YX7A 2E7XA 2W82A 1BX1A 1KK1A 3QP6A 2R7SA 3MCAA 1TUIA 3OFNA 4YZXA 3ELKA 2W00A 1YG2A 3RCOA 1G4DA 2G9WA 3PSFA 2MG4A 1QPMA 3CCRI 1MD0A 4P5OA 1TTTA 1Q82D 1WH7A 2BN4A 3R6KA 1TWAJ 2CW7A 3F6VA 2WAEA 1V5GA 5BOXA 3ECOA 3KETA 4XM3A 3CMMA 1KU7A 4MIMA 2R5YA 1YI2I 1LUJB 2VOPA 2IAIA 5M5XJ 3S17J 4WWVA 2R7FA 1O8DA 1IW7F 1OB2A 3SEQA 4P96A 2STWA 4IXAA 3HOSA 3GFJA 1P4XA 3GTKJ 1VQ4I 5F4MA 2P8TA 3GRHA 3G1OA 1SVMA 1K8AD 3B6AA 3O3KA 4M53A 4P9SA 3MZ8A 2NPFA 4IRIA 3F8CA 1T33A 3OJXA 3F21A 1WJ5A 3U2RA 3S16J 2JJ7A 1YS6A 1QVFB 4KIBA 4F52A 2RQQA 4KFCA 1Y0NA 2PEXA 4XSXF 4WWCA 2QE7A 3ZPLA 3H5NA 1POGA 4JX6A 2MBFA 2FE3A 4AC0A 4A3CJ 1W4MA 5CVIA 5ICCA 2Z6BD 1IXSB 4B48A 2NTBA 3VFZA 3LA7A 5GAEJ 3SKBA 3GCMA 3PJRA 4GRIA 3B4NA 1Q81D 4YZAA 3JRDA 1BX0A 3V4GA 1SEUA 4NK8A 3RKWA 1EJ9A 3DTKA 2VBVA 4QFMA 3M8EA 1MMSA 3GSIA 1LEAA 5DCFA 5JFRA 2IOUG 2QVOA 2V31A 1D1CA 3SQVA 1U8RA 2QTLA 4KN7X 5K7ZA 3OY9A 5KW9A 3RYPA 1PJ6A 4QPQA 3QRFF 4EH1A 2IA0A 3B8HA 3TQNA 1UG2A 3BJOA 1I3AA 2GAUA 1U2RA 3FKSA 3N97A 4Z4VA 4BH9A 1T39A 1WKMA 1TTYA 1KYZA 2EZKA 4RM3A 4S0HB 4EM1A 5F1JA 3ZOBA 1QA3A 3VEPA 2BM6A 2H94A 4Y15A 4URRA 1XSXA 1Z67A 2IGNA 2ZMEC 4J0QA 3L7WA 2L02A 3M07A 2A5YB 5LMZA 2JK3A 4BJ5C 5L3BA 1RI7A 2JA8J 4P6YA 2KHMA 2PJRB 1X2MA 1HKQA 4KA4A 3RKQA 5J1YA 3ONYA 1XDUA 2XAHA 1A6QA 4MTEA 3J80Z 4BE0A 2LKXA 5FKNA 2AXTC 3CZ6A 3DLAA 1MJBA 1R1UA 5J1RA 1E2XA 1BJAA 3SJMA 4V02C 1ZELA 2F4NA 3GLXA 1WTHD 3FMQA 1DDNA 1JGSA 3BC8A 4P22A 5FIUA 5BS6A 3VPRA 2BY0A 4GYGA 1YIJI 5LRRA 2IW5A 5D6EA 5HZBA 1CLWA 1SVOA 3GVAA 4M6XA 1K78A 2V7XA 2GK6A 3ABKH 4G7WA 4M1KA 2DW4A 3K4NA 3LQEA 4JQFA 1X1PA 1CNEA 3VO1A 4N4NB 1BI0A 4C2TA 2ZBVA 1ZM3A 4L9VA 3Q39A 4YAFA 3LNQA 3GMEA 5CVRA 5JHFA 3MHPA 1SFEA 4C0SA 2L7ZA 2PMZN 4M6VA 1ZG3A 2KJCA 3BY6A 2DI3A 5LGTA 3PA1A 1KQ9A 1DPUA 5IYNA 2BY1A 4B3FX 1T0FC 2L3DA 4IX7A 3L09A 4PK4A 4ZDLA 1TNTA 4ZGQB 2VJIA 1IXCA 1S6LA 2Q1ZB 2Z9OA 3RY8A 3BH6B 1HOMA 3G05A 4TMXA 2Y31A 4XR6A 1R5GA 3AKZA 2PX9A 2RREA 2ZBKA 3FXRA 2LSOA 5DV5A 4HNTA 4MEYF 2R7RA 2CRVA 3PVDA 2F5DA 2E1RA 3ZPNA 1IRZA 3VSKA 3WG7H 4AYBN 1FWZA 2XB0X 3CF2A 5FLXZ 3BR5A 1F4KA 1K7AA 1QQ1A 4OJPA 3ABTA 5TJJA 1UMKA 4OPOA 1E3OC 4ZCMA 3DU1X 3QFSA 3HOYJ 3I71A 3WTYC 2HYGD 3N90A 4OMZA 2XGDA 4UXNA 2QSHX 2R9VA 3W2FA 2H1KA 1D3YA 5F27A 1QQIA 4LB5A 3BR6A 4ZYEA 2W6IA 5H5JA 4DIQA 3ISXA 1R7JA 3FXLA 2LBFA 2M34A 4NC6A 3MFKA 2CRGA 2LD5A 2V1UA 1F60A 3OZVA 4EMSA 1S0UA 2JJ1A 3PETA 3LL7A 3OR1C 4XLCA 1GXQA 1X3WB 2NVXJ 3JCUC 2G0YA 4G6DA 4PJJA 1P4WA 3OYCA 1I6HJ 3JSOA 1W87A 1U6GA 2BE5F 2D1HA 1EZGA 4LLGF 1TYVA 5HZAA 4LLLA 1XMKA 2Y0MA 4H9GA 1HKTA 1ZRFA 2B7BA 3WYAA 2OV7A 3B6CA 3JRGA 1FY7A 1AHDP 2LH9A 1R6RA 4BUPA 2UZKA 1TYWA 2IT0A 2NT9A 4WZTA 1BBYA 4LBWA 2XSJC 3QP5A 3HAGA 3ASOH 3CD6B 4NK6A 3E1SA 1Y0UA 3FXUA 2QYUA 4KIFA 2W1OA 4BE1A 3QFTA 1RWRA 3M9AA 3FWEA 4UNOA 5AONA 3ROUA 4UB6C 3HL2A 4Q47A 3CMAI 3OEHA 3CCMB 1KU3A 2GM4A 2EZLA 1VQLI 2C6YA 4D5CA 3UR3C 3M8FA 4JOMA 1TZLA 4M3EA 1H85A 1SD6A 5GAHJ 2DMQA 3ZN1A 3N4MA 4BYYA 3HKZA 3Q9SA 5IP6A 1O8IA 5D6FA 3JRCA 2DY1A 1RNLA 2BW3B 4RGRA 4YFNF 1JKOC 1ETYA 5DM7F 1NK3P 3I4MJ 4WZEA 3EPZA 1FIAA 4AIHA 2K7LA 3LQQA 4KH3A 1WJEA 5JVGF 3TP0A 2DA2A 4QIWN 3DFGA 3H36A 2FBIA 3G1MA 3LAPA 1W0UA 5L3EA 3CC4B 4RLQA 3T8RA 4YFOA 1LE8B 3A01B 5BPDA 1RKTA 3BDDA 1BR2A 3BPXA 3K4BA 2C5HA 2NS0A 3BQJA 3K69A 4X0GA 4D1QA 3OYFA 2RVCA 4H0EA 3E20A 3FPKA 2DLLA 2XTWA 2VNIA 1TQMA 3OS1A 1PYVA 3ABUA 4HOBA 4X1EA 5K7HA 2GA2A 2KIQA 3EDPA 4NC7A 5F1RA 1BW5A 2GPJA 1IO2A 2M0CA 2ZCWA 5DEQA 4ETSA 3I1FA 1M90D 1SD4A 3B8YA 2KRCA 5J3OA 2IA1A 2NOGA 2Q0OA 4I02A 3E6CC 1I6XA 2LG4A 4NQWB 4MYUA 3IUOA 1EA0A 2NNNA 4OJ6A 3PUFA 3GZ5A 1UG0A 3EUAA 2QEXB 2P6SA 3FBIB 2HU9A 1PLUA 2W25A 3S93A 2JA5J 5HKKA 2XT4A 1JJ6C 1J9IA 1OCOH 3OOPA 3JQRA 3CJTB 3MKZA 4U0VA 3C3WA 4I0AA 2QQBA 3ASQA 3U6KA 2XTXA 5HLTA 2LRDA 2ZO4A 3HYIA 1YW7A 2UWMA 4DNCA 1ZG5A 2A6HF 4JP0A 4ROXA 3CC2B 2W85A 3S1RJ 2D3NA 3I9V2 4D5FA 2BM5A 2X6OA 3MKYB 2CBXA 4BDZA 1MDMB 2YUHA 5LLQA 2EV0A 1NHCA 3KZIC 2GIVA 2F4OB 2HS5A 3HG9A 3DCFA 1DUXC 3FMSA 4KUMA 2W84A 2VQLA 5TGTA 1AMOA 2ZC2A 1VQPI 3AG3H 1E64A 3BZCA 1WPCA 1H8AC 2X51A 2JIZA 3OYBA 2P81A 1ACIA 1RMGA 4EQQA 5E3NA 1VNDA 3P7NA 1G6NA 5HOOA 2DOFA 1ZG1A 1DBOA 4XK4A 1H8HA 4D7MA 3KEYA 1YJWB 4Y13A 2ZXIA 2KFDA 3LO8A 2EA4A 1T56A 1WQ2A 1SMTA 3K4JA 2JN9A 1YX2A 3VSVA 4Y3OA 2DIEA 1LJ9A 5CYVA 3CJNA 3H94A 3JRHA 3Q3AA 5FFZA 2A68F 4O5VA 1LEBA 1XMAA 4G6IA 4ZH4F 1T2KA 5DSZA 2YPRA 1IV6A 5EEAA 4I7HA 2YWEA 1JHFA 1V3FA 4M72A 4FTHA 4DYCA 4TN1A 1KK3A 2XGXA 2PMHA 1R5ID 1S7AA 4M4SA 1V5FA 3ZBUA 1YLFA 2LOOA 3A0HC 3CDLA 4X7EA 3DU5A 2E71A 2BEOA 4RD6A 2XAFA 4XLNF 3KEWA 5IT9Z 5GV8A 2OA4A 5TV2A 2VL8A 2K9QA 1AIPA 2VC1A 4M3DA 4ESFA 3ESWB 2HKXA 1KD1D 4G12A 2OYNA 2WY7Q 2ICWG 1N0VC 2VIXA 2E5NA 3GO5A 3OV8A 4W8RA 4P6VF 2IJLA 2PQ8A 3ONUA 4KKTA 5F6FA 1COWA 2XZOA 2TRTA 3LSMA 5DTDA 5E17F 2WAQA 3DPTA 3GQ8A 2P7VB 4PJNA 1BPLA 4OPVA 4TSFA 3W6KB 2FA5A 2VBTA 2Z8GA 3TDUC 1MBKA 1BR1A 2WV1A 5B66C 1DP7P 5F0FA 4QV2A 1D1AA 2W57A 5LRSA 2MW8A 3JRFA 4Z4TA 2R92J 1MNMC 2XRNA 2KRHA 4QPOA 3R61A 1B9NA 3QPTA 1SFOJ 4DJAA 3A03A 4D0PA 2VB6A 3SJPA 2R93J 3KLNA 1EV7A 4P12A 1YITB 1OQYA 3S3OA 1Y39A 2JVHA 4F91B 2X3UA 4YFKF 1KTWA 5FLVA 1J0RA 3LMWA 2ZL5A 1QVTA 3NAWA 1GAWA 3X2QH 2CFXA 1JGGA 2KISA 3F23A 2R7ZJ 4C9YA 3EETA 3K1MA 1KMHA 1BR4A 2E60A 3CCQB 3ASTA 3C1DA 5TY0A 3SJZA 5GTIC 5ILVA 2E2IJ 4TMTA 4E7HA 1FSHA 1YYVA 4LJZF 3OS0A 3U1DA 1WOOA 3C2GA 4RDKA 3BG9A 1Q1HA 3BCAA 4MHGA 2V5IA 2DFEA 1KRHA 2C77A 5J6XA 2VE9A 5KAIC 2XF5A 4JX5A 4A12A 5FD5A 2G0EA 2K3PA 4EATA 2QM3A 3Q0VA 4UB8C 2H27A 2HYFA 2VNJA 1VQOI 2VT2A 4DYRA 5EGOA 2FU4A 1ONVA 2DDBA 5FKOA 1YRNB 4W1UA 2DOAA 4HSRA 1OKRA 4FX0A 2VKVA 2L9VA 3V7RA 5LFAA 4M9ZA 4DZJA 4HA8A 3K70D 3MEXA 4XMYA 1I27A 3PFIA 3S3MA 2STTA 1MMDA 3DKWA 5LEJA 4EGYA 3LJYA 1MBJA 2O7OA 2KQRA 4I01A 2XAQA 3SFZA 5CQEA 1OGMX 4MEXF 3M1CA 3CUQA 5EEHA 4PC3A 2WC2A 1H89C 2BVNA 4HV6A 3P5JA 1AWCA 4M73A 1Y0RA 2YWHA 3BPVA 1JNYA 4L9TA 1A31A 5KAFC 2X3HA 1LDJA 1YIOA 2DT5A 4B3XA 1H8EA 3JR9A 2OK8A 1WSUA 1UD3A 3I53A 4X05A 3AVTA 4P1VA 5L46A 4YZ0A 3AAFA 1VQ9I 4EW9A 4ANJA 4I09A 2EILH 1LDKB 3KEQA 1NRKA 3BH7B 2LNBA 1IDYA 3RPUD 1Z0XA 3CCEI 4YHBA 4L5JA 3VMVA 4A2UA 1ETKA 2W48A 4P55A 5TISC 2P7CB 3K4LA 5ERIA 1YJNI 1Y8RB 1XTAA 2DTRA 1TNSA 5IT3A 1B72B 1XMXA 1XS9A 3OKXA 2R7UA 4IPAA 1KONA 2Y0SA 1O8FA 2M4KA 4QUZA 2DETA 2QKMB 4ASNA 1S72I 1VLOA 3OYJA 1WU8A 1EH6A 3ZMZA 3VMWA 3FHZA 3TBIA 4CICA 4HQEA 2R5ZB 1BL0A 1QG0A 1P9QC 2R7WA 1K9MD 3W5HA 1I5ZA 3ZSCA 4CSWA 2QZAA 2UXNA 2K9NA 5FO1A 1QA6A 3ZC3A 2E36A 4BXXJ 3H9JA 3BCFA 1XCBA 3ZQQA 2R5ZA 2XAJA 2VODA 1BA5A 5E20A 1E62A 3G6EB 2L0KA 1B2RA 4RAFA 2L2OA 1LFBA 1KTVA 1LKXA 1Z6RA 1SM4A 5B6IA 3HIFA 3B82A 1LFPA 2A6TA 5IT9K 1U3EM 2DA7A 9ANTA 1O8JA 1UHMA 5ILSA 3N05A 2L5QA 1FBUA 5FO5A 3L2QA 3GTLJ 2X0KA 1WPKA 1H88C 2FXAA 4ACBA 3BT9A 1A5JA 5K1YA 1E3ZA 3C7JA 1DP3A 2CC2A 2OK7A 4Y7CA 2BXYA 4OIRF 2Z5UA 1K6OA 3WE3A 2W6JA 3RPUA 3I54A 2HOEA 4LFUA 5FLMJ 3GFIA 1O3QA 4N3NA 3DV8A 1FPQA 1RZ4A 3MD2A 1QNTA 3HKZN 2L7MP 4IKFA 1YOVB 1IAWA 3MN2A 1FX0A 5GAGJ 3ASNH 1QU3A 3Q6QA 2LREA 2PN6A 1XFOA 1KQ5A 2VKHA 3R0JA 3KP5A 5GV7A 3OYDA 2V79A 1BQEA 3K10A 1IUYA 3EUHA 1W7PA 2GJKA 2NS7A 2ZZEA 3PNTA 3CCSB 2DA3A 3JQQA 3FKJA 1NHAA 3J81Z 1A35A 4HG2A 1TSPA 5L3GA 2XDVA 3HRUA 2JA7J 1Q9SA 2X8KA 3CCUB 3HZJA 1FOWA 5IK2A 4A0XA 5THXA 1EE6A 2WR8A 2LP0A 2O61A 1GV5A 2O8KA 3DBHB 2E1BA 1BLIA 4XL9A 2QLZA 4AWXB 1OCRH 2BZTA 4RGSA 1D0YA 3E97A 3PA2A 1YLOA 3P27A 1O8EA 2XPVA 3Q0UA 1CZFA 2KT0A 1B1BA 2A07F 5FKMA 1PKVA 3FPPA 4Z1MA 4DZPA 3P26A 4IOAF 1MBHA 1S3JA 2ZSIB 3FDYA 4KT5C 3I56B 2Q2EB 3BG5A 3GBGA 4IHTA 3TKYA 4FWTA 2ZFUA 2JJ2A 2MYSA 3P9KA 2CMPA 2QCOA 4ABZA 3LSJA 4ZYHA 2B0LA 1WDTA 3HUGB 4Z4SA 3OYAA 5EZGA 1VQMB 3R6SA 2VBEA 4Z6YA 3FM5A 3OIOA 4PJLA 4BS9A 4RPBA 1SFUA 5DS0A 4GDFA 2HQAA 4X7CA 5D8LB 1JTAA 1J75A 4RA2A 3IWFA 4N3GA 5DDGA 4CZCA 3GZNB 2CK3A 3KP7A 3O6BB 2LDUA 3BLYA 5ED4A 3JRBA 2FQ3A 2O04A 1FMWA 3SY2A 2A6EF 1HDDC 3FF5A 4CHUA 1W0KA 4YG2F 3IAM2 4KDPA 5EDNA 1T6ZA 1BW6A 2CGPA 1Z3YA 3WTVC 5D4SA 3OMYA 2D1VA 5LEKA 4YAUA 3AG2H 1B59A 3PNYA 1OYYA 3ZZTA 5BPIA 2DBBA 2L4MA 1OFCX 2CQXA 1R1TA 3JSPA 1SFXA 4HF0A 1P4AA 1OYWA 2ZB9A 4HWVA 2JUCA 1ETQA 1CF7B 3BQZA 3CLQA 3GQ7A 3CQZJ 1ZUNB 2QXZA 1ZARA 5M3MJ 1HW5A 2M45A 2VBMA 2Y9YA 2OF7A 2VZLA 1S9HA 1BOBA 2VE8A 3ZUGA 1VJSA 5HDGA 4PZJA 2ELHA 3ZZ0A 2OUMA 3JURA 2PFBA 3KZZA 3CUOA 4LG3A 4EJOA 2DFFA 4ZJZA 1YQAA 2ESNA 3QAHA 1SKYB 4ENKA 2M9HA 3L2CA 4CQJA 4BHBA 3TO7A 2IRFG 4UUSB 3G4SB 1L1IA 3BY1A 3M1EA 1PVEA 3ZXSA 2XRLA 4A3MJ 3IKVA 1FNCA 4XLFA 2HZTA 3VO2A 4DNTB 4OWRB 2NTQA 1F43A 1G7CA 4BL0B 4HEA2 2BVMA 3VMFA 3ZQLA 2GXAA 3E5QA 1N77A 1VQNB 2HNHA 1SFKA 3HTSB 4AU7A 3K70C 1DU6A 1V5VA 3WQZA 3UKGA 3F8MA 1Z7LA 2NV4A 4C3JJ 4TMWA 2HCJB 3F8BA 3E6MA 4N4OB 4MGRA 3CCLI 1WOPA 5ILUA 4UZEA 2AHQA 3BZKA 1KYWA 3Q5FA 1DDGA 2XZLA 2WYRA 5IOYA 1KK2A 5GPAA 3BG3A 1E79A 4WZLA 2O3FA 2HR3A 2RGVA 1UZCA 4OAYA 2IQ7A 1B9MA 1I3QJ 3A3BA 4G8XA 2AO9A 2FMLA 2ZJ2A 4P3IA 2KIMA 4W97A 4A5NA 5FKLA 2CSOA 3E7LA 4LMYA 3GQ9A 2RQPA 3TP3A 3ZMVA 3NB2A 3ZP5A 2DMTA 2E1CA 4QVAA 1E63A 2O8XA 2DPUA 3SHFA 1IB0A 3MMYB 2BPOA 2NRAC 4HAMA 1SD5A 2Q6OA 3TO6A 3HB9A 4A3FJ 5K7FA 4P25A 2YUSA 2VXZA 4L9JA 1V54H 3GX4X 2K86A 1JT6A 2DT6A 1W7PB 4ENMA 3TOAA 1RQRA 4N9HA 4TT3A 4C3HJ 2MH9A 2DN0A 2V1NA 2MGQA 1A8PA 1NBMA 3CCMI 3L1PA 1HF0A 3WTZA 2ID3A 1WJFA 5JLXA 1F1ZA 1WH5A 1FOKA 3ZZUA 2V26A 2J5OA 2QKLB 1SANA 3ZR8X 3OYEA 3NRVA 3A35A 2XF6A 3AG1H 4JX4A 4MFEA 2HWVA 2KIFA 1G7TA 4PFOA 2PIAA 3WBKA 2AHOA 2P4WA 4FX4A 4U88A 2CV0A 1Z21A 1VQMI 2XV4S 3OJWA 2OTLI 2OPTA 3AGPA 4OINF 5IYWA 4XD7A 5DUIA 1XG1A 4IOCF 1QX4A 1MZBA 3GVKA 2KL4A 1DBGA 3PSSA 3JTHA 2VYQA 2LR8A 3S3NA 1ON2A 2XF7A 4CYCA 1KU9A 4Y9RA 1GJRA 2O0WA 5EG0A 4BKXA 2VBSA 2FOWA 1ZAOA 3E0JB 4RB3C 1IJWC 4BGDA 2FX3A 5HNFA 2H1LA 5HS8A 2WJVA 1FYLA 1HA8A 1U2WA 1KGSA 2EPFA 2K5CA 4A3LJ 2JZYA 3HJEA 4RJLA 2LF7A 2V1DA 2OBPA 3VYSB 3BCDA 3IH4A 1S4MA 1EA3A 3RZOJ 4AF7A 1G59A 3OW2B 1IDJA 2EIKH 4BHCA 5DCMB 4EV0A 3A01A 1QH0A 2LZJA 1VQ6B 4GYIA 3CCUI 1KZLA 3OYHA 1NG7A 2WAFA 3D0SA 1N07A 1AIRA 1EFTA 2HVSA 4X7DA 2VFPA 5J8FA 4G1BA 3SZPA 2F5EA 2XGCA 3PQKA 1IC8A 4U0WA 2PE3A 3G71I 2M87A 3FXMA 4C2LA 2JMWA 1VQ6I 4A6DA 5H6RA 5H6QA 2RKHA 3V8JA 2F4IA 3H5RA 3CESA 4RBOA 2C5BA 1ZGWA 2XNDA 3T56B 2ZNZA 3DBLB 2K3FA 3CMAB 1ON1A 4I0BA 5F64A 2EQRA 1OMIA 2JRMA 3OL4A 4BJTA 1E43A 3HUGA 4ENNA 4LG0A 4XKWA 3K2ZA 5LBQA 1QRBA 3E6BA 4X6AJ 3PSZA 2XROA 2KMUA 5C4JJ 1RETA 1WI3A 3HC7A 3C18A 5GADJ 2M0MA 5FLXK 2V4DA 1FBQA 1VF9A 4I84A 3IH3A 3O2PE 3OAAA 3SZEA 2I10A 4Z03A 1CNFA 2CWEA 3HPGA 1FNNA 1ERDA 3SQNA 3OPOA 1E17A 3FBNB 1KU2A 1D1BA 1G7SA 1STZA 1U9NA 2IS4A 4IRHA 4P1WA 3ZQ7A 2VBYA 4G7HF 2CO5A 1FOXA 1JA0A 2HDDA 1XD7A 4YAWA 4LC0A 3DKYA 4FE7A 4M3BA 1PUFB 2R7VA 4OPWA 3GEZA 2DT7B 2YSRA 1SVLA 2F2EA 2YU9J 2QX3A 2NXNB 2F5CA 4PCQA 3P9CA 2KDZA 4L18B 3I58A 2EIJH 2H6BA 3K1NA 3W5UA 2BY3A 3PM1A 3UNGC 1U0JA 3CTAA 2EZIA 4JK1X 4JMQA 2DK8A 4JRAC 1SAXA 1GVJA 4HYEA 5JBQA 2K02A 3CP2A 4MFDA 2PI0A 5D5WB 3ZIAA 2P5LC 2XPUA 2BGIA 2GQFA 1MSEC 1LB2A 2ZBUA 1ZRDA 2UXXA 1VLYA 2TDXA 2QQ8A 5E1XA 4DQKA 3N6ZA 2BV6A 3ZQHA 4HX8A 4B1RA 1HSTA 1LM1A 1Z3XA 5IYRA 2OCCH 2ZTNA 3GXOA 1JTXA 2JVGA 2VASA 1Z7UA 1MDMA 4P2NA 3VYRB 2X9DA 3I5UA 3CCYA 5KSWB 5JLVC 5ICEA 1ZR4A 3ZQFA 4LBVA 2DFIA 2XC7A 2OD5A 4LGWA 3AVYA 1V5EA 1ZM9A 3CUQC 4A3GJ 4AUXA 2V9PA 4LK1F 4AIKA 1QZYA 1TC3C 4W8SA 2OTJI 3A4CA 4I99C 1X3UA 4J00A 3HHGA 2NVTJ 2P0WA 3V8LA 1OB0A 2EV6A 2DMUA 4PMHA 5J1UA 1BI3A 2GIZA 4AVZA 1WCMJ 5AN9A 1XGNA 2EWEA 1MMAA 4XSZF 4YCQA 4LOCA 2ZL6A 4G7XA 3BP8A 3PENA 3WBJA 2ZJRF 3D1NI 3K9TA 3GTGJ 2MC4A 4Y4RA 1QGYA 1HKSA 5DYMA 5LHGA 3HOUJ 3WNDA 4QSHA 3ERED 3SEJA 1D8KA 2BGCA 3HDDA 1ETOA 3GQBA 2DQLA 2QSGX 3I0TA 2ECBA 4YIFA 3V7CA 2DJNA 1S7EA 1K83J 4PGOA 4XORA 4WQMA 2MH2A 1GLNA 3M7GA 1XGMA 2KZVA 1E0EA 1MJAA 4Z4ZA 3GQAA 5D8KB 3PQJA 1UD6A 1EFRA 2CQ7A 1BJZA 1LLWA 3Q3SA 1ETWA 1T8IA 3K4KA 4G94A 1QUFA 2GK7A 4E7JA 2X4HA 4B4DA 1I8DA 3J81K 4Z4WA 4BU2A 1GHCA 2QDXA 1LPQA 4JYKA 4PC2A 4BQOA 4NB5A 3WHBA 3ZN0A 3WTWC 1FYKA 4DK0A 4GCVA 3HOTA 1G3TA 2ZL7A 4B3GA 5JI6A 4E7KA 3UW0A 1ULYA 3K2AA 3OWTA 4QHYA 1OJLA 2MLKA 1YITI 1XC5A 1OR7A 4ZDPA 5IY5H 3EQLF 4OOSA 5FRMA 4ITVA 2PMUA 1XGSA 4KMUX 1ZLJA 2E7WA 2Z1DA 1RKWA 4DNRB 1PJRA 1Q7YD 1Z6TA 5GPCA 3ZGKA 4ASUA 1PE9A 1JXSA 2Q6IA 1KCDA 1HLVA 3ERMA 3VNVA 5J4YA 2FJ1A 3NEUA 3OE7A 3NAUA 2VJ4A 3K4CA 3DBRB 1JRGA 4FXUA 1WRJA 1R22A 4BY1J 3PUBA 1OGOX 1M1EB 1KJZA 1JA1A 3U1KA 1U78A 1YW8A 1DGWY 3COAC 2WBMA 2EB7A 2HFHA 4I6ZA 1G8XA 4MQ9F 2L54A 4C2UA 4XKVA 2KDOA 4KKSA 1O8LA 2M8GX 5LGUA 4IHYA 3GTMJ 4FE4A 1W7PD 3K1PA 2V1XA 3CP8A 3DTIA 1IN6A 2E1MC 2JRTA 3TW7A 1D8TA 4Z4YA 3LAJA 3OIQA 2K9SA 3RYRA 2V7UA 4OP7A 2Z16A 1FX7A 1I7PA 1G3YA 2FNAA 2WSSA 1L0OC 3G6EI 5A88A 2E35A 4M3FA 1FC3A 1QPIA 4YEIA 2FSWA 3BWGA 3W2IA 2F5FA 5FFXA 1K28D 4P26A 1MIJA 1ZYRF 4G9YA 2R3SA 2DA4A 5D4RA 1E1RA 1BHEA 3L00A 1GR1A 5E8GA 4RGUA 3QYFA 1TW2A 3GTQJ 4YFXF 4AIJA 1V55H 3T5XA 4FT8A 1X1DA 5JVTA 1F20A 1K78B 2IVMA 5A2QK 5CKTA 2H6CA 1ENHA 1EKEA 4XOTA 1U5TB 2BF4A 3AGQA 4K2EA 2LVSA 3S1NJ 2CW0F 2WV0A 3OYLA 1FRQA 3IAS2 3CPXA 1EP3B 1V0EA 4BJ6C 4CDGA 5D5XB 2NVQJ 5DD8A 4KKUA 4RD4A 3ISPA 4RAGA 4M6YA 1BI2A 1WJAA 1XB4A 4S05A 3PNVA 2E2JJ 2VJ5A 2M1BA 2RAEA 4GO1A 1R5BA 4RLZA 4UZUA 1SKQA 3B90A 4FK8A 2ZXWH 4ZYGA 4WXCA 1BI1A 5LHIA 1ZQ3P 4XICA 3OZWA 1K4SA 2XB5A 3OS2A 3W2WA 1FOYA 3Q0WA 1R58A 5IP9J 1FJLA 1O3SA 1D0XA 3KRGA 1O8KA 2E2HJ 2H8WA 4RB2C 5FO0A 3ASPA 2JN6A 2BHYA 4RGXA 2CH0A 4BY7J 3HRMA 3I4PA 3DPUA 3VOEA 3JRAA 1W9XA 3WWGA 3HBLA 1XQBA 1HA3A 3CMYA 1N0UA 3WE2A 2W7ZA 2VQCA 1YJWI 4RCZA 1TYXA 3FKIJ 3H9GA 4OOXA 2BY2A 4DK1A 3GIRA 1VQKB 5CVVA 2ZXHA 5CPRB 3BR3A 4E7IA 2BHZA 2F48A 3OIPA 1VQOB 3ZQIA 1AKHB 4YDTA 3SYTA 1MGTA 3ZBTA 4R8HA 2VFQA 3M8JA 4E7SA 2ZFWA 1S7OA 3CCRB 1ODDA 2XASA 2YS9A 1X1CA 3OYMA 1JUMA 1ORKA 2PMZA 4F3QA 4EVIA 3ULQB 1B23P 1B6AA 1IUFA 1MJ9A 2A5WA 2CV1A 2X6XA 3E5XA 2EH3A 1O8MA 4Y52J 2HMAA 3CCQI 3OP1A 1U5TA 4P3YA 4I98B 2X48A 2CUJA 2CW8A 2FRHA 3ZMTA 1G2HA 2RC4A 3MMPA 3T53B 1YX5A 1H42A 1MMNA 1R5OA 5E3LA 5TRDA 2F1LA 3OYIA 6PAXA 3F8FA 1XGOA 3LYCA 4YEJA 1P7IA 5KK1A 1K4TA 3BC9A 3DDYA 1IXRC 3GTJJ 1P6RA 1FT9A 3HGYA 3OSFA 4UV9A 2DYRH 4IO9F 1VQ7I 4OJLA 2HOAA 3MZYA 1W36C 2B7EA 1TBXA 2J7KA 1PP7U 2CQQA 3LFKA 3JW4A 4CGZA 2R7TA 4BXFA 3T51B 2XAUA 3HRSA 4NUBA 3ES9A 4Q4ZF 1A04A 2FBHA 3L2RA 2E1NA 2ESHA 1JKQC 3GVLA 3CUQB 2M5WA 4XLAA 2P5KA 3GTPJ 3ZMDA 5FROA 1PJ7A 2H09A 2OZUA 4FQGA 3KP2A 1FP2A 1EF4A 4OM9A 4LD5A 1Y56A 2EWNA 4FHTA 4B47A 4LBYA 3EQNA 1MH4A 3M3YJ 1PDNC 4A3BJ 3BR1A 4II2A 3NWTA 3WY9A 1HBXG 2K40A 3LSRA 5M3FJ 3PIPF 3W2AA 1OLTA 1N06A 2ZTGA 1DABA 1GXPA 3S32A 4UUSA 5EGOB 4OPSA 1WI9A 5E6TA 2DCEA 3CXCB 4WCGA 2DQRA 2BYVE 2EA2A 3MKWB 1S29A 1U5TC 4HQMA 2UVEA 4YRVA 2R7QA 2CW5A 5BMZA 4F55A 4F7DA 2VBZA 3AFHA 2VFMA 4ZYAA 2J8IA 1X1AA 4XNFA 2HGCA 4CYDA 4E6KG 4PAAA 3Q38A 1Z9CA 2OAZA 1A6IA 3QPSA 3KYCB 2I5UA 1O3RA 3RKYA 2JSCA 2JUGA 4KJZA 1EP1B 1OFDA 2D45A 4P9UA 4BEHA 2GLOA 2O6WA 3CW2A 2B5OA 1X0CA 3GFLA 1D5YA 1QGAA 2LKPA 5FD6A 1IN7A 5GTHC 1EH8A 1J2XA 2BX6A 4ZYDA 4OIQF 4DQ2A 4F92B 1VZ0A 2P6TA 4D9JA 1QO0D 1K6YA 1KA8A 3BOQA 3EYYA 5HVQC 1T6YA 5GP9A 3P9IA 3VODA 1G7RA 2E1MB 1R4NB 4XQFA 4NDLA 3QODA 2O17A 2PJPA 2Z33A 2JPCA 1MH3A 1X4PA 2VOOA 2KPMA 4I76A 2HDCA 5BSYA 3ASSA 1ZRCA 4UHTA 5C1EA 1DQUA 2BGJA 2CFOA 5AIPA 1UB9A 1X19A 5J3LA 2C2WA 1Z91A 1EH7A 2L4AA 1I39A 1LVKA 2A69F 3L9FA 3FIWA 4AC9A 3GW2A 2G7UA 4FETA 3JAMZ 3PFYA 2VT3A 1HW1A 3H1CA 4UY8I 3CCVI 2DJIA 3JRIA 5H2FC 1VQNI 1R4MB 3DKXA 4DGWB 4B09A 1VQ5I 1FMVA 4CCNA 2Y75A 5J47A 1D0ZA 1HVXA 5B3SH 4CCMA 4A69C 3AVXA 2QUFA 1BOAA 1J09A 5E3MA 1WSVA 3H9NA 1H9GA 1I1SA 4PC1A 3AG4H 3ZMSA 1PP8F 1X2NA 2YR2A 2COBA 4RPDA 2C4TA 3BTIA 2FF4A 2ZZFA 2GOXB 4EJTA 2RN7A 1QRCA 4UVCA 1UD8A 3CO6C 1MKMA 3J7AY 2VXDA 2ZMEB 2XSDC 2LY9A 1OPCA 3D5SC 4E7ZA 2ISZA 1FNBA 3BROA 2O9LA 4Q48A 3HXLA 1R49A 1YJ9I 3R4KA 1DPRA 3E6DA 1KQ8A 1JHHA 1IN5A 4U49A 5A89A 3CC7I 3OYNA 1J5YA 1OYIA 1XSDA 2DPDA 3WNCA 1WMRA 5E79C 2Z2SB 1YHQI 3I56I 4YALA 5J40A 2Z99A 1ZM2A 4ZV4A 2CG4A 3MQ0A 2D74A 3ML6A 4A3DJ 2PLFA 2V7QA 3LVBA 4Q5SF 5FA6A 3ZPPA 2ELJA 1CF7A 4KICA 5IYDJ 2DDAA 4UV8A 4AF6A 3CMEB 3DEEA 2X1EA 4E7LA 1D8JA 4HF2A 4JBAA 2XNJA 1D2EA 5F0CA 5CLSA 1VI0A 3SDGA 4MNUA 2F6CA 1JKPC 1SAUA 1MBGA 2K9LA 2M4GA 2WWYA 1XSVA 4LLNA 3JQPA 2IGKA 1I18A 2VKEA 5FNZA 4ZTFA 3BJ6A 4PGGA 3BR2A 5L3CA 3A8KA 1OCPA 4CZZA 4PJMA 4A6EA 5TR9A 2EJRA 3PIOF 5F4OA 1Y1VJ 3TO9A 1SD7A 2GA1A 3EUHC 1SMYF 3HM5A 4DQLA 4ZGNB 4F7ZA 1QGPA 4TV7A 1DGRM 4KMFA 4X7FA 2QQ9A 1J9ZA 3V7AA 4IW3B 5B1BH 4XN0A 1UHSA 2L01A 4M9SA 5FJ8J 5K5QA 3CJRB 3JU4A 2EINH 5JLWA 2ZMEA 1ZR2A 1MBEA 2COMA 2NAZA 3SDBA 1NDHA 2X6YA 2OTJB 1EFUA 3FXKA 2QN6A 2OZ6A 3OW7A 1BM9A 3TOBA 4U4BA 4ZC3A 2EFOA 2Z3YA 2TCTA 5IP7J 2EFWA 2RV8A 2Y9ZA 3MZHA 2ZNYA 1UJ8A 2PJRA 3WNBA 5IOZA 4Z4RA 3CPWB 1UAAA 1LQ1A 4E70A 3KYLA 1PJ5A 2IGOA 1V0FA 2DTZA 3LSTA 2VNHA 2VQGA 4OOVA 4Z2YA 1QFYA 2FEZA 2ME0A 2CUZA 3LSGA 3FX3A 1W5SA 2VC0A 1OISA 3DP7A 4QWQA 3RTRA 4DOZA 4L0ZB 2OQGA 2KRFA 1LE8A 3RDIA 1BC8C 2I1LA 3AK5A 3AVVA 1YS7A 4A3JJ 1RIOH 2INUA 2M7BA 2E1OA 2ZSHB 1E1QA 2CU7A 1K61A 4LBZA 2E5ZA 2VFOA 5LGNA 1T08B 5AIQA 3OYGA 2VJJA 2HPIA 3KEOA 2D3LA 2P5VA 2AQEA 3T8TA 4ZCIA 4PC7A 1OCZH 3GUDA 4UUTA 1USTA 2PBIA 2WB1N 5F08A 2IP2A 2VBXA 3IC7A 1O4XA 3CCLB 3H3ZA 3B78A 4YELA 1TLLA 4HE5A 1KCCA 3IRQA 3Q6RA 2DA6A 3I59B 1HQCA 2FMYA 5DM6F 2NZMA 5A2QZ 1VQ4B 5CJ9A 4NBQA 1HZEA 5ICGA 1GAQA 1S5LC 1YJNB 1EP2B 2H8RA 3S14J 1VHOA 2GREA 3H3UA 1IRGA 3RQIA 5HDNA 1U9OA 3OEEA 2GQQA 3J7ZI 1MRZA 4RAZA 5L3DA 4Z06A 3LFUA 3E1YE 4W8TA 4MYTA 1W5TA 4D7NA 1NB0A 5CVUA 1FRNA 2XVCA 3H9QA 3OL3A 1C0WA 1T6XA 4R71A 2L9SA 1Q86D 4Y17A 3A2KA 1RESA 3VDXA 1H9TA 2FNPA 2M2EA 2R7DA 4X0CA 4BNCA 4U0YA 2B63J 1VHEA 2LC2A 4HDUA 2K9MA 3DTEA 2AQFA 3LNNA 4AD9A 2QA4I 4LG0B 1QUEA 2NYXA 1OGIA 3MVPA 3OSGA 2HQNA 3G71B 1HSJA 2DYSH 3WGGA 3A8IA 5BNGA 3NWSA 1WVRA 1R5HA 3EYIA 3S8PA 2X0LA 4B43A 1OFMA 1QBJA 2RC6A 3W6JB 2FBKA 2XHKA 1FNMA 2XT2A 1O3TA 3RSNA 2HOTA 4L8JA 4XONA 4QTRA 2V7VA 2UVFA 1WHUA 3FISA 2NSPA 1T5EA 1WWXA 1FIPA 4RLFA 2ELKA 3GZ6A 4RM0A 5HLIA 1UD4A 4P9FA 2ZXJA 2RC5A 1W35A 5KHDA 1DARA 4GQNA 3OOUA 3S1QJ 2L7FP 3R60A 4IQJA 1WZ2A 1F9NA 3TH0A 2ZZQA 2ID6A 2JTVA 2CQNA 3RKXA 1OHHA 2HZDA 4F93B 2K4JA 1IJFA 1JJ8C 4XLHA 2CS3A 2O5RA 2Q8KA 3IL2A 4RD0A 4BEHB 5A8AA 1R36A 1BIBA 2LLKA 2QZ8A 3QU3A 1VQKI 2F4MB 1OFLA 3HGGA 5HS9A 2BM7A 4ZDOA 2CUFA 1NTCA 2JDIA 2GJPA 1OCTC 3K6GA 3HOWJ 1EXMA 4U87A 1NK2P 2Q2EA 3KP6A 1Y0YA 3CB4A 1VBLA 4LIUA 3VWBA 2ECCA 3WTXC 2OTLB 1J7KA 3CCSI 4IEJA 1UD2A 3DLLF 1B4AA 4XRFA 3G2BA 3VNUA 1XCVA 2G7HA 2O6GE 1TT5B 1IDZA 3K0LA 4HDVA 1HCRA 2W24A 3WODF 4EM2A 3T9GA 4PSXA 4BPRA 4U7DA 1HXDA 1IF1A 3U2QA 1KQSB 2V7FA 4GGGA 1KC8D 4AVPA 3J81k 1Z1DA 2KZGA 1YRNA 2VPLA 2JA6J 2HTSA 2HVQA 4FN5A 2XKOA 2BXZA 4A3EJ 4M71A 2J5PA 3F22A 2GBYA 3BG6A 2F43A 5E8IA 2HKOA 2DOEA 5E1ZB 2HOSA 4RD1A 4C43A 2BM1A 1YFHA 4RCYA 2PMDA 2O0VA 2NOJB 2Y48A 2O0YA 3HSEA 4FASD 1ZHFA 1CQTA 3SFIA 4ZCLA 2WZPP 2L9RA 4CUGA 3NE5B 4OIOF 2XGEA 1ZGJA 3RQ4A 5LD2C 1DDIA 3BQYA 3CCEB 3I3LA 5IYQA 3SYJA 1BN8A 1BIAA 3J7YJ 2V7TA 4I2OA 4BQAA 2NTPA 3MCZA 1N25A 2KIUA 1RUNA 1XPXA 1OGJA 3F72A 2QBYB 2QA4B 1D5VA 4N9IA 4BBRJ 5LHHA 5EZHA 3FXQA 4XLEA 1W36D 2V6EA 3I55B 2DERA 4Z05A 4RM2A 5J4VA 1P2FA 4UUVA 3PSIA 3BTLA 3F3XA 2WAQN 2X6WA 3I64A 1T0FA 2X53S 2EZHA 4YC5A 2KJBA 5DS9A 2J8KA 1R5NA 2YX4A 4XBFA 1RR8C 3HOXJ 1IRXA 1UD5A 2R6HA 2INVA 2DA1A 2LMDA 3BJAA 4B8XA 2FOKA 3S2DJ 3KE2A 2GXBA 3GYHX 4OJOA 3ABLH 1ZGAA 2EFNA 4WXDA 3T0YA 3A02A 4YIRX 3IP4B 1RPWA 4XKBA 5HLGA 3LSKA 3DXJF 4HX7A 4MQVA 2LKSA 4M74A 4ESJA 1KK0A 2IXSA 2LF8A 1GVHA 4RDLA 5IPAA 1CGPA 1TVCA 4C2MJ 1VFCA 2MA3A 5C3EJ 1O7FA 4XOPA 4ZZLA 5J35A 1VQ9B 4S04A 1NH3A 1QFJA 1UFMA 2BOLA 3JTGA 5JR3A 4LK0F 2F5VA 2Y0SN 5DCMA 2WB1A 3CC2I 3A1YA 4LIVA 2JQ7A 2BM0A 1KQ0A 3G3ZA 1R9TJ 3WHCA 3FK7A 5BSXA 4R1HA 3VYUB 2YWFA 1Q1VA 1YE9A 4KISA 1XE1A 4O6JA 3BTCA 2NT6A 5E3OA 4IF4A 4CA0A 5K5RA 1LFUP 3KP3A 3W6VA 1ZM4A 3HRTA 3A3GA 3D26A 2HXOA 3W2EA 1M1KD 1R00A 2NVYJ 2EK5A 2VI6A 5E18F 1PUFA 1ZK8A 5HDKA 4U7BA 1TWFJ 5EJCA 5EMNA 1YI2B 2WY8Q 1MMGA 3QOPA 3WU2C 3SUCA 2BW3A 3S2HJ 1IJEA 4H4KC 3O8GA 4BXUA 4YXWA 2ADUA 3DEWA 3NQOA 2HQRA 1AU7A 1LLZA 4G6QA 1GDTA 2DA5A 1R71A 5C1CA 4HRIA 4XN3A 2JWTA 2QY1A 1IV8A 2QTZA 4HIZA 2BM4A 4NQWA 3IHUA 2FVGA 1T6SA 3B73A 1MSFC 1TLHB 1YTYA 4M9XA 4OZYA 2EV5A 1RRJA 3RI4A 1AA7A 5M5WJ 1WSRA 2VQHA 2O03A 3SZTA
chains in the Genus database with same CATH topology
5DN6A 3HUGB 2HVRA 3OYAA 1VF7A 4BJ5C 2VBEA 2KHMA 4MXNA 2PJRB 2CUJA 2CW8A 3T53B 4YZAA 2W4SA 3KX2A 1YX5A 4PJLA 2MABA 4BS9A 1MMNA 2I8DA 3LSIA 4CCKA 2HQAA 4BE0A 1JTAA 3LMMA 3OYIA 4CZCA 3CZ6A 3DLAA 4HSTA 4YEJA 2CK3A 3EUKL 1XG2A 3BLYA 2O04A 3BC9A 1FMWA 3DDYA 1ZELA 4CCLA 1W0KA 1WTHD 3IAM2 3VSUA 3BC8A 4P22A 2JSPA 4OJLA 4PSWA 2VLAA 1W36C 1Z3YA 3OMYA 3GVJA 2R7TA 3PNYA 4BXFA 3AL0C 3T51B 2OC6A 2XAUA 4NUBA 3D5LA 4LITA 2GK6A 4G7WA 3K4NA 3L2RA 4IZZA 4TKOB 4JQFA 2L7KA 4PUSA 3GVLA 3OOCA 4N4NB 4C2TA 4XLAA 3OYKA 5FROA 1OR7C 5JHFA 2UV1A 3V42A 4HWVA 1Y56A 3ZRGA 4B47A 3EQNA 3GQ7A 2QXZA 4II2A 3NWTA 4B3FX 1T0FC 2VBMA 4IX7A 5HNHA 1OLTA 3W2AA 4PK4A 4ZDLA 4B44A 3AL0B 2ZTGA 1OOCA 1S9HA 1QJVA 1BOBA 3S32A 2VJIA 1VJSA 2Q1ZB 2OUMA 2DCEA 3G05A 3JURA 4LG3A 3MKWB 4XR6A 4ZJZA 3AKZA 4YRVA 2RREA 4HNTA 1SKYB 2R7QA 2UVEA 3ZPNA 2R7RA 4F55A 2LY2A 3AFHA 3VSKA 4ZYAA 1TT0A 2O1DA 1X1AA 4XNFA 4E6KG 3CF2A 2ZZGA 3ZXSA 4OJPA 4XLFA 1T95A 1X1BA 3VSTA 4DNTB 4OWRB 2NTQA 2JUGA 1MNEA 1QHGA 4KJZA 4BL0B 4HEA2 2BVMA 3ZCOA 4BEHA 2PYHA 1N77A 1X0CA 2R9VA 2HNHA 1SFKA 2CV2A 4AU7A 3K70C 3WQZA 2W6IA 5KCMA 1Z7LA 4DIQA 4N4OB 2LBFA 1O88A 4F92B 1VZ0A 4D9JA 1H80A 4R79A 1K6YA 5HVQC 1IA5A 1Y6IA 3C2HA 2XZLA 3TMOA 1X4OA 2E1MB 4XQFA 2O17A 3QODA 2JJ1A 2R4GA 3LL7A 3OR1C 4XLCA 4PJJA 1X4PA 1E79A 3OYCA 3BH4A 2KPMA 3U21A 5C1EA 1DQUA 2CFOA 3OR2C 4OAYA 2IQ7A 1X19A 3A3BA 3CJQB 3L2VA 1LVKA 2OV7A 2LH9A 1R6RA 4FETA 4BUPA 3PFYA 3GQ9A 2NT9A 1IDKA 2DJIA 2GOMA 2XSJC 4OAZA 4AYBA 3DKXA 3MMYB 4DGWB 3HAGA 4NK6A 3E1SA 3ONQA 1FMVA 2V4JC 2W1OA 4CCNA 4BE1A 4CCJA 4BE2A 2PECA 1HVXA 1D0ZA 1RWRA 3L2UA 4IQ4A 2VXZA 4CCMA 3H35A 3HL2A 3OEHA 2DT6A 1J09A 2XGJA 3UR3C 4TT3A 2V1NA 4JOMA 1TZLA 1QHHD 2IS2A 1NBMA 2ZZFA 2GOXB 3SZGA 4HNUA 1UD8A 3HKZA 4KITB 1W0JA 1WJFA 1O8IA 1WFXA 4Y33A 3J7AY 2VXDA 3DWLE 3QYBA 3D5SC 4E7ZA 2V26A 2BW3B 2HLDA 2QKLB 3OYEA 3ZR8X 3EQOA 5FL7A 3HXLA 3A35A 3EPZA 2XF6A 2LBFB 1O8GA 2UUZA 4PFOA 1WJEA 2JA2A 2CV0A 4BQQA 1Z21A 4U49A 2WA0A 3OYNA 4RLQA 4XD7A 1WMRA 1BR2A 3K4BA 2Z2SB 2BVLA 3FHNA 4X0GA 2LY1A 4D1QA 3GVKA 3OYFA 2KL4A 1DBGA 3S3NA 2XF7A 3OS1A 2V7QA 1PYVA 3ZPPA 2ELJA 1WP6A 2O0WA 4NC7A 3E0JB 3DEEA 2X1EA 4E7LA 4BGDA 2IGMA 2M3AA 5HNFA 2KVOA 2M5SA 2WJVA 1HA8A 3B8YA 2KRCA 3F9KA 2K5CA 2XZPA 2F6CA 2LG4A 4NQWB 1SAUA 2K9LA 1I18A 2M4GA 3IUOA 3VYSB 2IGKA 3BCDA 4OJ6A 1EA3A 4OZZA 4ZTFA 2IS6A 3FY3A 1G59A 1IDJA 1UG0A 3EUAA 1N78A 3FBIB 2HU9A 2LZJA 1PLUA 4PJMA 3DQVC 1HG8A 3S93A 1KZLA 5HKKA 4OJ5A 3OYHA 3MKZA 3EUHC 1NG7A 2WAFA 2NSTA 4MR0A 1AIRA 1DGRM 2HVSA 5HLTA 2LRDA 4XN0A 5FRNA 2UWMA 3CJRB 3JU4A 2D3NA 3I9V2 4C2LA 3MKYB 3SDBA 4BDZA 2X6YA 5KNLA 3W2VA 1NHCA 2F4IA 3CESA 2VKDA 3H5RA 3HG9A 3OW7A 4U4BA 4ZC3A 1IB4A 2VQLA 5TGTA 2XNDA 3T56B 2PJRA 4BQNA 1WPCA 2ODLA 2X51A 3OL4A 1UAAA 4BJTA 3KYLA 1E43A 1V0FA 2IGOA 2JIZA 1N75A 3OYBA 1RMGA 4XKWA 2VQGA 4NC8A 5HOOA 2KMUA 2CUZA 3LSGA 1DBOA 3VR6A 1H8HA 3HC7A 1BMFA 2LYCA 4YZQA 3KEYA 2M0MA 2ZXIA 3BCBA 3RTRA 4DOZA 2V4DA 4I84A 4KT6A 3K4JA 3VSVA 4Y3OA 2DIEA 3OAAA 1O8HA 4Z03A 3H94A 3HPGA 3PL8A 2M7BA 2ZSHB 1ERDA 2INUA 1E1QA 3OPOA 2RNGA 3FBNB 1WJBA 1D1BA 2E5ZA 3VSLA 3OYGA 3L2WA 2IS4A 4P1WA 4G6IA 3LSHA 2VJJA 2HPIA 2D3LA 2AQEA 1WJCA 3K4MA 3DKYA 2R7VA 1V5FA 2DT7B 2LOOA 4W8QA 2WADA 2QX3A 2HPMA 3DU5A 4YELA 1KCCA 3KEWA 3H0DA 2VL8A 3UNGC 1U0JA 4DBRA 2WPDA 2NZMA 4JMQA 2WY7Q 2VIXA 2E5NA 1HZEA 3CP2A 3ZIAA 4W8RA 2BSPA 4KKTA 1VLYA 2R7XA 1COWA 3OEEA 2XZOA 3LSMA 1K5CA 2F1MA 2L9NA 1Z3XA 2WAQA 3DPTA 3GQ8A 4PJNA 1BPLA 2WJYA 2ZTNA 4E4HA 4TSFA 4Z06A 1GQ8A 3LFUA 2Z8GA 4W8TA 2JVGA 2VASA 2MFZA 1BR1A 2HDWA 2X1DA 3H9QA 3OL3A 3VYRB 2L9SA 1D1AA 3A2KA 3VDXA 4BACA 2KRHA 2XC7A 4QPOA 1V5EA 2LC2A 2K9MA 3DTEA 2AQFA 3QYEA 4DJAA 4DBQA 3LNNA 2X85A 2VB6A 4W8SA 3A4CA 4J00A 2P0WA 1OB0A 3S3OA 2JVHA 1QCXA 4F91B 4PMHA 4AVZA 4CCOA 1KTWA 3NWSA 4C30A 2EWEA 3LMWA 1MMAA 3S8PA 4B43A 4G7XA 1OFMA 4C9YA 2MC4A 4Y4RA 1KMHA 1BR4A 2E60A 3RSNA 3HPHA 4L8JA 4XONA 4E7HA 3H5AA 2UVFA 3OS0A 1T5EA 2FUG2 3GQBA 2NSPA 4RLFA 4XKCA 3C2GA 1UD4A 3BCAA 4J01A 4XORA 5KHDA 4GQNA 1GLNA 4ZTJA 3OOUA 2KZVA 1E0EA 2R7OA 4IQJA 3GQAA 2GJRA 1UD6A 2XF5A 2XOKA 1EFRA 2ZZQA 2KP6A 1OHHA 4G6TB 2HZDA 2K3PA 3VYTB 4EATA 3K4KA 4F93B 2GK7A 4E7JA 1I8DA 4XLHA 2CS3A 2O5RA 4BU2A 4BEHB 4BQOA 4II3A 5CQGA 1OFLA 2DOAA 4DK0A 4HSRA 3SEZA 3HOTA 5LFAA 4B3GA 4ZDOA 4CH7A 4E7KA 2JDIA 2GJPA 4HPQA 3DU6A 3K6GA 2VBKA 2X1CA 3D5RC 3UW0A 3K70D 2KLOA 4XMYA 3S3MA 1RU4A 3OWTA 1MMDA 4U87A 1VBLA 3QOEA 3DPLC 1NG6A 4LIUA 3VWBA 2KQRA 4ZDPA 1UD2A 5CQEA 3G2BA 5FRMA 4ITVA 1OGMX 4PFPA 3M1CA 2Z1DA 4DNRB 1PJRA 3ZGKA 1MNDA 4ASUA 3T9GA 2V9KA 1YX3A 2MD0A 4PSXA 1PE9A 2IS1A 1KCDA 1JI8A 2X3HA 4B3XA 1H8EA 2V7FA 2DXIA 1UD3A 3BG7A 2VPLA 2W7NA 2HVQA 3OE7A 4YZ0A 2M7AA 1WJDA 4EW9A 4RMNA 4ANJA 1LDKB 2VJ4A 3BG6A 3K4CA 1NRKA 2F43A 4FXUA 1JRGA 2PYGA 3PUBA 3RPUD 1OGOX 1E3XA 3VMVA 1UELB 2O0VA 1DGWY 2WBMA 1G8XA 4C2UA 2NOJB 3K4LA 4XKVA 2KDOA 4FASD 4KKSA 2WZPP 1O8LA 1PXZA 1MABA 4BDYA 3W3CA 4MLOA 3CP8A 3DTIA 4CUGA 2E1MC 3NE5B 3RQ4A 5LD2C 5CDFA 3I3LA 2R7UA 1KONA 2Y0SA 3OIQA 2JJ2A 2M4KA 1O8FA 2QKMB 2Z16A 3OYJA 3VMWA 1BN8A 3TL4X 1MW7A 2WSSA 4NNJA 3TBIA 2W82A 2NTPA 2R7SA 3OFNA 4YZXA 1P9QC 2R7WA 3ZSCA 4CSWA 2W00A 3RCOA 4XLEA 1W36D 2V6EA 4Z05A 1K28D 4RM2A 5AMVA 3PSFA 3PSIA 2X53S 2X6WA 1E1RA 1BHEA 3H9JA 4P5OA 3BCFA 3ZQQA 3QYFA 2CW7A 1X1DA 1IRXA 1UD5A 2WAEA 2INVA 2L2OA 1LKXA 1V5GA 4XM3A 3CMMA 5CKTA 4XOTA 4OJOA 1LFPA 2A6TA 3IP4B 4XKBA 3OYLA 3IAS2 3LSKA 1O8JA 1O8DA 1V0EA 4BJ6C 3N05A 2L5QA 3L2QA 3SEQA 2IXSA 3HOSA 4KKUA 1E3ZA 3GRHA 1DP3A 1WJAA 3PNVA 2W6JA 2VJ5A 4XOPA 1WJ5A 2BOLA 4UZUA 3MD2A 1FX0A 4IKFA 3B90A 4F52A 2F5VA 1QU3A 2RQQA 2WB1A 2QE7A 2LREA 3A1YA 3OS2A 4LIVA 3W2WA 3H5NA 2VKHA 3OYDA 1D0XA 3K10A 4B48A 2Z6BD 3KRGA 1O8KA 2NTBA 2GJKA 3PJRA 4GRIA 3VYUB 3PNTA 2ZZEA 3B4NA 1YE9A 4KISA 4E0FA 3FKJA 2CH0A 1W9XA 3DPUA 2NT6A 4HG2A 4CA0A 3A3GA 3WWGA 4NK8A 2XDVA 2X8KA 3DTKA 5IK2A 2VQCA 4U7BA 1EE6A 2WY8Q 3H9GA 4DK1A 1MMGA 3SUCA 2BW3A 2ZXHA 5CPRB 1D1CA 2E1BA 4E7IA 4XL9A 1BLIA 4H4KC 3OIPA 2V31A 3OY9A 3SYTA 4YXWA 4QPQA 1D0YA 1O8EA 3M8JA 4E7SA 1CZFA 3FKSA 1X1CA 3OYMA 1PKVA 3FPPA 5C1CA 4HRIA 4XN3A 4Z1MA 2QY1A 2PMZA 4HIZA 4F3QA 4RM3A 2ZSIB 3FDYA 3GBGA 2Q2EB 4OZYA 2A5WA 4URRA 1AA7A 2ZFUA 2IGNA 2X6XA 2CV1A 2MYSA 2CMPA 2VQHA 1O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRG A;  2PEC A;  2PYG A;  2VBE A;  4MXN A;  1RWR A;  1OGO X;  3VMV A;  4W8Q A;  2O0V A;  2QX3 A;  1JTA A;  4XKV A;  1O8L A;  1PXZ A;  4YEL A;  1KCC A;  4YEJ A;  1XG2 A;  2NZM A;  2O04 A;  1O8I A;  1O8F A;  4W8R A;  3VSU A;  2BSP A;  4OJL A;  3VMW A;  1BN8 A;  3EQO A;  1O8G A;  2NTP A;  1K5C A;  3GQ8 A;  4U49 A;  4YZX A;  4Z06 A;  1GQ8 A;  4W8T A;  2Z8G A;  4Z05 A;  3ZSC A;  4XLE A;  1WMR A;  5AMV A;  2X6W A;  4XLA A;  1BHE A;  1DBG A;  4HWV A;  3ZPP A;  2O0W A;  2INV A;  3EQN A;  3GQ7 A;  2X85 A;  2QXZ A;  4XM3 A;  4XOT A;  4OJO A;  4W8S A;  2VBM A;  3B8Y A;  1OOC A;  1QCX A;  1QJV A;  4PMH A;  2VJI A;  4AVZ A;  1O8J A;  1KTW A;  1O8D A;  3LMW A;  2EWE A;  4OJ6 A;  3JUR A;  4OZZ A;  3FY3 A;  1IDJ A;  1OFM A;  4XR6 A;  2UVE A;  1PLU A;  3GRH A;  1HG8 A;  4OJ5 A;  4XOP A;  2O1D A;  4XNF A;  4XON A;  2NST A;  2UVF A;  4OJP A;  2NSP A;  4MR0 A;  3B90 A;  4XLF A;  1AIR A;  3VST A;  2NTQ A;  4XN0 A;  4XOR A;  2PYH A;  1X0C A;  3GQA A;  3KRG A;  1O8K A;  2NTB A;  4C2L A;  2X6Y A;  4YZA A;  3B4N A;  1NHC A;  2NT6 A;  4U4B A;  1IB4 A;  4XLH A;  1O88 A;  3WWG A;  4NK8 A;  1H80 A;  1OFL A;  2ODL A;  1EE6 A;  1IA5 A;  1RMG A;  4XKW A;  2VBK A;  4XQF A;  2O17 A;  3UW0 A;  3SUC A;  4XLC A;  4XMY A;  1RU4 A;  4XL9 A;  1VBL A;  1DBO A;  4YZQ A;  5C1E A;  1O8E A;  1OGM X;  2IQ7 A;  1CZF A;  4I84 A;  3VSV A;  5C1C A;  1O8H A;  4XN3 A;  2QY1 A;  3T9G A;  1PE9 A;  4Z03 A;  2INU A;  1KCD A;  2X3H A;  3GQ9 A;  2NT9 A;  4OZY A;  1IDK A;  4URR A;  2X6X A;  4YZ0 A;  2VJJ A;  4NK6 A;  4EW9 A;  1O8M A; 
#chains in the Genus database with same CATH topology
 5DN6 A;  2HVR A;  1VF7 A;  4RAY A;  4RB1 A;  1R23 A;  4RB0 A;  4L5E A;  3CF5 F;  4MXN A;  4M3G A;  2FD5 A;  5EF6 A;  4RD2 A;  2W4S A;  3KX2 A;  3MAJ A;  3JRE A;  2MAB A;  1YJ9 B;  2I8D A;  3LSI A;  4CCK A;  3G1L A;  3LMM A;  3QSY A;  3IKT A;  3QE2 A;  3CLO A;  4HST A;  2WTE A;  3EUK L;  1N05 A;  1XG2 A;  4BAY A;  2HQ5 A;  4UZF A;  1R1V A;  2QEX I;  1TWC J;  4AM3 A;  4CCL A;  1REP C;  4A0Y A;  2DYI A;  3VSU A;  3CCJ I;  3WU1 B;  1EFC A;  2JSP A;  1VQL B;  4BHP A;  1QVG B;  1IG7 A;  2DCU A;  4PSW A;  5DD4 A;  2VLA A;  5FKK A;  3F8N A;  4FCY A;  1XB2 A;  1N8R D;  3GVJ A;  2ZJQ F;  1K79 A;  2IBD A;  2YU3 A;  3FM3 A;  4A3I J;  3AL0 C;  2OC6 A;  1JB9 A;  1LDD A;  3D5L A;  4LIT A;  2QGG A;  4V2G A;  1QA1 A;  2VPR A;  4IZZ A;  5IYP A;  4TKO B;  2QQA A;  1ETV A;  5DUK A;  4TMV A;  1IHM A;  2OBS A;  2L7K A;  4PUS A;  1FLI A;  3BNW A;  3OOC A;  2WZN A;  1GV2 A;  4MTD A;  3OYK A;  1OR7 C;  1WXR A;  2HTJ A;  2UV1 A;  2QMU A;  3LSP A;  3V42 A;  1BJK A;  4RDJ A;  4OIP F;  1ELO A;  2LTP A;  1FZP B;  3ZRG A;  3E5U A;  2K27 A;  3RIR A;  4CO8 A;  4QLC U;  1J59 A;  2XC1 A;  3W2H A;  1GT0 C;  4HW0 A;  3TW6 A;  3AVU A;  3QPL A;  3ZQC A;  5HNH A;  3AL0 B;  4B44 A;  2ZKZ A;  1OOC A;  3CRZ A;  4HNV A;  1QJV A;  4XRS A;  2ETH A;  4OOI A;  2OU2 A;  2ZIT A;  3SLD A;  3ABM H;  3LA3 A;  5JHU A;  3V8K A;  2NS8 A;  2GXG A;  2LY2 A;  3KYD B;  3QFR A;  1B8I A;  2FX0 A;  1TT0 A;  3H3V K;  2O1D A;  1FP1 D;  2ZZG A;  1Z77 A;  4Y7N J;  4KN4 X;  4XID A;  1T95 A;  1X1B A;  2ACJ A;  5M5Y J;  4ESB A;  3W5V A;  3VST A;  2A3S A;  1MNE A;  1QHG A;  2NNY A;  3ZCO A;  4IHX A;  2PYH A;  2K85 A;  1ZRE A;  3WGI A;  1FYM A;  4ACA A;  4IHV A;  2MSY A;  4O3M A;  2CV2 A;  3T1B A;  2VN2 A;  4RS8 A;  4M0L A;  2MC3 A;  1P4M A;  5KCM A;  1W1W E;  4XRS G;  4A0Z A;  4QVJ A;  1HC8 A;  4EM0 B;  4G5G A;  1O88 A;  5IYB J;  1FDR A;  1W34 A;  4DW6 A;  2RDP A;  1H80 A;  4R79 A;  1A36 A;  3RZD J;  4A93 J;  1IA5 A;  3QWL A;  4B4C A;  1Y6I A;  2IEK A;  3C2H A;  4V2F A;  3TMO A;  1X4O A;  1ZKG A;  4IL6 C;  2R4G A;  3M4O J;  1LNW A;  2EFQ A;  1ZTR A;  3WTU C;  4HX4 A;  3HOV J;  3NAR A;  3BH4 A;  3AVW A;  2CJJ A;  4X07 A;  1K8F A;  1B72 A;  3U21 A;  2A05 A;  2XIG A;  4E0F A;  3OR2 C;  1XX5 A;  3QQA A;  1S8N A;  3QPH A;  4M2L A;  3CJQ B;  3L2V A;  1S72 B;  3V76 A;  1JJ2 B;  5K5O A;  5KVR A;  3MKL A;  3WTS C;  3WU0 A;  1IN4 A;  5CVJ A;  4L5I A;  4PGH A;  1U8B A;  1IDK A;  2GOM A;  1WOS A;  4OAZ A;  5B1A H;  4AYB A;  1YO5 C;  3SXY A;  3WTT C;  3ONQ A;  5F4J A;  2V4J C;  4BE2 A;  4CCJ A;  2PEC A;  3JX8 A;  4PDK A;  3L2U A;  4IQ4 A;  5DNS A;  1RR7 A;  3KP4 A;  1ZLK A;  3H35 A;  1CQX A;  2OQR A;  2BV3 A;  2OCE A;  3U6B A;  3A1P A;  1VQ7 B;  2XGJ A;  3Q9V A;  4UAJ A;  2IA2 A;  3G4S I;  2AS5 F;  2IS2 A;  1QHH D;  4ENJ A;  4EJV A;  1T98 A;  3LQ6 A;  4K1X A;  2QGU A;  5IYC J;  3SZG A;  4HNU A;  4KIT B;  1W0J A;  1USS A;  4XRM A;  1QFZ A;  1WGX A;  1WFX A;  4Y33 A;  3DWL E;  3QYB A;  3U9G A;  1JUS A;  2HLD A;  2BSA A;  1VTN C;  1UCR A;  3EQO A;  2LK2 A;  5FL7 A;  2V7W A;  3CCV B;  3B02 A;  2LBF B;  5E1W A;  1O8G A;  2UUZ A;  3TED A;  3S1M J;  2YWG A;  3OZU A;  2JA2 A;  1NJI D;  4BQQ A;  3RJP A;  1FSE A;  3DF8 A;  2WA0 A;  3BTJ A;  3KLO A;  3PUM A;  3KZY A;  3R6J A;  2BMW A;  2CQK A;  4MO7 A;  2BVL A;  3FHN A;  2LY1 A;  3FXJ A;  2Y69 H;  1LVA A;  1FBS A;  4A3K J;  1SC7 A;  1AKH A;  1N08 A;  5H20 A;  1HW2 A;  4Y9U A;  4Q7J B;  1MBF A;  1JKR C;  1I1G A;  1WP6 A;  2CND A;  2IGM A;  4BBS J;  2M3A A;  4J19 A;  2KVO A;  2M5S A;  1ETX A;  1YIJ B;  2IPQ X;  3CME I;  3F9K A;  2XZP A;  5AMV A;  4L9N A;  1VQP B;  2VON A;  3KL9 A;  2QBY A;  4V19 K;  4OZZ A;  2C4U A;  1E3H A;  3H0G J;  2IS6 A;  3FY3 A;  2QSF X;  5D5V B;  1N78 A;  1Y8Q B;  4HE6 A;  2B7C A;  4WX9 A;  3DQV C;  1HG8 A;  2DFH A;  3PO2 J;  3ECH A;  4OJ5 A;  4EJW A;  1VQ5 B;  3HEF A;  2CF4 A;  1JUP A;  3F0C A;  3CC7 B;  2NST A;  4MR0 A;  2V6C A;  5C44 J;  4GXO A;  4NCN A;  3DEU A;  2VBW A;  5FRN A;  3QFC A;  4HLY A;  3H92 A;  4ZZD A;  3RIQ A;  5JMC B;  2QYO A;  3HTU A;  1RC9 A;  2XTY A;  1F5T A;  5KNL A;  1X58 A;  3W2V A;  3GFM A;  2DU9 A;  4U9U A;  2VKD A;  1TYU A;  2XPW A;  1IB4 A;  1FTZ A;  2Y30 A;  4G7O F;  2Q6K A;  2VFN A;  1WOR A;  3FJO A;  4YAO A;  3W2G A;  1QVU A;  4BQN A;  3J80 K;  2ODL A;  4HZF A;  4WK8 F;  1QGZ A;  1O57 A;  1N75 A;  3PUN A;  4IRG A;  3I4N J;  4NC8 A;  2XEX A;  4G7Z F;  3REO A;  3BY2 A;  2HDN B;  1TWH J;  1IZ1 A;  1BC7 C;  2XKP A;  3VR6 A;  1VQ8 B;  2D5V A;  1BMF A;  2LYC A;  2M8E A;  4YZQ A;  2F3L A;  2DEU A;  3BCB A;  1BN5 A;  3FMR A;  3IH2 A;  2QWW A;  1QZZ A;  4KT6 A;  1Z05 A;  3HSR A;  2QF7 A;  3F6O A;  1O8H A;  2M30 A;  2C78 A;  3PL8 A;  2P3M A;  2EFP A;  4WZK A;  2RNG A;  4HLX A;  4HBL A;  1WJB A;  3ZQG A;  2DMP A;  4GFB A;  4HF1 A;  4PAB A;  3VSL A;  3L2W A;  5HLH A;  3QU6 A;  3LSH A;  1GUU A;  3CO7 C;  1DU0 A;  3I55 I;  2KKO A;  3FXO A;  1D1N A;  3MWM A;  4N0B A;  1WJC A;  3K4M A;  5BQT A;  4L0Y B;  1AOY A;  1W0T A;  3LA2 A;  1I50 J;  3WGH A;  4AID A;  4W8Q A;  2WAD A;  5L3F A;  3SLN A;  2HPM A;  4KNY A;  4OU0 A;  3IV5 A;  1TQP A;  2MD5 A;  4IJA A;  5ICF A;  3H0D A;  2VBU A;  3ASR A;  2HXI A;  4DBR A;  2E19 A;  5D5U B;  2WPD A;  1YW9 A;  3BR0 A;  1RUO A;  4IHS A;  1X3Z B;  2EIM H;  1HDP A;  1JE8 A;  2ISY A;  3H09 A;  2BSP A;  2AXL A;  4C3I J;  2VUM J;  3CD6 I;  5C4X J;  2JT1 A;  2HI3 A;  2R7X A;  4CYC B;  1K5C A;  3FZV A;  1K4Z A;  2F1M A;  2L9N A;  2EFG A;  1VQ8 I;  3G73 A;  2WJY A;  3LOC A;  2DOD A;  3FK6 A;  3LQR A;  4E4H A;  1RQP A;  1GQ8 A;  2D2W A;  4XLP F;  2MFZ A;  3P4G A;  2MLG A;  2HDW A;  2V9V A;  3RPQ A;  1OB5 A;  2X1D A;  4KYW A;  2VNK A;  2DO7 A;  1GO2 A;  1ZH5 A;  2NVU B;  1G3W A;  1QZE A;  1HF2 A;  4BAC A;  1V4R A;  4A5M A;  2R0Q C;  2ME6 A;  5J8C A;  1TWG J;  3QYE A;  1OFE A;  4DBQ A;  2X85 A;  1L3L A;  1IN8 A;  1APL C;  3A8J A;  2R5Y B;  2B9S A;  1O7L A;  3CDI A;  3BZ6 A;  1W2B B;  1QCX A;  2ZJP F;  4B3A A;  4CCO A;  2K4B A;  2QEN A;  2XAG A;  3CC4 I;  1UHW A;  4OMY A;  4C30 A;  1ITY A;  4EEF G;  4CXF A;  1TL8 A;  4Z4U A;  3S2W A;  4FIS A;  4KIG A;  4RD3 A;  1XN7 A;  2GZW A;  1F36 A;  3HSF A;  3E3V A;  5HOD A;  4TMZ A;  3HPH A;  1QRY A;  2Y2Z A;  3H5A A;  4WXH A;  1TW3 A;  2DK5 A;  3HOZ J;  2FUG 2;  3KCC A;  1NB9 A;  5HXB A;  1FTT A;  4XKC A;  2DAO A;  3C2B A;  3VB2 A;  1P7J A;  4J01 A;  4ZTJ A;  4EJU A;  3PO3 J;  1B8I B;  2Q6L A;  2R7O A;  2DOG A;  3GLL A;  2GJR A;  2HEO A;  2XOK A;  2OBT A;  2KP6 A;  5F04 A;  4G6T B;  4PJ0 C;  1Y1W J;  1IRF A;  3VYT B;  3S15 J;  4IVN A;  1W5C C;  3GWZ A;  4UVB A;  1DG1 G;  3LWF A;  5B5E C;  1G3S A;  4IHW A;  4II3 A;  3GF2 A;  2PG4 A;  3IWZ A;  3TGN A;  4NHJ A;  5CQG A;  1TQI A;  3SEZ A;  2BBY A;  3KFW X;  3O8H A;  4HV5 A;  4CH7 A;  1YHQ B;  2B0R A;  3ZMU A;  4HPQ A;  3DU6 A;  4LB6 B;  2VBK A;  2X1C A;  3D5R C;  2KLO A;  1RU4 A;  1KZH A;  1E3P A;  2OBR A;  3QOE A;  3DPL C;  3CDH A;  1NG6 A;  3KPH A;  1T38 A;  4G1V A;  1EWY A;  5H59 A;  2A61 A;  2HYJ A;  3KIO A;  5EG0 B;  3TDZ C;  4NBS A;  3R0A A;  4PFP A;  1GVD A;  3JAM K;  2PLY A;  3ML3 A;  3V7S A;  5HS7 A;  2CYY A;  1TP4 A;  3HHH A;  1MND A;  3A0B C;  2V9K A;  4UVA A;  1YX3 A;  2MD0 A;  4YII A;  2FQ4 A;  5EYR A;  2IS1 A;  2EBI A;  5FGM A;  4EGZ A;  1JI8 A;  4X8I A;  2DXI A;  3WG9 A;  5F0H A;  3BG7 A;  2XUB A;  2GWR A;  4RDU A;  2W7N A;  1JTY A;  1WJD A;  2M7A A;  5EEG A;  4RMN A;  1IGN A;  5FB2 A;  3CCJ B;  2D9R A;  2PYG A;  1XDS A;  1H0M A;  1UMQ A;  2DMN A;  1P92 A;  1E3X A;  1UEL B;  3WXM A;  2JPB A;  3J7A O;  1K73 D;  3K7A J;  2EIX A;  4X06 A;  1PXZ A;  4DYQ A;  2N8G A;  1MAB A;  4BDY A;  2CUE A;  1JT0 A;  3W3C A;  4MLO A;  3I59 A;  5CDF A;  2OJE D;  4ON0 A;  4WF2 A;  1FND A;  2RNJ A;  1FEX A;  2E34 A;  2LFB A;  4PC6 A;  1PUE E;  2XNC A;  1QA2 A;  3IRR A;  3GTO J;  1ZN2 A;  3TL4 X;  1MW7 A;  1OCC H;  4NNJ A;  2YX7 A;  2E7X A;  2W82 A;  1BX1 A;  1KK1 A;  3QP6 A;  2R7S A;  3MCA A;  1TUI A;  3OFN A;  4YZX A;  3ELK A;  2W00 A;  1YG2 A;  3RCO A;  1G4D A;  2G9W A;  3PSF A;  2MG4 A;  1QPM A;  3CCR I;  1MD0 A;  4P5O A;  1TTT A;  1Q82 D;  1WH7 A;  2BN4 A;  3R6K A;  1TWA J;  2CW7 A;  3F6V A;  2WAE A;  1V5G A;  5BOX A;  3ECO A;  3KET A;  4XM3 A;  3CMM A;  1KU7 A;  4MIM A;  2R5Y A;  1YI2 I;  1LUJ B;  2VOP A;  2IAI A;  5M5X J;  3S17 J;  4WWV A;  2R7F A;  1O8D A;  1IW7 F;  1OB2 A;  3SEQ A;  4P96 A;  2STW A;  4IXA A;  3HOS A;  3GFJ A;  1P4X A;  3GTK J;  1VQ4 I;  5F4M A;  2P8T A;  3GRH A;  3G1O A;  1SVM A;  1K8A D;  3B6A A;  3O3K A;  4M53 A;  4P9S A;  3MZ8 A;  2NPF A;  4IRI A;  3F8C A;  1T33 A;  3OJX A;  3F21 A;  1WJ5 A;  3U2R A;  3S16 J;  2JJ7 A;  1YS6 A;  1QVF B;  4KIB A;  4F52 A;  2RQQ A;  4KFC A;  1Y0N A;  2PEX A;  4XSX F;  4WWC A;  2QE7 A;  3ZPL A;  3H5N A;  1POG A;  4JX6 A;  2MBF A;  2FE3 A;  4AC0 A;  4A3C J;  1W4M A;  5CVI A;  5ICC A;  2Z6B D;  1IXS B;  4B48 A;  2NTB A;  3VFZ A;  3LA7 A;  5GAE J;  3SKB A;  3GCM A;  3PJR A;  4GRI A;  3B4N A;  1Q81 D;  4YZA A;  3JRD A;  1BX0 A;  3V4G A;  1SEU A;  4NK8 A;  3RKW A;  1EJ9 A;  3DTK A;  2VBV A;  4QFM A;  3M8E A;  1MMS A;  3GSI A;  1LEA A;  5DCF A;  5JFR A;  2IOU G;  2QVO A;  2V31 A;  1D1C A;  3SQV A;  1U8R A;  2QTL A;  4KN7 X;  5K7Z A;  3OY9 A;  5KW9 A;  3RYP A;  1PJ6 A;  4QPQ A;  3QRF F;  4EH1 A;  2IA0 A;  3B8H A;  3TQN A;  1UG2 A;  3BJO A;  1I3A A;  2GAU A;  1U2R A;  3FKS A;  3N97 A;  4Z4V A;  4BH9 A;  1T39 A;  1WKM A;  1TTY A;  1KYZ A;  2EZK A;  4RM3 A;  4S0H B;  4EM1 A;  5F1J A;  3ZOB A;  1QA3 A;  3VEP A;  2BM6 A;  2H94 A;  4Y15 A;  4URR A;  1XSX A;  1Z67 A;  2IGN A;  2ZME C;  4J0Q A;  3L7W A;  2L02 A;  3M07 A;  2A5Y B;  5LMZ A;  2JK3 A;  4BJ5 C;  5L3B A;  1RI7 A;  2JA8 J;  4P6Y A;  2KHM A;  2PJR B;  1X2M A;  1HKQ A;  4KA4 A;  3RKQ A;  5J1Y A;  3ONY A;  1XDU A;  2XAH A;  1A6Q A;  4MTE A;  3J80 Z;  4BE0 A;  2LKX A;  5FKN A;  2AXT C;  3CZ6 A;  3DLA A;  1MJB A;  1R1U A;  5J1R A;  1E2X A;  1BJA A;  3SJM A;  4V02 C;  1ZEL A;  2F4N A;  3GLX A;  1WTH D;  3FMQ A;  1DDN A;  1JGS A;  3BC8 A;  4P22 A;  5FIU A;  5BS6 A;  3VPR A;  2BY0 A;  4GYG A;  1YIJ I;  5LRR A;  2IW5 A;  5D6E A;  5HZB A;  1CLW A;  1SVO A;  3GVA A;  4M6X A;  1K78 A;  2V7X A;  2GK6 A;  3ABK H;  4G7W A;  4M1K A;  2DW4 A;  3K4N A;  3LQE A;  4JQF A;  1X1P A;  1CNE A;  3VO1 A;  4N4N B;  1BI0 A;  4C2T A;  2ZBV A;  1ZM3 A;  4L9V A;  3Q39 A;  4YAF A;  3LNQ A;  3GME A;  5CVR A;  5JHF A;  3MHP A;  1SFE A;  4C0S A;  2L7Z A;  2PMZ N;  4M6V A;  1ZG3 A;  2KJC A;  3BY6 A;  2DI3 A;  5LGT A;  3PA1 A;  1KQ9 A;  1DPU A;  5IYN A;  2BY1 A;  4B3F X;  1T0F C;  2L3D A;  4IX7 A;  3L09 A;  4PK4 A;  4ZDL A;  1TNT A;  4ZGQ B;  2VJI A;  1IXC A;  1S6L A;  2Q1Z B;  2Z9O A;  3RY8 A;  3BH6 B;  1HOM A;  3G05 A;  4TMX A;  2Y31 A;  4XR6 A;  1R5G A;  3AKZ A;  2PX9 A;  2RRE A;  2ZBK A;  3FXR A;  2LSO A;  5DV5 A;  4HNT A;  4MEY F;  2R7R A;  2CRV A;  3PVD A;  2F5D A;  2E1R A;  3ZPN A;  1IRZ A;  3VSK A;  3WG7 H;  4AYB N;  1FWZ A;  2XB0 X;  3CF2 A;  5FLX Z;  3BR5 A;  1F4K A;  1K7A A;  1QQ1 A;  4OJP A;  3ABT A;  5TJJ A;  1UMK A;  4OPO A;  1E3O C;  4ZCM A;  3DU1 X;  3QFS A;  3HOY J;  3I71 A;  3WTY C;  2HYG D;  3N90 A;  4OMZ A;  2XGD A;  4UXN A;  2QSH X;  2R9V A;  3W2F A;  2H1K A;  1D3Y A;  5F27 A;  1QQI A;  4LB5 A;  3BR6 A;  4ZYE A;  2W6I A;  5H5J A;  4DIQ A;  3ISX A;  1R7J A;  3FXL A;  2LBF A;  2M34 A;  4NC6 A;  3MFK A;  2CRG A;  2LD5 A;  2V1U A;  1F60 A;  3OZV A;  4EMS A;  1S0U A;  2JJ1 A;  3PET A;  3LL7 A;  3OR1 C;  4XLC A;  1GXQ A;  1X3W B;  2NVX J;  3JCU C;  2G0Y A;  4G6D A;  4PJJ A;  1P4W A;  3OYC A;  1I6H J;  3JSO A;  1W87 A;  1U6G A;  2BE5 F;  2D1H A;  1EZG A;  4LLG F;  1TYV A;  5HZA A;  4LLL A;  1XMK A;  2Y0M A;  4H9G A;  1HKT A;  1ZRF A;  2B7B A;  3WYA A;  2OV7 A;  3B6C A;  3JRG A;  1FY7 A;  1AHD P;  2LH9 A;  1R6R A;  4BUP A;  2UZK A;  1TYW A;  2IT0 A;  2NT9 A;  4WZT A;  1BBY A;  4LBW A;  2XSJ C;  3QP5 A;  3HAG A;  3ASO H;  3CD6 B;  4NK6 A;  3E1S A;  1Y0U A;  3FXU A;  2QYU A;  4KIF A;  2W1O A;  4BE1 A;  3QFT A;  1RWR A;  3M9A A;  3FWE A;  4UNO A;  5AON A;  3ROU A;  4UB6 C;  3HL2 A;  4Q47 A;  3CMA I;  3OEH A;  3CCM B;  1KU3 A;  2GM4 A;  2EZL A;  1VQL I;  2C6Y A;  4D5C A;  3UR3 C;  3M8F A;  4JOM A;  1TZL A;  4M3E A;  1H85 A;  1SD6 A;  5GAH J;  2DMQ A;  3ZN1 A;  3N4M A;  4BYY A;  3HKZ A;  3Q9S A;  5IP6 A;  1O8I A;  5D6F A;  3JRC A;  2DY1 A;  1RNL A;  2BW3 B;  4RGR A;  4YFN F;  1JKO C;  1ETY A;  5DM7 F;  1NK3 P;  3I4M J;  4WZE A;  3EPZ A;  1FIA A;  4AIH A;  2K7L A;  3LQQ A;  4KH3 A;  1WJE A;  5JVG F;  3TP0 A;  2DA2 A;  4QIW N;  3DFG A;  3H36 A;  2FBI A;  3G1M A;  3LAP A;  1W0U A;  5L3E A;  3CC4 B;  4RLQ A;  3T8R A;  4YFO A;  1LE8 B;  3A01 B;  5BPD A;  1RKT A;  3BDD A;  1BR2 A;  3BPX A;  3K4B A;  2C5H A;  2NS0 A;  3BQJ A;  3K69 A;  4X0G A;  4D1Q A;  3OYF A;  2RVC A;  4H0E A;  3E20 A;  3FPK A;  2DLL A;  2XTW A;  2VNI A;  1TQM A;  3OS1 A;  1PYV A;  3ABU A;  4HOB A;  4X1E A;  5K7H A;  2GA2 A;  2KIQ A;  3EDP A;  4NC7 A;  5F1R A;  1BW5 A;  2GPJ A;  1IO2 A;  2M0C A;  2ZCW A;  5DEQ A;  4ETS A;  3I1F A;  1M90 D;  1SD4 A;  3B8Y A;  2KRC A;  5J3O A;  2IA1 A;  2NOG A;  2Q0O A;  4I02 A;  3E6C C;  1I6X A;  2LG4 A;  4NQW B;  4MYU A;  3IUO A;  1EA0 A;  2NNN A;  4OJ6 A;  3PUF A;  3GZ5 A;  1UG0 A;  3EUA A;  2QEX B;  2P6S A;  3FBI B;  2HU9 A;  1PLU A;  2W25 A;  3S93 A;  2JA5 J;  5HKK A;  2XT4 A;  1JJ6 C;  1J9I A;  1OCO H;  3OOP A;  3JQR A;  3CJT B;  3MKZ A;  4U0V A;  3C3W A;  4I0A A;  2QQB A;  3ASQ A;  3U6K A;  2XTX A;  5HLT A;  2LRD A;  2ZO4 A;  3HYI A;  1YW7 A;  2UWM A;  4DNC A;  1ZG5 A;  2A6H F;  4JP0 A;  4ROX A;  3CC2 B;  2W85 A;  3S1R J;  2D3N A;  3I9V 2;  4D5F A;  2BM5 A;  2X6O A;  3MKY B;  2CBX A;  4BDZ A;  1MDM B;  2YUH A;  5LLQ A;  2EV0 A;  1NHC A;  3KZI C;  2GIV A;  2F4O B;  2HS5 A;  3HG9 A;  3DCF A;  1DUX C;  3FMS A;  4KUM A;  2W84 A;  2VQL A;  5TGT A;  1AMO A;  2ZC2 A;  1VQP I;  3AG3 H;  1E64 A;  3BZC A;  1WPC A;  1H8A C;  2X51 A;  2JIZ A;  3OYB A;  2P81 A;  1ACI A;  1RMG A;  4EQQ A;  5E3N A;  1VND A;  3P7N A;  1G6N A;  5HOO A;  2DOF A;  1ZG1 A;  1DBO A;  4XK4 A;  1H8H A;  4D7M A;  3KEY A;  1YJW B;  4Y13 A;  2ZXI A;  2KFD A;  3LO8 A;  2EA4 A;  1T56 A;  1WQ2 A;  1SMT A;  3K4J A;  2JN9 A;  1YX2 A;  3VSV A;  4Y3O A;  2DIE A;  1LJ9 A;  5CYV A;  3CJN A;  3H94 A;  3JRH A;  3Q3A A;  5FFZ A;  2A68 F;  4O5V A;  1LEB A;  1XMA A;  4G6I A;  4ZH4 F;  1T2K A;  5DSZ A;  2YPR A;  1IV6 A;  5EEA A;  4I7H A;  2YWE A;  1JHF A;  1V3F A;  4M72 A;  4FTH A;  4DYC A;  4TN1 A;  1KK3 A;  2XGX A;  2PMH A;  1R5I D;  1S7A A;  4M4S A;  1V5F A;  3ZBU A;  1YLF A;  2LOO A;  3A0H C;  3CDL A;  4X7E A;  3DU5 A;  2E71 A;  2BEO A;  4RD6 A;  2XAF A;  4XLN F;  3KEW A;  5IT9 Z;  5GV8 A;  2OA4 A;  5TV2 A;  2VL8 A;  2K9Q A;  1AIP A;  2VC1 A;  4M3D A;  4ESF A;  3ESW B;  2HKX A;  1KD1 D;  4G12 A;  2OYN A;  2WY7 Q;  2ICW G;  1N0V C;  2VIX A;  2E5N A;  3GO5 A;  3OV8 A;  4W8R A;  4P6V F;  2IJL A;  2PQ8 A;  3ONU A;  4KKT A;  5F6F A;  1COW A;  2XZO A;  2TRT A;  3LSM A;  5DTD A;  5E17 F;  2WAQ A;  3DPT A;  3GQ8 A;  2P7V B;  4PJN A;  1BPL A;  4OPV A;  4TSF A;  3W6K B;  2FA5 A;  2VBT A;  2Z8G A;  3TDU C;  1MBK A;  1BR1 A;  2WV1 A;  5B66 C;  1DP7 P;  5F0F A;  4QV2 A;  1D1A A;  2W57 A;  5LRS A;  2MW8 A;  3JRF A;  4Z4T A;  2R92 J;  1MNM C;  2XRN A;  2KRH A;  4QPO A;  3R61 A;  1B9N A;  3QPT A;  1SFO J;  4DJA A;  3A03 A;  4D0P A;  2VB6 A;  3SJP A;  2R93 J;  3KLN A;  1EV7 A;  4P12 A;  1YIT B;  1OQY A;  3S3O A;  1Y39 A;  2JVH A;  4F91 B;  2X3U A;  4YFK F;  1KTW A;  5FLV A;  1J0R A;  3LMW A;  2ZL5 A;  1QVT A;  3NAW A;  1GAW A;  3X2Q H;  2CFX A;  1JGG A;  2KIS A;  3F23 A;  2R7Z J;  4C9Y A;  3EET A;  3K1M A;  1KMH A;  1BR4 A;  2E60 A;  3CCQ B;  3AST A;  3C1D A;  5TY0 A;  3SJZ A;  5GTI C;  5ILV A;  2E2I J;  4TMT A;  4E7H A;  1FSH A;  1YYV A;  4LJZ F;  3OS0 A;  3U1D A;  1WOO A;  3C2G A;  4RDK A;  3BG9 A;  1Q1H A;  3BCA A;  4MHG A;  2V5I A;  2DFE A;  1KRH A;  2C77 A;  5J6X A;  2VE9 A;  5KAI C;  2XF5 A;  4JX5 A;  4A12 A;  5FD5 A;  2G0E A;  2K3P A;  4EAT A;  2QM3 A;  3Q0V A;  4UB8 C;  2H27 A;  2HYF A;  2VNJ A;  1VQO I;  2VT2 A;  4DYR A;  5EGO A;  2FU4 A;  1ONV A;  2DDB A;  5FKO A;  1YRN B;  4W1U A;  2DOA A;  4HSR A;  1OKR A;  4FX0 A;  2VKV A;  2L9V A;  3V7R A;  5LFA A;  4M9Z A;  4DZJ A;  4HA8 A;  3K70 D;  3MEX A;  4XMY A;  1I27 A;  3PFI A;  3S3M A;  2STT A;  1MMD A;  3DKW A;  5LEJ A;  4EGY A;  3LJY A;  1MBJ A;  2O7O A;  2KQR A;  4I01 A;  2XAQ A;  3SFZ A;  5CQE A;  1OGM X;  4MEX F;  3M1C A;  3CUQ A;  5EEH A;  4PC3 A;  2WC2 A;  1H89 C;  2BVN A;  4HV6 A;  3P5J A;  1AWC A;  4M73 A;  1Y0R A;  2YWH A;  3BPV A;  1JNY A;  4L9T A;  1A31 A;  5KAF C;  2X3H A;  1LDJ A;  1YIO A;  2DT5 A;  4B3X A;  1H8E A;  3JR9 A;  2OK8 A;  1WSU A;  1UD3 A;  3I53 A;  4X05 A;  3AVT A;  4P1V A;  5L46 A;  4YZ0 A;  3AAF A;  1VQ9 I;  4EW9 A;  4ANJ A;  4I09 A;  2EIL H;  1LDK B;  3KEQ A;  1NRK A;  3BH7 B;  2LNB A;  1IDY A;  3RPU D;  1Z0X A;  3CCE I;  4YHB A;  4L5J A;  3VMV A;  4A2U A;  1ETK A;  2W48 A;  4P55 A;  5TIS C;  2P7C B;  3K4L A;  5ERI A;  1YJN I;  1Y8R B;  1XTA A;  2DTR A;  1TNS A;  5IT3 A;  1B72 B;  1XMX A;  1XS9 A;  3OKX A;  2R7U A;  4IPA A;  1KON A;  2Y0S A;  1O8F A;  2M4K A;  4QUZ A;  2DET A;  2QKM B;  4ASN A;  1S72 I;  1VLO A;  3OYJ A;  1WU8 A;  1EH6 A;  3ZMZ A;  3VMW A;  3FHZ A;  3TBI A;  4CIC A;  4HQE A;  2R5Z B;  1BL0 A;  1QG0 A;  1P9Q C;  2R7W A;  1K9M D;  3W5H A;  1I5Z A;  3ZSC A;  4CSW A;  2QZA A;  2UXN A;  2K9N A;  5FO1 A;  1QA6 A;  3ZC3 A;  2E36 A;  4BXX J;  3H9J A;  3BCF A;  1XCB A;  3ZQQ A;  2R5Z A;  2XAJ A;  2VOD A;  1BA5 A;  5E20 A;  1E62 A;  3G6E B;  2L0K A;  1B2R A;  4RAF A;  2L2O A;  1LFB A;  1KTV A;  1LKX A;  1Z6R A;  1SM4 A;  5B6I A;  3HIF A;  3B82 A;  1LFP A;  2A6T A;  5IT9 K;  1U3E M;  2DA7 A;  9ANT A;  1O8J A;  1UHM A;  5ILS A;  3N05 A;  2L5Q A;  1FBU A;  5FO5 A;  3L2Q A;  3GTL J;  2X0K A;  1WPK A;  1H88 C;  2FXA A;  4ACB A;  3BT9 A;  1A5J A;  5K1Y A;  1E3Z A;  3C7J A;  1DP3 A;  2CC2 A;  2OK7 A;  4Y7C A;  2BXY A;  4OIR F;  2Z5U A;  1K6O A;  3WE3 A;  2W6J A;  3RPU A;  3I54 A;  2HOE A;  4LFU A;  5FLM J;  3GFI A;  1O3Q A;  4N3N A;  3DV8 A;  1FPQ A;  1RZ4 A;  3MD2 A;  1QNT A;  3HKZ N;  2L7M P;  4IKF A;  1YOV B;  1IAW A;  3MN2 A;  1FX0 A;  5GAG J;  3ASN H;  1QU3 A;  3Q6Q A;  2LRE A;  2PN6 A;  1XFO A;  1KQ5 A;  2VKH A;  3R0J A;  3KP5 A;  5GV7 A;  3OYD A;  2V79 A;  1BQE A;  3K10 A;  1IUY A;  3EUH A;  1W7P A;  2GJK A;  2NS7 A;  2ZZE A;  3PNT A;  3CCS B;  2DA3 A;  3JQQ A;  3FKJ A;  1NHA A;  3J81 Z;  1A35 A;  4HG2 A;  1TSP A;  5L3G A;  2XDV A;  3HRU A;  2JA7 J;  1Q9S A;  2X8K A;  3CCU B;  3HZJ A;  1FOW A;  5IK2 A;  4A0X A;  5THX A;  1EE6 A;  2WR8 A;  2LP0 A;  2O61 A;  1GV5 A;  2O8K A;  3DBH B;  2E1B A;  1BLI A;  4XL9 A;  2QLZ A;  4AWX B;  1OCR H;  2BZT A;  4RGS A;  1D0Y A;  3E97 A;  3PA2 A;  1YLO A;  3P27 A;  1O8E A;  2XPV A;  3Q0U A;  1CZF A;  2KT0 A;  1B1B A;  2A07 F;  5FKM A;  1PKV A;  3FPP A;  4Z1M A;  4DZP A;  3P26 A;  4IOA F;  1MBH A;  1S3J A;  2ZSI B;  3FDY A;  4KT5 C;  3I56 B;  2Q2E B;  3BG5 A;  3GBG A;  4IHT A;  3TKY A;  4FWT A;  2ZFU A;  2JJ2 A;  2MYS A;  3P9K A;  2CMP A;  2QCO A;  4ABZ A;  3LSJ A;  4ZYH A;  2B0L A;  1WDT A;  3HUG B;  4Z4S A;  3OYA A;  5EZG A;  1VQM B;  3R6S A;  2VBE A;  4Z6Y A;  3FM5 A;  3OIO A;  4PJL A;  4BS9 A;  4RPB A;  1SFU A;  5DS0 A;  4GDF A;  2HQA A;  4X7C A;  5D8L B;  1JTA A;  1J75 A;  4RA2 A;  3IWF A;  4N3G A;  5DDG A;  4CZC A;  3GZN B;  2CK3 A;  3KP7 A;  3O6B B;  2LDU A;  3BLY A;  5ED4 A;  3JRB A;  2FQ3 A;  2O04 A;  1FMW A;  3SY2 A;  2A6E F;  1HDD C;  3FF5 A;  4CHU A;  1W0K A;  4YG2 F;  3IAM 2;  4KDP A;  5EDN A;  1T6Z A;  1BW6 A;  2CGP A;  1Z3Y A;  3WTV C;  5D4S A;  3OMY A;  2D1V A;  5LEK A;  4YAU A;  3AG2 H;  1B59 A;  3PNY A;  1OYY A;  3ZZT A;  5BPI A;  2DBB A;  2L4M A;  1OFC X;  2CQX A;  1R1T A;  3JSP A;  1SFX A;  4HF0 A;  1P4A A;  1OYW A;  2ZB9 A;  4HWV A;  2JUC A;  1ETQ A;  1CF7 B;  3BQZ A;  3CLQ A;  3GQ7 A;  3CQZ J;  1ZUN B;  2QXZ A;  1ZAR A;  5M3M J;  1HW5 A;  2M45 A;  2VBM A;  2Y9Y A;  2OF7 A;  2VZL A;  1S9H A;  1BOB A;  2VE8 A;  3ZUG A;  1VJS A;  5HDG A;  4PZJ A;  2ELH A;  3ZZ0 A;  2OUM A;  3JUR A;  2PFB A;  3KZZ A;  3CUO A;  4LG3 A;  4EJO A;  2DFF A;  4ZJZ A;  1YQA A;  2ESN A;  3QAH A;  1SKY B;  4ENK A;  2M9H A;  3L2C A;  4CQJ A;  4BHB A;  3TO7 A;  2IRF G;  4UUS B;  3G4S B;  1L1I A;  3BY1 A;  3M1E A;  1PVE A;  3ZXS A;  2XRL A;  4A3M J;  3IKV A;  1FNC A;  4XLF A;  2HZT A;  3VO2 A;  4DNT B;  4OWR B;  2NTQ A;  1F43 A;  1G7C A;  4BL0 B;  4HEA 2;  2BVM A;  3VMF A;  3ZQL A;  2GXA A;  3E5Q A;  1N77 A;  1VQN B;  2HNH A;  1SFK A;  3HTS B;  4AU7 A;  3K70 C;  1DU6 A;  1V5V A;  3WQZ A;  3UKG A;  3F8M A;  1Z7L A;  2NV4 A;  4C3J J;  4TMW A;  2HCJ B;  3F8B A;  3E6M A;  4N4O B;  4MGR A;  3CCL I;  1WOP A;  5ILU A;  4UZE A;  2AHQ A;  3BZK A;  1KYW A;  3Q5F A;  1DDG A;  2XZL A;  2WYR A;  5IOY A;  1KK2 A;  5GPA A;  3BG3 A;  1E79 A;  4WZL A;  2O3F A;  2HR3 A;  2RGV A;  1UZC A;  4OAY A;  2IQ7 A;  1B9M A;  1I3Q J;  3A3B A;  4G8X A;  2AO9 A;  2FML A;  2ZJ2 A;  4P3I A;  2KIM A;  4W97 A;  4A5N A;  5FKL A;  2CSO A;  3E7L A;  4LMY A;  3GQ9 A;  2RQP A;  3TP3 A;  3ZMV A;  3NB2 A;  3ZP5 A;  2DMT A;  2E1C A;  4QVA A;  1E63 A;  2O8X A;  2DPU A;  3SHF A;  1IB0 A;  3MMY B;  2BPO A;  2NRA C;  4HAM A;  1SD5 A;  2Q6O A;  3TO6 A;  3HB9 A;  4A3F J;  5K7F A;  4P25 A;  2YUS A;  2VXZ A;  4L9J A;  1V54 H;  3GX4 X;  2K86 A;  1JT6 A;  2DT6 A;  1W7P B;  4ENM A;  3TOA A;  1RQR A;  4N9H A;  4TT3 A;  4C3H J;  2MH9 A;  2DN0 A;  2V1N A;  2MGQ A;  1A8P A;  1NBM A;  3CCM I;  3L1P A;  1HF0 A;  3WTZ A;  2ID3 A;  1WJF A;  5JLX A;  1F1Z A;  1WH5 A;  1FOK A;  3ZZU A;  2V26 A;  2J5O A;  2QKL B;  1SAN A;  3ZR8 X;  3OYE A;  3NRV A;  3A35 A;  2XF6 A;  3AG1 H;  4JX4 A;  4MFE A;  2HWV A;  2KIF A;  1G7T A;  4PFO A;  2PIA A;  3WBK A;  2AHO A;  2P4W A;  4FX4 A;  4U88 A;  2CV0 A;  1Z21 A;  1VQM I;  2XV4 S;  3OJW A;  2OTL I;  2OPT A;  3AGP A;  4OIN F;  5IYW A;  4XD7 A;  5DUI A;  1XG1 A;  4IOC F;  1QX4 A;  1MZB A;  3GVK A;  2KL4 A;  1DBG A;  3PSS A;  3JTH A;  2VYQ A;  2LR8 A;  3S3N A;  1ON2 A;  2XF7 A;  4CYC A;  1KU9 A;  4Y9R A;  1GJR A;  2O0W A;  5EG0 A;  4BKX A;  2VBS A;  2FOW A;  1ZAO A;  3E0J B;  4RB3 C;  1IJW C;  4BGD A;  2FX3 A;  5HNF A;  2H1L A;  5HS8 A;  2WJV A;  1FYL A;  1HA8 A;  1U2W A;  1KGS A;  2EPF A;  2K5C A;  4A3L J;  2JZY A;  3HJE A;  4RJL A;  2LF7 A;  2V1D A;  2OBP A;  3VYS B;  3BCD A;  3IH4 A;  1S4M A;  1EA3 A;  3RZO J;  4AF7 A;  1G59 A;  3OW2 B;  1IDJ A;  2EIK H;  4BHC A;  5DCM B;  4EV0 A;  3A01 A;  1QH0 A;  2LZJ A;  1VQ6 B;  4GYI A;  3CCU I;  1KZL A;  3OYH A;  1NG7 A;  2WAF A;  3D0S A;  1N07 A;  1AIR A;  1EFT A;  2HVS A;  4X7D A;  2VFP A;  5J8F A;  4G1B A;  3SZP A;  2F5E A;  2XGC A;  3PQK A;  1IC8 A;  4U0W A;  2PE3 A;  3G71 I;  2M87 A;  3FXM A;  4C2L A;  2JMW A;  1VQ6 I;  4A6D A;  5H6R A;  5H6Q A;  2RKH A;  3V8J A;  2F4I A;  3H5R A;  3CES A;  4RBO A;  2C5B A;  1ZGW A;  2XND A;  3T56 B;  2ZNZ A;  3DBL B;  2K3F A;  3CMA B;  1ON1 A;  4I0B A;  5F64 A;  2EQR A;  1OMI A;  2JRM A;  3OL4 A;  4BJT A;  1E43 A;  3HUG A;  4ENN A;  4LG0 A;  4XKW A;  3K2Z A;  5LBQ A;  1QRB A;  3E6B A;  4X6A J;  3PSZ A;  2XRO A;  2KMU A;  5C4J J;  1RET A;  1WI3 A;  3HC7 A;  3C18 A;  5GAD J;  2M0M A;  5FLX K;  2V4D A;  1FBQ A;  1VF9 A;  4I84 A;  3IH3 A;  3O2P E;  3OAA A;  3SZE A;  2I10 A;  4Z03 A;  1CNF A;  2CWE A;  3HPG A;  1FNN A;  1ERD A;  3SQN A;  3OPO A;  1E17 A;  3FBN B;  1KU2 A;  1D1B A;  1G7S A;  1STZ A;  1U9N A;  2IS4 A;  4IRH A;  4P1W A;  3ZQ7 A;  2VBY A;  4G7H F;  2CO5 A;  1FOX A;  1JA0 A;  2HDD A;  1XD7 A;  4YAW A;  4LC0 A;  3DKY A;  4FE7 A;  4M3B A;  1PUF B;  2R7V A;  4OPW A;  3GEZ A;  2DT7 B;  2YSR A;  1SVL A;  2F2E A;  2YU9 J;  2QX3 A;  2NXN B;  2F5C A;  4PCQ A;  3P9C A;  2KDZ A;  4L18 B;  3I58 A;  2EIJ H;  2H6B A;  3K1N A;  3W5U A;  2BY3 A;  3PM1 A;  3UNG C;  1U0J A;  3CTA A;  2EZI A;  4JK1 X;  4JMQ A;  2DK8 A;  4JRA C;  1SAX A;  1GVJ A;  4HYE A;  5JBQ A;  2K02 A;  3CP2 A;  4MFD A;  2PI0 A;  5D5W B;  3ZIA A;  2P5L C;  2XPU A;  2BGI A;  2GQF A;  1MSE C;  1LB2 A;  2ZBU A;  1ZRD A;  2UXX A;  1VLY A;  2TDX A;  2QQ8 A;  5E1X A;  4DQK A;  3N6Z A;  2BV6 A;  3ZQH A;  4HX8 A;  4B1R A;  1HST A;  1LM1 A;  1Z3X A;  5IYR A;  2OCC H;  2ZTN A;  3GXO A;  1JTX A;  2JVG A;  2VAS A;  1Z7U A;  1MDM A;  4P2N A;  3VYR B;  2X9D A;  3I5U A;  3CCY A;  5KSW B;  5JLV C;  5ICE A;  1ZR4 A;  3ZQF A;  4LBV A;  2DFI A;  2XC7 A;  2OD5 A;  4LGW A;  3AVY A;  1V5E A;  1ZM9 A;  3CUQ C;  4A3G J;  4AUX A;  2V9P A;  4LK1 F;  4AIK A;  1QZY A;  1TC3 C;  4W8S A;  2OTJ I;  3A4C A;  4I99 C;  1X3U A;  4J00 A;  3HHG A;  2NVT J;  2P0W A;  3V8L A;  1OB0 A;  2EV6 A;  2DMU A;  4PMH A;  5J1U A;  1BI3 A;  2GIZ A;  4AVZ A;  1WCM J;  5AN9 A;  1XGN A;  2EWE A;  1MMA A;  4XSZ F;  4YCQ A;  4LOC A;  2ZL6 A;  4G7X A;  3BP8 A;  3PEN A;  3WBJ A;  2ZJR F;  3D1N I;  3K9T A;  3GTG J;  2MC4 A;  4Y4R A;  1QGY A;  1HKS A;  5DYM A;  5LHG A;  3HOU J;  3WND A;  4QSH A;  3ERE D;  3SEJ A;  1D8K A;  2BGC A;  3HDD A;  1ETO A;  3GQB A;  2DQL A;  2QSG X;  3I0T A;  2ECB A;  4YIF A;  3V7C A;  2DJN A;  1S7E A;  1K83 J;  4PGO A;  4XOR A;  4WQM A;  2MH2 A;  1GLN A;  3M7G A;  1XGM A;  2KZV A;  1E0E A;  1MJA A;  4Z4Z A;  3GQA A;  5D8K B;  3PQJ A;  1UD6 A;  1EFR A;  2CQ7 A;  1BJZ A;  1LLW A;  3Q3S A;  1ETW A;  1T8I A;  3K4K A;  4G94 A;  1QUF A;  2GK7 A;  4E7J A;  2X4H A;  4B4D A;  1I8D A;  3J81 K;  4Z4W A;  4BU2 A;  1GHC A;  2QDX A;  1LPQ A;  4JYK A;  4PC2 A;  4BQO A;  4NB5 A;  3WHB A;  3ZN0 A;  3WTW C;  1FYK A;  4DK0 A;  4GCV A;  3HOT A;  1G3T A;  2ZL7 A;  4B3G A;  5JI6 A;  4E7K A;  3UW0 A;  1ULY A;  3K2A A;  3OWT A;  4QHY A;  1OJL A;  2MLK A;  1YIT I;  1XC5 A;  1OR7 A;  4ZDP A;  5IY5 H;  3EQL F;  4OOS A;  5FRM A;  4ITV A;  2PMU A;  1XGS A;  4KMU X;  1ZLJ A;  2E7W A;  2Z1D A;  1RKW A;  4DNR B;  1PJR A;  1Q7Y D;  1Z6T A;  5GPC A;  3ZGK A;  4ASU A;  1PE9 A;  1JXS A;  2Q6I A;  1KCD A;  1HLV A;  3ERM A;  3VNV A;  5J4Y A;  2FJ1 A;  3NEU A;  3OE7 A;  3NAU A;  2VJ4 A;  3K4C A;  3DBR B;  1JRG A;  4FXU A;  1WRJ A;  1R22 A;  4BY1 J;  3PUB A;  1OGO X;  1M1E B;  1KJZ A;  1JA1 A;  3U1K A;  1U78 A;  1YW8 A;  1DGW Y;  3COA C;  2WBM A;  2EB7 A;  2HFH A;  4I6Z A;  1G8X A;  4MQ9 F;  2L54 A;  4C2U A;  4XKV A;  2KDO A;  4KKS A;  1O8L A;  2M8G X;  5LGU A;  4IHY A;  3GTM J;  4FE4 A;  1W7P D;  3K1P A;  2V1X A;  3CP8 A;  3DTI A;  1IN6 A;  2E1M C;  2JRT A;  3TW7 A;  1D8T A;  4Z4Y A;  3LAJ A;  3OIQ A;  2K9S A;  3RYR A;  2V7U A;  4OP7 A;  2Z16 A;  1FX7 A;  1I7P A;  1G3Y A;  2FNA A;  2WSS A;  1L0O C;  3G6E I;  5A88 A;  2E35 A;  4M3F A;  1FC3 A;  1QPI A;  4YEI A;  2FSW A;  3BWG A;  3W2I A;  2F5F A;  5FFX A;  1K28 D;  4P26 A;  1MIJ A;  1ZYR F;  4G9Y A;  2R3S A;  2DA4 A;  5D4R A;  1E1R A;  1BHE A;  3L00 A;  1GR1 A;  5E8G A;  4RGU A;  3QYF A;  1TW2 A;  3GTQ J;  4YFX F;  4AIJ A;  1V55 H;  3T5X A;  4FT8 A;  1X1D A;  5JVT A;  1F20 A;  1K78 B;  2IVM A;  5A2Q K;  5CKT A;  2H6C A;  1ENH A;  1EKE A;  4XOT A;  1U5T B;  2BF4 A;  3AGQ A;  4K2E A;  2LVS A;  3S1N J;  2CW0 F;  2WV0 A;  3OYL A;  1FRQ A;  3IAS 2;  3CPX A;  1EP3 B;  1V0E A;  4BJ6 C;  4CDG A;  5D5X B;  2NVQ J;  5DD8 A;  4KKU A;  4RD4 A;  3ISP A;  4RAG A;  4M6Y A;  1BI2 A;  1WJA A;  1XB4 A;  4S05 A;  3PNV A;  2E2J J;  2VJ5 A;  2M1B A;  2RAE A;  4GO1 A;  1R5B A;  4RLZ A;  4UZU A;  1SKQ A;  3B90 A;  4FK8 A;  2ZXW H;  4ZYG A;  4WXC A;  1BI1 A;  5LHI A;  1ZQ3 P;  4XIC A;  3OZW A;  1K4S A;  2XB5 A;  3OS2 A;  3W2W A;  1FOY A;  3Q0W A;  1R58 A;  5IP9 J;  1FJL A;  1O3S A;  1D0X A;  3KRG A;  1O8K A;  2E2H J;  2H8W A;  4RB2 C;  5FO0 A;  3ASP A;  2JN6 A;  2BHY A;  4RGX A;  2CH0 A;  4BY7 J;  3HRM A;  3I4P A;  3DPU A;  3VOE A;  3JRA A;  1W9X A;  3WWG A;  3HBL A;  1XQB A;  1HA3 A;  3CMY A;  1N0U A;  3WE2 A;  2W7Z A;  2VQC A;  1YJW I;  4RCZ A;  1TYX A;  3FKI J;  3H9G A;  4OOX A;  2BY2 A;  4DK1 A;  3GIR A;  1VQK B;  5CVV A;  2ZXH A;  5CPR B;  3BR3 A;  4E7I A;  2BHZ A;  2F48 A;  3OIP A;  1VQO B;  3ZQI A;  1AKH B;  4YDT A;  3SYT A;  1MGT A;  3ZBT A;  4R8H A;  2VFQ A;  3M8J A;  4E7S A;  2ZFW A;  1S7O A;  3CCR B;  1ODD A;  2XAS A;  2YS9 A;  1X1C A;  3OYM A;  1JUM A;  1ORK A;  2PMZ A;  4F3Q A;  4EVI A;  3ULQ B;  1B23 P;  1B6A A;  1IUF A;  1MJ9 A;  2A5W A;  2CV1 A;  2X6X A;  3E5X A;  2EH3 A;  1O8M A;  4Y52 J;  2HMA A;  3CCQ I;  3OP1 A;  1U5T A;  4P3Y A;  4I98 B;  2X48 A;  2CUJ A;  2CW8 A;  2FRH A;  3ZMT A;  1G2H A;  2RC4 A;  3MMP A;  3T53 B;  1YX5 A;  1H42 A;  1MMN A;  1R5O A;  5E3L A;  5TRD A;  2F1L A;  3OYI A;  6PAX A;  3F8F A;  1XGO A;  3LYC A;  4YEJ A;  1P7I A;  5KK1 A;  1K4T A;  3BC9 A;  3DDY A;  1IXR C;  3GTJ J;  1P6R A;  1FT9 A;  3HGY A;  3OSF A;  4UV9 A;  2DYR H;  4IO9 F;  1VQ7 I;  4OJL A;  2HOA A;  3MZY A;  1W36 C;  2B7E A;  1TBX A;  2J7K A;  1PP7 U;  2CQQ A;  3LFK A;  3JW4 A;  4CGZ A;  2R7T A;  4BXF A;  3T51 B;  2XAU A;  3HRS A;  4NUB A;  3ES9 A;  4Q4Z F;  1A04 A;  2FBH A;  3L2R A;  2E1N A;  2ESH A;  1JKQ C;  3GVL A;  3CUQ B;  2M5W A;  4XLA A;  2P5K A;  3GTP J;  3ZMD A;  5FRO A;  1PJ7 A;  2H09 A;  2OZU A;  4FQG A;  3KP2 A;  1FP2 A;  1EF4 A;  4OM9 A;  4LD5 A;  1Y56 A;  2EWN A;  4FHT A;  4B47 A;  4LBY A;  3EQN A;  1MH4 A;  3M3Y J;  1PDN C;  4A3B J;  3BR1 A;  4II2 A;  3NWT A;  3WY9 A;  1HBX G;  2K40 A;  3LSR A;  5M3F J;  3PIP F;  3W2A A;  1OLT A;  1N06 A;  2ZTG A;  1DAB A;  1GXP A;  3S32 A;  4UUS A;  5EGO B;  4OPS A;  1WI9 A;  5E6T A;  2DCE A;  3CXC B;  4WCG A;  2DQR A;  2BYV E;  2EA2 A;  3MKW B;  1S29 A;  1U5T C;  4HQM A;  2UVE A;  4YRV A;  2R7Q A;  2CW5 A;  5BMZ A;  4F55 A;  4F7D A;  2VBZ A;  3AFH A;  2VFM A;  4ZYA A;  2J8I A;  1X1A A;  4XNF A;  2HGC A;  4CYD A;  4E6K G;  4PAA A;  3Q38 A;  1Z9C A;  2OAZ A;  1A6I A;  3QPS A;  3KYC B;  2I5U A;  1O3R A;  3RKY A;  2JSC A;  2JUG A;  4KJZ A;  1EP1 B;  1OFD A;  2D45 A;  4P9U A;  4BEH A;  2GLO A;  2O6W A;  3CW2 A;  2B5O A;  1X0C A;  3GFL A;  1D5Y A;  1QGA A;  2LKP A;  5FD6 A;  1IN7 A;  5GTH C;  1EH8 A;  1J2X A;  2BX6 A;  4ZYD A;  4OIQ F;  4DQ2 A;  4F92 B;  1VZ0 A;  2P6T A;  4D9J A;  1QO0 D;  1K6Y A;  1KA8 A;  3BOQ A;  3EYY A;  5HVQ C;  1T6Y A;  5GP9 A;  3P9I A;  3VOD A;  1G7R A;  2E1M B;  1R4N B;  4XQF A;  4NDL A;  3QOD A;  2O17 A;  2PJP A;  2Z33 A;  2JPC A;  1MH3 A;  1X4P A;  2VOO A;  2KPM A;  4I76 A;  2HDC A;  5BSY A;  3ASS A;  1ZRC A;  4UHT A;  5C1E A;  1DQU A;  2BGJ A;  2CFO A;  5AIP A;  1UB9 A;  1X19 A;  5J3L A;  2C2W A;  1Z91 A;  1EH7 A;  2L4A A;  1I39 A;  1LVK A;  2A69 F;  3L9F A;  3FIW A;  4AC9 A;  3GW2 A;  2G7U A;  4FET A;  3JAM Z;  3PFY A;  2VT3 A;  1HW1 A;  3H1C A;  4UY8 I;  3CCV I;  2DJI A;  3JRI A;  5H2F C;  1VQN I;  1R4M B;  3DKX A;  4DGW B;  4B09 A;  1VQ5 I;  1FMV A;  4CCN A;  2Y75 A;  5J47 A;  1D0Z A;  1HVX A;  5B3S H;  4CCM A;  4A69 C;  3AVX A;  2QUF A;  1BOA A;  1J09 A;  5E3M A;  1WSV A;  3H9N A;  1H9G A;  1I1S A;  4PC1 A;  3AG4 H;  3ZMS A;  1PP8 F;  1X2N A;  2YR2 A;  2COB A;  4RPD A;  2C4T A;  3BTI A;  2FF4 A;  2ZZF A;  2GOX B;  4EJT A;  2RN7 A;  1QRC A;  4UVC A;  1UD8 A;  3CO6 C;  1MKM A;  3J7A Y;  2VXD A;  2ZME B;  2XSD C;  2LY9 A;  1OPC A;  3D5S C;  4E7Z A;  2ISZ A;  1FNB A;  3BRO A;  2O9L A;  4Q48 A;  3HXL A;  1R49 A;  1YJ9 I;  3R4K A;  1DPR A;  3E6D A;  1KQ8 A;  1JHH A;  1IN5 A;  4U49 A;  5A89 A;  3CC7 I;  3OYN A;  1J5Y A;  1OYI A;  1XSD A;  2DPD A;  3WNC A;  1WMR A;  5E79 C;  2Z2S B;  1YHQ I;  3I56 I;  4YAL A;  5J40 A;  2Z99 A;  1ZM2 A;  4ZV4 A;  2CG4 A;  3MQ0 A;  2D74 A;  3ML6 A;  4A3D J;  2PLF A;  2V7Q A;  3LVB A;  4Q5S F;  5FA6 A;  3ZPP A;  2ELJ A;  1CF7 A;  4KIC A;  5IYD J;  2DDA A;  4UV8 A;  4AF6 A;  3CME B;  3DEE A;  2X1E A;  4E7L A;  1D8J A;  4HF2 A;  4JBA A;  2XNJ A;  1D2E A;  5F0C A;  5CLS A;  1VI0 A;  3SDG A;  4MNU A;  2F6C A;  1JKP C;  1SAU A;  1MBG A;  2K9L A;  2M4G A;  2WWY A;  1XSV A;  4LLN A;  3JQP A;  2IGK A;  1I18 A;  2VKE A;  5FNZ A;  4ZTF A;  3BJ6 A;  4PGG A;  3BR2 A;  5L3C A;  3A8K A;  1OCP A;  4CZZ A;  4PJM A;  4A6E A;  5TR9 A;  2EJR A;  3PIO F;  5F4O A;  1Y1V J;  3TO9 A;  1SD7 A;  2GA1 A;  3EUH C;  1SMY F;  3HM5 A;  4DQL A;  4ZGN B;  4F7Z A;  1QGP A;  4TV7 A;  1DGR M;  4KMF A;  4X7F A;  2QQ9 A;  1J9Z A;  3V7A A;  4IW3 B;  5B1B H;  4XN0 A;  1UHS A;  2L01 A;  4M9S A;  5FJ8 J;  5K5Q A;  3CJR B;  3JU4 A;  2EIN H;  5JLW A;  2ZME A;  1ZR2 A;  1MBE A;  2COM A;  2NAZ A;  3SDB A;  1NDH A;  2X6Y A;  2OTJ B;  1EFU A;  3FXK A;  2QN6 A;  2OZ6 A;  3OW7 A;  1BM9 A;  3TOB A;  4U4B A;  4ZC3 A;  2EFO A;  2Z3Y A;  2TCT A;  5IP7 J;  2EFW A;  2RV8 A;  2Y9Z A;  3MZH A;  2ZNY A;  1UJ8 A;  2PJR A;  3WNB A;  5IOZ A;  4Z4R A;  3CPW B;  1UAA A;  1LQ1 A;  4E70 A;  3KYL A;  1PJ5 A;  2IGO A;  1V0F A;  2DTZ A;  3LST A;  2VNH A;  2VQG A;  4OOV A;  4Z2Y A;  1QFY A;  2FEZ A;  2ME0 A;  2CUZ A;  3LSG A;  3FX3 A;  1W5S A;  2VC0 A;  1OIS A;  3DP7 A;  4QWQ A;  3RTR A;  4DOZ A;  4L0Z B;  2OQG A;  2KRF A;  1LE8 A;  3RDI A;  1BC8 C;  2I1L A;  3AK5 A;  3AVV A;  1YS7 A;  4A3J J;  1RIO H;  2INU A;  2M7B A;  2E1O A;  2ZSH B;  1E1Q A;  2CU7 A;  1K61 A;  4LBZ A;  2E5Z A;  2VFO A;  5LGN A;  1T08 B;  5AIQ A;  3OYG A;  2VJJ A;  2HPI A;  3KEO A;  2D3L A;  2P5V A;  2AQE A;  3T8T A;  4ZCI A;  4PC7 A;  1OCZ H;  3GUD A;  4UUT A;  1UST A;  2PBI A;  2WB1 N;  5F08 A;  2IP2 A;  2VBX A;  3IC7 A;  1O4X A;  3CCL B;  3H3Z A;  3B78 A;  4YEL A;  1TLL A;  4HE5 A;  1KCC A;  3IRQ A;  3Q6R A;  2DA6 A;  3I59 B;  1HQC A;  2FMY A;  5DM6 F;  2NZM A;  5A2Q Z;  1VQ4 B;  5CJ9 A;  4NBQ A;  1HZE A;  5ICG A;  1GAQ A;  1S5L C;  1YJN B;  1EP2 B;  2H8R A;  3S14 J;  1VHO A;  2GRE A;  3H3U A;  1IRG A;  3RQI A;  5HDN A;  1U9O A;  3OEE A;  2GQQ A;  3J7Z I;  1MRZ A;  4RAZ A;  5L3D A;  4Z06 A;  3LFU A;  3E1Y E;  4W8T A;  4MYT A;  1W5T A;  4D7N A;  1NB0 A;  5CVU A;  1FRN A;  2XVC A;  3H9Q A;  3OL3 A;  1C0W A;  1T6X A;  4R71 A;  2L9S A;  1Q86 D;  4Y17 A;  3A2K A;  1RES A;  3VDX A;  1H9T A;  2FNP A;  2M2E A;  2R7D A;  4X0C A;  4BNC A;  4U0Y A;  2B63 J;  1VHE A;  2LC2 A;  4HDU A;  2K9M A;  3DTE A;  2AQF A;  3LNN A;  4AD9 A;  2QA4 I;  4LG0 B;  1QUE A;  2NYX A;  1OGI A;  3MVP A;  3OSG A;  2HQN A;  3G71 B;  1HSJ A;  2DYS H;  3WGG A;  3A8I A;  5BNG A;  3NWS A;  1WVR A;  1R5H A;  3EYI A;  3S8P A;  2X0L A;  4B43 A;  1OFM A;  1QBJ A;  2RC6 A;  3W6J B;  2FBK A;  2XHK A;  1FNM A;  2XT2 A;  1O3T A;  3RSN A;  2HOT A;  4L8J A;  4XON A;  4QTR A;  2V7V A;  2UVF A;  1WHU A;  3FIS A;  2NSP A;  1T5E A;  1WWX A;  1FIP A;  4RLF A;  2ELK A;  3GZ6 A;  4RM0 A;  5HLI A;  1UD4 A;  4P9F A;  2ZXJ A;  2RC5 A;  1W35 A;  5KHD A;  1DAR A;  4GQN A;  3OOU A;  3S1Q J;  2L7F P;  3R60 A;  4IQJ A;  1WZ2 A;  1F9N A;  3TH0 A;  2ZZQ A;  2ID6 A;  2JTV A;  2CQN A;  3RKX A;  1OHH A;  2HZD A;  4F93 B;  2K4J A;  1IJF A;  1JJ8 C;  4XLH A;  2CS3 A;  2O5R A;  2Q8K A;  3IL2 A;  4RD0 A;  4BEH B;  5A8A A;  1R36 A;  1BIB A;  2LLK A;  2QZ8 A;  3QU3 A;  1VQK I;  2F4M B;  1OFL A;  3HGG A;  5HS9 A;  2BM7 A;  4ZDO A;  2CUF A;  1NTC A;  2JDI A;  2GJP A;  1OCT C;  3K6G A;  3HOW J;  1EXM A;  4U87 A;  1NK2 P;  2Q2E A;  3KP6 A;  1Y0Y A;  3CB4 A;  1VBL A;  4LIU A;  3VWB A;  2ECC A;  3WTX C;  2OTL B;  1J7K A;  3CCS I;  4IEJ A;  1UD2 A;  3DLL F;  1B4A A;  4XRF A;  3G2B A;  3VNU A;  1XCV A;  2G7H A;  2O6G E;  1TT5 B;  1IDZ A;  3K0L A;  4HDV A;  1HCR A;  2W24 A;  3WOD F;  4EM2 A;  3T9G A;  4PSX A;  4BPR A;  4U7D A;  1HXD A;  1IF1 A;  3U2Q A;  1KQS B;  2V7F A;  4GGG A;  1KC8 D;  4AVP A;  3J81 k;  1Z1D A;  2KZG A;  1YRN A;  2VPL A;  2JA6 J;  2HTS A;  2HVQ A;  4FN5 A;  2XKO A;  2BXZ A;  4A3E J;  4M71 A;  2J5P A;  3F22 A;  2GBY A;  3BG6 A;  2F43 A;  5E8I A;  2HKO A;  2DOE A;  5E1Z B;  2HOS A;  4RD1 A;  4C43 A;  2BM1 A;  1YFH A;  4RCY A;  2PMD A;  2O0V A;  2NOJ B;  2Y48 A;  2O0Y A;  3HSE A;  4FAS D;  1ZHF A;  1CQT A;  3SFI A;  4ZCL A;  2WZP P;  2L9R A;  4CUG A;  3NE5 B;  4OIO F;  2XGE A;  1ZGJ A;  3RQ4 A;  5LD2 C;  1DDI A;  3BQY A;  3CCE B;  3I3L A;  5IYQ A;  3SYJ A;  1BN8 A;  1BIA A;  3J7Y J;  2V7T A;  4I2O A;  4BQA A;  2NTP A;  3MCZ A;  1N25 A;  2KIU A;  1RUN A;  1XPX A;  1OGJ A;  3F72 A;  2QBY B;  2QA4 B;  1D5V A;  4N9I A;  4BBR J;  5LHH A;  5EZH A;  3FXQ A;  4XLE A;  1W36 D;  2V6E A;  3I55 B;  2DER A;  4Z05 A;  4RM2 A;  5J4V A;  1P2F A;  4UUV A;  3PSI A;  3BTL A;  3F3X A;  2WAQ N;  2X6W A;  3I64 A;  1T0F A;  2X53 S;  2EZH A;  4YC5 A;  2KJB A;  5DS9 A;  2J8K A;  1R5N A;  2YX4 A;  4XBF A;  1RR8 C;  3HOX J;  1IRX A;  1UD5 A;  2R6H A;  2INV A;  2DA1 A;  2LMD A;  3BJA A;  4B8X A;  2FOK A;  3S2D J;  3KE2 A;  2GXB A;  3GYH X;  4OJO A;  3ABL H;  1ZGA A;  2EFN A;  4WXD A;  3T0Y A;  3A02 A;  4YIR X;  3IP4 B;  1RPW A;  4XKB A;  5HLG A;  3LSK A;  3DXJ F;  4HX7 A;  4MQV A;  2LKS A;  4M74 A;  4ESJ A;  1KK0 A;  2IXS A;  2LF8 A;  1GVH A;  4RDL A;  5IPA A;  1CGP A;  1TVC A;  4C2M J;  1VFC A;  2MA3 A;  5C3E J;  1O7F A;  4XOP A;  4ZZL A;  5J35 A;  1VQ9 B;  4S04 A;  1NH3 A;  1QFJ A;  1UFM A;  2BOL A;  3JTG A;  5JR3 A;  4LK0 F;  2F5V A;  2Y0S N;  5DCM A;  2WB1 A;  3CC2 I;  3A1Y A;  4LIV A;  2JQ7 A;  2BM0 A;  1KQ0 A;  3G3Z A;  1R9T J;  3WHC A;  3FK7 A;  5BSX A;  4R1H A;  3VYU B;  2YWF A;  1Q1V A;  1YE9 A;  4KIS A;  1XE1 A;  4O6J A;  3BTC A;  2NT6 A;  5E3O A;  4IF4 A;  4CA0 A;  5K5R A;  1LFU P;  3KP3 A;  3W6V A;  1ZM4 A;  3HRT A;  3A3G A;  3D26 A;  2HXO A;  3W2E A;  1M1K D;  1R00 A;  2NVY J;  2EK5 A;  2VI6 A;  5E18 F;  1PUF A;  1ZK8 A;  5HDK A;  4U7B A;  1TWF J;  5EJC A;  5EMN A;  1YI2 B;  2WY8 Q;  1MMG A;  3QOP A;  3WU2 C;  3SUC A;  2BW3 A;  3S2H J;  1IJE A;  4H4K C;  3O8G A;  4BXU A;  4YXW A;  2ADU A;  3DEW A;  3NQO A;  2HQR A;  1AU7 A;  1LLZ A;  4G6Q A;  1GDT A;  2DA5 A;  1R71 A;  5C1C A;  4HRI A;  4XN3 A;  2JWT A;  2QY1 A;  1IV8 A;  2QTZ A;  4HIZ A;  2BM4 A;  4NQW A;  3IHU A;  2FVG A;  1T6S A;  3B73 A;  1MSF C;  1TLH B;  1YTY A;  4M9X A;  4OZY A;  2EV5 A;  1RRJ A;  3RI4 A;  1AA7 A;  5M5W J;  1WSR A;  2VQH A;  2O03 A;  3SZT A; 
#chains in the Genus database with same CATH homology
 5DN6 A;  3HUG B;  2HVR A;  3OYA A;  1VF7 A;  4BJ5 C;  2VBE A;  2KHM A;  4MXN A;  2PJR B;  2CUJ A;  2CW8 A;  3T53 B;  4YZA A;  2W4S A;  3KX2 A;  1YX5 A;  4PJL A;  2MAB A;  4BS9 A;  1MMN A;  2I8D A;  3LSI A;  4CCK A;  2HQA A;  4BE0 A;  1JTA A;  3LMM A;  3OYI A;  4CZC A;  3CZ6 A;  3DLA A;  4HST A;  4YEJ A;  2CK3 A;  3EUK L;  1XG2 A;  3BLY A;  2O04 A;  3BC9 A;  1FMW A;  3DDY A;  1ZEL A;  4CCL A;  1W0K A;  1WTH D;  3IAM 2;  3VSU A;  3BC8 A;  4P22 A;  2JSP A;  4OJL A;  4PSW A;  2VLA A;  1W36 C;  1Z3Y A;  3OMY A;  3GVJ A;  2R7T A;  3PNY A;  4BXF A;  3AL0 C;  3T51 B;  2OC6 A;  2XAU A;  4NUB A;  3D5L A;  4LIT A;  2GK6 A;  4G7W A;  3K4N A;  3L2R A;  4IZZ A;  4TKO B;  4JQF A;  2L7K A;  4PUS A;  3GVL A;  3OOC A;  4N4N B;  4C2T A;  4XLA A;  3OYK A;  5FRO A;  1OR7 C;  5JHF A;  2UV1 A;  3V42 A;  4HWV A;  1Y56 A;  3ZRG A;  4B47 A;  3EQN A;  3GQ7 A;  2QXZ A;  4II2 A;  3NWT A;  4B3F X;  1T0F C;  2VBM A;  4IX7 A;  5HNH A;  1OLT A;  3W2A A;  4PK4 A;  4ZDL A;  4B44 A;  3AL0 B;  2ZTG A;  1OOC A;  1S9H A;  1QJV A;  1BOB A;  3S32 A;  2VJI A;  1VJS A;  2Q1Z B;  2OUM A;  2DCE A;  3G05 A;  3JUR A;  4LG3 A;  3MKW B;  4XR6 A;  4ZJZ A;  3AKZ A;  4YRV A;  2RRE A;  4HNT A;  1SKY B;  2R7Q A;  2UVE A;  3ZPN A;  2R7R A;  4F55 A;  2LY2 A;  3AFH A;  3VSK A;  4ZYA A;  1TT0 A;  2O1D A;  1X1A A;  4XNF A;  4E6K G;  3CF2 A;  2ZZG A;  3ZXS A;  4OJP A;  4XLF A;  1T95 A;  1X1B A;  3VST A;  4DNT B;  4OWR B;  2NTQ A;  2JUG A;  1MNE A;  1QHG A;  4KJZ A;  4BL0 B;  4HEA 2;  2BVM A;  3ZCO A;  4BEH A;  2PYH A;  1N77 A;  1X0C A;  2R9V A;  2HNH A;  1SFK A;  2CV2 A;  4AU7 A;  3K70 C;  3WQZ A;  2W6I A;  5KCM A;  1Z7L A;  4DIQ A;  4N4O B;  2LBF A;  1O88 A;  4F92 B;  1VZ0 A;  4D9J A;  1H80 A;  4R79 A;  1K6Y A;  5HVQ C;  1IA5 A;  1Y6I A;  3C2H A;  2XZL A;  3TMO A;  1X4O A;  2E1M B;  4XQF A;  2O17 A;  3QOD A;  2JJ1 A;  2R4G A;  3LL7 A;  3OR1 C;  4XLC A;  4PJJ A;  1X4P A;  1E79 A;  3OYC A;  3BH4 A;  2KPM A;  3U21 A;  5C1E A;  1DQU A;  2CFO A;  3OR2 C;  4OAY A;  2IQ7 A;  1X19 A;  3A3B A;  3CJQ B;  3L2V A;  1LVK A;  2OV7 A;  2LH9 A;  1R6R A;  4FET A;  4BUP A;  3PFY A;  3GQ9 A;  2NT9 A;  1IDK A;  2DJI A;  2GOM A;  2XSJ C;  4OAZ A;  4AYB A;  3DKX A;  3MMY B;  4DGW B;  3HAG A;  4NK6 A;  3E1S A;  3ONQ A;  1FMV A;  2V4J C;  2W1O A;  4CCN A;  4BE1 A;  4CCJ A;  4BE2 A;  2PEC A;  1HVX A;  1D0Z A;  1RWR A;  3L2U A;  4IQ4 A;  2VXZ A;  4CCM A;  3H35 A;  3HL2 A;  3OEH A;  2DT6 A;  1J09 A;  2XGJ A;  3UR3 C;  4TT3 A;  2V1N A;  4JOM A;  1TZL A;  1QHH D;  2IS2 A;  1NBM A;  2ZZF A;  2GOX B;  3SZG A;  4HNU A;  1UD8 A;  3HKZ A;  4KIT B;  1W0J A;  1WJF A;  1O8I A;  1WFX A;  4Y33 A;  3J7A Y;  2VXD A;  3DWL E;  3QYB A;  3D5S C;  4E7Z A;  2V26 A;  2BW3 B;  2HLD A;  2QKL B;  3OYE A;  3ZR8 X;  3EQO A;  5FL7 A;  3HXL A;  3A35 A;  3EPZ A;  2XF6 A;  2LBF B;  1O8G A;  2UUZ A;  4PFO A;  1WJE A;  2JA2 A;  2CV0 A;  4BQQ A;  1Z21 A;  4U49 A;  2WA0 A;  3OYN A;  4RLQ A;  4XD7 A;  1WMR A;  1BR2 A;  3K4B A;  2Z2S B;  2BVL A;  3FHN A;  4X0G A;  2LY1 A;  4D1Q A;  3GVK A;  3OYF A;  2KL4 A;  1DBG A;  3S3N A;  2XF7 A;  3OS1 A;  2V7Q A;  1PYV A;  3ZPP A;  2ELJ A;  1WP6 A;  2O0W A;  4NC7 A;  3E0J B;  3DEE A;  2X1E A;  4E7L A;  4BGD A;  2IGM A;  2M3A A;  5HNF A;  2KVO A;  2M5S A;  2WJV A;  1HA8 A;  3B8Y A;  2KRC A;  3F9K A;  2K5C A;  2XZP A;  2F6C A;  2LG4 A;  4NQW B;  1SAU A;  2K9L A;  1I18 A;  2M4G A;  3IUO A;  3VYS B;  2IGK A;  3BCD A;  4OJ6 A;  1EA3 A;  4OZZ A;  4ZTF A;  2IS6 A;  3FY3 A;  1G59 A;  1IDJ A;  1UG0 A;  3EUA A;  1N78 A;  3FBI B;  2HU9 A;  2LZJ A;  1PLU A;  4PJM A;  3DQV C;  1HG8 A;  3S93 A;  1KZL A;  5HKK A;  4OJ5 A;  3OYH A;  3MKZ A;  3EUH C;  1NG7 A;  2WAF A;  2NST A;  4MR0 A;  1AIR A;  1DGR M;  2HVS A;  5HLT A;  2LRD A;  4XN0 A;  5FRN A;  2UWM A;  3CJR B;  3JU4 A;  2D3N A;  3I9V 2;  4C2L A;  3MKY B;  3SDB A;  4BDZ A;  2X6Y A;  5KNL A;  3W2V A;  1NHC A;  2F4I A;  3CES A;  2VKD A;  3H5R A;  3HG9 A;  3OW7 A;  4U4B A;  4ZC3 A;  1IB4 A;  2VQL A;  5TGT A;  2XND A;  3T56 B;  2PJR A;  4BQN A;  1WPC A;  2ODL A;  2X51 A;  3OL4 A;  1UAA A;  4BJT A;  3KYL A;  1E43 A;  1V0F A;  2IGO A;  2JIZ A;  1N75 A;  3OYB A;  1RMG A;  4XKW A;  2VQG A;  4NC8 A;  5HOO A;  2KMU A;  2CUZ A;  3LSG A;  1DBO A;  3VR6 A;  1H8H A;  3HC7 A;  1BMF A;  2LYC A;  4YZQ A;  3KEY A;  2M0M A;  2ZXI A;  3BCB A;  3RTR A;  4DOZ A;  2V4D A;  4I84 A;  4KT6 A;  3K4J A;  3VSV A;  4Y3O A;  2DIE A;  3OAA A;  1O8H A;  4Z03 A;  3H94 A;  3HPG A;  3PL8 A;  2M7B A;  2ZSH B;  1ERD A;  2INU A;  1E1Q A;  3OPO A;  2RNG A;  3FBN B;  1WJB A;  1D1B A;  2E5Z A;  3VSL A;  3OYG A;  3L2W A;  2IS4 A;  4P1W A;  4G6I A;  3LSH A;  2VJJ A;  2HPI A;  2D3L A;  2AQE A;  1WJC A;  3K4M A;  3DKY A;  2R7V A;  1V5F A;  2DT7 B;  2LOO A;  4W8Q A;  2WAD A;  2QX3 A;  2HPM A;  3DU5 A;  4YEL A;  1KCC A;  3KEW A;  3H0D A;  2VL8 A;  3UNG C;  1U0J A;  4DBR A;  2WPD A;  2NZM A;  4JMQ A;  2WY7 Q;  2VIX A;  2E5N A;  1HZE A;  3CP2 A;  3ZIA A;  4W8R A;  2BSP A;  4KKT A;  1VLY A;  2R7X A;  1COW A;  3OEE A;  2XZO A;  3LSM A;  1K5C A;  2F1M A;  2L9N A;  1Z3X A;  2WAQ A;  3DPT A;  3GQ8 A;  4PJN A;  1BPL A;  2WJY A;  2ZTN A;  4E4H A;  4TSF A;  4Z06 A;  1GQ8 A;  3LFU A;  2Z8G A;  4W8T A;  2JVG A;  2VAS A;  2MFZ A;  1BR1 A;  2HDW A;  2X1D A;  3H9Q A;  3OL3 A;  3VYR B;  2L9S A;  1D1A A;  3A2K A;  3VDX A;  4BAC A;  2KRH A;  2XC7 A;  4QPO A;  1V5E A;  2LC2 A;  2K9M A;  3DTE A;  2AQF A;  3QYE A;  4DJA A;  4DBQ A;  3LNN A;  2X85 A;  2VB6 A;  4W8S A;  3A4C A;  4J00 A;  2P0W A;  1OB0 A;  3S3O A;  2JVH A;  1QCX A;  4F91 B;  4PMH A;  4AVZ A;  4CCO A;  1KTW A;  3NWS A;  4C30 A;  2EWE A;  3LMW A;  1MMA A;  3S8P A;  4B43 A;  4G7X A;  1OFM A;  4C9Y A;  2MC4 A;  4Y4R A;  1KMH A;  1BR4 A;  2E60 A;  3RSN A;  3HPH A;  4L8J A;  4XON A;  4E7H A;  3H5A A;  2UVF A;  3OS0 A;  1T5E A;  2FUG 2;  3GQB A;  2NSP A;  4RLF A;  4XKC A;  3C2G A;  1UD4 A;  3BCA A;  4J01 A;  4XOR A;  5KHD A;  4GQN A;  1GLN A;  4ZTJ A;  3OOU A;  2KZV A;  1E0E A;  2R7O A;  4IQJ A;  3GQA A;  2GJR A;  1UD6 A;  2XF5 A;  2XOK A;  1EFR A;  2ZZQ A;  2KP6 A;  1OHH A;  4G6T B;  2HZD A;  2K3P A;  3VYT B;  4EAT A;  3K4K A;  4F93 B;  2GK7 A;  4E7J A;  1I8D A;  4XLH A;  2CS3 A;  2O5R A;  4BU2 A;  4BEH B;  4BQO A;  4II3 A;  5CQG A;  1OFL A;  2DOA A;  4DK0 A;  4HSR A;  3SEZ A;  3HOT A;  5LFA A;  4B3G A;  4ZDO A;  4CH7 A;  4E7K A;  2JDI A;  2GJP A;  4HPQ A;  3DU6 A;  3K6G A;  2VBK A;  2X1C A;  3D5R C;  3UW0 A;  3K70 D;  2KLO A;  4XMY A;  3S3M A;  1RU4 A;  3OWT A;  1MMD A;  4U87 A;  1VBL A;  3QOE A;  3DPL C;  1NG6 A;  4LIU A;  3VWB A;  2KQR A;  4ZDP A;  1UD2 A;  5CQE A;  3G2B A;  5FRM A;  4ITV A;  1OGM X;  4PFP A;  3M1C A;  2Z1D A;  4DNR B;  1PJR A;  3ZGK A;  1MND A;  4ASU A;  3T9G A;  2V9K A;  1YX3 A;  2MD0 A;  4PSX A;  1PE9 A;  2IS1 A;  1KCD A;  1JI8 A;  2X3H A;  4B3X A;  1H8E A;  2V7F A;  2DXI A;  1UD3 A;  3BG7 A;  2VPL A;  2W7N A;  2HVQ A;  3OE7 A;  4YZ0 A;  2M7A A;  1WJD A;  4EW9 A;  4RMN A;  4ANJ A;  1LDK B;  2VJ4 A;  3BG6 A;  3K4C A;  1NRK A;  2F43 A;  4FXU A;  1JRG A;  2PYG A;  3PUB A;  3RPU D;  1OGO X;  1E3X A;  3VMV A;  1UEL B;  2O0V A;  1DGW Y;  2WBM A;  1G8X A;  4C2U A;  2NOJ B;  3K4L A;  4XKV A;  2KDO A;  4FAS D;  4KKS A;  2WZP P;  1O8L A;  1PXZ A;  1MAB A;  4BDY A;  3W3C A;  4MLO A;  3CP8 A;  3DTI A;  4CUG A;  2E1M C;  3NE5 B;  3RQ4 A;  5LD2 C;  5CDF A;  3I3L A;  2R7U A;  1KON A;  2Y0S A;  3OIQ A;  2JJ2 A;  2M4K A;  1O8F A;  2QKM B;  2Z16 A;  3OYJ A;  3VMW A;  1BN8 A;  3TL4 X;  1MW7 A;  2WSS A;  4NNJ A;  3TBI A;  2W82 A;  2NTP A;  2R7S A;  3OFN A;  4YZX A;  1P9Q C;  2R7W A;  3ZSC A;  4CSW A;  2W00 A;  3RCO A;  4XLE A;  1W36 D;  2V6E A;  4Z05 A;  1K28 D;  4RM2 A;  5AMV A;  3PSF A;  3PSI A;  2X53 S;  2X6W A;  1E1R A;  1BHE A;  3H9J A;  4P5O A;  3BCF A;  3ZQQ A;  3QYF A;  2CW7 A;  1X1D A;  1IRX A;  1UD5 A;  2WAE A;  2INV A;  2L2O A;  1LKX A;  1V5G A;  4XM3 A;  3CMM A;  5CKT A;  4XOT A;  4OJO A;  1LFP A;  2A6T A;  3IP4 B;  4XKB A;  3OYL A;  3IAS 2;  3LSK A;  1O8J A;  1O8D A;  1V0E A;  4BJ6 C;  3N05 A;  2L5Q A;  3L2Q A;  3SEQ A;  2IXS A;  3HOS A;  4KKU A;  1E3Z A;  3GRH A;  1DP3 A;  1WJA A;  3PNV A;  2W6J A;  2VJ5 A;  4XOP A;  1WJ5 A;  2BOL A;  4UZU A;  3MD2 A;  1FX0 A;  4IKF A;  3B90 A;  4F52 A;  2F5V A;  1QU3 A;  2RQQ A;  2WB1 A;  2QE7 A;  2LRE A;  3A1Y A;  3OS2 A;  4LIV A;  3W2W A;  3H5N A;  2VKH A;  3OYD A;  1D0X A;  3K10 A;  4B48 A;  2Z6B D;  3KRG A;  1O8K A;  2NTB A;  2GJK A;  3PJR A;  4GRI A;  3VYU B;  3PNT A;  2ZZE A;  3B4N A;  1YE9 A;  4KIS A;  4E0F A;  3FKJ A;  2CH0 A;  1W9X A;  3DPU A;  2NT6 A;  4HG2 A;  4CA0 A;  3A3G A;  3WWG A;  4NK8 A;  2XDV A;  2X8K A;  3DTK A;  5IK2 A;  2VQC A;  4U7B A;  1EE6 A;  2WY8 Q;  3H9G A;  4DK1 A;  1MMG A;  3SUC A;  2BW3 A;  2ZXH A;  5CPR B;  1D1C A;  2E1B A;  4E7I A;  4XL9 A;  1BLI A;  4H4K C;  3OIP A;  2V31 A;  3OY9 A;  3SYT A;  4YXW A;  4QPQ A;  1D0Y A;  1O8E A;  3M8J A;  4E7S A;  1CZF A;  3FKS A;  1X1C A;  3OYM A;  1PKV A;  3FPP A;  5C1C A;  4HRI A;  4XN3 A;  4Z1M A;  2QY1 A;  2PMZ A;  4HIZ A;  4F3Q A;  4RM3 A;  2ZSI B;  3FDY A;  3GBG A;  2Q2E B;  4OZY A;  2A5W A;  4URR A;  1AA7 A;  2ZFU A;  2IGN A;  2X6X A;  2CV1 A;  2MYS A;  2CMP A;  2VQH A;  1O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...