4XONA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xonA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xonA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xonA02
2O1DA 4OZYA 1IDKA 4XKWA 1KTWA 2X3HA 1BN8A 1VBLA 5C1EA 4XLHA 4XMYA 4YZAA 3VSVA 1GQ8A 1H80A 2PYHA 3UW0A 1O8LA 3EQNA 4XKVA 2X6YA 1OGOX 2NZMA 1EE6A 4XN0A 2BSPA 1IB4A 1RU4A 1OFMA 2O04A 2NSPA 1O8MA 2ODLA 3JURA 2NSTA 1KCDA 4XNFA 4PMHA 4W8QA 3LMWA 4YZ0A 4OJOA 2UVEA 4URRA 1BHEA 4YZXA 3WWGA 1K5CA 2VBKA 5AMVA 1O8DA 2X6WA 2X85A 4XN3A 1JTAA 3EQOA 4XL9A 1O8IA 3GQAA 1QCXA 4XLFA 3GQ7A 2IQ7A 4NK8A 4YELA 2NT6A 4XM3A 2Z8GA 3SUCA 2QXZA 3VMVA 1OOCA 4C2LA 1JRGA 3GQ9A 3KRGA 2VBMA 1IDJA 1QJVA 4I84A 4HWVA 4W8TA 1RMGA 1RWRA 4XONA 4XQFA 1OFLA 1XG2A 4MR0A 4W8SA 1DBOA 3GRHA 4XLCA 4OJPA 3VSTA 2QX3A 4U49A 4YZQA 4XOPA 2VJIA 1PXZA 1O8JA 2INVA 5C1CA 2NTBA 2O0WA 4Z05A 3ZSCA 3B90A 1WMRA 2VBEA 2O17A 4U4BA 4YEJA 4OJLA 4MXNA 1AIRA 1KCCA 1O8KA 4XORA 1O8HA 2NT9A 2VJJA 4NK6A 1X0CA 1PE9A 1O88A 2PECA 3ZPPA 4XR6A 1HG8A 1IA5A 4Z03A 2NTPA 1PLUA 1O8GA 1O8EA 1O8FA 2O0VA 4XLEA 3B4NA 4AVZA 1NHCA 2PYGA 3GQ8A 4XOTA 3VSUA 1DBGA 4OJ5A 2QY1A 1CZFA 4EW9A 3VMWA 2UVFA 2EWEA 2INUA 4W8RA 3B8YA 4OJ6A 4OZZA 2NTQA 3T9GA 3FY3A 2X6XA 4XLAA 4Z06A 1OGMX
chains in the Genus database with same CATH superfamily
2Y0SA 2V7FA 3ZMSA 1BM9A 1KYWA 3F0CA 3JX8A 1KU9A 2VLAA 2C6YA 3J7YJ 5D8KB 4YAUA 5J3OA 1LDKB 2DTZA 2P4WA 5LRRA 2GXGA 2OF7A 3I54A 1FYKA 2QGGA 4YAOA 4KIBA 1E3XA 1TT5B 1WSRA 3ABTA 2UXNA 4PC3A 2VXZA 3IP4B 1YE9A 3U9GA 2WZNA 4RAFA 1USTA 4UVBA 2DMPA 2E2JJ 1R5GA 4FE4A 3PNYA 1W35A 1AOYA 1IJWC 2M8GX 4EQQA 1APLC 3MEXA 3LMWA 1X1DA 2EK5A 2ZKZA 5FD5A 5TJJA 4P3YA 5LEJA 1JUPA 1KONA 2EFPA 5C3EJ 1K78B 2UVEA 4OJOA 2XB5A 3K70C 4YZXA 1WJDA 4OIOF 2R7XA 2RN7A 1DQUA 4XIDA 2KZVA 4IO9F 1UD2A 5F0FA 1Q1HA 3TL4X 4LLLA 1ACIA 2PLFA 1KA8A 1ZGWA 1SMYF 4JYKA 2ME6A 4YIIA 5F08A 2A5YB 4M74A 2JA8J 3ELKA 1I1GA 4F52A 4BY1J 3HOYJ 2YSRA 4EJTA 1QU3A 5KVRA 5ICFA 1NB0A 3H9GA 1O3TA 3BTCA 2QUFA 1ZRCA 2F1MA 4BDYA 3SYTA 2ZTGA 3HKZN 3L00A 5A2QK 4U7DA 4WX9A 2VKHA 3OW2B 1V5GA 2HQAA 3F6VA 4MLOA 5AIQA 3DKXA 4IRGA 4EM1A 2R5YA 3WGHA 3WU0A 4XK4A 4I01A 3FJOA 3Q3AA 1FBQA 4A2UA 1SVOA 2YU3A 3ERMA 1W5CC 5TY0A 2DDBA 5EG0B 2QX3A 4A5MA 5CLSA 4YZQA 4FX0A 4FK8A 5IOYA 4BQNA 5C1CA 2XKOA 2VT2A 4IVNA 1XS9A 3FXOA 1YYVA 2ZJQF 4Q5SF 2BGIA 1LUJB 4TMVA 3S15J 3WG9A 2VBYA 1NDHA 3CMYA 4PGHA 2GOMA 4YXWA 3W2IA 2KDZA 4ASNA 2XSDC 1IUYA 4EV0A 1A6IA 1OKRA 3S14J 3VSKA 2P6SA 5FLXZ 1KU7A 2ZL5A 3KYCB 4EJWA 4C2MJ 4KUMA 2LSOA 3ZQGA 4ANJA 5F0HA 3L2RA 1ZM2A 4G1BA 1FC3A 2DTRA 2PQ8A 1RETA 1PE9A 5LHGA 3BR3A 3N05A 4B3AA 1A04A 4DOZA 3OOCA 1O88A 1AMOA 5BSXA 3M1CA 3BY2A 4PFOA 2HQRA 2IGNA 3JAMK 1MSFC 3PQJA 3C2GA 2HVRA 2ZO4A 3BTLA 4EM0B 4B8XA 3WTSC 3B02A 3LSMA 3FXUA 1XN7A 2E1OA 2KP6A 5GP9A 4EW9A 4A12A 2E1CA 2HYJA 4HBLA 4A0XA 4ZJZA 5H5JA 3FIWA 4UUSB 2XAGA 2D1HA 4B43A 2ZMEC 2LY2A 4N3NA 1R5ID 2ID3A 1JJ8C 4KMFA 5KAFC 2NAZA 3AG4H 3CP8A 4M2LA 1W5TA 2K27A 3CJTB 3OIPA 4LFUA 1MMAA 2VI6A 2E1RA 2VNJA 2R9VA 3NAUA 2NOGA 5DNSA 2O5RA 5E1WA 4BDZA 3W6KB 1O57A 1T2KA 4NC6A 4A6DA 4AIJA 4YALA 1YRNB 3SYJA 1LLWA 4P6VF 4PFPA 2BW3B 3WE2A 2PX9A 1H8HA 5ILSA 2CK3A 2PLYA 2RNGA 2B9SA 1RQPA 3DBLB 5K5RA 4M1KA 4ROXA 1HW5A 3W2FA 3E1YE 2EIKH 2G0EA 3KZYA 1U8BA 1SKYB 2VXDA 2DYIA 2XT2A 1W36C 5AN9A 3LMMA 4BE1A 2HVSA 2XZLA 3CUOA 2CWEA 2A5WA 2YWHA 2KHMA 5GAHJ 2DQRA 1VQ7B 2GJPA 1FEXA 3CZ6A 1T0FC 2VFQA 4M72A 3SEQA 3ZR8X 3DCFA 2WPDA 5L3CA 3EETA 4Q7JB 2WJYA 2IGMA 2ZZQA 3MZYA 1G3TA 1VQ7I 5HLGA 1PUEE 1G7RA 2OBRA 3B6CA 1EFCA 1WP6A 3JQRA 2V9KA 3GW2A 4NDLA 4R79A 2ZITA 2V1DA 4BHPA 1FX7A 2E7XA 4M3BA 2UWMA 4XICA 3M8FA 1YQAA 2M0MA 2PIAA 2AXLA 4XLFA 3JRHA 2PN6A 1M90D 3K2AA 3A01B 1Q1VA 2I8DA 3JW4A 2B5OA 2QXZA 2XHKA 4IHWA 2VBWA 4UUTA 4C2LA 4RB2C 3SJMA 3H09A 4U87A 3VO2A 3CC7B 1ETVA 3FF5A 3ZP5A 4PSWA 3HOZJ 2KPMA 3A1YA 2B63J 3DKYA 4RM2A 1BC8C 2DA1A 3FHNA 2J7KA 2CQKA 4XONA 3CC7I 4E70A 3CLQA 4MFEA 4TMZA 1QVTA 4KIFA 1EWYA 4O6JA 4LBVA 1VQ9B 3A3GA 2VFOA 3ERED 2L3DA 3FKJA 2QLZA 2YUSA 3QP5A 1VQ9I 4ZCMA 4RD1A 1CNEA 2QENA 5IYQA 4Z4TA 1VQPB 2X51A 4B3GA 2DFFA 5FGMA 3W5UA 3ZZ0A 1T8IA 2Y0SN 4M4SA 2VONA 3N4MA 3BZKA 4MTDA 4IHVA 3TO6A 1R6RA 3MKLA 3AAFA 4HLYA 4A3MJ 3IHUA 3U21A 1IO2A 1B9NA 4TV7A 4BEHA 1SD4A 2GK6A 3G6EI 2H94A 2XSJC 4NK6A 5TGTA 3E0JB 5ILUA 1WJAA 3LSTA 1LFUP 2EA4A 4N3GA 2RREA 3B6AA 4CHUA 4P22A 1EFRA 2D5VA 1T56A 5J6XA 1R7JA 4KFCA 4KISA 4LBZA 1O8FA 3ASNH 4KT5C 3J7ZI 4YDTA 2STTA 2EFOA 2O6WA 1QRYA 2R7ZJ 1UJ8A 1GVHA 3ZC3A 4GQNA 2INUA 2FNAA 1P4WA 3PSSA 1AKHB 2X3UA 2K85A 4QIWN 3PUNA 3CC4I 4BACA 2VFNA 2FBKA 4PJ0C 1EF4A 2RV8A 2RC6A 2B7EA 4OPWA 2FOWA 2K9SA 4O3MA 3NB2A 1X1AA 3ZMTA 4AIKA 1PVEA 2AQEA 1XDSA 1LDJA 4RGSA 4HQEA 3A1PA 4YIFA 2VPRA 3EUKL 4IRIA 2F5CA 2CU7A 3GTQJ 3QYFA 4MYTA 4IHXA 2ESNA 2QQAA 4FN5A 1LEAA 1BR1A 5CQEA 3CO6C 4YEIA 2XUBA 1LE8B 1K79A 1JUSA 3HB9A 1QPIA 2WWYA 2O8XA 2NSPA 2JRTA 4A3JJ 2VJ5A 4M9XA 1NK3P 2MH2A 2PMUA 4Y9UA 2XTWA 4PMHA 1ZLJA 1RI7A 3MMYB 1HVXA 3SLNA 3W2AA 3OYNA 1Z05A 2CYYA 1I8DA 3T51B 1QQ1A 4URRA 1TBXA 1LJ9A 2F5VA 4UV8A 3TGNA 4OMYA 4E7KA 1P2FA 1U2RA 1Y8QB 2IEKA 1Z3XA 1ZGJA 3E5UA 1G4DA 3P26A 1PUFA 2OJED 2L9VA 1G7SA 4K2EA 3GQAA 1UG2A 3FXJA 2VZLA 4MFDA 5LMZA 1TQIA 1W5SA 4A3GJ 1JI8A 4WWCA 4DNCA 4HV5A 3OS2A 4B4DA 3ZMUA 3HSRA 2EIMH 1X1PA 2XZPA 4P6YA 3LQQA 3CPWB 1FIPA 3K1NA 3C1DA 1SKQA 4HX8A 1FYMA 1I3AA 1E62A 1T6SA 3KP4A 1RMGA 3L7WA 2GZWA 2D3LA 2F1LA 4ZYGA 4JP0A 3VSLA 1MBFA 1TNTA 4KT6A 5FKMA 2IA2A 4DBQA 3H0DA 4CSWA 5J1YA 3PFYA 4JBAA 3ZQLA 1LPQA 2JVGA 2MW8A 1A6QA 3LNQA 1IDZA 2IXSA 2HFHA 1ZN2A 3VSTA 1IUFA 4CH7A 3L2QA 2KRCA 3WNCA 3VMFA 2AO9A 2FBIA 1FYLA 4LG0B 1PXZA 1T08B 1XCBA 5H6RA 3HEFA 5HDNA 2CJJA 3VR6A 5DM7F 2KIFA 3I71A 3DQVC 1ZQ3P 3RJPA 3RY8A 4HNTA 4CCJA 3OSGA 5JLVC 2HDWA 5ED4A 1T5EA 2ICWG 4L5EA 2GPJA 1T38A 4XORA 4X0GA 1KJZA 2NT9A 2VJJA 2MD0A 5HS9A 5IPAA 1X4PA 2HVQA 2Q6KA 2XDVA 1XX5A 4GDFA 3ZQCA 2VODA 1WI3A 4Z4VA 2P5VA 2WB1A 4WXCA 4UVCA 5LGTA 5K1YA 1MNEA 1VQOB 2O0VA 3B8HA 2FD5A 3KEWA 3Q39A 3J81Z 2K40A 4A3DJ 3KFWX 1NRKA 2BM4A 3IH4A 5L3EA 1VQOI 4RMNA 4D7NA 3AGQA 3TW6A 1N8RD 3GXOA 1CZFA 1AIPA 4RGRA 3BR5A 1X4OA 1BJZA 3GTOJ 5BSYA 2V79A 2NPFA 4RDLA 2MLGA 5FFXA 5KW9A 5AIPA 3VFZA 1K6OA 3SZEA 2DYSH 1LVKA 4G9YA 4U7BA 1COWA 1QA2A 5EEHA 4Y7NJ 4TMWA 2VBVA 3G4SB 3E97A 5E3MA 1V5VA 1SD7A 1K61A 3QFRA 2L9NA 3BJOA 1IV6A 1TQPA 4HX4A 1FOKA 4XLHA 1USSA 2IVMA 3G4SI 3HC7A 4CO8A 1H85A 1KQ8A 4YZAA 1RZ4A 4P9FA 2IS6A 2C78A 2ZL7A 5DCFA 1GQ8A 4BL0B 2A07F 3CMAB 1FLIA 3D5SC 1ZR2A 2JN9A 3PNTA 2V9VA 3SJPA 3VYTB 4QLCU 1WH7A 3HM5A 2FEZA 2ZSHB 3CMAI 3ASTA 3HOSA 4WQMA 2QYOA 3CUQA 3WHCA 1NB9A 1JHHA 2WV1A 3M9AA 4CCKA 2Y9ZA 1N78A 2VBXA 4EH1A 4YRVA 4WZTA 3QWLA 1LLZA 1YIJI 1SVMA 5CVIA 1UMQA 1ZKGA 2P81A 4X7EA 1M1KD 2DK5A 4ESFA 2IT0A 1IB0A 2HNHA 2F4IA 3WNBA 2MD5A 2VBZA 4BYYA 2KZGA 4Z2YA 3SZGA 4G1VA 4WXHA 4R71A 2NVQJ 4ZCLA 1DPRA 2LP0A 1D0XA 3L2WA 5C4XJ 3CB4A 2BEOA 3DPLC 3RPUD 3LFKA 3Q9VA 3K2ZA 3R6SA 2OZ6A 1DARA 3ZOBA 5LBQA 2EA2A 4L18B 2XNCA 4MO7A 2IW5A 3K7AJ 4CYCA 2DOGA 3V7CA 4AF6A 1W2BB 2DJIA 2ID6A 2P8TA 4LD5A 3J7AO 2NT6A 1IXRC 3M1EA 4M3GA 4D0PA 1HKTA 2LF8A 5LEKA 2EIXA 2VASA 3HTUA 1XPXA 4LBYA 3KRGA 1TTTA 2DJNA 1U5TB 3TP3A 3DKWA 3QP6A 4P1VA 3ABMH 2X1DA 3OYDA 1RWRA 4XQFA 2RC5A 2Z6BD 4DQKA 1EFTA 2OCCH 3K70D 1B6AA 2GBYA 1FY7A 3A8JA 3MCAA 1L0OC 5FRNA 1U9NA 1W7PB 3VDXA 4JX6A 2NVYJ 5JR3A 4IOCF 2QA4B 4RLQA 1DP7P 1S29A 4M9SA 4ZDPA 3T56B 2BGJA 1UZCA 5F0CA 2X6OA 3I59A 3LA2A 2JIZA 2QA4I 3G2BA 4RD6A 1WORA 3WTVC 3ZMDA 3BWGA 1Z9CA 3GZ6A 4U4BA 1QUEA 4HRIA 4BPRA 2WC2A 4YC5A 4NQWA 4A93J 2M4GA 2OZUA 4DZPA 4OMZA 2I5UA 4UY8I 2V1XA 2OYNA 3M7GA 2XPWA 4M9ZA 3VEPA 1OYIA 1E63A 2WAQA 1KGSA 2PECA 2IBDA 2YWGA 4UZEA 2R5ZB 2ZBKA 1R36A 3FPPA 3GQ8A 2X8KA 1MDMA 3ASPA 2IJLA 2QY1A 2MBFA 3MZHA 3S32A 2ZJRF 5HKKA 2L7MP 1OR7C 2DMUA 2YU9J 1WH5A 1WQ2A 4CICA 1MBEA 1S9HA 4LITA 4WXDA 3ASOH 3VPRA 3JU4A 2WAFA 4X1EA 1T98A 2BHYA 3FKIJ 2NNNA 3H1CA 1E17A 3KP2A 1GAWA 3UNGC 4IKFA 1R5NA 1W4MA 1IGNA 3RIQA 5C4JJ 5HODA 2VB6A 2IP2A 1OHHA 1ELOA 3CCQB 1G3YA 1D0YA 1Z3YA 2EIJH 3A8IA 3O3KA 2O6GE 3DXJF 3K4LA 1G59A 2M5SA 3SKBA 3CCQI 3G71B 2QN6A 1MJAA 3GBGA 3AG2H 4ENKA 3HKZA 3J81k 3A3BA 1EA3A 2NZMA 4L9VA 4PSXA 2VC1A 4KIGA 3G71I 4KDPA 4FT8A 3G73A 1IC8A 1LQ1A 2D3NA 2XGEA 2CG4A 3KZIC 2EZLA 4AWXB 5D5VB 2NNYA 4C2TA 1STZA 1KK1A 3V8JA 3A2KA 4N9HA 2OTJB 1MKMA 3PSZA 3D5RC 2PJRA 3BOQA 1P4XA 4DZJA 3R61A 2CUEA 1DABA 3QU3A 1ZG5A 4LLNA 2OTJI 2Q1ZB 2JZYA 3X2QH 1QX4A 2DY1A 4QSHA 3WYAA 1WOOA 1JGGA 3SEZA 2R7UA 2GIZA 3NWSA 4MEXF 2LBFB 2DW4A 1NG7A 1OCCH 5FIUA 2XGDA 1ON2A 2ZJPF 4XL9A 1HF2A 2LYCA 1XDUA 3HDDA 3FKSA 2HWVA 3LFUA 1W34A 2QBYB 1OCZH 2XAHA 2CMPA 4ZYHA 1D3YA 2JPBA 3TDUC 1W36D 3IV5A 2WB1N 1E3HA 4G8XA 4V19K 4RD2A 4X8IA 4C43A 1EA0A 2J5OA 4E7ZA 2RAEA 3P27A 4N9IA 2C4TA 4HWVA 2NS7A 1H8AC 4D9JA 5D6EA 4BNCA 2R7SA 1VF7A 2XRLA 1JXSA 1R23A 1X58A 4WZLA 1BBYA 1UCRA 3K0LA 1JKPC 1FZPB 1B23P 1DBOA 3KEQA 1EH6A 3PO3J 1EP3B 3ZN0A 4MNUA 1LDDA 4I02A 4C3HJ 1CGPA 1XMXA 3O2PE 3H3VK 1MMSA 4ZTFA 4XOPA 2PMHA 2VJIA 1QZYA 3KP6A 2DPUA 4L0YB 2P7CB 4I76A 3HGGA 4M53A 3OYGA 4U0VA 2COBA 1R00A 1S7AA 1F1ZA 3EPZA 3KZZA 4GGGA 1W87A 2V31A 2R6HA 3VB2A 3RZDJ 4I2OA 1D1NA 3QODA 3HOXJ 3W2WA 4CUGA 2YWFA 4D5CA 2LF7A 3PSIA 4P25A 2JJ7A 4ZCIA 1O8HA 5M3FJ 2XZOA 4LOCA 2AHOA 2JWTA 1YOVB 3DU5A 3W2VA 2V7XA 3JRDA 2DFIA 1SAUA 5DCMB 2HPIA 4GYIA 1RUOA 1RQRA 1V0FA 2IA1A 1QRBA 1OISA 1MIJA 1U5TC 2TDXA 1HBXG 1V0EA 4OOSA 4OJ5A 4RPBA 5ERIA 4E7IA 4NCNA 1UMKA 3PA1A 1BC7C 2GJKA 4YAFA 3MHPA 2UVFA 2YPRA 4MHGA 2M9HA 1VQKB 1MW7A 3KYDB 1ZG1A 1JTXA 3CCEI 1VQKI 2ZSIB 1IB4A 2BXZA 2EH3A 3ZGKA 3B90A 3KL9A 1Z6TA 3ISPA 1U9OA 1V55H 1DGWY 4XKWA 5LD2C 3OEEA 1KMHA 4G94A 1YX2A 1GLNA 4Y4RA 4HF0A 3QFTA 3BG5A 5K7FA 2EFGA 2WADA 3GO5A 4ESBA 1IRXA 1WJCA 5THXA 2KQRA 1GVDA 3I55B 1RPWA 4FE7A 1XFOA 2RNJA 4HX7A 1OJLA 3OS0A 1FNDA 3P9CA 1J9ZA 2OD5A 3QQAA 3I55I 2K7LA 3ZQFA 3FDYA 3GTMJ 1AU7A 4AC9A 2BF4A 2Y2ZA 2MFZA 3RIRA 4WCGA 2RC4A 3LYCA 5FB2A 3OYBA 3GTLJ 1ENHA 4XNFA 2Z3YA 4IF4A 3LO8A 3V4GA 4F3QA 3HUGB 1UD3A 2VBUA 5E18F 2DPDA 5FD6A 3GMEA 4Q48A 3BZ6A 2XKPA 1MJ9A 1TWHJ 4HA8A 3GQBA 1T6ZA 2L01A 2G9WA 2K4JA 4E7LA 2LKXA 2H8RA 5DN6A 2X85A 3OYAA 3CC2B 2KIMA 3OL3A 2L4AA 2KISA 4NB5A 3RDIA 1MH3A 3TP0A 1FX0A 2W4SA 4PJNA 1K6YA 5L3FA 2B7BA 5HVQC 2WAQN 2EV0A 2X4HA 3CC2I 2LD5A 4L0ZB 1FJLA 3GQ9A 3QPLA 1G3SA 2VNHA 4IW3B 3D1NI 2VQLA 1TVCA 3OEHA 1TT0A 3PM1A 5EGOA 1UD5A 4Y13A 4HSTA 1SVLA 1FNBA 5J40A 1RKTA 2JMWA 2V6CA 4Y3OA 4C3JJ 2P5KA 1JNYA 1H9TA 4RAGA 3QFCA 1XSVA 1DG1G 2ZXWH 1DDIA 1F60A 2EZKA 2R7DA 2W48A 3C7JA 3GFJA 4NHJA 1W9XA 2YWEA 4CCMA 2O0WA 3AVYA 3ZSCA 2GOXB 4RB1A 1Y6IA 1QGAA 3HJEA 3K4KA 1GVJA 1P9QC 4ZYAA 1KU2A 3ZZUA 1MBHA 5IY5H 4ON0A 4CCNA 1MBGA 2KT0A 2MA3A 2R0QC 1MBKA 1WI9A 1W0TA 3OYCA 3V8LA 4ESJA 1FWZA 1I1SA 3FZVA 2LKSA 2ZMEA 3BG9A 4A69C 4DQ2A 1KCCA 1A5JA 1KZLA 4ZDOA 4X06A 3RI4A 1XD7A 5HDKA 3ZXSA 3T8RA 2M34A 1ETQA 3L2UA 1TYXA 4D7MA 5B3SH 2FUG2 2LY1A 3MZ8A 2DYRH 4PK4A 3U2QA 2P0WA 3LVBA 2PE3A 4ACBA 2CV1A 4HAMA 3SDBA 4DYRA 2H27A 1YLOA 4MGRA 3GVJA 2GA1A 2XAJA 4OINF 3CMEB 1UG0A 1OB2A 3ZBUA 5BS6A 5F4MA 1MD0A 3CDHA 3J81K 2BM5A 2W25A 4EEFG 1G6NA 3CMEI 2DA6A 4XLAA 2ZNYA 5E1ZB 4Z06A 2DBBA 3P7NA 3PNVA 4RGXA 2C5HA 1NK2P 4XLNF 4RD4A 2KRHA 1CNFA 4G7WA 1F4KA 1KTVA 4BUPA 3OYKA 2O1DA 4PAAA 2YX7A 2XEXA 1Y0YA 1Y56A 2Q6OA 4RD0A 2DMTA 3VYUB 3WBKA 2DLLA 1SEUA 4YFNF 1NH3A 2QVOA 4OPSA 1XG1A 3DF8A 5E17F 3HXLA 3K4BA 4EATA 3L1PA 3E5QA 3L2VA 1J75A 1QA6A 5IT9Z 4OM9A 2BN4A 4E7SA 3OYEA 5KCMA 3UW0A 1DP3A 4H4KC 3ZN1A 2HMAA 3C18A 2VE8A 3FBNB 4BJTA 4KH3A 3OOPA 1F9NA 2LKPA 1ZM3A 2KLOA 5CVUA 2Y9YA 4GYGA 2B0RA 4DGWB 4A3BJ 3A4CA 2NSTA 3REOA 2ECCA 5CVVA 3IRRA 2ESHA 4AD9A 4ENNA 1MGTA 1IN4A 1PJRA 2OQRA 2QF7A 1X19A 1J9IA 3MKWB 1WDTA 3CD6B 1FT9A 1HW1A 2RDPA 1ZLKA 3RQIA 2GWRA 1QHGA 2BY3A 2ZZEA 4BXFA 2LNBA 4G5GA 4WWVA 5D4RA 3CD6I 4P1WA 5HNHA 4FCYA 3EYIA 1HA8A 3R6KA 4Y7CA 4L5JA 3PFIA 4AYBN 1RC9A 2WYRA 2EFWA 3ML3A 4BQOA 3WNDA 4BQQA 4BQAA 1HQCA 2HI3A 5LFAA 4DYQA 2W7ZA 2Y31A 1K78A 1FOYA 1HSJA 2O03A 4IL6C 3V7RA 3HOWJ 1KRHA 1XQBA 4F91B 4DK1A 3BG6A 2FXAA 3BH6B 4V2GA 2EFNA 3NARA 5B1AH 3IRQA 2JA5J 4EJOA 3LSIA 2IPQX 1XE1A 2JSCA 1K4SA 3RSNA 3KP5A 1TWCJ 3T1BA 5FA6A 5K7HA 2CFXA 5IYPA 4LGWA 2J8IA 5GAEJ 3AGPA 3TEDA 3GTJJ 1F43A 1VHEA 3ONUA 2QCOA 4MEYF 3EUHC 1P6RA 2QTZA 2O17A 1OB0A 4BU2A 1TLHB 4OPVA 1WVRA 4EM2A 3BC8A 2E35A 3I53A 1ERDA 2XT4A 1AHDP 1DGRM 5IP7J 2DFEA 1XB2A 5EG0A 1K4ZA 2L2OA 2GIVA 2W24A 1BI2A 2O3FA 2KJCA 4QHYA 5JFRA 2V4JC 3RYRA 2DT5A 3UR3C 1CF7B 1O8EA 1U0JA 2VQCA 3PVDA 1C0WA 4CA0A 4XRSA 2DEUA 4OOIA 1WPKA 2BV3A 1QO0D 1ETWA 3ZPLA 3LL7A 4Z6YA 4G7OF 5JVGF 4B09A 2X53S 3GLXA 3CCSB 4ZGNB 3BH7B 2M30A 4PZJA 3QFSA 3F8MA 3G6EB 3CCSI 2ISYA 3ZMVA 3DEUA 2BV6A 4JRAC 3LA3A 3WHBA 3DDYA 1BQEA 1EKEA 1K9MD 3W5VA 3CXCB 1XMKA 4V02C 1QQIA 1V54H 5M5YJ 4HE5A 4AU7A 2AS5F 5IYRA 5F64A 1TUIA 1X2MA 3J7AY 4IOAF 3VSVA 2XNJA 2HOSA 4UUSA 1AWCA 3CCLB 1KQ5A 2DA4A 1H80A 2PYHA 3S17J 2XAUA 3ZUGA 1SANA 3CCLI 3B78A 1ORKA 3T5XA 5J1RA 2MSYA 5IP9J 2CW7A 4P55A 4S0HB 3CC4B 1HCRA 3OR1C 1KQSB 1I18A 1IJFA 3GLLA 3DU6A 1N0VC 2ODLA 1QGZA 2FVGA 2VKEA 1LVAA 3OYLA 1YRNA 1U6GA 1TLLA 4AF7A 2BM6A 3H3UA 2BW3A 3TH0A 3QYEA 5DM6F 3DPTA 1WJFA 1P4MA 3FPKA 1OYYA 2OV7A 3E3VA 2HZDA 2Z2SB 3U1KA 5ICGA 1A36A 2XF5A 1YI2B 3WWGA 4RD3A 1Z21A 3WE3A 2XGCA 2DAOA 1TW3A 4BH9A 2WJVA 3EQOA 3G1MA 2VBSA 3E6BA 1YI2I 1FRQA 5JLXA 2KJBA 2JJ1A 5E20A 3R0JA 3OIQA 2QZAA 2ZXIA 2HYGD 2H1KA 3ZIAA 2Z8GA 1R1VA 4BE0A 2IOUG 1A35A 1S72B 5CPRB 1BX0A 3HL2A 3L2CA 3H9NA 1SD6A 1ZH5A 4A0ZA 5BNGA 3FMQA 4Y17A 1S72I 2FA5A 5F1JA 5FO0A 1BPLA 4PJJA 4B4CA 4G7XA 3JRFA 1GV5A 1JE8A 4CYDA 3N90A 4X07A 4E7JA 4Z4WA 4PGGA 3A01A 1X3ZB 2HDCA 1VQMI 3IL2A 1YTYA 4UZFA 2M7AA 2IGOA 3F8NA 3R4KA 4QPOA 3I64A 3KYLA 2L02A 1YG2A 2Z99A 3N6ZA 3E6CC 1H9GA 2FF4A 3JCUC 3P4GA 1VQ5B 1ZK8A 1FMWA 3M3YJ 1D1AA 4OAZA 5HOOA 3Q3SA 1BMFA 1VQ5I 4PJMA 4Z4SA 1YJ9B 1AIRA 4FXUA 4MQVA 2FMYA 1SMTA 1YJ9I 3HAGA 3RKWA 3SQNA 2K9QA 2JQ7A 3WQZA 3H5RA 3PO2J 3L9FA 4FQGA 2K9NA 1EH8A 1ZGAA 4FTHA 4DNTB 2BVLA 4PJLA 2C5BA 2F43A 3H5AA 4AVZA 2V26A 3GUDA 4ZC3A 3GZNB 2C2WA 3AVVA 2IGKA 3SJZA 3SY2A 2M3AA 3VODA 2MGQA 2BE5F 3AG3H 4BS9A 3IAM2 1T95A 2NVUB 2HEOA 3F9KA 3ISXA 2W00A 3V42A 1U8RA 1I6HJ 3I3LA 4M3DA 4E7HA 3OPOA 3TKYA 1FBSA 1UELB 1DDNA 4Y9RA 2F48A 4UHTA 3PL8A 4ASUA 4TKOB 3SQVA 1YS7A 2BM7A 3A8KA 4RDUA 1Z7UA 2V7WA 3FXKA 4HYEA 2HOTA 2MABA 1XSXA 1GAQA 3BP8A 3JTGA 2DI3A 3OYIA 2GQFA 3TDZC 2M8EA 3M8EA 3S3OA 3GX4X 1SAXA 1AKHA 4DQLA 5TV2A 2ZXHA 3HHGA 2X6YA 1OGOX 2VFMA 2HOAA 1YFHA 2HU9A 4X6AJ 3OYHA 3IWZA 3S3NA 2BSPA 4AIDA 1OYWA 2R4GA 4RA2A 4J01A 3KX2A 2K4BA 4PDKA 1XC5A 4DJAA 2QQ8A 3LSHA 1W7PD 4DYCA 4I09A 4PGOA 3SLDA 1X3UA 3RKYA 1SM4A 1OLTA 3SDGA 2CV0A 2BHZA 2ZB9A 1JT6A 1HZEA 3ABKH 2XIGA 4IHYA 1BJKA 1QA3A 1BHEA 2DODA 5E8IA 3WTYC 3A02A 1TYVA 5AMVA 3IKVA 1FTTA 2HLDA 3OZUA 1ULYA 2ZXJA 3OS1A 1LE8A 5HLTA 2L7KA 3JTHA 1KK2A 2OCEA 4A3FJ 1XGNA 2CW5A 4DK0A 3GQ7A 4HOBA 3BNWA 3GZ5A 2OPTA 2Q2EB 5BQTA 1E79A 2NV4A 4J00A 2L7ZA 5E8GA 1YIJB 3VMVA 2A6EF 4B44A 3ZQ7A 3BZCA 3FXMA 1QH0A 1IDJA 3Q5FA 2BOLA 2W85A 3WTUC 3LSGA 3W6JB 1EH7A 3OWTA 5M5WJ 2OA4A 1WRJA 4WZKA 1YS6A 4YCQA 1BW5A 2QKLB 2MC3A 4ITVA 4M71A 4F93B 3VWBA 1XGOA 2XF6A 2HTJA 3K9TA 3HPHA 4OOXA 1WHUA 1KZHA 3EDPA 2RQPA 4RAYA 3JSOA 2H6CA 1D1BA 2EPFA 2XF7A 2HTSA 1FRNA 2NTBA 2LVSA 5KAIC 5DYMA 2CV2A 1FPQA 5CVRA 1WXRA 1E2XA 3HRMA 4M73A 1QZEA 1TWFJ 4I99C 5K5OA 2VBEA 2L54A 3ZCOA 1ETOA 4X05A 1OR7A 2ECBA 3JRAA 2A61A 3OMYA 4HW0A 3LSRA 2R7VA 4MXNA 1OFEA 2MC4A 1UHSA 4JQFA 2XPVA 1TZLA 1V3FA 1WJ5A 1X0CA 4U49A 2EQRA 3I5UA 3ESWB 3GFIA 2XV4S 2JTVA 3L09A 4LG0A 3T0YA 2XNDA 2DOFA 2Y75A 5TISC 2JDIA 3DTKA 2VN2A 4N0BA 3WTZA 4RB3C 1KK3A 3B4NA 1NTCA 2K9MA 4WF2A 3WTXC 5M5XJ 1Z6RA 2KKOA 1MSEC 4BJ5C 1T39A 1O4XA 4FX4A 1D1CA 3GWZA 2WR8A 2CS3A 3F21A 1FP2A 1WCMJ 2CH0A 4LB5A 2WAEA 3BROA 1E3ZA 1QRCA 4Z1MA 2PMZA 3WG7H 1WOSA 4KITB 3PIOF 3PA2A 3LJYA 1D8JA 4N4OB 2TRTA 4RM3A 4A3IJ 1QGYA 2GK7A 3CCJB 1KTWA 1BN8A 1TYWA 5JLWA 1HOMA 3OYFA 5FLXK 1BA5A 5KSWB 3CCJI 1B2RA 1VTNC 2E2HJ 1R1TA 1V5EA 2Q0OA 1U78A 3FHZA 3I4NJ 2QKMB 3OIOA 1YW7A 1R5OA 2LG4A 2HGCA 3BR1A 1R5BA 3G1OA 1TTYA 4IX7A 2B7CA 2D9RA 1J7KA 2VFPA 3H9QA 2A69F 2NOJB 3BTIA 2VBTA 4XN0A 3ZQQA 5DD8A 3BCFA 2K3FA 3BG7A 1T33A 2UUZA 2DOAA 2IS2A 2I1LA 5FO1A 1UD6A 3RKXA 4HDUA 1WPCA 2ZC2A 1KCDA 3CDIA 1V5FA 3LAPA 1OCRH 4M6YA 1TQMA 2EV6A 1Z1DA 3JREA 3ASQA 3CTAA 1Y39A 3HGYA 2M45A 2DK8A 3CCUB 1BR4A 3MN2A 4CZCA 2E71A 3FWEA 4W97A 2UZKA 1V4RA 1IF1A 4UAJA 1DUXC 1PJ6A 3CF2A 1W0JA 2LZJA 3LQ6A 2LR8A 3T8TA 3CCUI 2X1EA 4G6IA 3DU1X 2DCEA 3TOBA 1Q7YD 2HZTA 2VQGA 1QFJA 2M0CA 1E43A 1L3LA 5FL7A 4U88A 3KEYA 1XMAA 2QQBA 1UFMA 3KIOA 1IRZA 1JB9A 1EZGA 2BGCA 2DIEA 2DETA 1B8IB 1S0UA 1TYUA 2DOEA 3FM5A 1EJ9A 1H8EA 4CCOA 2G7UA 2JUCA 3BR2A 1KD1D 2OBPA 5H2FC 4F92B 2B0LA 2X48A 3OJWA 4C0SA 4FISA 1IXSB 5J1UA 5BOXA 1GUUA 1YHQB 4MIMA 3A0BC 3OYMA 2EBIA 5HS7A 1JKRC 2Z9OA 5JHFA 1U5TA 3TMOA 3S93A 2GM4A 2VC0A 1YHQI 2F3LA 4OJLA 1IAWA 3Q9SA 2OK7A 4MQ9F 3BDDA 2MG4A 2L0KA 3H36A 4ABZA 2BXYA 1GDTA 2R7FA 9ANTA 2HS5A 1KC8D 1KQ9A 4LJZF 5KNLA 1W7PA 3WTTC 3WTWC 3F6OA 3E6MA 4X7FA 5JVTA 2E1BA 1HG8A 2M1BA 2ZFUA 3PJRA 3AL0B 4TN1A 1LM1A 1PLUA 5JHUA 3GTKJ 4EMSA 3K69A 1M1EB 4TSFA 4A6EA 4BXXJ 1NHCA 4I6ZA 1WKMA 3ECOA 2D45A 3ABLH 1Q82D 2L9SA 5DSZA 4IHSA 1VLOA 2V7VA 1K73D 2ZL6A 3DBRB 5F04A 2DMQA 2QSHX 3WXMA 5LLQA 3B8YA 1RKWA 2K9LA 3T9GA 1K8AD 2MH9A 3RQ4A 3OE7A 4ZDLA 2R5ZA 3DWLE 5L3DA 4FASD 2XC1A 4ZYEA 4PC2A 3GYHX 2OTLB 4AYBA 5IP6A 4II2A 4RPDA 1IDKA 1VFCA 3S1QJ 2CF4A 1VBLA 2OBSA 1JKOC 1MNDA 3IKTA 1Y1WJ 2OTLI 3DEEA 2COMA 3M07A 4HF1A 1ZELA 5J47A 3GEZA 3PIPF 1E3OC 3F22A 1N08A 5K7ZA 2VPLA 3RPUA 3A03A 4U0WA 1BIAA 3G05A 2STWA 1JKQC 1QFYA 4YAWA 1GO2A 2X1CA 2YR2A 5E3NA 3CCEB 3CO7C 4V2FA 2K02A 4LC0A 3S2HJ 4ACAA 2O04A 3CLOA 1VF9A 3GSIA 2K3PA 2FE3A 3QYBA 1HW2A 1Z0XA 3OW7A 5K5QA 3CCVB 3P5JA 2IAIA 1ETYA 4GCVA 1Y0RA 2X0LA 3O8HA 1S7EA 3RYPA 2V7TA 5EYRA 5JMCB 3CCVI 3K10A 2FQ3A 2CFOA 2V9PA 2R5YB 4PUSA 3GF2A 3BQZA 4RM0A 5HLHA 4G7ZF 5FRMA 3W2HA 5L3GA 5ICEA 2JA6J 2IQ7A 1POGA 3FK6A 4NK8A 1Q86D 2L4MA 3HZJA 5CJ9A 3BLYA 3AVXA 5KHDA 2BM1A 1J59A 3LSJA 3SXYA 3OY9A 2QSGX 1UD8A 3E1SA 1OB5A 1D8KA 2W84A 4L9TA 2OK8A 2E2IJ 2LBFA 4PCQA 4W8TA 3DP7A 5EEGA 1S5LC 3BR6A 1B9MA 5GTHC 4LK0F 4HNVA 3WODF 2XRNA 3KPHA 4I7HA 5HDGA 2DA2A 4EVIA 6PAXA 1RR7A 3BCAA 4R8HA 2JN6A 4XLCA 3MWMA 2QBYA 2IRFG 2Q6IA 3GRHA 3QU6A 1FMVA 3VYRB 2X9DA 2PMZN 5D5XB 3FXLA 2CSOA 2L5QA 2CQQA 1ETKA 1ZG3A 1IN8A 2V4DA 2M4KA 2OC6A 2XB0X 2GREA 1BW6A 2G7HA 2VJ4A 3P9KA 4HNUA 4TMTA 2EJRA 3OOUA 5BPIA 3I1FA 3SEJA 1WMRA 4C3IJ 5B5EC 3ZBTA 1HKSA 2QQ9A 1JT0A 2PJPA 1N06A 4G12A 5E3LA 1QVUA 2BX6A 1K83J 5JI6A 1SFKA 3PQKA 4ZGQB 1T6XA 1O8KA 1PP7U 3ECHA 1R4MB 3KE2A 3OFNA 3R6JA 4XRSG 5A8AA 1MRZA 5HZBA 1NG6A 3FMSA 3I4MJ 2HQ5A 1ZR4A 3U1DA 3SFIA 5HLIA 2R7OA 4X7CA 3FBIB 3K6GA 3ASRA 5ICCA 3HSFA 4KA4A 4IRHA 2R7RA 4XLPF 1J5YA 2YS9A 1BR2A 1WJBA 3G1LA 5DUKA 1R58A 2NVTJ 2EWEA 1G7CA 1I50J 2JUGA 5J4VA 2QE7A 4OJ6A 3BJ6A 4OOVA 1FOXA 1GV2A 3BPXA 5ILVA 3FISA 1HA3A 4IJAA 3IH2A 1XCVA 5DCMA 3D0SA 2LRDA 2VT3A 1QZZA 2M5WA 3RZOJ 2IA0A 3GTPJ 2ELKA 1K4TA 2CO5A 4MYUA 3S1NJ 3E6DA 3FX3A 2FX3A 4XSZF 3ZQIA 5GTIC 1YO5C 3OJXA 1Y8RB 3OZWA 5J8CA 1D5VA 4EJVA 5IYDJ 4E0FA 2R3SA 3QPSA 2RKHA 3DTEA 5M3MJ 4P5OA 4E6KG 2HDNB 1E1RA 3I4PA 4RB0A 2F2EA 4QFMA 3QOEA 1RU4A 2E5NA 5D5WB 3TBIA 3AL0C 2DA3A 1LEBA 1GJRA 3S2DJ 3B73A 3WU1B 4XBFA 4IQJA 5L3BA 2UV1A 4BY7J 2Z16A 3LSPA 1D0ZA 1O7LA 2OBTA 5FKLA 1T0FA 1WSUA 3J80Z 2O9LA 3MKZA 3RCOA 4GRIA 5B1BH 2DU9A 1BI1A 2W57A 4AIHA 2O8KA 3WBJA 5IK2A 3QSYA 3OKXA 1NJID 1JTYA 4YFXF 1VHOA 1KK0A 1S6LA 5EDNA 3BCDA 5LRSA 1QCXA 2CRVA 4QTRA 2LREA 4ENJA 2VL8A 4IZZA 3EUHA 1XTAA 4NC8A 3CF5F 2CW0F 3HUGA 1VJSA 5FNZA 3GFLA 2Z5UA 4ZTJA 1IZ1A 4LMYA 1N75A 1OCOH 1SD5A 1WWXA 1SFXA 4U0YA 1B4AA 2XTXA 3CCRB 2ME0A 1OFLA 1BOBA 4BGDA 3W3CA 4W8SA 2NS8A 4BEHB 3OAAA 4YFKF 2KL4A 3CCRI 2PBIA 1OFCX 2DA7A 3BQYA 3H0GJ 2FNPA 1MBJA 1QA1A 1KQ0A 3QPTA 2INVA 3OL4A 1XB4A 1E1QA 2W6IA 5H6QA 1W0UA 3F8FA 4BHBA 1FBUA 2M87A 5CKTA 4DIQA 1JUMA 2RQQA 4YEJA 4AC0A 2HCJB 2D74A 4QVJA 1XGMA 3EUAA 1B72A 2E1NA 2FOKA 4X7DA 3CJRB 5HZAA 4ZV4A 3Q6QA 3IAS2 2E5ZA 2DMNA 1O3QA 1HDPA 3P9IA 2R93J 2XOKA 3BC9A 3MQ0A 5E1XA 4QPQA 1JGSA 2VE9A 3JRIA 1BL0A 2VOPA 2QTLA 2G0YA 4YIRX 3PUMA 4UV9A 3AVUA 3BTJA 3DV8A 2CC2A 5HXBA 4XLEA 2F4OB 3JQQA 4L8JA 2PYGA 4BE2A 2WBMA 3JR9A 2BVMA 4YHBA 5J3LA 2ACJA 3D26A 4F55A 2VYQA 3ZZTA 2FQ4A 4BBSJ 4IEJA 3O6BB 2BZTA 1SFEA 3CP2A 2JJ2A 3RKQA 4ENMA 2LLKA 1VZ0A 3FXRA 2V1UA 2R7WA 4RAZA 4S05A 3AVTA 3Q0WA 4A5NA 2LFBA 2NVXJ 3JQPA 1XGSA 1P7JA 3NRVA 2M2EA 4G6QA 3CPXA 1TWGJ 2OUMA 5C1EA 4TT3A 2WY8Q 3Q0VA 1J0RA 4PC1A 2DT6A 2XC7A 3DEWA 2GJRA 4M0LA 4L9NA 4L9JA 2PI0A 1B59A 3DLLF 5E3OA 3F23A 4KMUX 1N05A 5FO5A 1PUFB 2IS4A 3U2RA 3AVWA 3NE5B 2V7UA 1ZRFA 2Y0MA 1P7IA 1FP1D 3CJQB 1WOPA 2QZ8A 1EV7A 5H20A 3JURA 1L1IA 4O5VA 2Q6LA 5IYWA 4W8QA 4A3CJ 2XAQA 2RGVA 4Y33A 4YZ0A 3CJNA 2PG4A 4II3A 3VOEA 3BR0A 1BIBA 1Y1VJ 4KN4X 4JK1X 1O8DA 1OMIA 4RLFA 4CQJA 4I0AA 3WY9A 2DO7A 1B72B 1YX5A 5GV8A 1O8IA 2P3MA 3AK5A 2DN0A 3E7LA 1VQPI 3OSFA 4FHTA 3G3ZA 4XM3A 4YELA 1H42A 4J0QA 3IWFA 3KLOA 4LBWA 3W5HA 4LLGF 3EYYA 3O8GA 3CMMA 1Y0UA 4D1QA 3N97A 2HKXA 1B1BA 5DTDA 2ZZGA 5IYNA 1GHCA 2ZTNA 2P6TA 5LHIA 3MCZA 2PMDA 4IXAA 2XVCA 3FXQA 4UB8C 4WZEA 2WTEA 2LY9A 4LK1F 2EZIA 2ZBUA 2C4UA 2E34A 2HYFA 1HKQA 1I39A 2E1MB 5IYCJ 3KETA 1S4MA 2ZZFA 3U6KA 2BMWA 2KIUA 4JX5A 3HSEA 1ITYA 3OR2C 4FETA 3S2WA 4Y15A 3I0TA 5E79C 4HV6A 1BN5A 2ETHA 1RUNA 1EP1B 3HPGA 4NBSA 3BPVA 3GTGJ 3VYSB 4B48A 1VQ4B 1E3PA 3SZPA 3DPUA 3W2EA 2ZFWA 1SFOJ 1S7OA 2HOEA 5FLVA 4P9SA 1QVFB 2VIXA 1VQ4I 1EXMA 1WTHD 5FKNA 5TRDA 1VQMB 3ZPPA 4NUBA 4P12A 4HPQA 2H6BA 1UB9A 5F4JA 1O8GA 4PABA 5EMNA 1HDDC 2ZCWA 3ZRGA 2ADUA 4BBRJ 4RBOA 2DXIA 1R1UA 3BJAA 3H9JA 2JA7J 2IS1A 5GADJ 1DBGA 3PETA 2AQFA 2E7WA 4OP7A 1PKVA 3S1RJ 2CNDA 3E20A 1IN5A 1YIOA 5D6FA 4OZZA 4XKBA 3OP1A 2HR3A 4S04A 2O61A 2GXBA 4A0YA 2X6XA 3GFMA 3HBLA 1BI3A 1LNWA 1CF7A 3CUQB 5D8LB 4Q4ZF 1VLYA 5D5UB 3T53B 5L46A 1OGMX 4HQMA 2BVNA 1QNTA 4OZYA 2X3HA 4OU0A 2FU4A 1HXDA 1MZBA 4D5FA 4U9UA 4OIPF 1AA7A 4Z4UA 1O8LA 2KRFA 4P2NA 4RLZA 4M3FA 2J5PA 3R0AA 5HNFA 3EQNA 4G7HF 2TCTA 2KFDA 2W6JA 3A35A 3BT9A 5F27A 1EE6A 1TL8A 2XAFA 5CVJA 3LQEA 1I7PA 5CQGA 2HDDA 2LC2A 4JOMA 2AXTC 4CYCB 1YITB 3S16J 1ZUNB 4KKTA 1YJWB 2J8KA 2VOOA 3PUFA 2HXOA 2I10A 3BCBA 1YITI 2YX4A 1YJWI 1IG7A 1WJEA 2A3SA 5DD4A 5DDGA 5GV7A 1LFPA 2NS0A 4QVAA 2A05A 1VQ8B 2VBKA 2KVOA 1BI0A 1IRGA 5A88A 1TW2A 2LH9A 3PSFA 1DU6A 1VQ8I 2ZJ2A 1QGPA 1IHMA 1ZM9A 5A2QZ 1Z77A 4UVAA 3ZPNA 4JMQA 3I58A 1A8PA 1LFBA 2A6HF 2H8WA 2VBMA 1U2WA 4J19A 3I59B 1YW8A 2VKDA 5IYBJ 1QJVA 4I84A 3K4CA 3HIFA 4A3KJ 1D8TA 3Q6RA 4QV2A 2X0KA 5FLMJ 3K4JA 1RNLA 3FK7A 2DQLA 2EV5A 3BY1A 1OPCA 4NQWB 3WGGA 4YG2F 1UAAA 1BX1A 1Z67A 1J09A 4OIRF 4AVPA 4M6VA 4HDVA 4Z4ZA 2GQQA 1YLFA 1IN7A 2YUHA 4OJPA 3R60A 1FSHA 3QRFF 5F6FA 3V7AA 3PENA 4C30A 3IC7A 3F8BA 3KLNA 1U3EM 2CQNA 4KYWA 1DDGA 1MJBA 1I27A 1K8FA 3W6VA 2JRMA 4CCLA 2PFBA 4N4NB 2QYUA 2D2WA 1MDMB 3F72A 4B47A 4KKUA 3S1MJ 2QEXB 5DV5A 4B1RA 1OQYA 1CQTA 3NAWA 1I3QJ 1ON1A 2RVCA 3JAMZ 3UKGA 4AUXA 4HIZA 2QEXI 4NBQA 3AFHA 1FDRA 4R1HA 2LOOA 1I6XA 2V5IA 4Z03A 2QDXA 2NTPA 2ZBVA 2XPUA 2L7FP 2QWWA 2D1VA 2CQXA 3Q0UA 1QFZA 2WZPP 4XSXF 2CW8A 4XOTA 5CYVA 1HF0A 4P3IA 4P9UA 1UHMA 1MMGA 1IDYA 2Z1DA 2GA2A 2JK3A 3S8PA 3OZVA 3U6BA 1P92A 2HQNA 2NTQA 3V7SA 3FY3A 3RPQA 1FNNA 2KIQA 1OCTC 1EP2B 3K4NA 3ASSA 2E1MC 2EWNA 1BJAA 3CCYA 1F20A 1ZHFA 2NRAC 1S8NA 3IUOA 4XD7A 2AHQA 5CDFA 2PJRB 4XMYA 1TNSA 3QAHA 1JA0A 1UD4A 2KDOA 3ES9A 1PJ5A 4UZUA 3I56B 4EGZA 3HOUJ 1Z91A 4OIQF 3Q38A 4ZH4F 2L9RA 2BY2A 3JSPA 1QPMA 4ETSA 3I56I 4QWQA 1PDNC 3LQRA 3MVPA 1WGXA 2KMUA 5DEQA 4W1UA 4BHCA 3MMPA 2DCUA 2EINH 3HYIA 3ML6A 3H94A 1OFMA 4YFOA 1X3WB 5FFZA 4I98B 5FKOA 2E60A 3K1PA 5FJ8J 1O8MA 2Y48A 1LB2A 1VNDA 1G3WA 2JPCA 1MMNA 1JA1A 5EEAA 1Q9SA 3HHHA 2H1LA 3MFKA 1O3RA 4RDKA 1H89C 4F7DA 2W7NA 2H09A 2JA2A 4KJZA 2Y69H 4HF2A 5FKKA 2BSAA 2FMLA 1PJ7A 1K7AA 2XTYA 3IH3A 2CUFA 5B66C 1OGIA 2DA5A 4RDJA 3SHFA 2FRHA 2X6WA 4AM3A 1ZYRF 3S3MA 4XN3A 1HLVA 1R22A 3J80K 1JTAA 1QG0A 2F5DA 4E4HA 4OAYA 2VNKA 2LMDA 1VI0A 1X2NA 2W1OA 3CUQC 3CDLA 3C3WA 3VO1A 5TR9A 2FSWA 4GFBA 3AKZA 3W2GA 3FMRA 3F3XA 5LGUA 4M3EA 1GXQA 4BJ6C 2GLOA 2XASA 1O3SA 5IT9K 2DFHA 3WU2C 2QSFX 1KYZA 4IQ4A 1FNCA 1FNMA 5F4OA 4ZZDA 4KKSA 3H35A 1GR1A 4PC6A 1JJ2B 4EGYA 1N07A 3MD2A 3NQOA 4Z4YA 4F7ZA 1BOAA 1X1CA 1X1BA 5EZGA 3ZMZA 3HRSA 2ZNZA 1E64A 5E6TA 1PYVA 2CUZA 2OQGA 2Q2EA 2Z33A 1ZAOA 3CW2A 2EFQA 1VQ6B 5H59A 4HLXA 1XSDA 4HEA2 3KP7A 3HOTA 1N77A 3K4MA 3GVAA 2E19A 5GAGJ 4DW6A 1HC8A 1VQ6I 3GVLA 2XGXA 1MABA 1G8XA 2NXNB 4HE6A 3HOVJ 2V1NA 3H5NA 1E0EA 2A68F 1RRJA 2XROA 1W0KA 5DS9A 2QMUA 3TOAA 1IXCA 4I0BA 2VUMJ 2FBHA 5DUIA 2A6TA 1MH4A 1QBJA 2EILH 4DBRA 5KK1A 3TO7A 3BH4A 3F8CA 3FM3A 4KNYA 2F4NA 2FJ1A 4B3FX 3CQZJ 1D5YA 1UHWA 2BYVE 3PUBA 4P96A 5F1RA 4H0EA 4QUZA 3CCMB 4BAYA 4NNJA 3VSUA 1EFUA 1YX3A 4FWTA 1VQNB 1G7TA 2LDUA 4HG2A 3C2BA 2VQHA 4LG3A 4ZYDA 1Y0NA 2WSSA 1GXPA 1ETXA 1QHHD 3GVKA 3JRGA 2P7VB 2BBYA 3CCMI 3LAJA 3OV8A 3HG9A 3COAC 4XRFA 1Q81D 1VQNI 2P5LC 1SFUA 4K1XA 2MLKA 1GT0C 2OAZA 1Z7LA 1KU3A 4UXNA 4DNRB 5EJCA 1IRFA 4OWRB 2F5FA 2HXIA 2K86A 1SC7A 1T6YA 1JHFA 3MAJA 4LB6B 5BPDA 4OPOA 5J4YA 1RESA 4CDGA 2DDAA 3M8JA 1YW9A 2R7TA 3HRTA 1O7FA 4RS8A 3TO9A 3JRCA 2GXAA 4H9GA 2CBXA 3SFZA 5D4SA 5FROA 1ZM4A 3H92A 2OU2A 1NBMA 5J8FA 1N0UA 5EZHA 4MTEA 3MKYB 2JSPA 4RCYA 1W1WE 2DERA 2BM0A 5GPAA 5GPCA 4A3EJ 5J35A 1N25A 1RIOH 2WA0A 4XKVA 4ZZLA 3RTRA 3M4OJ 3QE2A 4RCZA 1IJEA 3JRBA 3QPHA 3DLAA 1K28D 1H88C 4C9YA 4X0CA 2BY1A 2VKVA 4KICA 1R9TJ 3ROUA 3B82A 2WV0A 3KEOA 1OGJA 4XKCA 4Z4RA 4B3XA 1R5HA 2QGUA 4A3LJ 1PP8F 4UB6C 5LGNA 1TSPA 4JX4A 4CGZA 4RGUA 2FX0A 3I9V2 2JT1A 5AONA 2O0YA 1FTZA 2N8GA 1WSVA 1K5CA 4P26A 2HKOA 3AG1H 2CQ7A 2M7BA 5EGOB 1I5ZA 1MNMC 1DPUA 1YJNB 3GIRA 2XGJA 4XRMA 1R71A 3DTIA 1VQLB 1DU0A 1YJNI 4G6TB 3SUCA 1VQLI 1ZARA 1MMDA 3LSKA 3H3ZA 2BY0A 3KCCA 1WU8A 4WK8F 1OOCA 3OYJA 3LNNA 4PC7A 1JRGA 4Q47A 4BKXA 2E36A 2CUJA 2V7QA 2ISZA 1FSEA 1RR8C 3DFGA 2R92J 2O7OA 3ZQHA 1S3JA 4Y52J 2BPOA 2CRGA 3VNUA 2GAUA 4IHTA 5A89A 2ELHA 2F5EA 2K5CA 1P4AA 2QM3A 3V8KA 4CZZA 2CGPA 3NEUA 1XG2A 4MR0A 4RJLA 3ONYA 3VNVA 1FOWA 2ZMEB 4TMXA 2PEXA 3K1MA 2DT7B 3KP3A 3TQNA 1QVGB 1ZTRA 2JVHA 2LTPA 2C77A 2VNIA 1OCPA 3HRUA 1O8JA 3V76A 1B8IA 5JBQA 2UXXA 4Z05A 3LOCA 3BY6A 5HS8A 2EB7A 2EZHA 5IT3A 2HPMA 3D5LA 1ZRDA 1F5TA 1CQXA 2NYXA 4KN7X 3CRZA 1IN6A 1H0MA 2Q8KA 3LA7A 1LKXA 1TP4A 3WGIA 1CLWA 2V6EA 5BMZA 1R4NB 3BQJA 4GO1A 1NHAA 1TC3C 3NWTA 2F6CA 3GCMA 4NC7A 5DS0A 4M6XA 5C44J 4LIUA 2Y30A 4CXFA 2W82A 4XR6A 1REPC 4GXOA 3DBHB 4LIVA 1HSTA 1IA5A 3A0HC 1ONVA 3TW7A 4BXUA 5B6IA 3BG3A 1G2HA 1JJ6C 4HSRA 1FIAA 4C2UA 3CESA 2R7QA 2F4MB 3ONQA 3HTSB 3C2HA 4L5IA 4EJUA 1J2XA 2ELJA 2LK2A 1WZ2A 1ZREA 4UUVA 3E5XA 4IPAA 3ULQB 3VMWA 4HZFA 1R49A 3ABUA 1A31A 4W8RA 2WY7Q 1BLIA 1D2EA 3SZTA 4UNOA 3LWFA 1TWAJ 3EQLF 3QOPA 5EF6A 4G6DA 5LHHA 1WFXA 5IOZA 1IW7F 1F36A 2MYSA 1QUFA 1ODDA 1OFDA 1IV8A
chains in the Genus database with same CATH topology
2Y0SA 2V7FA 2VB6A 2MABA 2OUMA 2VLAA 1OHHA 5C1EA 4TT3A 1Z3YA 1D0YA 2WY8Q 3OYIA 4IKFA 1LDKB 3K4LA 2DT6A 2XC7A 1G59A 2M5SA 2GJRA 3GBGA 3S3OA 3HKZA 1E3XA 2ZXHA 2X6YA 1OGOX 3A3BA 1EA3A 2NZMA 2HU9A 4PSXA 3OYHA 2IS4A 3S3NA 2BSPA 2VXZA 3IP4B 1YE9A 2D3NA 2R4GA 3NE5B 4J01A 4C2TA 1IB4A 3KX2A 3A2KA 3CJQB 4DJAA 3LSHA 3D5RC 3PNYA 2PJRA 3JURA 1OLTA 4W8QA 2CV0A 3LMWA 4Y33A 1X1DA 1HZEA 4YZ0A 4OJOA 2Q1ZB 1KONA 2UVEA 1BHEA 4II3A 3K70C 4YZXA 1WJDA 3SEZA 2R7UA 2R7XA 1DQUA 3NWSA 2KZVA 2LBFB 5AMVA 1UD2A 1NG7A 2HLDA 4RLFA 1O8DA 3TL4X 3OS1A 5HLTA 2L7KA 4XL9A 2LYCA 1O8IA 1YX5A 3FKSA 3LFUA 4DK0A 3GQ7A 2Q2EB 4YELA 1E79A 4XM3A 2CMPA 1W36D 4J00A 4F52A 3VMVA 4B44A 1QU3A 4E7ZA 3H9GA 2F1MA 3CMMA 4D1QA 4BDYA 2ZZGA 1IDJA 3SYTA 4HWVA 2ZTGA 4D9JA 2BOLA 2R7SA 2ZTNA 1VF7A 2VKHA 3LSGA 1V5GA 2HQAA 4MLOA 3OWTA 3DKXA 2QKLB 4ITVA 1DBOA 4F93B 3VWBA 2XF6A 2QX3A 4U49A 2E1MB 3HPHA 2ZZFA 4ZTFA 4XOPA 4YZQA 2VJIA 4BQNA 5C1CA 1D1BA 2XF7A 2NTBA 3OR2C 4FETA 2CV2A 3OYGA 3B90A 2VBEA 3EPZA 3HPGA 3ZCOA 4YXWA 4MXNA 2GOMA 3OMYA 3VYSB 4B48A 2R7VA 2V31A 2MC4A 3DPUA 3QODA 3VSKA 3W2WA 4CUGA 4JQFA 1O8HA 3PSIA 4ANJA 3L2RA 1TZLA 2VIXA 2XZOA 1X0CA 1WJ5A 1WTHD 1O88A 3N05A 1PE9A 4DOZA 3OOCA 3ZPPA 4NUBA 4HPQA 3M1CA 3DU5A 3W2VA 2XNDA 4PFOA 2IGNA 1O8GA 1SAUA 2JDIA 3ZRGA 2HPIA 3DTKA 3C2GA 2HVRA 3B4NA 1V0FA 2DXIA 2IS1A 2K9MA 3H9JA 1DBGA 2AQFA 3LSMA 1V0EA 4OJ5A 1PKVA 2KP6A 4E7IA 4EW9A 4BJ5C 2GJKA 2UVFA 1D1CA 4ZJZA 4OZZA 2CS3A 4XKBA 1MW7A 4B43A 2CH0A 2X6XA 2LY2A 2WAEA 1E3ZA 4Z1MA 2PMZA 4KITB 1VLYA 2ZSIB 3CP8A 3T53B 1OGMX 3OIPA 3ZGKA 1MMAA 4N4OB 4RM3A 2GK7A 4OZYA 4XKWA 1DGWY 3OEEA 5LD2C 2R9VA 1BN8A 1KTWA 1KMHA 2X3HA 2O5RA 1GLNA 4BDZA 3OYFA 4Y4RA 1AA7A 4PFPA 1V5EA 2BW3B 1H8HA 2WADA 2CK3A 2QKMB 1IRXA 1WJCA 2LG4A 2KQRA 2RNGA 5HNFA 4IX7A 3EQNA 3H9QA 3OS0A 2W6JA 3A35A 2NOJB 1EE6A 1SKYB 4XN0A 2VXDA 3ZQQA 1W36C 3LMMA 4BE1A 2HVSA 3FDYA 3BG7A 3BCFA 5CQGA 2XZLA 2LC2A 2A5WA 2UUZA 2DOAA 2KHMA 2MFZA 4JOMA 2IS2A 4KKTA 1UD6A 1WPCA 2GJPA 3CZ6A 3OYBA 1T0FC 1KCDA 3SEQA 4XNFA 3ZR8X 1V5FA 2WPDA 4F3QA 2WJYA 2IGMA 3HUGB 1UD3A 2ZZQA 3BCBA 1WJEA 1WP6A 2V9KA 1LFPA 4R79A 1BR4A 3GQBA 4CZCA 2VBKA 4E7LA 1W0JA 3CF2A 2KVOA 2X85A 2UWMA 2LZJA 3OYAA 5DN6A 3OL3A 2M0MA 2X1EA 2LH9A 3PSFA 4G6IA 1FX0A 2DCEA 4XLFA 2W4SA 4PJNA 1K6YA 2VQGA 5HVQC 1E43A 2I8DA 5FL7A 3ZPNA 3KEYA 2QXZA 4JMQA 4C2LA 2DIEA 4U87A 3GQ9A 2VBMA 4PSWA 1QJVA 2VQLA 2VKDA 3OEHA 2KPMA 3A1YA 4I84A 1TT0A 3DKYA 3K4CA 4RM2A 3FHNA 1UD5A 4XONA 3K4JA 4HSTA 1H8EA 4CCOA 4NQWB 1UAAA 3A3GA 4Y3OA 1J09A 4F92B 4OJPA 3FKJA 2X51A 1W9XA 4B3GA 3OYMA 4CCMA 4C30A 2O0WA 3ZSCA 2GOXB 5JHFA 1Y6IA 3TMOA 3K4KA 3S93A 1P9QC 4ZYAA 1R6RA 4CCLA 4OJLA 4CCNA 4N4NB 3U21A 4B47A 4KKUA 3OYCA 4BEHA 1KCCA 2GK6A 2XSJC 5KNLA 4ZDOA 5TGTA 1KZLA 3E0JB 4HIZA 4NK6A 1WJAA 3AFHA 2E1BA 2RREA 2LOOA 1HG8A 3ZXSA 2ZFUA 3L2UA 3PJRA 3AL0B 1EFRA 4P22A 2NTPA 1PLUA 2FUG2 4Z03A 1O8FA 4KISA 2LY1A 4PK4A 4TSFA 2P0WA 2WZPP 1NHCA 2CV1A 3SDBA 2CW8A 4XOTA 3GVJA 2L9SA 1MMGA 1UG0A 2Z1DA 3S8PA 4GQNA 2INUA 3B8YA 2K9LA 2NTQA 3T9GA 3RQ4A 3OE7A 3FY3A 4XLAA 4ZDLA 4Z06A 3DWLE 3PNVA 3K4NA 4FASD 4BACA 2E1MC 2KRHA 4G7WA 4BUPA 3OYKA 2O1DA 1X1AA 4AYBA 4II2A 1IDKA 2AQEA 3IUOA 4XD7A 1VBLA 5CDFA 2PJRB 1Y56A 4XMYA 3EUKL 1MNDA 3VYUB 1UD4A 2KDOA 3DEEA 4UZUA 3QYFA 1ZELA 3HXLA 3K4BA 4EATA 2VPLA 3L2VA 3UW0A 4E7SA 3OYEA 5KCMA 3G05A 1DP3A 4H4KC 1BR1A 2X1CA 2KMUA 5CQEA 3FBNB 4BJTA 3H94A 1OFMA 2KLOA 2E60A 2NSPA 2O04A 1O8MA 4DGWB 2K3PA 2VJ5A 3A4CA 3QYBA 3OW7A 2NSTA 4PMHA 1MMNA 3MMYB 1HVXA 1PJRA 3W2AA 3OYNA 1X19A 1I8DA 3MKWB 3T51B 4URRA 2W7NA 2JA2A 4KJZA 1QHGA 2F5VA 4E7KA 2ZZEA 1Z3XA 4BXFA 3K10A 2X6WA 4P1WA 5HNHA 3S3MA 2CFOA 4XN3A 1JTAA 1HA8A 4PUSA 4E4HA 3GQAA 4OAYA 5FRMA 2W1OA 2IQ7A 4BQOA 1JI8A 4NK8A 4BQQA 3AKZA 3OS2A 5LFAA 3BLYA 2XZPA 4BJ6C 5KHDA 3OY9A 4F91B 4DK1A 3BG6A 1UD8A 3E1SA 4IQ4A 4KKSA 2LBFA 3H35A 4W8TA 1RMGA 3MD2A 2D3LA 3LSIA 1X1CA 1X1BA 3VSLA 4KT6A 4DBQA 3H0DA 4CSWA 3BCAA 1PYVA 2CUZA 3PFYA 2JVGA 4XLCA 3RSNA 3GRHA 2IXSA 3VSTA 1FMVA 3VYRB 4CH7A 3L2QA 2KRCA 2L5QA 1PXZA 4HEA2 3HOTA 1N77A 3K4MA 2V4DA 3VR6A 2M4KA 2OC6A 3GVLA 3EUHC 3DQVC 2VJ4A 1MABA 4HNUA 1G8XA 3OOUA 1WMRA 4HNTA 2O17A 1OB0A 4BU2A 4CCJA 2V1NA 3H5NA 1E0EA 2HDWA 3BC8A 1ERDA 1T5EA 1W0KA 1SFKA 1O8KA 4XORA 1DGRM 4X0GA 2NT9A 2VJJA 3OFNA 2L2OA 2MD0A 2A6TA 1X4PA 2HVQA 4DBRA 2XDVA 3BH4A 1NG6A 2V4JC 2WB1A 3UR3C 1O8EA 2O0VA 1MNEA 1U0JA 2VQCA 2R7OA 3KEWA 4B3FX 3FBIB 4CA0A 3K6GA 3PUBA 1NRKA 4NNJA 3VSUA 1YX3A 4HG2A 2WSSA 2VQHA 4LG3A 4RMNA 2R7RA 3LL7A 3GVKA 1QHHD 1CZFA 1BR2A 1WJBA 2X53S 3HG9A 2EWEA 1X4OA 2JUGA 2QE7A 4OJ6A 1Z7LA 1LVKA 4DNRB 4U7BA 1COWA 4OWRB 3DDYA 3M8JA 2L9NA 2LRDA 4AU7A 2R7TA 4XLHA 3HC7A 4YZAA 5FROA 3J7AY 2IS6A 1NBMA 1GQ8A 3VSVA 4BL0B 3MKYB 2JSPA 3D5SC 1H80A 3PNTA 4E0FA 2PYHA 1O8LA 3VYTB 2XAUA 2WA0A 4XKVA 2ZSHB 3DTEA 3RTRA 4P5OA 3HOSA 4E6KG 1E1RA 3DLAA 1N78A 1K28D 2CW7A 3QOEA 4CCKA 2E5NA 1RU4A 3TBIA 3AL0C 3OR1C 4C9YA 1I18A 4YRVA 3DU6A 2ODLA 4IQJA 2UV1A 4XKCA 2Z16A 4B3XA 1D0ZA 3OYLA 2HNHA 2F4IA 2BW3A 3I9V2 3QYEA 3SZGA 3DPTA 3MKZA 3RCOA 1WJFA 2OV7A 4GRIA 2HZDA 2Z2SB 1D0XA 3L2WA 2XF5A 3WWGA 1K5CA 3DPLC 2M7BA 3RPUD 2XGJA 1Z21A 5IK2A 3DTIA 2WJVA 3EQOA 3BCDA 1QCXA 2LREA 2JJ1A 2DJIA 3OIQA 4G6TB 2ZXIA 2VL8A 3ZIAA 2NT6A 2Z8GA 3SUCA 1MMDA 3LSKA 4IZZA 4NC8A 4BE0A 1VJSA 1OOCA 2VASA 3OYJA 4ZTJA 3LNNA 5CPRB 1JRGA 3KRGA 3HL2A 2CUJA 2V7QA 1N75A 3OYDA 2X1DA 1RWRA 4XQFA 1OFLA 2Z6BD 1BPLA 4PJJA 1BOBA 2K5CA 4BGDA 4G7XA 3K70D 3W3CA 1XG2A 4MR0A 4W8SA 4BEHB 3OAAA 4E7JA 2KL4A 5FRNA 2DT7B 3VDXA 2M7AA 2IGOA 2JVHA 4QPOA 3KYLA 4RLQA 1O8JA 2INVA 3OL4A 4ZDPA 1E1QA 2W6IA 3T56B 4Z05A 2HPMA 2JIZA 3D5LA 3G2BA 1FMWA 1D1AA 5CKTA 4DIQA 4OAZA 5HOOA 1BMFA 4U4BA 2RQQA 4YEJA 4HRIA 4PJMA 1LKXA 3EUAA 2M4GA 4FXUA 1AIRA 2V6EA 3CJRB 3IAS2 2E5ZA 3NWTA 3HAGA 2F6CA 2XOKA 3BC9A 4NC7A 4QPQA 2WAQA 2PECA 3WQZA 3H5RA 4LIUA 2W82A 4XR6A 1IA5A 4LIVA 4DNTB 2BVLA 4PJLA 2F43A 3H5AA 4XLEA 3FPPA 4L8JA 4AVZA 2V26A 4HSRA 4C2UA 2PYGA 3GQ8A 4ZC3A 3CESA 2R7QA 2WBMA 3ONQA 4BE2A 3C2HA 2IGKA 2X8KA 2ELJA 2BVMA 2M3AA 2QY1A 4F55A 3S32A 5HKKA 3VMWA 4BS9A 1OR7C 4W8RA 3IAM2 1T95A 2WY7Q 1BLIA 3F9KA 2W00A 3CP2A 3V42A 2JJ2A 3I3LA 1S9HA 4LITA 4E7HA 3OPOA 1UELB 1WFXA 3JU4A 2WAFA 4ASUA 1VZ0A 3PL8A 2MYSA 2R7WA 4TKOB 3UNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1D A;  4OZY A;  1IDK A;  4XKW A;  1KTW A;  2X3H A;  1BN8 A;  1VBL A;  5C1E A;  4XLH A;  4XMY A;  4YZA A;  3VSV A;  1GQ8 A;  1H80 A;  2PYH A;  3UW0 A;  1O8L A;  3EQN A;  4XKV A;  2X6Y A;  1OGO X;  2NZM A;  1EE6 A;  4XN0 A;  2BSP A;  1IB4 A;  1RU4 A;  1OFM A;  2O04 A;  2NSP A;  1O8M A;  2ODL A;  3JUR A;  2NST A;  1KCD A;  4XNF A;  4PMH A;  4W8Q A;  3LMW A;  4YZ0 A;  4OJO A;  2UVE A;  4URR A;  1BHE A;  4YZX A;  3WWG A;  1K5C A;  2VBK A;  5AMV A;  1O8D A;  2X6W A;  2X85 A;  4XN3 A;  1JTA A;  3EQO A;  4XL9 A;  1O8I A;  3GQA A;  1QCX A;  4XLF A;  3GQ7 A;  2IQ7 A;  4NK8 A;  4YEL A;  2NT6 A;  4XM3 A;  2Z8G A;  3SUC A;  2QXZ A;  3VMV A;  1OOC A;  4C2L A;  1JRG A;  3GQ9 A;  3KRG A;  2VBM A;  1IDJ A;  1QJV A;  4I84 A;  4HWV A;  4W8T A;  1RMG A;  1RWR A;  4XON A;  4XQF A;  1OFL A;  1XG2 A;  4MR0 A;  4W8S A;  1DBO A;  3GRH A;  4XLC A;  4OJP A;  3VST A;  2QX3 A;  4U49 A;  4YZQ A;  4XOP A;  2VJI A;  1PXZ A;  1O8J A;  2INV A;  5C1C A;  2NTB A;  2O0W A;  4Z05 A;  3ZSC A;  3B90 A;  1WMR A;  2VBE A;  2O17 A;  4U4B A;  4YEJ A;  4OJL A;  4MXN A;  1AIR A;  1KCC A;  1O8K A;  4XOR A;  1O8H A;  2NT9 A;  2VJJ A;  4NK6 A;  1X0C A;  1PE9 A;  1O88 A;  2PEC A;  3ZPP A;  4XR6 A;  1HG8 A;  1IA5 A;  4Z03 A;  2NTP A;  1PLU A;  1O8G A;  1O8E A;  1O8F A;  2O0V A;  4XLE A;  3B4N A;  4AVZ A;  1NHC A;  2PYG A;  3GQ8 A;  4XOT A;  3VSU A;  1DBG A;  4OJ5 A;  2QY1 A;  1CZF A;  4EW9 A;  3VMW A;  2UVF A;  2EWE A;  2INU A;  4W8R A;  3B8Y A;  4OJ6 A;  4OZZ A;  2NTQ A;  3T9G A;  3FY3 A;  2X6X A;  4XLA A;  4Z06 A;  1OGM X; 
#chains in the Genus database with same CATH topology
 2Y0S A;  2V7F A;  3ZMS A;  1BM9 A;  1KYW A;  3F0C A;  3JX8 A;  1KU9 A;  2VLA A;  2C6Y A;  3J7Y J;  5D8K B;  4YAU A;  5J3O A;  1LDK B;  2DTZ A;  2P4W A;  5LRR A;  2GXG A;  2OF7 A;  3I54 A;  1FYK A;  2QGG A;  4YAO A;  4KIB A;  1E3X A;  1TT5 B;  1WSR A;  3ABT A;  2UXN A;  4PC3 A;  2VXZ A;  3IP4 B;  1YE9 A;  3U9G A;  2WZN A;  4RAF A;  1UST A;  4UVB A;  2DMP A;  2E2J J;  1R5G A;  4FE4 A;  3PNY A;  1W35 A;  1AOY A;  1IJW C;  2M8G X;  4EQQ A;  1APL C;  3MEX A;  3LMW A;  1X1D A;  2EK5 A;  2ZKZ A;  5FD5 A;  5TJJ A;  4P3Y A;  5LEJ A;  1JUP A;  1KON A;  2EFP A;  5C3E J;  1K78 B;  2UVE A;  4OJO A;  2XB5 A;  3K70 C;  4YZX A;  1WJD A;  4OIO F;  2R7X A;  2RN7 A;  1DQU A;  4XID A;  2KZV A;  4IO9 F;  1UD2 A;  5F0F A;  1Q1H A;  3TL4 X;  4LLL A;  1ACI A;  2PLF A;  1KA8 A;  1ZGW A;  1SMY F;  4JYK A;  2ME6 A;  4YII A;  5F08 A;  2A5Y B;  4M74 A;  2JA8 J;  3ELK A;  1I1G A;  4F52 A;  4BY1 J;  3HOY J;  2YSR A;  4EJT A;  1QU3 A;  5KVR A;  5ICF A;  1NB0 A;  3H9G A;  1O3T A;  3BTC A;  2QUF A;  1ZRC A;  2F1M A;  4BDY A;  3SYT A;  2ZTG A;  3HKZ N;  3L00 A;  5A2Q K;  4U7D A;  4WX9 A;  2VKH A;  3OW2 B;  1V5G A;  2HQA A;  3F6V A;  4MLO A;  5AIQ A;  3DKX A;  4IRG A;  4EM1 A;  2R5Y A;  3WGH A;  3WU0 A;  4XK4 A;  4I01 A;  3FJO A;  3Q3A A;  1FBQ A;  4A2U A;  1SVO A;  2YU3 A;  3ERM A;  1W5C C;  5TY0 A;  2DDB A;  5EG0 B;  2QX3 A;  4A5M A;  5CLS A;  4YZQ A;  4FX0 A;  4FK8 A;  5IOY A;  4BQN A;  5C1C A;  2XKO A;  2VT2 A;  4IVN A;  1XS9 A;  3FXO A;  1YYV A;  2ZJQ F;  4Q5S F;  2BGI A;  1LUJ B;  4TMV A;  3S15 J;  3WG9 A;  2VBY A;  1NDH A;  3CMY A;  4PGH A;  2GOM A;  4YXW A;  3W2I A;  2KDZ A;  4ASN A;  2XSD C;  1IUY A;  4EV0 A;  1A6I A;  1OKR A;  3S14 J;  3VSK A;  2P6S A;  5FLX Z;  1KU7 A;  2ZL5 A;  3KYC B;  4EJW A;  4C2M J;  4KUM A;  2LSO A;  3ZQG A;  4ANJ A;  5F0H A;  3L2R A;  1ZM2 A;  4G1B A;  1FC3 A;  2DTR A;  2PQ8 A;  1RET A;  1PE9 A;  5LHG A;  3BR3 A;  3N05 A;  4B3A A;  1A04 A;  4DOZ A;  3OOC A;  1O88 A;  1AMO A;  5BSX A;  3M1C A;  3BY2 A;  4PFO A;  2HQR A;  2IGN A;  3JAM K;  1MSF C;  3PQJ A;  3C2G A;  2HVR A;  2ZO4 A;  3BTL A;  4EM0 B;  4B8X A;  3WTS C;  3B02 A;  3LSM A;  3FXU A;  1XN7 A;  2E1O A;  2KP6 A;  5GP9 A;  4EW9 A;  4A12 A;  2E1C A;  2HYJ A;  4HBL A;  4A0X A;  4ZJZ A;  5H5J A;  3FIW A;  4UUS B;  2XAG A;  2D1H A;  4B43 A;  2ZME C;  2LY2 A;  4N3N A;  1R5I D;  2ID3 A;  1JJ8 C;  4KMF A;  5KAF C;  2NAZ A;  3AG4 H;  3CP8 A;  4M2L A;  1W5T A;  2K27 A;  3CJT B;  3OIP A;  4LFU A;  1MMA A;  2VI6 A;  2E1R A;  2VNJ A;  2R9V A;  3NAU A;  2NOG A;  5DNS A;  2O5R A;  5E1W A;  4BDZ A;  3W6K B;  1O57 A;  1T2K A;  4NC6 A;  4A6D A;  4AIJ A;  4YAL A;  1YRN B;  3SYJ A;  1LLW A;  4P6V F;  4PFP A;  2BW3 B;  3WE2 A;  2PX9 A;  1H8H A;  5ILS A;  2CK3 A;  2PLY A;  2RNG A;  2B9S A;  1RQP A;  3DBL B;  5K5R A;  4M1K A;  4ROX A;  1HW5 A;  3W2F A;  3E1Y E;  2EIK H;  2G0E A;  3KZY A;  1U8B A;  1SKY B;  2VXD A;  2DYI A;  2XT2 A;  1W36 C;  5AN9 A;  3LMM A;  4BE1 A;  2HVS A;  2XZL A;  3CUO A;  2CWE A;  2A5W A;  2YWH A;  2KHM A;  5GAH J;  2DQR A;  1VQ7 B;  2GJP A;  1FEX A;  3CZ6 A;  1T0F C;  2VFQ A;  4M72 A;  3SEQ A;  3ZR8 X;  3DCF A;  2WPD A;  5L3C A;  3EET A;  4Q7J B;  2WJY A;  2IGM A;  2ZZQ A;  3MZY A;  1G3T A;  1VQ7 I;  5HLG A;  1PUE E;  1G7R A;  2OBR A;  3B6C A;  1EFC A;  1WP6 A;  3JQR A;  2V9K A;  3GW2 A;  4NDL A;  4R79 A;  2ZIT A;  2V1D A;  4BHP A;  1FX7 A;  2E7X A;  4M3B A;  2UWM A;  4XIC A;  3M8F A;  1YQA A;  2M0M A;  2PIA A;  2AXL A;  4XLF A;  3JRH A;  2PN6 A;  1M90 D;  3K2A A;  3A01 B;  1Q1V A;  2I8D A;  3JW4 A;  2B5O A;  2QXZ A;  2XHK A;  4IHW A;  2VBW A;  4UUT A;  4C2L A;  4RB2 C;  3SJM A;  3H09 A;  4U87 A;  3VO2 A;  3CC7 B;  1ETV A;  3FF5 A;  3ZP5 A;  4PSW A;  3HOZ J;  2KPM A;  3A1Y A;  2B63 J;  3DKY A;  4RM2 A;  1BC8 C;  2DA1 A;  3FHN A;  2J7K A;  2CQK A;  4XON A;  3CC7 I;  4E70 A;  3CLQ A;  4MFE A;  4TMZ A;  1QVT A;  4KIF A;  1EWY A;  4O6J A;  4LBV A;  1VQ9 B;  3A3G A;  2VFO A;  3ERE D;  2L3D A;  3FKJ A;  2QLZ A;  2YUS A;  3QP5 A;  1VQ9 I;  4ZCM A;  4RD1 A;  1CNE A;  2QEN A;  5IYQ A;  4Z4T A;  1VQP B;  2X51 A;  4B3G A;  2DFF A;  5FGM A;  3W5U A;  3ZZ0 A;  1T8I A;  2Y0S N;  4M4S A;  2VON A;  3N4M A;  3BZK A;  4MTD A;  4IHV A;  3TO6 A;  1R6R A;  3MKL A;  3AAF A;  4HLY A;  4A3M J;  3IHU A;  3U21 A;  1IO2 A;  1B9N A;  4TV7 A;  4BEH A;  1SD4 A;  2GK6 A;  3G6E I;  2H94 A;  2XSJ C;  4NK6 A;  5TGT A;  3E0J B;  5ILU A;  1WJA A;  3LST A;  1LFU P;  2EA4 A;  4N3G A;  2RRE A;  3B6A A;  4CHU A;  4P22 A;  1EFR A;  2D5V A;  1T56 A;  5J6X A;  1R7J A;  4KFC A;  4KIS A;  4LBZ A;  1O8F A;  3ASN H;  4KT5 C;  3J7Z I;  4YDT A;  2STT A;  2EFO A;  2O6W A;  1QRY A;  2R7Z J;  1UJ8 A;  1GVH A;  3ZC3 A;  4GQN A;  2INU A;  2FNA A;  1P4W A;  3PSS A;  1AKH B;  2X3U A;  2K85 A;  4QIW N;  3PUN A;  3CC4 I;  4BAC A;  2VFN A;  2FBK A;  4PJ0 C;  1EF4 A;  2RV8 A;  2RC6 A;  2B7E A;  4OPW A;  2FOW A;  2K9S A;  4O3M A;  3NB2 A;  1X1A A;  3ZMT A;  4AIK A;  1PVE A;  2AQE A;  1XDS A;  1LDJ A;  4RGS A;  4HQE A;  3A1P A;  4YIF A;  2VPR A;  3EUK L;  4IRI A;  2F5C A;  2CU7 A;  3GTQ J;  3QYF A;  4MYT A;  4IHX A;  2ESN A;  2QQA A;  4FN5 A;  1LEA A;  1BR1 A;  5CQE A;  3CO6 C;  4YEI A;  2XUB A;  1LE8 B;  1K79 A;  1JUS A;  3HB9 A;  1QPI A;  2WWY A;  2O8X A;  2NSP A;  2JRT A;  4A3J J;  2VJ5 A;  4M9X A;  1NK3 P;  2MH2 A;  2PMU A;  4Y9U A;  2XTW A;  4PMH A;  1ZLJ A;  1RI7 A;  3MMY B;  1HVX A;  3SLN A;  3W2A A;  3OYN A;  1Z05 A;  2CYY A;  1I8D A;  3T51 B;  1QQ1 A;  4URR A;  1TBX A;  1LJ9 A;  2F5V A;  4UV8 A;  3TGN A;  4OMY A;  4E7K A;  1P2F A;  1U2R A;  1Y8Q B;  2IEK A;  1Z3X A;  1ZGJ A;  3E5U A;  1G4D A;  3P26 A;  1PUF A;  2OJE D;  2L9V A;  1G7S A;  4K2E A;  3GQA A;  1UG2 A;  3FXJ A;  2VZL A;  4MFD A;  5LMZ A;  1TQI A;  1W5S A;  4A3G J;  1JI8 A;  4WWC A;  4DNC A;  4HV5 A;  3OS2 A;  4B4D A;  3ZMU A;  3HSR A;  2EIM H;  1X1P A;  2XZP A;  4P6Y A;  3LQQ A;  3CPW B;  1FIP A;  3K1N A;  3C1D A;  1SKQ A;  4HX8 A;  1FYM A;  1I3A A;  1E62 A;  1T6S A;  3KP4 A;  1RMG A;  3L7W A;  2GZW A;  2D3L A;  2F1L A;  4ZYG A;  4JP0 A;  3VSL A;  1MBF A;  1TNT A;  4KT6 A;  5FKM A;  2IA2 A;  4DBQ A;  3H0D A;  4CSW A;  5J1Y A;  3PFY A;  4JBA A;  3ZQL A;  1LPQ A;  2JVG A;  2MW8 A;  1A6Q A;  3LNQ A;  1IDZ A;  2IXS A;  2HFH A;  1ZN2 A;  3VST A;  1IUF A;  4CH7 A;  3L2Q A;  2KRC A;  3WNC A;  3VMF A;  2AO9 A;  2FBI A;  1FYL A;  4LG0 B;  1PXZ A;  1T08 B;  1XCB A;  5H6R A;  3HEF A;  5HDN A;  2CJJ A;  3VR6 A;  5DM7 F;  2KIF A;  3I71 A;  3DQV C;  1ZQ3 P;  3RJP A;  3RY8 A;  4HNT A;  4CCJ A;  3OSG A;  5JLV C;  2HDW A;  5ED4 A;  1T5E A;  2ICW G;  4L5E A;  2GPJ A;  1T38 A;  4XOR A;  4X0G A;  1KJZ A;  2NT9 A;  2VJJ A;  2MD0 A;  5HS9 A;  5IPA A;  1X4P A;  2HVQ A;  2Q6K A;  2XDV A;  1XX5 A;  4GDF A;  3ZQC A;  2VOD A;  1WI3 A;  4Z4V A;  2P5V A;  2WB1 A;  4WXC A;  4UVC A;  5LGT A;  5K1Y A;  1MNE A;  1VQO B;  2O0V A;  3B8H A;  2FD5 A;  3KEW A;  3Q39 A;  3J81 Z;  2K40 A;  4A3D J;  3KFW X;  1NRK A;  2BM4 A;  3IH4 A;  5L3E A;  1VQO I;  4RMN A;  4D7N A;  3AGQ A;  3TW6 A;  1N8R D;  3GXO A;  1CZF A;  1AIP A;  4RGR A;  3BR5 A;  1X4O A;  1BJZ A;  3GTO J;  5BSY A;  2V79 A;  2NPF A;  4RDL A;  2MLG A;  5FFX A;  5KW9 A;  5AIP A;  3VFZ A;  1K6O A;  3SZE A;  2DYS H;  1LVK A;  4G9Y A;  4U7B A;  1COW A;  1QA2 A;  5EEH A;  4Y7N J;  4TMW A;  2VBV A;  3G4S B;  3E97 A;  5E3M A;  1V5V A;  1SD7 A;  1K61 A;  3QFR A;  2L9N A;  3BJO A;  1IV6 A;  1TQP A;  4HX4 A;  1FOK A;  4XLH A;  1USS A;  2IVM A;  3G4S I;  3HC7 A;  4CO8 A;  1H85 A;  1KQ8 A;  4YZA A;  1RZ4 A;  4P9F A;  2IS6 A;  2C78 A;  2ZL7 A;  5DCF A;  1GQ8 A;  4BL0 B;  2A07 F;  3CMA B;  1FLI A;  3D5S C;  1ZR2 A;  2JN9 A;  3PNT A;  2V9V A;  3SJP A;  3VYT B;  4QLC U;  1WH7 A;  3HM5 A;  2FEZ A;  2ZSH B;  3CMA I;  3AST A;  3HOS A;  4WQM A;  2QYO A;  3CUQ A;  3WHC A;  1NB9 A;  1JHH A;  2WV1 A;  3M9A A;  4CCK A;  2Y9Z A;  1N78 A;  2VBX A;  4EH1 A;  4YRV A;  4WZT A;  3QWL A;  1LLZ A;  1YIJ I;  1SVM A;  5CVI A;  1UMQ A;  1ZKG A;  2P81 A;  4X7E A;  1M1K D;  2DK5 A;  4ESF A;  2IT0 A;  1IB0 A;  2HNH A;  2F4I A;  3WNB A;  2MD5 A;  2VBZ A;  4BYY A;  2KZG A;  4Z2Y A;  3SZG A;  4G1V A;  4WXH A;  4R71 A;  2NVQ J;  4ZCL A;  1DPR A;  2LP0 A;  1D0X A;  3L2W A;  5C4X J;  3CB4 A;  2BEO A;  3DPL C;  3RPU D;  3LFK A;  3Q9V A;  3K2Z A;  3R6S A;  2OZ6 A;  1DAR A;  3ZOB A;  5LBQ A;  2EA2 A;  4L18 B;  2XNC A;  4MO7 A;  2IW5 A;  3K7A J;  4CYC A;  2DOG A;  3V7C A;  4AF6 A;  1W2B B;  2DJI A;  2ID6 A;  2P8T A;  4LD5 A;  3J7A O;  2NT6 A;  1IXR C;  3M1E A;  4M3G A;  4D0P A;  1HKT A;  2LF8 A;  5LEK A;  2EIX A;  2VAS A;  3HTU A;  1XPX A;  4LBY A;  3KRG A;  1TTT A;  2DJN A;  1U5T B;  3TP3 A;  3DKW A;  3QP6 A;  4P1V A;  3ABM H;  2X1D A;  3OYD A;  1RWR A;  4XQF A;  2RC5 A;  2Z6B D;  4DQK A;  1EFT A;  2OCC H;  3K70 D;  1B6A A;  2GBY A;  1FY7 A;  3A8J A;  3MCA A;  1L0O C;  5FRN A;  1U9N A;  1W7P B;  3VDX A;  4JX6 A;  2NVY J;  5JR3 A;  4IOC F;  2QA4 B;  4RLQ A;  1DP7 P;  1S29 A;  4M9S A;  4ZDP A;  3T56 B;  2BGJ A;  1UZC A;  5F0C A;  2X6O A;  3I59 A;  3LA2 A;  2JIZ A;  2QA4 I;  3G2B A;  4RD6 A;  1WOR A;  3WTV C;  3ZMD A;  3BWG A;  1Z9C A;  3GZ6 A;  4U4B A;  1QUE A;  4HRI A;  4BPR A;  2WC2 A;  4YC5 A;  4NQW A;  4A93 J;  2M4G A;  2OZU A;  4DZP A;  4OMZ A;  2I5U A;  4UY8 I;  2V1X A;  2OYN A;  3M7G A;  2XPW A;  4M9Z A;  3VEP A;  1OYI A;  1E63 A;  2WAQ A;  1KGS A;  2PEC A;  2IBD A;  2YWG A;  4UZE A;  2R5Z B;  2ZBK A;  1R36 A;  3FPP A;  3GQ8 A;  2X8K A;  1MDM A;  3ASP A;  2IJL A;  2QY1 A;  2MBF A;  3MZH A;  3S32 A;  2ZJR F;  5HKK A;  2L7M P;  1OR7 C;  2DMU A;  2YU9 J;  1WH5 A;  1WQ2 A;  4CIC A;  1MBE A;  1S9H A;  4LIT A;  4WXD A;  3ASO H;  3VPR A;  3JU4 A;  2WAF A;  4X1E A;  1T98 A;  2BHY A;  3FKI J;  2NNN A;  3H1C A;  1E17 A;  3KP2 A;  1GAW A;  3UNG C;  4IKF A;  1R5N A;  1W4M A;  1IGN A;  3RIQ A;  5C4J J;  5HOD A;  2VB6 A;  2IP2 A;  1OHH A;  1ELO A;  3CCQ B;  1G3Y A;  1D0Y A;  1Z3Y A;  2EIJ H;  3A8I A;  3O3K A;  2O6G E;  3DXJ F;  3K4L A;  1G59 A;  2M5S A;  3SKB A;  3CCQ I;  3G71 B;  2QN6 A;  1MJA A;  3GBG A;  3AG2 H;  4ENK A;  3HKZ A;  3J81 k;  3A3B A;  1EA3 A;  2NZM A;  4L9V A;  4PSX A;  2VC1 A;  4KIG A;  3G71 I;  4KDP A;  4FT8 A;  3G73 A;  1IC8 A;  1LQ1 A;  2D3N A;  2XGE A;  2CG4 A;  3KZI C;  2EZL A;  4AWX B;  5D5V B;  2NNY A;  4C2T A;  1STZ A;  1KK1 A;  3V8J A;  3A2K A;  4N9H A;  2OTJ B;  1MKM A;  3PSZ A;  3D5R C;  2PJR A;  3BOQ A;  1P4X A;  4DZJ A;  3R61 A;  2CUE A;  1DAB A;  3QU3 A;  1ZG5 A;  4LLN A;  2OTJ I;  2Q1Z B;  2JZY A;  3X2Q H;  1QX4 A;  2DY1 A;  4QSH A;  3WYA A;  1WOO A;  1JGG A;  3SEZ A;  2R7U A;  2GIZ A;  3NWS A;  4MEX F;  2LBF B;  2DW4 A;  1NG7 A;  1OCC H;  5FIU A;  2XGD A;  1ON2 A;  2ZJP F;  4XL9 A;  1HF2 A;  2LYC A;  1XDU A;  3HDD A;  3FKS A;  2HWV A;  3LFU A;  1W34 A;  2QBY B;  1OCZ H;  2XAH A;  2CMP A;  4ZYH A;  1D3Y A;  2JPB A;  3TDU C;  1W36 D;  3IV5 A;  2WB1 N;  1E3H A;  4G8X A;  4V19 K;  4RD2 A;  4X8I A;  4C43 A;  1EA0 A;  2J5O A;  4E7Z A;  2RAE A;  3P27 A;  4N9I A;  2C4T A;  4HWV A;  2NS7 A;  1H8A C;  4D9J A;  5D6E A;  4BNC A;  2R7S A;  1VF7 A;  2XRL A;  1JXS A;  1R23 A;  1X58 A;  4WZL A;  1BBY A;  1UCR A;  3K0L A;  1JKP C;  1FZP B;  1B23 P;  1DBO A;  3KEQ A;  1EH6 A;  3PO3 J;  1EP3 B;  3ZN0 A;  4MNU A;  1LDD A;  4I02 A;  4C3H J;  1CGP A;  1XMX A;  3O2P E;  3H3V K;  1MMS A;  4ZTF A;  4XOP A;  2PMH A;  2VJI A;  1QZY A;  3KP6 A;  2DPU A;  4L0Y B;  2P7C B;  4I76 A;  3HGG A;  4M53 A;  3OYG A;  4U0V A;  2COB A;  1R00 A;  1S7A A;  1F1Z A;  3EPZ A;  3KZZ A;  4GGG A;  1W87 A;  2V31 A;  2R6H A;  3VB2 A;  3RZD J;  4I2O A;  1D1N A;  3QOD A;  3HOX J;  3W2W A;  4CUG A;  2YWF A;  4D5C A;  2LF7 A;  3PSI A;  4P25 A;  2JJ7 A;  4ZCI A;  1O8H A;  5M3F J;  2XZO A;  4LOC A;  2AHO A;  2JWT A;  1YOV B;  3DU5 A;  3W2V A;  2V7X A;  3JRD A;  2DFI A;  1SAU A;  5DCM B;  2HPI A;  4GYI A;  1RUO A;  1RQR A;  1V0F A;  2IA1 A;  1QRB A;  1OIS A;  1MIJ A;  1U5T C;  2TDX A;  1HBX G;  1V0E A;  4OOS A;  4OJ5 A;  4RPB A;  5ERI A;  4E7I A;  4NCN A;  1UMK A;  3PA1 A;  1BC7 C;  2GJK A;  4YAF A;  3MHP A;  2UVF A;  2YPR A;  4MHG A;  2M9H A;  1VQK B;  1MW7 A;  3KYD B;  1ZG1 A;  1JTX A;  3CCE I;  1VQK I;  2ZSI B;  1IB4 A;  2BXZ A;  2EH3 A;  3ZGK A;  3B90 A;  3KL9 A;  1Z6T A;  3ISP A;  1U9O A;  1V55 H;  1DGW Y;  4XKW A;  5LD2 C;  3OEE A;  1KMH A;  4G94 A;  1YX2 A;  1GLN A;  4Y4R A;  4HF0 A;  3QFT A;  3BG5 A;  5K7F A;  2EFG A;  2WAD A;  3GO5 A;  4ESB A;  1IRX A;  1WJC A;  5THX A;  2KQR A;  1GVD A;  3I55 B;  1RPW A;  4FE7 A;  1XFO A;  2RNJ A;  4HX7 A;  1OJL A;  3OS0 A;  1FND A;  3P9C A;  1J9Z A;  2OD5 A;  3QQA A;  3I55 I;  2K7L A;  3ZQF A;  3FDY A;  3GTM J;  1AU7 A;  4AC9 A;  2BF4 A;  2Y2Z A;  2MFZ A;  3RIR A;  4WCG A;  2RC4 A;  3LYC A;  5FB2 A;  3OYB A;  3GTL J;  1ENH A;  4XNF A;  2Z3Y A;  4IF4 A;  3LO8 A;  3V4G A;  4F3Q A;  3HUG B;  1UD3 A;  2VBU A;  5E18 F;  2DPD A;  5FD6 A;  3GME A;  4Q48 A;  3BZ6 A;  2XKP A;  1MJ9 A;  1TWH J;  4HA8 A;  3GQB A;  1T6Z A;  2L01 A;  2G9W A;  2K4J A;  4E7L A;  2LKX A;  2H8R A;  5DN6 A;  2X85 A;  3OYA A;  3CC2 B;  2KIM A;  3OL3 A;  2L4A A;  2KIS A;  4NB5 A;  3RDI A;  1MH3 A;  3TP0 A;  1FX0 A;  2W4S A;  4PJN A;  1K6Y A;  5L3F A;  2B7B A;  5HVQ C;  2WAQ N;  2EV0 A;  2X4H A;  3CC2 I;  2LD5 A;  4L0Z B;  1FJL A;  3GQ9 A;  3QPL A;  1G3S A;  2VNH A;  4IW3 B;  3D1N I;  2VQL A;  1TVC A;  3OEH A;  1TT0 A;  3PM1 A;  5EGO A;  1UD5 A;  4Y13 A;  4HST A;  1SVL A;  1FNB A;  5J40 A;  1RKT A;  2JMW A;  2V6C A;  4Y3O A;  4C3J J;  2P5K A;  1JNY A;  1H9T A;  4RAG A;  3QFC A;  1XSV A;  1DG1 G;  2ZXW H;  1DDI A;  1F60 A;  2EZK A;  2R7D A;  2W48 A;  3C7J A;  3GFJ A;  4NHJ A;  1W9X A;  2YWE A;  4CCM A;  2O0W A;  3AVY A;  3ZSC A;  2GOX B;  4RB1 A;  1Y6I A;  1QGA A;  3HJE A;  3K4K A;  1GVJ A;  1P9Q C;  4ZYA A;  1KU2 A;  3ZZU A;  1MBH A;  5IY5 H;  4ON0 A;  4CCN A;  1MBG A;  2KT0 A;  2MA3 A;  2R0Q C;  1MBK A;  1WI9 A;  1W0T A;  3OYC A;  3V8L A;  4ESJ A;  1FWZ A;  1I1S A;  3FZV A;  2LKS A;  2ZME A;  3BG9 A;  4A69 C;  4DQ2 A;  1KCC A;  1A5J A;  1KZL A;  4ZDO A;  4X06 A;  3RI4 A;  1XD7 A;  5HDK A;  3ZXS A;  3T8R A;  2M34 A;  1ETQ A;  3L2U A;  1TYX A;  4D7M A;  5B3S H;  2FUG 2;  2LY1 A;  3MZ8 A;  2DYR H;  4PK4 A;  3U2Q A;  2P0W A;  3LVB A;  2PE3 A;  4ACB A;  2CV1 A;  4HAM A;  3SDB A;  4DYR A;  2H27 A;  1YLO A;  4MGR A;  3GVJ A;  2GA1 A;  2XAJ A;  4OIN F;  3CME B;  1UG0 A;  1OB2 A;  3ZBU A;  5BS6 A;  5F4M A;  1MD0 A;  3CDH A;  3J81 K;  2BM5 A;  2W25 A;  4EEF G;  1G6N A;  3CME I;  2DA6 A;  4XLA A;  2ZNY A;  5E1Z B;  4Z06 A;  2DBB A;  3P7N A;  3PNV A;  4RGX A;  2C5H A;  1NK2 P;  4XLN F;  4RD4 A;  2KRH A;  1CNF A;  4G7W A;  1F4K A;  1KTV A;  4BUP A;  3OYK A;  2O1D A;  4PAA A;  2YX7 A;  2XEX A;  1Y0Y A;  1Y56 A;  2Q6O A;  4RD0 A;  2DMT A;  3VYU B;  3WBK A;  2DLL A;  1SEU A;  4YFN F;  1NH3 A;  2QVO A;  4OPS A;  1XG1 A;  3DF8 A;  5E17 F;  3HXL A;  3K4B A;  4EAT A;  3L1P A;  3E5Q A;  3L2V A;  1J75 A;  1QA6 A;  5IT9 Z;  4OM9 A;  2BN4 A;  4E7S A;  3OYE A;  5KCM A;  3UW0 A;  1DP3 A;  4H4K C;  3ZN1 A;  2HMA A;  3C18 A;  2VE8 A;  3FBN B;  4BJT A;  4KH3 A;  3OOP A;  1F9N A;  2LKP A;  1ZM3 A;  2KLO A;  5CVU A;  2Y9Y A;  4GYG A;  2B0R A;  4DGW B;  4A3B J;  3A4C A;  2NST A;  3REO A;  2ECC A;  5CVV A;  3IRR A;  2ESH A;  4AD9 A;  4ENN A;  1MGT A;  1IN4 A;  1PJR A;  2OQR A;  2QF7 A;  1X19 A;  1J9I A;  3MKW B;  1WDT A;  3CD6 B;  1FT9 A;  1HW1 A;  2RDP A;  1ZLK A;  3RQI A;  2GWR A;  1QHG A;  2BY3 A;  2ZZE A;  4BXF A;  2LNB A;  4G5G A;  4WWV A;  5D4R A;  3CD6 I;  4P1W A;  5HNH A;  4FCY A;  3EYI A;  1HA8 A;  3R6K A;  4Y7C A;  4L5J A;  3PFI A;  4AYB N;  1RC9 A;  2WYR A;  2EFW A;  3ML3 A;  4BQO A;  3WND A;  4BQQ A;  4BQA A;  1HQC A;  2HI3 A;  5LFA A;  4DYQ A;  2W7Z A;  2Y31 A;  1K78 A;  1FOY A;  1HSJ A;  2O03 A;  4IL6 C;  3V7R A;  3HOW J;  1KRH A;  1XQB A;  4F91 B;  4DK1 A;  3BG6 A;  2FXA A;  3BH6 B;  4V2G A;  2EFN A;  3NAR A;  5B1A H;  3IRQ A;  2JA5 J;  4EJO A;  3LSI A;  2IPQ X;  1XE1 A;  2JSC A;  1K4S A;  3RSN A;  3KP5 A;  1TWC J;  3T1B A;  5FA6 A;  5K7H A;  2CFX A;  5IYP A;  4LGW A;  2J8I A;  5GAE J;  3AGP A;  3TED A;  3GTJ J;  1F43 A;  1VHE A;  3ONU A;  2QCO A;  4MEY F;  3EUH C;  1P6R A;  2QTZ A;  2O17 A;  1OB0 A;  4BU2 A;  1TLH B;  4OPV A;  1WVR A;  4EM2 A;  3BC8 A;  2E35 A;  3I53 A;  1ERD A;  2XT4 A;  1AHD P;  1DGR M;  5IP7 J;  2DFE A;  1XB2 A;  5EG0 A;  1K4Z A;  2L2O A;  2GIV A;  2W24 A;  1BI2 A;  2O3F A;  2KJC A;  4QHY A;  5JFR A;  2V4J C;  3RYR A;  2DT5 A;  3UR3 C;  1CF7 B;  1O8E A;  1U0J A;  2VQC A;  3PVD A;  1C0W A;  4CA0 A;  4XRS A;  2DEU A;  4OOI A;  1WPK A;  2BV3 A;  1QO0 D;  1ETW A;  3ZPL A;  3LL7 A;  4Z6Y A;  4G7O F;  5JVG F;  4B09 A;  2X53 S;  3GLX A;  3CCS B;  4ZGN B;  3BH7 B;  2M30 A;  4PZJ A;  3QFS A;  3F8M A;  3G6E B;  3CCS I;  2ISY A;  3ZMV A;  3DEU A;  2BV6 A;  4JRA C;  3LA3 A;  3WHB A;  3DDY A;  1BQE A;  1EKE A;  1K9M D;  3W5V A;  3CXC B;  1XMK A;  4V02 C;  1QQI A;  1V54 H;  5M5Y J;  4HE5 A;  4AU7 A;  2AS5 F;  5IYR A;  5F64 A;  1TUI A;  1X2M A;  3J7A Y;  4IOA F;  3VSV A;  2XNJ A;  2HOS A;  4UUS A;  1AWC A;  3CCL B;  1KQ5 A;  2DA4 A;  1H80 A;  2PYH A;  3S17 J;  2XAU A;  3ZUG A;  1SAN A;  3CCL I;  3B78 A;  1ORK A;  3T5X A;  5J1R A;  2MSY A;  5IP9 J;  2CW7 A;  4P55 A;  4S0H B;  3CC4 B;  1HCR A;  3OR1 C;  1KQS B;  1I18 A;  1IJF A;  3GLL A;  3DU6 A;  1N0V C;  2ODL A;  1QGZ A;  2FVG A;  2VKE A;  1LVA A;  3OYL A;  1YRN A;  1U6G A;  1TLL A;  4AF7 A;  2BM6 A;  3H3U A;  2BW3 A;  3TH0 A;  3QYE A;  5DM6 F;  3DPT A;  1WJF A;  1P4M A;  3FPK A;  1OYY A;  2OV7 A;  3E3V A;  2HZD A;  2Z2S B;  3U1K A;  5ICG A;  1A36 A;  2XF5 A;  1YI2 B;  3WWG A;  4RD3 A;  1Z21 A;  3WE3 A;  2XGC A;  2DAO A;  1TW3 A;  4BH9 A;  2WJV A;  3EQO A;  3G1M A;  2VBS A;  3E6B A;  1YI2 I;  1FRQ A;  5JLX A;  2KJB A;  2JJ1 A;  5E20 A;  3R0J A;  3OIQ A;  2QZA A;  2ZXI A;  2HYG D;  2H1K A;  3ZIA A;  2Z8G A;  1R1V A;  4BE0 A;  2IOU G;  1A35 A;  1S72 B;  5CPR B;  1BX0 A;  3HL2 A;  3L2C A;  3H9N A;  1SD6 A;  1ZH5 A;  4A0Z A;  5BNG A;  3FMQ A;  4Y17 A;  1S72 I;  2FA5 A;  5F1J A;  5FO0 A;  1BPL A;  4PJJ A;  4B4C A;  4G7X A;  3JRF A;  1GV5 A;  1JE8 A;  4CYD A;  3N90 A;  4X07 A;  4E7J A;  4Z4W A;  4PGG A;  3A01 A;  1X3Z B;  2HDC A;  1VQM I;  3IL2 A;  1YTY A;  4UZF A;  2M7A A;  2IGO A;  3F8N A;  3R4K A;  4QPO A;  3I64 A;  3KYL A;  2L02 A;  1YG2 A;  2Z99 A;  3N6Z A;  3E6C C;  1H9G A;  2FF4 A;  3JCU C;  3P4G A;  1VQ5 B;  1ZK8 A;  1FMW A;  3M3Y J;  1D1A A;  4OAZ A;  5HOO A;  3Q3S A;  1BMF A;  1VQ5 I;  4PJM A;  4Z4S A;  1YJ9 B;  1AIR A;  4FXU A;  4MQV A;  2FMY A;  1SMT A;  1YJ9 I;  3HAG A;  3RKW A;  3SQN A;  2K9Q A;  2JQ7 A;  3WQZ A;  3H5R A;  3PO2 J;  3L9F A;  4FQG A;  2K9N A;  1EH8 A;  1ZGA A;  4FTH A;  4DNT B;  2BVL A;  4PJL A;  2C5B A;  2F43 A;  3H5A A;  4AVZ A;  2V26 A;  3GUD A;  4ZC3 A;  3GZN B;  2C2W A;  3AVV A;  2IGK A;  3SJZ A;  3SY2 A;  2M3A A;  3VOD A;  2MGQ A;  2BE5 F;  3AG3 H;  4BS9 A;  3IAM 2;  1T95 A;  2NVU B;  2HEO A;  3F9K A;  3ISX A;  2W00 A;  3V42 A;  1U8R A;  1I6H J;  3I3L A;  4M3D A;  4E7H A;  3OPO A;  3TKY A;  1FBS A;  1UEL B;  1DDN A;  4Y9R A;  2F48 A;  4UHT A;  3PL8 A;  4ASU A;  4TKO B;  3SQV A;  1YS7 A;  2BM7 A;  3A8K A;  4RDU A;  1Z7U A;  2V7W A;  3FXK A;  4HYE A;  2HOT A;  2MAB A;  1XSX A;  1GAQ A;  3BP8 A;  3JTG A;  2DI3 A;  3OYI A;  2GQF A;  3TDZ C;  2M8E A;  3M8E A;  3S3O A;  3GX4 X;  1SAX A;  1AKH A;  4DQL A;  5TV2 A;  2ZXH A;  3HHG A;  2X6Y A;  1OGO X;  2VFM A;  2HOA A;  1YFH A;  2HU9 A;  4X6A J;  3OYH A;  3IWZ A;  3S3N A;  2BSP A;  4AID A;  1OYW A;  2R4G A;  4RA2 A;  4J01 A;  3KX2 A;  2K4B A;  4PDK A;  1XC5 A;  4DJA A;  2QQ8 A;  3LSH A;  1W7P D;  4DYC A;  4I09 A;  4PGO A;  3SLD A;  1X3U A;  3RKY A;  1SM4 A;  1OLT A;  3SDG A;  2CV0 A;  2BHZ A;  2ZB9 A;  1JT6 A;  1HZE A;  3ABK H;  2XIG A;  4IHY A;  1BJK A;  1QA3 A;  1BHE A;  2DOD A;  5E8I A;  3WTY C;  3A02 A;  1TYV A;  5AMV A;  3IKV A;  1FTT A;  2HLD A;  3OZU A;  1ULY A;  2ZXJ A;  3OS1 A;  1LE8 A;  5HLT A;  2L7K A;  3JTH A;  1KK2 A;  2OCE A;  4A3F J;  1XGN A;  2CW5 A;  4DK0 A;  3GQ7 A;  4HOB A;  3BNW A;  3GZ5 A;  2OPT A;  2Q2E B;  5BQT A;  1E79 A;  2NV4 A;  4J00 A;  2L7Z A;  5E8G A;  1YIJ B;  3VMV A;  2A6E F;  4B44 A;  3ZQ7 A;  3BZC A;  3FXM A;  1QH0 A;  1IDJ A;  3Q5F A;  2BOL A;  2W85 A;  3WTU C;  3LSG A;  3W6J B;  1EH7 A;  3OWT A;  5M5W J;  2OA4 A;  1WRJ A;  4WZK A;  1YS6 A;  4YCQ A;  1BW5 A;  2QKL B;  2MC3 A;  4ITV A;  4M71 A;  4F93 B;  3VWB A;  1XGO A;  2XF6 A;  2HTJ A;  3K9T A;  3HPH A;  4OOX A;  1WHU A;  1KZH A;  3EDP A;  2RQP A;  4RAY A;  3JSO A;  2H6C A;  1D1B A;  2EPF A;  2XF7 A;  2HTS A;  1FRN A;  2NTB A;  2LVS A;  5KAI C;  5DYM A;  2CV2 A;  1FPQ A;  5CVR A;  1WXR A;  1E2X A;  3HRM A;  4M73 A;  1QZE A;  1TWF J;  4I99 C;  5K5O A;  2VBE A;  2L54 A;  3ZCO A;  1ETO A;  4X05 A;  1OR7 A;  2ECB A;  3JRA A;  2A61 A;  3OMY A;  4HW0 A;  3LSR A;  2R7V A;  4MXN A;  1OFE A;  2MC4 A;  1UHS A;  4JQF A;  2XPV A;  1TZL A;  1V3F A;  1WJ5 A;  1X0C A;  4U49 A;  2EQR A;  3I5U A;  3ESW B;  3GFI A;  2XV4 S;  2JTV A;  3L09 A;  4LG0 A;  3T0Y A;  2XND A;  2DOF A;  2Y75 A;  5TIS C;  2JDI A;  3DTK A;  2VN2 A;  4N0B A;  3WTZ A;  4RB3 C;  1KK3 A;  3B4N A;  1NTC A;  2K9M A;  4WF2 A;  3WTX C;  5M5X J;  1Z6R A;  2KKO A;  1MSE C;  4BJ5 C;  1T39 A;  1O4X A;  4FX4 A;  1D1C A;  3GWZ A;  2WR8 A;  2CS3 A;  3F21 A;  1FP2 A;  1WCM J;  2CH0 A;  4LB5 A;  2WAE A;  3BRO A;  1E3Z A;  1QRC A;  4Z1M A;  2PMZ A;  3WG7 H;  1WOS A;  4KIT B;  3PIO F;  3PA2 A;  3LJY A;  1D8J A;  4N4O B;  2TRT A;  4RM3 A;  4A3I J;  1QGY A;  2GK7 A;  3CCJ B;  1KTW A;  1BN8 A;  1TYW A;  5JLW A;  1HOM A;  3OYF A;  5FLX K;  1BA5 A;  5KSW B;  3CCJ I;  1B2R A;  1VTN C;  2E2H J;  1R1T A;  1V5E A;  2Q0O A;  1U78 A;  3FHZ A;  3I4N J;  2QKM B;  3OIO A;  1YW7 A;  1R5O A;  2LG4 A;  2HGC A;  3BR1 A;  1R5B A;  3G1O A;  1TTY A;  4IX7 A;  2B7C A;  2D9R A;  1J7K A;  2VFP A;  3H9Q A;  2A69 F;  2NOJ B;  3BTI A;  2VBT A;  4XN0 A;  3ZQQ A;  5DD8 A;  3BCF A;  2K3F A;  3BG7 A;  1T33 A;  2UUZ A;  2DOA A;  2IS2 A;  2I1L A;  5FO1 A;  1UD6 A;  3RKX A;  4HDU A;  1WPC A;  2ZC2 A;  1KCD A;  3CDI A;  1V5F A;  3LAP A;  1OCR H;  4M6Y A;  1TQM A;  2EV6 A;  1Z1D A;  3JRE A;  3ASQ A;  3CTA A;  1Y39 A;  3HGY A;  2M45 A;  2DK8 A;  3CCU B;  1BR4 A;  3MN2 A;  4CZC A;  2E71 A;  3FWE A;  4W97 A;  2UZK A;  1V4R A;  1IF1 A;  4UAJ A;  1DUX C;  1PJ6 A;  3CF2 A;  1W0J A;  2LZJ A;  3LQ6 A;  2LR8 A;  3T8T A;  3CCU I;  2X1E A;  4G6I A;  3DU1 X;  2DCE A;  3TOB A;  1Q7Y D;  2HZT A;  2VQG A;  1QFJ A;  2M0C A;  1E43 A;  1L3L A;  5FL7 A;  4U88 A;  3KEY A;  1XMA A;  2QQB A;  1UFM A;  3KIO A;  1IRZ A;  1JB9 A;  1EZG A;  2BGC A;  2DIE A;  2DET A;  1B8I B;  1S0U A;  1TYU A;  2DOE A;  3FM5 A;  1EJ9 A;  1H8E A;  4CCO A;  2G7U A;  2JUC A;  3BR2 A;  1KD1 D;  2OBP A;  5H2F C;  4F92 B;  2B0L A;  2X48 A;  3OJW A;  4C0S A;  4FIS A;  1IXS B;  5J1U A;  5BOX A;  1GUU A;  1YHQ B;  4MIM A;  3A0B C;  3OYM A;  2EBI A;  5HS7 A;  1JKR C;  2Z9O A;  5JHF A;  1U5T A;  3TMO A;  3S93 A;  2GM4 A;  2VC0 A;  1YHQ I;  2F3L A;  4OJL A;  1IAW A;  3Q9S A;  2OK7 A;  4MQ9 F;  3BDD A;  2MG4 A;  2L0K A;  3H36 A;  4ABZ A;  2BXY A;  1GDT A;  2R7F A;  9ANT A;  2HS5 A;  1KC8 D;  1KQ9 A;  4LJZ F;  5KNL A;  1W7P A;  3WTT C;  3WTW C;  3F6O A;  3E6M A;  4X7F A;  5JVT A;  2E1B A;  1HG8 A;  2M1B A;  2ZFU A;  3PJR A;  3AL0 B;  4TN1 A;  1LM1 A;  1PLU A;  5JHU A;  3GTK J;  4EMS A;  3K69 A;  1M1E B;  4TSF A;  4A6E A;  4BXX J;  1NHC A;  4I6Z A;  1WKM A;  3ECO A;  2D45 A;  3ABL H;  1Q82 D;  2L9S A;  5DSZ A;  4IHS A;  1VLO A;  2V7V A;  1K73 D;  2ZL6 A;  3DBR B;  5F04 A;  2DMQ A;  2QSH X;  3WXM A;  5LLQ A;  3B8Y A;  1RKW A;  2K9L A;  3T9G A;  1K8A D;  2MH9 A;  3RQ4 A;  3OE7 A;  4ZDL A;  2R5Z A;  3DWL E;  5L3D A;  4FAS D;  2XC1 A;  4ZYE A;  4PC2 A;  3GYH X;  2OTL B;  4AYB A;  5IP6 A;  4II2 A;  4RPD A;  1IDK A;  1VFC A;  3S1Q J;  2CF4 A;  1VBL A;  2OBS A;  1JKO C;  1MND A;  3IKT A;  1Y1W J;  2OTL I;  3DEE A;  2COM A;  3M07 A;  4HF1 A;  1ZEL A;  5J47 A;  3GEZ A;  3PIP F;  1E3O C;  3F22 A;  1N08 A;  5K7Z A;  2VPL A;  3RPU A;  3A03 A;  4U0W A;  1BIA A;  3G05 A;  2STW A;  1JKQ C;  1QFY A;  4YAW A;  1GO2 A;  2X1C A;  2YR2 A;  5E3N A;  3CCE B;  3CO7 C;  4V2F A;  2K02 A;  4LC0 A;  3S2H J;  4ACA A;  2O04 A;  3CLO A;  1VF9 A;  3GSI A;  2K3P A;  2FE3 A;  3QYB A;  1HW2 A;  1Z0X A;  3OW7 A;  5K5Q A;  3CCV B;  3P5J A;  2IAI A;  1ETY A;  4GCV A;  1Y0R A;  2X0L A;  3O8H A;  1S7E A;  3RYP A;  2V7T A;  5EYR A;  5JMC B;  3CCV I;  3K10 A;  2FQ3 A;  2CFO A;  2V9P A;  2R5Y B;  4PUS A;  3GF2 A;  3BQZ A;  4RM0 A;  5HLH A;  4G7Z F;  5FRM A;  3W2H A;  5L3G A;  5ICE A;  2JA6 J;  2IQ7 A;  1POG A;  3FK6 A;  4NK8 A;  1Q86 D;  2L4M A;  3HZJ A;  5CJ9 A;  3BLY A;  3AVX A;  5KHD A;  2BM1 A;  1J59 A;  3LSJ A;  3SXY A;  3OY9 A;  2QSG X;  1UD8 A;  3E1S A;  1OB5 A;  1D8K A;  2W84 A;  4L9T A;  2OK8 A;  2E2I J;  2LBF A;  4PCQ A;  4W8T A;  3DP7 A;  5EEG A;  1S5L C;  3BR6 A;  1B9M A;  5GTH C;  4LK0 F;  4HNV A;  3WOD F;  2XRN A;  3KPH A;  4I7H A;  5HDG A;  2DA2 A;  4EVI A;  6PAX A;  1RR7 A;  3BCA A;  4R8H A;  2JN6 A;  4XLC A;  3MWM A;  2QBY A;  2IRF G;  2Q6I A;  3GRH A;  3QU6 A;  1FMV A;  3VYR B;  2X9D A;  2PMZ N;  5D5X B;  3FXL A;  2CSO A;  2L5Q A;  2CQQ A;  1ETK A;  1ZG3 A;  1IN8 A;  2V4D A;  2M4K A;  2OC6 A;  2XB0 X;  2GRE A;  1BW6 A;  2G7H A;  2VJ4 A;  3P9K A;  4HNU A;  4TMT A;  2EJR A;  3OOU A;  5BPI A;  3I1F A;  3SEJ A;  1WMR A;  4C3I J;  5B5E C;  3ZBT A;  1HKS A;  2QQ9 A;  1JT0 A;  2PJP A;  1N06 A;  4G12 A;  5E3L A;  1QVU A;  2BX6 A;  1K83 J;  5JI6 A;  1SFK A;  3PQK A;  4ZGQ B;  1T6X A;  1O8K A;  1PP7 U;  3ECH A;  1R4M B;  3KE2 A;  3OFN A;  3R6J A;  4XRS G;  5A8A A;  1MRZ A;  5HZB A;  1NG6 A;  3FMS A;  3I4M J;  2HQ5 A;  1ZR4 A;  3U1D A;  3SFI A;  5HLI A;  2R7O A;  4X7C A;  3FBI B;  3K6G A;  3ASR A;  5ICC A;  3HSF A;  4KA4 A;  4IRH A;  2R7R A;  4XLP F;  1J5Y A;  2YS9 A;  1BR2 A;  1WJB A;  3G1L A;  5DUK A;  1R58 A;  2NVT J;  2EWE A;  1G7C A;  1I50 J;  2JUG A;  5J4V A;  2QE7 A;  4OJ6 A;  3BJ6 A;  4OOV A;  1FOX A;  1GV2 A;  3BPX A;  5ILV A;  3FIS A;  1HA3 A;  4IJA A;  3IH2 A;  1XCV A;  5DCM A;  3D0S A;  2LRD A;  2VT3 A;  1QZZ A;  2M5W A;  3RZO J;  2IA0 A;  3GTP J;  2ELK A;  1K4T A;  2CO5 A;  4MYU A;  3S1N J;  3E6D A;  3FX3 A;  2FX3 A;  4XSZ F;  3ZQI A;  5GTI C;  1YO5 C;  3OJX A;  1Y8R B;  3OZW A;  5J8C A;  1D5V A;  4EJV A;  5IYD J;  4E0F A;  2R3S A;  3QPS A;  2RKH A;  3DTE A;  5M3M J;  4P5O A;  4E6K G;  2HDN B;  1E1R A;  3I4P A;  4RB0 A;  2F2E A;  4QFM A;  3QOE A;  1RU4 A;  2E5N A;  5D5W B;  3TBI A;  3AL0 C;  2DA3 A;  1LEB A;  1GJR A;  3S2D J;  3B73 A;  3WU1 B;  4XBF A;  4IQJ A;  5L3B A;  2UV1 A;  4BY7 J;  2Z16 A;  3LSP A;  1D0Z A;  1O7L A;  2OBT A;  5FKL A;  1T0F A;  1WSU A;  3J80 Z;  2O9L A;  3MKZ A;  3RCO A;  4GRI A;  5B1B H;  2DU9 A;  1BI1 A;  2W57 A;  4AIH A;  2O8K A;  3WBJ A;  5IK2 A;  3QSY A;  3OKX A;  1NJI D;  1JTY A;  4YFX F;  1VHO A;  1KK0 A;  1S6L A;  5EDN A;  3BCD A;  5LRS A;  1QCX A;  2CRV A;  4QTR A;  2LRE A;  4ENJ A;  2VL8 A;  4IZZ A;  3EUH A;  1XTA A;  4NC8 A;  3CF5 F;  2CW0 F;  3HUG A;  1VJS A;  5FNZ A;  3GFL A;  2Z5U A;  4ZTJ A;  1IZ1 A;  4LMY A;  1N75 A;  1OCO H;  1SD5 A;  1WWX A;  1SFX A;  4U0Y A;  1B4A A;  2XTX A;  3CCR B;  2ME0 A;  1OFL A;  1BOB A;  4BGD A;  3W3C A;  4W8S A;  2NS8 A;  4BEH B;  3OAA A;  4YFK F;  2KL4 A;  3CCR I;  2PBI A;  1OFC X;  2DA7 A;  3BQY A;  3H0G J;  2FNP A;  1MBJ A;  1QA1 A;  1KQ0 A;  3QPT A;  2INV A;  3OL4 A;  1XB4 A;  1E1Q A;  2W6I A;  5H6Q A;  1W0U A;  3F8F A;  4BHB A;  1FBU A;  2M87 A;  5CKT A;  4DIQ A;  1JUM A;  2RQQ A;  4YEJ A;  4AC0 A;  2HCJ B;  2D74 A;  4QVJ A;  1XGM A;  3EUA A;  1B72 A;  2E1N A;  2FOK A;  4X7D A;  3CJR B;  5HZA A;  4ZV4 A;  3Q6Q A;  3IAS 2;  2E5Z A;  2DMN A;  1O3Q A;  1HDP A;  3P9I A;  2R93 J;  2XOK A;  3BC9 A;  3MQ0 A;  5E1X A;  4QPQ A;  1JGS A;  2VE9 A;  3JRI A;  1BL0 A;  2VOP A;  2QTL A;  2G0Y A;  4YIR X;  3PUM A;  4UV9 A;  3AVU A;  3BTJ A;  3DV8 A;  2CC2 A;  5HXB A;  4XLE A;  2F4O B;  3JQQ A;  4L8J A;  2PYG A;  4BE2 A;  2WBM A;  3JR9 A;  2BVM A;  4YHB A;  5J3L A;  2ACJ A;  3D26 A;  4F55 A;  2VYQ A;  3ZZT A;  2FQ4 A;  4BBS J;  4IEJ A;  3O6B B;  2BZT A;  1SFE A;  3CP2 A;  2JJ2 A;  3RKQ A;  4ENM A;  2LLK A;  1VZ0 A;  3FXR A;  2V1U A;  2R7W A;  4RAZ A;  4S05 A;  3AVT A;  3Q0W A;  4A5N A;  2LFB A;  2NVX J;  3JQP A;  1XGS A;  1P7J A;  3NRV A;  2M2E A;  4G6Q A;  3CPX A;  1TWG J;  2OUM A;  5C1E A;  4TT3 A;  2WY8 Q;  3Q0V A;  1J0R A;  4PC1 A;  2DT6 A;  2XC7 A;  3DEW A;  2GJR A;  4M0L A;  4L9N A;  4L9J A;  2PI0 A;  1B59 A;  3DLL F;  5E3O A;  3F23 A;  4KMU X;  1N05 A;  5FO5 A;  1PUF B;  2IS4 A;  3U2R A;  3AVW A;  3NE5 B;  2V7U A;  1ZRF A;  2Y0M A;  1P7I A;  1FP1 D;  3CJQ B;  1WOP A;  2QZ8 A;  1EV7 A;  5H20 A;  3JUR A;  1L1I A;  4O5V A;  2Q6L A;  5IYW A;  4W8Q A;  4A3C J;  2XAQ A;  2RGV A;  4Y33 A;  4YZ0 A;  3CJN A;  2PG4 A;  4II3 A;  3VOE A;  3BR0 A;  1BIB A;  1Y1V J;  4KN4 X;  4JK1 X;  1O8D A;  1OMI A;  4RLF A;  4CQJ A;  4I0A A;  3WY9 A;  2DO7 A;  1B72 B;  1YX5 A;  5GV8 A;  1O8I A;  2P3M A;  3AK5 A;  2DN0 A;  3E7L A;  1VQP I;  3OSF A;  4FHT A;  3G3Z A;  4XM3 A;  4YEL A;  1H42 A;  4J0Q A;  3IWF A;  3KLO A;  4LBW A;  3W5H A;  4LLG F;  3EYY A;  3O8G A;  3CMM A;  1Y0U A;  4D1Q A;  3N97 A;  2HKX A;  1B1B A;  5DTD A;  2ZZG A;  5IYN A;  1GHC A;  2ZTN A;  2P6T A;  5LHI A;  3MCZ A;  2PMD A;  4IXA A;  2XVC A;  3FXQ A;  4UB8 C;  4WZE A;  2WTE A;  2LY9 A;  4LK1 F;  2EZI A;  2ZBU A;  2C4U A;  2E34 A;  2HYF A;  1HKQ A;  1I39 A;  2E1M B;  5IYC J;  3KET A;  1S4M A;  2ZZF A;  3U6K A;  2BMW A;  2KIU A;  4JX5 A;  3HSE A;  1ITY A;  3OR2 C;  4FET A;  3S2W A;  4Y15 A;  3I0T A;  5E79 C;  4HV6 A;  1BN5 A;  2ETH A;  1RUN A;  1EP1 B;  3HPG A;  4NBS A;  3BPV A;  3GTG J;  3VYS B;  4B48 A;  1VQ4 B;  1E3P A;  3SZP A;  3DPU A;  3W2E A;  2ZFW A;  1SFO J;  1S7O A;  2HOE A;  5FLV A;  4P9S A;  1QVF B;  2VIX A;  1VQ4 I;  1EXM A;  1WTH D;  5FKN A;  5TRD A;  1VQM B;  3ZPP A;  4NUB A;  4P12 A;  4HPQ A;  2H6B A;  1UB9 A;  5F4J A;  1O8G A;  4PAB A;  5EMN A;  1HDD C;  2ZCW A;  3ZRG A;  2ADU A;  4BBR J;  4RBO A;  2DXI A;  1R1U A;  3BJA A;  3H9J A;  2JA7 J;  2IS1 A;  5GAD J;  1DBG A;  3PET A;  2AQF A;  2E7W A;  4OP7 A;  1PKV A;  3S1R J;  2CND A;  3E20 A;  1IN5 A;  1YIO A;  5D6F A;  4OZZ A;  4XKB A;  3OP1 A;  2HR3 A;  4S04 A;  2O61 A;  2GXB A;  4A0Y A;  2X6X A;  3GFM A;  3HBL A;  1BI3 A;  1LNW A;  1CF7 A;  3CUQ B;  5D8L B;  4Q4Z F;  1VLY A;  5D5U B;  3T53 B;  5L46 A;  1OGM X;  4HQM A;  2BVN A;  1QNT A;  4OZY A;  2X3H A;  4OU0 A;  2FU4 A;  1HXD A;  1MZB A;  4D5F A;  4U9U A;  4OIP F;  1AA7 A;  4Z4U A;  1O8L A;  2KRF A;  4P2N A;  4RLZ A;  4M3F A;  2J5P A;  3R0A A;  5HNF A;  3EQN A;  4G7H F;  2TCT A;  2KFD A;  2W6J A;  3A35 A;  3BT9 A;  5F27 A;  1EE6 A;  1TL8 A;  2XAF A;  5CVJ A;  3LQE A;  1I7P A;  5CQG A;  2HDD A;  2LC2 A;  4JOM A;  2AXT C;  4CYC B;  1YIT B;  3S16 J;  1ZUN B;  4KKT A;  1YJW B;  2J8K A;  2VOO A;  3PUF A;  2HXO A;  2I10 A;  3BCB A;  1YIT I;  2YX4 A;  1YJW I;  1IG7 A;  1WJE A;  2A3S A;  5DD4 A;  5DDG A;  5GV7 A;  1LFP A;  2NS0 A;  4QVA A;  2A05 A;  1VQ8 B;  2VBK A;  2KVO A;  1BI0 A;  1IRG A;  5A88 A;  1TW2 A;  2LH9 A;  3PSF A;  1DU6 A;  1VQ8 I;  2ZJ2 A;  1QGP A;  1IHM A;  1ZM9 A;  5A2Q Z;  1Z77 A;  4UVA A;  3ZPN A;  4JMQ A;  3I58 A;  1A8P A;  1LFB A;  2A6H F;  2H8W A;  2VBM A;  1U2W A;  4J19 A;  3I59 B;  1YW8 A;  2VKD A;  5IYB J;  1QJV A;  4I84 A;  3K4C A;  3HIF A;  4A3K J;  1D8T A;  3Q6R A;  4QV2 A;  2X0K A;  5FLM J;  3K4J A;  1RNL A;  3FK7 A;  2DQL A;  2EV5 A;  3BY1 A;  1OPC A;  4NQW B;  3WGG A;  4YG2 F;  1UAA A;  1BX1 A;  1Z67 A;  1J09 A;  4OIR F;  4AVP A;  4M6V A;  4HDV A;  4Z4Z A;  2GQQ A;  1YLF A;  1IN7 A;  2YUH A;  4OJP A;  3R60 A;  1FSH A;  3QRF F;  5F6F A;  3V7A A;  3PEN A;  4C30 A;  3IC7 A;  3F8B A;  3KLN A;  1U3E M;  2CQN A;  4KYW A;  1DDG A;  1MJB A;  1I27 A;  1K8F A;  3W6V A;  2JRM A;  4CCL A;  2PFB A;  4N4N B;  2QYU A;  2D2W A;  1MDM B;  3F72 A;  4B47 A;  4KKU A;  3S1M J;  2QEX B;  5DV5 A;  4B1R A;  1OQY A;  1CQT A;  3NAW A;  1I3Q J;  1ON1 A;  2RVC A;  3JAM Z;  3UKG A;  4AUX A;  4HIZ A;  2QEX I;  4NBQ A;  3AFH A;  1FDR A;  4R1H A;  2LOO A;  1I6X A;  2V5I A;  4Z03 A;  2QDX A;  2NTP A;  2ZBV A;  2XPU A;  2L7F P;  2QWW A;  2D1V A;  2CQX A;  3Q0U A;  1QFZ A;  2WZP P;  4XSX F;  2CW8 A;  4XOT A;  5CYV A;  1HF0 A;  4P3I A;  4P9U A;  1UHM A;  1MMG A;  1IDY A;  2Z1D A;  2GA2 A;  2JK3 A;  3S8P A;  3OZV A;  3U6B A;  1P92 A;  2HQN A;  2NTQ A;  3V7S A;  3FY3 A;  3RPQ A;  1FNN A;  2KIQ A;  1OCT C;  1EP2 B;  3K4N A;  3ASS A;  2E1M C;  2EWN A;  1BJA A;  3CCY A;  1F20 A;  1ZHF A;  2NRA C;  1S8N A;  3IUO A;  4XD7 A;  2AHQ A;  5CDF A;  2PJR B;  4XMY A;  1TNS A;  3QAH A;  1JA0 A;  1UD4 A;  2KDO A;  3ES9 A;  1PJ5 A;  4UZU A;  3I56 B;  4EGZ A;  3HOU J;  1Z91 A;  4OIQ F;  3Q38 A;  4ZH4 F;  2L9R A;  2BY2 A;  3JSP A;  1QPM A;  4ETS A;  3I56 I;  4QWQ A;  1PDN C;  3LQR A;  3MVP A;  1WGX A;  2KMU A;  5DEQ A;  4W1U A;  4BHC A;  3MMP A;  2DCU A;  2EIN H;  3HYI A;  3ML6 A;  3H94 A;  1OFM A;  4YFO A;  1X3W B;  5FFZ A;  4I98 B;  5FKO A;  2E60 A;  3K1P A;  5FJ8 J;  1O8M A;  2Y48 A;  1LB2 A;  1VND A;  1G3W A;  2JPC A;  1MMN A;  1JA1 A;  5EEA A;  1Q9S A;  3HHH A;  2H1L A;  3MFK A;  1O3R A;  4RDK A;  1H89 C;  4F7D A;  2W7N A;  2H09 A;  2JA2 A;  4KJZ A;  2Y69 H;  4HF2 A;  5FKK A;  2BSA A;  2FML A;  1PJ7 A;  1K7A A;  2XTY A;  3IH3 A;  2CUF A;  5B66 C;  1OGI A;  2DA5 A;  4RDJ A;  3SHF A;  2FRH A;  2X6W A;  4AM3 A;  1ZYR F;  3S3M A;  4XN3 A;  1HLV A;  1R22 A;  3J80 K;  1JTA A;  1QG0 A;  2F5D A;  4E4H A;  4OAY A;  2VNK A;  2LMD A;  1VI0 A;  1X2N A;  2W1O A;  3CUQ C;  3CDL A;  3C3W A;  3VO1 A;  5TR9 A;  2FSW A;  4GFB A;  3AKZ A;  3W2G A;  3FMR A;  3F3X A;  5LGU A;  4M3E A;  1GXQ A;  4BJ6 C;  2GLO A;  2XAS A;  1O3S A;  5IT9 K;  2DFH A;  3WU2 C;  2QSF X;  1KYZ A;  4IQ4 A;  1FNC A;  1FNM A;  5F4O A;  4ZZD A;  4KKS A;  3H35 A;  1GR1 A;  4PC6 A;  1JJ2 B;  4EGY A;  1N07 A;  3MD2 A;  3NQO A;  4Z4Y A;  4F7Z A;  1BOA A;  1X1C A;  1X1B A;  5EZG A;  3ZMZ A;  3HRS A;  2ZNZ A;  1E64 A;  5E6T A;  1PYV A;  2CUZ A;  2OQG A;  2Q2E A;  2Z33 A;  1ZAO A;  3CW2 A;  2EFQ A;  1VQ6 B;  5H59 A;  4HLX A;  1XSD A;  4HEA 2;  3KP7 A;  3HOT A;  1N77 A;  3K4M A;  3GVA A;  2E19 A;  5GAG J;  4DW6 A;  1HC8 A;  1VQ6 I;  3GVL A;  2XGX A;  1MAB A;  1G8X A;  2NXN B;  4HE6 A;  3HOV J;  2V1N A;  3H5N A;  1E0E A;  2A68 F;  1RRJ A;  2XRO A;  1W0K A;  5DS9 A;  2QMU A;  3TOA A;  1IXC A;  4I0B A;  2VUM J;  2FBH A;  5DUI A;  2A6T A;  1MH4 A;  1QBJ A;  2EIL H;  4DBR A;  5KK1 A;  3TO7 A;  3BH4 A;  3F8C A;  3FM3 A;  4KNY A;  2F4N A;  2FJ1 A;  4B3F X;  3CQZ J;  1D5Y A;  1UHW A;  2BYV E;  3PUB A;  4P96 A;  5F1R A;  4H0E A;  4QUZ A;  3CCM B;  4BAY A;  4NNJ A;  3VSU A;  1EFU A;  1YX3 A;  4FWT A;  1VQN B;  1G7T A;  2LDU A;  4HG2 A;  3C2B A;  2VQH A;  4LG3 A;  4ZYD A;  1Y0N A;  2WSS A;  1GXP A;  1ETX A;  1QHH D;  3GVK A;  3JRG A;  2P7V B;  2BBY A;  3CCM I;  3LAJ A;  3OV8 A;  3HG9 A;  3COA C;  4XRF A;  1Q81 D;  1VQN I;  2P5L C;  1SFU A;  4K1X A;  2MLK A;  1GT0 C;  2OAZ A;  1Z7L A;  1KU3 A;  4UXN A;  4DNR B;  5EJC A;  1IRF A;  4OWR B;  2F5F A;  2HXI A;  2K86 A;  1SC7 A;  1T6Y A;  1JHF A;  3MAJ A;  4LB6 B;  5BPD A;  4OPO A;  5J4Y A;  1RES A;  4CDG A;  2DDA A;  3M8J A;  1YW9 A;  2R7T A;  3HRT A;  1O7F A;  4RS8 A;  3TO9 A;  3JRC A;  2GXA A;  4H9G A;  2CBX A;  3SFZ A;  5D4S A;  5FRO A;  1ZM4 A;  3H92 A;  2OU2 A;  1NBM A;  5J8F A;  1N0U A;  5EZH A;  4MTE A;  3MKY B;  2JSP A;  4RCY A;  1W1W E;  2DER A;  2BM0 A;  5GPA A;  5GPC A;  4A3E J;  5J35 A;  1N25 A;  1RIO H;  2WA0 A;  4XKV A;  4ZZL A;  3RTR A;  3M4O J;  3QE2 A;  4RCZ A;  1IJE A;  3JRB A;  3QPH A;  3DLA A;  1K28 D;  1H88 C;  4C9Y A;  4X0C A;  2BY1 A;  2VKV A;  4KIC A;  1R9T J;  3ROU A;  3B82 A;  2WV0 A;  3KEO A;  1OGJ A;  4XKC A;  4Z4R A;  4B3X A;  1R5H A;  2QGU A;  4A3L J;  1PP8 F;  4UB6 C;  5LGN A;  1TSP A;  4JX4 A;  4CGZ A;  4RGU A;  2FX0 A;  3I9V 2;  2JT1 A;  5AON A;  2O0Y A;  1FTZ A;  2N8G A;  1WSV A;  1K5C A;  4P26 A;  2HKO A;  3AG1 H;  2CQ7 A;  2M7B A;  5EGO B;  1I5Z A;  1MNM C;  1DPU A;  1YJN B;  3GIR A;  2XGJ A;  4XRM A;  1R71 A;  3DTI A;  1VQL B;  1DU0 A;  1YJN I;  4G6T B;  3SUC A;  1VQL I;  1ZAR A;  1MMD A;  3LSK A;  3H3Z A;  2BY0 A;  3KCC A;  1WU8 A;  4WK8 F;  1OOC A;  3OYJ A;  3LNN A;  4PC7 A;  1JRG A;  4Q47 A;  4BKX A;  2E36 A;  2CUJ A;  2V7Q A;  2ISZ A;  1FSE A;  1RR8 C;  3DFG A;  2R92 J;  2O7O A;  3ZQH A;  1S3J A;  4Y52 J;  2BPO A;  2CRG A;  3VNU A;  2GAU A;  4IHT A;  5A89 A;  2ELH A;  2F5E A;  2K5C A;  1P4A A;  2QM3 A;  3V8K A;  4CZZ A;  2CGP A;  3NEU A;  1XG2 A;  4MR0 A;  4RJL A;  3ONY A;  3VNV A;  1FOW A;  2ZME B;  4TMX A;  2PEX A;  3K1M A;  2DT7 B;  3KP3 A;  3TQN A;  1QVG B;  1ZTR A;  2JVH A;  2LTP A;  2C77 A;  2VNI A;  1OCP A;  3HRU A;  1O8J A;  3V76 A;  1B8I A;  5JBQ A;  2UXX A;  4Z05 A;  3LOC A;  3BY6 A;  5HS8 A;  2EB7 A;  2EZH A;  5IT3 A;  2HPM A;  3D5L A;  1ZRD A;  1F5T A;  1CQX A;  2NYX A;  4KN7 X;  3CRZ A;  1IN6 A;  1H0M A;  2Q8K A;  3LA7 A;  1LKX A;  1TP4 A;  3WGI A;  1CLW A;  2V6E A;  5BMZ A;  1R4N B;  3BQJ A;  4GO1 A;  1NHA A;  1TC3 C;  3NWT A;  2F6C A;  3GCM A;  4NC7 A;  5DS0 A;  4M6X A;  5C44 J;  4LIU A;  2Y30 A;  4CXF A;  2W82 A;  4XR6 A;  1REP C;  4GXO A;  3DBH B;  4LIV A;  1HST A;  1IA5 A;  3A0H C;  1ONV A;  3TW7 A;  4BXU A;  5B6I A;  3BG3 A;  1G2H A;  1JJ6 C;  4HSR A;  1FIA A;  4C2U A;  3CES A;  2R7Q A;  2F4M B;  3ONQ A;  3HTS B;  3C2H A;  4L5I A;  4EJU A;  1J2X A;  2ELJ A;  2LK2 A;  1WZ2 A;  1ZRE A;  4UUV A;  3E5X A;  4IPA A;  3ULQ B;  3VMW A;  4HZF A;  1R49 A;  3ABU A;  1A31 A;  4W8R A;  2WY7 Q;  1BLI A;  1D2E A;  3SZT A;  4UNO A;  3LWF A;  1TWA J;  3EQL F;  3QOP A;  5EF6 A;  4G6D A;  5LHH A;  1WFX A;  5IOZ A;  1IW7 F;  1F36 A;  2MYS A;  1QUF A;  1ODD A;  1OFD A;  1IV8 A; 
#chains in the Genus database with same CATH homology
 2Y0S A;  2V7F A;  2VB6 A;  2MAB A;  2OUM A;  2VLA A;  1OHH A;  5C1E A;  4TT3 A;  1Z3Y A;  1D0Y A;  2WY8 Q;  3OYI A;  4IKF A;  1LDK B;  3K4L A;  2DT6 A;  2XC7 A;  1G59 A;  2M5S A;  2GJR A;  3GBG A;  3S3O A;  3HKZ A;  1E3X A;  2ZXH A;  2X6Y A;  1OGO X;  3A3B A;  1EA3 A;  2NZM A;  2HU9 A;  4PSX A;  3OYH A;  2IS4 A;  3S3N A;  2BSP A;  2VXZ A;  3IP4 B;  1YE9 A;  2D3N A;  2R4G A;  3NE5 B;  4J01 A;  4C2T A;  1IB4 A;  3KX2 A;  3A2K A;  3CJQ B;  4DJA A;  3LSH A;  3D5R C;  3PNY A;  2PJR A;  3JUR A;  1OLT A;  4W8Q A;  2CV0 A;  3LMW A;  4Y33 A;  1X1D A;  1HZE A;  4YZ0 A;  4OJO A;  2Q1Z B;  1KON A;  2UVE A;  1BHE A;  4II3 A;  3K70 C;  4YZX A;  1WJD A;  3SEZ A;  2R7U A;  2R7X A;  1DQU A;  3NWS A;  2KZV A;  2LBF B;  5AMV A;  1UD2 A;  1NG7 A;  2HLD A;  4RLF A;  1O8D A;  3TL4 X;  3OS1 A;  5HLT A;  2L7K A;  4XL9 A;  2LYC A;  1O8I A;  1YX5 A;  3FKS A;  3LFU A;  4DK0 A;  3GQ7 A;  2Q2E B;  4YEL A;  1E79 A;  4XM3 A;  2CMP A;  1W36 D;  4J00 A;  4F52 A;  3VMV A;  4B44 A;  1QU3 A;  4E7Z A;  3H9G A;  2F1M A;  3CMM A;  4D1Q A;  4BDY A;  2ZZG A;  1IDJ A;  3SYT A;  4HWV A;  2ZTG A;  4D9J A;  2BOL A;  2R7S A;  2ZTN A;  1VF7 A;  2VKH A;  3LSG A;  1V5G A;  2HQA A;  4MLO A;  3OWT A;  3DKX A;  2QKL B;  4ITV A;  1DBO A;  4F93 B;  3VWB A;  2XF6 A;  2QX3 A;  4U49 A;  2E1M B;  3HPH A;  2ZZF A;  4ZTF A;  4XOP A;  4YZQ A;  2VJI A;  4BQN A;  5C1C A;  1D1B A;  2XF7 A;  2NTB A;  3OR2 C;  4FET A;  2CV2 A;  3OYG A;  3B90 A;  2VBE A;  3EPZ A;  3HPG A;  3ZCO A;  4YXW A;  4MXN A;  2GOM A;  3OMY A;  3VYS B;  4B48 A;  2R7V A;  2V31 A;  2MC4 A;  3DPU A;  3QOD A;  3VSK A;  3W2W A;  4CUG A;  4JQF A;  1O8H A;  3PSI A;  4ANJ A;  3L2R A;  1TZL A;  2VIX A;  2XZO A;  1X0C A;  1WJ5 A;  1WTH D;  1O88 A;  3N05 A;  1PE9 A;  4DOZ A;  3OOC A;  3ZPP A;  4NUB A;  4HPQ A;  3M1C A;  3DU5 A;  3W2V A;  2XND A;  4PFO A;  2IGN A;  1O8G A;  1SAU A;  2JDI A;  3ZRG A;  2HPI A;  3DTK A;  3C2G A;  2HVR A;  3B4N A;  1V0F A;  2DXI A;  2IS1 A;  2K9M A;  3H9J A;  1DBG A;  2AQF A;  3LSM A;  1V0E A;  4OJ5 A;  1PKV A;  2KP6 A;  4E7I A;  4EW9 A;  4BJ5 C;  2GJK A;  2UVF A;  1D1C A;  4ZJZ A;  4OZZ A;  2CS3 A;  4XKB A;  1MW7 A;  4B43 A;  2CH0 A;  2X6X A;  2LY2 A;  2WAE A;  1E3Z A;  4Z1M A;  2PMZ A;  4KIT B;  1VLY A;  2ZSI B;  3CP8 A;  3T53 B;  1OGM X;  3OIP A;  3ZGK A;  1MMA A;  4N4O B;  4RM3 A;  2GK7 A;  4OZY A;  4XKW A;  1DGW Y;  3OEE A;  5LD2 C;  2R9V A;  1BN8 A;  1KTW A;  1KMH A;  2X3H A;  2O5R A;  1GLN A;  4BDZ A;  3OYF A;  4Y4R A;  1AA7 A;  4PFP A;  1V5E A;  2BW3 B;  1H8H A;  2WAD A;  2CK3 A;  2QKM B;  1IRX A;  1WJC A;  2LG4 A;  2KQR A;  2RNG A;  5HNF A;  4IX7 A;  3EQN A;  3H9Q A;  3OS0 A;  2W6J A;  3A35 A;  2NOJ B;  1EE6 A;  1SKY B;  4XN0 A;  2VXD A;  3ZQQ A;  1W36 C;  3LMM A;  4BE1 A;  2HVS A;  3FDY A;  3BG7 A;  3BCF A;  5CQG A;  2XZL A;  2LC2 A;  2A5W A;  2UUZ A;  2DOA A;  2KHM A;  2MFZ A;  4JOM A;  2IS2 A;  4KKT A;  1UD6 A;  1WPC A;  2GJP A;  3CZ6 A;  3OYB A;  1T0F C;  1KCD A;  3SEQ A;  4XNF A;  3ZR8 X;  1V5F A;  2WPD A;  4F3Q A;  2WJY A;  2IGM A;  3HUG B;  1UD3 A;  2ZZQ A;  3BCB A;  1WJE A;  1WP6 A;  2V9K A;  1LFP A;  4R79 A;  1BR4 A;  3GQB A;  4CZC A;  2VBK A;  4E7L A;  1W0J A;  3CF2 A;  2KVO A;  2X85 A;  2UWM A;  2LZJ A;  3OYA A;  5DN6 A;  3OL3 A;  2M0M A;  2X1E A;  2LH9 A;  3PSF A;  4G6I A;  1FX0 A;  2DCE A;  4XLF A;  2W4S A;  4PJN A;  1K6Y A;  2VQG A;  5HVQ C;  1E43 A;  2I8D A;  5FL7 A;  3ZPN A;  3KEY A;  2QXZ A;  4JMQ A;  4C2L A;  2DIE A;  4U87 A;  3GQ9 A;  2VBM A;  4PSW A;  1QJV A;  2VQL A;  2VKD A;  3OEH A;  2KPM A;  3A1Y A;  4I84 A;  1TT0 A;  3DKY A;  3K4C A;  4RM2 A;  3FHN A;  1UD5 A;  4XON A;  3K4J A;  4HST A;  1H8E A;  4CCO A;  4NQW B;  1UAA A;  3A3G A;  4Y3O A;  1J09 A;  4F92 B;  4OJP A;  3FKJ A;  2X51 A;  1W9X A;  4B3G A;  3OYM A;  4CCM A;  4C30 A;  2O0W A;  3ZSC A;  2GOX B;  5JHF A;  1Y6I A;  3TMO A;  3K4K A;  3S93 A;  1P9Q C;  4ZYA A;  1R6R A;  4CCL A;  4OJL A;  4CCN A;  4N4N B;  3U21 A;  4B47 A;  4KKU A;  3OYC A;  4BEH A;  1KCC A;  2GK6 A;  2XSJ C;  5KNL A;  4ZDO A;  5TGT A;  1KZL A;  3E0J B;  4HIZ A;  4NK6 A;  1WJA A;  3AFH A;  2E1B A;  2RRE A;  2LOO A;  1HG8 A;  3ZXS A;  2ZFU A;  3L2U A;  3PJR A;  3AL0 B;  1EFR A;  4P22 A;  2NTP A;  1PLU A;  2FUG 2;  4Z03 A;  1O8F A;  4KIS A;  2LY1 A;  4PK4 A;  4TSF A;  2P0W A;  2WZP P;  1NHC A;  2CV1 A;  3SDB A;  2CW8 A;  4XOT A;  3GVJ A;  2L9S A;  1MMG A;  1UG0 A;  2Z1D A;  3S8P A;  4GQN A;  2INU A;  3B8Y A;  2K9L A;  2NTQ A;  3T9G A;  3RQ4 A;  3OE7 A;  3FY3 A;  4XLA A;  4ZDL A;  4Z06 A;  3DWL E;  3PNV A;  3K4N A;  4FAS D;  4BAC A;  2E1M C;  2KRH A;  4G7W A;  4BUP A;  3OYK A;  2O1D A;  1X1A A;  4AYB A;  4II2 A;  1IDK A;  2AQE A;  3IUO A;  4XD7 A;  1VBL A;  5CDF A;  2PJR B;  1Y56 A;  4XMY A;  3EUK L;  1MND A;  3VYU B;  1UD4 A;  2KDO A;  3DEE A;  4UZU A;  3QYF A;  1ZEL A;  3HXL A;  3K4B A;  4EAT A;  2VPL A;  3L2V A;  3UW0 A;  4E7S A;  3OYE A;  5KCM A;  3G05 A;  1DP3 A;  4H4K C;  1BR1 A;  2X1C A;  2KMU A;  5CQE A;  3FBN B;  4BJT A;  3H94 A;  1OFM A;  2KLO A;  2E60 A;  2NSP A;  2O04 A;  1O8M A;  4DGW B;  2K3P A;  2VJ5 A;  3A4C A;  3QYB A;  3OW7 A;  2NST A;  4PMH A;  1MMN A;  3MMY B;  1HVX A;  1PJR A;  3W2A A;  3OYN A;  1X19 A;  1I8D A;  3MKW B;  3T51 B;  4URR A;  2W7N A;  2JA2 A;  4KJZ A;  1QHG A;  2F5V A;  4E7K A;  2ZZE A;  1Z3X A;  4BXF A;  3K10 A;  2X6W A;  4P1W A;  5HNH A;  3S3M A;  2CFO A;  4XN3 A;  1JTA A;  1HA8 A;  4PUS A;  4E4H A;  3GQA A;  4OAY A;  5FRM A;  2W1O A;  2IQ7 A;  4BQO A;  1JI8 A;  4NK8 A;  4BQQ A;  3AKZ A;  3OS2 A;  5LFA A;  3BLY A;  2XZP A;  4BJ6 C;  5KHD A;  3OY9 A;  4F91 B;  4DK1 A;  3BG6 A;  1UD8 A;  3E1S A;  4IQ4 A;  4KKS A;  2LBF A;  3H35 A;  4W8T A;  1RMG A;  3MD2 A;  2D3L A;  3LSI A;  1X1C A;  1X1B A;  3VSL A;  4KT6 A;  4DBQ A;  3H0D A;  4CSW A;  3BCA A;  1PYV A;  2CUZ A;  3PFY A;  2JVG A;  4XLC A;  3RSN A;  3GRH A;  2IXS A;  3VST A;  1FMV A;  3VYR B;  4CH7 A;  3L2Q A;  2KRC A;  2L5Q A;  1PXZ A;  4HEA 2;  3HOT A;  1N77 A;  3K4M A;  2V4D A;  3VR6 A;  2M4K A;  2OC6 A;  3GVL A;  3EUH C;  3DQV C;  2VJ4 A;  1MAB A;  4HNU A;  1G8X A;  3OOU A;  1WMR A;  4HNT A;  2O17 A;  1OB0 A;  4BU2 A;  4CCJ A;  2V1N A;  3H5N A;  1E0E A;  2HDW A;  3BC8 A;  1ERD A;  1T5E A;  1W0K A;  1SFK A;  1O8K A;  4XOR A;  1DGR M;  4X0G A;  2NT9 A;  2VJJ A;  3OFN A;  2L2O A;  2MD0 A;  2A6T A;  1X4P A;  2HVQ A;  4DBR A;  2XDV A;  3BH4 A;  1NG6 A;  2V4J C;  2WB1 A;  3UR3 C;  1O8E A;  2O0V A;  1MNE A;  1U0J A;  2VQC A;  2R7O A;  3KEW A;  4B3F X;  3FBI B;  4CA0 A;  3K6G A;  3PUB A;  1NRK A;  4NNJ A;  3VSU A;  1YX3 A;  4HG2 A;  2WSS A;  2VQH A;  4LG3 A;  4RMN A;  2R7R A;  3LL7 A;  3GVK A;  1QHH D;  1CZF A;  1BR2 A;  1WJB A;  2X53 S;  3HG9 A;  2EWE A;  1X4O A;  2JUG A;  2QE7 A;  4OJ6 A;  1Z7L A;  1LVK A;  4DNR B;  4U7B A;  1COW A;  4OWR B;  3DDY A;  3M8J A;  2L9N A;  2LRD A;  4AU7 A;  2R7T A;  4XLH A;  3HC7 A;  4YZA A;  5FRO A;  3J7A Y;  2IS6 A;  1NBM A;  1GQ8 A;  3VSV A;  4BL0 B;  3MKY B;  2JSP A;  3D5S C;  1H80 A;  3PNT A;  4E0F A;  2PYH A;  1O8L A;  3VYT B;  2XAU A;  2WA0 A;  4XKV A;  2ZSH B;  3DTE A;  3RTR A;  4P5O A;  3HOS A;  4E6K G;  1E1R A;  3DLA A;  1N78 A;  1K28 D;  2CW7 A;  3QOE A;  4CCK A;  2E5N A;  1RU4 A;  3TBI A;  3AL0 C;  3OR1 C;  4C9Y A;  1I18 A;  4YRV A;  3DU6 A;  2ODL A;  4IQJ A;  2UV1 A;  4XKC A;  2Z16 A;  4B3X A;  1D0Z A;  3OYL A;  2HNH A;  2F4I A;  2BW3 A;  3I9V 2;  3QYE A;  3SZG A;  3DPT A;  3MKZ A;  3RCO A;  1WJF A;  2OV7 A;  4GRI A;  2HZD A;  2Z2S B;  1D0X A;  3L2W A;  2XF5 A;  3WWG A;  1K5C A;  3DPL C;  2M7B A;  3RPU D;  2XGJ A;  1Z21 A;  5IK2 A;  3DTI A;  2WJV A;  3EQO A;  3BCD A;  1QCX A;  2LRE A;  2JJ1 A;  2DJI A;  3OIQ A;  4G6T B;  2ZXI A;  2VL8 A;  3ZIA A;  2NT6 A;  2Z8G A;  3SUC A;  1MMD A;  3LSK A;  4IZZ A;  4NC8 A;  4BE0 A;  1VJS A;  1OOC A;  2VAS A;  3OYJ A;  4ZTJ A;  3LNN A;  5CPR B;  1JRG A;  3KRG A;  3HL2 A;  2CUJ A;  2V7Q A;  1N75 A;  3OYD A;  2X1D A;  1RWR A;  4XQF A;  1OFL A;  2Z6B D;  1BPL A;  4PJJ A;  1BOB A;  2K5C A;  4BGD A;  4G7X A;  3K70 D;  3W3C A;  1XG2 A;  4MR0 A;  4W8S A;  4BEH B;  3OAA A;  4E7J A;  2KL4 A;  5FRN A;  2DT7 B;  3VDX A;  2M7A A;  2IGO A;  2JVH A;  4QPO A;  3KYL A;  4RLQ A;  1O8J A;  2INV A;  3OL4 A;  4ZDP A;  1E1Q A;  2W6I A;  3T56 B;  4Z05 A;  2HPM A;  2JIZ A;  3D5L A;  3G2B A;  1FMW A;  1D1A A;  5CKT A;  4DIQ A;  4OAZ A;  5HOO A;  1BMF A;  4U4B A;  2RQQ A;  4YEJ A;  4HRI A;  4PJM A;  1LKX A;  3EUA A;  2M4G A;  4FXU A;  1AIR A;  2V6E A;  3CJR B;  3IAS 2;  2E5Z A;  3NWT A;  3HAG A;  2F6C A;  2XOK A;  3BC9 A;  4NC7 A;  4QPQ A;  2WAQ A;  2PEC A;  3WQZ A;  3H5R A;  4LIU A;  2W82 A;  4XR6 A;  1IA5 A;  4LIV A;  4DNT B;  2BVL A;  4PJL A;  2F43 A;  3H5A A;  4XLE A;  3FPP A;  4L8J A;  4AVZ A;  2V26 A;  4HSR A;  4C2U A;  2PYG A;  3GQ8 A;  4ZC3 A;  3CES A;  2R7Q A;  2WBM A;  3ONQ A;  4BE2 A;  3C2H A;  2IGK A;  2X8K A;  2ELJ A;  2BVM A;  2M3A A;  2QY1 A;  4F55 A;  3S32 A;  5HKK A;  3VMW A;  4BS9 A;  1OR7 C;  4W8R A;  3IAM 2;  1T95 A;  2WY7 Q;  1BLI A;  3F9K A;  2W00 A;  3CP2 A;  3V42 A;  2JJ2 A;  3I3L A;  1S9H A;  4LIT A;  4E7H A;  3OPO A;  1UEL B;  1WFX A;  3JU4 A;  2WAF A;  4ASU A;  1VZ0 A;  3PL8 A;  2MYS A;  2R7W A;  4TKO B;  3UNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...