4XONA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xonA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xonA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xonA02
4U49A 4URRA 4I84A 2X6WA 4XN0A 1JTAA 2X6YA 2VBMA 1IDKA 1GQ8A 2NT6A 2UVEA 1QJVA 3VMVA 4YZXA 4MXNA 3GQ7A 3EQNA 3GQ8A 4XLEA 1O8JA 4YEJA 2Z8GA 4Z06A 4W8TA 1CZFA 3VMWA 4MR0A 2O0VA 3LMWA 4OZYA 1OFLA 1KCDA 2UVFA 2VBEA 4YZ0A 1O8EA 4XONA 1IB4A 3B90A 1O8HA 4XN3A 4NK6A 1O8MA 5C1EA 2NTPA 4XKVA 1PE9A 2NSTA 3GQ9A 3T9GA 1VBLA 4OJLA 1PLUA 4U4BA 1H80A 2O17A 3ZSCA 1O8DA 3SUCA 1O8GA 1IDJA 3GRHA 4W8SA 3EQOA 4EW9A 3VSTA 4NK8A 2EWEA 4XM3A 4Z05A 4AVZA 2PYHA 3JURA 1BN8A 3VSUA 1O8LA 1PXZA 4XNFA 4XLAA 1AIRA 3WWGA 1EE6A 2O1DA 1RWRA 2PYGA 2QX3A 4PMHA 2O04A 4OJ6A 4XOPA 1NHCA 4HWVA 4OZZA 3B4NA 4XORA 2X3HA 4XL9A 1O8KA 4YZQA 1JRGA 4C2LA 4XLHA 2VJJA 1IA5A 4XLFA 1O8FA 3FY3A 1X0CA 3UW0A 4OJ5A 4XLCA 1OGMX 2NSPA 2INVA 1OOCA 4XMYA 1QCXA 2QXZA 1WMRA 4Z03A 2IQ7A 3ZPPA 1O8IA 4YELA 2QY1A 1HG8A 2ODLA 1BHEA 1RU4A 4OJPA 5C1CA 2BSPA 2X6XA 3KRGA 1KCCA 4XQFA 2NZMA 2O0WA 3GQAA 1OFMA 4W8RA 1OGOX 4XR6A 4OJOA 3B8YA 2VJIA 4XOTA 1O88A 2NTBA 2X85A 2VBKA 1DBGA 3VSVA 1DBOA 5AMVA 1RMGA 2NT9A 2NTQA 1KTWA 1K5CA 2PECA 4YZAA 2INUA 4W8QA 4XKWA 1XG2A
chains in the Genus database with same CATH superfamily
2GM4A 4LBYA 3BG3A 1ZGJA 1E62A 5ICEA 4CCMA 2VE8A 1ZGWA 1YJWB 2FE3A 3W2IA 4ZYHA 4E0FA 3REOA 1W0UA 3GTJJ 3BC9A 1MBGA 3D5SC 3ECHA 2DYIA 1BX1A 2M30A 1B72B 2NNYA 3HOVJ 3FPPA 2ZZQA 4Q5SF 1QO0D 3GEZA 1JJ6C 2BSAA 1ONVA 1JGGA 2RQQA 2XB5A 2C77A 4XLEA 2X8KA 1T0FC 2VKHA 3E6DA 1I6XA 4YALA 4LJZF 2CUZA 2IA0A 3FX3A 1O3SA 2VQGA 1VQPI 4D5FA 5DM7F 4RLZA 1KCDA 4OIRF 4XSXF 4ZYAA 1O8EA 3FHNA 3BQZA 3HOXJ 4G6QA 1NK3P 2DN0A 2FD5A 4LFUA 3CC2I 5KSWB 3QPLA 2IVMA 3VOEA 3ES9A 3W5VA 5C1EA 4JOMA 3DPLC 3B02A 1KQ9A 1PUEE 3GQ9A 4RM0A 2KISA 3EDPA 3QODA 4G9YA 4CA0A 3I59A 5L3CA 4RAFA 2V7VA 3CCSI 1WJEA 3PFIA 2ZB9A 4MTEA 4KMFA 1VJSA 2GXAA 2AQEA 1FEXA 4B3FX 4KN4X 3ULQB 3T56B 3PA1A 1V5EA 3GBGA 3GRHA 1ETVA 4EJTA 1Z7LA 3P7NA 2Y0SN 3E0JB 2BM7A 1K6YA 3ZOBA 2DTRA 2E1OA 1TC3C 2NVTJ 1QVGB 3WWGA 3FXLA 4CO8A 3W6VA 5FLMJ 1OGIA 2O1DA 1MNEA 2G9WA 4G94A 4RD0A 1Z6RA 3MKZA 5F04A 4LITA 2VYQA 1ZH5A 2QVOA 4EJWA 2AQFA 1LVKA 4A3LJ 2DT5A 1K8AD 3HIFA 2LKPA 1E3OC 1D8KA 3NQOA 1YIJB 5CVUA 1JRGA 4B43A 1TWHJ 3IUOA 4EM2A 1FP1D 2K9QA 1BC7C 1MBJA 3GYHX 5TRDA 2XGCA 2E1CA 2GIVA 1JT6A 1BOBA 2HOAA 4A3GJ 5EEHA 2XNDA 2L9VA 5LHGA 1F36A 4ENNA 3MHPA 4YHBA 3CCUB 1FTZA 3W2EA 4Q48A 1BIAA 4XK4A 2R0QC 2D3NA 2QY1A 3JX8A 1VQ4I 1U3EM 1DARA 2EFPA 3OIQA 3ZMUA 1XE1A 2WAQA 2OTLB 1RU4A 5C1CA 2QQ9A 4A5NA 3OZUA 4PJMA 3N97A 1U6GA 4XQFA 1GHCA 4ZDOA 2DT7B 2DIEA 1TL8A 1HW2A 2QCOA 2MC4A 1KQ0A 3QFTA 2DQLA 3PUNA 4XOTA 2DA5A 2QTZA 4GYIA 2J8IA 4YDTA 3WU0A 3TEDA 5IYNA 3S1RJ 3MN2A 2PMZN 1WRJA 1ZLJA 3OS2A 2Y0SA 3CESA 4TMZA 1TP4A 4OPWA 4X6AJ 1ZKGA 4B09A 3WTVC 2VZLA 3F8BA 3JTGA 2JN6A 3A2KA 2K85A 2IGNA 2VXDA 3IKVA 4MQVA 1NRKA 4WZLA 1HF2A 2YSRA 1QVFB 3RQIA 3PETA 4AD9A 2XPWA 3FISA 2FJ1A 4HNVA 3I58A 3KZYA 1GQ8A 4F93B 1G3SA 3U2RA 1MBEA 3ASOH 1ETKA 4ZDLA 1EJ9A 3AG1H 4BBSJ 5DDGA 4BY7J 4NCNA 3S1MJ 3GVKA 9ANTA 5LBQA 2CU7A 3CCEB 2WAFA 3MKLA 5EEGA 2ZZEA 1IZ1A 1Z1DA 4Z4SA 3DP7A 5DV5A 4AIKA 1N06A 3MCAA 3MFKA 2R7UA 2P7CB 1SVLA 1MMDA 4YFKF 4OMZA 1N78A 1MIJA 1SFEA 3PNVA 5K7FA 1LE8B 2AHQA 2K40A 4L18B 3I71A 4XRSG 5IP9J 4A6EA 3A01B 3PO3J 4I7HA 1GDTA 4L0ZB 4XN3A 2DOAA 4XRFA 4NK6A 2CFOA 1KYZA 1X4PA 1Q1HA 2GWRA 5EMNA 5IPAA 3OW7A 3C3WA 3HZJA 1OCCH 3K1MA 3SFZA 4IKFA 2DY1A 2XC1A 3PUMA 1WPKA 4E7LA 2ZZGA 4JBAA 4HDVA 5THXA 1H80A 3HPGA 2JA6J 4QUZA 2WC2A 3CRZA 3H94A 5HS7A 1S29A 4C30A 2MH2A 3V8JA 3V8KA 4QVJA 3ZMVA 2RGVA 2RQPA 2LK2A 1YHQI 2EWEA 3CTAA 4PC7A 3R60A 3OSFA 1QA2A 2P3MA 1R23A 1YW9A 2ZL7A 1SEUA 5FD5A 2LP0A 4ZTJA 1VLOA 1N8RD 4QVAA 3O6BB 5M3FJ 3S32A 2KHMA 3Q5FA 3QYFA 3I4PA 3WTTC 3QFCA 3IH2A 4GFBA 1WKMA 2IGKA 4HSRA 3C18A 3ZQQA 3E6CC 4EGZA 3CCLB 4KT5C 4O6JA 3U1DA 3G71I 3K4NA 4UB8C 4XLFA 1S4MA 4KMUX 5IYBJ 3KLNA 1USTA 4DGWB 3UW0A 2CS3A 1BJZA 1B8IA 2JPBA 4X8IA 4BUPA 5E3LA 1GUUA 1TLLA 2PMZA 4HLXA 4RD3A 4ZCIA 2OJED 3CC2B 2KZVA 3MCZA 2JA5J 4UHTA 1JNYA 4G7WA 1AHDP 3LA3A 2QQBA 4CYCB 1NTCA 4DNTB 2MW8A 1HG8A 4EEFG 1REPC 1B9MA 1N07A 2R5YA 4ZYEA 1IF1A 2BW3B 4NBQA 1S72B 1PDNC 1PJ7A 4CDGA 1YW7A 3OYIA 1HC8A 1QG0A 3HSRA 4IRIA 2WR8A 3VYRB 2QUFA 4FCYA 2PEXA 1GVDA 2KKOA 5F1RA 1GJRA 1QFJA 4OOVA 2LDUA 1VQOB 4HOBA 1X3UA 5FRMA 4Y4RA 4G7OF 1TWCJ 2PLFA 4X7DA 2M5SA 2P7VB 1W35A 3FDYA 3BP8A 3ABKH 2IA1A 2TRTA 3U9GA 3WGHA 5E6TA 5E1ZB 1FDRA 2NTQA 2PECA 3HSFA 5F64A 2W4SA 5BPIA 3KFWX 4XKWA 1D1BA 3HG9A 2ACJA 3HSEA 4I84A 3G73A 1BJAA 4I2OA 2X6YA 2VBYA 5CQEA 1GAQA 2PG4A 2CK3A 2CRVA 2QZAA 1SANA 2OQRA 4UV9A 4AF7A 4AYBA 2OD5A 5J6XA 4JQFA 1OISA 1VI0A 4BXUA 1FRQA 1R4NB 2KLOA 4RBOA 1XSDA 3BZCA 5FFXA 3OOPA 3DU1X 5F27A 3JAMZ 1BR1A 4FASD 1Q86D 3KEOA 1AU7A 1WI3A 3DCFA 1SFKA 3GTKJ 1PJ6A 5FB2A 3LA2A 4AU7A 2HKXA 1X1BA 4NQWB 4A5MA 4PJLA 4DBQA 4BE2A 1FSEA 1E63A 2OU2A 3U21A 2BGIA 1QGZA 1DUXC 1EFCA 3MEXA 4FTHA 3C2HA 1GT0C 2M4GA 2NTPA 5E3MA 4U0YA 2LYCA 1G7TA 3QPTA 5HNHA 1H89C 1ZGAA 3BQJA 1FY7A 1XMXA 2FBKA 4UUTA 5H6QA 1BR2A 1J0RA 2NOGA 3HTUA 1X1PA 5D4SA 5HDKA 4HQEA 1BL0A 4X05A 4UY8I 1ETXA 4BQOA 3B6AA 2IPQX 2HFHA 2WZNA 3CJTB 3Q9SA 2HZDA 3I5UA 3GFIA 4PCQA 3GMEA 3QPSA 2ZL5A 1KQ5A 4AVZA 3H0GJ 3E6BA 2ME0A 5TJJA 5ILUA 2J7KA 3AVVA 5D8KB 1FMVA 2DPDA 1U0JA 4CXFA 4DK1A 4HX7A 2AHOA 5JMCB 4JX5A 4S0HB 2PJRB 4KISA 3ZMSA 2WZPP 3QWLA 4ZZLA 2HQNA 2O04A 1QNTA 2OV7A 3OOCA 1J09A 1QGAA 4L0YB 4I76A 4UVCA 5C44J 1E1RA 3JCUC 1ERDA 4M3DA 5A8AA 3L1PA 1E3HA 2D9RA 1YS6A 1MNMC 2CV1A 1IA5A 2GBYA 4U7DA 3CXCB 1QRBA 1LQ1A 2L54A 3JQQA 3QYBA 5HZBA 2LFBA 2INVA 3WNBA 4P9UA 1OOCA 3RSNA 2FRHA 5HZAA 3LSTA 4RAZA 1K73D 2X1EA 4IOCF 3NWSA 5KVRA 3FBIB 3PIOF 1S5LC 2G7HA 3G4SI 2ODLA 4DJAA 4G6IA 4EV0A 3KRGA 4QPQA 4CZZA 5CVIA 3HXLA 1IRZA 3GFJA 1OFMA 1NB9A 1VQ8I 3RIRA 2LKXA 1QZYA 3FIWA 4GXOA 1XG1A 2DFEA 2OC6A 5JFRA 2Z2SB 3KCCA 1YJ9I 2CYYA 2LSOA 2NXNB 4P9FA 4DZJA 4IZZA 4LG3A 1IXSB 1DDIA 2D5VA 5DS0A 1ODDA 4CYCA 2WADA 2ZMEB 4YZAA 4L9TA 2HTJA 1LFUP 1FNNA 1ZREA 2XEXA 1QZZA 2A69F 5HVQC 3Q38A 3VO2A 1YHQB 4F52A 3RYRA 4XIDA 3A8IA 3GTGJ 2V7FA 3SZEA 5EG0B 2ZZFA 5TY0A 3WGGA 4WCGA 3CUQA 2JRMA 2ELKA 1JA1A 2XC7A 4PJJA 2FOWA 4TMTA 2DO7A 4GCVA 3KL9A 3ABLH 3GQ7A 5HDGA 1Y8RB 2KFDA 1ZM9A 1TTYA 4EJVA 3I4MJ 1ELOA 3SKBA 3VSLA 3RTRA 2W84A 2E1RA 1YJWI 4CYDA 3BH7B 5HKKA 4OZYA 2EIKH 5E18F 4Q7JB 1ETQA 2DYSH 2QEXI 4M6VA 4LK0F 1T56A 2COMA 1VQOI 4EVIA 3HUGB 2ZTNA 5DN6A 3QU6A 4LLLA 4M3GA 1I1SA 1FT9A 2A07F 3HOSA 4TMVA 4DYRA 1W0JA 4FK8A 2FX3A 2Q0OA 2P5LC 4G1BA 2Q6OA 3DBLB 2K86A 1XDUA 2W25A 4P1VA 1TYWA 4LK1F 2FNPA 4HX4A 3EQLF 2QBYA 2KZGA 2E5ZA 3OYJA 1O8DA 4FT8A 3TBIA 1IDJA 1TQPA 2NS7A 4Y33A 2BY1A 2LBFB 2DTZA 3RZDJ 3AFHA 3FXJA 1PP7U 1H0MA 4EJOA 4LBZA 1EZGA 1P4WA 2EIXA 1PXZA 1QQIA 1I7PA 2ZBUA 3TMOA 1R71A 2JRTA 3DF8A 1NH3A 1EH6A 3CD6I 2OPTA 3F6OA 3Q6RA 5HLHA 4N4OB 5IT9K 3LFUA 3DKWA 1UD3A 4ESFA 2XPVA 2A05A 2K3FA 3SZTA 1EFTA 4OIPF 2HQAA 3KEYA 1DU0A 2R7RA 4NHJA 5HS9A 1D0YA 2ELJA 3MZHA 4RCYA 1ZELA 1T38A 1Z21A 2D74A 1KZHA 3ZZ0A 4KIFA 5JVTA 1S7OA 3BR2A 3I56I 3NEUA 4BE1A 2W6JA 1DPRA 2MYSA 1JTXA 3WGIA 1UD8A 4RLFA 4BXFA 2EB7A 4A3BJ 1BBYA 3AG2H 5B5EC 5FIUA 3D5LA 4QV2A 5D5WB 1FMWA 1YFHA 1BQEA 1DP3A 2CUFA 3OPOA 4FXUA 1R5GA 1YIJI 4K1XA 4O5VA 3S3NA 2HDCA 2H6CA 2BVNA 4OWRB 5EG0A 1O4XA 3R6JA 4RPDA 3WQZA 2ZXWH 3ZQ7A 3GUDA 1A8PA 3GQAA 4PJNA 2STTA 1KK3A 4YRVA 1VQNI 3OFNA 1MSFC 4OJOA 3BZ6A 4RPBA 1S7AA 3DKXA 4WK8F 1FYMA 3GWZA 1MMGA 5EZGA 3UKGA 2EK5A 3FMSA 3Q0VA 5IYRA 2XTXA 3JQPA 3OOUA 1KTWA 1ZARA 4HRIA 3KYCB 4L5IA 4GO1A 4YC5A 2KDOA 2L7FP 4AC0A 1OHHA 4UZUA 3BTJA 1YYVA 4DNRB 3WTWC 1Z6TA 3FKIJ 2BGJA 4KFCA 4A3DJ 3AGQA 4XBFA 2XROA 3MKWB 3QOEA 1IN6A 3P9CA 3K7AJ 4V2FA 2XUBA 2CRGA 5HDNA 1EP3B 3VMVA 5L3DA 2MABA 1X58A 4Y3OA 5JLWA 2MA3A 3WTYC 3DQVC 2EV5A 4HYEA 2O5RA 2BXYA 1VQ6B 2H8RA 1IN5A 2CC2A 5KAFC 5BOXA 5LGTA 3CCLI 2COBA 4M72A 1R4MB 4L9JA 1BN5A 3JAMK 1KZLA 3LMWA 2DA3A 3WE3A 3FPKA 3H9JA 5F0FA 2VUMJ 1RC9A 3B90A 2GQFA 2R6HA 2R4GA 2VI6A 2HEOA 1E3XA 2DEUA 3TP0A 4BYYA 4J01A 5GV8A 2BX6A 3LQEA 3OEHA 3F3XA 4PZJA 3OR1C 4IEJA 5ED4A 3ZPNA 2BF4A 1PLUA 4PAAA 1DDGA 2QE7A 1ZQ3P 2KT0A 2Y31A 3T8TA 5E8GA 2W48A 4V19K 5GPAA 4OIOF 1FWZA 2XHKA 4FE7A 5IP6A 4DK0A 3VSTA 5GPCA 2YUSA 3BR1A 1G4DA 1FOWA 1V4RA 1YLOA 2XPUA 2ECCA 4CCNA 5FLXK 5B1BH 1EFUA 5M3MJ 5BSYA 1TYUA 4U88A 3OZWA 4V02C 1W0KA 3GLXA 1WPCA 1MW7A 2V9KA 5LRRA 3OYCA 2FVGA 2E1MB 3ELKA 2BE5F 4BKXA 3RKXA 4PMHA 3VFZA 3ZZTA 3WNDA 3CC7B 4I6ZA 4RAGA 4DQKA 3E7LA 5FRNA 2PMUA 3FKJA 1SC7A 3GQ8A 3CC4I 3VEPA 1FLIA 1MNDA 4FX4A 1N0VC 2HQRA 5DSZA 1O8KA 2JK3A 2LF8A 3H1CA 4HLYA 4ENJA 3D5RC 3KLOA 4YG2F 1RUOA 1V0EA 1QFZA 1O8FA 3PNYA 3MD2A 2F48A 1T5EA 4Q4ZF 3TOBA 1T39A 1JJ8C 2QZ8A 3HGGA 3WG7H 3SLNA 2DMTA 4PFOA 1K61A 2ZJ2A 1STZA 1P7JA 3C7JA 4AUXA 3JRBA 1KRHA 3GQBA 3IHUA 3JREA 3IH3A 3GZ6A 1QQ1A 5LFAA 4A69C 1GR1A 1Y0YA 1O8IA 5DS9A 3F23A 3ZCOA 4YCQA 4PJ0C 1IN7A 3CMAB 4KN7X 2EFQA 2DOEA 4FE4A 2STWA 2XRLA 3GVJA 2KDZA 2VT3A 4PC1A 2K4JA 2X0KA 4EM0B 2DODA 1HKQA 2Q2EB 3WBJA 4I98B 1YI2B 1XS9A 2WSSA 2CQNA 3BG5A 2NYXA 2VFNA 1Z91A 4XRSA 3RKWA 3N6ZA 3E5UA 2P8TA 1G7SA 1T0FA 5K7HA 4Z1MA 2Z16A 2YR2A 3OYFA 3J7AY 1I8DA 1FNBA 1S9HA 1IV8A 3JW4A 3M3YJ 2L5QA 2Q6KA 2CUEA 2NNNA 4RB3C 4XD7A 2XGJA 1U5TA 1SD4A 2W00A 3QAHA 4Q47A 4CGZA 1VQLB 1Y0RA 3KP4A 2CQXA 2L02A 4PFPA 1VLYA 3K4KA 2LG4A 2OCEA 1WOSA 1WTHD 3OV8A 3GSIA 4M9XA 1QJVA 3ABMH 1HW1A 3RKYA 4MFEA 2VJ5A 1RNLA 2XTYA 1KONA 2L4MA 1OPCA 2KRFA 4GYGA 1Y1VJ 3I59B 3LNQA 5E3OA 4G7XA 1XMAA 3M1CA 3PM1A 3DXJF 2JZYA 2ZKZA 2WJYA 1TVCA 3T0YA 1VQ6I 4OPVA 1AIPA 4U9UA 3PSSA 4MR0A 3W6JB 3CUQB 4HZFA 1WH5A 2OBTA 1IB4A 4MFDA 1BI0A 4R79A 3OR2C 1R1UA 3HHHA 4D0PA 3MKYB 3DEUA 4E7ZA 5J35A 4DIQA 2E2HJ 2M8GX 1RZ4A 4J19A 2WYRA 2CQKA 5DCFA 5D5VB 1KJZA 3BH6B 3AVXA 4UNOA 4ABZA 4QFMA 2Y0MA 3KETA 4U0VA 3I4NJ 2A5YB 1UHWA 2P0WA 3DTIA 2R7XA 1XB2A 1VQ8B 4OAZA 2HOTA 3G6EB 1ZRDA 2B7BA 5TGTA 3VSKA 2Z5UA 2JPCA 4C3JJ 4BU2A 4OOSA 4X07A 2HYGD 4BDZA 2QGGA 1O3RA 2H09A 5GAHJ 1SKQA 2DYRH 1QU3A 3HJEA 2A5WA 3T51B 1ULYA 2GJRA 3DLAA 2FUG2 2VPLA 2E2IJ 2B7CA 3SHFA 1FOKA 1Y0NA 4ENMA 2BHZA 1EA3A 2AXLA 3K1NA 3OWTA 5EDNA 4HWVA 2G7UA 4ACBA 4R1HA 3ZN0A 2KVOA 1JTYA 2R93J 4F92B 2HVSA 1BM9A 3S2WA 1S7EA 3VDXA 5CVRA 1UJ8A 4OIQF 4KKTA 5KW9A 2EZIA 1TQIA 4IW3B 1G8XA 1ON1A 3DBRB 5CLSA 2HWVA 3A03A 1X0CA 3V7CA 1LDKB 1WH7A 2I5UA 3K2AA 4RD1A 1Z05A 2WY8Q 3QRFF 2E1NA 2DAOA 1PUFB 2YWFA 1QVTA 4N4NB 3A8JA 3EUKL 2V5IA 1ETWA 2VIXA 1G7CA 4D7NA 4E7IA 1EF4A 1DU6A 4N3NA 1H8AC 1RESA 4BHCA 2VNHA 3CCRI 3ASNH 5JVGF 3TW7A 1FIAA 3PJRA 2E7XA 2HI3A 2ZFWA 2V9VA 3PUFA 4MIMA 2BSPA 1WSRA 4IHYA 2V1XA 1U78A 2H8WA 3M1EA 1XCVA 2HS5A 2XF5A 2VBVA 2Z99A 1KMHA 5LEJA 4HF0A 5E1XA 1CF7B 4BQAA 5HLIA 3LOCA 4QHYA 4W8RA 3HYIA 2XAGA 4ZJZA 1W34A 4C9YA 1ENHA 1TWAJ 2R5ZA 4YIRX 3GTPJ 1CQXA 2V9PA 3CCVB 1DBOA 2CQ7A 1KTVA 1BI1A 3IV5A 2NAZA 3IP4B 2Y69H 1QA6A 1JJ2B 3CC7I 3SJPA 1ZG3A 3LVBA 3RPUA 4U49A 5DUKA 2P4WA 2OTJB 2HVRA 1USSA 5C4JJ 2XVCA 3DU5A 3CMEI 1B6AA 3FZVA 1WJCA 2RREA 3CCMI 1SFXA 1NG7A 1LB2A 2H1KA 1Z67A 1T95A 2RC4A 2V7XA 4ZGNB 3A4CA 1UZCA 1WJ5A 1B59A 3A3BA 3DTEA 5CYVA 1V0FA 4A93J 1O3QA 1IRFA 1YJNI 3J7ZI 4OINF 4YEJA 2DA7A 3FMQA 2WV0A 3HRSA 2PI0A 5GADJ 1JA0A 5H59A 5J1RA 2D45A 1YG2A 5A2QZ 1R5HA 3I0TA 1SVMA 1BI3A 2H1LA 5L46A 2QM3A 1ZK8A 2IRFG 3HOYJ 1U5TC 4AIJA 2XGDA 4I02A 1KU9A 4KIBA 2YU3A 2IP2A 3HOTA 1YW8A 3WY9A 3BZKA 2DLLA 4ESBA 2XKPA 4A3JJ 1Z77A 2W82A 2F4NA 4NBSA 2UZKA 4UVAA 1S6LA 3HKZA 2F5VA 3WU1B 2O61A 1UD2A 4X7FA 1OCTC 1LEAA 3K4JA 5F08A 5C3EJ 1EA0A 2A6TA 2BBYA 2YWGA 3EETA 2XSJC 1QZEA 3CCYA 3LQRA 4OMYA 3OAAA 1QH0A 3WG9A 2Y48A 3OIOA 3K4LA 1A35A 3G05A 1LM1A 2QX3A 1A36A 2B9SA 3V8LA 3LSIA 1W7PB 1MDMA 1K6OA 3ZC3A 1FBUA 4B4DA 2P5VA 1FNDA 3F8FA 5FKMA 1LDJA 4C2LA 1MH3A 3DEWA 2X6OA 2YPRA 2F3LA 1XMKA 2K5CA 2F5FA 2QLZA 2E7WA 1FIPA 2MLGA 3FY3A 3RY8A 2BXZA 3CW2A 4OJ5A 3Q0WA 2NSPA 2GA1A 2HQ5A 5K5RA 2MD5A 4X0CA 3DKYA 3A1YA 2F5CA 3A0HC 2VONA 3VYSB 1F4KA 4A3KJ 1D8JA 4PSXA 3TW6A 4YELA 2E60A 3OS1A 2DPUA 2RC5A 3ECOA 3OW2B 3CQZJ 3PO2J 2DFFA 5LHHA 4WZTA 5FFZA 2HKOA 1QGPA 1KA8A 3O3KA 3S16J 1AMOA 3BTLA 4DQLA 4BEHB 4C3IJ 3CMYA 2O0WA 1T08B 1TW2A 1UMQA 2L0KA 3DU6A 3E3VA 6PAXA 2DDBA 3H3ZA 2XTWA 2FX0A 2P81A 3WHCA 5J4YA 2PQ8A 4WZKA 3D0SA 4LLGF 2D3LA 4JP0A 4HE5A 5FA6A 1UAAA 3F8MA 1K78B 3CUQC 1HQCA 1PJRA 3CDIA 3CMMA 4RB0A 1A31A 4P96A 2HYFA 1WOOA 1K5CA 4J00A 3OSGA 2V26A 3ROUA 3BG7A 1UELB 2GPJA 3IAS2 2IT0A 1KQSB 3SQVA 2LNBA 2W57A 3J81Z 4RD4A 5FKOA 1TNTA 3LNNA 2GIZA 1LKXA 1WJBA 2R7TA 5GTIC 2BYVE 1VQ9I 1KK1A 2XSDC 5DCMA 1BI2A 3WTXC 3LAPA 2A6EF 2UVEA 2BY3A 2FBIA 2DMQA 3VB2A 2PE3A 2EFNA 1MD0A 2E19A 2DERA 5J1UA 1LLWA 5F0HA 1APLC 2JMWA 1DPUA 3BLYA 2B63J 3HOZJ 2ZXJA 3FKSA 3AK5A 5K1YA 1DQUA 1F20A 4E70A 3CC4B 4ZCLA 1G3YA 2X0LA 3LWFA 2OQGA 2L7MP 3OYKA 1NB0A 4D7MA 3I54A 5B6IA 4P1WA 2Z8GA 5EYRA 1HSJA 2DK5A 2E71A 5GTHC 5LGUA 3LSMA 1OFLA 4WXDA 2L9NA 2JT1A 1ZTRA 1COWA 3BY1A 1Z0XA 2O03A 2E35A 1K28D 3PQJA 1B23P 2EV6A 2RVCA 2I1LA 4BH9A 1S8NA 4P12A 4Y9UA 3P9KA 4BL0B 2ESNA 4NQWA 5DCMB 2XF7A 1R1TA 4RM2A 4OJLA 3KIOA 4F3QA 3JTHA 3SLDA 1YX5A 2L7ZA 2Y75A 1QHGA 1ZAOA 2QF7A 1ZRCA 4OOXA 1B1BA 4BJ5C 5IOZA 1EH7A 2FQ3A 1D0XA 4EW9A 2F1LA 1A04A 3CCRB 2GA2A 1XC5A 4RAYA 4UB6C 2DDAA 2KIQA 1WFXA 1JKPC 4JX4A 3K70C 1IHMA 1VZ0A 2AS5F 3SEZA 3TO9A 2BGCA 4O3MA 4CCKA 4KICA 1OCPA 1W9XA 1EFRA 1RWRA 2UV1A 2B0RA 4FISA 2BZTA 4D1QA 1HOMA 2DFIA 3I9V2 2GQQA 2NVUB 1HKTA 4XRMA 2C5BA 3B4NA 1K7AA 4IQJA 2X48A 3ASPA 2GXGA 3JRFA 2FQ4A 1AWCA 1SAXA 3H5RA 1RQRA 3RPUD 4RDKA 1XGSA 1QHHD 1JKOC 4S04A 2PMDA 4LG0B 2FOKA 4M9ZA 3CCSB 1V3FA 1NJID 1QCXA 1XCBA 4IHWA 2B5OA 2NVYJ 2PFBA 1K4SA 2VFPA 3KP3A 2RC6A 2KQRA 1IW7F 2HNHA 4CSWA 4E7HA 4I0AA 1YX3A 2RV8A 3CCJB 3GX4X 1G59A 1TNSA 1IG7A 2VFOA 3K4BA 3P27A 3ZGKA 2DI3A 2DMPA 1T6ZA 1E79A 5J1YA 3X2QH 2H94A 2IS2A 5KCMA 3BG6A 2E1BA 2IJLA 3GZNB 2KIFA 3EUHC 3RDIA 2FF4A 3NAUA 1R5BA 5IYCJ 3V7AA 1JHFA 1O7FA 4Y9RA 2DA4A 1SMTA 1W4MA 2M0MA 2LD5A 4LBVA 4YFOA 1RI7A 1J7KA 1MJAA 4XSZF 3F8CA 3BCBA 5AMVA 1VQ4B 1R6RA 3V4GA 1KU3A 4XLNF 3OJWA 5LGNA 3IRQA 2CF4A 3F6VA 2OTLI 3IRRA 4F7DA 2QSGX 1F9NA 1XX5A 3RYPA 1D8TA 4HV6A 2CW8A 3RQ4A 5FJ8J 2GK7A 1UB9A 4RDUA 3MVPA 3E5XA 4HPQA 3OE7A 2IW5A 5D4RA 2MSYA 3WTUC 1WI9A 3MAJA 4ZC3A 1SD6A 3HL2A 4MXNA 4Y7NJ 2LH9A 4BXXJ 2JWTA 1IN4A 2MG4A 3C2GA 3J80K 1A6QA 4UXNA 3AKZA 1IO2A 1IJEA 1ZLKA 1WJAA 1B4AA 4ZDPA 3ZPLA 1FNCA 1I50J 3CDLA 1Z3YA 5JLXA 3I55I 1HXDA 3O8GA 4HV5A 1S3JA 4MLOA 2CGPA 2Y9YA 1VHOA 4YEIA 2FBHA 1GXQA 3CJQB 3FM3A 3HHGA 1IJFA 4ZV4A 3BROA 1HW5A 3H9GA 1V5FA 1D3YA 1WQ2A 5ICCA 2HDDA 2X51A 2EFOA 4HNUA 2VODA 4ZH4F 2Z6BD 2VBXA 4TMWA 1XSXA 3K69A 4NNJA 3ASQA 3DTKA 2LLKA 3LMMA 2Q8KA 2M9HA 2ETHA 4QTRA 3I64A 5D5UB 2PJRA 1VBLA 3T9GA 4AF6A 2IS1A 3G1MA 2Z3YA 2UXNA 4G12A 1I27A 4HDUA 5FD6A 4RB1A 1X1DA 3HB9A 1R5NA 1HDDC 1MBFA 3OYHA 2QWWA 2NV4A 4L9VA 4Z4WA 1O8GA 1T8IA 3W2VA 2W85A 4II2A 2R3SA 4HA8A 1FOYA 1OCRH 3G2BA 2JA7J 3WNCA 1QPMA 2QA4I 3OMYA 3OY9A 1YRNA 1Y6IA 5DUIA 1MSEC 3HDDA 1FC3A 2MC3A 1AIRA 3U2QA 1IC8A 2ZCWA 3FXUA 1WU8A 1K8FA 1X19A 4B4CA 2XAFA 1L1IA 3BY2A 3EPZA 4LIUA 4A6DA 1R1VA 4DNCA 4RS8A 3G4SB 1RKTA 2LVSA 4YAOA 2DMNA 2K3PA 2F6CA 3RPQA 2QMUA 1VQ9B 3QQAA 1K83J 2NOJB 1KYWA 1YQAA 4B44A 1TLHB 4MGRA 1JB9A 1BPLA 2HR3A 3HOUJ 4HNTA 2JJ2A 4Z4RA 2CNDA 2HMAA 1H42A 1F5TA 3TL4X 3KE2A 3GLLA 1B8IB 5DEQA 4ASNA 2RN7A 4MQ9F 4X0GA 2DJNA 4A12A 1ZUNB 3K4MA 1BHEA 4A2UA 2LR8A 3GTQJ 5ERIA 4Z2YA 2X6XA 2HCJB 4HBLA 3LSHA 4RA2A 1W5SA 5DTDA 4CCLA 1FP2A 4ZCMA 4FWTA 2YUHA 3CCJI 3JSPA 1XGMA 4CQJA 4C0SA 3K2ZA 1D5YA 2VOPA 4NUBA 3GVAA 1D1NA 3VSVA 3IAM2 3L2CA 3A3GA 2VBKA 4MO7A 2VASA 4AIDA 2M87A 3PNTA 1RMGA 2V6EA 3ZQHA 1JUMA 2VBZA 5CJ9A 5FLVA 1VQKB 2HVQA 1TQMA 2CV0A 4Z4YA 4IRGA 5ICFA 1CQTA 2ZXHA 1FRNA 1G7RA 4Z4TA 4XLPF 4P2NA 4PGOA 2JSCA 3Q39A 3BR6A 3J7AO 4OP7A 2DCEA 5JR3A 4TMXA 2GOXB 4PK4A 2Y2ZA 1IRGA 3CLQA 4WF2A 3BJOA 2PN6A 4UV8A 2M3AA 2NT6A 2IAIA 2TDXA 4YZXA 2X9DA 5KHDA 2D1HA 3DDYA 3OL3A 1YITI 3HPHA 2QENA 5M5YJ 1RR8C 2WB1A 1N0UA 2EZHA 1ETYA 2J5OA 1QFYA 2XT2A 2OK8A 3U6BA 5HOOA 3BC8A 3H09A 1IB0A 1WHUA 1POGA 1Z7UA 5D6EA 5EF6A 2QBYB 1UHMA 2OK7A 3UNGC 5K5OA 3OJXA 1R36A 3IWFA 3LSJA 1GXPA 4M53A 4B3XA 3WHBA 3A01A 2F5DA 2K4BA 1N75A 1LPQA 3H5AA 4XONA 3ZQCA 3L9FA 2JN9A 2DFHA 3JRAA 1O8HA 2XAHA 2DU9A 4GRIA 4N0BA 1FPQA 1PE9A 5KK1A 2BM1A 1MJBA 3ML6A 2A61A 1YJNB 1V5VA 2BPOA 5BPDA 1Y56A 2R7VA 3ASTA 2O17A 4PGGA 1Y8QB 1OQYA 4X7CA 4L5JA 2R7FA 3FJOA 5BS6A 3QPHA 3WYAA 4A0YA 1N08A 1H88C 1OB2A 2PBIA 4HAMA 4AYBN 1MRZA 3MMYB 4XLAA 2EFWA 3PA2A 3MZ8A 1XB4A 5JLVC 1CF7A 5TR9A 5E17F 2V7UA 2I8DA 5CKTA 4M74A 1P92A 1WJDA 4WXHA 3TP3A 1HLVA 4NB5A 1MBKA 1OYWA 4LB5A 5J8FA 2YX4A 1R7JA 1HDPA 2LREA 3W2GA 1I3AA 1OFEA 1WJFA 3RJPA 1B2RA 4M3EA 1FNMA 5L3GA 1I39A 2Q2EA 2ISYA 1JXSA 1F60A 5CDFA 3P4GA 5H6RA 3T1BA 4BHPA 1ZM3A 4MHGA 1T6XA 1MMAA 2BEOA 1W7PD 5IYWA 3R6SA 2EV0A 3BOQA 2HGCA 4IF4A 2BVMA 2QQAA 3ZPPA 4JK1X 1Y0UA 1BOAA 2ZNZA 2OBSA 2QGUA 1DP7P 1NG6A 1H9GA 1OFCX 2EILH 2M8EA 2OUMA 4PSWA 3OYBA 2BV3A 3D26A 3JQRA 4G5GA 1EKEA 2LY2A 3CB4A 3QSYA 1CNFA 2A6HF 1ETOA 3V42A 2NZMA 3KP5A 3NE5B 1KGSA 2ZSIB 3ISPA 2QKMB 3CCQB 5J40A 4G1VA 2K02A 2F1MA 4P6YA 3J80Z 3IWZA 3FXRA 4XR6A 3H9NA 4P3IA 1LEBA 5A88A 3H0DA 2NTBA 2VFQA 3V76A 4UUSA 4C2TA 2DT6A 4BNCA 2TCTA 3E6MA 2CFXA 2D1VA 3SQNA 3HOWJ 4PUSA 1W2BB 1V54H 3S3OA 1D1CA 2EA4A 3W3CA 1QBJA 2ZBVA 1XD7A 1T98A 4P9SA 1XSVA 4LOCA 5F0CA 2X6WA 4MEXF 1VFCA 3A35A 3CO7C 2JVHA 3ONQA 2HXIA 1GVJA 2ID6A 3QP5A 3R0AA 3ONYA 3H9QA 3OYMA 4M71A 3L2RA 5A89A 2OTJI 1GO2A 4RLQA 2LC2A 4UUVA 2A68F 3BR3A 3R6KA 4GDFA 2V6CA 2RAEA 2QA4B 1O8JA 2L7KA 3W2HA 3K6GA 2DA6A 1O7LA 1CZFA 2PX9A 2BM6A 3FWEA 2QDXA 2M45A 4F7ZA 1ZR4A 1QUFA 1V55H 3L2VA 5ILVA 3KP7A 4K2EA 1I5ZA 1SMYF 2O0YA 1U9NA 5C4XJ 1XN7A 3N90A 2DQRA 3U1KA 2K9NA 4EGYA 4RM3A 1SFOJ 3OP1A 3KP6A 2F4IA 2WBMA 2HU9A 2VN2A 2Z1DA 5FNZA 5HODA 3BTIA 1H85A 4YAUA 2ZL6A 2FSWA 4IOAF 1FYKA 4U4BA 3HRUA 4AVPA 3Q0UA 4M4SA 4UUSB 3CJNA 3KEQA 3Q3SA 4KNYA 1HA3A 4CCOA 2VFMA 2RDPA 1K79A 4W8SA 3BTCA 4GGGA 4PC3A 5FKNA 4JRAC 4M2LA 4RD6A 3P26A 4Z05A 1QRCA 2Z33A 4Z4VA 1XTAA 2PYHA 1VQ7B 3SEJA 1BN8A 1WSVA 1P7IA 2PMHA 5D6FA 4BJTA 2C4UA 3A02A 2ADUA 3FXMA 3DFGA 4G6DA 3W2WA 4FETA 5FO5A 3ABUA 1I18A 4P3YA 5F6FA 3HRMA 3JRGA 2O8XA 1KD1D 1SKYB 1ZM4A 2IGMA 4HSTA 2IA2A 2NVXJ 3FK6A 4YZQA 2XB0X 4U0WA 4F55A 1PUFA 4XLHA 2JQ7A 1TW3A 1Z3XA 3ZUGA 2QYOA 5FKLA 3G1LA 1T2KA 2W6IA 2EFGA 5AIQA 1VF9A 1E1QA 3WTZA 4XLCA 1OGMX 4HF2A 2JA2A 2M4KA 4QWQA 4BEHA 1YI2I 5IYQA 2KJCA 5DYMA 1R22A 3SJZA 1YITB 2JJ7A 2DA1A 4KDPA 2VL8A 4YFNF 2UXXA 3AG4H 2M1BA 2PIAA 4KKUA 1WMRA 5FO0A 1AA7A 2CUJA 2M7AA 2JJ1A 1LLZA 3NAWA 2XAQA 1SFUA 2GLOA 3CCMB 1CNEA 1J9ZA 1IUYA 1DGRM 2X4HA 1UFMA 2R5YB 1YLFA 2W24A 1OMIA 1P9QC 2EH3A 3JRHA 2Q6LA 1VQMB 3JRCA 5CVVA 1E3PA 1L3LA 3VMFA 5LRSA 4J0QA 1OGOX 1WGXA 3TKYA 1BIBA 1E43A 2L2OA 1UD5A 1BMFA 4IHSA 2M34A 2M5WA 2HYJA 3JR9A 4IVNA 2O6GE 4CHUA 2C4TA 2MGQA 2MD0A 1A5JA 3HBLA 1J59A 3DWLE 5EGOA 1X3WB 2DK8A 2ID3A 2GJPA 1JTAA 1TYXA 3KZZA 2CMPA 3H35A 4R71A 3RIQA 2YS9A 1BX0A 1M90D 4XKBA 3GIRA 4OPSA 3DLLF 4G6TB 4EJUA 2GJKA 3AAFA 5E8IA 1OYYA 4Y15A 4ZYGA 2ECBA 2KPMA 4RGUA 3ZR8X 1QPIA 1SM4A 2VBUA 4W97A 1UD6A 1FBQA 3BPVA 4II3A 1VQLI 4Z06A 3COAC 2F5EA 3M9AA 1W36D 2XGEA 1PJ5A 3VR6A 1CLWA 3S1NJ 1P6RA 1BW6A 2R7SA 2V7QA 2LKSA 3G6EI 3S1QJ 1BA5A 2V79A 4UVBA 3O2PE 3N05A 3ZZUA 3TH0A 1X4OA 2YU9J 4OM9A 4P55A 4N9IA 2CWEA 2LOOA 2ICWG 1WOPA 2NSTA 1P2FA 4FHTA 1MDMB 3T53B 1LDDA 4D5CA 2C5HA 4WWVA 1IXRC 2N8GA 3FMRA 3M4OJ 5LMZA 3J81k 2WB1N 3PL8A 4HQMA 1MMSA 3ASSA 1MJ9A 4M0LA 3ZSCA 3CPXA 3LAJA 2XAJA 4IQ4A 3T5XA 5GV7A 5IOYA 5HS8A 4KT6A 1PVEA 3EQOA 3C2BA 4IPAA 2WA0A 2DXIA 5CVJA 2BY2A 1ZG1A 1C0WA 3WBKA 3JURA 3K10A 4IX7A 3GTLJ 3L2WA 4V2GA 1O8LA 2LY1A 2P6TA 3CCVI 4RJLA 3I56B 2K27A 1EE6A 2XZOA 4YAWA 2PYGA 1UG0A 2IEKA 5JBQA 4DYCA 4OJ6A 1IXCA 2WAEA 5E79C 1KU2A 3SJMA 5LD2C 2XZLA 4RGRA 3SDGA 3H3VK 4XORA 1PYVA 1U5TB 2CH0A 1YTYA 3QOPA 4A0XA 1VQ5B 1AKHA 4E7SA 2C78A 4QSHA 3KP2A 5FROA 1KK2A 1OB5A 4CH7A 3TO6A 2Z9OA 1B72A 4RGSA 1F1ZA 3VPRA 3F9KA 3K4CA 1YE9A 4IL6C 4A3CJ 3B8HA 2W1OA 4I01A 4Z03A 5E20A 3FXKA 4CZCA 2IQ7A 1MH4A 2QTLA 4G8XA 1U2RA 2DCUA 1J9IA 1U8RA 1FYLA 2YWEA 1X3ZB 1R00A 4C2MJ 5F4JA 3VNVA 1OYIA 1GLNA 2L4AA 3Q9VA 4OAYA 2JSPA 2OZ6A 4MTDA 3RI4A 1Q7YD 1BR4A 1DDNA 2IBDA 4UAJA 1XGOA 2G0YA 3GCMA 3FHZA 5DD8A 5M5XJ 1X1CA 2E36A 4B48A 2O7OA 5CPRB 2HDWA 2VC1A 2BM0A 3AVWA 2BM4A 3ZP5A 1IUFA 2XASA 4AM3A 4BQQA 1OR7C 3W2FA 3NWTA 3JSOA 1RQPA 4YXWA 3F21A 1F43A 3KZIC 5IP7J 1RPWA 4ZGQB 2UUZA 3CMAI 2DJIA 2JUCA 5E1WA 4PC2A 1TWFJ 3AG3H 3LYCA 1M1KD 3BR5A 5HLGA 2ZBKA 4HX8A 1XG2A 2KRHA 3CDHA 4N3GA 1N77A 4LG0A 1HCRA 2EIMH 1XQBA 2DMUA 3J7YJ 3Q3AA 4ZYDA 2ISZA 1YIOA 1N05A 3G1OA 2VBMA 3BWGA 2GOMA 1ZHFA 1FX0A 1L0OC 4CCJA 3S2HJ 3LL7A 3S93A 1OB0A 2EZKA 1TZLA 3ZXSA 1BLIA 5HXBA 1VF7A 5IYPA 4YIFA 4ON0A 4B47A 2L9RA 2DW4A 1ITYA 1VQPB 5J47A 3ONUA 1UCRA 3ERED 4A0ZA 2EZLA 1Y1WJ 4DYQA 1RUNA 3TDUC 4NDLA 2XGXA 4U87A 5JHFA 5FLXZ 2O8KA 4IHXA 4WXCA 1VTNC 3ZN1A 2ZTGA 3LSRA 4BHBA 4BDYA 4RD2A 4LGWA 1NK2P 2XIGA 1UHSA 1HF0A 1ACIA 3CJRB 2EQRA 4BAYA 4H0EA 2FNAA 3QU3A 4XKCA 4H4KC 3HRTA 3IC7A 4IO9F 4E4HA 2WV1A 2VQHA 1D5VA 2ZMEA 1FSHA 4DW6A 3BJAA 4ITVA 1OGJA 2LRDA 1S0UA 2EA2A 2EWNA 3GFMA 5KAIC 2IXSA 3K0LA 3F72A 4DQ2A 3CCQI 3SYTA 1IDZA 2GK6A 3AVUA 1J5YA 5AN9A 3L00A 4CUGA 3R0JA 3OYDA 1HKSA 2QQ8A 3QP6A 3OIPA 4DZPA 3CLOA 5LLQA 4XNFA 2R9VA 4AC9A 2L9SA 3K1PA 4JMQA 5FO1A 2EBIA 2F43A 3SZGA 3OZVA 1TBXA 5DD4A 3GO5A 1NDHA 4QIWN 2KJBA 2C6YA 4PDKA 4BQNA 4QPOA 5F4MA 5LHIA 2BY0A 2KP6A 3NARA 4Z6YA 2X3HA 3AL0B 2HPIA 4XL9A 2KIUA 1SD7A 2E2JJ 1MABA 3B78A 2CSOA 1OFDA 4TKOB 2XT4A 5L3BA 4IHTA 3LFKA 3WE2A 3MQ0A 2MH9A 1VQ5I 2YX7A 3CP2A 4P5OA 1UD4A 4LC0A 2VT2A 3PVDA 4NC8A 4TV7A 2H6BA 2V1NA 3CUOA 4Z4ZA 3W5HA 1Q1VA 4XMYA 2QXZA 3ZBTA 1R5ID 1G3WA 1GV5A 3GW2A 3LSKA 1JHHA 3TGNA 4ZZDA 4I09A 1HVXA 4WZEA 3MMPA 5J4VA 2IS4A 4IJAA 3F22A 5FGMA 4BBRJ 3CZ6A 2VOOA 3HC7A 3OYNA 1OKRA 1OJLA 3FF5A 4RMNA 1WVRA 2UWMA 4P6VF 5GP9A 5ILSA 5D5XB 4UZEA 3ERMA 4OU0A 3OYEA 4D9JA 1JUPA 1WZ2A 2IOUG 1OCOH 2VNJA 4HEA2 3SXYA 2X1DA 1ORKA 3KPHA 4HG2A 5TISC 2L3DA 1TT5B 5EEAA 2ZJRF 2GZWA 2R5ZB 2O6WA 4XICA 3B8YA 4RCZA 2R7DA 2VJIA 1D1AA 2HXOA 3D1NI 3E1YE 1YO5C 5FKKA 1E2XA 1JGSA 3E97A 2AO9A 1EWYA 2DETA 1TT0A 3BY6A 1OLTA 3H92A 2AXTC 4W8QA 5EZHA 1N25A 1MKMA 2ZNYA 2BW3A 2ZJQF 2LZJA 4EATA 4ETSA 1A6IA 3KYLA 2G0EA 2JVGA 4C3HJ 3OKXA 3OYGA 3WTSC 1SD5A 2CV2A 2FA5A 3EYIA 4Y52J 1LFPA 1IRXA 2R92J 2QEXB 3PQKA 3CCEI 2FU4A 3F8NA 4QLCU 2EPFA 2OF7A 3BCAA 3MZYA 1VHEA 2VNKA 3GVLA 2VLAA 4KKSA 1X1AA 1NBMA 2NVQJ 1D0ZA 5BNGA 4M3FA 3ZQGA 1HSTA 1CGPA 4TSFA 5GAGJ 4JYKA 1K4ZA 3G3ZA 4NC6A 3EYYA 3PSIA 4BE0A 1MBHA 2E5NA 4DOZA 3Q6QA 3FXOA 5AONA 1H9TA 3BJ6A 2V1DA 4W8TA 3ZRGA 4G7HF 3VMWA 3S14J 3EUHA 1T6SA 3A1PA 2O0VA 3JRDA 3CMEB 3C1DA 1YX2A 3QE2A 3R61A 4YFXF 1H8HA 1Y39A 2CW0F 4KITB 4HE6A 1PKVA 2BVLA 1O8MA 1GAWA 1XDSA 2OA4A 4GQNA 5B1AH 2QN6A 3ZMZA 1P4XA 4U7BA 2VE9A 1YJ9B 1HA8A 3LJYA 4A3FJ 1JUSA 2GREA 4B8XA 3TQNA 1BC8C 1IDYA 1JKQC 1FJLA 3PENA 4H9GA 1U9OA 4M1KA 3U6KA 2QYUA 2RKHA 1U8BA 2Q1ZB 3W6KB 1JT0A 4HW0A 5GAEJ 3S17J 1VQMI 3SUCA 3M8EA 2MFZA 3LA7A 1P4MA 4X7EA 2DA2A 5L3FA 2ZJPF 2F2EA 2V4JC 4M73A 3HTSB 1TUIA 5FL7A 3E5QA 3HM5A 3R4KA 1GV2A 2NS0A 3VODA 2FXAA 4AIHA 4EMSA 1JI8A 2KL4A 3BCDA 2HLDA 1QA3A 3VSUA 3MWMA 1W0TA 3BH4A 2JA8J 3SFIA 1R9TJ 3ZMTA 2CG4A 1Q9SA 2B0LA 4BJ6C 2WJVA 2O3FA 5BQTA 5F1JA 2W7NA 4B3GA 2C2WA 3PIPF 4XOPA 1RR7A 2BOLA 4ENKA 4KJZA 1LE8A 2V1UA 4Y7CA 1ZM2A 2P6SA 5IT3A 4MEYF 1E0EA 2F4OB 3LQQA 2VJJA 1IN8A 1WCMJ 1FZPB 1KU7A 1WXRA 2FMLA 4WQMA 2ZMEC 2ZXIA 2VPRA 1VQ7I 1BJKA 4IHVA 5B66C 2PLYA 4PGHA 2ME6A 3N4MA 2K9LA 3DPTA 2VB6A 4KA4A 2X3UA 4I99C 4LBWA 4Y13A 3DEEA 4OPOA 2CJJA 2RNJA 2RNGA 3S2DJ 2J5PA 1D2EA 4YIIA 4OJPA 2ZC2A 3NRVA 2ZSHB 3JRIA 4FQGA 1K4TA 2VKEA 1BW5A 4KUMA 2LY9A 2R7WA 3K70D 4ACAA 1Q82D 5F4OA 1QUEA 2OCCH 2K9MA 3BNWA 3B6CA 3RCOA 2XNCA 4ASUA 5M5WJ 4IXAA 5E3NA 3RKQA 4C43A 1RKWA 4W1UA 1W36C 1EV7A 3BR0A 3CD6B 1H8EA 1ZN2A 2INUA 2W7ZA 3M8JA 4P22A 1X2NA 4LIVA 1ZR2A 3OEEA 4URRA 1EH8A 2OZUA 2VKVA 3L2UA 1KC8D 3CPWB 3ZQFA 4TT3A 1IDKA 2DBBA 3ZQLA 1R49A 2BN4A 1XPXA 2VC0A 4X06A 4TN1A 3ZBUA 2K7LA 5H5JA 2I10A 1DG1G 1T33A 4LLNA 2ZFUA 2KMUA 2ZO4A 1QGYA 4PABA 3I53A 2XDVA 4S05A 2CW5A 1OR7A 3HEFA 4WX9A 1EP2B 5IYDJ 1KK0A 2BMWA 4L8JA 3BG9A 1PP8F 4EH1A 3EQNA 5L3EA 4BACA 1I3QJ 2JIZA 3FM5A 2GXBA 3VNUA 5H20A 3CCUI 4BGDA 4HF1A 1OCZH 1O57A 2B7EA 2KIMA 2D2WA 3BPXA 2XZPA 1VQNB 1LVAA 4A3EJ 4KIGA 1X2MA 2LF7A 4ZTFA 3I1FA 1J2XA 3FK7A 4L9NA 2HZTA 5K5QA 2BHYA 1QRYA 2WY7Q 4ROXA 2VKDA 4NC7A 4BS9A 1YRNB 3QFRA 1O3TA 4DBRA 2EINH 5B3SH 1W1WE 1V5GA 5JHUA 1RRJA 1I6HJ 3I3LA 1IV6A 3PFYA 4LMYA 2OYNA 2QSFX 2XV4S 2K9SA 3BQYA 3IL2A 3IKTA 5BSXA 4MYTA 2MLKA 4RDJA 1YOVB 5HLTA 1W5TA 4NK8A 5J3OA 4XM3A 1MMNA 3ESWB 2V31A 2YWHA 3LO8A 2DOGA 3G71B 2GAUA 3M8FA 2CW7A 5BMZA 2Q6IA 3GF2A 3SDBA 2CBXA 3CO6C 2ZITA 4I0BA 2VQCA 3UR3C 2LTPA 3L09A 2O9LA 1VQKI 5J3LA 2KRCA 2LBFA 2JDIA 3GZ5A 3B73A 4E7KA 4ANJA 3KX2A 3V7RA 5JI6A 4ESJA 3DPUA 2QSHX 4FN5A 1MZBA 2WWYA 3WU2C 3OL4A 1LUJB 3K9TA 1FX7A 3LSGA 2WPDA 4FX0A 3EUAA 2Y30A 2R7OA 3FBNB 3GTOJ 1B9NA 2DOFA 1Q81D 2VJ4A 1E64A 2CO5A 3J81K 2VBSA 1DGWY 2VQLA 2R7QA 2JTVA 2V7TA 2FEZA 1EP1B 3PUBA 1TTTA 4YAFA 2A3SA 2HOSA 4E6KG 1JE8A 1U2WA 2M7BA 3HAGA 5EGOB 1S72I 2OBRA 3P5JA 5TV2A 3OYLA 3ABTA 4E7JA 1O88A 3E1SA 4M6XA 3BDDA 3B82A 1R5OA 4X1EA 1EXMA 1WDTA 4B3AA 2NT9A 5K7ZA 1G6NA 2Y9ZA 1RIOH 3ZIAA 1DABA 2OAZA 1LNWA 3TOAA 3H36A 4LD5A 3LSPA 3CF5F 3HKZN 3S15J 1IGNA 3BT9A 4A3MJ 3ASRA 1ZRFA 4XN0A 3VYTB 3LQ6A 3VWBA 1JKRC 5DNSA 1I1GA 2M2EA 5HNFA 5CQGA 3A8KA 1LFBA 4KYWA 1UG2A 1WWXA 3TO7A 5H2FC 4P26A 1XGNA 3A0BC 1GVHA 1G3TA 3WODF 1TWGJ 1WSUA 1AOYA 2M0CA 2XRNA 2L01A 4C2UA 5AIPA 3HGYA 1MGTA 4JX6A 3GFLA 3NB2A 3ML3A 3ZQIA 3QFSA 2V4DA 2VBTA 3F0CA 3FXQA 4HIZA 1J75A 2E1MC 1ON2A 4B1RA 3IH4A 2CQQA 3ZMDA 2UVFA 2VBEA 1FTTA 4YZ0A 4R8HA 5EJCA 1AKHB 2BM5A 3AL0C 3S8PA 5IY5H 3DV8A 4XKVA 1WP6A 1E17A 2XOKA 3TDZC 2J8KA 4PC6A 3AVYA 3PSFA 1E3ZA 2F4MB 3SEQA 2WAQN 1IAWA 3I55B 3OS0A 3VYUB 4RB2C 3W2AA 5IK2A 2IS6A 1TYVA 4LB6B 1K9MD 1QVUA 3SZPA 5LEKA 5DM6F 4EQQA 4MNUA 3HUGA 2P5KA 3QYEA 4N9HA 1SAUA 3P9IA 1Z9CA 4F91B 4MYUA 3W5UA 3SYJA 2JUGA 2EJRA 2XAUA 1NHAA 4IRHA 5KNLA 2ESHA 2X53S 2MBFA 3AVTA 1M1EB 1NHCA 3VO1A 1UMKA 4OZZA 2WTEA 3O8HA 2FMYA 2HPMA 5A2QK 1YS7A 3H5NA 2NS8A 3M07A 3CP8A 3T8RA 5J8CA 1W87A 3E20A 2NPFA 4RDLA 4P25A 1HZEA 4UZFA 3V7SA 2LMDA 4WWCA 2R7ZJ 1HBXG 4M9SA 2ELHA 2XNJA 2PJPA 2XKOA 1LJ9A 3WXMA 2BV6A 2HTSA 4RGXA 1G2HA 2V7WA 3GXOA 2VNIA 2IGOA 1RETA 5D8LB 4CICA 3OYAA 3S3MA 2XF6A 3RZOJ 3M7GA 1QA1A 1ZYRF 3ISXA 3JU4A 4BPRA 4EM1A 1VNDA 2H27A 1TSPA 1T6YA 1FBSA 2OBPA 1SVOA 2EIJH 1W5CC 4Y17A 4G7ZF 2NRAC 4M6YA 3GTMJ 1R58A 1QX4A 1KCCA 2VXZA 5ICGA 2HDNB 3BCFA 3H3UA 4KH3A 1IJWC 1P4AA 3CF2A 3DBHB 3KYDB 1ZG5A 4BY1J 1WORA 3AGPA 2X1CA 3PSZA 3SY2A 4OOIA 4L5EA 4AWXB 4M3BA 2X85A 4A3IJ 5IT9Z 1DBGA 1KQ8A 2E34A 2VBWA 3L2QA 1XFOA 2QKLB 1FOXA 2HOEA 1W7PA 1K78A 3L7WA 4Z4UA 3KEWA
chains in the Genus database with same CATH topology
2KRHA 1OHHA 4UZUA 1N77A 2CW8A 3RQ4A 4DNRB 2GK7A 4CCMA 4E0FA 2VBMA 2GOMA 1FX0A 4CCJA 3LL7A 3BC9A 3S93A 3MKWB 3QOEA 4HPQA 3D5SC 1OB0A 3OE7A 3VMVA 1TZLA 2MABA 4ZC3A 4Y3OA 3ZXSA 3HL2A 3FPPA 4MXNA 1BLIA 2LH9A 2ZZQA 3WWGA 3DQVC 1VF7A 2O5RA 3C2GA 4B47A 3AKZA 2RQQA 1WJAA 4XLEA 1T0FC 2X8KA 2VKHA 4ZDPA 2CUZA 1Z3YA 4U87A 5JHFA 4MLOA 2VQGA 1KZLA 3LMWA 3CJQB 1KCDA 2ZTGA 3H9GA 3H9JA 1V5FA 4ZYAA 3FHNA 4BDYA 1O8EA 2X51A 3B90A 4HNUA 2R4GA 1E3XA 3CJRB 2Z6BD 5C1EA 4J01A 4JOMA 3DPLC 4XKCA 4NNJA 3OEHA 4H4KC 3GQ9A 3DTKA 3LMMA 3QODA 3T9GA 1VBLA 2PJRA 3OR1C 4CA0A 4E4HA 2VQHA 2IS1A 3ZPNA 1PLUA 1WJEA 2QE7A 1X1DA 4ITVA 2LRDA 1VJSA 4B3FX 2AQEA 2IXSA 3OYHA 2GK6A 3SYTA 3T56B 1V5EA 3GBGA 3W2VA 1O8GA 4II2A 3GRHA 4DK0A 3VSTA 1Z7LA 3G2BA 4CUGA 3OYDA 3E0JB 1K6YA 3OMYA 4CCNA 3OIPA 3OY9A 1Y6IA 4XNFA 1W0KA 1AIRA 2R9VA 1WPCA 2L9SA 1MW7A 2V9KA 4JMQA 3OYCA 2F43A 3SZGA 2E1MB 2O1DA 1MNEA 1X19A 4PMHA 3MKZA 4LITA 4BQNA 2AQFA 4QPOA 5FRNA 3FKJA 3EPZA 4LIUA 2KP6A 1LVKA 2X3HA 3AL0B 2HPIA 1MNDA 4XL9A 1O8KA 1JRGA 2K3PA 4B43A 2F6CA 1MABA 3IUOA 3D5RC 1V0EA 4TKOB 2NOJB 1O8FA 3PNYA 3MD2A 4B44A 3CP2A 1T5EA 4P5OA 1UD4A 1BOBA 1BPLA 4NC8A 2V1NA 2XNDA 4PFOA 4HNTA 4XMYA 2JJ2A 2QXZA 3GQBA 3LSKA 1HVXA 5LFAA 3TL4X 1O8IA 4X0GA 2IS4A 2D3NA 2QY1A 3ZCOA 3CZ6A 3K4MA 3OIQA 3HC7A 3OYNA 2WAQA 1BHEA 1RU4A 5C1CA 4RMNA 2UWMA 4PJMA 3GVJA 2X6XA 4XQFA 3LSHA 3OYEA 4D9JA 4ZDOA 2DT7B 2DIEA 4CCLA 2Q2EB 4HEA2 2X1DA 4HG2A 2WSSA 2MC4A 4NUBA 3B8YA 2VJIA 4XOTA 1D1AA 3VSVA 3IAM2 2VBKA 3A3GA 2VASA 3PNTA 3OS2A 2V6EA 4Z1MA 1RMGA 1TT0A 2Z16A 2Y0SA 1OLTA 3CESA 3OYFA 3J7AY 1I8DA 2HVQA 2CV0A 1S9HA 4W8QA 2L5QA 2ZXHA 2BW3A 4XD7A 2LZJA 4EATA 2W00A 2XGJA 3KYLA 3A2KA 2DCEA 2JVGA 2IGNA 2VXDA 2GOXB 4PK4A 4PFPA 1NRKA 3OYGA 3K4KA 2LG4A 1VLYA 1WTHD 2CV2A 1LFPA 1IRXA 2M3AA 1GQ8A 2NT6A 1QJVA 4F93B 3BCAA 4YZXA 5KHDA 4KKSA 4ZDLA 3GVLA 2VJ5A 2VLAA 1X1AA 1NBMA 3OL3A 1D0ZA 3DDYA 3HPHA 3GVKA 1KONA 2WAFA 4TSFA 2WB1A 2ZZEA 3PSIA 4BE0A 2E5NA 4DOZA 3M1CA 4G7XA 5HOOA 2R7UA 3BC8A 1MMDA 2WJYA 1N78A 4W8TA 3ZRGA 3PNVA 3VMWA 3UNGC 4MR0A 2O0VA 4B3XA 1N75A 1H8HA 3H5AA 4XONA 1IB4A 4R79A 1O8HA 4XN3A 2DOAA 4KITB 4GRIA 3OR2C 2BVLA 1PKVA 2CFOA 1O8MA 4NK6A 3MKYB 4GQNA 1X4PA 4E7ZA 1PE9A 4DIQA 3OW7A 4IKFA 4U7BA 1HA8A 4E7LA 2ZZGA 1Y56A 2R7VA 1H80A 2O17A 3HPGA 2Q1ZB 3H94A 3SUCA 2MFZA 2P0WA 3DTIA 4C30A 2R7XA 2V4JC 5FL7A 2EWEA 4OAZA 5TGTA 1JI8A 3VSKA 2KL4A 4BU2A 3BCDA 4BDZA 2HLDA 3VSUA 1QU3A 3BH4A 3MMYB 2A5WA 4XLAA 3T51B 4ZTJA 2GJRA 3DLAA 4BJ6C 2FUG2 2VPLA 2WJVA 2W7NA 4B3GA 2I8DA 5CKTA 1EA3A 4XOPA 2KHMA 2BOLA 3OWTA 1WJDA 4KJZA 3QYFA 3S32A 4HWVA 2KVOA 4F92B 2HVSA 4KKTA 2IGKA 4HSRA 2LREA 3VDXA 3ZQQA 1E0EA 2VJJA 1G8XA 1WJFA 3K4NA 4XLFA 2ZXIA 1X0CA 3UW0A 4DGWB 5CDFA 2CS3A 1LDKB 1MMAA 4BUPA 2WY8Q 2PMZA 4N4NB 2BVMA 2K9LA 2KZVA 3DPTA 3EUKL 4G7WA 3ZPPA 2VB6A 2VIXA 4E7IA 4DNTB 1HG8A 3DEEA 1NG6A 2OUMA 4PSWA 2RNGA 3OYBA 3PJRA 2BW3B 4OJPA 2LY2A 2ZSHB 3OYIA 2BSPA 3VYRB 3V42A 2NZMA 3NE5B 2ZSIB 2QKMB 2XF5A 2R7WA 3K70D 1KMHA 4W8RA 5FRMA 2F1MA 4Y4RA 4XR6A 2K9MA 4ZJZA 3RCOA 3H0DA 2NTBA 4C9YA 2M5SA 4ASUA 4C2TA 3FDYA 2DT6A 1DBOA 2NTQA 3IP4B 1W36C 2PECA 4PUSA 2INUA 1H8EA 2W4SA 3S3OA 1D1CA 3KEWA 4XKWA 3W3CA 3M8JA 4P22A 1D1BA 4LIVA 3OEEA 3HG9A 4U49A 4URRA 3L2UA 4I84A 2X6WA 2HVRA 2X6YA 5CQEA 4TT3A 1IDKA 3A35A 3DU5A 2CK3A 2JVHA 3ONQA 3H9QA 1WJCA 2RREA 3OYMA 1NG7A 2KMUA 2ZFUA 4AYBA 3L2RA 4RLQA 1T95A 2XDVA 4JQFA 2LC2A 4L8JA 3A4CA 3EQNA 1WJ5A 3A3BA 3DTEA 4BACA 2JIZA 2KLOA 1V0FA 4BGDA 2L7KA 1O8JA 4YEJA 2XZPA 1BR1A 3K6GA 4FASD 1CZFA 1SFKA 4ZTFA 4AU7A 3L2VA 1X1BA 2WY7Q 4NQWB 4PJLA 4DBQA 4BE2A 3U21A 2VKDA 4NC7A 4BS9A 3C2HA 4RM3A 2M4GA 4DBRA 3HOTA 2NTPA 2F4IA 2WBMA 2HU9A 2LYCA 2Z1DA 1V5GA 5HNHA 3I3LA 2W82A 3PFYA 4U4BA 1BR2A 3HKZA 2F5VA 1UD2A 3GQAA 4CCOA 4BQOA 5HLTA 4W8SA 3K4JA 4NK8A 2HZDA 4XM3A 1MMNA 2V31A 4Z05A 2A6TA 4AVZA 2PYHA 2CW7A 2XSJC 1BN8A 3SDBA 4BJTA 3OAAA 1FMVA 2VQCA 3K4LA 3UR3C 1U0JA 4DK1A 3W2WA 4FETA 2PJRB 2KRCA 2LBFA 4KISA 3G05A 2WZPP 1I18A 2QX3A 3LSIA 2JDIA 2O04A 2OV7A 3OOCA 1J09A 4ANJA 4E7KA 1SKYB 3KX2A 2IGMA 4HSTA 1E1RA 3DPUA 1ERDA 4C2LA 4YZQA 4F55A 4XLHA 2K5CA 2CV1A 1Z3XA 1IA5A 3OL4A 3FY3A 2W6IA 1E1QA 4OJ5A 4XLCA 1OGMX 3QYBA 2NSPA 2JA2A 2M4KA 4BEHA 3LSGA 2WPDA 2INVA 3EUAA 1OOCA 2R7OA 3DKYA 3A1YA 3RSNA 2VL8A 4KKUA 3FBNB 3VYSB 1WMRA 2X1EA 4PSXA 1AA7A 2VJ4A 3NWSA 2CUJA 2M7AA 3FBIB 4YELA 2JJ1A 2E60A 3OS1A 1DGWY 2VQLA 2R7QA 2ODLA 4DJAA 1DGRM 3PUBA 4G6IA 3KRGA 4QPQA 4BEHB 1P9QC 4E6KG 3HXLA 2O0WA 2M7BA 3DU6A 3HAGA 1OFMA 3OYLA 1OGOX 4E7JA 1E43A 2L2OA 3E1SA 1UD5A 1BMFA 2OC6A 2D3LA 2Z2SB 1UAAA 1O88A 1PJRA 3CMMA 4IZZA 4LG3A 2NT9A 3ZIAA 2WADA 4J00A 4YZAA 1K5CA 2V26A 3BG7A 1UELB 3IAS2 2MD0A 5HVQC 3DWLE 4F52A 4XN0A 3VYTB 2GJPA 3LNNA 1JTAA 3VWBA 1LKXA 1WJBA 2CMPA 2V7FA 3H35A 2R7TA 5HNFA 5CQGA 2ZZFA 4XKBA 2UVEA 4G6TB 2XC7A 4PJJA 2GJKA 4C2UA 3BLYA 3GQ7A 2KPMA 3FKSA 1DQUA 3ZR8X 3GQ8A 3OYKA 2V4DA 1UD6A 3VSLA 4P1WA 3RTRA 4II3A 2Z8GA 4Z06A 4HIZA 1W36D 3VR6A 2E1MC 5HKKA 4OZYA 3LSMA 2V7QA 2R7SA 2L9NA 1OFLA 2UVFA 2VBEA 1COWA 4YZ0A 1K28D 3AL0C 3S8PA 3N05A 1X4OA 3HUGB 1WP6A 2LOOA 4XKVA 2ZTNA 5DN6A 2NSTA 3HOSA 2XOKA 3T53B 4BL0B 1W0JA 3PSFA 1E3ZA 2XF7A 4OJLA 4RM2A 3PL8A 4F3QA 3SEQA 1YX5A 3ZSCA 3OS0A 1QHGA 2E5ZA 3VYUB 3OYJA 3W2AA 5IK2A 4IQ4A 1O8DA 3TBIA 1IDJA 2IS6A 4BJ5C 3EQOA 4KT6A 4EW9A 4Y33A 1D0XA 2WA0A 2LBFB 2DXIA 3AFHA 3JURA 3K10A 4IX7A 3QYEA 3L2WA 1SAUA 1WFXA 4F91B 1O8LA 2LY1A 1PXZA 3K70C 2JUGA 1VZ0A 3TMOA 2XAUA 5KNLA 3SEZA 1EE6A 2XZOA 2X53S 4CCKA 1W9XA 1UG0A 1EFRA 1RWRA 2PYGA 2UV1A 4OJ6A 4N4OB 3LFUA 2WAEA 4D1QA 5LD2C 1UD3A 1NHCA 4OZZA 2XZLA 3I9V2 2HPMA 3B4NA 2HQAA 3KEYA 4XORA 1PYVA 3H5NA 2CH0A 4IQJA 2R7RA 3CP8A 4E7SA 1D0YA 2ELJA 3H5RA 1ZELA 3RPUD 1HZEA 5FROA 1Z21A 1QHHD 4CH7A 3F9KA 3K4CA 1YE9A 4BE1A 2W1OA 2W6JA 1QCXA 2MYSA 4Z03A 4CZCA 1UD8A 2IQ7A 2IGOA 4RLFA 4BXFA 3S3MA 3OYAA 2XF6A 2KQRA 3D5LA 2HNHA 4CSWA 1FMWA 4E7HA 1GLNA 1DP3A 1YX3A 4OAYA 3JU4A 2JSPA 3OPOA 4FXUA 1G59A 1BR4A 3S3NA 3K4BA 3ZGKA 1KCCA 4OWRB 2VXZA 1E79A 3BCFA 3WQZA 2IS2A 1X1CA 4B48A 5KCMA 3BG6A 3CF2A 4PJNA 5CPRB 2HDWA 2E1BA 1XG2A 4YRVA 2X1CA 3EUHC 3OFNA 4BQQA 1OR7C 4OJOA 3NWTA 2X85A 4YXWA 1DBGA 2M0MA 3DKXA 3L2QA 1MMGA 5AMVA 2QKLB 3BCBA 2UUZA 1R6RA 2DJIA 3OOUA 4HRIA 1KTWA 2KDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U49 A;  4URR A;  4I84 A;  2X6W A;  4XN0 A;  1JTA A;  2X6Y A;  2VBM A;  1IDK A;  1GQ8 A;  2NT6 A;  2UVE A;  1QJV A;  3VMV A;  4YZX A;  4MXN A;  3GQ7 A;  3EQN A;  3GQ8 A;  4XLE A;  1O8J A;  4YEJ A;  2Z8G A;  4Z06 A;  4W8T A;  1CZF A;  3VMW A;  4MR0 A;  2O0V A;  3LMW A;  4OZY A;  1OFL A;  1KCD A;  2UVF A;  2VBE A;  4YZ0 A;  1O8E A;  4XON A;  1IB4 A;  3B90 A;  1O8H A;  4XN3 A;  4NK6 A;  1O8M A;  5C1E A;  2NTP A;  4XKV A;  1PE9 A;  2NST A;  3GQ9 A;  3T9G A;  1VBL A;  4OJL A;  1PLU A;  4U4B A;  1H80 A;  2O17 A;  3ZSC A;  1O8D A;  3SUC A;  1O8G A;  1IDJ A;  3GRH A;  4W8S A;  3EQO A;  4EW9 A;  3VST A;  4NK8 A;  2EWE A;  4XM3 A;  4Z05 A;  4AVZ A;  2PYH A;  3JUR A;  1BN8 A;  3VSU A;  1O8L A;  1PXZ A;  4XNF A;  4XLA A;  1AIR A;  3WWG A;  1EE6 A;  2O1D A;  1RWR A;  2PYG A;  2QX3 A;  4PMH A;  2O04 A;  4OJ6 A;  4XOP A;  1NHC A;  4HWV A;  4OZZ A;  3B4N A;  4XOR A;  2X3H A;  4XL9 A;  1O8K A;  4YZQ A;  1JRG A;  4C2L A;  4XLH A;  2VJJ A;  1IA5 A;  4XLF A;  1O8F A;  3FY3 A;  1X0C A;  3UW0 A;  4OJ5 A;  4XLC A;  1OGM X;  2NSP A;  2INV A;  1OOC A;  4XMY A;  1QCX A;  2QXZ A;  1WMR A;  4Z03 A;  2IQ7 A;  3ZPP A;  1O8I A;  4YEL A;  2QY1 A;  1HG8 A;  2ODL A;  1BHE A;  1RU4 A;  4OJP A;  5C1C A;  2BSP A;  2X6X A;  3KRG A;  1KCC A;  4XQF A;  2NZM A;  2O0W A;  3GQA A;  1OFM A;  4W8R A;  1OGO X;  4XR6 A;  4OJO A;  3B8Y A;  2VJI A;  4XOT A;  1O88 A;  2NTB A;  2X85 A;  2VBK A;  1DBG A;  3VSV A;  1DBO A;  5AMV A;  1RMG A;  2NT9 A;  2NTQ A;  1KTW A;  1K5C A;  2PEC A;  4YZA A;  2INU A;  4W8Q A;  4XKW A;  1XG2 A; 
#chains in the Genus database with same CATH topology
 2GM4 A;  4LBY A;  3BG3 A;  1ZGJ A;  1E62 A;  5ICE A;  4CCM A;  2VE8 A;  1ZGW A;  1YJW B;  2FE3 A;  3W2I A;  4ZYH A;  4E0F A;  3REO A;  1W0U A;  3GTJ J;  3BC9 A;  1MBG A;  3D5S C;  3ECH A;  2DYI A;  1BX1 A;  2M30 A;  1B72 B;  2NNY A;  3HOV J;  3FPP A;  2ZZQ A;  4Q5S F;  1QO0 D;  3GEZ A;  1JJ6 C;  2BSA A;  1ONV A;  1JGG A;  2RQQ A;  2XB5 A;  2C77 A;  4XLE A;  2X8K A;  1T0F C;  2VKH A;  3E6D A;  1I6X A;  4YAL A;  4LJZ F;  2CUZ A;  2IA0 A;  3FX3 A;  1O3S A;  2VQG A;  1VQP I;  4D5F A;  5DM7 F;  4RLZ A;  1KCD A;  4OIR F;  4XSX F;  4ZYA A;  1O8E A;  3FHN A;  3BQZ A;  3HOX J;  4G6Q A;  1NK3 P;  2DN0 A;  2FD5 A;  4LFU A;  3CC2 I;  5KSW B;  3QPL A;  2IVM A;  3VOE A;  3ES9 A;  3W5V A;  5C1E A;  4JOM A;  3DPL C;  3B02 A;  1KQ9 A;  1PUE E;  3GQ9 A;  4RM0 A;  2KIS A;  3EDP A;  3QOD A;  4G9Y A;  4CA0 A;  3I59 A;  5L3C A;  4RAF A;  2V7V A;  3CCS I;  1WJE A;  3PFI A;  2ZB9 A;  4MTE A;  4KMF A;  1VJS A;  2GXA A;  2AQE A;  1FEX A;  4B3F X;  4KN4 X;  3ULQ B;  3T56 B;  3PA1 A;  1V5E A;  3GBG A;  3GRH A;  1ETV A;  4EJT A;  1Z7L A;  3P7N A;  2Y0S N;  3E0J B;  2BM7 A;  1K6Y A;  3ZOB A;  2DTR A;  2E1O A;  1TC3 C;  2NVT J;  1QVG B;  3WWG A;  3FXL A;  4CO8 A;  3W6V A;  5FLM J;  1OGI A;  2O1D A;  1MNE A;  2G9W A;  4G94 A;  4RD0 A;  1Z6R A;  3MKZ A;  5F04 A;  4LIT A;  2VYQ A;  1ZH5 A;  2QVO A;  4EJW A;  2AQF A;  1LVK A;  4A3L J;  2DT5 A;  1K8A D;  3HIF A;  2LKP A;  1E3O C;  1D8K A;  3NQO A;  1YIJ B;  5CVU A;  1JRG A;  4B43 A;  1TWH J;  3IUO A;  4EM2 A;  1FP1 D;  2K9Q A;  1BC7 C;  1MBJ A;  3GYH X;  5TRD A;  2XGC A;  2E1C A;  2GIV A;  1JT6 A;  1BOB A;  2HOA A;  4A3G J;  5EEH A;  2XND A;  2L9V A;  5LHG A;  1F36 A;  4ENN A;  3MHP A;  4YHB A;  3CCU B;  1FTZ A;  3W2E A;  4Q48 A;  1BIA A;  4XK4 A;  2R0Q C;  2D3N A;  2QY1 A;  3JX8 A;  1VQ4 I;  1U3E M;  1DAR A;  2EFP A;  3OIQ A;  3ZMU A;  1XE1 A;  2WAQ A;  2OTL B;  1RU4 A;  5C1C A;  2QQ9 A;  4A5N A;  3OZU A;  4PJM A;  3N97 A;  1U6G A;  4XQF A;  1GHC A;  4ZDO A;  2DT7 B;  2DIE A;  1TL8 A;  1HW2 A;  2QCO A;  2MC4 A;  1KQ0 A;  3QFT A;  2DQL A;  3PUN A;  4XOT A;  2DA5 A;  2QTZ A;  4GYI A;  2J8I A;  4YDT A;  3WU0 A;  3TED A;  5IYN A;  3S1R J;  3MN2 A;  2PMZ N;  1WRJ A;  1ZLJ A;  3OS2 A;  2Y0S A;  3CES A;  4TMZ A;  1TP4 A;  4OPW A;  4X6A J;  1ZKG A;  4B09 A;  3WTV C;  2VZL A;  3F8B A;  3JTG A;  2JN6 A;  3A2K A;  2K85 A;  2IGN A;  2VXD A;  3IKV A;  4MQV A;  1NRK A;  4WZL A;  1HF2 A;  2YSR A;  1QVF B;  3RQI A;  3PET A;  4AD9 A;  2XPW A;  3FIS A;  2FJ1 A;  4HNV A;  3I58 A;  3KZY A;  1GQ8 A;  4F93 B;  1G3S A;  3U2R A;  1MBE A;  3ASO H;  1ETK A;  4ZDL A;  1EJ9 A;  3AG1 H;  4BBS J;  5DDG A;  4BY7 J;  4NCN A;  3S1M J;  3GVK A;  9ANT A;  5LBQ A;  2CU7 A;  3CCE B;  2WAF A;  3MKL A;  5EEG A;  2ZZE A;  1IZ1 A;  1Z1D A;  4Z4S A;  3DP7 A;  5DV5 A;  4AIK A;  1N06 A;  3MCA A;  3MFK A;  2R7U A;  2P7C B;  1SVL A;  1MMD A;  4YFK F;  4OMZ A;  1N78 A;  1MIJ A;  1SFE A;  3PNV A;  5K7F A;  1LE8 B;  2AHQ A;  2K40 A;  4L18 B;  3I71 A;  4XRS G;  5IP9 J;  4A6E A;  3A01 B;  3PO3 J;  4I7H A;  1GDT A;  4L0Z B;  4XN3 A;  2DOA A;  4XRF A;  4NK6 A;  2CFO A;  1KYZ A;  1X4P A;  1Q1H A;  2GWR A;  5EMN A;  5IPA A;  3OW7 A;  3C3W A;  3HZJ A;  1OCC H;  3K1M A;  3SFZ A;  4IKF A;  2DY1 A;  2XC1 A;  3PUM A;  1WPK A;  4E7L A;  2ZZG A;  4JBA A;  4HDV A;  5THX A;  1H80 A;  3HPG A;  2JA6 J;  4QUZ A;  2WC2 A;  3CRZ A;  3H94 A;  5HS7 A;  1S29 A;  4C30 A;  2MH2 A;  3V8J A;  3V8K A;  4QVJ A;  3ZMV A;  2RGV A;  2RQP A;  2LK2 A;  1YHQ I;  2EWE A;  3CTA A;  4PC7 A;  3R60 A;  3OSF A;  1QA2 A;  2P3M A;  1R23 A;  1YW9 A;  2ZL7 A;  1SEU A;  5FD5 A;  2LP0 A;  4ZTJ A;  1VLO A;  1N8R D;  4QVA A;  3O6B B;  5M3F J;  3S32 A;  2KHM A;  3Q5F A;  3QYF A;  3I4P A;  3WTT C;  3QFC A;  3IH2 A;  4GFB A;  1WKM A;  2IGK A;  4HSR A;  3C18 A;  3ZQQ A;  3E6C C;  4EGZ A;  3CCL B;  4KT5 C;  4O6J A;  3U1D A;  3G71 I;  3K4N A;  4UB8 C;  4XLF A;  1S4M A;  4KMU X;  5IYB J;  3KLN A;  1UST A;  4DGW B;  3UW0 A;  2CS3 A;  1BJZ A;  1B8I A;  2JPB A;  4X8I A;  4BUP A;  5E3L A;  1GUU A;  1TLL A;  2PMZ A;  4HLX A;  4RD3 A;  4ZCI A;  2OJE D;  3CC2 B;  2KZV A;  3MCZ A;  2JA5 J;  4UHT A;  1JNY A;  4G7W A;  1AHD P;  3LA3 A;  2QQB A;  4CYC B;  1NTC A;  4DNT B;  2MW8 A;  1HG8 A;  4EEF G;  1REP C;  1B9M A;  1N07 A;  2R5Y A;  4ZYE A;  1IF1 A;  2BW3 B;  4NBQ A;  1S72 B;  1PDN C;  1PJ7 A;  4CDG A;  1YW7 A;  3OYI A;  1HC8 A;  1QG0 A;  3HSR A;  4IRI A;  2WR8 A;  3VYR B;  2QUF A;  4FCY A;  2PEX A;  1GVD A;  2KKO A;  5F1R A;  1GJR A;  1QFJ A;  4OOV A;  2LDU A;  1VQO B;  4HOB A;  1X3U A;  5FRM A;  4Y4R A;  4G7O F;  1TWC J;  2PLF A;  4X7D A;  2M5S A;  2P7V B;  1W35 A;  3FDY A;  3BP8 A;  3ABK H;  2IA1 A;  2TRT A;  3U9G A;  3WGH A;  5E6T A;  5E1Z B;  1FDR A;  2NTQ A;  2PEC A;  3HSF A;  5F64 A;  2W4S A;  5BPI A;  3KFW X;  4XKW A;  1D1B A;  3HG9 A;  2ACJ A;  3HSE A;  4I84 A;  3G73 A;  1BJA A;  4I2O A;  2X6Y A;  2VBY A;  5CQE A;  1GAQ A;  2PG4 A;  2CK3 A;  2CRV A;  2QZA A;  1SAN A;  2OQR A;  4UV9 A;  4AF7 A;  4AYB A;  2OD5 A;  5J6X A;  4JQF A;  1OIS A;  1VI0 A;  4BXU A;  1FRQ A;  1R4N B;  2KLO A;  4RBO A;  1XSD A;  3BZC A;  5FFX A;  3OOP A;  3DU1 X;  5F27 A;  3JAM Z;  1BR1 A;  4FAS D;  1Q86 D;  3KEO A;  1AU7 A;  1WI3 A;  3DCF A;  1SFK A;  3GTK J;  1PJ6 A;  5FB2 A;  3LA2 A;  4AU7 A;  2HKX A;  1X1B A;  4NQW B;  4A5M A;  4PJL A;  4DBQ A;  4BE2 A;  1FSE A;  1E63 A;  2OU2 A;  3U21 A;  2BGI A;  1QGZ A;  1DUX C;  1EFC A;  3MEX A;  4FTH A;  3C2H A;  1GT0 C;  2M4G A;  2NTP A;  5E3M A;  4U0Y A;  2LYC A;  1G7T A;  3QPT A;  5HNH A;  1H89 C;  1ZGA A;  3BQJ A;  1FY7 A;  1XMX A;  2FBK A;  4UUT A;  5H6Q A;  1BR2 A;  1J0R A;  2NOG A;  3HTU A;  1X1P A;  5D4S A;  5HDK A;  4HQE A;  1BL0 A;  4X05 A;  4UY8 I;  1ETX A;  4BQO A;  3B6A A;  2IPQ X;  2HFH A;  2WZN A;  3CJT B;  3Q9S A;  2HZD A;  3I5U A;  3GFI A;  4PCQ A;  3GME A;  3QPS A;  2ZL5 A;  1KQ5 A;  4AVZ A;  3H0G J;  3E6B A;  2ME0 A;  5TJJ A;  5ILU A;  2J7K A;  3AVV A;  5D8K B;  1FMV A;  2DPD A;  1U0J A;  4CXF A;  4DK1 A;  4HX7 A;  2AHO A;  5JMC B;  4JX5 A;  4S0H B;  2PJR B;  4KIS A;  3ZMS A;  2WZP P;  3QWL A;  4ZZL A;  2HQN A;  2O04 A;  1QNT A;  2OV7 A;  3OOC A;  1J09 A;  1QGA A;  4L0Y B;  4I76 A;  4UVC A;  5C44 J;  1E1R A;  3JCU C;  1ERD A;  4M3D A;  5A8A A;  3L1P A;  1E3H A;  2D9R A;  1YS6 A;  1MNM C;  2CV1 A;  1IA5 A;  2GBY A;  4U7D A;  3CXC B;  1QRB A;  1LQ1 A;  2L54 A;  3JQQ A;  3QYB A;  5HZB A;  2LFB A;  2INV A;  3WNB A;  4P9U A;  1OOC A;  3RSN A;  2FRH A;  5HZA A;  3LST A;  4RAZ A;  1K73 D;  2X1E A;  4IOC F;  3NWS A;  5KVR A;  3FBI B;  3PIO F;  1S5L C;  2G7H A;  3G4S I;  2ODL A;  4DJA A;  4G6I A;  4EV0 A;  3KRG A;  4QPQ A;  4CZZ A;  5CVI A;  3HXL A;  1IRZ A;  3GFJ A;  1OFM A;  1NB9 A;  1VQ8 I;  3RIR A;  2LKX A;  1QZY A;  3FIW A;  4GXO A;  1XG1 A;  2DFE A;  2OC6 A;  5JFR A;  2Z2S B;  3KCC A;  1YJ9 I;  2CYY A;  2LSO A;  2NXN B;  4P9F A;  4DZJ A;  4IZZ A;  4LG3 A;  1IXS B;  1DDI A;  2D5V A;  5DS0 A;  1ODD A;  4CYC A;  2WAD A;  2ZME B;  4YZA A;  4L9T A;  2HTJ A;  1LFU P;  1FNN A;  1ZRE A;  2XEX A;  1QZZ A;  2A69 F;  5HVQ C;  3Q38 A;  3VO2 A;  1YHQ B;  4F52 A;  3RYR A;  4XID A;  3A8I A;  3GTG J;  2V7F A;  3SZE A;  5EG0 B;  2ZZF A;  5TY0 A;  3WGG A;  4WCG A;  3CUQ A;  2JRM A;  2ELK A;  1JA1 A;  2XC7 A;  4PJJ A;  2FOW A;  4TMT A;  2DO7 A;  4GCV A;  3KL9 A;  3ABL H;  3GQ7 A;  5HDG A;  1Y8R B;  2KFD A;  1ZM9 A;  1TTY A;  4EJV A;  3I4M J;  1ELO A;  3SKB A;  3VSL A;  3RTR A;  2W84 A;  2E1R A;  1YJW I;  4CYD A;  3BH7 B;  5HKK A;  4OZY A;  2EIK H;  5E18 F;  4Q7J B;  1ETQ A;  2DYS H;  2QEX I;  4M6V A;  4LK0 F;  1T56 A;  2COM A;  1VQO I;  4EVI A;  3HUG B;  2ZTN A;  5DN6 A;  3QU6 A;  4LLL A;  4M3G A;  1I1S A;  1FT9 A;  2A07 F;  3HOS A;  4TMV A;  4DYR A;  1W0J A;  4FK8 A;  2FX3 A;  2Q0O A;  2P5L C;  4G1B A;  2Q6O A;  3DBL B;  2K86 A;  1XDU A;  2W25 A;  4P1V A;  1TYW A;  4LK1 F;  2FNP A;  4HX4 A;  3EQL F;  2QBY A;  2KZG A;  2E5Z A;  3OYJ A;  1O8D A;  4FT8 A;  3TBI A;  1IDJ A;  1TQP A;  2NS7 A;  4Y33 A;  2BY1 A;  2LBF B;  2DTZ A;  3RZD J;  3AFH A;  3FXJ A;  1PP7 U;  1H0M A;  4EJO A;  4LBZ A;  1EZG A;  1P4W A;  2EIX A;  1PXZ A;  1QQI A;  1I7P A;  2ZBU A;  3TMO A;  1R71 A;  2JRT A;  3DF8 A;  1NH3 A;  1EH6 A;  3CD6 I;  2OPT A;  3F6O A;  3Q6R A;  5HLH A;  4N4O B;  5IT9 K;  3LFU A;  3DKW A;  1UD3 A;  4ESF A;  2XPV A;  2A05 A;  2K3F A;  3SZT A;  1EFT A;  4OIP F;  2HQA A;  3KEY A;  1DU0 A;  2R7R A;  4NHJ A;  5HS9 A;  1D0Y A;  2ELJ A;  3MZH A;  4RCY A;  1ZEL A;  1T38 A;  1Z21 A;  2D74 A;  1KZH A;  3ZZ0 A;  4KIF A;  5JVT A;  1S7O A;  3BR2 A;  3I56 I;  3NEU A;  4BE1 A;  2W6J A;  1DPR A;  2MYS A;  1JTX A;  3WGI A;  1UD8 A;  4RLF A;  4BXF A;  2EB7 A;  4A3B J;  1BBY A;  3AG2 H;  5B5E C;  5FIU A;  3D5L A;  4QV2 A;  5D5W B;  1FMW A;  1YFH A;  1BQE A;  1DP3 A;  2CUF A;  3OPO A;  4FXU A;  1R5G A;  1YIJ I;  4K1X A;  4O5V A;  3S3N A;  2HDC A;  2H6C A;  2BVN A;  4OWR B;  5EG0 A;  1O4X A;  3R6J A;  4RPD A;  3WQZ A;  2ZXW H;  3ZQ7 A;  3GUD A;  1A8P A;  3GQA A;  4PJN A;  2STT A;  1KK3 A;  4YRV A;  1VQN I;  3OFN A;  1MSF C;  4OJO A;  3BZ6 A;  4RPB A;  1S7A A;  3DKX A;  4WK8 F;  1FYM A;  3GWZ A;  1MMG A;  5EZG A;  3UKG A;  2EK5 A;  3FMS A;  3Q0V A;  5IYR A;  2XTX A;  3JQP A;  3OOU A;  1KTW A;  1ZAR A;  4HRI A;  3KYC B;  4L5I A;  4GO1 A;  4YC5 A;  2KDO A;  2L7F P;  4AC0 A;  1OHH A;  4UZU A;  3BTJ A;  1YYV A;  4DNR B;  3WTW C;  1Z6T A;  3FKI J;  2BGJ A;  4KFC A;  4A3D J;  3AGQ A;  4XBF A;  2XRO A;  3MKW B;  3QOE A;  1IN6 A;  3P9C A;  3K7A J;  4V2F A;  2XUB A;  2CRG A;  5HDN A;  1EP3 B;  3VMV A;  5L3D A;  2MAB A;  1X58 A;  4Y3O A;  5JLW A;  2MA3 A;  3WTY C;  3DQV C;  2EV5 A;  4HYE A;  2O5R A;  2BXY A;  1VQ6 B;  2H8R A;  1IN5 A;  2CC2 A;  5KAF C;  5BOX A;  5LGT A;  3CCL I;  2COB A;  4M72 A;  1R4M B;  4L9J A;  1BN5 A;  3JAM K;  1KZL A;  3LMW A;  2DA3 A;  3WE3 A;  3FPK A;  3H9J A;  5F0F A;  2VUM J;  1RC9 A;  3B90 A;  2GQF A;  2R6H A;  2R4G A;  2VI6 A;  2HEO A;  1E3X A;  2DEU A;  3TP0 A;  4BYY A;  4J01 A;  5GV8 A;  2BX6 A;  3LQE A;  3OEH A;  3F3X A;  4PZJ A;  3OR1 C;  4IEJ A;  5ED4 A;  3ZPN A;  2BF4 A;  1PLU A;  4PAA A;  1DDG A;  2QE7 A;  1ZQ3 P;  2KT0 A;  2Y31 A;  3T8T A;  5E8G A;  2W48 A;  4V19 K;  5GPA A;  4OIO F;  1FWZ A;  2XHK A;  4FE7 A;  5IP6 A;  4DK0 A;  3VST A;  5GPC A;  2YUS A;  3BR1 A;  1G4D A;  1FOW A;  1V4R A;  1YLO A;  2XPU A;  2ECC A;  4CCN A;  5FLX K;  5B1B H;  1EFU A;  5M3M J;  5BSY A;  1TYU A;  4U88 A;  3OZW A;  4V02 C;  1W0K A;  3GLX A;  1WPC A;  1MW7 A;  2V9K A;  5LRR A;  3OYC A;  2FVG A;  2E1M B;  3ELK A;  2BE5 F;  4BKX A;  3RKX A;  4PMH A;  3VFZ A;  3ZZT A;  3WND A;  3CC7 B;  4I6Z A;  4RAG A;  4DQK A;  3E7L A;  5FRN A;  2PMU A;  3FKJ A;  1SC7 A;  3GQ8 A;  3CC4 I;  3VEP A;  1FLI A;  1MND A;  4FX4 A;  1N0V C;  2HQR A;  5DSZ A;  1O8K A;  2JK3 A;  2LF8 A;  3H1C A;  4HLY A;  4ENJ A;  3D5R C;  3KLO A;  4YG2 F;  1RUO A;  1V0E A;  1QFZ A;  1O8F A;  3PNY A;  3MD2 A;  2F48 A;  1T5E A;  4Q4Z F;  3TOB A;  1T39 A;  1JJ8 C;  2QZ8 A;  3HGG A;  3WG7 H;  3SLN A;  2DMT A;  4PFO A;  1K61 A;  2ZJ2 A;  1STZ A;  1P7J A;  3C7J A;  4AUX A;  3JRB A;  1KRH A;  3GQB A;  3IHU A;  3JRE A;  3IH3 A;  3GZ6 A;  1QQ1 A;  5LFA A;  4A69 C;  1GR1 A;  1Y0Y A;  1O8I A;  5DS9 A;  3F23 A;  3ZCO A;  4YCQ A;  4PJ0 C;  1IN7 A;  3CMA B;  4KN7 X;  2EFQ A;  2DOE A;  4FE4 A;  2STW A;  2XRL A;  3GVJ A;  2KDZ A;  2VT3 A;  4PC1 A;  2K4J A;  2X0K A;  4EM0 B;  2DOD A;  1HKQ A;  2Q2E B;  3WBJ A;  4I98 B;  1YI2 B;  1XS9 A;  2WSS A;  2CQN A;  3BG5 A;  2NYX A;  2VFN A;  1Z91 A;  4XRS A;  3RKW A;  3N6Z A;  3E5U A;  2P8T A;  1G7S A;  1T0F A;  5K7H A;  4Z1M A;  2Z16 A;  2YR2 A;  3OYF A;  3J7A Y;  1I8D A;  1FNB A;  1S9H A;  1IV8 A;  3JW4 A;  3M3Y J;  2L5Q A;  2Q6K A;  2CUE A;  2NNN A;  4RB3 C;  4XD7 A;  2XGJ A;  1U5T A;  1SD4 A;  2W00 A;  3QAH A;  4Q47 A;  4CGZ A;  1VQL B;  1Y0R A;  3KP4 A;  2CQX A;  2L02 A;  4PFP A;  1VLY A;  3K4K A;  2LG4 A;  2OCE A;  1WOS A;  1WTH D;  3OV8 A;  3GSI A;  4M9X A;  1QJV A;  3ABM H;  1HW1 A;  3RKY A;  4MFE A;  2VJ5 A;  1RNL A;  2XTY A;  1KON A;  2L4M A;  1OPC A;  2KRF A;  4GYG A;  1Y1V J;  3I59 B;  3LNQ A;  5E3O A;  4G7X A;  1XMA A;  3M1C A;  3PM1 A;  3DXJ F;  2JZY A;  2ZKZ A;  2WJY A;  1TVC A;  3T0Y A;  1VQ6 I;  4OPV A;  1AIP A;  4U9U A;  3PSS A;  4MR0 A;  3W6J B;  3CUQ B;  4HZF A;  1WH5 A;  2OBT A;  1IB4 A;  4MFD A;  1BI0 A;  4R79 A;  3OR2 C;  1R1U A;  3HHH A;  4D0P A;  3MKY B;  3DEU A;  4E7Z A;  5J35 A;  4DIQ A;  2E2H J;  2M8G X;  1RZ4 A;  4J19 A;  2WYR A;  2CQK A;  5DCF A;  5D5V B;  1KJZ A;  3BH6 B;  3AVX A;  4UNO A;  4ABZ A;  4QFM A;  2Y0M A;  3KET A;  4U0V A;  3I4N J;  2A5Y B;  1UHW A;  2P0W A;  3DTI A;  2R7X A;  1XB2 A;  1VQ8 B;  4OAZ A;  2HOT A;  3G6E B;  1ZRD A;  2B7B A;  5TGT A;  3VSK A;  2Z5U A;  2JPC A;  4C3J J;  4BU2 A;  4OOS A;  4X07 A;  2HYG D;  4BDZ A;  2QGG A;  1O3R A;  2H09 A;  5GAH J;  1SKQ A;  2DYR H;  1QU3 A;  3HJE A;  2A5W A;  3T51 B;  1ULY A;  2GJR A;  3DLA A;  2FUG 2;  2VPL A;  2E2I J;  2B7C A;  3SHF A;  1FOK A;  1Y0N A;  4ENM A;  2BHZ A;  1EA3 A;  2AXL A;  3K1N A;  3OWT A;  5EDN A;  4HWV A;  2G7U A;  4ACB A;  4R1H A;  3ZN0 A;  2KVO A;  1JTY A;  2R93 J;  4F92 B;  2HVS A;  1BM9 A;  3S2W A;  1S7E A;  3VDX A;  5CVR A;  1UJ8 A;  4OIQ F;  4KKT A;  5KW9 A;  2EZI A;  1TQI A;  4IW3 B;  1G8X A;  1ON1 A;  3DBR B;  5CLS A;  2HWV A;  3A03 A;  1X0C A;  3V7C A;  1LDK B;  1WH7 A;  2I5U A;  3K2A A;  4RD1 A;  1Z05 A;  2WY8 Q;  3QRF F;  2E1N A;  2DAO A;  1PUF B;  2YWF A;  1QVT A;  4N4N B;  3A8J A;  3EUK L;  2V5I A;  1ETW A;  2VIX A;  1G7C A;  4D7N A;  4E7I A;  1EF4 A;  1DU6 A;  4N3N A;  1H8A C;  1RES A;  4BHC A;  2VNH A;  3CCR I;  3ASN H;  5JVG F;  3TW7 A;  1FIA A;  3PJR A;  2E7X A;  2HI3 A;  2ZFW A;  2V9V A;  3PUF A;  4MIM A;  2BSP A;  1WSR A;  4IHY A;  2V1X A;  1U78 A;  2H8W A;  3M1E A;  1XCV A;  2HS5 A;  2XF5 A;  2VBV A;  2Z99 A;  1KMH A;  5LEJ A;  4HF0 A;  5E1X A;  1CF7 B;  4BQA A;  5HLI A;  3LOC A;  4QHY A;  4W8R A;  3HYI A;  2XAG A;  4ZJZ A;  1W34 A;  4C9Y A;  1ENH A;  1TWA J;  2R5Z A;  4YIR X;  3GTP J;  1CQX A;  2V9P A;  3CCV B;  1DBO A;  2CQ7 A;  1KTV A;  1BI1 A;  3IV5 A;  2NAZ A;  3IP4 B;  2Y69 H;  1QA6 A;  1JJ2 B;  3CC7 I;  3SJP A;  1ZG3 A;  3LVB A;  3RPU A;  4U49 A;  5DUK A;  2P4W A;  2OTJ B;  2HVR A;  1USS A;  5C4J J;  2XVC A;  3DU5 A;  3CME I;  1B6A A;  3FZV A;  1WJC A;  2RRE A;  3CCM I;  1SFX A;  1NG7 A;  1LB2 A;  2H1K A;  1Z67 A;  1T95 A;  2RC4 A;  2V7X A;  4ZGN B;  3A4C A;  1UZC A;  1WJ5 A;  1B59 A;  3A3B A;  3DTE A;  5CYV A;  1V0F A;  4A93 J;  1O3Q A;  1IRF A;  1YJN I;  3J7Z I;  4OIN F;  4YEJ A;  2DA7 A;  3FMQ A;  2WV0 A;  3HRS A;  2PI0 A;  5GAD J;  1JA0 A;  5H59 A;  5J1R A;  2D45 A;  1YG2 A;  5A2Q Z;  1R5H A;  3I0T A;  1SVM A;  1BI3 A;  2H1L A;  5L46 A;  2QM3 A;  1ZK8 A;  2IRF G;  3HOY J;  1U5T C;  4AIJ A;  2XGD A;  4I02 A;  1KU9 A;  4KIB A;  2YU3 A;  2IP2 A;  3HOT A;  1YW8 A;  3WY9 A;  3BZK A;  2DLL A;  4ESB A;  2XKP A;  4A3J J;  1Z77 A;  2W82 A;  2F4N A;  4NBS A;  2UZK A;  4UVA A;  1S6L A;  3HKZ A;  2F5V A;  3WU1 B;  2O61 A;  1UD2 A;  4X7F A;  1OCT C;  1LEA A;  3K4J A;  5F08 A;  5C3E J;  1EA0 A;  2A6T A;  2BBY A;  2YWG A;  3EET A;  2XSJ C;  1QZE A;  3CCY A;  3LQR A;  4OMY A;  3OAA A;  1QH0 A;  3WG9 A;  2Y48 A;  3OIO A;  3K4L A;  1A35 A;  3G05 A;  1LM1 A;  2QX3 A;  1A36 A;  2B9S A;  3V8L A;  3LSI A;  1W7P B;  1MDM A;  1K6O A;  3ZC3 A;  1FBU A;  4B4D A;  2P5V A;  1FND A;  3F8F A;  5FKM A;  1LDJ A;  4C2L A;  1MH3 A;  3DEW A;  2X6O A;  2YPR A;  2F3L A;  1XMK A;  2K5C A;  2F5F A;  2QLZ A;  2E7W A;  1FIP A;  2MLG A;  3FY3 A;  3RY8 A;  2BXZ A;  3CW2 A;  4OJ5 A;  3Q0W A;  2NSP A;  2GA1 A;  2HQ5 A;  5K5R A;  2MD5 A;  4X0C A;  3DKY A;  3A1Y A;  2F5C A;  3A0H C;  2VON A;  3VYS B;  1F4K A;  4A3K J;  1D8J A;  4PSX A;  3TW6 A;  4YEL A;  2E60 A;  3OS1 A;  2DPU A;  2RC5 A;  3ECO A;  3OW2 B;  3CQZ J;  3PO2 J;  2DFF A;  5LHH A;  4WZT A;  5FFZ A;  2HKO A;  1QGP A;  1KA8 A;  3O3K A;  3S16 J;  1AMO A;  3BTL A;  4DQL A;  4BEH B;  4C3I J;  3CMY A;  2O0W A;  1T08 B;  1TW2 A;  1UMQ A;  2L0K A;  3DU6 A;  3E3V A;  6PAX A;  2DDB A;  3H3Z A;  2XTW A;  2FX0 A;  2P81 A;  3WHC A;  5J4Y A;  2PQ8 A;  4WZK A;  3D0S A;  4LLG F;  2D3L A;  4JP0 A;  4HE5 A;  5FA6 A;  1UAA A;  3F8M A;  1K78 B;  3CUQ C;  1HQC A;  1PJR A;  3CDI A;  3CMM A;  4RB0 A;  1A31 A;  4P96 A;  2HYF A;  1WOO A;  1K5C A;  4J00 A;  3OSG A;  2V26 A;  3ROU A;  3BG7 A;  1UEL B;  2GPJ A;  3IAS 2;  2IT0 A;  1KQS B;  3SQV A;  2LNB A;  2W57 A;  3J81 Z;  4RD4 A;  5FKO A;  1TNT A;  3LNN A;  2GIZ A;  1LKX A;  1WJB A;  2R7T A;  5GTI C;  2BYV E;  1VQ9 I;  1KK1 A;  2XSD C;  5DCM A;  1BI2 A;  3WTX C;  3LAP A;  2A6E F;  2UVE A;  2BY3 A;  2FBI A;  2DMQ A;  3VB2 A;  2PE3 A;  2EFN A;  1MD0 A;  2E19 A;  2DER A;  5J1U A;  1LLW A;  5F0H A;  1APL C;  2JMW A;  1DPU A;  3BLY A;  2B63 J;  3HOZ J;  2ZXJ A;  3FKS A;  3AK5 A;  5K1Y A;  1DQU A;  1F20 A;  4E70 A;  3CC4 B;  4ZCL A;  1G3Y A;  2X0L A;  3LWF A;  2OQG A;  2L7M P;  3OYK A;  1NB0 A;  4D7M A;  3I54 A;  5B6I A;  4P1W A;  2Z8G A;  5EYR A;  1HSJ A;  2DK5 A;  2E71 A;  5GTH C;  5LGU A;  3LSM A;  1OFL A;  4WXD A;  2L9N A;  2JT1 A;  1ZTR A;  1COW A;  3BY1 A;  1Z0X A;  2O03 A;  2E35 A;  1K28 D;  3PQJ A;  1B23 P;  2EV6 A;  2RVC A;  2I1L A;  4BH9 A;  1S8N A;  4P12 A;  4Y9U A;  3P9K A;  4BL0 B;  2ESN A;  4NQW A;  5DCM B;  2XF7 A;  1R1T A;  4RM2 A;  4OJL A;  3KIO A;  4F3Q A;  3JTH A;  3SLD A;  1YX5 A;  2L7Z A;  2Y75 A;  1QHG A;  1ZAO A;  2QF7 A;  1ZRC A;  4OOX A;  1B1B A;  4BJ5 C;  5IOZ A;  1EH7 A;  2FQ3 A;  1D0X A;  4EW9 A;  2F1L A;  1A04 A;  3CCR B;  2GA2 A;  1XC5 A;  4RAY A;  4UB6 C;  2DDA A;  2KIQ A;  1WFX A;  1JKP C;  4JX4 A;  3K70 C;  1IHM A;  1VZ0 A;  2AS5 F;  3SEZ A;  3TO9 A;  2BGC A;  4O3M A;  4CCK A;  4KIC A;  1OCP A;  1W9X A;  1EFR A;  1RWR A;  2UV1 A;  2B0R A;  4FIS A;  2BZT A;  4D1Q A;  1HOM A;  2DFI A;  3I9V 2;  2GQQ A;  2NVU B;  1HKT A;  4XRM A;  2C5B A;  3B4N A;  1K7A A;  4IQJ A;  2X48 A;  3ASP A;  2GXG A;  3JRF A;  2FQ4 A;  1AWC A;  1SAX A;  3H5R A;  1RQR A;  3RPU D;  4RDK A;  1XGS A;  1QHH D;  1JKO C;  4S04 A;  2PMD A;  4LG0 B;  2FOK A;  4M9Z A;  3CCS B;  1V3F A;  1NJI D;  1QCX A;  1XCB A;  4IHW A;  2B5O A;  2NVY J;  2PFB A;  1K4S A;  2VFP A;  3KP3 A;  2RC6 A;  2KQR A;  1IW7 F;  2HNH A;  4CSW A;  4E7H A;  4I0A A;  1YX3 A;  2RV8 A;  3CCJ B;  3GX4 X;  1G59 A;  1TNS A;  1IG7 A;  2VFO A;  3K4B A;  3P27 A;  3ZGK A;  2DI3 A;  2DMP A;  1T6Z A;  1E79 A;  5J1Y A;  3X2Q H;  2H94 A;  2IS2 A;  5KCM A;  3BG6 A;  2E1B A;  2IJL A;  3GZN B;  2KIF A;  3EUH C;  3RDI A;  2FF4 A;  3NAU A;  1R5B A;  5IYC J;  3V7A A;  1JHF A;  1O7F A;  4Y9R A;  2DA4 A;  1SMT A;  1W4M A;  2M0M A;  2LD5 A;  4LBV A;  4YFO A;  1RI7 A;  1J7K A;  1MJA A;  4XSZ F;  3F8C A;  3BCB A;  5AMV A;  1VQ4 B;  1R6R A;  3V4G A;  1KU3 A;  4XLN F;  3OJW A;  5LGN A;  3IRQ A;  2CF4 A;  3F6V A;  2OTL I;  3IRR A;  4F7D A;  2QSG X;  1F9N A;  1XX5 A;  3RYP A;  1D8T A;  4HV6 A;  2CW8 A;  3RQ4 A;  5FJ8 J;  2GK7 A;  1UB9 A;  4RDU A;  3MVP A;  3E5X A;  4HPQ A;  3OE7 A;  2IW5 A;  5D4R A;  2MSY A;  3WTU C;  1WI9 A;  3MAJ A;  4ZC3 A;  1SD6 A;  3HL2 A;  4MXN A;  4Y7N J;  2LH9 A;  4BXX J;  2JWT A;  1IN4 A;  2MG4 A;  3C2G A;  3J80 K;  1A6Q A;  4UXN A;  3AKZ A;  1IO2 A;  1IJE A;  1ZLK A;  1WJA A;  1B4A A;  4ZDP A;  3ZPL A;  1FNC A;  1I50 J;  3CDL A;  1Z3Y A;  5JLX A;  3I55 I;  1HXD A;  3O8G A;  4HV5 A;  1S3J A;  4MLO A;  2CGP A;  2Y9Y A;  1VHO A;  4YEI A;  2FBH A;  1GXQ A;  3CJQ B;  3FM3 A;  3HHG A;  1IJF A;  4ZV4 A;  3BRO A;  1HW5 A;  3H9G A;  1V5F A;  1D3Y A;  1WQ2 A;  5ICC A;  2HDD A;  2X51 A;  2EFO A;  4HNU A;  2VOD A;  4ZH4 F;  2Z6B D;  2VBX A;  4TMW A;  1XSX A;  3K69 A;  4NNJ A;  3ASQ A;  3DTK A;  2LLK A;  3LMM A;  2Q8K A;  2M9H A;  2ETH A;  4QTR A;  3I64 A;  5D5U B;  2PJR A;  1VBL A;  3T9G A;  4AF6 A;  2IS1 A;  3G1M A;  2Z3Y A;  2UXN A;  4G12 A;  1I27 A;  4HDU A;  5FD6 A;  4RB1 A;  1X1D A;  3HB9 A;  1R5N A;  1HDD C;  1MBF A;  3OYH A;  2QWW A;  2NV4 A;  4L9V A;  4Z4W A;  1O8G A;  1T8I A;  3W2V A;  2W85 A;  4II2 A;  2R3S A;  4HA8 A;  1FOY A;  1OCR H;  3G2B A;  2JA7 J;  3WNC A;  1QPM A;  2QA4 I;  3OMY A;  3OY9 A;  1YRN A;  1Y6I A;  5DUI A;  1MSE C;  3HDD A;  1FC3 A;  2MC3 A;  1AIR A;  3U2Q A;  1IC8 A;  2ZCW A;  3FXU A;  1WU8 A;  1K8F A;  1X19 A;  4B4C A;  2XAF A;  1L1I A;  3BY2 A;  3EPZ A;  4LIU A;  4A6D A;  1R1V A;  4DNC A;  4RS8 A;  3G4S B;  1RKT A;  2LVS A;  4YAO A;  2DMN A;  2K3P A;  2F6C A;  3RPQ A;  2QMU A;  1VQ9 B;  3QQA A;  1K83 J;  2NOJ B;  1KYW A;  1YQA A;  4B44 A;  1TLH B;  4MGR A;  1JB9 A;  1BPL A;  2HR3 A;  3HOU J;  4HNT A;  2JJ2 A;  4Z4R A;  2CND A;  2HMA A;  1H42 A;  1F5T A;  3TL4 X;  3KE2 A;  3GLL A;  1B8I B;  5DEQ A;  4ASN A;  2RN7 A;  4MQ9 F;  4X0G A;  2DJN A;  4A12 A;  1ZUN B;  3K4M A;  1BHE A;  4A2U A;  2LR8 A;  3GTQ J;  5ERI A;  4Z2Y A;  2X6X A;  2HCJ B;  4HBL A;  3LSH A;  4RA2 A;  1W5S A;  5DTD A;  4CCL A;  1FP2 A;  4ZCM A;  4FWT A;  2YUH A;  3CCJ I;  3JSP A;  1XGM A;  4CQJ A;  4C0S A;  3K2Z A;  1D5Y A;  2VOP A;  4NUB A;  3GVA A;  1D1N A;  3VSV A;  3IAM 2;  3L2C A;  3A3G A;  2VBK A;  4MO7 A;  2VAS A;  4AID A;  2M87 A;  3PNT A;  1RMG A;  2V6E A;  3ZQH A;  1JUM A;  2VBZ A;  5CJ9 A;  5FLV A;  1VQK B;  2HVQ A;  1TQM A;  2CV0 A;  4Z4Y A;  4IRG A;  5ICF A;  1CQT A;  2ZXH A;  1FRN A;  1G7R A;  4Z4T A;  4XLP F;  4P2N A;  4PGO A;  2JSC A;  3Q39 A;  3BR6 A;  3J7A O;  4OP7 A;  2DCE A;  5JR3 A;  4TMX A;  2GOX B;  4PK4 A;  2Y2Z A;  1IRG A;  3CLQ A;  4WF2 A;  3BJO A;  2PN6 A;  4UV8 A;  2M3A A;  2NT6 A;  2IAI A;  2TDX A;  4YZX A;  2X9D A;  5KHD A;  2D1H A;  3DDY A;  3OL3 A;  1YIT I;  3HPH A;  2QEN A;  5M5Y J;  1RR8 C;  2WB1 A;  1N0U A;  2EZH A;  1ETY A;  2J5O A;  1QFY A;  2XT2 A;  2OK8 A;  3U6B A;  5HOO A;  3BC8 A;  3H09 A;  1IB0 A;  1WHU A;  1POG A;  1Z7U A;  5D6E A;  5EF6 A;  2QBY B;  1UHM A;  2OK7 A;  3UNG C;  5K5O A;  3OJX A;  1R36 A;  3IWF A;  3LSJ A;  1GXP A;  4M53 A;  4B3X A;  3WHB A;  3A01 A;  2F5D A;  2K4B A;  1N75 A;  1LPQ A;  3H5A A;  4XON A;  3ZQC A;  3L9F A;  2JN9 A;  2DFH A;  3JRA A;  1O8H A;  2XAH A;  2DU9 A;  4GRI A;  4N0B A;  1FPQ A;  1PE9 A;  5KK1 A;  2BM1 A;  1MJB A;  3ML6 A;  2A61 A;  1YJN B;  1V5V A;  2BPO A;  5BPD A;  1Y56 A;  2R7V A;  3AST A;  2O17 A;  4PGG A;  1Y8Q B;  1OQY A;  4X7C A;  4L5J A;  2R7F A;  3FJO A;  5BS6 A;  3QPH A;  3WYA A;  4A0Y A;  1N08 A;  1H88 C;  1OB2 A;  2PBI A;  4HAM A;  4AYB N;  1MRZ A;  3MMY B;  4XLA A;  2EFW A;  3PA2 A;  3MZ8 A;  1XB4 A;  5JLV C;  1CF7 A;  5TR9 A;  5E17 F;  2V7U A;  2I8D A;  5CKT A;  4M74 A;  1P92 A;  1WJD A;  4WXH A;  3TP3 A;  1HLV A;  4NB5 A;  1MBK A;  1OYW A;  4LB5 A;  5J8F A;  2YX4 A;  1R7J A;  1HDP A;  2LRE A;  3W2G A;  1I3A A;  1OFE A;  1WJF A;  3RJP A;  1B2R A;  4M3E A;  1FNM A;  5L3G A;  1I39 A;  2Q2E A;  2ISY A;  1JXS A;  1F60 A;  5CDF A;  3P4G A;  5H6R A;  3T1B A;  4BHP A;  1ZM3 A;  4MHG A;  1T6X A;  1MMA A;  2BEO A;  1W7P D;  5IYW A;  3R6S A;  2EV0 A;  3BOQ A;  2HGC A;  4IF4 A;  2BVM A;  2QQA A;  3ZPP A;  4JK1 X;  1Y0U A;  1BOA A;  2ZNZ A;  2OBS A;  2QGU A;  1DP7 P;  1NG6 A;  1H9G A;  1OFC X;  2EIL H;  2M8E A;  2OUM A;  4PSW A;  3OYB A;  2BV3 A;  3D26 A;  3JQR A;  4G5G A;  1EKE A;  2LY2 A;  3CB4 A;  3QSY A;  1CNF A;  2A6H F;  1ETO A;  3V42 A;  2NZM A;  3KP5 A;  3NE5 B;  1KGS A;  2ZSI B;  3ISP A;  2QKM B;  3CCQ B;  5J40 A;  4G1V A;  2K02 A;  2F1M A;  4P6Y A;  3J80 Z;  3IWZ A;  3FXR A;  4XR6 A;  3H9N A;  4P3I A;  1LEB A;  5A88 A;  3H0D A;  2NTB A;  2VFQ A;  3V76 A;  4UUS A;  4C2T A;  2DT6 A;  4BNC A;  2TCT A;  3E6M A;  2CFX A;  2D1V A;  3SQN A;  3HOW J;  4PUS A;  1W2B B;  1V54 H;  3S3O A;  1D1C A;  2EA4 A;  3W3C A;  1QBJ A;  2ZBV A;  1XD7 A;  1T98 A;  4P9S A;  1XSV A;  4LOC A;  5F0C A;  2X6W A;  4MEX F;  1VFC A;  3A35 A;  3CO7 C;  2JVH A;  3ONQ A;  2HXI A;  1GVJ A;  2ID6 A;  3QP5 A;  3R0A A;  3ONY A;  3H9Q A;  3OYM A;  4M71 A;  3L2R A;  5A89 A;  2OTJ I;  1GO2 A;  4RLQ A;  2LC2 A;  4UUV A;  2A68 F;  3BR3 A;  3R6K A;  4GDF A;  2V6C A;  2RAE A;  2QA4 B;  1O8J A;  2L7K A;  3W2H A;  3K6G A;  2DA6 A;  1O7L A;  1CZF A;  2PX9 A;  2BM6 A;  3FWE A;  2QDX A;  2M45 A;  4F7Z A;  1ZR4 A;  1QUF A;  1V55 H;  3L2V A;  5ILV A;  3KP7 A;  4K2E A;  1I5Z A;  1SMY F;  2O0Y A;  1U9N A;  5C4X J;  1XN7 A;  3N90 A;  2DQR A;  3U1K A;  2K9N A;  4EGY A;  4RM3 A;  1SFO J;  3OP1 A;  3KP6 A;  2F4I A;  2WBM A;  2HU9 A;  2VN2 A;  2Z1D A;  5FNZ A;  5HOD A;  3BTI A;  1H85 A;  4YAU A;  2ZL6 A;  2FSW A;  4IOA F;  1FYK A;  4U4B A;  3HRU A;  4AVP A;  3Q0U A;  4M4S A;  4UUS B;  3CJN A;  3KEQ A;  3Q3S A;  4KNY A;  1HA3 A;  4CCO A;  2VFM A;  2RDP A;  1K79 A;  4W8S A;  3BTC A;  4GGG A;  4PC3 A;  5FKN A;  4JRA C;  4M2L A;  4RD6 A;  3P26 A;  4Z05 A;  1QRC A;  2Z33 A;  4Z4V A;  1XTA A;  2PYH A;  1VQ7 B;  3SEJ A;  1BN8 A;  1WSV A;  1P7I A;  2PMH A;  5D6F A;  4BJT A;  2C4U A;  3A02 A;  2ADU A;  3FXM A;  3DFG A;  4G6D A;  3W2W A;  4FET A;  5FO5 A;  3ABU A;  1I18 A;  4P3Y A;  5F6F A;  3HRM A;  3JRG A;  2O8X A;  1KD1 D;  1SKY B;  1ZM4 A;  2IGM A;  4HST A;  2IA2 A;  2NVX J;  3FK6 A;  4YZQ A;  2XB0 X;  4U0W A;  4F55 A;  1PUF A;  4XLH A;  2JQ7 A;  1TW3 A;  1Z3X A;  3ZUG A;  2QYO A;  5FKL A;  3G1L A;  1T2K A;  2W6I A;  2EFG A;  5AIQ A;  1VF9 A;  1E1Q A;  3WTZ A;  4XLC A;  1OGM X;  4HF2 A;  2JA2 A;  2M4K A;  4QWQ A;  4BEH A;  1YI2 I;  5IYQ A;  2KJC A;  5DYM A;  1R22 A;  3SJZ A;  1YIT B;  2JJ7 A;  2DA1 A;  4KDP A;  2VL8 A;  4YFN F;  2UXX A;  3AG4 H;  2M1B A;  2PIA A;  4KKU A;  1WMR A;  5FO0 A;  1AA7 A;  2CUJ A;  2M7A A;  2JJ1 A;  1LLZ A;  3NAW A;  2XAQ A;  1SFU A;  2GLO A;  3CCM B;  1CNE A;  1J9Z A;  1IUY A;  1DGR M;  2X4H A;  1UFM A;  2R5Y B;  1YLF A;  2W24 A;  1OMI A;  1P9Q C;  2EH3 A;  3JRH A;  2Q6L A;  1VQM B;  3JRC A;  5CVV A;  1E3P A;  1L3L A;  3VMF A;  5LRS A;  4J0Q A;  1OGO X;  1WGX A;  3TKY A;  1BIB A;  1E43 A;  2L2O A;  1UD5 A;  1BMF A;  4IHS A;  2M34 A;  2M5W A;  2HYJ A;  3JR9 A;  4IVN A;  2O6G E;  4CHU A;  2C4T A;  2MGQ A;  2MD0 A;  1A5J A;  3HBL A;  1J59 A;  3DWL E;  5EGO A;  1X3W B;  2DK8 A;  2ID3 A;  2GJP A;  1JTA A;  1TYX A;  3KZZ A;  2CMP A;  3H35 A;  4R71 A;  3RIQ A;  2YS9 A;  1BX0 A;  1M90 D;  4XKB A;  3GIR A;  4OPS A;  3DLL F;  4G6T B;  4EJU A;  2GJK A;  3AAF A;  5E8I A;  1OYY A;  4Y15 A;  4ZYG A;  2ECB A;  2KPM A;  4RGU A;  3ZR8 X;  1QPI A;  1SM4 A;  2VBU A;  4W97 A;  1UD6 A;  1FBQ A;  3BPV A;  4II3 A;  1VQL I;  4Z06 A;  3COA C;  2F5E A;  3M9A A;  1W36 D;  2XGE A;  1PJ5 A;  3VR6 A;  1CLW A;  3S1N J;  1P6R A;  1BW6 A;  2R7S A;  2V7Q A;  2LKS A;  3G6E I;  3S1Q J;  1BA5 A;  2V79 A;  4UVB A;  3O2P E;  3N05 A;  3ZZU A;  3TH0 A;  1X4O A;  2YU9 J;  4OM9 A;  4P55 A;  4N9I A;  2CWE A;  2LOO A;  2ICW G;  1WOP A;  2NST A;  1P2F A;  4FHT A;  1MDM B;  3T53 B;  1LDD A;  4D5C A;  2C5H A;  4WWV A;  1IXR C;  2N8G A;  3FMR A;  3M4O J;  5LMZ A;  3J81 k;  2WB1 N;  3PL8 A;  4HQM A;  1MMS A;  3ASS A;  1MJ9 A;  4M0L A;  3ZSC A;  3CPX A;  3LAJ A;  2XAJ A;  4IQ4 A;  3T5X A;  5GV7 A;  5IOY A;  5HS8 A;  4KT6 A;  1PVE A;  3EQO A;  3C2B A;  4IPA A;  2WA0 A;  2DXI A;  5CVJ A;  2BY2 A;  1ZG1 A;  1C0W A;  3WBK A;  3JUR A;  3K10 A;  4IX7 A;  3GTL J;  3L2W A;  4V2G A;  1O8L A;  2LY1 A;  2P6T A;  3CCV I;  4RJL A;  3I56 B;  2K27 A;  1EE6 A;  2XZO A;  4YAW A;  2PYG A;  1UG0 A;  2IEK A;  5JBQ A;  4DYC A;  4OJ6 A;  1IXC A;  2WAE A;  5E79 C;  1KU2 A;  3SJM A;  5LD2 C;  2XZL A;  4RGR A;  3SDG A;  3H3V K;  4XOR A;  1PYV A;  1U5T B;  2CH0 A;  1YTY A;  3QOP A;  4A0X A;  1VQ5 B;  1AKH A;  4E7S A;  2C78 A;  4QSH A;  3KP2 A;  5FRO A;  1KK2 A;  1OB5 A;  4CH7 A;  3TO6 A;  2Z9O A;  1B72 A;  4RGS A;  1F1Z A;  3VPR A;  3F9K A;  3K4C A;  1YE9 A;  4IL6 C;  4A3C J;  3B8H A;  2W1O A;  4I01 A;  4Z03 A;  5E20 A;  3FXK A;  4CZC A;  2IQ7 A;  1MH4 A;  2QTL A;  4G8X A;  1U2R A;  2DCU A;  1J9I A;  1U8R A;  1FYL A;  2YWE A;  1X3Z B;  1R00 A;  4C2M J;  5F4J A;  3VNV A;  1OYI A;  1GLN A;  2L4A A;  3Q9V A;  4OAY A;  2JSP A;  2OZ6 A;  4MTD A;  3RI4 A;  1Q7Y D;  1BR4 A;  1DDN A;  2IBD A;  4UAJ A;  1XGO A;  2G0Y A;  3GCM A;  3FHZ A;  5DD8 A;  5M5X J;  1X1C A;  2E36 A;  4B48 A;  2O7O A;  5CPR B;  2HDW A;  2VC1 A;  2BM0 A;  3AVW A;  2BM4 A;  3ZP5 A;  1IUF A;  2XAS A;  4AM3 A;  4BQQ A;  1OR7 C;  3W2F A;  3NWT A;  3JSO A;  1RQP A;  4YXW A;  3F21 A;  1F43 A;  3KZI C;  5IP7 J;  1RPW A;  4ZGQ B;  2UUZ A;  3CMA I;  2DJI A;  2JUC A;  5E1W A;  4PC2 A;  1TWF J;  3AG3 H;  3LYC A;  1M1K D;  3BR5 A;  5HLG A;  2ZBK A;  4HX8 A;  1XG2 A;  2KRH A;  3CDH A;  4N3G A;  1N77 A;  4LG0 A;  1HCR A;  2EIM H;  1XQB A;  2DMU A;  3J7Y J;  3Q3A A;  4ZYD A;  2ISZ A;  1YIO A;  1N05 A;  3G1O A;  2VBM A;  3BWG A;  2GOM A;  1ZHF A;  1FX0 A;  1L0O C;  4CCJ A;  3S2H J;  3LL7 A;  3S93 A;  1OB0 A;  2EZK A;  1TZL A;  3ZXS A;  1BLI A;  5HXB A;  1VF7 A;  5IYP A;  4YIF A;  4ON0 A;  4B47 A;  2L9R A;  2DW4 A;  1ITY A;  1VQP B;  5J47 A;  3ONU A;  1UCR A;  3ERE D;  4A0Z A;  2EZL A;  1Y1W J;  4DYQ A;  1RUN A;  3TDU C;  4NDL A;  2XGX A;  4U87 A;  5JHF A;  5FLX Z;  2O8K A;  4IHX A;  4WXC A;  1VTN C;  3ZN1 A;  2ZTG A;  3LSR A;  4BHB A;  4BDY A;  4RD2 A;  4LGW A;  1NK2 P;  2XIG A;  1UHS A;  1HF0 A;  1ACI A;  3CJR B;  2EQR A;  4BAY A;  4H0E A;  2FNA A;  3QU3 A;  4XKC A;  4H4K C;  3HRT A;  3IC7 A;  4IO9 F;  4E4H A;  2WV1 A;  2VQH A;  1D5V A;  2ZME A;  1FSH A;  4DW6 A;  3BJA A;  4ITV A;  1OGJ A;  2LRD A;  1S0U A;  2EA2 A;  2EWN A;  3GFM A;  5KAI C;  2IXS A;  3K0L A;  3F72 A;  4DQ2 A;  3CCQ I;  3SYT A;  1IDZ A;  2GK6 A;  3AVU A;  1J5Y A;  5AN9 A;  3L00 A;  4CUG A;  3R0J A;  3OYD A;  1HKS A;  2QQ8 A;  3QP6 A;  3OIP A;  4DZP A;  3CLO A;  5LLQ A;  4XNF A;  2R9V A;  4AC9 A;  2L9S A;  3K1P A;  4JMQ A;  5FO1 A;  2EBI A;  2F43 A;  3SZG A;  3OZV A;  1TBX A;  5DD4 A;  3GO5 A;  1NDH A;  4QIW N;  2KJB A;  2C6Y A;  4PDK A;  4BQN A;  4QPO A;  5F4M A;  5LHI A;  2BY0 A;  2KP6 A;  3NAR A;  4Z6Y A;  2X3H A;  3AL0 B;  2HPI A;  4XL9 A;  2KIU A;  1SD7 A;  2E2J J;  1MAB A;  3B78 A;  2CSO A;  1OFD A;  4TKO B;  2XT4 A;  5L3B A;  4IHT A;  3LFK A;  3WE2 A;  3MQ0 A;  2MH9 A;  1VQ5 I;  2YX7 A;  3CP2 A;  4P5O A;  1UD4 A;  4LC0 A;  2VT2 A;  3PVD A;  4NC8 A;  4TV7 A;  2H6B A;  2V1N A;  3CUO A;  4Z4Z A;  3W5H A;  1Q1V A;  4XMY A;  2QXZ A;  3ZBT A;  1R5I D;  1G3W A;  1GV5 A;  3GW2 A;  3LSK A;  1JHH A;  3TGN A;  4ZZD A;  4I09 A;  1HVX A;  4WZE A;  3MMP A;  5J4V A;  2IS4 A;  4IJA A;  3F22 A;  5FGM A;  4BBR J;  3CZ6 A;  2VOO A;  3HC7 A;  3OYN A;  1OKR A;  1OJL A;  3FF5 A;  4RMN A;  1WVR A;  2UWM A;  4P6V F;  5GP9 A;  5ILS A;  5D5X B;  4UZE A;  3ERM A;  4OU0 A;  3OYE A;  4D9J A;  1JUP A;  1WZ2 A;  2IOU G;  1OCO H;  2VNJ A;  4HEA 2;  3SXY A;  2X1D A;  1ORK A;  3KPH A;  4HG2 A;  5TIS C;  2L3D A;  1TT5 B;  5EEA A;  2ZJR F;  2GZW A;  2R5Z B;  2O6W A;  4XIC A;  3B8Y A;  4RCZ A;  2R7D A;  2VJI A;  1D1A A;  2HXO A;  3D1N I;  3E1Y E;  1YO5 C;  5FKK A;  1E2X A;  1JGS A;  3E97 A;  2AO9 A;  1EWY A;  2DET A;  1TT0 A;  3BY6 A;  1OLT A;  3H92 A;  2AXT C;  4W8Q A;  5EZH A;  1N25 A;  1MKM A;  2ZNY A;  2BW3 A;  2ZJQ F;  2LZJ A;  4EAT A;  4ETS A;  1A6I A;  3KYL A;  2G0E A;  2JVG A;  4C3H J;  3OKX A;  3OYG A;  3WTS C;  1SD5 A;  2CV2 A;  2FA5 A;  3EYI A;  4Y52 J;  1LFP A;  1IRX A;  2R92 J;  2QEX B;  3PQK A;  3CCE I;  2FU4 A;  3F8N A;  4QLC U;  2EPF A;  2OF7 A;  3BCA A;  3MZY A;  1VHE A;  2VNK A;  3GVL A;  2VLA A;  4KKS A;  1X1A A;  1NBM A;  2NVQ J;  1D0Z A;  5BNG A;  4M3F A;  3ZQG A;  1HST A;  1CGP A;  4TSF A;  5GAG J;  4JYK A;  1K4Z A;  3G3Z A;  4NC6 A;  3EYY A;  3PSI A;  4BE0 A;  1MBH A;  2E5N A;  4DOZ A;  3Q6Q A;  3FXO A;  5AON A;  1H9T A;  3BJ6 A;  2V1D A;  4W8T A;  3ZRG A;  4G7H F;  3VMW A;  3S14 J;  3EUH A;  1T6S A;  3A1P A;  2O0V A;  3JRD A;  3CME B;  3C1D A;  1YX2 A;  3QE2 A;  3R61 A;  4YFX F;  1H8H A;  1Y39 A;  2CW0 F;  4KIT B;  4HE6 A;  1PKV A;  2BVL A;  1O8M A;  1GAW A;  1XDS A;  2OA4 A;  4GQN A;  5B1A H;  2QN6 A;  3ZMZ A;  1P4X A;  4U7B A;  2VE9 A;  1YJ9 B;  1HA8 A;  3LJY A;  4A3F J;  1JUS A;  2GRE A;  4B8X A;  3TQN A;  1BC8 C;  1IDY A;  1JKQ C;  1FJL A;  3PEN A;  4H9G A;  1U9O A;  4M1K A;  3U6K A;  2QYU A;  2RKH A;  1U8B A;  2Q1Z B;  3W6K B;  1JT0 A;  4HW0 A;  5GAE J;  3S17 J;  1VQM I;  3SUC A;  3M8E A;  2MFZ A;  3LA7 A;  1P4M A;  4X7E A;  2DA2 A;  5L3F A;  2ZJP F;  2F2E A;  2V4J C;  4M73 A;  3HTS B;  1TUI A;  5FL7 A;  3E5Q A;  3HM5 A;  3R4K A;  1GV2 A;  2NS0 A;  3VOD A;  2FXA A;  4AIH A;  4EMS A;  1JI8 A;  2KL4 A;  3BCD A;  2HLD A;  1QA3 A;  3VSU A;  3MWM A;  1W0T A;  3BH4 A;  2JA8 J;  3SFI A;  1R9T J;  3ZMT A;  2CG4 A;  1Q9S A;  2B0L A;  4BJ6 C;  2WJV A;  2O3F A;  5BQT A;  5F1J A;  2W7N A;  4B3G A;  2C2W A;  3PIP F;  4XOP A;  1RR7 A;  2BOL A;  4ENK A;  4KJZ A;  1LE8 A;  2V1U A;  4Y7C A;  1ZM2 A;  2P6S A;  5IT3 A;  4MEY F;  1E0E A;  2F4O B;  3LQQ A;  2VJJ A;  1IN8 A;  1WCM J;  1FZP B;  1KU7 A;  1WXR A;  2FML A;  4WQM A;  2ZME C;  2ZXI A;  2VPR A;  1VQ7 I;  1BJK A;  4IHV A;  5B66 C;  2PLY A;  4PGH A;  2ME6 A;  3N4M A;  2K9L A;  3DPT A;  2VB6 A;  4KA4 A;  2X3U A;  4I99 C;  4LBW A;  4Y13 A;  3DEE A;  4OPO A;  2CJJ A;  2RNJ A;  2RNG A;  3S2D J;  2J5P A;  1D2E A;  4YII A;  4OJP A;  2ZC2 A;  3NRV A;  2ZSH B;  3JRI A;  4FQG A;  1K4T A;  2VKE A;  1BW5 A;  4KUM A;  2LY9 A;  2R7W A;  3K70 D;  4ACA A;  1Q82 D;  5F4O A;  1QUE A;  2OCC H;  2K9M A;  3BNW A;  3B6C A;  3RCO A;  2XNC A;  4ASU A;  5M5W J;  4IXA A;  5E3N A;  3RKQ A;  4C43 A;  1RKW A;  4W1U A;  1W36 C;  1EV7 A;  3BR0 A;  3CD6 B;  1H8E A;  1ZN2 A;  2INU A;  2W7Z A;  3M8J A;  4P22 A;  1X2N A;  4LIV A;  1ZR2 A;  3OEE A;  4URR A;  1EH8 A;  2OZU A;  2VKV A;  3L2U A;  1KC8 D;  3CPW B;  3ZQF A;  4TT3 A;  1IDK A;  2DBB A;  3ZQL A;  1R49 A;  2BN4 A;  1XPX A;  2VC0 A;  4X06 A;  4TN1 A;  3ZBU A;  2K7L A;  5H5J A;  2I10 A;  1DG1 G;  1T33 A;  4LLN A;  2ZFU A;  2KMU A;  2ZO4 A;  1QGY A;  4PAB A;  3I53 A;  2XDV A;  4S05 A;  2CW5 A;  1OR7 A;  3HEF A;  4WX9 A;  1EP2 B;  5IYD J;  1KK0 A;  2BMW A;  4L8J A;  3BG9 A;  1PP8 F;  4EH1 A;  3EQN A;  5L3E A;  4BAC A;  1I3Q J;  2JIZ A;  3FM5 A;  2GXB A;  3VNU A;  5H20 A;  3CCU I;  4BGD A;  4HF1 A;  1OCZ H;  1O57 A;  2B7E A;  2KIM A;  2D2W A;  3BPX A;  2XZP A;  1VQN B;  1LVA A;  4A3E J;  4KIG A;  1X2M A;  2LF7 A;  4ZTF A;  3I1F A;  1J2X A;  3FK7 A;  4L9N A;  2HZT A;  5K5Q A;  2BHY A;  1QRY A;  2WY7 Q;  4ROX A;  2VKD A;  4NC7 A;  4BS9 A;  1YRN B;  3QFR A;  1O3T A;  4DBR A;  2EIN H;  5B3S H;  1W1W E;  1V5G A;  5JHU A;  1RRJ A;  1I6H J;  3I3L A;  1IV6 A;  3PFY A;  4LMY A;  2OYN A;  2QSF X;  2XV4 S;  2K9S A;  3BQY A;  3IL2 A;  3IKT A;  5BSX A;  4MYT A;  2MLK A;  4RDJ A;  1YOV B;  5HLT A;  1W5T A;  4NK8 A;  5J3O A;  4XM3 A;  1MMN A;  3ESW B;  2V31 A;  2YWH A;  3LO8 A;  2DOG A;  3G71 B;  2GAU A;  3M8F A;  2CW7 A;  5BMZ A;  2Q6I A;  3GF2 A;  3SDB A;  2CBX A;  3CO6 C;  2ZIT A;  4I0B A;  2VQC A;  3UR3 C;  2LTP A;  3L09 A;  2O9L A;  1VQK I;  5J3L A;  2KRC A;  2LBF A;  2JDI A;  3GZ5 A;  3B73 A;  4E7K A;  4ANJ A;  3KX2 A;  3V7R A;  5JI6 A;  4ESJ A;  3DPU A;  2QSH X;  4FN5 A;  1MZB A;  2WWY A;  3WU2 C;  3OL4 A;  1LUJ B;  3K9T A;  1FX7 A;  3LSG A;  2WPD A;  4FX0 A;  3EUA A;  2Y30 A;  2R7O A;  3FBN B;  3GTO J;  1B9N A;  2DOF A;  1Q81 D;  2VJ4 A;  1E64 A;  2CO5 A;  3J81 K;  2VBS A;  1DGW Y;  2VQL A;  2R7Q A;  2JTV A;  2V7T A;  2FEZ A;  1EP1 B;  3PUB A;  1TTT A;  4YAF A;  2A3S A;  2HOS A;  4E6K G;  1JE8 A;  1U2W A;  2M7B A;  3HAG A;  5EGO B;  1S72 I;  2OBR A;  3P5J A;  5TV2 A;  3OYL A;  3ABT A;  4E7J A;  1O88 A;  3E1S A;  4M6X A;  3BDD A;  3B82 A;  1R5O A;  4X1E A;  1EXM A;  1WDT A;  4B3A A;  2NT9 A;  5K7Z A;  1G6N A;  2Y9Z A;  1RIO H;  3ZIA A;  1DAB A;  2OAZ A;  1LNW A;  3TOA A;  3H36 A;  4LD5 A;  3LSP A;  3CF5 F;  3HKZ N;  3S15 J;  1IGN A;  3BT9 A;  4A3M J;  3ASR A;  1ZRF A;  4XN0 A;  3VYT B;  3LQ6 A;  3VWB A;  1JKR C;  5DNS A;  1I1G A;  2M2E A;  5HNF A;  5CQG A;  3A8K A;  1LFB A;  4KYW A;  1UG2 A;  1WWX A;  3TO7 A;  5H2F C;  4P26 A;  1XGN A;  3A0B C;  1GVH A;  1G3T A;  3WOD F;  1TWG J;  1WSU A;  1AOY A;  2M0C A;  2XRN A;  2L01 A;  4C2U A;  5AIP A;  3HGY A;  1MGT A;  4JX6 A;  3GFL A;  3NB2 A;  3ML3 A;  3ZQI A;  3QFS A;  2V4D A;  2VBT A;  3F0C A;  3FXQ A;  4HIZ A;  1J75 A;  2E1M C;  1ON2 A;  4B1R A;  3IH4 A;  2CQQ A;  3ZMD A;  2UVF A;  2VBE A;  1FTT A;  4YZ0 A;  4R8H A;  5EJC A;  1AKH B;  2BM5 A;  3AL0 C;  3S8P A;  5IY5 H;  3DV8 A;  4XKV A;  1WP6 A;  1E17 A;  2XOK A;  3TDZ C;  2J8K A;  4PC6 A;  3AVY A;  3PSF A;  1E3Z A;  2F4M B;  3SEQ A;  2WAQ N;  1IAW A;  3I55 B;  3OS0 A;  3VYU B;  4RB2 C;  3W2A A;  5IK2 A;  2IS6 A;  1TYV A;  4LB6 B;  1K9M D;  1QVU A;  3SZP A;  5LEK A;  5DM6 F;  4EQQ A;  4MNU A;  3HUG A;  2P5K A;  3QYE A;  4N9H A;  1SAU A;  3P9I A;  1Z9C A;  4F91 B;  4MYU A;  3W5U A;  3SYJ A;  2JUG A;  2EJR A;  2XAU A;  1NHA A;  4IRH A;  5KNL A;  2ESH A;  2X53 S;  2MBF A;  3AVT A;  1M1E B;  1NHC A;  3VO1 A;  1UMK A;  4OZZ A;  2WTE A;  3O8H A;  2FMY A;  2HPM A;  5A2Q K;  1YS7 A;  3H5N A;  2NS8 A;  3M07 A;  3CP8 A;  3T8R A;  5J8C A;  1W87 A;  3E20 A;  2NPF A;  4RDL A;  4P25 A;  1HZE A;  4UZF A;  3V7S A;  2LMD A;  4WWC A;  2R7Z J;  1HBX G;  4M9S A;  2ELH A;  2XNJ A;  2PJP A;  2XKO A;  1LJ9 A;  3WXM A;  2BV6 A;  2HTS A;  4RGX A;  1G2H A;  2V7W A;  3GXO A;  2VNI A;  2IGO A;  1RET A;  5D8L B;  4CIC A;  3OYA A;  3S3M A;  2XF6 A;  3RZO J;  3M7G A;  1QA1 A;  1ZYR F;  3ISX A;  3JU4 A;  4BPR A;  4EM1 A;  1VND A;  2H27 A;  1TSP A;  1T6Y A;  1FBS A;  2OBP A;  1SVO A;  2EIJ H;  1W5C C;  4Y17 A;  4G7Z F;  2NRA C;  4M6Y A;  3GTM J;  1R58 A;  1QX4 A;  1KCC A;  2VXZ A;  5ICG A;  2HDN B;  3BCF A;  3H3U A;  4KH3 A;  1IJW C;  1P4A A;  3CF2 A;  3DBH B;  3KYD B;  1ZG5 A;  4BY1 J;  1WOR A;  3AGP A;  2X1C A;  3PSZ A;  3SY2 A;  4OOI A;  4L5E A;  4AWX B;  4M3B A;  2X85 A;  4A3I J;  5IT9 Z;  1DBG A;  1KQ8 A;  2E34 A;  2VBW A;  3L2Q A;  1XFO A;  2QKL B;  1FOX A;  2HOE A;  1W7P A;  1K78 A;  3L7W A;  4Z4U A;  3KEW A; 
#chains in the Genus database with same CATH homology
 2KRH A;  1OHH A;  4UZU A;  1N77 A;  2CW8 A;  3RQ4 A;  4DNR B;  2GK7 A;  4CCM A;  4E0F A;  2VBM A;  2GOM A;  1FX0 A;  4CCJ A;  3LL7 A;  3BC9 A;  3S93 A;  3MKW B;  3QOE A;  4HPQ A;  3D5S C;  1OB0 A;  3OE7 A;  3VMV A;  1TZL A;  2MAB A;  4ZC3 A;  4Y3O A;  3ZXS A;  3HL2 A;  3FPP A;  4MXN A;  1BLI A;  2LH9 A;  2ZZQ A;  3WWG A;  3DQV C;  1VF7 A;  2O5R A;  3C2G A;  4B47 A;  3AKZ A;  2RQQ A;  1WJA A;  4XLE A;  1T0F C;  2X8K A;  2VKH A;  4ZDP A;  2CUZ A;  1Z3Y A;  4U87 A;  5JHF A;  4MLO A;  2VQG A;  1KZL A;  3LMW A;  3CJQ B;  1KCD A;  2ZTG A;  3H9G A;  3H9J A;  1V5F A;  4ZYA A;  3FHN A;  4BDY A;  1O8E A;  2X51 A;  3B90 A;  4HNU A;  2R4G A;  1E3X A;  3CJR B;  2Z6B D;  5C1E A;  4J01 A;  4JOM A;  3DPL C;  4XKC A;  4NNJ A;  3OEH A;  4H4K C;  3GQ9 A;  3DTK A;  3LMM A;  3QOD A;  3T9G A;  1VBL A;  2PJR A;  3OR1 C;  4CA0 A;  4E4H A;  2VQH A;  2IS1 A;  3ZPN A;  1PLU A;  1WJE A;  2QE7 A;  1X1D A;  4ITV A;  2LRD A;  1VJS A;  4B3F X;  2AQE A;  2IXS A;  3OYH A;  2GK6 A;  3SYT A;  3T56 B;  1V5E A;  3GBG A;  3W2V A;  1O8G A;  4II2 A;  3GRH A;  4DK0 A;  3VST A;  1Z7L A;  3G2B A;  4CUG A;  3OYD A;  3E0J B;  1K6Y A;  3OMY A;  4CCN A;  3OIP A;  3OY9 A;  1Y6I A;  4XNF A;  1W0K A;  1AIR A;  2R9V A;  1WPC A;  2L9S A;  1MW7 A;  2V9K A;  4JMQ A;  3OYC A;  2F43 A;  3SZG A;  2E1M B;  2O1D A;  1MNE A;  1X19 A;  4PMH A;  3MKZ A;  4LIT A;  4BQN A;  2AQF A;  4QPO A;  5FRN A;  3FKJ A;  3EPZ A;  4LIU A;  2KP6 A;  1LVK A;  2X3H A;  3AL0 B;  2HPI A;  1MND A;  4XL9 A;  1O8K A;  1JRG A;  2K3P A;  4B43 A;  2F6C A;  1MAB A;  3IUO A;  3D5R C;  1V0E A;  4TKO B;  2NOJ B;  1O8F A;  3PNY A;  3MD2 A;  4B44 A;  3CP2 A;  1T5E A;  4P5O A;  1UD4 A;  1BOB A;  1BPL A;  4NC8 A;  2V1N A;  2XND A;  4PFO A;  4HNT A;  4XMY A;  2JJ2 A;  2QXZ A;  3GQB A;  3LSK A;  1HVX A;  5LFA A;  3TL4 X;  1O8I A;  4X0G A;  2IS4 A;  2D3N A;  2QY1 A;  3ZCO A;  3CZ6 A;  3K4M A;  3OIQ A;  3HC7 A;  3OYN A;  2WAQ A;  1BHE A;  1RU4 A;  5C1C A;  4RMN A;  2UWM A;  4PJM A;  3GVJ A;  2X6X A;  4XQF A;  3LSH A;  3OYE A;  4D9J A;  4ZDO A;  2DT7 B;  2DIE A;  4CCL A;  2Q2E B;  4HEA 2;  2X1D A;  4HG2 A;  2WSS A;  2MC4 A;  4NUB A;  3B8Y A;  2VJI A;  4XOT A;  1D1A A;  3VSV A;  3IAM 2;  2VBK A;  3A3G A;  2VAS A;  3PNT A;  3OS2 A;  2V6E A;  4Z1M A;  1RMG A;  1TT0 A;  2Z16 A;  2Y0S A;  1OLT A;  3CES A;  3OYF A;  3J7A Y;  1I8D A;  2HVQ A;  2CV0 A;  1S9H A;  4W8Q A;  2L5Q A;  2ZXH A;  2BW3 A;  4XD7 A;  2LZJ A;  4EAT A;  2W00 A;  2XGJ A;  3KYL A;  3A2K A;  2DCE A;  2JVG A;  2IGN A;  2VXD A;  2GOX B;  4PK4 A;  4PFP A;  1NRK A;  3OYG A;  3K4K A;  2LG4 A;  1VLY A;  1WTH D;  2CV2 A;  1LFP A;  1IRX A;  2M3A A;  1GQ8 A;  2NT6 A;  1QJV A;  4F93 B;  3BCA A;  4YZX A;  5KHD A;  4KKS A;  4ZDL A;  3GVL A;  2VJ5 A;  2VLA A;  1X1A A;  1NBM A;  3OL3 A;  1D0Z A;  3DDY A;  3HPH A;  3GVK A;  1KON A;  2WAF A;  4TSF A;  2WB1 A;  2ZZE A;  3PSI A;  4BE0 A;  2E5N A;  4DOZ A;  3M1C A;  4G7X A;  5HOO A;  2R7U A;  3BC8 A;  1MMD A;  2WJY A;  1N78 A;  4W8T A;  3ZRG A;  3PNV A;  3VMW A;  3UNG C;  4MR0 A;  2O0V A;  4B3X A;  1N75 A;  1H8H A;  3H5A A;  4XON A;  1IB4 A;  4R79 A;  1O8H A;  4XN3 A;  2DOA A;  4KIT B;  4GRI A;  3OR2 C;  2BVL A;  1PKV A;  2CFO A;  1O8M A;  4NK6 A;  3MKY B;  4GQN A;  1X4P A;  4E7Z A;  1PE9 A;  4DIQ A;  3OW7 A;  4IKF A;  4U7B A;  1HA8 A;  4E7L A;  2ZZG A;  1Y56 A;  2R7V A;  1H80 A;  2O17 A;  3HPG A;  2Q1Z B;  3H94 A;  3SUC A;  2MFZ A;  2P0W A;  3DTI A;  4C30 A;  2R7X A;  2V4J C;  5FL7 A;  2EWE A;  4OAZ A;  5TGT A;  1JI8 A;  3VSK A;  2KL4 A;  4BU2 A;  3BCD A;  4BDZ A;  2HLD A;  3VSU A;  1QU3 A;  3BH4 A;  3MMY B;  2A5W A;  4XLA A;  3T51 B;  4ZTJ A;  2GJR A;  3DLA A;  4BJ6 C;  2FUG 2;  2VPL A;  2WJV A;  2W7N A;  4B3G A;  2I8D A;  5CKT A;  1EA3 A;  4XOP A;  2KHM A;  2BOL A;  3OWT A;  1WJD A;  4KJZ A;  3QYF A;  3S32 A;  4HWV A;  2KVO A;  4F92 B;  2HVS A;  4KKT A;  2IGK A;  4HSR A;  2LRE A;  3VDX A;  3ZQQ A;  1E0E A;  2VJJ A;  1G8X A;  1WJF A;  3K4N A;  4XLF A;  2ZXI A;  1X0C A;  3UW0 A;  4DGW B;  5CDF A;  2CS3 A;  1LDK B;  1MMA A;  4BUP A;  2WY8 Q;  2PMZ A;  4N4N B;  2BVM A;  2K9L A;  2KZV A;  3DPT A;  3EUK L;  4G7W A;  3ZPP A;  2VB6 A;  2VIX A;  4E7I A;  4DNT B;  1HG8 A;  3DEE A;  1NG6 A;  2OUM A;  4PSW A;  2RNG A;  3OYB A;  3PJR A;  2BW3 B;  4OJP A;  2LY2 A;  2ZSH B;  3OYI A;  2BSP A;  3VYR B;  3V42 A;  2NZM A;  3NE5 B;  2ZSI B;  2QKM B;  2XF5 A;  2R7W A;  3K70 D;  1KMH A;  4W8R A;  5FRM A;  2F1M A;  4Y4R A;  4XR6 A;  2K9M A;  4ZJZ A;  3RCO A;  3H0D A;  2NTB A;  4C9Y A;  2M5S A;  4ASU A;  4C2T A;  3FDY A;  2DT6 A;  1DBO A;  2NTQ A;  3IP4 B;  1W36 C;  2PEC A;  4PUS A;  2INU A;  1H8E A;  2W4S A;  3S3O A;  1D1C A;  3KEW A;  4XKW A;  3W3C A;  3M8J A;  4P22 A;  1D1B A;  4LIV A;  3OEE A;  3HG9 A;  4U49 A;  4URR A;  3L2U A;  4I84 A;  2X6W A;  2HVR A;  2X6Y A;  5CQE A;  4TT3 A;  1IDK A;  3A35 A;  3DU5 A;  2CK3 A;  2JVH A;  3ONQ A;  3H9Q A;  1WJC A;  2RRE A;  3OYM A;  1NG7 A;  2KMU A;  2ZFU A;  4AYB A;  3L2R A;  4RLQ A;  1T95 A;  2XDV A;  4JQF A;  2LC2 A;  4L8J A;  3A4C A;  3EQN A;  1WJ5 A;  3A3B A;  3DTE A;  4BAC A;  2JIZ A;  2KLO A;  1V0F A;  4BGD A;  2L7K A;  1O8J A;  4YEJ A;  2XZP A;  1BR1 A;  3K6G A;  4FAS D;  1CZF A;  1SFK A;  4ZTF A;  4AU7 A;  3L2V A;  1X1B A;  2WY7 Q;  4NQW B;  4PJL A;  4DBQ A;  4BE2 A;  3U21 A;  2VKD A;  4NC7 A;  4BS9 A;  3C2H A;  4RM3 A;  2M4G A;  4DBR A;  3HOT A;  2NTP A;  2F4I A;  2WBM A;  2HU9 A;  2LYC A;  2Z1D A;  1V5G A;  5HNH A;  3I3L A;  2W82 A;  3PFY A;  4U4B A;  1BR2 A;  3HKZ A;  2F5V A;  1UD2 A;  3GQA A;  4CCO A;  4BQO A;  5HLT A;  4W8S A;  3K4J A;  4NK8 A;  2HZD A;  4XM3 A;  1MMN A;  2V31 A;  4Z05 A;  2A6T A;  4AVZ A;  2PYH A;  2CW7 A;  2XSJ C;  1BN8 A;  3SDB A;  4BJT A;  3OAA A;  1FMV A;  2VQC A;  3K4L A;  3UR3 C;  1U0J A;  4DK1 A;  3W2W A;  4FET A;  2PJR B;  2KRC A;  2LBF A;  4KIS A;  3G05 A;  2WZP P;  1I18 A;  2QX3 A;  3LSI A;  2JDI A;  2O04 A;  2OV7 A;  3OOC A;  1J09 A;  4ANJ A;  4E7K A;  1SKY B;  3KX2 A;  2IGM A;  4HST A;  1E1R A;  3DPU A;  1ERD A;  4C2L A;  4YZQ A;  4F55 A;  4XLH A;  2K5C A;  2CV1 A;  1Z3X A;  1IA5 A;  3OL4 A;  3FY3 A;  2W6I A;  1E1Q A;  4OJ5 A;  4XLC A;  1OGM X;  3QYB A;  2NSP A;  2JA2 A;  2M4K A;  4BEH A;  3LSG A;  2WPD A;  2INV A;  3EUA A;  1OOC A;  2R7O A;  3DKY A;  3A1Y A;  3RSN A;  2VL8 A;  4KKU A;  3FBN B;  3VYS B;  1WMR A;  2X1E A;  4PSX A;  1AA7 A;  2VJ4 A;  3NWS A;  2CUJ A;  2M7A A;  3FBI B;  4YEL A;  2JJ1 A;  2E60 A;  3OS1 A;  1DGW Y;  2VQL A;  2R7Q A;  2ODL A;  4DJA A;  1DGR M;  3PUB A;  4G6I A;  3KRG A;  4QPQ A;  4BEH B;  1P9Q C;  4E6K G;  3HXL A;  2O0W A;  2M7B A;  3DU6 A;  3HAG A;  1OFM A;  3OYL A;  1OGO X;  4E7J A;  1E43 A;  2L2O A;  3E1S A;  1UD5 A;  1BMF A;  2OC6 A;  2D3L A;  2Z2S B;  1UAA A;  1O88 A;  1PJR A;  3CMM A;  4IZZ A;  4LG3 A;  2NT9 A;  3ZIA A;  2WAD A;  4J00 A;  4YZA A;  1K5C A;  2V26 A;  3BG7 A;  1UEL B;  3IAS 2;  2MD0 A;  5HVQ C;  3DWL E;  4F52 A;  4XN0 A;  3VYT B;  2GJP A;  3LNN A;  1JTA A;  3VWB A;  1LKX A;  1WJB A;  2CMP A;  2V7F A;  3H35 A;  2R7T A;  5HNF A;  5CQG A;  2ZZF A;  4XKB A;  2UVE A;  4G6T B;  2XC7 A;  4PJJ A;  2GJK A;  4C2U A;  3BLY A;  3GQ7 A;  2KPM A;  3FKS A;  1DQU A;  3ZR8 X;  3GQ8 A;  3OYK A;  2V4D A;  1UD6 A;  3VSL A;  4P1W A;  3RTR A;  4II3 A;  2Z8G A;  4Z06 A;  4HIZ A;  1W36 D;  3VR6 A;  2E1M C;  5HKK A;  4OZY A;  3LSM A;  2V7Q A;  2R7S A;  2L9N A;  1OFL A;  2UVF A;  2VBE A;  1COW A;  4YZ0 A;  1K28 D;  3AL0 C;  3S8P A;  3N05 A;  1X4O A;  3HUG B;  1WP6 A;  2LOO A;  4XKV A;  2ZTN A;  5DN6 A;  2NST A;  3HOS A;  2XOK A;  3T53 B;  4BL0 B;  1W0J A;  3PSF A;  1E3Z A;  2XF7 A;  4OJL A;  4RM2 A;  3PL8 A;  4F3Q A;  3SEQ A;  1YX5 A;  3ZSC A;  3OS0 A;  1QHG A;  2E5Z A;  3VYU B;  3OYJ A;  3W2A A;  5IK2 A;  4IQ4 A;  1O8D A;  3TBI A;  1IDJ A;  2IS6 A;  4BJ5 C;  3EQO A;  4KT6 A;  4EW9 A;  4Y33 A;  1D0X A;  2WA0 A;  2LBF B;  2DXI A;  3AFH A;  3JUR A;  3K10 A;  4IX7 A;  3QYE A;  3L2W A;  1SAU A;  1WFX A;  4F91 B;  1O8L A;  2LY1 A;  1PXZ A;  3K70 C;  2JUG A;  1VZ0 A;  3TMO A;  2XAU A;  5KNL A;  3SEZ A;  1EE6 A;  2XZO A;  2X53 S;  4CCK A;  1W9X A;  1UG0 A;  1EFR A;  1RWR A;  2PYG A;  2UV1 A;  4OJ6 A;  4N4O B;  3LFU A;  2WAE A;  4D1Q A;  5LD2 C;  1UD3 A;  1NHC A;  4OZZ A;  2XZL A;  3I9V 2;  2HPM A;  3B4N A;  2HQA A;  3KEY A;  4XOR A;  1PYV A;  3H5N A;  2CH0 A;  4IQJ A;  2R7R A;  3CP8 A;  4E7S A;  1D0Y A;  2ELJ A;  3H5R A;  1ZEL A;  3RPU D;  1HZE A;  5FRO A;  1Z21 A;  1QHH D;  4CH7 A;  3F9K A;  3K4C A;  1YE9 A;  4BE1 A;  2W1O A;  2W6J A;  1QCX A;  2MYS A;  4Z03 A;  4CZC A;  1UD8 A;  2IQ7 A;  2IGO A;  4RLF A;  4BXF A;  3S3M A;  3OYA A;  2XF6 A;  2KQR A;  3D5L A;  2HNH A;  4CSW A;  1FMW A;  4E7H A;  1GLN A;  1DP3 A;  1YX3 A;  4OAY A;  3JU4 A;  2JSP A;  3OPO A;  4FXU A;  1G59 A;  1BR4 A;  3S3N A;  3K4B A;  3ZGK A;  1KCC A;  4OWR B;  2VXZ A;  1E79 A;  3BCF A;  3WQZ A;  2IS2 A;  1X1C A;  4B48 A;  5KCM A;  3BG6 A;  3CF2 A;  4PJN A;  5CPR B;  2HDW A;  2E1B A;  1XG2 A;  4YRV A;  2X1C A;  3EUH C;  3OFN A;  4BQQ A;  1OR7 C;  4OJO A;  3NWT A;  2X85 A;  4YXW A;  1DBG A;  2M0M A;  3DKX A;  3L2Q A;  1MMG A;  5AMV A;  2QKL B;  3BCB A;  2UUZ A;  1R6R A;  2DJI A;  3OOU A;  4HRI A;  1KTW A;  2KDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...