4XONA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xonA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xonA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xonA02
1IA5A 1PE9A 4W8QA 2VBMA 2VBEA 1GQ8A 2NT6A 3KRGA 4YZQA 3EQNA 1H80A 4XOPA 3WWGA 2X6XA 2NTBA 2X6YA 4YELA 1AIRA 1RU4A 2QX3A 1WMRA 2UVEA 1O88A 3VSVA 1JRGA 3GQ9A 1CZFA 3VSTA 1EE6A 2INUA 4MXNA 1PXZA 4OJOA 1QCXA 2BSPA 3GQAA 5AMVA 5C1CA 4XQFA 4XMYA 4NK6A 1IDJA 4XNFA 1OFLA 1O8KA 3FY3A 4OZZA 4U4BA 1IB4A 2VJJA 2NTPA 4OJ5A 2IQ7A 2VJIA 4YEJA 1BHEA 2QY1A 5C1EA 2PECA 1HG8A 4YZAA 1KTWA 2Z8GA 2NT9A 4OJ6A 2PYHA 1OGMX 1O8JA 1OFMA 3GRHA 4W8SA 1VBLA 4XL9A 1K5CA 4XR6A 1OOCA 4XN0A 4XLAA 1O8MA 3GQ7A 1KCDA 1KCCA 1O8HA 2O1DA 1O8FA 2NSPA 2X3HA 3B8YA 4YZ0A 4XN3A 2EWEA 3GQ8A 2ODLA 4Z05A 4MR0A 1O8EA 1O8LA 1JTAA 2O0VA 4XLHA 4XONA 1DBGA 4OJPA 3B4NA 4EW9A 1XG2A 2PYGA 2X6WA 4C2LA 2O04A 1RWRA 4HWVA 3VMWA 4XLCA 3T9GA 2UVFA 4OZYA 2X85A 1O8GA 4XLEA 3B90A 3LMWA 3UW0A 1QJVA 4PMHA 4OJLA 1RMGA 2NSTA 4XLFA 4W8RA 1NHCA 4XKVA 4AVZA 2NZMA 1O8DA 4XOTA 3EQOA 3JURA 1BN8A 2INVA 2VBKA 2QXZA 4URRA 1O8IA 4Z03A 4XM3A 1OGOX 2O17A 4U49A 3VSUA 4W8TA 4XKWA 1PLUA 2O0WA 4YZXA 3VMVA 3ZPPA 3SUCA 1X0CA 4XORA 4NK8A 4Z06A 4I84A 3ZSCA 1DBOA 1IDKA 2NTQA
chains in the Genus database with same CATH superfamily
2JSPA 1Z05A 3S3OA 1BIBA 3SDBA 1YIOA 3LO8A 2VBEA 4ON0A 4XOPA 4XRSG 1P4XA 4AU7A 3WWGA 4EQQA 1QVUA 2ELJA 1Q86D 1WU8A 5K7ZA 3CCQB 2EBIA 2HKXA 2BV3A 3JRAA 3MZ8A 4B09A 3I59A 2XGCA 3FF5A 3JRHA 3CJQB 3CF2A 2OTJI 3CDIA 3AL0C 4U88A 1KU2A 3WHCA 5THXA 2GOXB 4L8JA 5LGNA 5ILUA 5IK2A 3LWFA 1T6SA 3OW2B 3OJXA 2BVLA 5D8LB 3SJPA 3DPUA 1U9NA 2F3LA 1FSHA 1RI7A 4UAJA 1TWAJ 2GIZA 4JX5A 3JRIA 2OA4A 5JMCB 2WJVA 5B5EC 3BC9A 4HF2A 1PKVA 3HOWJ 5BSYA 2NVUB 1YI2B 1WJAA 3WG7H 4RLZA 1WDTA 3QYBA 2VBYA 2VT2A 1KGSA 3WGHA 3E7LA 3RQ4A 1ZRCA 3F3XA 1ZN2A 2VIXA 2OYNA 2RQPA 5L46A 4MHGA 5EGOA 2MH9A 4C3IJ 4LG3A 4HZFA 4MLOA 2YU3A 4J0QA 4L9TA 2A05A 2F1MA 3GRHA 3TDUC 1N06A 3P9CA 1T8IA 2W85A 1APLC 3MD2A 3T0YA 2YPRA 4Q4ZF 4ZV4A 5AIPA 3MMPA 4LLNA 5AN9A 1ZLKA 2CQQA 3BCBA 4BPRA 1KCCA 2HQAA 1U2WA 4HNUA 1Z6RA 3TQNA 5BOXA 2VKEA 3M9AA 1I3QJ 1LEAA 1J75A 2KISA 2VNIA 2ZZQA 1WQ2A 2X3HA 1IN4A 3JRBA 3R0AA 2F5DA 2XPUA 3VNUA 4CCKA 3SFIA 1QH0A 1DARA 1QX4A 2E71A 2CWEA 3FXQA 1WJEA 3JW4A 2KIFA 5FKLA 3RPUD 5BNGA 4XKBA 4XLHA 1MKMA 1QA6A 3ZN0A 1TWGJ 1DBGA 4UB8C 4ZGQB 3ONYA 1X58A 1P7JA 5CVRA 5IOYA 3I4MJ 3OIPA 2HYJA 5GPCA 3A8JA 1RQRA 1IUFA 4PJLA 4JOMA 1BC7C 1AU7A 3FXJA 2JJ2A 2Z3YA 3NQOA 5L3EA 1H8HA 4G6IA 4NBSA 3V76A 2P3MA 2V4DA 4P55A 2NZMA 2XGJA 1U2RA 3FK7A 1J0RA 4HLXA 4KN4X 4OOIA 4AD9A 3K69A 1JTYA 2AQEA 4B47A 3OYNA 2VBKA 1R36A 3G6EB 4N3GA 3BPVA 3G1OA 2DT6A 1ETWA 2QDXA 4HSRA 2R7XA 1P9QC 2ZL5A 1VQPB 1QFJA 1B2RA 4II3A 3J7AY 5J35A 3VO1A 1W1WE 4GQNA 2Y0SA 1EH8A 2L7MP 2PEXA 3VMFA 2XHKA 2E1OA 1FOWA 3CF5F 1MGTA 3BTIA 4NHJA 4N4NB 2PIAA 1YLFA 3CCMI 2KDZA 9ANTA 2GQFA 1Z91A 4A3MJ 2B63J 2QTZA 2M7AA 4UNOA 4PJ0C 1S72B 1SFOJ 4Y7CA 2YSRA 1T39A 1D3YA 3E1YE 1MBKA 1OYWA 2EA4A 3F8MA 1SD6A 2XSJC 3O8HA 1HKSA 4MFEA 1Q1VA 2ESNA 1KZLA 2X6YA 4P9UA 1RU4A 1X4OA 2HI3A 3UR3C 1VQ9I 1LDDA 3R0JA 3PSZA 2F5FA 3ZP5A 5K5OA 1X3WB 3GZ6A 4TT3A 2JWTA 1U5TB 1EE6A 1H0MA 2GJRA 2V6CA 1FP1D 1RR8C 3Q38A 2XT4A 2H1KA 1ZTRA 1ETXA 3WE3A 2LR8A 3SXYA 4X06A 2VBZA 4FE7A 1IGNA 4UZUA 2W00A 2OTLB 2L5QA 4BUPA 1G3TA 2IOUG 4LMYA 3ERED 2UV1A 2Y0SN 2JK3A 3EUKL 1HZEA 4UUTA 1ZG3A 2ID6A 4RS8A 4A0YA 1QGYA 2PLFA 4EGZA 4YAUA 3EUHA 3BJ6A 5JLXA 4E7IA 1TL8A 2GK6A 3K10A 5J8FA 1UHWA 1KYWA 3OOUA 1YJNI 3H9NA 2HQ5A 2JN6A 5F08A 3PIOF 5M3MJ 4KISA 3GFMA 3L9FA 1HOMA 1WFXA 2JPBA 2O9LA 1IJWC 1SFEA 3HSRA 1VI0A 3AG4H 1MIJA 3V4GA 2G0YA 4A5NA 1B8IA 3L2UA 1W0KA 1RKTA 2JVGA 1FBSA 3CW2A 4KKUA 4WZTA 3J80Z 3OYFA 2H94A 5IP6A 3LL7A 1J9ZA 3JAMZ 1EJ9A 3ASTA 2BZTA 1DPUA 4Y17A 1IXCA 4IHWA 4PC1A 2EH3A 3DQVC 3H9QA 3WTVC 2F4OB 4L18B 1IV8A 3OYLA 2P5LC 4IHVA 4HBLA 4F93B 2JA6J 4WCGA 3DTIA 5D5UB 2QQBA 4XONA 2R7WA 2DA1A 4J00A 5E1XA 2JDIA 3A03A 1VQMB 4RGRA 2IT0A 3D5SC 1O4XA 4G12A 2CBXA 3LSGA 1S0UA 5DD8A 3F0CA 3HKZA 3HPGA 1LDJA 2LBFA 4LJZF 4UZFA 1O3QA 3PNTA 1RRJA 3ERMA 2ZZFA 4CYCA 2V26A 3ZMSA 3IHUA 1PUFB 1XMAA 2R5YA 4ZTJA 4M6YA 2GBYA 5ILVA 1CF7A 4XKVA 5F0CA 5M3FJ 4QVAA 4F3QA 1KD1D 4HIZA 1PJ5A 1UD4A 3JURA 2QWWA 4RAYA 4DIQA 5BQTA 3BY1A 3AVWA 5EG0A 2A68F 3E6CC 2ZBUA 4FN5A 3J80K 5CLSA 5HKKA 1IN5A 4Y15A 1EP2B 3HJEA 4Y9UA 4LIVA 1L3LA 4ASNA 4YIIA 3REOA 4Y33A 2XAFA 4BY1J 5EMNA 2EZLA 1U3EM 4AYBA 4AC9A 5KSWB 5KW9A 1JGSA 3G71I 2IS4A 4WWCA 4MGRA 2XPVA 4WXDA 5D6EA 2ZTNA 2LMDA 2PLYA 1BOAA 1JB9A 2CSOA 4LFUA 2DLLA 4D7MA 3KEWA 4OPSA 4N0BA 5FB2A 2HNHA 3U9GA 5L3BA 1I8DA 1H80A 4I98B 2UUZA 1U8BA 4JP0A 1ITYA 1K78A 1TW2A 1WMRA 1T6YA 3OZVA 5FO0A 1O88A 1R5BA 2XAGA 3SFZA 4A3JJ 1ZELA 4Z4RA 3HTUA 3JSOA 2P0WA 5GTIC 2INUA 2Y69H 2E1RA 3PNYA 3L2QA 2UWMA 1HQCA 4BY7J 4P1VA 2FEZA 1MW7A 2AXLA 1IC8A 1O7LA 4LBYA 1KQ8A 2HS5A 4V19K 2BF4A 1SKQA 1OFCX 1Z3XA 2JA2A 2VNJA 4D0PA 4A3KJ 4UV8A 1I6XA 1OYIA 3V8LA 2EIJH 4CO8A 5C44J 2ZJRF 5H2FC 4EJTA 1OGIA 3TKYA 3TMOA 2QBYB 4ZYGA 2XPWA 1VQ7I 5FRNA 2R7UA 2RGVA 4M6VA 3FXKA 3Q0WA 2A3SA 2CYYA 4AUXA 4DBQA 4Q7JB 1KTWA 5J6XA 3AGPA 1ZLJA 2IP2A 5TRDA 1MSFC 1OHHA 4HDVA 1TTYA 2FQ4A 1JJ6C 4XSZF 3OIOA 2D9RA 3B82A 1OFMA 3DWLE 2ZCWA 3NWSA 2EFWA 4RM0A 1VFCA 3CMEB 2Z1DA 1IJEA 3PO2J 2LK2A 4YIFA 3HG9A 2IBDA 2A6EF 1Z7LA 1DU6A 1BQEA 2RNGA 2CV1A 4P9FA 3RKXA 2O1DA 4OPVA 1R5OA 2R7ZJ 1WRJA 2KPMA 4BYYA 3H36A 2DPDA 2LD5A 2HPMA 3ML6A 2FUG2 2MA3A 3QOPA 1LNWA 2OBSA 1O8LA 1TQIA 2W1OA 2O0VA 2E7WA 2CQNA 1RC9A 1W5TA 3ASQA 2KKOA 3BR3A 1E63A 4U0VA 3F9KA 1I27A 2QQAA 2WSSA 1ACIA 4X8IA 4M3EA 5KNLA 3N4MA 2V9KA 3GMEA 3WTYC 3Q3SA 4ENJA 4HWVA 4Y52J 2X85A 1ZM4A 2KRHA 3B6AA 3CTAA 3HSFA 3L09A 1BMFA 3ZQFA 2DYSH 1BI1A 4OJLA 4ZYEA 5K7FA 2QZ8A 2O6GE 4YC5A 4UVBA 3L2RA 4RCYA 4OMZA 2P5KA 3PA2A 2YUHA 1AMOA 2R5ZA 2C2WA 4I2OA 2WWYA 3BR5A 4A2UA 3JCUC 4B44A 4ESJA 5JLWA 2JA7J 3Q0VA 3CC2I 1UB9A 4EATA 2PMZA 1LUJB 1WORA 3I3LA 4IX7A 4NUBA 3WNBA 1XQBA 1T6XA 2OBRA 1NK2P 4OIOF 3DCFA 4ZCLA 2DBBA 1Y1VJ 1PYVA 3HOTA 4FXUA 1JT6A 1FOXA 5HDGA 5K7HA 1VF9A 3IWFA 1FP2A 2FBHA 2Y9ZA 1D8JA 5EEGA 4XLPF 2HEOA 2O8KA 4MO7A 2BW3B 5JR3A 4XBFA 3ONUA 2ZFUA 4YELA 1K8FA 1Y8QB 1IZ1A 3S1QJ 1ETQA 2LF7A 3CMAB 3GQ9A 3BLYA 2GQQA 4BHBA 5HZBA 1MBJA 2STTA 1N08A 2DT5A 1XG1A 1JXSA 1HSJA 3TW7A 3GVKA 3CJTB 2E1CA 2FE3A 1SVMA 3DBLB 3C2GA 3ZCOA 3K9TA 3Q5FA 3W2EA 4WZKA 1QO0D 2YWFA 1K4SA 1CQXA 3WU2C 3J7AO 2BM7A 2GPJA 2JMWA 4XRSA 3PUBA 1D8TA 1EWYA 1IO2A 2DCUA 2HOEA 4YAOA 4B4CA 5DUKA 4IKFA 1VLYA 3RIQA 2BX6A 3RYRA 4C2TA 1MNMC 1VQOI 3TP0A 5FO1A 1USTA 2DOEA 3PQKA 3V8JA 4CCOA 1VQ7B 2GOMA 3SQNA 3ZIAA 2OAZA 2E36A 1FRQA 5C4XJ 2WY8Q 4TMTA 2RC4A 3OS2A 2IGOA 3LFKA 2QF7A 3U2RA 3K7AJ 1OB2A 3JU4A 4OWRB 1YW7A 3FK6A 1AWCA 1VBLA 2L9VA 3ZZUA 3A2KA 3L00A 3LSHA 5CKTA 3H3VK 5F04A 3MCAA 1MMAA 4B1RA 2IPQX 2VQHA 2QLZA 2VQGA 3KP3A 4E70A 4IHTA 2C78A 1O8MA 3ABKH 2HQRA 2Y48A 3E1SA 3KP6A 2ZSIB 3VFZA 2BSAA 2C4TA 4IRGA 3QU6A 4RDKA 4IO9F 3HDDA 3FJOA 5BSXA 5TGTA 2D74A 3VYSB 4RB0A 1VQ8I 1X2NA 3IP4B 2EWEA 1QZEA 2DEUA 3H9GA 2IS2A 3P5JA 4N9IA 2V1UA 2DERA 1W5CC 5E79C 1JA0A 3M3YJ 4E6KG 4A5MA 2R7OA 1W2BB 4W1UA 4RPBA 2BM0A 2GM4A 2NVXJ 4C3HJ 2HKOA 3BG5A 4HNTA 1YW9A 1NK3P 4M3BA 2W7NA 3BG6A 3M8EA 4OZYA 5D4RA 3QFRA 3CC4I 3DEWA 2QKLB 3SDGA 1GV2A 2HDNB 3G71B 2KIQA 3TW6A 4BDYA 3GQBA 3QPSA 5J8CA 3S1NJ 5TISC 3CP8A 2ZBVA 5F0FA 3CCVI 1NHAA 4C9YA 2QEXI 3WTTC 2FX0A 2MSYA 2VQCA 1YX5A 4AC0A 2VOPA 1G3YA 3W2VA 3LSRA 3DP7A 1U8RA 1G7TA 2VI6A 1XGMA 1GUUA 1X4PA 2X1EA 1SVOA 2R7RA 2L4MA 1E1RA 2H6BA 1F60A 3A3BA 3OZUA 4P12A 3F22A 4IOCF 4LD5A 4M9ZA 4E7KA 4BGDA 1G59A 4LB5A 3GFIA 3P9IA 2HXOA 2V31A 4M2LA 3H9JA 5LGUA 2G7HA 4YALA 2F5VA 3QFTA 4HPQA 3IKTA 2QGUA 2HZTA 3I53A 2YWHA 4R8HA 1XD7A 2M5WA 2WY7Q 4ZDPA 3IWZA 1SAXA 3RTRA 2V6EA 1ZR4A 2XTYA 3FX3A 4PFOA 3NARA 2DK5A 1JUPA 5F64A 1X1DA 1WJ5A 4FX0A 4IF4A 1QG0A 2ZZGA 2HGCA 1W87A 2K4JA 1YRNA 3VWBA 1QFZA 2FNAA 3QP6A 1W35A 5M5XJ 4B4DA 4EMSA 5KVRA 1ZHFA 2RQQA 4B43A 4BEHA 4CZZA 1D5YA 4ZH4F 2IJLA 3M7GA 4EVIA 3VSTA 2KIMA 2LC2A 4M4SA 5LHHA 1XGOA 4EH1A 3D26A 2RDPA 3HEFA 5E18F 1YS6A 2K9SA 4Z2YA 5FL7A 2KLOA 2W6JA 2NOJB 1WKMA 3VODA 2M2EA 1H89C 2W24A 4KT5C 1S5LC 2FMYA 3R60A 3WYAA 4WXHA 1UJ8A 1OCPA 3K4CA 3ZZ0A 3M07A 2QY1A 2LY1A 2DFEA 4JK1X 3ISXA 3OR1C 3HC7A 3Q9VA 5E3OA 1RR7A 5FFZA 2V7TA 1I1GA 1KRHA 3WQZA 2XC1A 3KPHA 1TUIA 1B4AA 1MDMA 2LTPA 1XX5A 4HNVA 4FWTA 4MEXF 1TT5B 2FBKA 1A36A 4O3MA 1O8JA 4JYKA 2ZNZA 5FGMA 3G4SB 2ZZEA 1ZK8A 1K5CA 1WXRA 2EZKA 4DQLA 3BT9A 5IT9Z 4ZC3A 1SVLA 2OTLI 2XSDC 3ZBUA 5DCFA 2E2JJ 2JRMA 2ZKZA 4AF7A 1WPCA 3GSIA 1O8HA 5B1AH 3MWMA 3N97A 1DU0A 3AVXA 4DNRB 3B8HA 5ED4A 2X48A 2VOOA 1O8FA 4A12A 3B8YA 1BBYA 4L5EA 1K4ZA 1KC8D 2LFBA 4A3LJ 3FMSA 4B48A 2L54A 4BJ6C 4ETSA 3CCEB 5M5WJ 4GCVA 2KP6A 3OL3A 2ZMEB 1E64A 2CW8A 5IYNA 4LBZA 4RD0A 5CDFA 3SJZA 3FM5A 1XG2A 4GYGA 2DTZA 1JKOC 5H6RA 4PC6A 3DEUA 2HWVA 2W7ZA 4IVNA 4XRMA 3OZWA 2H27A 3H5NA 3Q6QA 4C43A 2F43A 1XFOA 4QVJA 3IC7A 5HDNA 1X1AA 2EQRA 4PMHA 2K4BA 3RPQA 4ENKA 3OEEA 3BG9A 2ECBA 3IH3A 2XGXA 1WJFA 1FBUA 1VQ5I 3KX2A 1F43A 2PG4A 4RDLA 1B6AA 2BEOA 2EV6A 5KCMA 4UUSB 2KJCA 2KT0A 4BJTA 2DPUA 2K02A 3MEXA 2WPDA 2XAHA 1WSRA 2AHQA 1E3PA 2IS1A 4BDZA 3VSUA 2M5SA 3GTQJ 4PC2A 4CH7A 3K70D 2WAEA 3R4KA 1XCVA 3QRFF 2O0WA 2FXAA 2PMZN 5A2QK 2LKXA 4PGHA 1OCOH 4MTEA 1GAQA 1BR1A 1UD2A 5GPAA 3B78A 2PMHA 5ICFA 2L7FP 4HF1A 4OAZA 4I0AA 3WHBA 2ZSHB 4E7LA 1R49A 3DDYA 3LQEA 3ZSCA 3VR6A 1ZH5A 1OLTA 4HE5A 1D0ZA 4OOSA 2K7LA 3OYCA 2NRAC 5LD2C 1DP7P 3KRGA 1KQ9A 4ITVA 2QGGA 3F23A 3FISA 1HKTA 2GA1A 3CCEI 2Q6OA 1TZLA 4UHTA 1T98A 3BY2A 4TSFA 1X19A 3SLDA 3S32A 3CP2A 1FNDA 4CXFA 3ABMH 3WG9A 2EFOA 1R5GA 4ACAA 1ZQ3P 3S3MA 2BY1A 1Z0XA 2HYGD 4QTRA 4RD1A 2Q8KA 3AVVA 1R7JA 1XDUA 1FNMA 5E20A 4CCNA 2BGCA 5BPDA 1K7AA 2GAUA 1FNCA 3OS0A 2XGDA 4CZCA 1VNDA 3WTUC 2MYSA 1OQYA 2OZUA 2D45A 5GAEJ 4RLQA 3W5VA 1N8RD 1EXMA 3HRTA 2YWEA 1QVFB 3BTJA 2JN9A 3GVLA 3AKZA 1YG2A 2QSFX 2MW8A 3JSPA 1LKXA 3AG3H 3OPOA 3CCLI 2O6WA 3M8FA 3CQZJ 1K4TA 4S04A 3C2BA 1VTNC 3OSGA 1YJWB 2DA5A 1IN8A 2LDUA 4P2NA 5IY5H 2Q6LA 4O6JA 4U7BA 1SFUA 2OF7A 3FBNB 2HZDA 1SM4A 4B3GA 1K73D 3H09A 3H0DA 2BM6A 2CQ7A 2DA3A 1HCRA 2KZVA 3F6VA 2OTJB 1SMTA 1N25A 4EJWA 1E3OC 4AM3A 4XN3A 1TSPA 2NVTJ 1Y0YA 1JI8A 3GF2A 2I10A 4Q48A 1V4RA 4G7ZF 4KUMA 2LSOA 4X05A 1Q82D 2NV4A 2YX7A 4I09A 5GAHJ 4KMFA 4IJAA 2VXDA 2CUFA 3U1KA 3BWGA 3KCCA 4FX4A 3BDDA 5B1BH 2EV0A 3F6OA 4QLCU 3NE5B 3PO3J 2HQNA 3HOVJ 1LE8B 3T9GA 4LB6B 3AVYA 1VHOA 1W4MA 1XSDA 1VQLI 4CCLA 1OJLA 5L3CA 3MN2A 3I58A 3GBGA 1W9XA 3OFNA 4TKOB 2QA4B 1OMIA 2VLAA 4C2UA 1DGWY 3PFIA 2DOFA 1EP1B 1AKHA 2FOWA 1VJSA 1VQKB 3LSKA 3K4MA 4M71A 4OIQF 1E1QA 3K4LA 3S1MJ 2HU9A 2JIZA 1L1IA 1P92A 2BN4A 3MFKA 4L9NA 2X9DA 5KAIC 1V5FA 1G8XA 1H42A 2QEXB 1GT0C 2IA2A 1Z6TA 3H5RA 3D5RC 1MMSA 1GHCA 2BVNA 2HCJB 3VEPA 1Y1WJ 3R61A 1D1CA 1TYUA 1AIPA 3HRSA 1WJCA 4G6DA 2FJ1A 3GTLJ 2CRVA 5B6IA 1OGJA 3ROUA 2Q6IA 3TP3A 2WYRA 1IA5A 1PP7U 5H6QA 4C30A 2DY1A 3KYCB 4PJJA 2PFBA 5K5RA 2DA7A 5DS9A 3CCJI 1Q9SA 2NVQJ 3GW2A 1GVJA 1WJDA 4RGSA 3QOEA 4DW6A 2JA8J 3WGIA 1ZUNB 3OS1A 2XAJA 2HDCA 1A8PA 4YG2F 3GO5A 3U21A 2OZ6A 3E5QA 4RD6A 3HRUA 1PXZA 2K3FA 2F6CA 2KHMA 2QE7A 1YYVA 1YJWI 4U87A 4BQQA 2X0LA 4CICA 3FY3A 5TY0A 4RD4A 3GUDA 5LLQA 2B9SA 1QPIA 3CC7I 1S7OA 2A61A 1JT0A 2X3UA 1EF4A 2M9HA 4P3YA 2Q2EB 2WAFA 4C0SA 3T8RA 4YEJA 4QSHA 3OSFA 3TDZC 4Z1MA 3HOXJ 1HG8A 2WADA 2C5HA 3H35A 2TDXA 4UVAA 1YE9A 4UZEA 1D1AA 4BQAA 3LQRA 3RKWA 1R4NB 1HDDC 2ZJQF 2E35A 2ADUA 4G7HF 3A02A 2Z2SB 2J5OA 4W8SA 1QA3A 3DKWA 4JBAA 2ZTGA 1OOCA 1XDSA 2Z33A 1RKWA 5LRRA 4XLAA 3Q9SA 2ECCA 2Z6BD 2XZOA 3GQ7A 2DMPA 3GTMJ 5IYRA 3BTCA 3A4CA 3IKVA 1UMQA 4AIKA 1MMNA 2VBUA 1F9NA 3CDHA 4EJUA 4LG0A 5HLHA 1O3SA 4AF6A 2V1DA 1Y0RA 5DUIA 1MRZA 3SZEA 3ZOBA 2B0LA 1IG7A 2BGIA 1J5YA 4F7ZA 1ULYA 2XEXA 2J7KA 3RKYA 3J81Z 5FROA 3DKYA 3PL8A 1R22A 4OU0A 3KYLA 3ZZTA 2UVFA 1F36A 1K83J 1ZRFA 1USSA 1SAUA 2P4WA 4AYBN 4A3CJ 3CCSB 2XT2A 1T0FC 2O0YA 2E60A 2R7VA 1EFTA 2VPRA 1QQ1A 1XB2A 3ZQGA 4D5CA 3PJRA 1UG2A 1WOSA 3QP5A 1OFEA 2JTVA 1LPQA 1MMGA 4LLLA 4DK1A 1BL0A 1U5TC 2WTEA 1YO5C 4DJAA 4QFMA 2WA0A 2ELHA 1H9GA 2ZXHA 1TQMA 2V79A 4URRA 4PGGA 4XM3A 3LFUA 3QWLA 5HODA 4V02C 1X3ZB 1MBEA 2F4NA 3OAAA 2JUCA 3LNNA 2ETHA 4AWXB 2BVMA 1FEXA 2LOOA 1N05A 2MG4A 3KZZA 2VNHA 3TL4X 4NK8A 5DV5A 2IW5A 4K1XA 3RI4A 2XDVA 4NQWA 5DDGA 2BGJA 4HSTA 3WNDA 3SYTA 2W4SA 1DBOA 5ERIA 3M1EA 5E8IA 4E7ZA 3WBKA 2KFDA 4WX9A 1XCBA 2QENA 4BBSJ 3EQNA 1BN5A 3BOQA 4G7OF 1DDIA 2G9WA 2BPOA 1FBQA 3PUNA 4X7CA 1BM9A 1QZZA 4D7NA 1TLLA 1EFUA 2OCEA 3TEDA 3E97A 3ZMDA 3Q0UA 2IAIA 3D1NI 1EKEA 1BJKA 3IV5A 3FKIJ 2R6HA 3PUFA 4PABA 2OPTA 4FK8A 1BJAA 4LC0A 2MGQA 4WXCA 2DQLA 1VQNI 1R23A 4KFCA 2MABA 5E1WA 3WODF 1QQIA 1UHSA 1DGRM 2VBWA 6PAXA 3GQAA 2HVQA 2RC6A 2VUMJ 4NK6A 3LJYA 1PVEA 1LFBA 4IEJA 3G4SI 2LVSA 2QKMB 4HOBA 2IGKA 5FLXZ 1TYXA 1WZ2A 3GEZA 4EV0A 3OP1A 3W2GA 5DYMA 3ZQCA 1XN7A 2QCOA 2VJIA 4UY8I 1OCZH 3T1BA 2WZNA 4OIRF 1SC7A 3BNWA 2RV8A 5IYWA 5FLVA 2GK7A 3ZMVA 3HKZN 1S29A 4HLYA 3W2AA 1B1BA 5KAFC 2K40A 5LGTA 1MJBA 1H85A 4A93J 2ZBKA 5ILSA 1O3TA 2XOKA 3IRRA 4KMUX 3S3NA 1FZPB 2G0EA 4IZZA 1UG0A 3DF8A 4A6EA 2GXAA 2VBXA 1OR7C 4BQOA 1R5NA 5GV8A 4YFKF 4Y9RA 4HA8A 2ESHA 1FMVA 2CJJA 2QVOA 1S6LA 2X0KA 4NCNA 1DDGA 1LEBA 1FIAA 4IW3B 1R58A 5EGOB 3KP5A 4HYEA 1G7CA 3E20A 3D5LA 1O8EA 3G2BA 4KIBA 1BW6A 1FWZA 2Y0MA 5FJ8J 1Z77A 1ZG1A 3CB4A 3EQLF 2EPFA 3MZHA 1QRBA 3T5XA 1X2MA 1JKQC 2DMUA 3O8GA 4HQMA 3FMQA 5CVUA 5HVQC 5GTHC 4XLCA 4BS9A 4Y4RA 4ACBA 3HUGB 3FDYA 2X4HA 4C3JJ 2VFOA 5EZHA 4B8XA 4OP7A 3K2ZA 2KRCA 4XLFA 2Y2ZA 2UXNA 3K1NA 1N77A 2X1DA 3K4KA 5AONA 4EJOA 1O3RA 1A04A 1OFDA 1DPRA 2VFPA 1FMWA 3JRDA 1B72B 3I1FA 2CUJA 1WH7A 1WCMJ 4RBOA 5JHUA 1PP8F 1OCCH 3BY6A 3IAS2 3HXLA 3FMRA 1IDYA 3KZYA 4F7DA 2NVYJ 2QUFA 4YZXA 3VYUB 1KQ5A 3FXMA 1SD7A 3VYRB 5IOZA 2AQFA 2PJPA 5CVIA 3BR1A 4GFBA 4I84A 2OU2A 1YITB 4RGUA 4YAWA 3MAJA 2Z99A 1G7RA 3A1PA 3FXOA 2VBMA 2LP0A 2CV0A 3ASNH 4YZQA 4R79A 2IRFG 3RZOJ 2XVCA 1N07A 2MH2A 3V7SA 3ELKA 3TOAA 2XZLA 1RPWA 1W7PA 2IGMA 2I8DA 1JRGA 2A6HF 2VB6A 2PMUA 1G3WA 2O8XA 1ON2A 2OUMA 1LDKB 1VQ4B 5F4OA 4EM2A 3KEYA 2DU9A 4KICA 2XTWA 2PBIA 2XNDA 4G5GA 4RAFA 1QCXA 2GA2A 2BXYA 4EGYA 2E5NA 1D0YA 1D1BA 2N8GA 4BHCA 1JE8A 1E2XA 2DO7A 3VPRA 4MYUA 2Q0OA 5LEJA 3AVTA 4PSWA 3QAHA 1GDTA 5DTDA 4EM1A 1PDNC 2X53S 3PFYA 2E1BA 1WOPA 1F20A 4TN1A 2NNYA 3DFGA 3PA1A 2J8KA 1DDNA 2COBA 3LMMA 5AIQA 4NB5A 3MKLA 1YJNB 3VO2A 2PN6A 2PECA 1ELOA 1VQOB 3W6VA 2TRTA 1U5TA 2CS3A 2FVGA 2V5IA 3F72A 2L02A 3CMMA 3OYGA 1EA0A 2BV6A 2IGNA 2W84A 5ICGA 1IXSB 3GFJA 4FTHA 3A01B 3K4NA 3ZQ7A 5JVTA 3AVUA 4G6TB 1KTVA 2ZNYA 4PZJA 1V5VA 1UAAA 2EIMH 3DU5A 4H4KC 4XN0A 2ZMEC 1X1PA 2KIUA 1IRFA 2JZYA 4KIGA 3ZMTA 2CGPA 4IHYA 4YAFA 4OOVA 2CUZA 1S7AA 4BXXJ 5H5JA 3OW7A 4YFXF 1A5JA 4Q47A 2K9LA 5L3FA 3OKXA 4I01A 5IP9J 1Y0UA 1MBHA 3D0SA 4X7EA 4UUVA 2VZLA 3ZXSA 3E6DA 4KT6A 1MD0A 2GWRA 3CMAI 1C0WA 5LEKA 2ODLA 2GIVA 4Z05A 4P1WA 3A8KA 2VT3A 4DYQA 3JAMK 3BH4A 3B02A 3TO6A 3PSSA 4OJPA 2I5UA 5ICEA 1GR1A 3R6KA 1YHQB 1W34A 4A3BJ 1OISA 3ESWB 3HGGA 4C2LA 4U9UA 2HVSA 2L9SA 2RREA 3CCMB 2EFQA 3DU1X 3LQQA 3GZ5A 4XLNF 1W0TA 5CJ9A 1V5GA 3BQYA 2PJRA 1FC3A 3KETA 1VQPI 4XSXF 1IUYA 5HS8A 2CG4A 4KDPA 2ELKA 1FYMA 3WE2A 3RYPA 1S7EA 5CVJA 3EQOA 4WZLA 3G6EI 2LREA 3ZPLA 2DOAA 2EZIA 2R92J 3HOZJ 2O61A 3V7AA 2ICWG 5DCMB 4PGOA 4UV9A 4XKWA 4X0CA 3HIFA 4RM2A 3M4OJ 3BCAA 4YXWA 2VFQA 4KITB 1XSVA 2A6TA 2RN7A 2FD5A 2WV1A 4DGWB 4YCQA 1KU3A 2D5VA 3G05A 5LFAA 3QU3A 4D9JA 2IA1A 1FSEA 2CQXA 3DTEA 5DNSA 1IN6A 2O03A 1JUSA 3OYAA 2Y75A 4UUSA 2EFGA 2R9VA 3F8BA 3IL2A 2QTLA 5LMZA 5IYPA 4RB2C 1A35A 1W0JA 2E5ZA 3NAUA 1E3XA 3SQVA 2QQ9A 5EJCA 2R7FA 1H8AC 3ASOH 2P7CB 1K28D 2QX3A 1BR2A 5J4YA 4EM0B 3FXRA 2OBPA 4XKCA 1DG1G 2YR2A 3LAJA 1R1TA 4FE4A 4NC7A 4I02A 3VB2A 2AHOA 4BJ5C 2QMUA 3CCVB 3G3ZA 1T6ZA 4BXUA 4KH3A 3ECOA 2W25A 2BSPA 2QM3A 4D1QA 4M9SA 2OJED 3QPHA 1T2KA 2ME6A 3IUOA 3TBIA 2XRNA 1WPKA 3TGNA 1GXPA 4ROXA 5M5YJ 1OFLA 1JHFA 1T38A 4UXNA 4ZYAA 3JQPA 3AG2H 1HW1A 4KN7X 3PENA 3OIQA 5HOOA 1S9HA 1UD8A 4MFDA 1FOYA 3KIOA 4GXOA 1BHEA 1NB9A 3MKWB 2VBSA 3PETA 2CK3A 4E4HA 4P22A 1PJRA 1ZYRF 2Q1ZB 2QZAA 3W3CA 2BMWA 2FNPA 3ONQA 2TCTA 2FOKA 2IVMA 1LFUP 2XZPA 1HVXA 1ETKA 4E7JA 3ASRA 3MHPA 5EEHA 3N90A 5BS6A 4V2FA 4XL9A 3GFLA 3I54A 1NH3A 1YJ9B 5HNFA 2Y31A 3K6GA 4CCJA 1CLWA 1XE1A 2KZGA 4M3GA 4M74A 2QBYA 4IHXA 1IW7F 2B7BA 1R5HA 2D3NA 2K3PA 1YIJB 4HRIA 4DNTB 4OPWA 2LNBA 4YEIA 1QRYA 2DODA 5E1ZB 2OBTA 2MFZA 3ZRGA 2I1LA 4P26A 3CMYA 4HEA2 1BOBA 1HLVA 3LA7A 1YFHA 4A3FJ 5KHDA 2UZKA 2X6WA 1ZG5A 2FU4A 2YX4A 1QPMA 2CH0A 5E17F 3SY2A 1PJ6A 3OJWA 3SKBA 1TYWA 4GO1A 1NG6A 3R6SA 1PJ7A 3R6JA 4PJNA 2DYRH 3SYJA 2VJ5A 2DETA 4ESFA 1QJVA 3OYKA 1OCTC 2ZITA 3OE7A 3QPTA 5D5VB 1ENHA 2M87A 5DN6A 3BCFA 5C4JJ 1WHUA 3LSTA 3ZQIA 2VE9A 3I71A 2EIXA 3LOCA 2GREA 3I4NJ 4HV5A 1IDZA 2XF5A 1Z3YA 2MD0A 2C6YA 4QWQA 3L2WA 1OGOX 4DZPA 1I7PA 1RIOH 4KJZA 2Q6KA 2B5OA 1KJZA 2RKHA 4U0YA 3KEOA 1Z7UA 1MMDA 4PK4A 2XB0X 1WSVA 2QN6A 3HZJA 4X7DA 1JHHA 5K5QA 3BG3A 1HC8A 1ZGAA 1COWA 4H9GA 2DJNA 3CUQA 3FXLA 1T5EA 2C77A 1EV7A 1JUMA 5FLMJ 4A3EJ 2LH9A 4PAAA 2HDWA 4DOZA 2X6OA 1SFKA 3HOSA 1RQPA 1J9IA 2ZO4A 2FRHA 3P27A 4CCMA 1Z1DA 1KK3A 1B9NA 3HRMA 2NT6A 3OOPA 4BHPA 3T53B 2AXTC 5DS0A 4MQ9F 1FX0A 5TV2A 3WXMA 3RDIA 2NTBA 4YDTA 5IP7J 4E7HA 3HGYA 3V42A 3VSKA 5JVGF 1N78A 5E6TA 5H59A 2EINH 2VYQA 2DCEA 2LZJA 1OR7A 4QUZA 5K1YA 2BY3A 3DBRB 3N05A 1HBXG 2V7QA 5JBQA 2CNDA 1TNSA 2P7VB 4A6DA 1I50J 2XAQA 4PDKA 1IRGA 1W7PD 3JTGA 3LSPA 2DFHA 3U6KA 2OQRA 4XNFA 1VLOA 1O8KA 4RB1A 1MABA 2D1HA 2EV5A 3T51B 1OYYA 4PFPA 5IT3A 3OMYA 2PMDA 3COAC 3CRZA 2VJJA 3LSJA 3CCLB 1J09A 2NTPA 2O7OA 1BI0A 2IQ7A 1N75A 3I55I 1GO2A 4A69C 3NRVA 3GVJA 1QVTA 1MH3A 1QHHD 3MQ0A 2Z8GA 2V7VA 2HXIA 2VONA 2DAOA 3E3VA 4P96A 2ZXWH 1RUOA 2ZXIA 5F4MA 2E2HJ 4OINF 1ZRDA 3BR6A 2FSWA 2X51A 2P6TA 3ZMUA 2MLKA 2P8TA 4BBRJ 2VFMA 4KA4A 3JX8A 3KZIC 1POGA 4Q5SF 1WSUA 1ZM9A 2MBFA 4M53A 2Q2EA 3OV8A 2LBFB 3WNCA 1RETA 2YUSA 5D5WB 1VHEA 3AAFA 1G6NA 4HX8A 4EEFG 3A0HC 2EIKH 1AOYA 1L0OC 2NSPA 4CYCB 2JPCA 2XV4S 2R5YB 4H0EA 2QQ8A 2JSCA 3EETA 5FKMA 1S4MA 3HPHA 3KEQA 2M34A 2WB1N 3C3WA 5FKOA 1ZR2A 1JTAA 3OOCA 4MQVA 1OB5A 3HTSB 3MCZA 4DNCA 4G6QA 1BX1A 1S72I 2H09A 3HOYJ 4LOCA 3CCRB 5A89A 3BC8A 1KYZA 4XLEA 4FQGA 5DD4A 3SEZA 5IYCJ 2PE3A 2WJYA 1D5VA 1TC3C 4GYIA 2BBYA 4JMQA 1RMGA 2NSTA 1NHCA 2R3SA 5GV7A 4LG0B 5JLVC 2D2WA 1F1ZA 5JFRA 2FQ3A 3GYHX 2D1VA 3DKXA 3K70C 2J5PA 4NNJA 1ERDA 5F0HA 3L1PA 5F1RA 1UHMA 2O17A 4I99C 1QHGA 2K5CA 4U49A 2K9MA 2YS9A 2L01A 1B23P 2HOSA 1VQ5B 4M73A 1YX2A 3ZPPA 3GXOA 1ZAOA 1LQ1A 1JTXA 2DA6A 2ISYA 2M4GA 3O6BB 1KA8A 4F55A 4QIWN 4BACA 4C2MJ 4G7XA 2JT1A 3OL4A 4LLGF 1TLHB 3WGGA 5J1UA 3SHFA 2VKVA 3WU0A 1WWXA 2B7CA 3ZC3A 2G7UA 4ZZLA 3GLLA 3WTSC 3CCRI 4P5OA 2GJPA 1QVGB 2DYIA 1UFMA 4IQJA 1N0VC 3FBIB 1IHMA 3GZNB 3KE2A 2H8RA 2WAQA 4AVPA 3GIRA 1HF2A 1A6IA 3JRGA 1GVHA 1LLZA 2A5YB 3GTJJ 1Q7YD 4IHSA 1Y56A 3L2CA 2FF4A 3EDPA 1QBJA 4Z4TA 4NC8A 4M6XA 4P6YA 3HAGA 1CZFA 2XTXA 4TMZA 3J7ZI 4LITA 5L3GA 3CO7C 4KIFA 4RD2A 1EFRA 4DK0A 1R9TJ 1TWFJ 1SMYF 2ZXJA 2WBMA 2HFHA 3BJOA 5CYVA 5D8KB 1V0EA 1BI3A 1BX0A 1G4DA 4OZZA 1SANA 4LGWA 3DPTA 2RC5A 4F52A 4X6AJ 4HW0A 3BR0A 4M72A 2NPFA 4HG2A 3TOBA 5C1EA 1NTCA 4YZAA 2EJRA 3T56B 4ANJA 1K61A 3ISPA 1FJLA 1MNEA 3I55B 2DFIA 1XMXA 2CU7A 1FX7A 2M0CA 3P7NA 1EFCA 2CV2A 5B66C 1YI2I 3OYIA 1Z67A 4W97A 3BP8A 1KMHA 2NT9A 3AGQA 1MSEC 2PYHA 1WGXA 2JA5J 2YU9J 1HW2A 2BM4A 2DTRA 2ZJ2A 3RIRA 1JA1A 3DLLF 4BE1A 2XUBA 4BE0A 2VC0A 2WAQN 4XR6A 3RZDJ 3KL9A 2Y30A 1SEUA 3QFSA 3BG7A 1KZHA 3ASPA 1MZBA 3P4GA 3RQIA 3JREA 1ZGJA 1XMKA 1H88C 3ABTA 5FKKA 5HLIA 3SEQA 4ESBA 3WTWC 1FNNA 4KKTA 4YHBA 2DW4A 5BPIA 2L4AA 5B3SH 5HS7A 1LVAA 1FT9A 3F8NA 5HS9A 3WTZA 4RM3A 4ZYDA 1K6OA 2WR8A 4JX4A 2L0KA 2V4JC 2Z9OA 4A0XA 5F4JA 2CW0F 3P9KA 3FPKA 3B73A 2AS5F 1OPCA 1HF0A 5IYBJ 5A8AA 1D2EA 4J19A 2HR3A 3VMWA 3CLQA 2BHZA 3MKZA 4RGXA 2QSGX 2HOTA 2V9PA 2L7ZA 4D5FA 1JNYA 4YIRX 3AL0B 1RUNA 1BA5A 1MBFA 2ZL7A 3ZPNA 3FHNA 4Z4UA 2IA0A 1P2FA 4B3AA 3ULQB 2EFPA 3EUAA 3SZGA 3CESA 1PUEE 1CGPA 3RY8A 3GTOJ 2LRDA 3JRCA 1I3AA 1W36C 1O57A 4XOTA 1QNTA 3U2QA 2BM5A 4S05A 5IPAA 2ZMEA 4NBQA 1TNTA 3VSLA 4CA0A 1JKRC 1WTHD 1QA1A 4B3FX 1QGPA 4A3DJ 3KLOA 1FNBA 1O8IA 1ODDA 5EYRA 1R6RA 2ZFWA 3MMYB 1E79A 1TBXA 4CGZA 3HHGA 2M8EA 3HUGA 2XB5A 4N9HA 1GJRA 3VMVA 3QFCA 5HXBA 2ZC2A 3I59B 4CQJA 3PM1A 3TH0A 3OYMA 3FZVA 2STWA 1H8EA 2X1CA 5E3MA 2F4MB 3CC4B 3C18A 5A2QZ 3TO7A 2R93J 3DV8A 4DBRA 3O3KA 4RDUA 2KDOA 2JQ7A 3GTPJ 2NTQA 2DT7B 3K4BA 2LY2A 1ON1A 1P6RA 3H0GJ 4IXAA 5CQEA 1QUFA 3JQQA 1WJBA 1GQ8A 5EDNA 1ZREA 1UD6A 1DQUA 2X6XA 1LM1A 3S2HJ 4RLFA 4M0LA 3CO6C 3UKGA 2MC4A 2CQKA 2F4IA 1FIPA 2LKSA 4XIDA 1E0EA 2WZPP 1VQ8B 3BQJA 4XICA 2HVRA 2LYCA 1BI2A 1T33A 5FD5A 1YIJI 2C5BA 1W5SA 1G7SA 4L9JA 1CNEA 2FA5A 4I0BA 3BZ6A 1NB0A 4KNYA 5F27A 3ECHA 1V55H 2E7XA 3G1LA 3MKYB 2H1LA 2NS0A 2XROA 1YJ9I 1ORKA 2EWNA 3T8TA 1R1UA 2LKPA 4U4BA 1A31A 1Y8RB 2RAEA 1F5TA 4OJ5A 4ENNA 5GP9A 1SKYB 1EZGA 3ABUA 5EEAA 1ZKGA 3DEEA 4HDUA 3DXJF 1CNFA 1NRKA 1OCRH 1VF7A 4I76A 2ID3A 2DIEA 2NS7A 4ZDLA 3F21A 4JX6A 2XNCA 3I64A 1E43A 1GXQA 3Q39A 3RJPA 3PUMA 3HSEA 1HXDA 1V3FA 1BJZA 4FETA 1ETYA 2CW5A 3JTHA 4UB6C 4LIUA 4DYRA 3E5UA 1KQ0A 5D4SA 5EF6A 4A3IJ 3E6BA 2ME0A 1JGGA 1RZ4A 2R7SA 1Q81D 2DJIA 4BKXA 2K86A 3GWZA 3KYDB 1E3HA 4ZDOA 4XD7A 2M7BA 5FD6A 2OCCH 1BLIA 4G1VA 2CC2A 3C2HA 3HB9A 3ZMZA 1SD4A 2W6IA 4BAYA 1XGSA 1NDHA 2PI0A 1ONVA 2WV0A 2V7UA 1E62A 2V9VA 4YZ0A 1QU3A 2YWGA 3CD6B 2QYUA 2OK7A 2EZHA 4MR0A 1OKRA 1YOVB 3V7CA 2NOGA 1EA3A 1S8NA 2LF8A 4ABZA 5HNHA 2OC6A 3CCUI 2DMTA 5E8GA 1TQPA 2NNNA 1ZM3A 4HX7A 2VODA 3HM5A 4NC6A 1XGNA 3OYHA 2E1MB 1GLNA 3CUOA 1T08B 1RWRA 4CSWA 4YFOA 2XAUA 2XIGA 2MC3A 4HQEA 4LBWA 4P3IA 4WK8F 3QODA 1I1SA 5ICCA 2GZWA 3B6CA 3F8FA 4U7DA 3HHHA 5D5XB 3QSYA 3GLXA 1MDMB 2DDBA 2H6CA 4Z6YA 3S15J 1JJ8C 3VDXA 3MVPA 4AVZA 2CRGA 2VN2A 3FWEA 2ZJPF 2DI3A 4IPAA 4E0FA 4AIDA 3W2FA 2CFXA 2V7FA 4MNUA 2CUEA 3AG1H 3EYIA 3CC2B 3I56B 1WH5A 3KLNA 2E34A 4R71A 4W8TA 3AK5A 2L9RA 1FYLA 4IL6C 1LE8A 3K1MA 5JHFA 1FLIA 1TVCA 4G1BA 3AFHA 1YRNB 4MEYF 2E1NA 2VXZA 2W57A 4BEHB 1KQSB 4S0HB 5E3LA 2CFOA 2MD5A 3U1DA 1GAWA 4Z06A 4PJMA 4FISA 3E0JB 4BQNA 3FXUA 3KP4A 2GXBA 4U0WA 1DUXC 1HSTA 1W0UA 2QSHX 3OY9A 2FMLA 1AKHB 2HMAA 4YRVA 4EJVA 1PE9A 2B7EA 1YHQI 1ETVA 2P81A 3G73A 2VQLA 5DCMA 3H5AA 3LNQA 3CCUB 1Y6IA 2NXNB 1HW5A 1AIRA 2XC7A 4YFNF 4QV2A 2LLKA 3VSVA 3HYIA 3A1YA 4FHTA 1U9OA 1ZGWA 3JQRA 4Z4ZA 3K4JA 3S17J 3PVDA 2HPIA 3J7YJ 4XRFA 5J3OA 3BQZA 1LJ9A 3VNVA 4ZCMA 2VJ4A 1LVKA 3S8PA 4JRAC 2KL4A 3CMEI 1VQ6I 4L5IA 2HOAA 4GGGA 3H3ZA 3JR9A 3ZBTA 1FY7A 3G1MA 5DM7F 1B8IB 1IAWA 2C4UA 2JUGA 4RB3C 3I4PA 5E3NA 1QFYA 3QPLA 2R4GA 1YX3A 2GJKA 2M30A 1I18A 4RAZA 2AO9A 2DK8A 2M4KA 4L9VA 2O3FA 4HE6A 4CYDA 1X1CA 4IOAF 3TO9A 5FO5A 3W6KB 5J4VA 3SEJA 5H20A 1AHDP 3HOUJ 1KK0A 3NWTA 4OJ6A 4DZJA 1BR4A 1LFPA 4L5JA 3H92A 1BC8C 3LAPA 1RESA 3A35A 2VE8A 1HKQA 2EB7A 4OOXA 1Y39A 2HLDA 2M0MA 1GVDA 4WF2A 1FTTA 5IYDJ 3E6MA 2RNJA 3LA2A 5GADJ 5HLTA 1I39A 3PNVA 1UCRA 1VQ4I 1V0FA 4Z4SA 2BXZA 4I6ZA 1QA2A 3Q6RA 4O5VA 4AIJA 1JKPC 5IT9K 1PUFA 3CPWB 2XF6A 3I0TA 1CF7B 1BW5A 1LLWA 1IB0A 2DMNA 5CVVA 1HA3A 2L3DA 3BCDA 1YW8A 2EA2A 3FKSA 3OYJA 5EG0B 3B4NA 4EW9A 1BIAA 4QPQA 4OMYA 1VZ0A 2PQ8A 3GVAA 3KP2A 2GLOA 3L7WA 3OYDA 3I5UA 4A0ZA 3P26A 2O04A 2NYXA 2KRFA 5CPRB 2UXXA 4F92B 5J1YA 1YITI 2A69F 1MBGA 1XC5A 2EK5A 1U0JA 4RA2A 1UMKA 5FRMA 4ZTFA 2XRLA 4L0YB 5FLXK 5L3DA 3M1CA 1Z9CA 1G3SA 4F91B 3ASSA 1WP6A 2V7XA 1IRXA 1WI3A 1R1VA 3CJRB 2RVCA 2HTSA 1I6HJ 1A6QA 3DLAA 2BE5F 3RSNA 4Z4VA 1K6YA 1MJAA 1K78B 3QQAA 1EP3B 3LA3A 2D3LA 3BH6B 2WC2A 3SUCA 1X0CA 4ZJZA 4G8XA 2BHYA 3N6ZA 1KK2A 3K2AA 4RD3A 2BY2A 1W36D 3FHZA 3IH4A 1IN7A 4R1HA 3H1CA 4MYTA 4W8QA 1T56A 5TJJA 4G7WA 4FASD 2DMQA 3K1PA 1VQMI 1YLOA 3ZUGA 1R00A 2K9QA 2P6SA 4Y3OA 1FOKA 1E3ZA 2F5CA 3VYTB 1MH4A 2UVEA 2F1LA 4WQMA 2W82A 4X1EA 1XS9A 1QUEA 2H8WA 3CUQB 2VBTA 4TV7A 2R0QC 4NQWB 3DTKA 2BOLA 3A3GA 3DBHB 4OJOA 1KU7A 1Q1HA 1TTTA 4BH9A 4G94A 4CDGA 1NBMA 1TW3A 1SFXA 2Z5UA 3CLOA 2L7KA 5CQGA 1D8KA 2X8KA 2NS8A 4XMYA 4KYWA 2M1BA 4HV6A 3LVBA 4PCQA 2V1XA 1XPXA 3OR2C 2PX9A 2KQRA 3GTGJ 3UNGC 3LSIA 5DSZA 1X3UA 2Z16A 4JQFA 1BPLA 4DYCA 3UW0A 1H9TA 3CCYA 1IB4A 2XNJA 4HAMA 2XASA 3DU6A 4AIHA 3ABLH 2DOGA 2R7DA 1UD3A 4RCZA 3S2DJ 3HL2A 4Y7NJ 1IXRC 3RKQA 2R7QA 4M9XA 1REPC 2VBVA 1KU9A 3F8CA 1F4KA 3A0BC 2KJBA 1V5EA 3FPPA 4ENMA 4TMXA 1EH6A 3IAM2 4IQ4A 1G2HA 1S3JA 2E2IJ 4BL0B 3GCMA 3V8KA 3L2VA 2HTJA 2CO5A 3GX4X 1VQ6B 3BZCA 1WOOA 5LHIA 4CHUA 2ZL6A 4M3DA 1J7KA 1KK1A 3JRFA 1UD5A 1KCDA 3C7JA 3RCOA 2V7WA 1VQNB 4ZCIA 2CMPA 4KKSA 2BY0A 5BMZA 1HDPA 4RDJA 4TMWA 3CDLA 2ZB9A 4LK1F 1J59A 1VQ9B 4RPDA 3S16J 2M3AA 3GQ8A 1QGZA 2R5ZB 1D1NA 1HA8A 1I5ZA 4N3NA 3LSMA 1R5ID 2DXIA 4GRIA 2VPLA 1FRNA 1FPQA 2WB1A 1XTAA 5DEQA 3WU1B 5IYQA 3SZPA 4MTDA 2PYGA 2OQGA 1Y0NA 5GAGJ 2ISZA 5HLGA 2M45A 3PQJA 2LY9A 5LBQA 5LRSA 4J01A 1O8GA 3B90A 3PSFA 4X0GA 1IF1A 4II2A 4X7FA 2XF7A 1E17A 3BH7B 2V1NA 3BTLA 5KK1A 4RAGA 2JVHA 3WBJA 4W8RA 3CJNA 1ETOA 3PSIA 3ZQQA 4TMVA 1TT0A 2FX3A 4XK4A 3KP7A 2P5VA 4K2EA 4GDFA 2DA2A 1RNLA 1XSXA 1JJ2B 3HBLA 3S2WA 3SLNA 3I56I 5TR9A 2O5RA 3J81K 1FDRA 3ZQHA 1T0FA 2BW3A 3ZN1A 4B3XA 4BNCA 2VNKA 1DABA 5J3LA 1R71A 1NJID 4BXFA 1PLUA 4BU2A 3CPXA 2JRTA 2COMA 1IJFA 1QRCA 4Z4YA 3J81k 1QGAA 1UELB 2DDAA 5HZAA 3O2PE 4XORA 4A3GJ 1EH7A 3FIWA 1DP3A 1M1EB 5FKNA 2K9NA 4V2GA 4HX4A 1D0XA 3ZR8X 5JI6A 1MJ9A 3CCSI 3A8IA 4MIMA 3IRQA 1IDKA 2CW7A 3H3UA 2VFNA 3QE2A 3BPXA 3MZYA 1B72A 3CZ6A 3WY9A 2J8IA 4OPOA 2BM1A 3NB2A 1UZCA 5FFXA 3Q3AA 1MNDA 1IRZA 3H94A 1TWHJ 4FCYA 2OK8A 3LQ6A 4PC3A 4OIPF 2IS6A 1U78A 1CQTA 1P4AA 5EZGA 5FNZA 2KVOA 4P6VF 3CD6I 4M3FA 2LG4A 4OAYA 2GXGA 2MLGA 1K9MD 1LB2A 1FTZA 1Z21A 1STZA 4MXNA 2QYOA 1WI9A 3U6BA 3K0LA 4ZZDA 2VC1A 3SZTA 4DQ2A 2NAZA 5AMVA 5C1CA 4XQFA 3EYYA 4E7SA 1IDJA 2L9NA 3ZQLA 4OM9A 4LBVA 3QYEA 3RPUA 1U6GA 2E1MC 2VL8A 1ZARA 3CUQC 4PC7A 3FM3A 1W7PB 4WWVA 1SD5A 2K27A 2Y9YA 2VASA 4N4OB 4IRHA 4Y13A 3OYBA 4X07A 5F6FA 5FA6A 3FKJA 3W6JB 2JJ7A 3X2QH 1T95A 4RMNA 4FT8A 4ZYHA 3BZKA 2CF4A 3I9V2 2DFFA 3C1DA 2EILH 4P9SA 3CC7B 5LHGA 2XKOA 1OGMX 1K8AD 1X1BA 3V7RA 4IRIA 2ACJA 2XKPA 2IXSA 4ZGNB 3WTXC 4ASUA 3S1RJ 3BROA 1P4MA 2EFNA 1M1KD 3PIPF 3ES9A 3CXCB 4CUGA 3W2IA 4NDLA 1ZM2A 1P4WA 3DPLC 3SJMA 1AA7A 3W5UA 2B0RA 4Z4WA 2DA4A 3CCQI 3S14J 3W5HA 1TWCJ 2K85A 3A01A 1KONA 1V54H 3S93A 2BYVE 1K79A 2OD5A 4P25A 3CCJB 3IH2A 5HDKA 3KFWX 3ZGKA 4QPOA 3OWTA 1M90D 1IV6A 1TYVA 3E5XA 4WZEA 2E19A 3BR2A 5D6FA 5A88A 2R7TA 4QHYA 5F1JA 3OYEA 3GTKJ 4DQKA 4LK0F 3VOEA 1GV5A 1WVRA 1O7FA 2F2EA 2IEKA 2XGEA 1P7IA 1B59A 5J47A 2JJ1A 4L0ZB 1J2XA 2HDDA 3ML3A 3LMWA 1QZYA 1O8DA 4UVCA 4M1KA 5C3EJ 1R4MB 2VKDA 4G9YA 2A07F 1BN8A 2INVA 1N0UA 3LYCA 4BE2A 1OB0A 2QXZA 1YQAA 4Z03A 1VQKI 2DN0A 3W2HA 1FYKA 2VKHA 4RJLA 3NAWA 3NEUA 3QYFA 2OV7A 2F48A 4I7HA 2L2OA 3EPZA 4PUSA 2QA4I 4HF0A 2FBIA 1YTYA 3M8JA 2A5WA 2KMUA 2W48A 2HYFA 1VQLB 3OEHA 1NG7A 3BJAA 2PJRB 1XB4A 1YS7A 3W2WA 2F5EA 1B9MA 1TP4A 2M8GX 5J40A 3EUHC 5FIUA 5DM6F 4PSXA 5J1RA 2DQRA
chains in the Genus database with same CATH topology
2DT7B 3K4BA 2JSPA 2LY2A 3S3OA 5CQEA 3SDBA 1WJBA 4PFOA 2VBMA 2VBEA 1GQ8A 2CV0A 1UD6A 4YZQA 1DQUA 1X1DA 4XOPA 4R79A 1WJ5A 4AU7A 3WWGA 2X6XA 2ZZGA 4RLFA 2ELJA 2XZLA 2MC4A 2IGMA 3VWBA 2I8DA 2F4IA 1JRGA 2VB6A 1E0EA 2WZPP 4B43A 2RQQA 4BEHA 3CJQB 3CF2A 2HVRA 2OUMA 3AL0C 1LDKB 2LYCA 3VSTA 2LC2A 2GOXB 4L8JA 3KEYA 2XNDA 1QCXA 5IK2A 5FL7A 2E5NA 1D0YA 1D1BA 2BVLA 2KLOA 2NOJB 3DPUA 3MKYB 2W6JA 2WJVA 4PSWA 3BC9A 2X53S 3PFYA 4U4BA 1PKVA 2E1BA 4OJ5A 1WJAA 3K4CA 1SKYB 3LMMA 2QY1A 2LY1A 3DEEA 2PECA 3QYBA 3OR1C 3HC7A 2CS3A 3RQ4A 1NRKA 1VF7A 2DIEA 2VIXA 4ZDLA 3CMMA 3OYGA 3WQZA 2IGNA 1E43A 4LG3A 4FETA 4MLOA 3K4NA 1O8JA 2F1MA 3GRHA 4LIUA 4G6TB 2ZZEA 1K5CA 3MD2A 1UAAA 4ZC3A 2R7SA 2DJIA 3DU5A 4H4KC 4XN0A 3BCBA 4ZDOA 4XD7A 2HQAA 2M7BA 1KCCA 4HNUA 2CUZA 1BLIA 1WPCA 1O8HA 3C2HA 3OW7A 2W6IA 4DNRB 2K9LA 2ZZQA 1O8FA 2X3HA 3B8YA 4YZ0A 1QU3A 3ZXSA 4KT6A 4CCKA 2ODLA 4Z05A 4P1WA 4MR0A 4B48A 1WJEA 4BJ6C 3BH4A 3RPUD 1EA3A 4XKBA 4XLHA 5HNHA 2KP6A 2OC6A 3OL3A 1DBGA 4OJPA 2CW8A 5CDFA 1XG2A 3OYHA 2E1MB 1GLNA 4C2LA 1RWRA 3OIPA 4CSWA 3H5NA 2HVSA 2L9SA 2RREA 2XAUA 2F43A 4PJLA 4JOMA 3QODA 1X1AA 4PMHA 2JJ2A 1V5GA 3OEEA 2PJRA 1H8HA 4G6IA 1WJFA 3VDXA 2V4DA 4AVZA 3KX2A 4E0FA 2NZMA 2XGJA 5KCMA 3EQOA 2V7FA 4B47A 4BJTA 2AQEA 2WPDA 3OYNA 2VBKA 2LREA 2DOAA 2IS1A 4BDZA 2DT6A 3VSUA 2M5SA 4W8TA 4XKWA 4CH7A 4HSRA 3K70D 2WAEA 2R7XA 4RM2A 1P9QC 5JHFA 2O0WA 3BCAA 4YXWA 3AFHA 4KITB 4II3A 2VXZA 3J7AY 2A6TA 4DGWB 4GQNA 1BR1A 2Y0SA 4BEHB 1UD2A 2CFOA 3G05A 5LFAA 4D9JA 4Z06A 4N4NB 4OAZA 4PJMA 3E0JB 4BQNA 2ZSHB 4E7LA 3DDYA 3DTEA 2M7AA 3ZSCA 3VR6A 1OLTA 3OYAA 1D0ZA 3OY9A 1PE9A 4YRVA 3OYCA 2R9VA 5LD2C 3KRGA 1W0JA 2E5ZA 4ITVA 1E3XA 2VQLA 2XSJC 3H5AA 1Y6IA 1TZLA 1KZLA 2X6YA 4TSFA 1X19A 1AIRA 1K28D 1X4OA 3S32A 1BR2A 2XC7A 3CP2A 1RU4A 2QX3A 3UR3C 3VSVA 3A1YA 4XKCA 4TT3A 3K4JA 4NC7A 3S3MA 1EE6A 4BJ5C 2HPIA 2GJRA 2BSPA 2VJ4A 4D1QA 1LVKA 4CCNA 3S8PA 2KL4A 4UZUA 2W00A 3IUOA 2L5QA 3TBIA 4BUPA 1OFLA 3OS0A 2JUGA 2UV1A 4ZYAA 3EUKL 4CZCA 2GJKA 2R4GA 1YX3A 3OIQA 2MYSA 1S9HA 5HOOA 1HZEA 1UD8A 1I18A 4RLQA 2M4KA 1BHEA 3MKWB 2CK3A 3GVLA 3AKZA 4E4HA 4E7IA 1X1CA 2GK6A 3K10A 1PJRA 3OOUA 4P22A 2Q1ZB 3W3CA 1LKXA 3OPOA 4KISA 3ONQA 3NWTA 4OJ6A 1BR4A 1LFPA 1WFXA 2XZPA 1HVXA 4E7JA 4XL9A 3A35A 3L2UA 1W0KA 5HNFA 2JVGA 4KKUA 2HLDA 2M0MA 3K6GA 4CCJA 3OYFA 4U7BA 3FBNB 3LL7A 2HZDA 2D3NA 4B3GA 5HLTA 2K3PA 3PNVA 3H0DA 1V0FA 4HRIA 4DNTB 2KZVA 3DQVC 3H9QA 4XN3A 2XF6A 2MFZA 3ZRGA 3OYLA 1JI8A 4F93B 4HEA2 1BOBA 3BCDA 3DTIA 2R7WA 4XONA 4J00A 2JDIA 2VXDA 3FKSA 3OYJA 3B4NA 4EW9A 3D5SC 4QPQA 5KHDA 1VZ0A 2X6WA 3OYDA 2CH0A 3NE5B 3LSGA 2O04A 4F92B 3HKZA 3HPGA 2LBFA 5CPRB 3T9GA 1NG6A 4PJNA 2VJ5A 1U0JA 3PNTA 1QJVA 3OYKA 2ZZFA 3OE7A 2V26A 5FRMA 4CCLA 5DN6A 4ZTFA 4ZTJA 3GBGA 3M1CA 1W9XA 3BCFA 3OFNA 4TKOB 4XKVA 2VLAA 4C2UA 4F3QA 1DGWY 4F91B 4HIZA 1WP6A 1IRXA 1UD4A 1VJSA 3CJRB 3JURA 2XF5A 3LSKA 1Z3YA 2MD0A 3K4MA 4DIQA 3L2WA 1OGOX 3DLAA 3RSNA 3K4LA 4KJZA 1E1QA 1K6YA 2HU9A 5HKKA 2JIZA 2D3LA 1V5FA 1G8XA 1MMDA 4LIVA 4PK4A 4Y33A 3SUCA 1X0CA 3H5RA 4AYBA 3D5RC 4ZJZA 1COWA 1T5EA 2LH9A 1D1CA 2HDWA 4DOZA 1SFKA 3HOSA 2IS4A 1WJCA 2ZTNA 1W36D 4CCMA 1IA5A 3KEWA 4W8QA 4C30A 4G7WA 4PJJA 4FASD 2NT6A 2HNHA 1I8DA 3T53B 1H80A 2UUZA 1E3ZA 4Y3OA 1WJDA 1FX0A 2NTBA 3QOEA 3VYTB 4E7HA 1WMRA 3V42A 3VSKA 3OS1A 1N78A 1O88A 2UVEA 2W82A 2DCEA 2LZJA 1ZELA 3U21A 2P0WA 3N05A 2V7QA 4NQWB 2INUA 3DTKA 2BOLA 3A3GA 1PXZA 3PNYA 3L2QA 2UWMA 4OJOA 1NBMA 1MW7A 2L7KA 5CQGA 2F6CA 2X8KA 2KHMA 2QE7A 4XMYA 4XNFA 4U87A 4BQQA 1O8KA 3FY3A 1Z3XA 3OR2C 1MABA 2JA2A 2KQRA 4PFPA 3LSIA 3UNGC 3OMYA 3T51B 2Z16A 4JQFA 1BPLA 2VJJA 3UW0A 1IB4A 1J09A 2NTPA 3DU6A 3TMOA 2Q2EB 2WAFA 2IQ7A 2R7UA 1N75A 4YEJA 5FRNA 1UD3A 3GVJA 3HL2A 4Z1MA 4DBQA 1HG8A 2WADA 2R7QA 1QHHD 3H35A 1KTWA 2Z8GA 1YE9A 1D1AA 1V5EA 3FPPA 3IAM2 4IQ4A 2ZXIA 1OHHA 2Z2SB 4BL0B 1OFMA 2X51A 3DWLE 4W8SA 3L2VA 2ZTGA 3NWSA 1OOCA 2Z1DA 4XLAA 3HG9A 2Z6BD 1UD5A 3GQ7A 1KCDA 1Z7LA 2LBFB 3RCOA 2RNGA 2CV1A 2CMPA 3A4CA 4KKSA 2O1DA 1MMNA 2NSPA 2KPMA 2HPMA 2FUG2 2M3AA 3GQ8A 1HA8A 3HPHA 1O8LA 1JTAA 2W1OA 3LSMA 2DXIA 3OOCA 2O0VA 4GRIA 2VPLA 2WB1A 5FROA 3F9KA 3DKYA 2WSSA 2PYGA 3PL8A 5KNLA 2V9KA 3BC8A 3KYLA 4HWVA 2UVFA 4J01A 2X85A 1O8GA 2KRHA 4XLEA 1SAUA 3B90A 3PSFA 3SEZA 4X0GA 4II2A 1T0FC 2XF7A 2E60A 2R7VA 1BMFA 2WJYA 2V1NA 4JMQA 1RMGA 4OJLA 2NSTA 4W8RA 2JVHA 3PJRA 1NHCA 3L2RA 3ZQQA 3PSIA 4DK1A 1MMGA 3DKXA 1TT0A 4B44A 4NNJA 2WA0A 4DJAA 3K70C 1ERDA 2ZXHA 4URRA 2O5RA 4XM3A 3LFUA 2O17A 1QHGA 4EATA 2K5CA 2PMZA 2BW3A 2K9MA 4B3XA 4U49A 3I3LA 4IX7A 4NUBA 4BXFA 3OAAA 4BU2A 1PLUA 3LNNA 3ZPPA 2BVMA 1UELB 2LOOA 2M4GA 4G7XA 4F55A 4XORA 4BACA 3TL4X 1DP3A 4NK8A 3OL4A 1PYVA 3HOTA 2XDVA 3ZR8X 4FXUA 1D0XA 4HSTA 3SYTA 2W4SA 1DBOA 1IDKA 2CW7A 4P5OA 2GJPA 4E7ZA 3CZ6A 4IQJA 3FBIB 2WAQA 1MNDA 3EQNA 3H94A 2BW3B 2IS6A 2ZFUA 4YELA 1Y56A 2KVOA 3GQ9A 4NC8A 2LG4A 3BLYA 4OAYA 3HAGA 1CZFA 1Z21A 4LITA 4MXNA 2MABA 1EFRA 3GVKA 4DK0A 1DGRM 3GQAA 2WBMA 2HVQA 3ZCOA 5AMVA 3C2GA 4XQFA 5C1CA 4E7SA 1V0EA 1IDJA 4NK6A 2L9NA 2QKMB 4OZZA 2IGKA 3QYEA 3DPTA 2E1MC 2VL8A 4F52A 3PUBA 4HG2A 2VJIA 4IKFA 2VASA 5C1EA 4N4OB 1VLYA 3OYBA 4C2TA 3T56B 4YZAA 3FKJA 4ANJA 2GK7A 1T95A 1MNEA 4RMNA 4CCOA 3W2AA 2GOMA 3ZIAA 2CV2A 3I9V2 3OYIA 1KMHA 2XOKA 2WY8Q 2NT9A 3OS2A 3S3NA 2IGOA 1OGMX 2PYHA 4IZZA 1X1BA 1UG0A 3JU4A 4OWRB 4BE1A 1VBLA 4BE0A 4XR6A 2IXSA 3A2KA 3LSHA 4ASUA 1OR7C 5CKTA 4BQOA 1MMAA 1O8MA 2VQHA 2VQGA 3BG7A 1FMVA 3E1SA 4CUGA 2ZSIB 3DPLC 3SEQA 5TGTA 3VYSB 1AA7A 3IP4B 4KKTA 2EWEA 3H9GA 2IS2A 3D5LA 4RM3A 1O8EA 3G2BA 1KONA 2V4JC 3S93A 4E6KG 2R7OA 3ZGKA 4QPOA 3OWTA 4HNTA 5HVQC 2W7NA 3VMWA 3BG6A 4XLCA 4BS9A 4Y4RA 3MKZA 3HUGB 3FDYA 4OZYA 2R7TA 2QKLB 3OYEA 3AL0B 3ZPNA 4BDYA 3GQBA 3FHNA 2KRCA 3CP8A 4XLFA 3EUAA 3SZGA 1N77A 3CESA 2X1DA 4C9YA 2JJ1A 3K4KA 2VQCA 1YX5A 3LMWA 2LRDA 1O8DA 1W36C 3W2VA 1FMWA 4XOTA 2VKDA 4CA0A 1BN8A 2INVA 3VSLA 1X4PA 2X1EA 2R7RA 4BE2A 1OB0A 1WTHD 1E1RA 2CUJA 4B3FX 1O8IA 2QXZA 4Z03A 3A3BA 2VKHA 4E7KA 1R6RA 3IAS2 3HXLA 3MMYB 3QYFA 4BGDA 2OV7A 1G59A 1E79A 2V31A 2L2OA 2XZOA 3EPZA 4PUSA 3H9JA 4YZXA 3VYUB 3VMVA 2F5VA 3M8JA 4HPQA 2A5WA 2KMUA 3VYRB 3OYMA 3OEHA 1NG7A 2AQFA 2PJRB 3W2WA 2WY7Q 2X1CA 1H8EA 4I84A 4ZDPA 3EUHC 4PSXA 4DBRA 3RTRA 2V6EA 2KDOA 2NTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IA5 A;  1PE9 A;  4W8Q A;  2VBM A;  2VBE A;  1GQ8 A;  2NT6 A;  3KRG A;  4YZQ A;  3EQN A;  1H80 A;  4XOP A;  3WWG A;  2X6X A;  2NTB A;  2X6Y A;  4YEL A;  1AIR A;  1RU4 A;  2QX3 A;  1WMR A;  2UVE A;  1O88 A;  3VSV A;  1JRG A;  3GQ9 A;  1CZF A;  3VST A;  1EE6 A;  2INU A;  4MXN A;  1PXZ A;  4OJO A;  1QCX A;  2BSP A;  3GQA A;  5AMV A;  5C1C A;  4XQF A;  4XMY A;  4NK6 A;  1IDJ A;  4XNF A;  1OFL A;  1O8K A;  3FY3 A;  4OZZ A;  4U4B A;  1IB4 A;  2VJJ A;  2NTP A;  4OJ5 A;  2IQ7 A;  2VJI A;  4YEJ A;  1BHE A;  2QY1 A;  5C1E A;  2PEC A;  1HG8 A;  4YZA A;  1KTW A;  2Z8G A;  2NT9 A;  4OJ6 A;  2PYH A;  1OGM X;  1O8J A;  1OFM A;  3GRH A;  4W8S A;  1VBL A;  4XL9 A;  1K5C A;  4XR6 A;  1OOC A;  4XN0 A;  4XLA A;  1O8M A;  3GQ7 A;  1KCD A;  1KCC A;  1O8H A;  2O1D A;  1O8F A;  2NSP A;  2X3H A;  3B8Y A;  4YZ0 A;  4XN3 A;  2EWE A;  3GQ8 A;  2ODL A;  4Z05 A;  4MR0 A;  1O8E A;  1O8L A;  1JTA A;  2O0V A;  4XLH A;  4XON A;  1DBG A;  4OJP A;  3B4N A;  4EW9 A;  1XG2 A;  2PYG A;  2X6W A;  4C2L A;  2O04 A;  1RWR A;  4HWV A;  3VMW A;  4XLC A;  3T9G A;  2UVF A;  4OZY A;  2X85 A;  1O8G A;  4XLE A;  3B90 A;  3LMW A;  3UW0 A;  1QJV A;  4PMH A;  4OJL A;  1RMG A;  2NST A;  4XLF A;  4W8R A;  1NHC A;  4XKV A;  4AVZ A;  2NZM A;  1O8D A;  4XOT A;  3EQO A;  3JUR A;  1BN8 A;  2INV A;  2VBK A;  2QXZ A;  4URR A;  1O8I A;  4Z03 A;  4XM3 A;  1OGO X;  2O17 A;  4U49 A;  3VSU A;  4W8T A;  4XKW A;  1PLU A;  2O0W A;  4YZX A;  3VMV A;  3ZPP A;  3SUC A;  1X0C A;  4XOR A;  4NK8 A;  4Z06 A;  4I84 A;  3ZSC A;  1DBO A;  1IDK A;  2NTQ A; 
#chains in the Genus database with same CATH topology
 2JSP A;  1Z05 A;  3S3O A;  1BIB A;  3SDB A;  1YIO A;  3LO8 A;  2VBE A;  4ON0 A;  4XOP A;  4XRS G;  1P4X A;  4AU7 A;  3WWG A;  4EQQ A;  1QVU A;  2ELJ A;  1Q86 D;  1WU8 A;  5K7Z A;  3CCQ B;  2EBI A;  2HKX A;  2BV3 A;  3JRA A;  3MZ8 A;  4B09 A;  3I59 A;  2XGC A;  3FF5 A;  3JRH A;  3CJQ B;  3CF2 A;  2OTJ I;  3CDI A;  3AL0 C;  4U88 A;  1KU2 A;  3WHC A;  5THX A;  2GOX B;  4L8J A;  5LGN A;  5ILU A;  5IK2 A;  3LWF A;  1T6S A;  3OW2 B;  3OJX A;  2BVL A;  5D8L B;  3SJP A;  3DPU A;  1U9N A;  2F3L A;  1FSH A;  1RI7 A;  4UAJ A;  1TWA J;  2GIZ A;  4JX5 A;  3JRI A;  2OA4 A;  5JMC B;  2WJV A;  5B5E C;  3BC9 A;  4HF2 A;  1PKV A;  3HOW J;  5BSY A;  2NVU B;  1YI2 B;  1WJA A;  3WG7 H;  4RLZ A;  1WDT A;  3QYB A;  2VBY A;  2VT2 A;  1KGS A;  3WGH A;  3E7L A;  3RQ4 A;  1ZRC A;  3F3X A;  1ZN2 A;  2VIX A;  2OYN A;  2RQP A;  5L46 A;  4MHG A;  5EGO A;  2MH9 A;  4C3I J;  4LG3 A;  4HZF A;  4MLO A;  2YU3 A;  4J0Q A;  4L9T A;  2A05 A;  2F1M A;  3GRH A;  3TDU C;  1N06 A;  3P9C A;  1T8I A;  2W85 A;  1APL C;  3MD2 A;  3T0Y A;  2YPR A;  4Q4Z F;  4ZV4 A;  5AIP A;  3MMP A;  4LLN A;  5AN9 A;  1ZLK A;  2CQQ A;  3BCB A;  4BPR A;  1KCC A;  2HQA A;  1U2W A;  4HNU A;  1Z6R A;  3TQN A;  5BOX A;  2VKE A;  3M9A A;  1I3Q J;  1LEA A;  1J75 A;  2KIS A;  2VNI A;  2ZZQ A;  1WQ2 A;  2X3H A;  1IN4 A;  3JRB A;  3R0A A;  2F5D A;  2XPU A;  3VNU A;  4CCK A;  3SFI A;  1QH0 A;  1DAR A;  1QX4 A;  2E71 A;  2CWE A;  3FXQ A;  1WJE A;  3JW4 A;  2KIF A;  5FKL A;  3RPU D;  5BNG A;  4XKB A;  4XLH A;  1MKM A;  1QA6 A;  3ZN0 A;  1TWG J;  1DBG A;  4UB8 C;  4ZGQ B;  3ONY A;  1X58 A;  1P7J A;  5CVR A;  5IOY A;  3I4M J;  3OIP A;  2HYJ A;  5GPC A;  3A8J A;  1RQR A;  1IUF A;  4PJL A;  4JOM A;  1BC7 C;  1AU7 A;  3FXJ A;  2JJ2 A;  2Z3Y A;  3NQO A;  5L3E A;  1H8H A;  4G6I A;  4NBS A;  3V76 A;  2P3M A;  2V4D A;  4P55 A;  2NZM A;  2XGJ A;  1U2R A;  3FK7 A;  1J0R A;  4HLX A;  4KN4 X;  4OOI A;  4AD9 A;  3K69 A;  1JTY A;  2AQE A;  4B47 A;  3OYN A;  2VBK A;  1R36 A;  3G6E B;  4N3G A;  3BPV A;  3G1O A;  2DT6 A;  1ETW A;  2QDX A;  4HSR A;  2R7X A;  1P9Q C;  2ZL5 A;  1VQP B;  1QFJ A;  1B2R A;  4II3 A;  3J7A Y;  5J35 A;  3VO1 A;  1W1W E;  4GQN A;  2Y0S A;  1EH8 A;  2L7M P;  2PEX A;  3VMF A;  2XHK A;  2E1O A;  1FOW A;  3CF5 F;  1MGT A;  3BTI A;  4NHJ A;  4N4N B;  2PIA A;  1YLF A;  3CCM I;  2KDZ A;  9ANT A;  2GQF A;  1Z91 A;  4A3M J;  2B63 J;  2QTZ A;  2M7A A;  4UNO A;  4PJ0 C;  1S72 B;  1SFO J;  4Y7C A;  2YSR A;  1T39 A;  1D3Y A;  3E1Y E;  1MBK A;  1OYW A;  2EA4 A;  3F8M A;  1SD6 A;  2XSJ C;  3O8H A;  1HKS A;  4MFE A;  1Q1V A;  2ESN A;  1KZL A;  2X6Y A;  4P9U A;  1RU4 A;  1X4O A;  2HI3 A;  3UR3 C;  1VQ9 I;  1LDD A;  3R0J A;  3PSZ A;  2F5F A;  3ZP5 A;  5K5O A;  1X3W B;  3GZ6 A;  4TT3 A;  2JWT A;  1U5T B;  1EE6 A;  1H0M A;  2GJR A;  2V6C A;  1FP1 D;  1RR8 C;  3Q38 A;  2XT4 A;  2H1K A;  1ZTR A;  1ETX A;  3WE3 A;  2LR8 A;  3SXY A;  4X06 A;  2VBZ A;  4FE7 A;  1IGN A;  4UZU A;  2W00 A;  2OTL B;  2L5Q A;  4BUP A;  1G3T A;  2IOU G;  4LMY A;  3ERE D;  2UV1 A;  2Y0S N;  2JK3 A;  3EUK L;  1HZE A;  4UUT A;  1ZG3 A;  2ID6 A;  4RS8 A;  4A0Y A;  1QGY A;  2PLF A;  4EGZ A;  4YAU A;  3EUH A;  3BJ6 A;  5JLX A;  4E7I A;  1TL8 A;  2GK6 A;  3K10 A;  5J8F A;  1UHW A;  1KYW A;  3OOU A;  1YJN I;  3H9N A;  2HQ5 A;  2JN6 A;  5F08 A;  3PIO F;  5M3M J;  4KIS A;  3GFM A;  3L9F A;  1HOM A;  1WFX A;  2JPB A;  2O9L A;  1IJW C;  1SFE A;  3HSR A;  1VI0 A;  3AG4 H;  1MIJ A;  3V4G A;  2G0Y A;  4A5N A;  1B8I A;  3L2U A;  1W0K A;  1RKT A;  2JVG A;  1FBS A;  3CW2 A;  4KKU A;  4WZT A;  3J80 Z;  3OYF A;  2H94 A;  5IP6 A;  3LL7 A;  1J9Z A;  3JAM Z;  1EJ9 A;  3AST A;  2BZT A;  1DPU A;  4Y17 A;  1IXC A;  4IHW A;  4PC1 A;  2EH3 A;  3DQV C;  3H9Q A;  3WTV C;  2F4O B;  4L18 B;  1IV8 A;  3OYL A;  2P5L C;  4IHV A;  4HBL A;  4F93 B;  2JA6 J;  4WCG A;  3DTI A;  5D5U B;  2QQB A;  4XON A;  2R7W A;  2DA1 A;  4J00 A;  5E1X A;  2JDI A;  3A03 A;  1VQM B;  4RGR A;  2IT0 A;  3D5S C;  1O4X A;  4G12 A;  2CBX A;  3LSG A;  1S0U A;  5DD8 A;  3F0C A;  3HKZ A;  3HPG A;  1LDJ A;  2LBF A;  4LJZ F;  4UZF A;  1O3Q A;  3PNT A;  1RRJ A;  3ERM A;  2ZZF A;  4CYC A;  2V26 A;  3ZMS A;  3IHU A;  1PUF B;  1XMA A;  2R5Y A;  4ZTJ A;  4M6Y A;  2GBY A;  5ILV A;  1CF7 A;  4XKV A;  5F0C A;  5M3F J;  4QVA A;  4F3Q A;  1KD1 D;  4HIZ A;  1PJ5 A;  1UD4 A;  3JUR A;  2QWW A;  4RAY A;  4DIQ A;  5BQT A;  3BY1 A;  3AVW A;  5EG0 A;  2A68 F;  3E6C C;  2ZBU A;  4FN5 A;  3J80 K;  5CLS A;  5HKK A;  1IN5 A;  4Y15 A;  1EP2 B;  3HJE A;  4Y9U A;  4LIV A;  1L3L A;  4ASN A;  4YII A;  3REO A;  4Y33 A;  2XAF A;  4BY1 J;  5EMN A;  2EZL A;  1U3E M;  4AYB A;  4AC9 A;  5KSW B;  5KW9 A;  1JGS A;  3G71 I;  2IS4 A;  4WWC A;  4MGR A;  2XPV A;  4WXD A;  5D6E A;  2ZTN A;  2LMD A;  2PLY A;  1BOA A;  1JB9 A;  2CSO A;  4LFU A;  2DLL A;  4D7M A;  3KEW A;  4OPS A;  4N0B A;  5FB2 A;  2HNH A;  3U9G A;  5L3B A;  1I8D A;  1H80 A;  4I98 B;  2UUZ A;  1U8B A;  4JP0 A;  1ITY A;  1K78 A;  1TW2 A;  1WMR A;  1T6Y A;  3OZV A;  5FO0 A;  1O88 A;  1R5B A;  2XAG A;  3SFZ A;  4A3J J;  1ZEL A;  4Z4R A;  3HTU A;  3JSO A;  2P0W A;  5GTI C;  2INU A;  2Y69 H;  2E1R A;  3PNY A;  3L2Q A;  2UWM A;  1HQC A;  4BY7 J;  4P1V A;  2FEZ A;  1MW7 A;  2AXL A;  1IC8 A;  1O7L A;  4LBY A;  1KQ8 A;  2HS5 A;  4V19 K;  2BF4 A;  1SKQ A;  1OFC X;  1Z3X A;  2JA2 A;  2VNJ A;  4D0P A;  4A3K J;  4UV8 A;  1I6X A;  1OYI A;  3V8L A;  2EIJ H;  4CO8 A;  5C44 J;  2ZJR F;  5H2F C;  4EJT A;  1OGI A;  3TKY A;  3TMO A;  2QBY B;  4ZYG A;  2XPW A;  1VQ7 I;  5FRN A;  2R7U A;  2RGV A;  4M6V A;  3FXK A;  3Q0W A;  2A3S A;  2CYY A;  4AUX A;  4DBQ A;  4Q7J B;  1KTW A;  5J6X A;  3AGP A;  1ZLJ A;  2IP2 A;  5TRD A;  1MSF C;  1OHH A;  4HDV A;  1TTY A;  2FQ4 A;  1JJ6 C;  4XSZ F;  3OIO A;  2D9R A;  3B82 A;  1OFM A;  3DWL E;  2ZCW A;  3NWS A;  2EFW A;  4RM0 A;  1VFC A;  3CME B;  2Z1D A;  1IJE A;  3PO2 J;  2LK2 A;  4YIF A;  3HG9 A;  2IBD A;  2A6E F;  1Z7L A;  1DU6 A;  1BQE A;  2RNG A;  2CV1 A;  4P9F A;  3RKX A;  2O1D A;  4OPV A;  1R5O A;  2R7Z J;  1WRJ A;  2KPM A;  4BYY A;  3H36 A;  2DPD A;  2LD5 A;  2HPM A;  3ML6 A;  2FUG 2;  2MA3 A;  3QOP A;  1LNW A;  2OBS A;  1O8L A;  1TQI A;  2W1O A;  2O0V A;  2E7W A;  2CQN A;  1RC9 A;  1W5T A;  3ASQ A;  2KKO A;  3BR3 A;  1E63 A;  4U0V A;  3F9K A;  1I27 A;  2QQA A;  2WSS A;  1ACI A;  4X8I A;  4M3E A;  5KNL A;  3N4M A;  2V9K A;  3GME A;  3WTY C;  3Q3S A;  4ENJ A;  4HWV A;  4Y52 J;  2X85 A;  1ZM4 A;  2KRH A;  3B6A A;  3CTA A;  3HSF A;  3L09 A;  1BMF A;  3ZQF A;  2DYS H;  1BI1 A;  4OJL A;  4ZYE A;  5K7F A;  2QZ8 A;  2O6G E;  4YC5 A;  4UVB A;  3L2R A;  4RCY A;  4OMZ A;  2P5K A;  3PA2 A;  2YUH A;  1AMO A;  2R5Z A;  2C2W A;  4I2O A;  2WWY A;  3BR5 A;  4A2U A;  3JCU C;  4B44 A;  4ESJ A;  5JLW A;  2JA7 J;  3Q0V A;  3CC2 I;  1UB9 A;  4EAT A;  2PMZ A;  1LUJ B;  1WOR A;  3I3L A;  4IX7 A;  4NUB A;  3WNB A;  1XQB A;  1T6X A;  2OBR A;  1NK2 P;  4OIO F;  3DCF A;  4ZCL A;  2DBB A;  1Y1V J;  1PYV A;  3HOT A;  4FXU A;  1JT6 A;  1FOX A;  5HDG A;  5K7H A;  1VF9 A;  3IWF A;  1FP2 A;  2FBH A;  2Y9Z A;  1D8J A;  5EEG A;  4XLP F;  2HEO A;  2O8K A;  4MO7 A;  2BW3 B;  5JR3 A;  4XBF A;  3ONU A;  2ZFU A;  4YEL A;  1K8F A;  1Y8Q B;  1IZ1 A;  3S1Q J;  1ETQ A;  2LF7 A;  3CMA B;  3GQ9 A;  3BLY A;  2GQQ A;  4BHB A;  5HZB A;  1MBJ A;  2STT A;  1N08 A;  2DT5 A;  1XG1 A;  1JXS A;  1HSJ A;  3TW7 A;  3GVK A;  3CJT B;  2E1C A;  2FE3 A;  1SVM A;  3DBL B;  3C2G A;  3ZCO A;  3K9T A;  3Q5F A;  3W2E A;  4WZK A;  1QO0 D;  2YWF A;  1K4S A;  1CQX A;  3WU2 C;  3J7A O;  2BM7 A;  2GPJ A;  2JMW A;  4XRS A;  3PUB A;  1D8T A;  1EWY A;  1IO2 A;  2DCU A;  2HOE A;  4YAO A;  4B4C A;  5DUK A;  4IKF A;  1VLY A;  3RIQ A;  2BX6 A;  3RYR A;  4C2T A;  1MNM C;  1VQO I;  3TP0 A;  5FO1 A;  1UST A;  2DOE A;  3PQK A;  3V8J A;  4CCO A;  1VQ7 B;  2GOM A;  3SQN A;  3ZIA A;  2OAZ A;  2E36 A;  1FRQ A;  5C4X J;  2WY8 Q;  4TMT A;  2RC4 A;  3OS2 A;  2IGO A;  3LFK A;  2QF7 A;  3U2R A;  3K7A J;  1OB2 A;  3JU4 A;  4OWR B;  1YW7 A;  3FK6 A;  1AWC A;  1VBL A;  2L9V A;  3ZZU A;  3A2K A;  3L00 A;  3LSH A;  5CKT A;  3H3V K;  5F04 A;  3MCA A;  1MMA A;  4B1R A;  2IPQ X;  2VQH A;  2QLZ A;  2VQG A;  3KP3 A;  4E70 A;  4IHT A;  2C78 A;  1O8M A;  3ABK H;  2HQR A;  2Y48 A;  3E1S A;  3KP6 A;  2ZSI B;  3VFZ A;  2BSA A;  2C4T A;  4IRG A;  3QU6 A;  4RDK A;  4IO9 F;  3HDD A;  3FJO A;  5BSX A;  5TGT A;  2D74 A;  3VYS B;  4RB0 A;  1VQ8 I;  1X2N A;  3IP4 B;  2EWE A;  1QZE A;  2DEU A;  3H9G A;  2IS2 A;  3P5J A;  4N9I A;  2V1U A;  2DER A;  1W5C C;  5E79 C;  1JA0 A;  3M3Y J;  4E6K G;  4A5M A;  2R7O A;  1W2B B;  4W1U A;  4RPB A;  2BM0 A;  2GM4 A;  2NVX J;  4C3H J;  2HKO A;  3BG5 A;  4HNT A;  1YW9 A;  1NK3 P;  4M3B A;  2W7N A;  3BG6 A;  3M8E A;  4OZY A;  5D4R A;  3QFR A;  3CC4 I;  3DEW A;  2QKL B;  3SDG A;  1GV2 A;  2HDN B;  3G71 B;  2KIQ A;  3TW6 A;  4BDY A;  3GQB A;  3QPS A;  5J8C A;  3S1N J;  5TIS C;  3CP8 A;  2ZBV A;  5F0F A;  3CCV I;  1NHA A;  4C9Y A;  2QEX I;  3WTT C;  2FX0 A;  2MSY A;  2VQC A;  1YX5 A;  4AC0 A;  2VOP A;  1G3Y A;  3W2V A;  3LSR A;  3DP7 A;  1U8R A;  1G7T A;  2VI6 A;  1XGM A;  1GUU A;  1X4P A;  2X1E A;  1SVO A;  2R7R A;  2L4M A;  1E1R A;  2H6B A;  1F60 A;  3A3B A;  3OZU A;  4P12 A;  3F22 A;  4IOC F;  4LD5 A;  4M9Z A;  4E7K A;  4BGD A;  1G59 A;  4LB5 A;  3GFI A;  3P9I A;  2HXO A;  2V31 A;  4M2L A;  3H9J A;  5LGU A;  2G7H A;  4YAL A;  2F5V A;  3QFT A;  4HPQ A;  3IKT A;  2QGU A;  2HZT A;  3I53 A;  2YWH A;  4R8H A;  1XD7 A;  2M5W A;  2WY7 Q;  4ZDP A;  3IWZ A;  1SAX A;  3RTR A;  2V6E A;  1ZR4 A;  2XTY A;  3FX3 A;  4PFO A;  3NAR A;  2DK5 A;  1JUP A;  5F64 A;  1X1D A;  1WJ5 A;  4FX0 A;  4IF4 A;  1QG0 A;  2ZZG A;  2HGC A;  1W87 A;  2K4J A;  1YRN A;  3VWB A;  1QFZ A;  2FNA A;  3QP6 A;  1W35 A;  5M5X J;  4B4D A;  4EMS A;  5KVR A;  1ZHF A;  2RQQ A;  4B43 A;  4BEH A;  4CZZ A;  1D5Y A;  4ZH4 F;  2IJL A;  3M7G A;  4EVI A;  3VST A;  2KIM A;  2LC2 A;  4M4S A;  5LHH A;  1XGO A;  4EH1 A;  3D26 A;  2RDP A;  3HEF A;  5E18 F;  1YS6 A;  2K9S A;  4Z2Y A;  5FL7 A;  2KLO A;  2W6J A;  2NOJ B;  1WKM A;  3VOD A;  2M2E A;  1H89 C;  2W24 A;  4KT5 C;  1S5L C;  2FMY A;  3R60 A;  3WYA A;  4WXH A;  1UJ8 A;  1OCP A;  3K4C A;  3ZZ0 A;  3M07 A;  2QY1 A;  2LY1 A;  2DFE A;  4JK1 X;  3ISX A;  3OR1 C;  3HC7 A;  3Q9V A;  5E3O A;  1RR7 A;  5FFZ A;  2V7T A;  1I1G A;  1KRH A;  3WQZ A;  2XC1 A;  3KPH A;  1TUI A;  1B4A A;  1MDM A;  2LTP A;  1XX5 A;  4HNV A;  4FWT A;  4MEX F;  1TT5 B;  2FBK A;  1A36 A;  4O3M A;  1O8J A;  4JYK A;  2ZNZ A;  5FGM A;  3G4S B;  2ZZE A;  1ZK8 A;  1K5C A;  1WXR A;  2EZK A;  4DQL A;  3BT9 A;  5IT9 Z;  4ZC3 A;  1SVL A;  2OTL I;  2XSD C;  3ZBU A;  5DCF A;  2E2J J;  2JRM A;  2ZKZ A;  4AF7 A;  1WPC A;  3GSI A;  1O8H A;  5B1A H;  3MWM A;  3N97 A;  1DU0 A;  3AVX A;  4DNR B;  3B8H A;  5ED4 A;  2X48 A;  2VOO A;  1O8F A;  4A12 A;  3B8Y A;  1BBY A;  4L5E A;  1K4Z A;  1KC8 D;  2LFB A;  4A3L J;  3FMS A;  4B48 A;  2L54 A;  4BJ6 C;  4ETS A;  3CCE B;  5M5W J;  4GCV A;  2KP6 A;  3OL3 A;  2ZME B;  1E64 A;  2CW8 A;  5IYN A;  4LBZ A;  4RD0 A;  5CDF A;  3SJZ A;  3FM5 A;  1XG2 A;  4GYG A;  2DTZ A;  1JKO C;  5H6R A;  4PC6 A;  3DEU A;  2HWV A;  2W7Z A;  4IVN A;  4XRM A;  3OZW A;  2H27 A;  3H5N A;  3Q6Q A;  4C43 A;  2F43 A;  1XFO A;  4QVJ A;  3IC7 A;  5HDN A;  1X1A A;  2EQR A;  4PMH A;  2K4B A;  3RPQ A;  4ENK A;  3OEE A;  3BG9 A;  2ECB A;  3IH3 A;  2XGX A;  1WJF A;  1FBU A;  1VQ5 I;  3KX2 A;  1F43 A;  2PG4 A;  4RDL A;  1B6A A;  2BEO A;  2EV6 A;  5KCM A;  4UUS B;  2KJC A;  2KT0 A;  4BJT A;  2DPU A;  2K02 A;  3MEX A;  2WPD A;  2XAH A;  1WSR A;  2AHQ A;  1E3P A;  2IS1 A;  4BDZ A;  3VSU A;  2M5S A;  3GTQ J;  4PC2 A;  4CH7 A;  3K70 D;  2WAE A;  3R4K A;  1XCV A;  3QRF F;  2O0W A;  2FXA A;  2PMZ N;  5A2Q K;  2LKX A;  4PGH A;  1OCO H;  4MTE A;  1GAQ A;  1BR1 A;  1UD2 A;  5GPA A;  3B78 A;  2PMH A;  5ICF A;  2L7F P;  4HF1 A;  4OAZ A;  4I0A A;  3WHB A;  2ZSH B;  4E7L A;  1R49 A;  3DDY A;  3LQE A;  3ZSC A;  3VR6 A;  1ZH5 A;  1OLT A;  4HE5 A;  1D0Z A;  4OOS A;  2K7L A;  3OYC A;  2NRA C;  5LD2 C;  1DP7 P;  3KRG A;  1KQ9 A;  4ITV A;  2QGG A;  3F23 A;  3FIS A;  1HKT A;  2GA1 A;  3CCE I;  2Q6O A;  1TZL A;  4UHT A;  1T98 A;  3BY2 A;  4TSF A;  1X19 A;  3SLD A;  3S32 A;  3CP2 A;  1FND A;  4CXF A;  3ABM H;  3WG9 A;  2EFO A;  1R5G A;  4ACA A;  1ZQ3 P;  3S3M A;  2BY1 A;  1Z0X A;  2HYG D;  4QTR A;  4RD1 A;  2Q8K A;  3AVV A;  1R7J A;  1XDU A;  1FNM A;  5E20 A;  4CCN A;  2BGC A;  5BPD A;  1K7A A;  2GAU A;  1FNC A;  3OS0 A;  2XGD A;  4CZC A;  1VND A;  3WTU C;  2MYS A;  1OQY A;  2OZU A;  2D45 A;  5GAE J;  4RLQ A;  3W5V A;  1N8R D;  1EXM A;  3HRT A;  2YWE A;  1QVF B;  3BTJ A;  2JN9 A;  3GVL A;  3AKZ A;  1YG2 A;  2QSF X;  2MW8 A;  3JSP A;  1LKX A;  3AG3 H;  3OPO A;  3CCL I;  2O6W A;  3M8F A;  3CQZ J;  1K4T A;  4S04 A;  3C2B A;  1VTN C;  3OSG A;  1YJW B;  2DA5 A;  1IN8 A;  2LDU A;  4P2N A;  5IY5 H;  2Q6L A;  4O6J A;  4U7B A;  1SFU A;  2OF7 A;  3FBN B;  2HZD A;  1SM4 A;  4B3G A;  1K73 D;  3H09 A;  3H0D A;  2BM6 A;  2CQ7 A;  2DA3 A;  1HCR A;  2KZV A;  3F6V A;  2OTJ B;  1SMT A;  1N25 A;  4EJW A;  1E3O C;  4AM3 A;  4XN3 A;  1TSP A;  2NVT J;  1Y0Y A;  1JI8 A;  3GF2 A;  2I10 A;  4Q48 A;  1V4R A;  4G7Z F;  4KUM A;  2LSO A;  4X05 A;  1Q82 D;  2NV4 A;  2YX7 A;  4I09 A;  5GAH J;  4KMF A;  4IJA A;  2VXD A;  2CUF A;  3U1K A;  3BWG A;  3KCC A;  4FX4 A;  3BDD A;  5B1B H;  2EV0 A;  3F6O A;  4QLC U;  3NE5 B;  3PO3 J;  2HQN A;  3HOV J;  1LE8 B;  3T9G A;  4LB6 B;  3AVY A;  1VHO A;  1W4M A;  1XSD A;  1VQL I;  4CCL A;  1OJL A;  5L3C A;  3MN2 A;  3I58 A;  3GBG A;  1W9X A;  3OFN A;  4TKO B;  2QA4 B;  1OMI A;  2VLA A;  4C2U A;  1DGW Y;  3PFI A;  2DOF A;  1EP1 B;  1AKH A;  2FOW A;  1VJS A;  1VQK B;  3LSK A;  3K4M A;  4M71 A;  4OIQ F;  1E1Q A;  3K4L A;  3S1M J;  2HU9 A;  2JIZ A;  1L1I A;  1P92 A;  2BN4 A;  3MFK A;  4L9N A;  2X9D A;  5KAI C;  1V5F A;  1G8X A;  1H42 A;  2QEX B;  1GT0 C;  2IA2 A;  1Z6T A;  3H5R A;  3D5R C;  1MMS A;  1GHC A;  2BVN A;  2HCJ B;  3VEP A;  1Y1W J;  3R61 A;  1D1C A;  1TYU A;  1AIP A;  3HRS A;  1WJC A;  4G6D A;  2FJ1 A;  3GTL J;  2CRV A;  5B6I A;  1OGJ A;  3ROU A;  2Q6I A;  3TP3 A;  2WYR A;  1IA5 A;  1PP7 U;  5H6Q A;  4C30 A;  2DY1 A;  3KYC B;  4PJJ A;  2PFB A;  5K5R A;  2DA7 A;  5DS9 A;  3CCJ I;  1Q9S A;  2NVQ J;  3GW2 A;  1GVJ A;  1WJD A;  4RGS A;  3QOE A;  4DW6 A;  2JA8 J;  3WGI A;  1ZUN B;  3OS1 A;  2XAJ A;  2HDC A;  1A8P A;  4YG2 F;  3GO5 A;  3U21 A;  2OZ6 A;  3E5Q A;  4RD6 A;  3HRU A;  1PXZ A;  2K3F A;  2F6C A;  2KHM A;  2QE7 A;  1YYV A;  1YJW I;  4U87 A;  4BQQ A;  2X0L A;  4CIC A;  3FY3 A;  5TY0 A;  4RD4 A;  3GUD A;  5LLQ A;  2B9S A;  1QPI A;  3CC7 I;  1S7O A;  2A61 A;  1JT0 A;  2X3U A;  1EF4 A;  2M9H A;  4P3Y A;  2Q2E B;  2WAF A;  4C0S A;  3T8R A;  4YEJ A;  4QSH A;  3OSF A;  3TDZ C;  4Z1M A;  3HOX J;  1HG8 A;  2WAD A;  2C5H A;  3H35 A;  2TDX A;  4UVA A;  1YE9 A;  4UZE A;  1D1A A;  4BQA A;  3LQR A;  3RKW A;  1R4N B;  1HDD C;  2ZJQ F;  2E35 A;  2ADU A;  4G7H F;  3A02 A;  2Z2S B;  2J5O A;  4W8S A;  1QA3 A;  3DKW A;  4JBA A;  2ZTG A;  1OOC A;  1XDS A;  2Z33 A;  1RKW A;  5LRR A;  4XLA A;  3Q9S A;  2ECC A;  2Z6B D;  2XZO A;  3GQ7 A;  2DMP A;  3GTM J;  5IYR A;  3BTC A;  3A4C A;  3IKV A;  1UMQ A;  4AIK A;  1MMN A;  2VBU A;  1F9N A;  3CDH A;  4EJU A;  4LG0 A;  5HLH A;  1O3S A;  4AF6 A;  2V1D A;  1Y0R A;  5DUI A;  1MRZ A;  3SZE A;  3ZOB A;  2B0L A;  1IG7 A;  2BGI A;  1J5Y A;  4F7Z A;  1ULY A;  2XEX A;  2J7K A;  3RKY A;  3J81 Z;  5FRO A;  3DKY A;  3PL8 A;  1R22 A;  4OU0 A;  3KYL A;  3ZZT A;  2UVF A;  1F36 A;  1K83 J;  1ZRF A;  1USS A;  1SAU A;  2P4W A;  4AYB N;  4A3C J;  3CCS B;  2XT2 A;  1T0F C;  2O0Y A;  2E60 A;  2R7V A;  1EFT A;  2VPR A;  1QQ1 A;  1XB2 A;  3ZQG A;  4D5C A;  3PJR A;  1UG2 A;  1WOS A;  3QP5 A;  1OFE A;  2JTV A;  1LPQ A;  1MMG A;  4LLL A;  4DK1 A;  1BL0 A;  1U5T C;  2WTE A;  1YO5 C;  4DJA A;  4QFM A;  2WA0 A;  2ELH A;  1H9G A;  2ZXH A;  1TQM A;  2V79 A;  4URR A;  4PGG A;  4XM3 A;  3LFU A;  3QWL A;  5HOD A;  4V02 C;  1X3Z B;  1MBE A;  2F4N A;  3OAA A;  2JUC A;  3LNN A;  2ETH A;  4AWX B;  2BVM A;  1FEX A;  2LOO A;  1N05 A;  2MG4 A;  3KZZ A;  2VNH A;  3TL4 X;  4NK8 A;  5DV5 A;  2IW5 A;  4K1X A;  3RI4 A;  2XDV A;  4NQW A;  5DDG A;  2BGJ A;  4HST A;  3WND A;  3SYT A;  2W4S A;  1DBO A;  5ERI A;  3M1E A;  5E8I A;  4E7Z A;  3WBK A;  2KFD A;  4WX9 A;  1XCB A;  2QEN A;  4BBS J;  3EQN A;  1BN5 A;  3BOQ A;  4G7O F;  1DDI A;  2G9W A;  2BPO A;  1FBQ A;  3PUN A;  4X7C A;  1BM9 A;  1QZZ A;  4D7N A;  1TLL A;  1EFU A;  2OCE A;  3TED A;  3E97 A;  3ZMD A;  3Q0U A;  2IAI A;  3D1N I;  1EKE A;  1BJK A;  3IV5 A;  3FKI J;  2R6H A;  3PUF A;  4PAB A;  2OPT A;  4FK8 A;  1BJA A;  4LC0 A;  2MGQ A;  4WXC A;  2DQL A;  1VQN I;  1R23 A;  4KFC A;  2MAB A;  5E1W A;  3WOD F;  1QQI A;  1UHS A;  1DGR M;  2VBW A;  6PAX A;  3GQA A;  2HVQ A;  2RC6 A;  2VUM J;  4NK6 A;  3LJY A;  1PVE A;  1LFB A;  4IEJ A;  3G4S I;  2LVS A;  2QKM B;  4HOB A;  2IGK A;  5FLX Z;  1TYX A;  1WZ2 A;  3GEZ A;  4EV0 A;  3OP1 A;  3W2G A;  5DYM A;  3ZQC A;  1XN7 A;  2QCO A;  2VJI A;  4UY8 I;  1OCZ H;  3T1B A;  2WZN A;  4OIR F;  1SC7 A;  3BNW A;  2RV8 A;  5IYW A;  5FLV A;  2GK7 A;  3ZMV A;  3HKZ N;  1S29 A;  4HLY A;  3W2A A;  1B1B A;  5KAF C;  2K40 A;  5LGT A;  1MJB A;  1H85 A;  4A93 J;  2ZBK A;  5ILS A;  1O3T A;  2XOK A;  3IRR A;  4KMU X;  3S3N A;  1FZP B;  2G0E A;  4IZZ A;  1UG0 A;  3DF8 A;  4A6E A;  2GXA A;  2VBX A;  1OR7 C;  4BQO A;  1R5N A;  5GV8 A;  4YFK F;  4Y9R A;  4HA8 A;  2ESH A;  1FMV A;  2CJJ A;  2QVO A;  1S6L A;  2X0K A;  4NCN A;  1DDG A;  1LEB A;  1FIA A;  4IW3 B;  1R58 A;  5EGO B;  3KP5 A;  4HYE A;  1G7C A;  3E20 A;  3D5L A;  1O8E A;  3G2B A;  4KIB A;  1BW6 A;  1FWZ A;  2Y0M A;  5FJ8 J;  1Z77 A;  1ZG1 A;  3CB4 A;  3EQL F;  2EPF A;  3MZH A;  1QRB A;  3T5X A;  1X2M A;  1JKQ C;  2DMU A;  3O8G A;  4HQM A;  3FMQ A;  5CVU A;  5HVQ C;  5GTH C;  4XLC A;  4BS9 A;  4Y4R A;  4ACB A;  3HUG B;  3FDY A;  2X4H A;  4C3J J;  2VFO A;  5EZH A;  4B8X A;  4OP7 A;  3K2Z A;  2KRC A;  4XLF A;  2Y2Z A;  2UXN A;  3K1N A;  1N77 A;  2X1D A;  3K4K A;  5AON A;  4EJO A;  1O3R A;  1A04 A;  1OFD A;  1DPR A;  2VFP A;  1FMW A;  3JRD A;  1B72 B;  3I1F A;  2CUJ A;  1WH7 A;  1WCM J;  4RBO A;  5JHU A;  1PP8 F;  1OCC H;  3BY6 A;  3IAS 2;  3HXL A;  3FMR A;  1IDY A;  3KZY A;  4F7D A;  2NVY J;  2QUF A;  4YZX A;  3VYU B;  1KQ5 A;  3FXM A;  1SD7 A;  3VYR B;  5IOZ A;  2AQF A;  2PJP A;  5CVI A;  3BR1 A;  4GFB A;  4I84 A;  2OU2 A;  1YIT B;  4RGU A;  4YAW A;  3MAJ A;  2Z99 A;  1G7R A;  3A1P A;  3FXO A;  2VBM A;  2LP0 A;  2CV0 A;  3ASN H;  4YZQ A;  4R79 A;  2IRF G;  3RZO J;  2XVC A;  1N07 A;  2MH2 A;  3V7S A;  3ELK A;  3TOA A;  2XZL A;  1RPW A;  1W7P A;  2IGM A;  2I8D A;  1JRG A;  2A6H F;  2VB6 A;  2PMU A;  1G3W A;  2O8X A;  1ON2 A;  2OUM A;  1LDK B;  1VQ4 B;  5F4O A;  4EM2 A;  3KEY A;  2DU9 A;  4KIC A;  2XTW A;  2PBI A;  2XND A;  4G5G A;  4RAF A;  1QCX A;  2GA2 A;  2BXY A;  4EGY A;  2E5N A;  1D0Y A;  1D1B A;  2N8G A;  4BHC A;  1JE8 A;  1E2X A;  2DO7 A;  3VPR A;  4MYU A;  2Q0O A;  5LEJ A;  3AVT A;  4PSW A;  3QAH A;  1GDT A;  5DTD A;  4EM1 A;  1PDN C;  2X53 S;  3PFY A;  2E1B A;  1WOP A;  1F20 A;  4TN1 A;  2NNY A;  3DFG A;  3PA1 A;  2J8K A;  1DDN A;  2COB A;  3LMM A;  5AIQ A;  4NB5 A;  3MKL A;  1YJN B;  3VO2 A;  2PN6 A;  2PEC A;  1ELO A;  1VQO B;  3W6V A;  2TRT A;  1U5T A;  2CS3 A;  2FVG A;  2V5I A;  3F72 A;  2L02 A;  3CMM A;  3OYG A;  1EA0 A;  2BV6 A;  2IGN A;  2W84 A;  5ICG A;  1IXS B;  3GFJ A;  4FTH A;  3A01 B;  3K4N A;  3ZQ7 A;  5JVT A;  3AVU A;  4G6T B;  1KTV A;  2ZNY A;  4PZJ A;  1V5V A;  1UAA A;  2EIM H;  3DU5 A;  4H4K C;  4XN0 A;  2ZME C;  1X1P A;  2KIU A;  1IRF A;  2JZY A;  4KIG A;  3ZMT A;  2CGP A;  4IHY A;  4YAF A;  4OOV A;  2CUZ A;  1S7A A;  4BXX J;  5H5J A;  3OW7 A;  4YFX F;  1A5J A;  4Q47 A;  2K9L A;  5L3F A;  3OKX A;  4I01 A;  5IP9 J;  1Y0U A;  1MBH A;  3D0S A;  4X7E A;  4UUV A;  2VZL A;  3ZXS A;  3E6D A;  4KT6 A;  1MD0 A;  2GWR A;  3CMA I;  1C0W A;  5LEK A;  2ODL A;  2GIV A;  4Z05 A;  4P1W A;  3A8K A;  2VT3 A;  4DYQ A;  3JAM K;  3BH4 A;  3B02 A;  3TO6 A;  3PSS A;  4OJP A;  2I5U A;  5ICE A;  1GR1 A;  3R6K A;  1YHQ B;  1W34 A;  4A3B J;  1OIS A;  3ESW B;  3HGG A;  4C2L A;  4U9U A;  2HVS A;  2L9S A;  2RRE A;  3CCM B;  2EFQ A;  3DU1 X;  3LQQ A;  3GZ5 A;  4XLN F;  1W0T A;  5CJ9 A;  1V5G A;  3BQY A;  2PJR A;  1FC3 A;  3KET A;  1VQP I;  4XSX F;  1IUY A;  5HS8 A;  2CG4 A;  4KDP A;  2ELK A;  1FYM A;  3WE2 A;  3RYP A;  1S7E A;  5CVJ A;  3EQO A;  4WZL A;  3G6E I;  2LRE A;  3ZPL A;  2DOA A;  2EZI A;  2R92 J;  3HOZ J;  2O61 A;  3V7A A;  2ICW G;  5DCM B;  4PGO A;  4UV9 A;  4XKW A;  4X0C A;  3HIF A;  4RM2 A;  3M4O J;  3BCA A;  4YXW A;  2VFQ A;  4KIT B;  1XSV A;  2A6T A;  2RN7 A;  2FD5 A;  2WV1 A;  4DGW B;  4YCQ A;  1KU3 A;  2D5V A;  3G05 A;  5LFA A;  3QU3 A;  4D9J A;  2IA1 A;  1FSE A;  2CQX A;  3DTE A;  5DNS A;  1IN6 A;  2O03 A;  1JUS A;  3OYA A;  2Y75 A;  4UUS A;  2EFG A;  2R9V A;  3F8B A;  3IL2 A;  2QTL A;  5LMZ A;  5IYP A;  4RB2 C;  1A35 A;  1W0J A;  2E5Z A;  3NAU A;  1E3X A;  3SQV A;  2QQ9 A;  5EJC A;  2R7F A;  1H8A C;  3ASO H;  2P7C B;  1K28 D;  2QX3 A;  1BR2 A;  5J4Y A;  4EM0 B;  3FXR A;  2OBP A;  4XKC A;  1DG1 G;  2YR2 A;  3LAJ A;  1R1T A;  4FE4 A;  4NC7 A;  4I02 A;  3VB2 A;  2AHO A;  4BJ5 C;  2QMU A;  3CCV B;  3G3Z A;  1T6Z A;  4BXU A;  4KH3 A;  3ECO A;  2W25 A;  2BSP A;  2QM3 A;  4D1Q A;  4M9S A;  2OJE D;  3QPH A;  1T2K A;  2ME6 A;  3IUO A;  3TBI A;  2XRN A;  1WPK A;  3TGN A;  1GXP A;  4ROX A;  5M5Y J;  1OFL A;  1JHF A;  1T38 A;  4UXN A;  4ZYA A;  3JQP A;  3AG2 H;  1HW1 A;  4KN7 X;  3PEN A;  3OIQ A;  5HOO A;  1S9H A;  1UD8 A;  4MFD A;  1FOY A;  3KIO A;  4GXO A;  1BHE A;  1NB9 A;  3MKW B;  2VBS A;  3PET A;  2CK3 A;  4E4H A;  4P22 A;  1PJR A;  1ZYR F;  2Q1Z B;  2QZA A;  3W3C A;  2BMW A;  2FNP A;  3ONQ A;  2TCT A;  2FOK A;  2IVM A;  1LFU P;  2XZP A;  1HVX A;  1ETK A;  4E7J A;  3ASR A;  3MHP A;  5EEH A;  3N90 A;  5BS6 A;  4V2F A;  4XL9 A;  3GFL A;  3I54 A;  1NH3 A;  1YJ9 B;  5HNF A;  2Y31 A;  3K6G A;  4CCJ A;  1CLW A;  1XE1 A;  2KZG A;  4M3G A;  4M74 A;  2QBY A;  4IHX A;  1IW7 F;  2B7B A;  1R5H A;  2D3N A;  2K3P A;  1YIJ B;  4HRI A;  4DNT B;  4OPW A;  2LNB A;  4YEI A;  1QRY A;  2DOD A;  5E1Z B;  2OBT A;  2MFZ A;  3ZRG A;  2I1L A;  4P26 A;  3CMY A;  4HEA 2;  1BOB A;  1HLV A;  3LA7 A;  1YFH A;  4A3F J;  5KHD A;  2UZK A;  2X6W A;  1ZG5 A;  2FU4 A;  2YX4 A;  1QPM A;  2CH0 A;  5E17 F;  3SY2 A;  1PJ6 A;  3OJW A;  3SKB A;  1TYW A;  4GO1 A;  1NG6 A;  3R6S A;  1PJ7 A;  3R6J A;  4PJN A;  2DYR H;  3SYJ A;  2VJ5 A;  2DET A;  4ESF A;  1QJV A;  3OYK A;  1OCT C;  2ZIT A;  3OE7 A;  3QPT A;  5D5V B;  1ENH A;  2M87 A;  5DN6 A;  3BCF A;  5C4J J;  1WHU A;  3LST A;  3ZQI A;  2VE9 A;  3I71 A;  2EIX A;  3LOC A;  2GRE A;  3I4N J;  4HV5 A;  1IDZ A;  2XF5 A;  1Z3Y A;  2MD0 A;  2C6Y A;  4QWQ A;  3L2W A;  1OGO X;  4DZP A;  1I7P A;  1RIO H;  4KJZ A;  2Q6K A;  2B5O A;  1KJZ A;  2RKH A;  4U0Y A;  3KEO A;  1Z7U A;  1MMD A;  4PK4 A;  2XB0 X;  1WSV A;  2QN6 A;  3HZJ A;  4X7D A;  1JHH A;  5K5Q A;  3BG3 A;  1HC8 A;  1ZGA A;  1COW A;  4H9G A;  2DJN A;  3CUQ A;  3FXL A;  1T5E A;  2C77 A;  1EV7 A;  1JUM A;  5FLM J;  4A3E J;  2LH9 A;  4PAA A;  2HDW A;  4DOZ A;  2X6O A;  1SFK A;  3HOS A;  1RQP A;  1J9I A;  2ZO4 A;  2FRH A;  3P27 A;  4CCM A;  1Z1D A;  1KK3 A;  1B9N A;  3HRM A;  2NT6 A;  3OOP A;  4BHP A;  3T53 B;  2AXT C;  5DS0 A;  4MQ9 F;  1FX0 A;  5TV2 A;  3WXM A;  3RDI A;  2NTB A;  4YDT A;  5IP7 J;  4E7H A;  3HGY A;  3V42 A;  3VSK A;  5JVG F;  1N78 A;  5E6T A;  5H59 A;  2EIN H;  2VYQ A;  2DCE A;  2LZJ A;  1OR7 A;  4QUZ A;  5K1Y A;  2BY3 A;  3DBR B;  3N05 A;  1HBX G;  2V7Q A;  5JBQ A;  2CND A;  1TNS A;  2P7V B;  4A6D A;  1I50 J;  2XAQ A;  4PDK A;  1IRG A;  1W7P D;  3JTG A;  3LSP A;  2DFH A;  3U6K A;  2OQR A;  4XNF A;  1VLO A;  1O8K A;  4RB1 A;  1MAB A;  2D1H A;  2EV5 A;  3T51 B;  1OYY A;  4PFP A;  5IT3 A;  3OMY A;  2PMD A;  3COA C;  3CRZ A;  2VJJ A;  3LSJ A;  3CCL B;  1J09 A;  2NTP A;  2O7O A;  1BI0 A;  2IQ7 A;  1N75 A;  3I55 I;  1GO2 A;  4A69 C;  3NRV A;  3GVJ A;  1QVT A;  1MH3 A;  1QHH D;  3MQ0 A;  2Z8G A;  2V7V A;  2HXI A;  2VON A;  2DAO A;  3E3V A;  4P96 A;  2ZXW H;  1RUO A;  2ZXI A;  5F4M A;  2E2H J;  4OIN F;  1ZRD A;  3BR6 A;  2FSW A;  2X51 A;  2P6T A;  3ZMU A;  2MLK A;  2P8T A;  4BBR J;  2VFM A;  4KA4 A;  3JX8 A;  3KZI C;  1POG A;  4Q5S F;  1WSU A;  1ZM9 A;  2MBF A;  4M53 A;  2Q2E A;  3OV8 A;  2LBF B;  3WNC A;  1RET A;  2YUS A;  5D5W B;  1VHE A;  3AAF A;  1G6N A;  4HX8 A;  4EEF G;  3A0H C;  2EIK H;  1AOY A;  1L0O C;  2NSP A;  4CYC B;  2JPC A;  2XV4 S;  2R5Y B;  4H0E A;  2QQ8 A;  2JSC A;  3EET A;  5FKM A;  1S4M A;  3HPH A;  3KEQ A;  2M34 A;  2WB1 N;  3C3W A;  5FKO A;  1ZR2 A;  1JTA A;  3OOC A;  4MQV A;  1OB5 A;  3HTS B;  3MCZ A;  4DNC A;  4G6Q A;  1BX1 A;  1S72 I;  2H09 A;  3HOY J;  4LOC A;  3CCR B;  5A89 A;  3BC8 A;  1KYZ A;  4XLE A;  4FQG A;  5DD4 A;  3SEZ A;  5IYC J;  2PE3 A;  2WJY A;  1D5V A;  1TC3 C;  4GYI A;  2BBY A;  4JMQ A;  1RMG A;  2NST A;  1NHC A;  2R3S A;  5GV7 A;  4LG0 B;  5JLV C;  2D2W A;  1F1Z A;  5JFR A;  2FQ3 A;  3GYH X;  2D1V A;  3DKX A;  3K70 C;  2J5P A;  4NNJ A;  1ERD A;  5F0H A;  3L1P A;  5F1R A;  1UHM A;  2O17 A;  4I99 C;  1QHG A;  2K5C A;  4U49 A;  2K9M A;  2YS9 A;  2L01 A;  1B23 P;  2HOS A;  1VQ5 B;  4M73 A;  1YX2 A;  3ZPP A;  3GXO A;  1ZAO A;  1LQ1 A;  1JTX A;  2DA6 A;  2ISY A;  2M4G A;  3O6B B;  1KA8 A;  4F55 A;  4QIW N;  4BAC A;  4C2M J;  4G7X A;  2JT1 A;  3OL4 A;  4LLG F;  1TLH B;  3WGG A;  5J1U A;  3SHF A;  2VKV A;  3WU0 A;  1WWX A;  2B7C A;  3ZC3 A;  2G7U A;  4ZZL A;  3GLL A;  3WTS C;  3CCR I;  4P5O A;  2GJP A;  1QVG B;  2DYI A;  1UFM A;  4IQJ A;  1N0V C;  3FBI B;  1IHM A;  3GZN B;  3KE2 A;  2H8R A;  2WAQ A;  4AVP A;  3GIR A;  1HF2 A;  1A6I A;  3JRG A;  1GVH A;  1LLZ A;  2A5Y B;  3GTJ J;  1Q7Y D;  4IHS A;  1Y56 A;  3L2C A;  2FF4 A;  3EDP A;  1QBJ A;  4Z4T A;  4NC8 A;  4M6X A;  4P6Y A;  3HAG A;  1CZF A;  2XTX A;  4TMZ A;  3J7Z I;  4LIT A;  5L3G A;  3CO7 C;  4KIF A;  4RD2 A;  1EFR A;  4DK0 A;  1R9T J;  1TWF J;  1SMY F;  2ZXJ A;  2WBM A;  2HFH A;  3BJO A;  5CYV A;  5D8K B;  1V0E A;  1BI3 A;  1BX0 A;  1G4D A;  4OZZ A;  1SAN A;  4LGW A;  3DPT A;  2RC5 A;  4F52 A;  4X6A J;  4HW0 A;  3BR0 A;  4M72 A;  2NPF A;  4HG2 A;  3TOB A;  5C1E A;  1NTC A;  4YZA A;  2EJR A;  3T56 B;  4ANJ A;  1K61 A;  3ISP A;  1FJL A;  1MNE A;  3I55 B;  2DFI A;  1XMX A;  2CU7 A;  1FX7 A;  2M0C A;  3P7N A;  1EFC A;  2CV2 A;  5B66 C;  1YI2 I;  3OYI A;  1Z67 A;  4W97 A;  3BP8 A;  1KMH A;  2NT9 A;  3AGQ A;  1MSE C;  2PYH A;  1WGX A;  2JA5 J;  2YU9 J;  1HW2 A;  2BM4 A;  2DTR A;  2ZJ2 A;  3RIR A;  1JA1 A;  3DLL F;  4BE1 A;  2XUB A;  4BE0 A;  2VC0 A;  2WAQ N;  4XR6 A;  3RZD J;  3KL9 A;  2Y30 A;  1SEU A;  3QFS A;  3BG7 A;  1KZH A;  3ASP A;  1MZB A;  3P4G A;  3RQI A;  3JRE A;  1ZGJ A;  1XMK A;  1H88 C;  3ABT A;  5FKK A;  5HLI A;  3SEQ A;  4ESB A;  3WTW C;  1FNN A;  4KKT A;  4YHB A;  2DW4 A;  5BPI A;  2L4A A;  5B3S H;  5HS7 A;  1LVA A;  1FT9 A;  3F8N A;  5HS9 A;  3WTZ A;  4RM3 A;  4ZYD A;  1K6O A;  2WR8 A;  4JX4 A;  2L0K A;  2V4J C;  2Z9O A;  4A0X A;  5F4J A;  2CW0 F;  3P9K A;  3FPK A;  3B73 A;  2AS5 F;  1OPC A;  1HF0 A;  5IYB J;  5A8A A;  1D2E A;  4J19 A;  2HR3 A;  3VMW A;  3CLQ A;  2BHZ A;  3MKZ A;  4RGX A;  2QSG X;  2HOT A;  2V9P A;  2L7Z A;  4D5F A;  1JNY A;  4YIR X;  3AL0 B;  1RUN A;  1BA5 A;  1MBF A;  2ZL7 A;  3ZPN A;  3FHN A;  4Z4U A;  2IA0 A;  1P2F A;  4B3A A;  3ULQ B;  2EFP A;  3EUA A;  3SZG A;  3CES A;  1PUE E;  1CGP A;  3RY8 A;  3GTO J;  2LRD A;  3JRC A;  1I3A A;  1W36 C;  1O57 A;  4XOT A;  1QNT A;  3U2Q A;  2BM5 A;  4S05 A;  5IPA A;  2ZME A;  4NBQ A;  1TNT A;  3VSL A;  4CA0 A;  1JKR C;  1WTH D;  1QA1 A;  4B3F X;  1QGP A;  4A3D J;  3KLO A;  1FNB A;  1O8I A;  1ODD A;  5EYR A;  1R6R A;  2ZFW A;  3MMY B;  1E79 A;  1TBX A;  4CGZ A;  3HHG A;  2M8E A;  3HUG A;  2XB5 A;  4N9H A;  1GJR A;  3VMV A;  3QFC A;  5HXB A;  2ZC2 A;  3I59 B;  4CQJ A;  3PM1 A;  3TH0 A;  3OYM A;  3FZV A;  2STW A;  1H8E A;  2X1C A;  5E3M A;  2F4M B;  3CC4 B;  3C18 A;  5A2Q Z;  3TO7 A;  2R93 J;  3DV8 A;  4DBR A;  3O3K A;  4RDU A;  2KDO A;  2JQ7 A;  3GTP J;  2NTQ A;  2DT7 B;  3K4B A;  2LY2 A;  1ON1 A;  1P6R A;  3H0G J;  4IXA A;  5CQE A;  1QUF A;  3JQQ A;  1WJB A;  1GQ8 A;  5EDN A;  1ZRE A;  1UD6 A;  1DQU A;  2X6X A;  1LM1 A;  3S2H J;  4RLF A;  4M0L A;  3CO6 C;  3UKG A;  2MC4 A;  2CQK A;  2F4I A;  1FIP A;  2LKS A;  4XID A;  1E0E A;  2WZP P;  1VQ8 B;  3BQJ A;  4XIC A;  2HVR A;  2LYC A;  1BI2 A;  1T33 A;  5FD5 A;  1YIJ I;  2C5B A;  1W5S A;  1G7S A;  4L9J A;  1CNE A;  2FA5 A;  4I0B A;  3BZ6 A;  1NB0 A;  4KNY A;  5F27 A;  3ECH A;  1V55 H;  2E7X A;  3G1L A;  3MKY B;  2H1L A;  2NS0 A;  2XRO A;  1YJ9 I;  1ORK A;  2EWN A;  3T8T A;  1R1U A;  2LKP A;  4U4B A;  1A31 A;  1Y8R B;  2RAE A;  1F5T A;  4OJ5 A;  4ENN A;  5GP9 A;  1SKY B;  1EZG A;  3ABU A;  5EEA A;  1ZKG A;  3DEE A;  4HDU A;  3DXJ F;  1CNF A;  1NRK A;  1OCR H;  1VF7 A;  4I76 A;  2ID3 A;  2DIE A;  2NS7 A;  4ZDL A;  3F21 A;  4JX6 A;  2XNC A;  3I64 A;  1E43 A;  1GXQ A;  3Q39 A;  3RJP A;  3PUM A;  3HSE A;  1HXD A;  1V3F A;  1BJZ A;  4FET A;  1ETY A;  2CW5 A;  3JTH A;  4UB6 C;  4LIU A;  4DYR A;  3E5U A;  1KQ0 A;  5D4S A;  5EF6 A;  4A3I J;  3E6B A;  2ME0 A;  1JGG A;  1RZ4 A;  2R7S A;  1Q81 D;  2DJI A;  4BKX A;  2K86 A;  3GWZ A;  3KYD B;  1E3H A;  4ZDO A;  4XD7 A;  2M7B A;  5FD6 A;  2OCC H;  1BLI A;  4G1V A;  2CC2 A;  3C2H A;  3HB9 A;  3ZMZ A;  1SD4 A;  2W6I A;  4BAY A;  1XGS A;  1NDH A;  2PI0 A;  1ONV A;  2WV0 A;  2V7U A;  1E62 A;  2V9V A;  4YZ0 A;  1QU3 A;  2YWG A;  3CD6 B;  2QYU A;  2OK7 A;  2EZH A;  4MR0 A;  1OKR A;  1YOV B;  3V7C A;  2NOG A;  1EA3 A;  1S8N A;  2LF8 A;  4ABZ A;  5HNH A;  2OC6 A;  3CCU I;  2DMT A;  5E8G A;  1TQP A;  2NNN A;  1ZM3 A;  4HX7 A;  2VOD A;  3HM5 A;  4NC6 A;  1XGN A;  3OYH A;  2E1M B;  1GLN A;  3CUO A;  1T08 B;  1RWR A;  4CSW A;  4YFO A;  2XAU A;  2XIG A;  2MC3 A;  4HQE A;  4LBW A;  4P3I A;  4WK8 F;  3QOD A;  1I1S A;  5ICC A;  2GZW A;  3B6C A;  3F8F A;  4U7D A;  3HHH A;  5D5X B;  3QSY A;  3GLX A;  1MDM B;  2DDB A;  2H6C A;  4Z6Y A;  3S15 J;  1JJ8 C;  3VDX A;  3MVP A;  4AVZ A;  2CRG A;  2VN2 A;  3FWE A;  2ZJP F;  2DI3 A;  4IPA A;  4E0F A;  4AID A;  3W2F A;  2CFX A;  2V7F A;  4MNU A;  2CUE A;  3AG1 H;  3EYI A;  3CC2 B;  3I56 B;  1WH5 A;  3KLN A;  2E34 A;  4R71 A;  4W8T A;  3AK5 A;  2L9R A;  1FYL A;  4IL6 C;  1LE8 A;  3K1M A;  5JHF A;  1FLI A;  1TVC A;  4G1B A;  3AFH A;  1YRN B;  4MEY F;  2E1N A;  2VXZ A;  2W57 A;  4BEH B;  1KQS B;  4S0H B;  5E3L A;  2CFO A;  2MD5 A;  3U1D A;  1GAW A;  4Z06 A;  4PJM A;  4FIS A;  3E0J B;  4BQN A;  3FXU A;  3KP4 A;  2GXB A;  4U0W A;  1DUX C;  1HST A;  1W0U A;  2QSH X;  3OY9 A;  2FML A;  1AKH B;  2HMA A;  4YRV A;  4EJV A;  1PE9 A;  2B7E A;  1YHQ I;  1ETV A;  2P81 A;  3G73 A;  2VQL A;  5DCM A;  3H5A A;  3LNQ A;  3CCU B;  1Y6I A;  2NXN B;  1HW5 A;  1AIR A;  2XC7 A;  4YFN F;  4QV2 A;  2LLK A;  3VSV A;  3HYI A;  3A1Y A;  4FHT A;  1U9O A;  1ZGW A;  3JQR A;  4Z4Z A;  3K4J A;  3S17 J;  3PVD A;  2HPI A;  3J7Y J;  4XRF A;  5J3O A;  3BQZ A;  1LJ9 A;  3VNV A;  4ZCM A;  2VJ4 A;  1LVK A;  3S8P A;  4JRA C;  2KL4 A;  3CME I;  1VQ6 I;  4L5I A;  2HOA A;  4GGG A;  3H3Z A;  3JR9 A;  3ZBT A;  1FY7 A;  3G1M A;  5DM7 F;  1B8I B;  1IAW A;  2C4U A;  2JUG A;  4RB3 C;  3I4P A;  5E3N A;  1QFY A;  3QPL A;  2R4G A;  1YX3 A;  2GJK A;  2M30 A;  1I18 A;  4RAZ A;  2AO9 A;  2DK8 A;  2M4K A;  4L9V A;  2O3F A;  4HE6 A;  4CYD A;  1X1C A;  4IOA F;  3TO9 A;  5FO5 A;  3W6K B;  5J4V A;  3SEJ A;  5H20 A;  1AHD P;  3HOU J;  1KK0 A;  3NWT A;  4OJ6 A;  4DZJ A;  1BR4 A;  1LFP A;  4L5J A;  3H92 A;  1BC8 C;  3LAP A;  1RES A;  3A35 A;  2VE8 A;  1HKQ A;  2EB7 A;  4OOX A;  1Y39 A;  2HLD A;  2M0M A;  1GVD A;  4WF2 A;  1FTT A;  5IYD J;  3E6M A;  2RNJ A;  3LA2 A;  5GAD J;  5HLT A;  1I39 A;  3PNV A;  1UCR A;  1VQ4 I;  1V0F A;  4Z4S A;  2BXZ A;  4I6Z A;  1QA2 A;  3Q6R A;  4O5V A;  4AIJ A;  1JKP C;  5IT9 K;  1PUF A;  3CPW B;  2XF6 A;  3I0T A;  1CF7 B;  1BW5 A;  1LLW A;  1IB0 A;  2DMN A;  5CVV A;  1HA3 A;  2L3D A;  3BCD A;  1YW8 A;  2EA2 A;  3FKS A;  3OYJ A;  5EG0 B;  3B4N A;  4EW9 A;  1BIA A;  4QPQ A;  4OMY A;  1VZ0 A;  2PQ8 A;  3GVA A;  3KP2 A;  2GLO A;  3L7W A;  3OYD A;  3I5U A;  4A0Z A;  3P26 A;  2O04 A;  2NYX A;  2KRF A;  5CPR B;  2UXX A;  4F92 B;  5J1Y A;  1YIT I;  2A69 F;  1MBG A;  1XC5 A;  2EK5 A;  1U0J A;  4RA2 A;  1UMK A;  5FRM A;  4ZTF A;  2XRL A;  4L0Y B;  5FLX K;  5L3D A;  3M1C A;  1Z9C A;  1G3S A;  4F91 B;  3ASS A;  1WP6 A;  2V7X A;  1IRX A;  1WI3 A;  1R1V A;  3CJR B;  2RVC A;  2HTS A;  1I6H J;  1A6Q A;  3DLA A;  2BE5 F;  3RSN A;  4Z4V A;  1K6Y A;  1MJA A;  1K78 B;  3QQA A;  1EP3 B;  3LA3 A;  2D3L A;  3BH6 B;  2WC2 A;  3SUC A;  1X0C A;  4ZJZ A;  4G8X A;  2BHY A;  3N6Z A;  1KK2 A;  3K2A A;  4RD3 A;  2BY2 A;  1W36 D;  3FHZ A;  3IH4 A;  1IN7 A;  4R1H A;  3H1C A;  4MYT A;  4W8Q A;  1T56 A;  5TJJ A;  4G7W A;  4FAS D;  2DMQ A;  3K1P A;  1VQM I;  1YLO A;  3ZUG A;  1R00 A;  2K9Q A;  2P6S A;  4Y3O A;  1FOK A;  1E3Z A;  2F5C A;  3VYT B;  1MH4 A;  2UVE A;  2F1L A;  4WQM A;  2W82 A;  4X1E A;  1XS9 A;  1QUE A;  2H8W A;  3CUQ B;  2VBT A;  4TV7 A;  2R0Q C;  4NQW B;  3DTK A;  2BOL A;  3A3G A;  3DBH B;  4OJO A;  1KU7 A;  1Q1H A;  1TTT A;  4BH9 A;  4G94 A;  4CDG A;  1NBM A;  1TW3 A;  1SFX A;  2Z5U A;  3CLO A;  2L7K A;  5CQG A;  1D8K A;  2X8K A;  2NS8 A;  4XMY A;  4KYW A;  2M1B A;  4HV6 A;  3LVB A;  4PCQ A;  2V1X A;  1XPX A;  3OR2 C;  2PX9 A;  2KQR A;  3GTG J;  3UNG C;  3LSI A;  5DSZ A;  1X3U A;  2Z16 A;  4JQF A;  1BPL A;  4DYC A;  3UW0 A;  1H9T A;  3CCY A;  1IB4 A;  2XNJ A;  4HAM A;  2XAS A;  3DU6 A;  4AIH A;  3ABL H;  2DOG A;  2R7D A;  1UD3 A;  4RCZ A;  3S2D J;  3HL2 A;  4Y7N J;  1IXR C;  3RKQ A;  2R7Q A;  4M9X A;  1REP C;  2VBV A;  1KU9 A;  3F8C A;  1F4K A;  3A0B C;  2KJB A;  1V5E A;  3FPP A;  4ENM A;  4TMX A;  1EH6 A;  3IAM 2;  4IQ4 A;  1G2H A;  1S3J A;  2E2I J;  4BL0 B;  3GCM A;  3V8K A;  3L2V A;  2HTJ A;  2CO5 A;  3GX4 X;  1VQ6 B;  3BZC A;  1WOO A;  5LHI A;  4CHU A;  2ZL6 A;  4M3D A;  1J7K A;  1KK1 A;  3JRF A;  1UD5 A;  1KCD A;  3C7J A;  3RCO A;  2V7W A;  1VQN B;  4ZCI A;  2CMP A;  4KKS A;  2BY0 A;  5BMZ A;  1HDP A;  4RDJ A;  4TMW A;  3CDL A;  2ZB9 A;  4LK1 F;  1J59 A;  1VQ9 B;  4RPD A;  3S16 J;  2M3A A;  3GQ8 A;  1QGZ A;  2R5Z B;  1D1N A;  1HA8 A;  1I5Z A;  4N3N A;  3LSM A;  1R5I D;  2DXI A;  4GRI A;  2VPL A;  1FRN A;  1FPQ A;  2WB1 A;  1XTA A;  5DEQ A;  3WU1 B;  5IYQ A;  3SZP A;  4MTD A;  2PYG A;  2OQG A;  1Y0N A;  5GAG J;  2ISZ A;  5HLG A;  2M45 A;  3PQJ A;  2LY9 A;  5LBQ A;  5LRS A;  4J01 A;  1O8G A;  3B90 A;  3PSF A;  4X0G A;  1IF1 A;  4II2 A;  4X7F A;  2XF7 A;  1E17 A;  3BH7 B;  2V1N A;  3BTL A;  5KK1 A;  4RAG A;  2JVH A;  3WBJ A;  4W8R A;  3CJN A;  1ETO A;  3PSI A;  3ZQQ A;  4TMV A;  1TT0 A;  2FX3 A;  4XK4 A;  3KP7 A;  2P5V A;  4K2E A;  4GDF A;  2DA2 A;  1RNL A;  1XSX A;  1JJ2 B;  3HBL A;  3S2W A;  3SLN A;  3I56 I;  5TR9 A;  2O5R A;  3J81 K;  1FDR A;  3ZQH A;  1T0F A;  2BW3 A;  3ZN1 A;  4B3X A;  4BNC A;  2VNK A;  1DAB A;  5J3L A;  1R71 A;  1NJI D;  4BXF A;  1PLU A;  4BU2 A;  3CPX A;  2JRT A;  2COM A;  1IJF A;  1QRC A;  4Z4Y A;  3J81 k;  1QGA A;  1UEL B;  2DDA A;  5HZA A;  3O2P E;  4XOR A;  4A3G J;  1EH7 A;  3FIW A;  1DP3 A;  1M1E B;  5FKN A;  2K9N A;  4V2G A;  4HX4 A;  1D0X A;  3ZR8 X;  5JI6 A;  1MJ9 A;  3CCS I;  3A8I A;  4MIM A;  3IRQ A;  1IDK A;  2CW7 A;  3H3U A;  2VFN A;  3QE2 A;  3BPX A;  3MZY A;  1B72 A;  3CZ6 A;  3WY9 A;  2J8I A;  4OPO A;  2BM1 A;  3NB2 A;  1UZC A;  5FFX A;  3Q3A A;  1MND A;  1IRZ A;  3H94 A;  1TWH J;  4FCY A;  2OK8 A;  3LQ6 A;  4PC3 A;  4OIP F;  2IS6 A;  1U78 A;  1CQT A;  1P4A A;  5EZG A;  5FNZ A;  2KVO A;  4P6V F;  3CD6 I;  4M3F A;  2LG4 A;  4OAY A;  2GXG A;  2MLG A;  1K9M D;  1LB2 A;  1FTZ A;  1Z21 A;  1STZ A;  4MXN A;  2QYO A;  1WI9 A;  3U6B A;  3K0L A;  4ZZD A;  2VC1 A;  3SZT A;  4DQ2 A;  2NAZ A;  5AMV A;  5C1C A;  4XQF A;  3EYY A;  4E7S A;  1IDJ A;  2L9N A;  3ZQL A;  4OM9 A;  4LBV A;  3QYE A;  3RPU A;  1U6G A;  2E1M C;  2VL8 A;  1ZAR A;  3CUQ C;  4PC7 A;  3FM3 A;  1W7P B;  4WWV A;  1SD5 A;  2K27 A;  2Y9Y A;  2VAS A;  4N4O B;  4IRH A;  4Y13 A;  3OYB A;  4X07 A;  5F6F A;  5FA6 A;  3FKJ A;  3W6J B;  2JJ7 A;  3X2Q H;  1T95 A;  4RMN A;  4FT8 A;  4ZYH A;  3BZK A;  2CF4 A;  3I9V 2;  2DFF A;  3C1D A;  2EIL H;  4P9S A;  3CC7 B;  5LHG A;  2XKO A;  1OGM X;  1K8A D;  1X1B A;  3V7R A;  4IRI A;  2ACJ A;  2XKP A;  2IXS A;  4ZGN B;  3WTX C;  4ASU A;  3S1R J;  3BRO A;  1P4M A;  2EFN A;  1M1K D;  3PIP F;  3ES9 A;  3CXC B;  4CUG A;  3W2I A;  4NDL A;  1ZM2 A;  1P4W A;  3DPL C;  3SJM A;  1AA7 A;  3W5U A;  2B0R A;  4Z4W A;  2DA4 A;  3CCQ I;  3S14 J;  3W5H A;  1TWC J;  2K85 A;  3A01 A;  1KON A;  1V54 H;  3S93 A;  2BYV E;  1K79 A;  2OD5 A;  4P25 A;  3CCJ B;  3IH2 A;  5HDK A;  3KFW X;  3ZGK A;  4QPO A;  3OWT A;  1M90 D;  1IV6 A;  1TYV A;  3E5X A;  4WZE A;  2E19 A;  3BR2 A;  5D6F A;  5A88 A;  2R7T A;  4QHY A;  5F1J A;  3OYE A;  3GTK J;  4DQK A;  4LK0 F;  3VOE A;  1GV5 A;  1WVR A;  1O7F A;  2F2E A;  2IEK A;  2XGE A;  1P7I A;  1B59 A;  5J47 A;  2JJ1 A;  4L0Z B;  1J2X A;  2HDD A;  3ML3 A;  3LMW A;  1QZY A;  1O8D A;  4UVC A;  4M1K A;  5C3E J;  1R4M B;  2VKD A;  4G9Y A;  2A07 F;  1BN8 A;  2INV A;  1N0U A;  3LYC A;  4BE2 A;  1OB0 A;  2QXZ A;  1YQA A;  4Z03 A;  1VQK I;  2DN0 A;  3W2H A;  1FYK A;  2VKH A;  4RJL A;  3NAW A;  3NEU A;  3QYF A;  2OV7 A;  2F48 A;  4I7H A;  2L2O A;  3EPZ A;  4PUS A;  2QA4 I;  4HF0 A;  2FBI A;  1YTY A;  3M8J A;  2A5W A;  2KMU A;  2W48 A;  2HYF A;  1VQL B;  3OEH A;  1NG7 A;  3BJA A;  2PJR B;  1XB4 A;  1YS7 A;  3W2W A;  2F5E A;  1B9M A;  1TP4 A;  2M8G X;  5J40 A;  3EUH C;  5FIU A;  5DM6 F;  4PSX A;  5J1R A;  2DQR A; 
#chains in the Genus database with same CATH homology
 2DT7 B;  3K4B A;  2JSP A;  2LY2 A;  3S3O A;  5CQE A;  3SDB A;  1WJB A;  4PFO A;  2VBM A;  2VBE A;  1GQ8 A;  2CV0 A;  1UD6 A;  4YZQ A;  1DQU A;  1X1D A;  4XOP A;  4R79 A;  1WJ5 A;  4AU7 A;  3WWG A;  2X6X A;  2ZZG A;  4RLF A;  2ELJ A;  2XZL A;  2MC4 A;  2IGM A;  3VWB A;  2I8D A;  2F4I A;  1JRG A;  2VB6 A;  1E0E A;  2WZP P;  4B43 A;  2RQQ A;  4BEH A;  3CJQ B;  3CF2 A;  2HVR A;  2OUM A;  3AL0 C;  1LDK B;  2LYC A;  3VST A;  2LC2 A;  2GOX B;  4L8J A;  3KEY A;  2XND A;  1QCX A;  5IK2 A;  5FL7 A;  2E5N A;  1D0Y A;  1D1B A;  2BVL A;  2KLO A;  2NOJ B;  3DPU A;  3MKY B;  2W6J A;  2WJV A;  4PSW A;  3BC9 A;  2X53 S;  3PFY A;  4U4B A;  1PKV A;  2E1B A;  4OJ5 A;  1WJA A;  3K4C A;  1SKY B;  3LMM A;  2QY1 A;  2LY1 A;  3DEE A;  2PEC A;  3QYB A;  3OR1 C;  3HC7 A;  2CS3 A;  3RQ4 A;  1NRK A;  1VF7 A;  2DIE A;  2VIX A;  4ZDL A;  3CMM A;  3OYG A;  3WQZ A;  2IGN A;  1E43 A;  4LG3 A;  4FET A;  4MLO A;  3K4N A;  1O8J A;  2F1M A;  3GRH A;  4LIU A;  4G6T B;  2ZZE A;  1K5C A;  3MD2 A;  1UAA A;  4ZC3 A;  2R7S A;  2DJI A;  3DU5 A;  4H4K C;  4XN0 A;  3BCB A;  4ZDO A;  4XD7 A;  2HQA A;  2M7B A;  1KCC A;  4HNU A;  2CUZ A;  1BLI A;  1WPC A;  1O8H A;  3C2H A;  3OW7 A;  2W6I A;  4DNR B;  2K9L A;  2ZZQ A;  1O8F A;  2X3H A;  3B8Y A;  4YZ0 A;  1QU3 A;  3ZXS A;  4KT6 A;  4CCK A;  2ODL A;  4Z05 A;  4P1W A;  4MR0 A;  4B48 A;  1WJE A;  4BJ6 C;  3BH4 A;  3RPU D;  1EA3 A;  4XKB A;  4XLH A;  5HNH A;  2KP6 A;  2OC6 A;  3OL3 A;  1DBG A;  4OJP A;  2CW8 A;  5CDF A;  1XG2 A;  3OYH A;  2E1M B;  1GLN A;  4C2L A;  1RWR A;  3OIP A;  4CSW A;  3H5N A;  2HVS A;  2L9S A;  2RRE A;  2XAU A;  2F43 A;  4PJL A;  4JOM A;  3QOD A;  1X1A A;  4PMH A;  2JJ2 A;  1V5G A;  3OEE A;  2PJR A;  1H8H A;  4G6I A;  1WJF A;  3VDX A;  2V4D A;  4AVZ A;  3KX2 A;  4E0F A;  2NZM A;  2XGJ A;  5KCM A;  3EQO A;  2V7F A;  4B47 A;  4BJT A;  2AQE A;  2WPD A;  3OYN A;  2VBK A;  2LRE A;  2DOA A;  2IS1 A;  4BDZ A;  2DT6 A;  3VSU A;  2M5S A;  4W8T A;  4XKW A;  4CH7 A;  4HSR A;  3K70 D;  2WAE A;  2R7X A;  4RM2 A;  1P9Q C;  5JHF A;  2O0W A;  3BCA A;  4YXW A;  3AFH A;  4KIT B;  4II3 A;  2VXZ A;  3J7A Y;  2A6T A;  4DGW B;  4GQN A;  1BR1 A;  2Y0S A;  4BEH B;  1UD2 A;  2CFO A;  3G05 A;  5LFA A;  4D9J A;  4Z06 A;  4N4N B;  4OAZ A;  4PJM A;  3E0J B;  4BQN A;  2ZSH B;  4E7L A;  3DDY A;  3DTE A;  2M7A A;  3ZSC A;  3VR6 A;  1OLT A;  3OYA A;  1D0Z A;  3OY9 A;  1PE9 A;  4YRV A;  3OYC A;  2R9V A;  5LD2 C;  3KRG A;  1W0J A;  2E5Z A;  4ITV A;  1E3X A;  2VQL A;  2XSJ C;  3H5A A;  1Y6I A;  1TZL A;  1KZL A;  2X6Y A;  4TSF A;  1X19 A;  1AIR A;  1K28 D;  1X4O A;  3S32 A;  1BR2 A;  2XC7 A;  3CP2 A;  1RU4 A;  2QX3 A;  3UR3 C;  3VSV A;  3A1Y A;  4XKC A;  4TT3 A;  3K4J A;  4NC7 A;  3S3M A;  1EE6 A;  4BJ5 C;  2HPI A;  2GJR A;  2BSP A;  2VJ4 A;  4D1Q A;  1LVK A;  4CCN A;  3S8P A;  2KL4 A;  4UZU A;  2W00 A;  3IUO A;  2L5Q A;  3TBI A;  4BUP A;  1OFL A;  3OS0 A;  2JUG A;  2UV1 A;  4ZYA A;  3EUK L;  4CZC A;  2GJK A;  2R4G A;  1YX3 A;  3OIQ A;  2MYS A;  1S9H A;  5HOO A;  1HZE A;  1UD8 A;  1I18 A;  4RLQ A;  2M4K A;  1BHE A;  3MKW B;  2CK3 A;  3GVL A;  3AKZ A;  4E4H A;  4E7I A;  1X1C A;  2GK6 A;  3K10 A;  1PJR A;  3OOU A;  4P22 A;  2Q1Z B;  3W3C A;  1LKX A;  3OPO A;  4KIS A;  3ONQ A;  3NWT A;  4OJ6 A;  1BR4 A;  1LFP A;  1WFX A;  2XZP A;  1HVX A;  4E7J A;  4XL9 A;  3A35 A;  3L2U A;  1W0K A;  5HNF A;  2JVG A;  4KKU A;  2HLD A;  2M0M A;  3K6G A;  4CCJ A;  3OYF A;  4U7B A;  3FBN B;  3LL7 A;  2HZD A;  2D3N A;  4B3G A;  5HLT A;  2K3P A;  3PNV A;  3H0D A;  1V0F A;  4HRI A;  4DNT B;  2KZV A;  3DQV C;  3H9Q A;  4XN3 A;  2XF6 A;  2MFZ A;  3ZRG A;  3OYL A;  1JI8 A;  4F93 B;  4HEA 2;  1BOB A;  3BCD A;  3DTI A;  2R7W A;  4XON A;  4J00 A;  2JDI A;  2VXD A;  3FKS A;  3OYJ A;  3B4N A;  4EW9 A;  3D5S C;  4QPQ A;  5KHD A;  1VZ0 A;  2X6W A;  3OYD A;  2CH0 A;  3NE5 B;  3LSG A;  2O04 A;  4F92 B;  3HKZ A;  3HPG A;  2LBF A;  5CPR B;  3T9G A;  1NG6 A;  4PJN A;  2VJ5 A;  1U0J A;  3PNT A;  1QJV A;  3OYK A;  2ZZF A;  3OE7 A;  2V26 A;  5FRM A;  4CCL A;  5DN6 A;  4ZTF A;  4ZTJ A;  3GBG A;  3M1C A;  1W9X A;  3BCF A;  3OFN A;  4TKO B;  4XKV A;  2VLA A;  4C2U A;  4F3Q A;  1DGW Y;  4F91 B;  4HIZ A;  1WP6 A;  1IRX A;  1UD4 A;  1VJS A;  3CJR B;  3JUR A;  2XF5 A;  3LSK A;  1Z3Y A;  2MD0 A;  3K4M A;  4DIQ A;  3L2W A;  1OGO X;  3DLA A;  3RSN A;  3K4L A;  4KJZ A;  1E1Q A;  1K6Y A;  2HU9 A;  5HKK A;  2JIZ A;  2D3L A;  1V5F A;  1G8X A;  1MMD A;  4LIV A;  4PK4 A;  4Y33 A;  3SUC A;  1X0C A;  3H5R A;  4AYB A;  3D5R C;  4ZJZ A;  1COW A;  1T5E A;  2LH9 A;  1D1C A;  2HDW A;  4DOZ A;  1SFK A;  3HOS A;  2IS4 A;  1WJC A;  2ZTN A;  1W36 D;  4CCM A;  1IA5 A;  3KEW A;  4W8Q A;  4C30 A;  4G7W A;  4PJJ A;  4FAS D;  2NT6 A;  2HNH A;  1I8D A;  3T53 B;  1H80 A;  2UUZ A;  1E3Z A;  4Y3O A;  1WJD A;  1FX0 A;  2NTB A;  3QOE A;  3VYT B;  4E7H A;  1WMR A;  3V42 A;  3VSK A;  3OS1 A;  1N78 A;  1O88 A;  2UVE A;  2W82 A;  2DCE A;  2LZJ A;  1ZEL A;  3U21 A;  2P0W A;  3N05 A;  2V7Q A;  4NQW B;  2INU A;  3DTK A;  2BOL A;  3A3G A;  1PXZ A;  3PNY A;  3L2Q A;  2UWM A;  4OJO A;  1NBM A;  1MW7 A;  2L7K A;  5CQG A;  2F6C A;  2X8K A;  2KHM A;  2QE7 A;  4XMY A;  4XNF A;  4U87 A;  4BQQ A;  1O8K A;  3FY3 A;  1Z3X A;  3OR2 C;  1MAB A;  2JA2 A;  2KQR A;  4PFP A;  3LSI A;  3UNG C;  3OMY A;  3T51 B;  2Z16 A;  4JQF A;  1BPL A;  2VJJ A;  3UW0 A;  1IB4 A;  1J09 A;  2NTP A;  3DU6 A;  3TMO A;  2Q2E B;  2WAF A;  2IQ7 A;  2R7U A;  1N75 A;  4YEJ A;  5FRN A;  1UD3 A;  3GVJ A;  3HL2 A;  4Z1M A;  4DBQ A;  1HG8 A;  2WAD A;  2R7Q A;  1QHH D;  3H35 A;  1KTW A;  2Z8G A;  1YE9 A;  1D1A A;  1V5E A;  3FPP A;  3IAM 2;  4IQ4 A;  2ZXI A;  1OHH A;  2Z2S B;  4BL0 B;  1OFM A;  2X51 A;  3DWL E;  4W8S A;  3L2V A;  2ZTG A;  3NWS A;  1OOC A;  2Z1D A;  4XLA A;  3HG9 A;  2Z6B D;  1UD5 A;  3GQ7 A;  1KCD A;  1Z7L A;  2LBF B;  3RCO A;  2RNG A;  2CV1 A;  2CMP A;  3A4C A;  4KKS A;  2O1D A;  1MMN A;  2NSP A;  2KPM A;  2HPM A;  2FUG 2;  2M3A A;  3GQ8 A;  1HA8 A;  3HPH A;  1O8L A;  1JTA A;  2W1O A;  3LSM A;  2DXI A;  3OOC A;  2O0V A;  4GRI A;  2VPL A;  2WB1 A;  5FRO A;  3F9K A;  3DKY A;  2WSS A;  2PYG A;  3PL8 A;  5KNL A;  2V9K A;  3BC8 A;  3KYL A;  4HWV A;  2UVF A;  4J01 A;  2X85 A;  1O8G A;  2KRH A;  4XLE A;  1SAU A;  3B90 A;  3PSF A;  3SEZ A;  4X0G A;  4II2 A;  1T0F C;  2XF7 A;  2E60 A;  2R7V A;  1BMF A;  2WJY A;  2V1N A;  4JMQ A;  1RMG A;  4OJL A;  2NST A;  4W8R A;  2JVH A;  3PJR A;  1NHC A;  3L2R A;  3ZQQ A;  3PSI A;  4DK1 A;  1MMG A;  3DKX A;  1TT0 A;  4B44 A;  4NNJ A;  2WA0 A;  4DJA A;  3K70 C;  1ERD A;  2ZXH A;  4URR A;  2O5R A;  4XM3 A;  3LFU A;  2O17 A;  1QHG A;  4EAT A;  2K5C A;  2PMZ A;  2BW3 A;  2K9M A;  4B3X A;  4U49 A;  3I3L A;  4IX7 A;  4NUB A;  4BXF A;  3OAA A;  4BU2 A;  1PLU A;  3LNN A;  3ZPP A;  2BVM A;  1UEL B;  2LOO A;  2M4G A;  4G7X A;  4F55 A;  4XOR A;  4BAC A;  3TL4 X;  1DP3 A;  4NK8 A;  3OL4 A;  1PYV A;  3HOT A;  2XDV A;  3ZR8 X;  4FXU A;  1D0X A;  4HST A;  3SYT A;  2W4S A;  1DBO A;  1IDK A;  2CW7 A;  4P5O A;  2GJP A;  4E7Z A;  3CZ6 A;  4IQJ A;  3FBI B;  2WAQ A;  1MND A;  3EQN A;  3H94 A;  2BW3 B;  2IS6 A;  2ZFU A;  4YEL A;  1Y56 A;  2KVO A;  3GQ9 A;  4NC8 A;  2LG4 A;  3BLY A;  4OAY A;  3HAG A;  1CZF A;  1Z21 A;  4LIT A;  4MXN A;  2MAB A;  1EFR A;  3GVK A;  4DK0 A;  1DGR M;  3GQA A;  2WBM A;  2HVQ A;  3ZCO A;  5AMV A;  3C2G A;  4XQF A;  5C1C A;  4E7S A;  1V0E A;  1IDJ A;  4NK6 A;  2L9N A;  2QKM B;  4OZZ A;  2IGK A;  3QYE A;  3DPT A;  2E1M C;  2VL8 A;  4F52 A;  3PUB A;  4HG2 A;  2VJI A;  4IKF A;  2VAS A;  5C1E A;  4N4O B;  1VLY A;  3OYB A;  4C2T A;  3T56 B;  4YZA A;  3FKJ A;  4ANJ A;  2GK7 A;  1T95 A;  1MNE A;  4RMN A;  4CCO A;  3W2A A;  2GOM A;  3ZIA A;  2CV2 A;  3I9V 2;  3OYI A;  1KMH A;  2XOK A;  2WY8 Q;  2NT9 A;  3OS2 A;  3S3N A;  2IGO A;  1OGM X;  2PYH A;  4IZZ A;  1X1B A;  1UG0 A;  3JU4 A;  4OWR B;  4BE1 A;  1VBL A;  4BE0 A;  4XR6 A;  2IXS A;  3A2K A;  3LSH A;  4ASU A;  1OR7 C;  5CKT A;  4BQO A;  1MMA A;  1O8M A;  2VQH A;  2VQG A;  3BG7 A;  1FMV A;  3E1S A;  4CUG A;  2ZSI B;  3DPL C;  3SEQ A;  5TGT A;  3VYS B;  1AA7 A;  3IP4 B;  4KKT A;  2EWE A;  3H9G A;  2IS2 A;  3D5L A;  4RM3 A;  1O8E A;  3G2B A;  1KON A;  2V4J C;  3S93 A;  4E6K G;  2R7O A;  3ZGK A;  4QPO A;  3OWT A;  4HNT A;  5HVQ C;  2W7N A;  3VMW A;  3BG6 A;  4XLC A;  4BS9 A;  4Y4R A;  3MKZ A;  3HUG B;  3FDY A;  4OZY A;  2R7T A;  2QKL B;  3OYE A;  3AL0 B;  3ZPN A;  4BDY A;  3GQB A;  3FHN A;  2KRC A;  3CP8 A;  4XLF A;  3EUA A;  3SZG A;  1N77 A;  3CES A;  2X1D A;  4C9Y A;  2JJ1 A;  3K4K A;  2VQC A;  1YX5 A;  3LMW A;  2LRD A;  1O8D A;  1W36 C;  3W2V A;  1FMW A;  4XOT A;  2VKD A;  4CA0 A;  1BN8 A;  2INV A;  3VSL A;  1X4P A;  2X1E A;  2R7R A;  4BE2 A;  1OB0 A;  1WTH D;  1E1R A;  2CUJ A;  4B3F X;  1O8I A;  2QXZ A;  4Z03 A;  3A3B A;  2VKH A;  4E7K A;  1R6R A;  3IAS 2;  3HXL A;  3MMY B;  3QYF A;  4BGD A;  2OV7 A;  1G59 A;  1E79 A;  2V31 A;  2L2O A;  2XZO A;  3EPZ A;  4PUS A;  3H9J A;  4YZX A;  3VYU B;  3VMV A;  2F5V A;  3M8J A;  4HPQ A;  2A5W A;  2KMU A;  3VYR B;  3OYM A;  3OEH A;  1NG7 A;  2AQF A;  2PJR B;  3W2W A;  2WY7 Q;  2X1C A;  1H8E A;  4I84 A;  4ZDP A;  3EUH C;  4PSX A;  4DBR A;  3RTR A;  2V6E A;  2KDO A;  2NTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...