4XOSA

Anp32a lrr domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
b'GPHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic leucine-rich nuclear phosphoprotein 32 family member
publication title High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 51
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4xosA00
4FMZA 5A5CA 2XOTA 1KOOA 4BSSA 4AW4A 3C6NB 4Q3IA 4LI2A 1P8VA 1ZIWA 4WP6A 1FT8A 1IO0A 4FCGA 4R6GA 5HDHA 1DCEA 2CA6A 3UL7A 1YRGA 3RFEA 4KT1A 3RW7A 2Z62A 4CNMA 4P8SA 3ZYNA 4K17A 1OTNA 4CC4A 3E4GA 1JL5A 4U06A 3ULAA 4QXEA 1KOHA 1O6VA 2OMYA 4H09A 4J4LA 1FO1A 4ARRA 4PSJA 4B8CD 4RCWA 5IJCA 1DS9A 5B0NA 4WYKA 1M0ZA 1QYYA 3FXIA 2BEXA 2ELLA 5LFNA 3VQ1A 1PGVA 4Z61C 4Z79A 4XOSA 4R5CA 4R6FA 2RR6A 3OJAA 4PKIG 3W3LA 4QC0A 4FDWA 4LSXA 2Z7XB 2OMZA 2OMWA 3G3AA 2UZYA 4J0MA 4R0AA 4R07A 4YEBB 2Z63A 2UZXA 4CILA 4QBZA 4G8AA 1Z7XW 4ECOA 4L3AA 4PQ8A 2V70A 1XECA 5GS2B 3RFJA 4U7LA 2O6RA 3VQ2A 1G9UA 3BZ5A 3P72A 4LSAA 1H6UA 1FS2A 4ARNA 5AWAA 4U09A 5AWCA 5IJBA 3GOZA 4ECNA 1OTMA 3ZYOA 3W3GA 1W8AA 4HQ1A 3OGMB 2OMUA 2WQWA 3UN9A 4KXFB 1A4YA 1WWLA 5HZLB 1XCDA 4FHOA 4MN8B 3RW6A 4BV4R 4PEQB 4LXRA 3WPGA 3WPBA 3SB4A 5D3IA 5CMNA 4LXSA 5FTTB 1OZNA 1M9LA 5GMFA 1O6SA 2OMVA 2Z66A 3M19A 4P91A 2V9SA 2Z7XA 2Z64A 3G39A 4BSRA 2OMXA 3RFSA 3UL8A 4V2DA 4Z94G 3E6JA 1O6TA 4FS7A 3W3JA 1M9SA 4Y61B 3ZYIA 4XSQA 1XKUA 4R5DA 3M18A 4I6JB 1M10B 2V9TB 4V2EA 4R09A 4M7EC 5GMGA 3UL9A 5GQRK 2XWTC 3G3BA 1P9AG 4GLPA 4GT6A 4LSCA 3C6OB 3W3MA 2P1MB 3OJAB 2P1NB 3CIGA 3WN4A 2WQXA 4LSXC 3CVRA 2O6QA 4EZGA 1P8TA 3TSRE 3C6PB 5AZ5A 5AWDA 2FT3A 1A9NA 2P1PB 4R58A 3ZYJA 2OMTA 4CP6A 3WPCA 2P1QB 3ULUA 1OTOA 2WFHA 1OGQA 4Z8GA 3W3NA 3OGKB 2BNHA 2WQUA 3RGZA 4PERA 1XEUA 3RGXA 5B4PA 2WQVA 2Q4GW 4Z64C 1LTXA 2Z81A 4TZHA 2Z65A 2ASSB 3REZA 2JQDA 1K5DC 4U08A 3RJ0A 2JE1A 3WPIA 3O6NA 4V2CA 4L3FA 4MQWX 1SQ0B 4RCAB 4OQTA 4R6JA 3WPEA 5AWBA 2ID5A 1XWDC 1H6TA 4FD0A 4BSUA 5GS0A 2P1OB 3ULVA 4C2BB 1K5GC 4M7EA 3KJ4A 3CIYA 2RA8A 1GWBA 4CC4C 4NKHA 4XGOA 2R9UA 4RWTC 4C2AB 5B0TA 3WPFA 4LI1A 3W3KA 4IM6A 2Y5QA 3A79B 3WPHA 3RIZA 5CMPA 4KNGA 3E2JA 3JB9j 2A0ZA 1U0ND 5IYXC 4R08A 3G04C 1OOKG 4Q62A 1DFJI 4Q3GA 3DZEA 1D0BA 2ASTB 4R6AA 4NKGA 2O6SA 3O53A 2JE0A 1FQVA 3WPDA 3G06A 2IFGA 4CNCA 2Z82A 4UFRA 5GMHA 5IJDA 3PMHG 3E3ZA 4AY9X 3OGLB
chains in the Genus database with same CATH superfamily
4FMZA 5A5CA 2XOTA 1KOOA 4BSSA 4AW4A 3C6NB 4Q3IA 4LI2A 1P8VA 1ZIWA 4WP6A 1FT8A 1IO0A 4FCGA 4R6GA 5HDHA 1DCEA 2CA6A 3UL7A 1YRGA 3RFEA 4KT1A 3RW7A 2Z62A 4CNMA 4P8SA 3ZYNA 4K17A 1OTNA 4CC4A 3E4GA 1JL5A 4U06A 3ULAA 4QXEA 1KOHA 1O6VA 2OMYA 4H09A 4J4LA 1FO1A 4ARRA 4PSJA 4B8CD 4RCWA 5IJCA 1DS9A 5B0NA 4WYKA 1M0ZA 1QYYA 3FXIA 2BEXA 2ELLA 5LFNA 3VQ1A 1PGVA 4Z61C 4Z79A 4XOSA 4R5CA 4R6FA 2RR6A 3OJAA 4PKIG 3W3LA 4QC0A 4FDWA 4LSXA 2Z7XB 2OMZA 2OMWA 3G3AA 2UZYA 4J0MA 4R0AA 4R07A 4YEBB 2Z63A 2UZXA 4CILA 4QBZA 4G8AA 1Z7XW 4ECOA 4L3AA 4PQ8A 2V70A 1XECA 5GS2B 3RFJA 4U7LA 2O6RA 3VQ2A 1G9UA 3BZ5A 3P72A 4LSAA 1H6UA 1FS2A 4ARNA 5AWAA 4U09A 5AWCA 5IJBA 3GOZA 4NZRM 4ECNA 1OTMA 3ZYOA 3W3GA 1W8AA 4HQ1A 3OGMB 2OMUA 2WQWA 3UN9A 4KXFB 1A4YA 1WWLA 5HZLB 1XCDA 4FHOA 4MN8B 3RW6A 4BV4R 4PEQB 4LXRA 3WPGA 3WPBA 3SB4A 5D3IA 5CMNA 4LXSA 5FTTB 1OZNA 1M9LA 5GMFA 1O6SA 2OMVA 2Z66A 3M19A 4P91A 2V9SA 2Z7XA 2Z64A 3G39A 4BSRA 2OMXA 3RFSA 3UL8A 4V2DA 4Z94G 3E6JA 1O6TA 4FS7A 3W3JA 1M9SA 4Y61B 3ZYIA 4XSQA 1XKUA 4R5DA 3M18A 4I6JB 1M10B 2V9TB 4V2EA 4R09A 4M7EC 5GMGA 3UL9A 5GQRK 2XWTC 3G3BA 1P9AG 4GLPA 4GT6A 4LSCA 3C6OB 3W3MA 2P1MB 3OJAB 2P1NB 3CIGA 3WN4A 2WQXA 4LSXC 3CVRA 2O6QA 4EZGA 1P8TA 3TSRE 3C6PB 5AZ5A 5AWDA 2FT3A 1A9NA 2P1PB 4R58A 3ZYJA 2OMTA 4CP6A 3WPCA 2P1QB 3ULUA 1OTOA 2WFHA 1OGQA 4Z8GA 3W3NA 3OGKB 2BNHA 2WQUA 3RGZA 4PERA 1XEUA 3RGXA 5B4PA 2WQVA 2Q4GW 4Z64C 1LTXA 2Z81A 4TZHA 2Z65A 4NZTM 2ASSB 3REZA 2JQDA 1K5DC 4U08A 3RJ0A 2JE1A 3WPIA 3O6NA 4V2CA 4L3FA 4MQWX 1SQ0B 4RCAB 4OQTA 4R6JA 3WPEA 5AWBA 2ID5A 1XWDC 1H6TA 4FD0A 4BSUA 5GS0A 2P1OB 3ULVA 4C2BB 1K5GC 4M7EA 3KJ4A 3CIYA 2RA8A 1GWBA 4CC4C 4NKHA 4XGOA 2R9UA 4RWTC 4C2AB 5B0TA 3WPFA 4LI1A 3W3KA 4IM6A 2Y5QA 3A79B 3WPHA 3RIZA 5CMPA 4KNGA 3E2JA 3JB9j 2A0ZA 1U0ND 5IYXC 4R08A 3G04C 1OOKG 4Q62A 1DFJI 4Q3GA 3DZEA 1D0BA 2ASTB 4R6AA 4NKGA 2O6SA 3O53A 2JE0A 1FQVA 3WPDA 3G06A 2IFGA 4CNCA 2Z82A 4UFRA 5GMHA 5IJDA 3PMHG 3E3ZA 4AY9X 3OGLB
chains in the Genus database with same CATH topology
4FMZA 5A5CA 2XOTA 1KOOA 4BSSA 4AW4A 3C6NB 4Q3IA 4LI2A 1P8VA 1ZIWA 4WP6A 1FT8A 1IO0A 4FCGA 4R6GA 5HDHA 1DCEA 2CA6A 3UL7A 1YRGA 3RFEA 4KT1A 3RW7A 2Z62A 4CNMA 4P8SA 3ZYNA 4K17A 1OTNA 4CC4A 3E4GA 1JL5A 4U06A 3ULAA 4QXEA 1KOHA 1O6VA 2OMYA 4H09A 4J4LA 1FO1A 4ARRA 4PSJA 4B8CD 4RCWA 5IJCA 1DS9A 5B0NA 4WYKA 1M0ZA 1QYYA 3FXIA 2BEXA 2ELLA 5LFNA 3VQ1A 1PGVA 4Z61C 4Z79A 4XOSA 4R5CA 4R6FA 2RR6A 3OJAA 4PKIG 3W3LA 4QC0A 4FDWA 4LSXA 2Z7XB 2OMZA 2OMWA 3G3AA 2UZYA 4J0MA 4R0AA 4R07A 4YEBB 2Z63A 2UZXA 4CILA 4QBZA 4G8AA 1Z7XW 4ECOA 4L3AA 4PQ8A 2V70A 1XECA 5GS2B 3RFJA 4U7LA 2O6RA 3VQ2A 1G9UA 3BZ5A 3P72A 4LSAA 1H6UA 1FS2A 4ARNA 5AWAA 4U09A 5AWCA 5IJBA 3GOZA 4ECNA 1OTMA 3ZYOA 3W3GA 1W8AA 4HQ1A 3OGMB 2OMUA 2WQWA 3UN9A 4KXFB 1A4YA 1WWLA 5HZLB 1XCDA 4FHOA 4MN8B 3RW6A 4BV4R 4PEQB 4LXRA 3WPGA 3WPBA 3SB4A 5D3IA 5CMNA 4LXSA 5FTTB 1OZNA 1M9LA 5GMFA 1O6SA 2OMVA 2Z66A 3M19A 4P91A 2V9SA 2Z7XA 2Z64A 3G39A 4BSRA 2OMXA 3RFSA 3UL8A 4V2DA 4Z94G 3E6JA 1O6TA 4FS7A 3W3JA 1M9SA 4Y61B 3ZYIA 4XSQA 1XKUA 4R5DA 3M18A 4I6JB 1M10B 2V9TB 4V2EA 4R09A 4M7EC 5GMGA 3UL9A 5GQRK 2XWTC 3G3BA 1P9AG 4GLPA 4GT6A 4LSCA 3C6OB 3W3MA 2P1MB 3OJAB 2P1NB 3CIGA 3WN4A 2WQXA 4LSXC 3CVRA 2O6QA 4EZGA 1P8TA 3TSRE 3C6PB 5AZ5A 5AWDA 2FT3A 1A9NA 2P1PB 4R58A 3ZYJA 2OMTA 4CP6A 3WPCA 2P1QB 3ULUA 1OTOA 2WFHA 1OGQA 4Z8GA 3W3NA 3OGKB 2BNHA 2WQUA 3RGZA 4PERA 1XEUA 3RGXA 5B4PA 2WQVA 2Q4GW 4Z64C 1LTXA 2Z81A 4TZHA 2Z65A 2ASSB 3REZA 2JQDA 1K5DC 4U08A 3RJ0A 2JE1A 3WPIA 3O6NA 4V2CA 4L3FA 4MQWX 1SQ0B 4RCAB 4OQTA 4R6JA 3WPEA 5AWBA 2ID5A 1XWDC 1H6TA 4FD0A 4BSUA 5GS0A 2P1OB 3ULVA 4C2BB 1K5GC 4M7EA 3KJ4A 3CIYA 2RA8A 1GWBA 4CC4C 4NKHA 4XGOA 2R9UA 4RWTC 4C2AB 5B0TA 3WPFA 4LI1A 3W3KA 4IM6A 2Y5QA 3A79B 3WPHA 3RIZA 5CMPA 4KNGA 3E2JA 3JB9j 2A0ZA 1U0ND 5IYXC 4R08A 3G04C 1OOKG 4Q62A 1DFJI 4Q3GA 3DZEA 1D0BA 2ASTB 4R6AA 4NKGA 2O6SA 3O53A 2JE0A 1FQVA 3WPDA 3G06A 2IFGA 4CNCA 2Z82A 4UFRA 5GMHA 5IJDA 3PMHG 3E3ZA 4AY9X 3OGLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMZ A;  5A5C A;  2XOT A;  1KOO A;  4BSS A;  4AW4 A;  3C6N B;  4Q3I A;  4LI2 A;  1P8V A;  1ZIW A;  4WP6 A;  1FT8 A;  1IO0 A;  4FCG A;  4R6G A;  5HDH A;  1DCE A;  2CA6 A;  3UL7 A;  1YRG A;  3RFE A;  4KT1 A;  3RW7 A;  2Z62 A;  4CNM A;  4P8S A;  3ZYN A;  4K17 A;  1OTN A;  4CC4 A;  3E4G A;  1JL5 A;  4U06 A;  3ULA A;  4QXE A;  1KOH A;  1O6V A;  2OMY A;  4H09 A;  4J4L A;  1FO1 A;  4ARR A;  4PSJ A;  4B8C D;  4RCW A;  5IJC A;  1DS9 A;  5B0N A;  4WYK A;  1M0Z A;  1QYY A;  3FXI A;  2BEX A;  2ELL A;  5LFN A;  3VQ1 A;  1PGV A;  4Z61 C;  4Z79 A;  4XOS A;  4R5C A;  4R6F A;  2RR6 A;  3OJA A;  4PKI G;  3W3L A;  4QC0 A;  4FDW A;  4LSX A;  2Z7X B;  2OMZ A;  2OMW A;  3G3A A;  2UZY A;  4J0M A;  4R0A A;  4R07 A;  4YEB B;  2Z63 A;  2UZX A;  4CIL A;  4QBZ A;  4G8A A;  1Z7X W;  4ECO A;  4L3A A;  4PQ8 A;  2V70 A;  1XEC A;  5GS2 B;  3RFJ A;  4U7L A;  2O6R A;  3VQ2 A;  1G9U A;  3BZ5 A;  3P72 A;  4LSA A;  1H6U A;  1FS2 A;  4ARN A;  5AWA A;  4U09 A;  5AWC A;  5IJB A;  3GOZ A;  4ECN A;  1OTM A;  3ZYO A;  3W3G A;  1W8A A;  4HQ1 A;  3OGM B;  2OMU A;  2WQW A;  3UN9 A;  4KXF B;  1A4Y A;  1WWL A;  5HZL B;  1XCD A;  4FHO A;  4MN8 B;  3RW6 A;  4BV4 R;  4PEQ B;  4LXR A;  3WPG A;  3WPB A;  3SB4 A;  5D3I A;  5CMN A;  4LXS A;  5FTT B;  1OZN A;  1M9L A;  5GMF A;  1O6S A;  2OMV A;  2Z66 A;  3M19 A;  4P91 A;  2V9S A;  2Z7X A;  2Z64 A;  3G39 A;  4BSR A;  2OMX A;  3RFS A;  3UL8 A;  4V2D A;  4Z94 G;  3E6J A;  1O6T A;  4FS7 A;  3W3J A;  1M9S A;  4Y61 B;  3ZYI A;  4XSQ A;  1XKU A;  4R5D A;  3M18 A;  4I6J B;  1M10 B;  2V9T B;  4V2E A;  4R09 A;  4M7E C;  5GMG A;  3UL9 A;  5GQR K;  2XWT C;  3G3B A;  1P9A G;  4GLP A;  4GT6 A;  4LSC A;  3C6O B;  3W3M A;  2P1M B;  3OJA B;  2P1N B;  3CIG A;  3WN4 A;  2WQX A;  4LSX C;  3CVR A;  2O6Q A;  4EZG A;  1P8T A;  3TSR E;  3C6P B;  5AZ5 A;  5AWD A;  2FT3 A;  1A9N A;  2P1P B;  4R58 A;  3ZYJ A;  2OMT A;  4CP6 A;  3WPC A;  2P1Q B;  3ULU A;  1OTO A;  2WFH A;  1OGQ A;  4Z8G A;  3W3N A;  3OGK B;  2BNH A;  2WQU A;  3RGZ A;  4PER A;  1XEU A;  3RGX A;  5B4P A;  2WQV A;  2Q4G W;  4Z64 C;  1LTX A;  2Z81 A;  4TZH A;  2Z65 A;  2ASS B;  3REZ A;  2JQD A;  1K5D C;  4U08 A;  3RJ0 A;  2JE1 A;  3WPI A;  3O6N A;  4V2C A;  4L3F A;  4MQW X;  1SQ0 B;  4RCA B;  4OQT A;  4R6J A;  3WPE A;  5AWB A;  2ID5 A;  1XWD C;  1H6T A;  4FD0 A;  4BSU A;  5GS0 A;  2P1O B;  3ULV A;  4C2B B;  1K5G C;  4M7E A;  3KJ4 A;  3CIY A;  2RA8 A;  1GWB A;  4CC4 C;  4NKH A;  4XGO A;  2R9U A;  4RWT C;  4C2A B;  5B0T A;  3WPF A;  4LI1 A;  3W3K A;  4IM6 A;  2Y5Q A;  3A79 B;  3WPH A;  3RIZ A;  5CMP A;  4KNG A;  3E2J A;  3JB9 j;  2A0Z A;  1U0N D;  5IYX C;  4R08 A;  3G04 C;  1OOK G;  4Q62 A;  1DFJ I;  4Q3G A;  3DZE A;  1D0B A;  2AST B;  4R6A A;  4NKG A;  2O6S A;  3O53 A;  2JE0 A;  1FQV A;  3WPD A;  3G06 A;  2IFG A;  4CNC A;  2Z82 A;  4UFR A;  5GMH A;  5IJD A;  3PMH G;  3E3Z A;  4AY9 X;  3OGL B; 
#chains in the Genus database with same CATH topology
 4FMZ A;  5A5C A;  2XOT A;  1KOO A;  4BSS A;  4AW4 A;  3C6N B;  4Q3I A;  4LI2 A;  1P8V A;  1ZIW A;  4WP6 A;  1FT8 A;  1IO0 A;  4FCG A;  4R6G A;  5HDH A;  1DCE A;  2CA6 A;  3UL7 A;  1YRG A;  3RFE A;  4KT1 A;  3RW7 A;  2Z62 A;  4CNM A;  4P8S A;  3ZYN A;  4K17 A;  1OTN A;  4CC4 A;  3E4G A;  1JL5 A;  4U06 A;  3ULA A;  4QXE A;  1KOH A;  1O6V A;  2OMY A;  4H09 A;  4J4L A;  1FO1 A;  4ARR A;  4PSJ A;  4B8C D;  4RCW A;  5IJC A;  1DS9 A;  5B0N A;  4WYK A;  1M0Z A;  1QYY A;  3FXI A;  2BEX A;  2ELL A;  5LFN A;  3VQ1 A;  1PGV A;  4Z61 C;  4Z79 A;  4XOS A;  4R5C A;  4R6F A;  2RR6 A;  3OJA A;  4PKI G;  3W3L A;  4QC0 A;  4FDW A;  4LSX A;  2Z7X B;  2OMZ A;  2OMW A;  3G3A A;  2UZY A;  4J0M A;  4R0A A;  4R07 A;  4YEB B;  2Z63 A;  2UZX A;  4CIL A;  4QBZ A;  4G8A A;  1Z7X W;  4ECO A;  4L3A A;  4PQ8 A;  2V70 A;  1XEC A;  5GS2 B;  3RFJ A;  4U7L A;  2O6R A;  3VQ2 A;  1G9U A;  3BZ5 A;  3P72 A;  4LSA A;  1H6U A;  1FS2 A;  4ARN A;  5AWA A;  4U09 A;  5AWC A;  5IJB A;  3GOZ A;  4NZR M;  4ECN A;  1OTM A;  3ZYO A;  3W3G A;  1W8A A;  4HQ1 A;  3OGM B;  2OMU A;  2WQW A;  3UN9 A;  4KXF B;  1A4Y A;  1WWL A;  5HZL B;  1XCD A;  4FHO A;  4MN8 B;  3RW6 A;  4BV4 R;  4PEQ B;  4LXR A;  3WPG A;  3WPB A;  3SB4 A;  5D3I A;  5CMN A;  4LXS A;  5FTT B;  1OZN A;  1M9L A;  5GMF A;  1O6S A;  2OMV A;  2Z66 A;  3M19 A;  4P91 A;  2V9S A;  2Z7X A;  2Z64 A;  3G39 A;  4BSR A;  2OMX A;  3RFS A;  3UL8 A;  4V2D A;  4Z94 G;  3E6J A;  1O6T A;  4FS7 A;  3W3J A;  1M9S A;  4Y61 B;  3ZYI A;  4XSQ A;  1XKU A;  4R5D A;  3M18 A;  4I6J B;  1M10 B;  2V9T B;  4V2E A;  4R09 A;  4M7E C;  5GMG A;  3UL9 A;  5GQR K;  2XWT C;  3G3B A;  1P9A G;  4GLP A;  4GT6 A;  4LSC A;  3C6O B;  3W3M A;  2P1M B;  3OJA B;  2P1N B;  3CIG A;  3WN4 A;  2WQX A;  4LSX C;  3CVR A;  2O6Q A;  4EZG A;  1P8T A;  3TSR E;  3C6P B;  5AZ5 A;  5AWD A;  2FT3 A;  1A9N A;  2P1P B;  4R58 A;  3ZYJ A;  2OMT A;  4CP6 A;  3WPC A;  2P1Q B;  3ULU A;  1OTO A;  2WFH A;  1OGQ A;  4Z8G A;  3W3N A;  3OGK B;  2BNH A;  2WQU A;  3RGZ A;  4PER A;  1XEU A;  3RGX A;  5B4P A;  2WQV A;  2Q4G W;  4Z64 C;  1LTX A;  2Z81 A;  4TZH A;  2Z65 A;  4NZT M;  2ASS B;  3REZ A;  2JQD A;  1K5D C;  4U08 A;  3RJ0 A;  2JE1 A;  3WPI A;  3O6N A;  4V2C A;  4L3F A;  4MQW X;  1SQ0 B;  4RCA B;  4OQT A;  4R6J A;  3WPE A;  5AWB A;  2ID5 A;  1XWD C;  1H6T A;  4FD0 A;  4BSU A;  5GS0 A;  2P1O B;  3ULV A;  4C2B B;  1K5G C;  4M7E A;  3KJ4 A;  3CIY A;  2RA8 A;  1GWB A;  4CC4 C;  4NKH A;  4XGO A;  2R9U A;  4RWT C;  4C2A B;  5B0T A;  3WPF A;  4LI1 A;  3W3K A;  4IM6 A;  2Y5Q A;  3A79 B;  3WPH A;  3RIZ A;  5CMP A;  4KNG A;  3E2J A;  3JB9 j;  2A0Z A;  1U0N D;  5IYX C;  4R08 A;  3G04 C;  1OOK G;  4Q62 A;  1DFJ I;  4Q3G A;  3DZE A;  1D0B A;  2AST B;  4R6A A;  4NKG A;  2O6S A;  3O53 A;  2JE0 A;  1FQV A;  3WPD A;  3G06 A;  2IFG A;  4CNC A;  2Z82 A;  4UFR A;  5GMH A;  5IJD A;  3PMH G;  3E3Z A;  4AY9 X;  3OGL B; 
#chains in the Genus database with same CATH homology
 4FMZ A;  5A5C A;  2XOT A;  1KOO A;  4BSS A;  4AW4 A;  3C6N B;  4Q3I A;  4LI2 A;  1P8V A;  1ZIW A;  4WP6 A;  1FT8 A;  1IO0 A;  4FCG A;  4R6G A;  5HDH A;  1DCE A;  2CA6 A;  3UL7 A;  1YRG A;  3RFE A;  4KT1 A;  3RW7 A;  2Z62 A;  4CNM A;  4P8S A;  3ZYN A;  4K17 A;  1OTN A;  4CC4 A;  3E4G A;  1JL5 A;  4U06 A;  3ULA A;  4QXE A;  1KOH A;  1O6V A;  2OMY A;  4H09 A;  4J4L A;  1FO1 A;  4ARR A;  4PSJ A;  4B8C D;  4RCW A;  5IJC A;  1DS9 A;  5B0N A;  4WYK A;  1M0Z A;  1QYY A;  3FXI A;  2BEX A;  2ELL A;  5LFN A;  3VQ1 A;  1PGV A;  4Z61 C;  4Z79 A;  4XOS A;  4R5C A;  4R6F A;  2RR6 A;  3OJA A;  4PKI G;  3W3L A;  4QC0 A;  4FDW A;  4LSX A;  2Z7X B;  2OMZ A;  2OMW A;  3G3A A;  2UZY A;  4J0M A;  4R0A A;  4R07 A;  4YEB B;  2Z63 A;  2UZX A;  4CIL A;  4QBZ A;  4G8A A;  1Z7X W;  4ECO A;  4L3A A;  4PQ8 A;  2V70 A;  1XEC A;  5GS2 B;  3RFJ A;  4U7L A;  2O6R A;  3VQ2 A;  1G9U A;  3BZ5 A;  3P72 A;  4LSA A;  1H6U A;  1FS2 A;  4ARN A;  5AWA A;  4U09 A;  5AWC A;  5IJB A;  3GOZ A;  4ECN A;  1OTM A;  3ZYO A;  3W3G A;  1W8A A;  4HQ1 A;  3OGM B;  2OMU A;  2WQW A;  3UN9 A;  4KXF B;  1A4Y A;  1WWL A;  5HZL B;  1XCD A;  4FHO A;  4MN8 B;  3RW6 A;  4BV4 R;  4PEQ B;  4LXR A;  3WPG A;  3WPB A;  3SB4 A;  5D3I A;  5CMN A;  4LXS A;  5FTT B;  1OZN A;  1M9L A;  5GMF A;  1O6S A;  2OMV A;  2Z66 A;  3M19 A;  4P91 A;  2V9S A;  2Z7X A;  2Z64 A;  3G39 A;  4BSR A;  2OMX A;  3RFS A;  3UL8 A;  4V2D A;  4Z94 G;  3E6J A;  1O6T A;  4FS7 A;  3W3J A;  1M9S A;  4Y61 B;  3ZYI A;  4XSQ A;  1XKU A;  4R5D A;  3M18 A;  4I6J B;  1M10 B;  2V9T B;  4V2E A;  4R09 A;  4M7E C;  5GMG A;  3UL9 A;  5GQR K;  2XWT C;  3G3B A;  1P9A G;  4GLP A;  4GT6 A;  4LSC A;  3C6O B;  3W3M A;  2P1M B;  3OJA B;  2P1N B;  3CIG A;  3WN4 A;  2WQX A;  4LSX C;  3CVR A;  2O6Q A;  4EZG A;  1P8T A;  3TSR E;  3C6P B;  5AZ5 A;  5AWD A;  2FT3 A;  1A9N A;  2P1P B;  4R58 A;  3ZYJ A;  2OMT A;  4CP6 A;  3WPC A;  2P1Q B;  3ULU A;  1OTO A;  2WFH A;  1OGQ A;  4Z8G A;  3W3N A;  3OGK B;  2BNH A;  2WQU A;  3RGZ A;  4PER A;  1XEU A;  3RGX A;  5B4P A;  2WQV A;  2Q4G W;  4Z64 C;  1LTX A;  2Z81 A;  4TZH A;  2Z65 A;  2ASS B;  3REZ A;  2JQD A;  1K5D C;  4U08 A;  3RJ0 A;  2JE1 A;  3WPI A;  3O6N A;  4V2C A;  4L3F A;  4MQW X;  1SQ0 B;  4RCA B;  4OQT A;  4R6J A;  3WPE A;  5AWB A;  2ID5 A;  1XWD C;  1H6T A;  4FD0 A;  4BSU A;  5GS0 A;  2P1O B;  3ULV A;  4C2B B;  1K5G C;  4M7E A;  3KJ4 A;  3CIY A;  2RA8 A;  1GWB A;  4CC4 C;  4NKH A;  4XGO A;  2R9U A;  4RWT C;  4C2A B;  5B0T A;  3WPF A;  4LI1 A;  3W3K A;  4IM6 A;  2Y5Q A;  3A79 B;  3WPH A;  3RIZ A;  5CMP A;  4KNG A;  3E2J A;  3JB9 j;  2A0Z A;  1U0N D;  5IYX C;  4R08 A;  3G04 C;  1OOK G;  4Q62 A;  1DFJ I;  4Q3G A;  3DZE A;  1D0B A;  2AST B;  4R6A A;  4NKG A;  2O6S A;  3O53 A;  2JE0 A;  1FQV A;  3WPD A;  3G06 A;  2IFG A;  4CNC A;  2Z82 A;  4UFR A;  5GMH A;  5IJD A;  3PMH G;  3E3Z A;  4AY9 X;  3OGL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...