4XOWA

Structure of rsgreen0.7 in the green-on-state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
226
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVLCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGYYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNAYITADKQKNGIKSNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQNKLSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rsGreen0.7
publication title Expression-Enhanced Fluorescent Proteins Based on Enhanced Green Fluorescent Protein for Super-resolution Microscopy.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 61
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4xowA00
3U8PA 1QXTA 3DQ3A 1Q4DA 1YZWA 3O78A 4ZINA 3DPWA 4AR7A 4OHSA 3SVDA 4KF5A 3CBEA 2WHSA 4GESB 2G5ZB 3VHTA 4KGEA 5DPJA 4XL5A 3DQMA 4KPIA 4KW4A 4Q9XA 3TMRA 3V3DA 3SVEA 4NWSA 1EMFA 5DRFA 2QT2A 2P4MA 4W7FA 5DQMA 2H5QA 2Z1OA 4W7RA 4EMQA 4KEXA 3ST2A 3GJ1A 2G6XA 3EVVA 4OGSA 3SG5A 4UTSA 4W6FA 3DQLA 2DDCA 4H47A 4W6GA 4XOVA 4J89A 5DTLA 5EBJA 1EMGA 3DQFA 1Q4AA 4OQWA 5EB6A 3DPZA 3PIBA 3SG6A 3IR8A 4HQCA 2AH8A 2B3QA 2DUFA 3EVPA 4LJBA 5DTZA 3SVOA 3DQ8A 1EMBA 1Q4CA 2WSOA 1XAEA 4W6PA 2H5PA 2YFPA 5BTTA 3ZTFA 2HFCA 3VK1A 3NT3A 4KA9A 2IB5A 3NT9A 1MOVA 4PPLA 2C9IA 1RMOA 3KCSA 3CB9A 5HBDA 3RWAA 2GX2A 3DQIA 4ZF3A 2ZO7A 1XSSA 5BQLA 3DQJA 2A56B 2ZO6A 2FL1A 3LVCA 4J8AA 5DY6A 5F9GA 5HGEA 2Z6ZA 4W6SA 3SV5A 3AI4A 3SSHA 4W6TA 2QLGB 4JC2A 2OKWA 4ZFSA 5HW9A 2QZ0A 4H3NA 1ZUXA 2VADA 4DXMA 2Z6XA 3SSVA 4JGEA 3BXAA 3M22A 4W6OA 3E5TA 1RM9A 1ZGQA 4KW9A 5J2OA 3SVCA 3EK4A 4IK3A 4TZAA 4W6CA 5BT0A 4PPKA 4W69A 3SSYA 2OKYA 5HZUA 3DQUA 1OXDA 4IZNA 3OSQA 4Q7TA 3W1CA 4IK4A 2OTBA 4H3LA 3ZUJA 3GL4A 3DQOA 2DD9A 4W7XA 1HCJA 3CD9A 2H5RA 5H89A 2A52B 1RRXA 4Q7UA 2V4EB 2G16B 4Q7RA 3DQHA 3I19A 3DQ2A 4P1QA 4IK8A 3ST4A 4JF9A 2A53B 2HPWA 2HRSA 1YJFA 3UG0A 1ZGOA 4L12A 4KW8A 2WSNA 4W6KA 3E5WA 2A46A 3DQDA 2OTEA 4Q9WA 3VICA 2H6VA 3K1KA 4B30B 3DQAA 3SG7A 5DTXA 2ZMWA 3WCKA 3PJ5A 2QLGA 4P76A 4TZGA 1RMPA 5EXBA 2ZMUA 4Z4MA 3SVSA 2EMNA 3PJBA 3U0MA 1B9CA 2GW3A 2ICRA 5EXCI 3CFAA 1S6ZA 3SRYA 2C9JA 3BXBA 2QLHA 4W7CA 4W6BA 4KGFA 3H1OA 4W74A 5DTYA 2V4EC 4JEOA 4KF4A 2A54B 2AWJA 3M24A 2QU1A 4LJDC 4R6BA 2JADA 5DPHA 3SG4A 1RMMA 2HGDA 1EMAA 3P28A 1UISA 4W6DA 1YHHA 3DPXA 3NEDA 2BTJA 3AI5A 3MGFA 3DQNA 5LTPA 3SSLA 2HGYA 1QY3A 3SG3A 4KAGA 1EMCA 5LTQA 3E5VA 2YDZA 3EKJA 2HQZA 4OJ0A 2G3OA 3DQKA 4RYWA 1MOUA 1YHGA 5FVFA 2H9WA 2G6EA 4GOBA 2AWKA 2H5OA 2QLEA 2DUEA 4PPJA 1XA9A 4W6RA 4JRBA 4ZBLA 4ZF5A 3GB3A 1XQMA 2G3DB 1JC1A 1F09A 3IP2A 3A8SA 4LW5A 4I2YA 4PFEA 5FHVA 1EMMA 4RTCA 3BX9A 4H48A 4ORNA 3WLDA 3VHTB 4W73A 3OGOA 1KYPA 4W72A 4XGYA 5KTGA 5LK4A 4W6HA 1HUYA 4ZF4A 3EK8A 5EB7A 4ANJA 2DDDA 1MYWA 2AHAA 4IK1A 4L1IA 1JBZA 3CFFA 4H3MA 5H88A 2EMDA 2QLIA 4XVPA 5HZTA 2VVIA 5T3IA 1BFPA 3CGLA 3LF3A 4ZIOA 5FVIA 5DQBA 2PXSA 3ED8A 3EVUA 1Z1PA 1Q73A 1OXEA 1GFLA 2IOVA 3DQ1A 2HJOA 1F0BA 4OY4A 2WIQA 4HE4A 2Y0GA 5AQBB 5HZSA 4DXQA 3LVAA 1YHIA 4W6NA 1GL4A 4L13A 3U0KA 3ST3A 4LQUA 3U0NA 5DU0A 3LSAA 3LVDA 2DD7A 4W76A 3GEXA 4DXOA 2PXWA 1YJ2A 5DPIA 2O29A 3DQ6A 4DXNA 4W75A 5BTTB 4IK9A 4KF5C 2A48A 3SS0A 3SVNA 2A47A 2WHUA 3P8UA 2DUIA 3CD1A 3ZUFA 3UFZA 2Q6PA 3U8AA 2VZXA 2OJKA 3LA1A 4W77A 5DPGA 1Z1QA 4LJCA 3ST0A 4XOWA 3O77A 1QYOA 2A50B 4IK5A 3OSRA 3DQ4A 3PJ7A 1KYSA 4R6DA 4AS8A 2DUGA 4EULA 3DQ7A 2G2SB 2WURA 4U2VA 3DQ5A 2OGRA 1EMEA 4W7EA 1EMKA 3TMTA 3NF0A 5DRGA 1JBYA 1KP5A 1W7TA 2HQKA 4W7DA 3BXCA 2GW4B 1EMLA 3SVUA 3W1DA 4DXPA 1Q4EA 2V4EA 4W6MA 4LJDA 3LF4B 1GGXA 2ARLA 3SG2A 3CFHA 4B5YA 3GJ2A 4N3DA 2POXA 5HZOA 1XMZA 2GX0A 3DQEA 3RWTA 4HQ9A 5H87A 4JFGA 1OXFA 2WHTA 1W7UA 2AWMA 2YE0A 2YE1A 4W6IA 4B30A 5EJUA 4HVFA 2Q57A 5EHUA 2H8QA 2IE2A 3ADFA 2Z6YA 2DUHA 2QRFA 4GF6B 4W6JA 2G6YA 1KYRA 4DXIA 3AKOA 1JC0A 3U8CA 3DQCA 3SVBA 4RYSA 4J88A 2RH7A 3G9AA 1W7SA 2IB6A 3NEZA 1CV7A 2B3PA 3S05A 3ZULA 4BDUA 3EVRA 2EMOA 3SSTA 3DQ9A 3H1RA 1C4FA 2VVJA 5LTRA 3EK7A 2AWLA 4HQ8A 3KCTA 4W6UA 5FVGA 4Z4KA 2O2BA 1ZGPA 3LS3A 4DKNA 4DKMA 4EDOA 1QYFA 2VVHA 2HCGA 3SSKA 1YFPA 3SSPA 1G7KA 2VAEA 3WLCA 4W6AA 1H4UA 4ZB1A 5EXUA 3EKHA 3U0LA 4W7AA 4EN1A 1Q4BA 4W6LA 2FZUA 4EDSA 2O24A 3SVRA 4LQTA 1QYQA 2FWQA 2WISA 1H6RA
chains in the Genus database with same CATH superfamily
3U8PA 1QXTA 3DQ3A 1Q4DA 1YZWA 3O78A 4ZINA 3DPWA 4AR7A 4OHSA 3SVDA 4KF5A 3CBEA 2WHSA 4GESB 2G5ZB 3VHTA 4KGEA 5DPJA 4XL5A 3DQMA 4KPIA 4KW4A 4Q9XA 3TMRA 3V3DA 3SVEA 4NWSA 1EMFA 5DRFA 2QT2A 2P4MA 4W7FA 5DQMA 2H5QA 2Z1OA 4W7RA 4EMQA 4KEXA 3ST2A 3GJ1A 2G6XA 3EVVA 4OGSA 3SG5A 4UTSA 4W6FA 3DQLA 2DDCA 4H47A 4W6GA 4XOVA 4J89A 5DTLA 5EBJA 1EMGA 3DQFA 1Q4AA 4OQWA 5EB6A 3DPZA 3PIBA 3SG6A 3IR8A 4HQCA 2AH8A 2B3QA 2DUFA 3EVPA 4LJBA 5DTZA 3SVOA 3DQ8A 1EMBA 1Q4CA 2WSOA 1XAEA 4W6PA 2H5PA 2YFPA 5BTTA 3ZTFA 2HFCA 3VK1A 3NT3A 4KA9A 2IB5A 3NT9A 1MOVA 4PPLA 2C9IA 1RMOA 3KCSA 3CB9A 5HBDA 3RWAA 2GX2A 3DQIA 4ZF3A 2ZO7A 1XSSA 5BQLA 3DQJA 2A56B 2ZO6A 2FL1A 3LVCA 4J8AA 5DY6A 5F9GA 5HGEA 2Z6ZA 4W6SA 3SV5A 3AI4A 3SSHA 4W6TA 2QLGB 4JC2A 2OKWA 4ZFSA 5HW9A 2QZ0A 4H3NA 1ZUXA 2VADA 4DXMA 2Z6XA 3SSVA 4JGEA 3BXAA 3M22A 4W6OA 3E5TA 1RM9A 1ZGQA 4KW9A 5J2OA 3SVCA 3EK4A 4IK3A 4TZAA 4W6CA 5BT0A 4PPKA 4W69A 3SSYA 2OKYA 5HZUA 3DQUA 1OXDA 4IZNA 3OSQA 4Q7TA 3W1CA 4IK4A 2OTBA 4H3LA 3ZUJA 3GL4A 3DQOA 2DD9A 4W7XA 1HCJA 3CD9A 2H5RA 5H89A 2A52B 1RRXA 4Q7UA 2V4EB 2G16B 4Q7RA 3DQHA 3I19A 3DQ2A 4P1QA 4IK8A 3ST4A 4JF9A 2A53B 2HPWA 2HRSA 1YJFA 3UG0A 1ZGOA 4L12A 4KW8A 2WSNA 4W6KA 3E5WA 2A46A 3DQDA 2OTEA 4Q9WA 3VICA 2H6VA 3K1KA 4B30B 3DQAA 3SG7A 5DTXA 2ZMWA 3WCKA 3PJ5A 2QLGA 4P76A 4TZGA 1RMPA 5EXBA 2ZMUA 4Z4MA 3SVSA 2EMNA 3PJBA 3U0MA 1B9CA 2GW3A 2ICRA 5EXCI 3CFAA 1S6ZA 3SRYA 2C9JA 3BXBA 2QLHA 4W7CA 4W6BA 4KGFA 3H1OA 4W74A 5DTYA 2V4EC 4JEOA 4KF4A 2A54B 2AWJA 3M24A 2QU1A 4LJDC 4R6BA 2JADA 5DPHA 3SG4A 1RMMA 2HGDA 1EMAA 3P28A 1UISA 4W6DA 1YHHA 3DPXA 3NEDA 2BTJA 3AI5A 3MGFA 3DQNA 5LTPA 3SSLA 2HGYA 1QY3A 3SG3A 4KAGA 1EMCA 5LTQA 3E5VA 2YDZA 3EKJA 2HQZA 4OJ0A 2G3OA 3DQKA 4RYWA 1MOUA 1YHGA 5FVFA 2H9WA 2G6EA 4GOBA 2AWKA 2H5OA 2QLEA 2DUEA 4PPJA 1XA9A 4W6RA 4JRBA 4ZBLA 4ZF5A 3GB3A 1XQMA 2G3DB 1JC1A 1F09A 3IP2A 3A8SA 4LW5A 4I2YA 4PFEA 5FHVA 1EMMA 4RTCA 3BX9A 4H48A 4ORNA 3WLDA 3VHTB 4W73A 3OGOA 1KYPA 4W72A 4XGYA 5KTGA 5LK4A 4W6HA 1HUYA 4ZF4A 3EK8A 5EB7A 4ANJA 2DDDA 1MYWA 2AHAA 4IK1A 4L1IA 1JBZA 3CFFA 4H3MA 5H88A 2EMDA 2QLIA 4XVPA 5HZTA 2VVIA 5T3IA 1BFPA 3CGLA 3LF3A 4ZIOA 5FVIA 5DQBA 2PXSA 3ED8A 3EVUA 1Z1PA 1Q73A 1OXEA 1GFLA 2IOVA 3DQ1A 2HJOA 1F0BA 4OY4A 2WIQA 4HE4A 2Y0GA 5AQBB 5HZSA 4DXQA 3LVAA 1YHIA 4W6NA 1GL4A 4L13A 3U0KA 3ST3A 4LQUA 3U0NA 5DU0A 3LSAA 3LVDA 2DD7A 4W76A 3GEXA 4DXOA 2PXWA 1YJ2A 5DPIA 2O29A 3DQ6A 4DXNA 4W75A 5BTTB 4IK9A 4KF5C 2A48A 3SS0A 3SVNA 2A47A 2WHUA 3P8UA 2DUIA 3CD1A 3ZUFA 3UFZA 2Q6PA 3U8AA 2VZXA 2OJKA 3LA1A 4W77A 5DPGA 1Z1QA 4LJCA 3ST0A 4XOWA 3O77A 1QYOA 2A50B 4IK5A 3OSRA 3DQ4A 3PJ7A 1KYSA 4R6DA 4AS8A 2DUGA 4EULA 3DQ7A 2G2SB 2WURA 4U2VA 3DQ5A 2OGRA 1EMEA 4W7EA 1EMKA 3TMTA 3NF0A 5DRGA 1JBYA 1KP5A 1W7TA 2HQKA 4W7DA 3BXCA 2GW4B 1EMLA 3SVUA 3W1DA 4DXPA 1Q4EA 2V4EA 4W6MA 4LJDA 3LF4B 1GGXA 2ARLA 3SG2A 3CFHA 4B5YA 3GJ2A 4N3DA 2POXA 5HZOA 1XMZA 2GX0A 3DQEA 3RWTA 4HQ9A 5H87A 4JFGA 1OXFA 2WHTA 1W7UA 2AWMA 2YE0A 2YE1A 4W6IA 4B30A 5EJUA 4HVFA 2Q57A 5EHUA 2H8QA 2IE2A 3ADFA 2Z6YA 2DUHA 2QRFA 4GF6B 4W6JA 2G6YA 1KYRA 4DXIA 3AKOA 1JC0A 3U8CA 3DQCA 3SVBA 4RYSA 4J88A 2RH7A 3G9AA 1W7SA 2IB6A 3NEZA 1CV7A 2B3PA 3S05A 3ZULA 4BDUA 3EVRA 2EMOA 3SSTA 3DQ9A 3H1RA 1C4FA 2VVJA 5LTRA 3EK7A 2AWLA 4HQ8A 3KCTA 4W6UA 5FVGA 4Z4KA 2O2BA 1ZGPA 3LS3A 4DKNA 4DKMA 4EDOA 1QYFA 2VVHA 2HCGA 3SSKA 1YFPA 3SSPA 1G7KA 2VAEA 3WLCA 4W6AA 1H4UA 4ZB1A 5EXUA 3EKHA 3U0LA 4W7AA 4EN1A 1Q4BA 4W6LA 2FZUA 4EDSA 2O24A 3SVRA 4LQTA 1QYQA 2FWQA 2WISA 1H6RA
chains in the Genus database with same CATH topology
3U8PA 1QXTA 3DQ3A 1Q4DA 1YZWA 3O78A 4ZINA 3DPWA 4AR7A 4OHSA 3SVDA 4KF5A 3CBEA 2WHSA 4GESB 2G5ZB 3VHTA 4KGEA 5DPJA 4XL5A 3DQMA 4KPIA 4KW4A 4Q9XA 3TMRA 3V3DA 3SVEA 4NWSA 1EMFA 5DRFA 2QT2A 2P4MA 4W7FA 5DQMA 2H5QA 2Z1OA 4W7RA 4EMQA 4KEXA 3ST2A 3GJ1A 2G6XA 3EVVA 4OGSA 3SG5A 4UTSA 4W6FA 3DQLA 2DDCA 4H47A 4W6GA 4XOVA 4J89A 5DTLA 5EBJA 1EMGA 3DQFA 1Q4AA 4OQWA 5EB6A 3DPZA 3PIBA 3SG6A 3IR8A 4HQCA 2AH8A 2B3QA 2DUFA 3EVPA 4LJBA 5DTZA 3SVOA 3DQ8A 1EMBA 1Q4CA 2WSOA 1XAEA 4W6PA 2H5PA 2YFPA 5BTTA 3ZTFA 2HFCA 3VK1A 3NT3A 4KA9A 2IB5A 3NT9A 1MOVA 4PPLA 2C9IA 1RMOA 3KCSA 3CB9A 5HBDA 3RWAA 2GX2A 3DQIA 4ZF3A 2ZO7A 1XSSA 5BQLA 3DQJA 2A56B 2ZO6A 2FL1A 3LVCA 4J8AA 5DY6A 5F9GA 5HGEA 2Z6ZA 4W6SA 3SV5A 3AI4A 3SSHA 4W6TA 2QLGB 4JC2A 2OKWA 4ZFSA 5HW9A 2QZ0A 4H3NA 1ZUXA 2VADA 4DXMA 2Z6XA 3SSVA 4JGEA 3BXAA 3M22A 4W6OA 3E5TA 1RM9A 1ZGQA 4KW9A 5J2OA 3SVCA 3EK4A 4IK3A 4TZAA 4W6CA 5BT0A 4PPKA 4W69A 3SSYA 2OKYA 5HZUA 3DQUA 1OXDA 4IZNA 3OSQA 4Q7TA 3W1CA 4IK4A 2OTBA 4H3LA 3ZUJA 3GL4A 3DQOA 2DD9A 4W7XA 1HCJA 3CD9A 2H5RA 5H89A 2A52B 1RRXA 4Q7UA 2V4EB 2G16B 4Q7RA 3DQHA 3I19A 3DQ2A 4P1QA 4IK8A 3ST4A 4JF9A 2A53B 2HPWA 2HRSA 1YJFA 3UG0A 1ZGOA 4L12A 4KW8A 2WSNA 4W6KA 3E5WA 2A46A 3DQDA 2OTEA 4Q9WA 3VICA 2H6VA 3K1KA 4B30B 3DQAA 3SG7A 5DTXA 2ZMWA 3WCKA 3PJ5A 2QLGA 4P76A 4TZGA 1RMPA 5EXBA 2ZMUA 4Z4MA 3SVSA 2EMNA 3PJBA 3U0MA 1B9CA 2GW3A 2ICRA 5EXCI 3CFAA 1S6ZA 3SRYA 2C9JA 3BXBA 2QLHA 4W7CA 4W6BA 4KGFA 3H1OA 4W74A 5DTYA 2V4EC 4JEOA 4KF4A 2A54B 2AWJA 3M24A 2QU1A 4LJDC 4R6BA 2JADA 5DPHA 3SG4A 1RMMA 2HGDA 1EMAA 3P28A 1UISA 4W6DA 1YHHA 3DPXA 3NEDA 2BTJA 3AI5A 3MGFA 3DQNA 5LTPA 3SSLA 2HGYA 1QY3A 3SG3A 4KAGA 1EMCA 5LTQA 3E5VA 2YDZA 3EKJA 2HQZA 4OJ0A 2G3OA 3DQKA 4RYWA 1MOUA 1YHGA 5FVFA 2H9WA 2G6EA 4GOBA 2AWKA 2H5OA 2QLEA 2DUEA 4PPJA 1XA9A 4W6RA 4JRBA 4ZBLA 4ZF5A 3GB3A 1XQMA 2G3DB 1JC1A 1F09A 3IP2A 3A8SA 4LW5A 4I2YA 4PFEA 5FHVA 1EMMA 4RTCA 3BX9A 4H48A 4ORNA 3WLDA 3VHTB 4W73A 3OGOA 1KYPA 4W72A 4XGYA 5KTGA 5LK4A 4W6HA 1HUYA 4ZF4A 3EK8A 5EB7A 4ANJA 2DDDA 1MYWA 2AHAA 4IK1A 4L1IA 1JBZA 3CFFA 4H3MA 5H88A 2EMDA 2QLIA 4XVPA 5HZTA 2VVIA 5T3IA 1BFPA 3CGLA 3LF3A 4ZIOA 5FVIA 5DQBA 2PXSA 3ED8A 3EVUA 1Z1PA 1Q73A 1OXEA 1GFLA 2IOVA 3DQ1A 2HJOA 1F0BA 4OY4A 2WIQA 4HE4A 2Y0GA 5AQBB 5HZSA 4DXQA 3LVAA 1YHIA 4W6NA 1GL4A 4L13A 3U0KA 3ST3A 4LQUA 3U0NA 5DU0A 3LSAA 3LVDA 2DD7A 4W76A 3GEXA 4DXOA 2PXWA 1YJ2A 5DPIA 2O29A 3DQ6A 4DXNA 4W75A 5BTTB 4IK9A 4KF5C 2A48A 3SS0A 3SVNA 2A47A 2WHUA 3P8UA 2DUIA 3CD1A 3ZUFA 3UFZA 2Q6PA 3U8AA 2VZXA 2OJKA 3LA1A 4W77A 5DPGA 1Z1QA 4LJCA 3ST0A 4XOWA 3O77A 1QYOA 2A50B 4IK5A 3OSRA 3DQ4A 3PJ7A 1KYSA 4R6DA 4AS8A 2DUGA 4EULA 3DQ7A 2G2SB 2WURA 4U2VA 3DQ5A 2OGRA 1EMEA 4W7EA 1EMKA 3TMTA 3NF0A 5DRGA 1JBYA 1KP5A 1W7TA 2HQKA 4W7DA 3BXCA 2GW4B 1EMLA 3SVUA 3W1DA 4DXPA 1Q4EA 2V4EA 4W6MA 4LJDA 3LF4B 1GGXA 2ARLA 3SG2A 3CFHA 4B5YA 3GJ2A 4N3DA 2POXA 5HZOA 1XMZA 2GX0A 3DQEA 3RWTA 4HQ9A 5H87A 4JFGA 1OXFA 2WHTA 1W7UA 2AWMA 2YE0A 2YE1A 4W6IA 4B30A 5EJUA 4HVFA 2Q57A 5EHUA 2H8QA 2IE2A 3ADFA 2Z6YA 2DUHA 2QRFA 4GF6B 4W6JA 2G6YA 1KYRA 4DXIA 3AKOA 1JC0A 3U8CA 3DQCA 3SVBA 4RYSA 4J88A 2RH7A 3G9AA 1W7SA 2IB6A 3NEZA 1CV7A 2B3PA 3S05A 3ZULA 4BDUA 3EVRA 2EMOA 3SSTA 3DQ9A 3H1RA 1C4FA 2VVJA 5LTRA 3EK7A 2AWLA 4HQ8A 3KCTA 4W6UA 5FVGA 4Z4KA 2O2BA 1ZGPA 3LS3A 4DKNA 4DKMA 4EDOA 1QYFA 2VVHA 2HCGA 3SSKA 1YFPA 3SSPA 1G7KA 2VAEA 3WLCA 4W6AA 1H4UA 4ZB1A 5EXUA 3EKHA 3U0LA 4W7AA 4EN1A 1Q4BA 4W6LA 2FZUA 4EDSA 2O24A 3SVRA 4LQTA 1QYQA 2FWQA 2WISA 1H6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8P A;  1QXT A;  3DQ3 A;  1Q4D A;  1YZW A;  3O78 A;  4ZIN A;  3DPW A;  4AR7 A;  4OHS A;  3SVD A;  4KF5 A;  3CBE A;  2WHS A;  4GES B;  2G5Z B;  3VHT A;  4KGE A;  5DPJ A;  4XL5 A;  3DQM A;  4KPI A;  4KW4 A;  4Q9X A;  3TMR A;  3V3D A;  3SVE A;  4NWS A;  1EMF A;  5DRF A;  2QT2 A;  2P4M A;  4W7F A;  5DQM A;  2H5Q A;  2Z1O A;  4W7R A;  4EMQ A;  4KEX A;  3ST2 A;  3GJ1 A;  2G6X A;  3EVV A;  4OGS A;  3SG5 A;  4UTS A;  4W6F A;  3DQL A;  2DDC A;  4H47 A;  4W6G A;  4XOV A;  4J89 A;  5DTL A;  5EBJ A;  1EMG A;  3DQF A;  1Q4A A;  4OQW A;  5EB6 A;  3DPZ A;  3PIB A;  3SG6 A;  3IR8 A;  4HQC A;  2AH8 A;  2B3Q A;  2DUF A;  3EVP A;  4LJB A;  5DTZ A;  3SVO A;  3DQ8 A;  1EMB A;  1Q4C A;  2WSO A;  1XAE A;  4W6P A;  2H5P A;  2YFP A;  5BTT A;  3ZTF A;  2HFC A;  3VK1 A;  3NT3 A;  4KA9 A;  2IB5 A;  3NT9 A;  1MOV A;  4PPL A;  2C9I A;  1RMO A;  3KCS A;  3CB9 A;  5HBD A;  3RWA A;  2GX2 A;  3DQI A;  4ZF3 A;  2ZO7 A;  1XSS A;  5BQL A;  3DQJ A;  2A56 B;  2ZO6 A;  2FL1 A;  3LVC A;  4J8A A;  5DY6 A;  5F9G A;  5HGE A;  2Z6Z A;  4W6S A;  3SV5 A;  3AI4 A;  3SSH A;  4W6T A;  2QLG B;  4JC2 A;  2OKW A;  4ZFS A;  5HW9 A;  2QZ0 A;  4H3N A;  1ZUX A;  2VAD A;  4DXM A;  2Z6X A;  3SSV A;  4JGE A;  3BXA A;  3M22 A;  4W6O A;  3E5T A;  1RM9 A;  1ZGQ A;  4KW9 A;  5J2O A;  3SVC A;  3EK4 A;  4IK3 A;  4TZA A;  4W6C A;  5BT0 A;  4PPK A;  4W69 A;  3SSY A;  2OKY A;  5HZU A;  3DQU A;  1OXD A;  4IZN A;  3OSQ A;  4Q7T A;  3W1C A;  4IK4 A;  2OTB A;  4H3L A;  3ZUJ A;  3GL4 A;  3DQO A;  2DD9 A;  4W7X A;  1HCJ A;  3CD9 A;  2H5R A;  5H89 A;  2A52 B;  1RRX A;  4Q7U A;  2V4E B;  2G16 B;  4Q7R A;  3DQH A;  3I19 A;  3DQ2 A;  4P1Q A;  4IK8 A;  3ST4 A;  4JF9 A;  2A53 B;  2HPW A;  2HRS A;  1YJF A;  3UG0 A;  1ZGO A;  4L12 A;  4KW8 A;  2WSN A;  4W6K A;  3E5W A;  2A46 A;  3DQD A;  2OTE A;  4Q9W A;  3VIC A;  2H6V A;  3K1K A;  4B30 B;  3DQA A;  3SG7 A;  5DTX A;  2ZMW A;  3WCK A;  3PJ5 A;  2QLG A;  4P76 A;  4TZG A;  1RMP A;  5EXB A;  2ZMU A;  4Z4M A;  3SVS A;  2EMN A;  3PJB A;  3U0M A;  1B9C A;  2GW3 A;  2ICR A;  5EXC I;  3CFA A;  1S6Z A;  3SRY A;  2C9J A;  3BXB A;  2QLH A;  4W7C A;  4W6B A;  4KGF A;  3H1O A;  4W74 A;  5DTY A;  2V4E C;  4JEO A;  4KF4 A;  2A54 B;  2AWJ A;  3M24 A;  2QU1 A;  4LJD C;  4R6B A;  2JAD A;  5DPH A;  3SG4 A;  1RMM A;  2HGD A;  1EMA A;  3P28 A;  1UIS A;  4W6D A;  1YHH A;  3DPX A;  3NED A;  2BTJ A;  3AI5 A;  3MGF A;  3DQN A;  5LTP A;  3SSL A;  2HGY A;  1QY3 A;  3SG3 A;  4KAG A;  1EMC A;  5LTQ A;  3E5V A;  2YDZ A;  3EKJ A;  2HQZ A;  4OJ0 A;  2G3O A;  3DQK A;  4RYW A;  1MOU A;  1YHG A;  5FVF A;  2H9W A;  2G6E A;  4GOB A;  2AWK A;  2H5O A;  2QLE A;  2DUE A;  4PPJ A;  1XA9 A;  4W6R A;  4JRB A;  4ZBL A;  4ZF5 A;  3GB3 A;  1XQM A;  2G3D B;  1JC1 A;  1F09 A;  3IP2 A;  3A8S A;  4LW5 A;  4I2Y A;  4PFE A;  5FHV A;  1EMM A;  4RTC A;  3BX9 A;  4H48 A;  4ORN A;  3WLD A;  3VHT B;  4W73 A;  3OGO A;  1KYP A;  4W72 A;  4XGY A;  5KTG A;  5LK4 A;  4W6H A;  1HUY A;  4ZF4 A;  3EK8 A;  5EB7 A;  4ANJ A;  2DDD A;  1MYW A;  2AHA A;  4IK1 A;  4L1I A;  1JBZ A;  3CFF A;  4H3M A;  5H88 A;  2EMD A;  2QLI A;  4XVP A;  5HZT A;  2VVI A;  5T3I A;  1BFP A;  3CGL A;  3LF3 A;  4ZIO A;  5FVI A;  5DQB A;  2PXS A;  3ED8 A;  3EVU A;  1Z1P A;  1Q73 A;  1OXE A;  1GFL A;  2IOV A;  3DQ1 A;  2HJO A;  1F0B A;  4OY4 A;  2WIQ A;  4HE4 A;  2Y0G A;  5AQB B;  5HZS A;  4DXQ A;  3LVA A;  1YHI A;  4W6N A;  1GL4 A;  4L13 A;  3U0K A;  3ST3 A;  4LQU A;  3U0N A;  5DU0 A;  3LSA A;  3LVD A;  2DD7 A;  4W76 A;  3GEX A;  4DXO A;  2PXW A;  1YJ2 A;  5DPI A;  2O29 A;  3DQ6 A;  4DXN A;  4W75 A;  5BTT B;  4IK9 A;  4KF5 C;  2A48 A;  3SS0 A;  3SVN A;  2A47 A;  2WHU A;  3P8U A;  2DUI A;  3CD1 A;  3ZUF A;  3UFZ A;  2Q6P A;  3U8A A;  2VZX A;  2OJK A;  3LA1 A;  4W77 A;  5DPG A;  1Z1Q A;  4LJC A;  3ST0 A;  4XOW A;  3O77 A;  1QYO A;  2A50 B;  4IK5 A;  3OSR A;  3DQ4 A;  3PJ7 A;  1KYS A;  4R6D A;  4AS8 A;  2DUG A;  4EUL A;  3DQ7 A;  2G2S B;  2WUR A;  4U2V A;  3DQ5 A;  2OGR A;  1EME A;  4W7E A;  1EMK A;  3TMT A;  3NF0 A;  5DRG A;  1JBY A;  1KP5 A;  1W7T A;  2HQK A;  4W7D A;  3BXC A;  2GW4 B;  1EML A;  3SVU A;  3W1D A;  4DXP A;  1Q4E A;  2V4E A;  4W6M A;  4LJD A;  3LF4 B;  1GGX A;  2ARL A;  3SG2 A;  3CFH A;  4B5Y A;  3GJ2 A;  4N3D A;  2POX A;  5HZO A;  1XMZ A;  2GX0 A;  3DQE A;  3RWT A;  4HQ9 A;  5H87 A;  4JFG A;  1OXF A;  2WHT A;  1W7U A;  2AWM A;  2YE0 A;  2YE1 A;  4W6I A;  4B30 A;  5EJU A;  4HVF A;  2Q57 A;  5EHU A;  2H8Q A;  2IE2 A;  3ADF A;  2Z6Y A;  2DUH A;  2QRF A;  4GF6 B;  4W6J A;  2G6Y A;  1KYR A;  4DXI A;  3AKO A;  1JC0 A;  3U8C A;  3DQC A;  3SVB A;  4RYS A;  4J88 A;  2RH7 A;  3G9A A;  1W7S A;  2IB6 A;  3NEZ A;  1CV7 A;  2B3P A;  3S05 A;  3ZUL A;  4BDU A;  3EVR A;  2EMO A;  3SST A;  3DQ9 A;  3H1R A;  1C4F A;  2VVJ A;  5LTR A;  3EK7 A;  2AWL A;  4HQ8 A;  3KCT A;  4W6U A;  5FVG A;  4Z4K A;  2O2B A;  1ZGP A;  3LS3 A;  4DKN A;  4DKM A;  4EDO A;  1QYF A;  2VVH A;  2HCG A;  3SSK A;  1YFP A;  3SSP A;  1G7K A;  2VAE A;  3WLC A;  4W6A A;  1H4U A;  4ZB1 A;  5EXU A;  3EKH A;  3U0L A;  4W7A A;  4EN1 A;  1Q4B A;  4W6L A;  2FZU A;  4EDS A;  2O24 A;  3SVR A;  4LQT A;  1QYQ A;  2FWQ A;  2WIS A;  1H6R A; 
#chains in the Genus database with same CATH topology
 3U8P A;  1QXT A;  3DQ3 A;  1Q4D A;  1YZW A;  3O78 A;  4ZIN A;  3DPW A;  4AR7 A;  4OHS A;  3SVD A;  4KF5 A;  3CBE A;  2WHS A;  4GES B;  2G5Z B;  3VHT A;  4KGE A;  5DPJ A;  4XL5 A;  3DQM A;  4KPI A;  4KW4 A;  4Q9X A;  3TMR A;  3V3D A;  3SVE A;  4NWS A;  1EMF A;  5DRF A;  2QT2 A;  2P4M A;  4W7F A;  5DQM A;  2H5Q A;  2Z1O A;  4W7R A;  4EMQ A;  4KEX A;  3ST2 A;  3GJ1 A;  2G6X A;  3EVV A;  4OGS A;  3SG5 A;  4UTS A;  4W6F A;  3DQL A;  2DDC A;  4H47 A;  4W6G A;  4XOV A;  4J89 A;  5DTL A;  5EBJ A;  1EMG A;  3DQF A;  1Q4A A;  4OQW A;  5EB6 A;  3DPZ A;  3PIB A;  3SG6 A;  3IR8 A;  4HQC A;  2AH8 A;  2B3Q A;  2DUF A;  3EVP A;  4LJB A;  5DTZ A;  3SVO A;  3DQ8 A;  1EMB A;  1Q4C A;  2WSO A;  1XAE A;  4W6P A;  2H5P A;  2YFP A;  5BTT A;  3ZTF A;  2HFC A;  3VK1 A;  3NT3 A;  4KA9 A;  2IB5 A;  3NT9 A;  1MOV A;  4PPL A;  2C9I A;  1RMO A;  3KCS A;  3CB9 A;  5HBD A;  3RWA A;  2GX2 A;  3DQI A;  4ZF3 A;  2ZO7 A;  1XSS A;  5BQL A;  3DQJ A;  2A56 B;  2ZO6 A;  2FL1 A;  3LVC A;  4J8A A;  5DY6 A;  5F9G A;  5HGE A;  2Z6Z A;  4W6S A;  3SV5 A;  3AI4 A;  3SSH A;  4W6T A;  2QLG B;  4JC2 A;  2OKW A;  4ZFS A;  5HW9 A;  2QZ0 A;  4H3N A;  1ZUX A;  2VAD A;  4DXM A;  2Z6X A;  3SSV A;  4JGE A;  3BXA A;  3M22 A;  4W6O A;  3E5T A;  1RM9 A;  1ZGQ A;  4KW9 A;  5J2O A;  3SVC A;  3EK4 A;  4IK3 A;  4TZA A;  4W6C A;  5BT0 A;  4PPK A;  4W69 A;  3SSY A;  2OKY A;  5HZU A;  3DQU A;  1OXD A;  4IZN A;  3OSQ A;  4Q7T A;  3W1C A;  4IK4 A;  2OTB A;  4H3L A;  3ZUJ A;  3GL4 A;  3DQO A;  2DD9 A;  4W7X A;  1HCJ A;  3CD9 A;  2H5R A;  5H89 A;  2A52 B;  1RRX A;  4Q7U A;  2V4E B;  2G16 B;  4Q7R A;  3DQH A;  3I19 A;  3DQ2 A;  4P1Q A;  4IK8 A;  3ST4 A;  4JF9 A;  2A53 B;  2HPW A;  2HRS A;  1YJF A;  3UG0 A;  1ZGO A;  4L12 A;  4KW8 A;  2WSN A;  4W6K A;  3E5W A;  2A46 A;  3DQD A;  2OTE A;  4Q9W A;  3VIC A;  2H6V A;  3K1K A;  4B30 B;  3DQA A;  3SG7 A;  5DTX A;  2ZMW A;  3WCK A;  3PJ5 A;  2QLG A;  4P76 A;  4TZG A;  1RMP A;  5EXB A;  2ZMU A;  4Z4M A;  3SVS A;  2EMN A;  3PJB A;  3U0M A;  1B9C A;  2GW3 A;  2ICR A;  5EXC I;  3CFA A;  1S6Z A;  3SRY A;  2C9J A;  3BXB A;  2QLH A;  4W7C A;  4W6B A;  4KGF A;  3H1O A;  4W74 A;  5DTY A;  2V4E C;  4JEO A;  4KF4 A;  2A54 B;  2AWJ A;  3M24 A;  2QU1 A;  4LJD C;  4R6B A;  2JAD A;  5DPH A;  3SG4 A;  1RMM A;  2HGD A;  1EMA A;  3P28 A;  1UIS A;  4W6D A;  1YHH A;  3DPX A;  3NED A;  2BTJ A;  3AI5 A;  3MGF A;  3DQN A;  5LTP A;  3SSL A;  2HGY A;  1QY3 A;  3SG3 A;  4KAG A;  1EMC A;  5LTQ A;  3E5V A;  2YDZ A;  3EKJ A;  2HQZ A;  4OJ0 A;  2G3O A;  3DQK A;  4RYW A;  1MOU A;  1YHG A;  5FVF A;  2H9W A;  2G6E A;  4GOB A;  2AWK A;  2H5O A;  2QLE A;  2DUE A;  4PPJ A;  1XA9 A;  4W6R A;  4JRB A;  4ZBL A;  4ZF5 A;  3GB3 A;  1XQM A;  2G3D B;  1JC1 A;  1F09 A;  3IP2 A;  3A8S A;  4LW5 A;  4I2Y A;  4PFE A;  5FHV A;  1EMM A;  4RTC A;  3BX9 A;  4H48 A;  4ORN A;  3WLD A;  3VHT B;  4W73 A;  3OGO A;  1KYP A;  4W72 A;  4XGY A;  5KTG A;  5LK4 A;  4W6H A;  1HUY A;  4ZF4 A;  3EK8 A;  5EB7 A;  4ANJ A;  2DDD A;  1MYW A;  2AHA A;  4IK1 A;  4L1I A;  1JBZ A;  3CFF A;  4H3M A;  5H88 A;  2EMD A;  2QLI A;  4XVP A;  5HZT A;  2VVI A;  5T3I A;  1BFP A;  3CGL A;  3LF3 A;  4ZIO A;  5FVI A;  5DQB A;  2PXS A;  3ED8 A;  3EVU A;  1Z1P A;  1Q73 A;  1OXE A;  1GFL A;  2IOV A;  3DQ1 A;  2HJO A;  1F0B A;  4OY4 A;  2WIQ A;  4HE4 A;  2Y0G A;  5AQB B;  5HZS A;  4DXQ A;  3LVA A;  1YHI A;  4W6N A;  1GL4 A;  4L13 A;  3U0K A;  3ST3 A;  4LQU A;  3U0N A;  5DU0 A;  3LSA A;  3LVD A;  2DD7 A;  4W76 A;  3GEX A;  4DXO A;  2PXW A;  1YJ2 A;  5DPI A;  2O29 A;  3DQ6 A;  4DXN A;  4W75 A;  5BTT B;  4IK9 A;  4KF5 C;  2A48 A;  3SS0 A;  3SVN A;  2A47 A;  2WHU A;  3P8U A;  2DUI A;  3CD1 A;  3ZUF A;  3UFZ A;  2Q6P A;  3U8A A;  2VZX A;  2OJK A;  3LA1 A;  4W77 A;  5DPG A;  1Z1Q A;  4LJC A;  3ST0 A;  4XOW A;  3O77 A;  1QYO A;  2A50 B;  4IK5 A;  3OSR A;  3DQ4 A;  3PJ7 A;  1KYS A;  4R6D A;  4AS8 A;  2DUG A;  4EUL A;  3DQ7 A;  2G2S B;  2WUR A;  4U2V A;  3DQ5 A;  2OGR A;  1EME A;  4W7E A;  1EMK A;  3TMT A;  3NF0 A;  5DRG A;  1JBY A;  1KP5 A;  1W7T A;  2HQK A;  4W7D A;  3BXC A;  2GW4 B;  1EML A;  3SVU A;  3W1D A;  4DXP A;  1Q4E A;  2V4E A;  4W6M A;  4LJD A;  3LF4 B;  1GGX A;  2ARL A;  3SG2 A;  3CFH A;  4B5Y A;  3GJ2 A;  4N3D A;  2POX A;  5HZO A;  1XMZ A;  2GX0 A;  3DQE A;  3RWT A;  4HQ9 A;  5H87 A;  4JFG A;  1OXF A;  2WHT A;  1W7U A;  2AWM A;  2YE0 A;  2YE1 A;  4W6I A;  4B30 A;  5EJU A;  4HVF A;  2Q57 A;  5EHU A;  2H8Q A;  2IE2 A;  3ADF A;  2Z6Y A;  2DUH A;  2QRF A;  4GF6 B;  4W6J A;  2G6Y A;  1KYR A;  4DXI A;  3AKO A;  1JC0 A;  3U8C A;  3DQC A;  3SVB A;  4RYS A;  4J88 A;  2RH7 A;  3G9A A;  1W7S A;  2IB6 A;  3NEZ A;  1CV7 A;  2B3P A;  3S05 A;  3ZUL A;  4BDU A;  3EVR A;  2EMO A;  3SST A;  3DQ9 A;  3H1R A;  1C4F A;  2VVJ A;  5LTR A;  3EK7 A;  2AWL A;  4HQ8 A;  3KCT A;  4W6U A;  5FVG A;  4Z4K A;  2O2B A;  1ZGP A;  3LS3 A;  4DKN A;  4DKM A;  4EDO A;  1QYF A;  2VVH A;  2HCG A;  3SSK A;  1YFP A;  3SSP A;  1G7K A;  2VAE A;  3WLC A;  4W6A A;  1H4U A;  4ZB1 A;  5EXU A;  3EKH A;  3U0L A;  4W7A A;  4EN1 A;  1Q4B A;  4W6L A;  2FZU A;  4EDS A;  2O24 A;  3SVR A;  4LQT A;  1QYQ A;  2FWQ A;  2WIS A;  1H6R A; 
#chains in the Genus database with same CATH homology
 3U8P A;  1QXT A;  3DQ3 A;  1Q4D A;  1YZW A;  3O78 A;  4ZIN A;  3DPW A;  4AR7 A;  4OHS A;  3SVD A;  4KF5 A;  3CBE A;  2WHS A;  4GES B;  2G5Z B;  3VHT A;  4KGE A;  5DPJ A;  4XL5 A;  3DQM A;  4KPI A;  4KW4 A;  4Q9X A;  3TMR A;  3V3D A;  3SVE A;  4NWS A;  1EMF A;  5DRF A;  2QT2 A;  2P4M A;  4W7F A;  5DQM A;  2H5Q A;  2Z1O A;  4W7R A;  4EMQ A;  4KEX A;  3ST2 A;  3GJ1 A;  2G6X A;  3EVV A;  4OGS A;  3SG5 A;  4UTS A;  4W6F A;  3DQL A;  2DDC A;  4H47 A;  4W6G A;  4XOV A;  4J89 A;  5DTL A;  5EBJ A;  1EMG A;  3DQF A;  1Q4A A;  4OQW A;  5EB6 A;  3DPZ A;  3PIB A;  3SG6 A;  3IR8 A;  4HQC A;  2AH8 A;  2B3Q A;  2DUF A;  3EVP A;  4LJB A;  5DTZ A;  3SVO A;  3DQ8 A;  1EMB A;  1Q4C A;  2WSO A;  1XAE A;  4W6P A;  2H5P A;  2YFP A;  5BTT A;  3ZTF A;  2HFC A;  3VK1 A;  3NT3 A;  4KA9 A;  2IB5 A;  3NT9 A;  1MOV A;  4PPL A;  2C9I A;  1RMO A;  3KCS A;  3CB9 A;  5HBD A;  3RWA A;  2GX2 A;  3DQI A;  4ZF3 A;  2ZO7 A;  1XSS A;  5BQL A;  3DQJ A;  2A56 B;  2ZO6 A;  2FL1 A;  3LVC A;  4J8A A;  5DY6 A;  5F9G A;  5HGE A;  2Z6Z A;  4W6S A;  3SV5 A;  3AI4 A;  3SSH A;  4W6T A;  2QLG B;  4JC2 A;  2OKW A;  4ZFS A;  5HW9 A;  2QZ0 A;  4H3N A;  1ZUX A;  2VAD A;  4DXM A;  2Z6X A;  3SSV A;  4JGE A;  3BXA A;  3M22 A;  4W6O A;  3E5T A;  1RM9 A;  1ZGQ A;  4KW9 A;  5J2O A;  3SVC A;  3EK4 A;  4IK3 A;  4TZA A;  4W6C A;  5BT0 A;  4PPK A;  4W69 A;  3SSY A;  2OKY A;  5HZU A;  3DQU A;  1OXD A;  4IZN A;  3OSQ A;  4Q7T A;  3W1C A;  4IK4 A;  2OTB A;  4H3L A;  3ZUJ A;  3GL4 A;  3DQO A;  2DD9 A;  4W7X A;  1HCJ A;  3CD9 A;  2H5R A;  5H89 A;  2A52 B;  1RRX A;  4Q7U A;  2V4E B;  2G16 B;  4Q7R A;  3DQH A;  3I19 A;  3DQ2 A;  4P1Q A;  4IK8 A;  3ST4 A;  4JF9 A;  2A53 B;  2HPW A;  2HRS A;  1YJF A;  3UG0 A;  1ZGO A;  4L12 A;  4KW8 A;  2WSN A;  4W6K A;  3E5W A;  2A46 A;  3DQD A;  2OTE A;  4Q9W A;  3VIC A;  2H6V A;  3K1K A;  4B30 B;  3DQA A;  3SG7 A;  5DTX A;  2ZMW A;  3WCK A;  3PJ5 A;  2QLG A;  4P76 A;  4TZG A;  1RMP A;  5EXB A;  2ZMU A;  4Z4M A;  3SVS A;  2EMN A;  3PJB A;  3U0M A;  1B9C A;  2GW3 A;  2ICR A;  5EXC I;  3CFA A;  1S6Z A;  3SRY A;  2C9J A;  3BXB A;  2QLH A;  4W7C A;  4W6B A;  4KGF A;  3H1O A;  4W74 A;  5DTY A;  2V4E C;  4JEO A;  4KF4 A;  2A54 B;  2AWJ A;  3M24 A;  2QU1 A;  4LJD C;  4R6B A;  2JAD A;  5DPH A;  3SG4 A;  1RMM A;  2HGD A;  1EMA A;  3P28 A;  1UIS A;  4W6D A;  1YHH A;  3DPX A;  3NED A;  2BTJ A;  3AI5 A;  3MGF A;  3DQN A;  5LTP A;  3SSL A;  2HGY A;  1QY3 A;  3SG3 A;  4KAG A;  1EMC A;  5LTQ A;  3E5V A;  2YDZ A;  3EKJ A;  2HQZ A;  4OJ0 A;  2G3O A;  3DQK A;  4RYW A;  1MOU A;  1YHG A;  5FVF A;  2H9W A;  2G6E A;  4GOB A;  2AWK A;  2H5O A;  2QLE A;  2DUE A;  4PPJ A;  1XA9 A;  4W6R A;  4JRB A;  4ZBL A;  4ZF5 A;  3GB3 A;  1XQM A;  2G3D B;  1JC1 A;  1F09 A;  3IP2 A;  3A8S A;  4LW5 A;  4I2Y A;  4PFE A;  5FHV A;  1EMM A;  4RTC A;  3BX9 A;  4H48 A;  4ORN A;  3WLD A;  3VHT B;  4W73 A;  3OGO A;  1KYP A;  4W72 A;  4XGY A;  5KTG A;  5LK4 A;  4W6H A;  1HUY A;  4ZF4 A;  3EK8 A;  5EB7 A;  4ANJ A;  2DDD A;  1MYW A;  2AHA A;  4IK1 A;  4L1I A;  1JBZ A;  3CFF A;  4H3M A;  5H88 A;  2EMD A;  2QLI A;  4XVP A;  5HZT A;  2VVI A;  5T3I A;  1BFP A;  3CGL A;  3LF3 A;  4ZIO A;  5FVI A;  5DQB A;  2PXS A;  3ED8 A;  3EVU A;  1Z1P A;  1Q73 A;  1OXE A;  1GFL A;  2IOV A;  3DQ1 A;  2HJO A;  1F0B A;  4OY4 A;  2WIQ A;  4HE4 A;  2Y0G A;  5AQB B;  5HZS A;  4DXQ A;  3LVA A;  1YHI A;  4W6N A;  1GL4 A;  4L13 A;  3U0K A;  3ST3 A;  4LQU A;  3U0N A;  5DU0 A;  3LSA A;  3LVD A;  2DD7 A;  4W76 A;  3GEX A;  4DXO A;  2PXW A;  1YJ2 A;  5DPI A;  2O29 A;  3DQ6 A;  4DXN A;  4W75 A;  5BTT B;  4IK9 A;  4KF5 C;  2A48 A;  3SS0 A;  3SVN A;  2A47 A;  2WHU A;  3P8U A;  2DUI A;  3CD1 A;  3ZUF A;  3UFZ A;  2Q6P A;  3U8A A;  2VZX A;  2OJK A;  3LA1 A;  4W77 A;  5DPG A;  1Z1Q A;  4LJC A;  3ST0 A;  4XOW A;  3O77 A;  1QYO A;  2A50 B;  4IK5 A;  3OSR A;  3DQ4 A;  3PJ7 A;  1KYS A;  4R6D A;  4AS8 A;  2DUG A;  4EUL A;  3DQ7 A;  2G2S B;  2WUR A;  4U2V A;  3DQ5 A;  2OGR A;  1EME A;  4W7E A;  1EMK A;  3TMT A;  3NF0 A;  5DRG A;  1JBY A;  1KP5 A;  1W7T A;  2HQK A;  4W7D A;  3BXC A;  2GW4 B;  1EML A;  3SVU A;  3W1D A;  4DXP A;  1Q4E A;  2V4E A;  4W6M A;  4LJD A;  3LF4 B;  1GGX A;  2ARL A;  3SG2 A;  3CFH A;  4B5Y A;  3GJ2 A;  4N3D A;  2POX A;  5HZO A;  1XMZ A;  2GX0 A;  3DQE A;  3RWT A;  4HQ9 A;  5H87 A;  4JFG A;  1OXF A;  2WHT A;  1W7U A;  2AWM A;  2YE0 A;  2YE1 A;  4W6I A;  4B30 A;  5EJU A;  4HVF A;  2Q57 A;  5EHU A;  2H8Q A;  2IE2 A;  3ADF A;  2Z6Y A;  2DUH A;  2QRF A;  4GF6 B;  4W6J A;  2G6Y A;  1KYR A;  4DXI A;  3AKO A;  1JC0 A;  3U8C A;  3DQC A;  3SVB A;  4RYS A;  4J88 A;  2RH7 A;  3G9A A;  1W7S A;  2IB6 A;  3NEZ A;  1CV7 A;  2B3P A;  3S05 A;  3ZUL A;  4BDU A;  3EVR A;  2EMO A;  3SST A;  3DQ9 A;  3H1R A;  1C4F A;  2VVJ A;  5LTR A;  3EK7 A;  2AWL A;  4HQ8 A;  3KCT A;  4W6U A;  5FVG A;  4Z4K A;  2O2B A;  1ZGP A;  3LS3 A;  4DKN A;  4DKM A;  4EDO A;  1QYF A;  2VVH A;  2HCG A;  3SSK A;  1YFP A;  3SSP A;  1G7K A;  2VAE A;  3WLC A;  4W6A A;  1H4U A;  4ZB1 A;  5EXU A;  3EKH A;  3U0L A;  4W7A A;  4EN1 A;  1Q4B A;  4W6L A;  2FZU A;  4EDS A;  2O24 A;  3SVR A;  4LQT A;  1QYQ A;  2FWQ A;  2WIS A;  1H6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...