4XP1L

X-ray structure of drosophila dopamine transporter bound to neurotransmitter dopamine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/transport protein
molecule keywords Dopamine transporter, isoform B
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp1L01
5KSVB 5IEKB 2O26U 3QWRD 2DI9A 5D1QB 1HDMA 1Y18B 4WI9A 5C0FB 4NQDA 1D9KC 4ONHB 2MTPA 3QUKA 5H2BA 5MERB 4MX7B 3QI9B 4OIIL 3MC0A 5F7HA 2RFXB 1ZHNA 1YY8A 1FFPA 1FZJA 2BNRB 2Q7YB 1A14H 5F9JA 5T3XD 5GS0D 3ARED 3RNKB 2B1HL 3L5WA 4MDIB 4HZLB 5I1CH 3P73A 4QXWA 5JHDD 3FO1B 4WI2A 5JHLH 3OKDB 4CVXA 1TCMA 2ICCA 2WIIB 2XWJA 2XZCH 1JMZA 1HQRA 2DQUH 2BOBA 4TUOB 2I24N 3S35X 4GAJH 5GIRA 1RV6X 3PL6D 4HPOL 1DBKL 4ISVA 1KULA 1ROWA 1H3TA 4JFYB 4PD4K 5E8DH 4RGOL 3NAAL 4OCMC 4LASH 4U1NB 1CDGA 2BSSA 4ZUTA 1FZMB 1M71A 4PTTA 3WFHB 4PPTA 4QRPD 4S0SD 3K3QA 1NGYA 3HAEG 4Y2DA 3VWKB 1EVUA 1PG7W 1QLRB 3QNXB 1JV5A 1KTLB 4IDJH 4Z7VA 1U8PB 3TEUA 5D7LE 3X3GH 2RJMA 2ICWA 3BIKB 5F9OL 2EDQA 2LU3A 2JJWA 4PJGB 5DD5L 3QHFH 1F8TL 1KEGH 5C8JA 3GSXA 2V2WA 5CS7A 5IBUG 5ACMA 5KSBB 5MEPB 3GI8L 5DK0B 4NM8H 4FQJL 4O2CB 3VRLE 3DGGB 1ZANL 4EUPA 3MROB 3RIFF 1EEUA 2A83B 5I1KL 4LCCC 4P4KD 1MFDL 3P0YL 4JFEE 1A3LH 4FZ8H 4G8FA 1FN4B 3ARZA 2ZKHH 3O3DB 4S1DD 5IESL 4C54A 1X4YA 2B5IB 1X5IA 4NWUL 4P5TB 1LEIB 2XIDA 3MJ9H 3SDCC 1WSST 2G9HB 5IW1B 2AV1A 1UKQA 1AGCB 1YA5A 4JRXB 4LIQE 1LDPH 2DQIH 1G6RB 1OAUL 4QOKD 5J11B 3L5IA 3KPPA 4ZTPH 3NCFB 4M93C 4OFDA 4AIZB 4H25A 1NSNL 1GZQB 3HMWL 1BZ7A 5LXGH 4MS8D 4PBWD 4ENEC 3SKOB 1EGJL 1YECH 2R0KH 3ARFA 2OYPA 3SGKC 1CDYA 3T65B 1I8LC 3FONB 4IRJB 4Z7UA 4UAOB 2EDWA 4JZNA 5JOFB 1Q8MA 2OTPA 2FIRT 4J8RA 2DD8H 3BW9B 4KHTH 4XBPB 3HZVA 3VD4A 1LO5A 5KANG 4JGJA 3D3VD 3WDJA 4LDEB 3VXSB 1RULL 2EE9A 1JNLL 4E9LA 4KKAD 1A7PL 2X2YA 4NZJA 5T3XE 3DVGA 5B38G 5CZKA 1KFAL 3EDJA 2VABB 1T5WA 4NUJA 4YHOL 1XR8A 4TQEL 3Q3GB 4G7YH 5JDJA 2CDEA 2RR3A 5JHDE 1I1AC 4LHUB 3BKMH 3UTZA 5DC0A 5DEFA 5LCVL 4J2XA 2BHYA 2XA8L 2EDLA 2NQCA 4LPVA 2BZDA 5F9WB 5LGJA 1FCGA 3KYOA 2P8MB 1P4BH 3SO3C 4P4RA 2VE6A 2XOTA 5GSVA 5HI4C 3G6DH 4JY5L 5KAQG 1YEHL 3SDAD 3EOAB 3NACL 2WWKT 1HSBB 3CSBA 4BFIA 3E8UH 1S9WA 4QRPE 2DM2A 1F4XH 5FV1L 5KJRL 5F89B 3TT1L 2ZNWA 5KVDL 4KMLB 4C4KO 3HE7D 5J7CC 3H0TA 4X7CC 4A6YH 5D2NB 4HCRA 4Y5VC 1HHHA 3V5KB 5I75B 4FQ2L 4LARH 1T03L 1E4XH 4LMQI 5ENWA 3ZE2E 3MR9B 2FJFA 5F7KC 5BOPA 1CTNA 1IM9B 3JTSA 4X8XA 5D7IB 3T0DA 4LLDA 1RIVL 2VXVH 4YO0A 3OKLB 2QHLA 4K3GA 5EO9A 1S7WA 1NCAL 1S7SB 2J1KA 4OFYD 3L1OL 3B2UD 3O9WB 5ESAB 3WEXB 5DT1L 1Q38A 4GG6A 3OKOB 4YBQC 4ODUA 1DANT 4X7FC 3QRGH 3NFNB 3F12A 2W9LA 1NDMB 4XPHL 4OJFH 1ACZA 5I1LA 4XI5D 2YR3A 5DHYB 1SQ2N 4XVSH 4B50A 3SDXE 3V95A 1I85C 2UWEF 5MEQB 1B0GA 1DQDH 3ZE1F 4K94L 3MGAA 1AD0B 1OAQL 3U0TA 4WCYL 4AL8L 3VCLB 1J18A 1X5LA 3S6CA 1QD0A 4GW5B 1A6PA 5FA3B 3GIVA 4JHBA 4Z7NE 1JHKH 4IEFB 4DKDC 4QOKE 3DVIA 3GSUB 1U3HC 1CF8H 2OL3A 3QO0A 1MF2L 2ATPA 4NZRH 4HC1L 5EZLA 3EDFA 3AS0A 1IQDB 3MLZH 3KPRB 3HI5H 5A2JH 5HD8C 5F6HJ 5I17A 5DJ0B 1MFCL 1N59A 4F57H 4OGYL 1C16A 3GMMA 1QFWH 5GHWH 5D1XC 2CKBA 4LHJB 3WUWB 2UVFA 4NO3A 1AQKL 2CRZA 4HUWA 3IDJA 1NEZB 4MB4A 4K9EH 4WY7L 1EMTL 3UC0H 3E6HA 1N7MH 3RL2A 5BJTA 4F9PC 2WUCH 3CFKA 3EYSH 5F3BB 3OF6D 2DQDL 4Z7WF 5GGSY 4YHPB 5IFAL 3D3VE 5GJTL 5JR1H 4P23A 5FYJD 1CICD 5FDYA 1YNKL 3N1MC 3T0ED 3W2DL 3CFBA 3WE6B 3SQOL 2CK0L 1PEWA 1IGIH 1ED3A 1FFNA 1OF2B 4Y1AD 4GMTH 1KEMH 4MJIE 1B6DA 5GGQH 1TPXC 4AH2B 3O3AA 1XCQB 1EEYA 5C0RL 3NA9H 1A9BA 4PV9B 4QRQB 1DVFA 1X6NA 5IB2A 2QTEA 4ODSH 1WWAX 3BH9A 1MCSA 2J2ZA 4HPYH 1G7HA 4G6KL 5F6IB 3QEGL 4BELD 1T0NB 4WO4B 1T7WA 2OTWA 5EG6C 5ISZB 1HYRC 5J06A 4EOWL 5IB1B 3L6FA 1H8NA 2CO7B 5D4QA 1JFQL 3TBSA 3ES6B 2CGRH 3LKQA 4OZIF 3D2UD 2BDNH 1A14L 5HXMA 4NO5A 4XZUB 4LPWA 1KLUB 5K59F 3LQAC 3VXMA 4ODTH 2BSRB 3RWJB 3QHZH 4O51A 4LCYB 5I1CL 1OGTB 3MRQB 2Q86A 1HE7A 2Y9RT 3S4SG 2QQNH 3CD4A 4ETYA 1KPVB 4CRPA 4Q9BA 2DI8A 2DJ4A 5I74B 2HN7A 5EC2A 3ZMRA 4BM7A 2DQUL 1GXEA 3D1MC 2QV2A 3RTQA 4P2OA 1SYSA 1Q9WB 5E8DL 3SGEH 1BJMA 3QUML 3JV4A 3FO1A 4J3WA 1TVHB 4PRNA 3KYNB 3QR2A 3RU8L 3G5YA 1VACB 3RWCB 4XP4H 1JNNH 5B4MC 2AJUH 1JPSL 3DBXA 4W6YB 4TUOA 2QSQA 1MFAL 5D2LF 3B6SB 2IADB 4NQEB 2YXFA 4MAUH 1LP9B 3QUZC 1DQQB 4DZBB 4RMUA 4X7TB 2DLTA 4LVNB 2XPGB 2HFEB 5IQ7L 1QVOA 3C60D 3PXHA 4YC2B 4AIOA 3QDMA 2WANA 4UU9A 4ELMF 3MUJA 3QBTB 5I1JH 1VFBB 1KEGL 2XKNB 4OZHE 1UJ3A 3R0MA 3G08A 2Z93B 1KTLA 4NM8L 2GJZB 2IF7A 3L3OA 5DJAB 2PR4L 1VESA 3HMXH 1O0VA 3QH3B 3BZDA 5C2BH 4HV8B 3KAAA 4JDZB 3FT4B 3KLAA 1Q0XH 1T21A 1A3LL 4FZ8L 4UV7H 4ZUVB 4EN3D 4JQXC 3LZFH 3WV0A 3VRJA 1DQML 4J3VA 5IOPB 3ZT7A 5K9OA 4U1HA 5CUSH 5C92A 4LAQH 4M5YL 4F2MB 1LO3H 3T0EE 2A83A 5BZDA 4L8SA 2ED8A 1JYWA 4A6YB 3V0AC 4PRHD 2GFBB 3O8XD 1LDPL 2DQIL 4TNWF 2XTJC 1YQVH 1AO7B 3CSYB 1T7YA 2QHRH 4ZTPL 4Y1AE 2NYYD 5HHPB 4QXUH 1YZZA 4X4XA 3OR6A 3IDNB 1LEIA 1TNMA 2H3NA 5LXGL 4C83B 4JAMB 5HHOA 1T1WA 1OQOA 2D4FA 2WQRA 5JZ7D 1YECL 3NFPA 2R0KL 4HGMA 4U1KB 2X1PA 2XV6B 4H8WH 1UEYA 4DW2L 5F88A 1OLZA 4OBSA 3X12B 1J12A 3MOQA 5CEYB 2DD8L 4R6UA 1RZ7L 4KHTL 1SJHB 2NY7H 3AB0C 4M48L 5EZOL 2EDEA 3FCTA 1H3GA 3MV7B 5CEZH 4KKBC 1D5BB 5EULV 3T65A 4N0CD 4RAUA 3MJ8A 3BPNB 4RNRB 2HT4C 5JOFA 5BVJB 4AQ1B 1FNSH 1RVFH 4Y4KC 3BW9A 2UUDH 2Q8AL 4G7YL 5E6ID 4H88L 4DUVA 1U8NA 3BKML 3W82A 3BO8A 3VXSA 4LSTL 1L7IL 3F5WB 4QCIB 4EI5C 4X99A 2J8HA 1I4FA 5FHAH 5INDB 4AM0B 4U6HA 1P4BL 3HE6D 5IMKB 4WW2A 1PG7H 5CJQL 4DN4L 2BNQD 1SMAA 1IAOA 4G6JH 1YN7A 2R9HC 2YD7A 5IKCA 2CLRA 3E8UL 3IJSB 3PV6B 1F4XL 2JTDA 3ULVC 4ODWA 3DO7B 3QYCA 2PF6A 4A6YL 1UZ8B 2XG5A 2Y23A 3V6OC 2GUOB 4LARL 1X7QB 2BC4A 1E4XL 3TVMD 3QDGE 3TC9A 5SWZB 2VXVL 1A2YA 2M26A 4NDMA 5B8CC 5KVEL 5J56B 4HHAA 3CIQA 3REVB 4R90H 5L0QC 4GRLC 2FO4B 2MHAB 3MNZB 1FYHB 5FOJA 4NO0D 1S9YB 4ODHH 2W07A 1T2QH 4QO1A 3FRUA 2CIIB 1TJHH 2JF1A 2X4RB 3BGMB 4BSVB 4PRAB 1KB5H 3MR9A 5IUSA 3L3KB 2VDRL 5EO0A 5D7IA 1ZT7B 4OJFL 4NN6B 1BQSA 2HTLC 4XVSL 3H9HB 4FNLH 1UM5H 3VFGL 1NUFA 5DJZA 1S7SA 4UTAH 5T5NF 2MPAH 3ISWA 5EWIH 4P2QB 1T66C 5BQ7A 5FM5M 1EVTC 2NY0C 2DI7A 5BMFH 3PWUB 5JW4M 3ULVL 3PGFH 1N0XH 1WWWX 2VDPH 2DJSA 2H2SC 1OAXH 1CF8L 2KKQA 5EC1A 4JHZA 5F96H 3SCMA 5MHSD 1J0YA 4G42A 3E2HB 5IV2B 3D0LA 5IVOA 3ZL4H 3MLZL 4PLKD 3OKMB 3GSVA 2X4QA 3TBVB 1UADC 1TQBC 3HI5L 3STLB 3PWPD 3GMPB 2YS4A 4P2CG 1AD9B 3BJ91 5C08D 4F57L 4TSCH 1XZ0B 1ZK9A 3KXFB 4PJ5D 5EH1A 5KN5A 1QFWL 1A7OH 3QXWA 1RZKH 4URTB 4C56A 3GKWL 1MCOH 1F2XK 5CP3A 3D9AH 3GNMH 1BD2B 3ARRA 3TCLA 4K9EL 5C09D 4HIXL 3TPUA 4XXDB 1N7ML 2NY6D 4QRRE 2GJ6A 2B4CH 4JREC 1NCCL 3EYSL 3NCJH 4L3AA 2CUIA 4AT6A 1PD6A 1I8MA 3L5JA 4N0YH 3UX9B 4K23L 1G0DA 1CU4H 3N0PB 3LSOA 2H2PD 3L5XL 3DROB 4OIBA 4WHCA 1IGIL 3QULB 5GGVY 3WJLC 4RDQG 2Y72A 1PX4A 1S7RB 1S5HB 1HSAA 4N8VB 1JTTA 1KEML 4GMTL 4P2RE 5GGQL 1QR1B 3U2SA 3W0WB 3A6OA 3GSNA 3NA9L 1MCHA 2AS5M 3RVXC 4Y16B 1H3PH 4HPYL 4UQ3B 2DL2A 4JN2B 4YPGB 1XAUA 4X6FB 3M1BB 3QG7L 3I6GB 4JG1H 5D71H 2E7LC 2EDTA 2UWEE 4NPYB 3ZE1E 3TBWB 5ESQA 1XCQA 2BNQE 3VGEA 3VDCA 1YMME 1YNLL 3QISA 4PJFA 2B8OT 3F58L 1J7VR 3RZCB 2ESVD 4LRNH 1KCRH 3HB3C 4FFVD 4PJEB 1QP1A 3HRZB 1CFSB 2Z92A 3FB6B 4XPAH 2C7UA 5K33A 3KNBA 4RMVA 3MRLB 1E6OH 2X5PA 1CLOH 3QXDA 1DN0A 3QUXB 3B9KD 3TT3H 5FEBA 5LG1A 1NMBH 3QQ3B 3NPSC 1FP5A 3G6JB 1U2CA 3QIBA 3TO4B 3WLWC 4X83A 3NN8B 4TTDC 1DFBH 1RZIA 4ZAKD 5BW7A 4DQOL 3GEWB 4OLWH 5DUBA 5FUCC 1MWAH 3P4NB 4K55A 2APBA 3ARGB 3OJVC 3U46A 3CX5K 4N0UB 4JKPH 4YXLH 4Z7VF 4NRZA 1JYXA 3O4LD 43CAB 1HHIB 1PYWB 4UNTA 4EVNB 4Z7WE 3RWGA 3W39B 3QZWB 2H41A 4XP4L 2F74A 2AJUL 4L9DA 2E9BA 4PG9A 5C71A 1NBZB 1AGEA 3FOMB 2FZ3A 4HT1L 2H26B 2X4PA 5IFJA 1M7IA 2VZTA 3SDDB 3U4EB 1ZT4B 1F11A 3CH1B 4QF1A 3RDTC 2VLJD 5MHSE 5I1JL 4O2FB 3H9YA 1O7SA 4CMMA 2EZ0C 1EHXA 2DQFA 5C0DB 4LDLB 3UTPD 4I13B 3NTCH 2VDOH 2Y5TB 4M62L 5I73C 1LP9A 3PWPE 4DZBA 1DBJH 3ARBA 1QFWI 1T89A 3HMXL 4NQXB 3C5JA 5SWQA 2DQHL 3GMNB 5C2BL 1G0XA 2W9EH 3ARDC 4NQCA 4ZG1A 5E00A 1T1ZB 4UV7L 5LGHH 1JWUB 1P6AB 1U3ZA 5C09E 5GGUB 3LZFL 4OZIE 4G9FB 3FTGB 1QEWA 2JB6B 5DF0A 3LMJL 3SE4C 3VXRA 4OV5A 4PRPD 5K59E 3HA0A 1HCVA 3QH3A 4LOUC 4K3DL 1DBAH 3R06B 5HYQB 4G8GD 4OCWH 2FB4L 3IS0X 3P0GB 4CNIB 2IPKB 4Z7UF 3WHE0 3N1FC 2BFVL 1N2RA 2MQCA 4K3HA 4ZUVA 5EUOB 2WLYA 2QHRL 3RVWC 1UXSB 4OZ4B 4LHUG 3EYQC 4JDVB 3P77B 2CJUH 5J57B 1U9KA 1II4E 3ZDYF 2YPLA 4HLZG 4N9GB 5I9QB 4N0FA 3QFJD 4YXHH 3ZT5A 2CLZB 4KUZH 4XPGH 4WWKD 5FUOL 4PJ8C 3AUVA 5AUMA 4RA0C 4QWWC 2P8PB 5D5MF 4HGKC 2AJZB 1A7RH 1S7QB 5HDQH 3ZHDA 5D2LE 1KB5B 3MXVL 1F5WA 3CDCA 4HMEA 1FVCA 3DXAA 3QPXL 5KSAA 3G04A 3DMMD 4APQA 3OJDB 2OX5A 5ELIA 4GBXC 2ESVE 32C2B 3V4PL 4AJ0A 4YDLB 1SY6L 4TSAH 2DLGA 1R24A 4X5WA 4ELME 3ZT6A 1FNSL 4OFKA 3I9GL 5DRZB 1I75A 4WDIB 3N9GL 1MAMH 1QSEB 2HT2C 4HULB 1D5MB 4L1HA 5D1ZA 2FATH 3TN0B 4PJ9A 3MV7A 4NSKB 2A6KB 3VH8A 1JPFA 2QQLH 2P24A 3DHJA 3SGEI 1AC0A 5FHAL 2VKXA 3O4LE 1PG7L 1KLGB 3OXSB 1IGTB 4G8EB 3ZKXB 2IALA 4YXKH 4NHCH 3ULUD 5E2TH 35C8H 3JTTA 2FX7H 4QCIA 5HYJB 2O61B 3IDIA 3WO4C 3X11A 1KIQA 4QLRA 5HHVH 4LCWD 5FECA 5INDA 3IXAB 3N06B 4AM0A 4OAWB 2ADFL 5IMKA 3VDAA 1DQJA 2B0SH 1JK8B 3DURA 4Y4FB 1FH5H 3RGVD 4JM2D 2VLJE 3LKPB 1YYMH 2P8LB 1OCWH 3MJ7B 3PV6A 2EXYC 4I0PA 4GXVL 1PQZA 3FFCE 3OHXB 3ROLB 1U3YA 3M07A 1ZWIB 4RMTA 1UYWH 4EXKA 1BFTA 2OSLB 1ZLSH 4PYHA 4ODHL 1KC5H 1EPFA 1WFTA 4U0QB 3WUWG 1NGXA 1TJHL 3MV9D 1BVKA 1NEZG 1YEDA 4WEUD 2WBJC 5SWZA 3GMOA 4YEEA 3H3KA 5HVHC 4FNLL 1UM5L 5F8QC 4JFPB 2MHAA 3D6GA 2CMRH 4L8BA 4PRPE 1GGYA 4UIMB 2MPAL 3RPKA 5EWIL 3ZKND 3BH8A 1SEBA 3FKUS 1NC2A 2ZOLA 1P4LB 3BGMA 3H3PH 5L2KD 4G8GE 2NXZD 5BMFL 1N0XL 2LVEA 1P7HL 2ZUYA 4RWYH 2VDPL 1OAXL 4E41B 5DEZA 4D0BB 4NT6B 5TH2B 5TE6L 4P2QA 2P5WB 2X7LA 3BEWA 4Y4HA 5DFWH 4J3OC 5ID0B 2OR9L 1FE8H 3QQ9C 4K8RH 1MWAB 3TZVC 4XNXH 4FQXB 2FH8A 4DAGL 1F2QA 4IMKC 4Y2OA 3VGHA 2EDOA 1AXSA 4IIQA 3UBXA 3D9AL 3DVNB 1P5UA 5K9JH 3EYVA 2A0LD 3F62A 5FA4A 3GMPA 5KS9B 2B4CL 2F8OA 1RJZB 3NCJL 4F7CA 2RGSA 5C0EB 2R2EA 1NFDB 1ZVYA 4NN5C 4MHHI 1CU4L 1KIPA 3S36L 1CXEA 3AFLA 3CVIL 4N8CH 3ZKSD 1CIDA 1SBBA 2HJKA 5INCB 4Y89A 2FX8L 4KDTA 5CEXA 3DPBA 4F80A 4U1LB 1HEZA 1OSPH 1SJVA 4ZDHA 3QIUD 5E4IA 3VFTB 3FRPG 3VFPB 1JWMB 1I7TA 3RNQB 2HKFL 5HVWA 4M4RA 5CZVH 1VPOL 5D71L 2WWKO 5DO2C 1NCWL 3BIAX 4FMFA 1BAFL 2OBGA 3CXHK 3JV6B 1J8HA 4LRIC 1AKJA 1BHGA 4F58L 2P7TA 1YN6B 5BV7C 4JE4B 1YMHB 4MAYB 4XPTH 4JN2A 4KK6C 1AHWB 1HHGA 5F7LB 4LCWE 4KV5F 5IVZB 4GKNB 1NLDH 3QEUB 4XPAL 4HDIA 2J8UB 1PW3A 4NPYA 2VRAA 1EAPB 1E6OL 5SV3A 1K5NA 1UGNA 3QIWA 5D6CA 2HRPH 3RIAF 1NMBL 1EBAA 1J8KA 2FRGP 3QEQB 2X42A 5D7KD 5AZEH 3RZCA 4ZOAA 1DFBL 1WTGT 4QGTA 1EAJA 4HUMB 3BPOC 1MCNA 5I76A 3MRHA 4OLWL 4U3XA 5DRNB 1T0MB 3T8XB 1MWAL 2WP3T 4XBEH 1IGFH 2OTUA 3GMRB 3O45A 2CSPA 4YXLL 5DVKA 3CZFA 5EIIA 3BZFB 3QUXA 3GJFH 4WHTA 4YFDB 2A6JB 3MV9E 3F6LA 3REWA 4GXUM 5IMOA 3TA3D 3QWQB 3IFLL 1SEQH 3GDBA 2R56H 2VZUA 2IFFH 3DRTB 1DBBH 3ARFD 3AXLB 1OPGH 5IB5B 4UOJA 1Z6JT 3PDGA 3OQ3B 1QHPA 5AWNH 4WWID 2NMSA 3CFEB 4NQDE 5BV7L 2VLLB 4HIEB 5L2KE 5GZOC 1LNUA 4NOBA 1K6QH 4JLRB 3DJ9A 2IWGA 4LIQH 5DUPH 1NBZA 5D8JL 3GBMH 3FOMA 4R7NA 4XP9H 1IGJA 3WFDH 4L3EB 1C5DB 4Y19A 3NTCL 2VDOL 1YEFL 3O2DA 4R4ND 4JO4H 5JO5B 4AEHL 5CHNA 1DBJL 1R5IA 4POZD 4MWFA 1B2WH 1YPZB 1MJ7H 2Y1VA 5IK3B 3EYFA 1PZUB 4PD4J 1JF1B 5TQ0H 2W9EL 5C9JA 3ILPB 2K7QA 2AEWA 2KZWA 5FO7B 5LGHL 3BN3B 3S8WA 3O6FD 5JDSA 2R1XB 1ODAA 4AYFA 1CDUA 1EFXA 3SJVD 2J4WH 3GMNA 4YPJA 5GJSH 2X9YA 5J9PB 5E2UL 2VDMH 3LKOB 2R1WA 3FTGA 4PJXA 1F6AB 2CJUL 1A6VH 1KPRA 4Z7VE 3WHXB 2P5EB 1TQCB 4YXHL 1IILE 1NLBH 4KUZL 5I30H 2PO6C 1UB6A 4AG4H 4NC1E 2DQCH 3AS2A 1OP5H 3WCYA 5GGVL 4X9BA 4BZ2H 1A7RL 3BKYL 5J89A 3UJIH 5HDQL 5F9AC 3TBTA 4U1MB 3O2WL 3RBSA 1NBQA 2FD6H 3N85H 3T3PF 3T2NH 2BK8A 2SEBA 4JGMA 3TIEB 3WJJC 2VIRB 2P8PA 5I1GH 3C6SA 1H3VA 4TSAL 2DKUA 5HHQB 4WW2F 1MH5B 1KJVA 1D5XB 4GO6B 1MAML 5TDOA 3JBG7 5JPMB 2OJEA 3RY6C 4F15B 4X4MA 3MRFB 5EZJB 2QQLL 1YNTA 1GH7A 3OKKA 2V9QA 4NGHH 5DRZA 2G60H 1UVQB 3BDYL 4KK9D 3NBNA 1U42A 3C09B 3ALXA 3PHOA 4HUKB 2MQ0A 1DLHB 1I1YB 3NA4A 1H5BB 4R96B 4NHCL 4NSKA 1Z5LB 3DUUB 5GZNC 4ZOBA 2C3XA 2IH1A 5J13C 1KV3A 1MUJA 2R23B 4LLWB 4Z7UE 5HHVL 4Y5VB 4ZO9A 1T80A 3WN5C 5BO1H 4XX1G 3UTTB 1FH5L 1IGTA 2VWEC 4LSPH 3P4OA 4OQTA 1HINL 3ZDYE 3GK8H 2YPKA 5D7IF 1RAMA 3GB7B 4P23D 3UJTH 1PKQA 5HGHB 4KTDL 5HYJA 3KDMA 2IH3B 4GRMB 1C1EL 5HBBA 2IAMC 5D5ME 3IXAA 5CSZB 1HILB 3PGDB 1JK8A 1T3FA 3NGBC 4LCUB 2XWTA 4MXWH 1UYWL 5J1AB 1NAKL 3SKMA 5MENB 1KC5L 3L7FA 4CDGC 4RZCB 4G6MH 1WFOA 3O6MH 1TXKA 3GSOB 1T83C 3T08A 2P8LA 3OJMB 1XF2A 3TO2B 4QRSA 3WIHA 3RHWK 3CDGA 3V5HB 4I77H 5JTWA 3ROLA 3U30B 2VLRB 2CMRL 1XIWB 2W0FB 2EDYA 3P9WB 3C5ZB 1MIEH 1YEEH 5I8EB 4PIRF 3SJVE 3H42L 2GKIA 3MRKB 5FM8A 1I9JH 2YN3A 4N8VG 4YDJA 4OZGA 3DUSA 1IL1B 4NUGH 5SX5K 1TETH 1MHPH 2PYED 3C5SA 5IEHB 4O02H 1MJJB 5DMYA 1IQWH 5D1QD 5D7LB 3V6FA 1AY1H 1RK0B 3GI9L 5MI0B 4POUB 4I9WD 4K8RL 3QI9D 3ARPA 1LEKA 5HY9B 4XNXL 5DC9B 1T22A 3GJFB 3QUYB 1A47A 2BNRD 4RAVA 1I9RH 4X9HA 2P5WA 4F8QA 3UZQA 2NX5B 1HK6A 4WUKH 3VG9C 3SOBL 3PQYA 2WK2A 3LD8B 4JFEB 4U6YA 3QXAA 4JFQB 2H32B 3OAYK 3NCBB 4FQXA 1CT8A 1NJ9B 3BD5A 1OW0C 1VGEH 4N8CL 5JA9A 1VCAA 4JFXA 3GSRB 3KYMB 1TPXB 4WFGD 4PY7B 5GRXG 5C0EA 4PJDA 2ZG1A 2VQ1A 1JPGA 3MBEC 1G7MB 1N5YH 1TMCB 3MV8A 4ZXBB 1BMGA 2VOTA 5HI5D 3ROOB 4XC1H 3PHQB 4NHUA 4I48B 2X4OA 2YUZA 1QFUH 1T6VN 3OPZH 1F3DJ 3VWKD 2X10A 4M03A 4NKOA 1UB5B 4U2YA 3T0AA 5C0AA 4CVUA 4MJ5B 3VFWB 1A6TB 4WTWA 3K46A 3LEXB 5FUZH 4UDTA 1FFRA 4XPTL 4Z0XA 2E5EA 3FT3A 4MD4B 4G8IB 1A1NB 1WV7T 2A77L 4RX4D 1NLDL 3W5NA 1SBSH 1D9KA 3TH4T 4K3EL 5EBWA 3W11C 1JP5A 2C1OB 2HRPL 4X6DB 2YPVH 3LRSB 4Y7MA 5AZEL 1ORQA 4Y5XC 3QEUA 4NQSA 2I60H 1IGFL 4G80B 4OZFH 1KJ3H 1FZOB 4X5XB 3WNOA 1A6WH 1CE6B 3ULSB 3RL1A 9CGTA 3WDHA 2RCSL 4QHUA 2ITDA 2H8PB 1W0WA 2EH7H 2HVKA 5J6HB 2VZ1A 3CVHH 3QPQD 4JRXD 5A16B 2AXGA 1DBBL 3CC5A 4FHBD 1MEXH 1BVLA 1R3JA 1PSKH 1OPGL 1LP9F 1XGYL 3GMRA 1UFUA 4GS7B 1RZ8A 2Y07L 3UTQB 5ACZA 5JQ6L 4H1LA 4ZTOH 3IDUA 3AREC 5C70A 4LMQE 2A73A 1I8KA 3SO5A 1MAKA 3AXLA 1OY3B 4LSUH 4LIQL 4IRJD 5DUPL 2PYEE 3GBML 4NKDB 5JIHA 3WFDL 2Z8VC 3MCKB 4M8VA 4JO4L 1KNOA 2VLLA 1HOCB 2EEBA 3PL6C 4I9WE 1B2WL 1U8HA 4Y8AA 4NWTL 3VXSD 2C3WA 5TQ0L 5D96C 2BVOA 4BH8A 4F7EB 3U83A 5GS2H 4KV5E 2DWDA 4PREB 3RP1A 2VSCA 1AGDB 1F3JA 1DE4A 3V7AG 3ECBA 1OTUC 2NZ9D 1HH6A 3CLFL 4IDLA 4LCCA 4HH9B 4LHUD 5H94B 1QLEH 2D7TH 3WFEH 5DFTA 2J4WL 4YDKH 2EYSA 5GJSL 2DS4A 1LO0H 1UH2A 3IDMB 4DEPC 5C07A 1I9EA 2F8XC 5GS0L 2E27H 1WZMA 4KMTH 2MFNA 4WFGE 1A6VL 3SDCA 4JVPA 5AYQA 5GS1B 2DB8A 1FNFA 1NLBL 4XCYB 5I30L 3KYKH 2EE6A 3ET9F 1AJ7L 1N64H 3K81A 4JKKA 4P9HC 4AG4L 2H6PA 4P4KC 1HYSC 3PWJA 2D7MA 4TUJB 3CCHB 4BZ2L 3H6JA 3M8OL 5DZOA 3UJIL 3PJSA 2XFXB 4RCAA 4S1DC 4ZPTB 4HIHB 2VLMD 2BY3A 3JWDH 1NFIA 4MJ2A 3ZHLA 3N85L 3SGKA 3T0BA 1I8LA 1IM9D 5BZWA 1MJUH 2VH5H 5I1GL 4OI7A 4XCEA 1M7DB 3HUJA 1B6UA 1NCTA 2E8YA 3MA7A 5DJXB 2E6PA 3MNWB 4FOMA 1YUHA 5DRWB 4TNVF 4E5XB 1DUYB 4NQUA 2Y7QB 4NO2B 3I02B 2AABH 2AVGA 2CDFB 5GRVK 1DEEA 4RBPK 4MS8C 4I3RH 4XAKE 3TIEA 2VIRA 4TPRH 5HGAA 5EU7C 3SCMD 1BIHA 4MJIB 1ETZA 1RU9H 1W0YT 4NGHL 1D5ZA 4NKMB 5CILH 1RIUL 2G60L 4EKXA 1S5IL 3L3HA 1I1AA 3HNVH 2E3VA 5HHOE 5HDOA 4I18C 4JRXE 4P9HL 5T1LA 4U7MA 3LKRA 4M1DL 4Z0BL 1OHQA 4YHZL 2CD0A 3DYMA 1GC1H 2HYMA 3BUYB 1DDHA 2H9GA 4KKAC 3KPRD 3BESR 2BOCB 2CDGB 3KLHD 3QQ4B 1TJIH 4MDJB 1LILA 4R96A 3GK8L 4TVPE 5F1NA 3UJTL 5JMRA 1JHLH 2IBZX 2NNAB 1G7JB 2WV3A 5L0QB 2ZUQC 3QXUA 3SPVB 1CDJA 4XP1H 1P2CA 5TE7L 1HQ4B 1FIGH 3VXSE 1NAMA 3VE0B 4ZFZA 2AXFB 2NW2B 3Q6FA 3BIBX 3NZ8A 4FA8A 3SDAC 3T3PE 2DTMH 2NY3B 4YUEH 4HWBA 4U1JB 4NFBA 5DD0H 1Q9LB 1RZJH 1OM3H 1H9VA 2FHBA 3HE7C 2FIKA 2WQ8A 2NPLX 3PGCA 3IETB 1N26A 1FSKC 5DR5H 1A6AB 2YOCA 1I9JL 3QG6B 2V7HA 3KJ4B 1I85A 1BBJB 3FB5B 4Z5RB 1TETL 1MHPL 2PTTA 4WO4D 2X09A 3MACH 2VLRA 1TQBB 1BZ9B 3E1F1 4PJCB 1WZLA 5ISZD 4NFDA 1IQWL 2AK4A 1R3HA 2I9TA 2GHWB 1JZ6A 1TZGH 4J4PD 3LIZH 1U3HA 3L3JA 3DX9B 1OAYH 2BSED 4OZFB 4H5SB 1BOGA 4LF3B 3STZA 4XI5C 3D85A 1QNZH 1Q9KB 2QR0A 4K7PH 5I8KH 3ARVA 3CVHB 3NVQA 4WUKL 2XI9A 5I1DA 2F58H 3CFCL 1L9MA 2GAZA 4GQ9H 4KK5D 5D1XA 3TNNB 3JUZA 5D7IE 5EU6A 5ADPL 3IB4A 5DVLA 1VGEL 4B53A 1A3RH 2P45B 1T2JA 3MLUH 1HKLH 4F9PA 2AV7B 1RJLB 1T1YA 3ZYJA 4KRNA 2D7PA 1Z2KA 4MD5B 1IAII 2H32A 2Z91B 3T0XA 4YGVB 3MLTA 1N5YL 1NJ9A 3TNMB 3MRDB 4XC1L 2ATKB 1FO0H 2BCKA 4QTHB 3OPZL 4NQED 3K80A 2NTSP 1HHJB 1ZHLB 2HJLB 3KS0J 4PV8A 4HJGB 2YSSB 2ITCB 4LEOA 3QUMA 4K07A 2OQJB 4F8TA 5FUZL 2JELH 2X89D 1A9EB 2YMXL 1GZPB 3ROOA 5B39A 5EOCH 4C56E 3T0EC 1FV1B 4YBHA 1JYNA 5HYEA 3MFFA 1F13A 2HP4A 1SBSL 3BRFA 3QNYB 2CLVB 1MFEH 3G6JF 3B2VL 4PRIA 1E4WH 1A6UH 1BLNB 4ODXA 4Z95H 3FFDB 4KJWD 2VERN 2Y36L 1LE9A 4E0RB 3ZDZF 1A1NA 4JO3H 1XR9B 4O2EB 4H26A 5DS8A 2I60L 1YY9D 4OF0A 4XNQA 5ILTH 1KJ3L 2KL6A 4Z9KB 1NGWA 1JMXA 1KACB 4KRPC 2V2TA 2C1OA 4NCDA 4JY6A 4X6BA 2EH7L 3VXTA 1DUZA 3S34L 4PP1D 4KI5D 3CVHL 4LPCA 4WJ5A 3QJHA 3HZKA 1S7VB 3HS0A 3T0WA 3LN4B 1MEXL 4XNYH 1AO7D 2PXYB 1FLTX 2ZNXA 1TJGH 5I16B 5C1MB 3AROA 2XACC 1T04A 2H8PA 3DXAD 5KSAD 4QHKJ 1KIUA 4RISL 3NPZB 4IJ3B 5F7MC 2Q7NA 3DECA 3RAJH 4Y5YC 1MCEA 4MQ7A 5T3ZD 4LSUL 4CU6A 2GCYA 1AC6A 3KPTA 5CKAA 1XFPA 2C26A 3QUZA 3VFRA 2ICEA 4U2ZA 4YNYB 2AKRA 1MNUL 3OSKA 1EHAA 3MUHL 3QDGB 4TULH 4MXQD 1FJ1A 3CX5J 4G43B 4JHAH 3GHEH 4M02A 2D7OA 3MV7D 2A6DB 4M5ZH 4Q9RH 5HVFB 1VFMA 4PJXF 4PY8J 1N5AA 2LQRA 1HIMH 3T4AB 4H20L 2JE8A 5DEGA 2C4FT 5E4EC 1G9NH 2EIZA 3LS5L 4HK0B 2EE2A 3MRCB 1QLEL 1N6VA 3VFUA 1NGPL 2D7QA 3VXPB 1JN6B 1LO0L 3BAEL 3SY0B 4JQXA 4AMKL 4O00A 1NC4A 3C60C 1MVUB 4BA8A 4PJ7A 1JF6A 4R7DA 4KMTL 2DL9A 3PDOA 2R2BA 1FFOA 3D5OF 4XMLL 5FK9A 4UNVA 4I4WB 3FB7B 3OX8B 1ZT1A 4BFBD 3PP3K 4HG4K 3T4YA 5IW6A 3MPCA 3KYKL 4JO1L 4YJZL 3S35H 4FFYH 4ELKB 2NZIA 1N64L 3CZJA 4OUUA 4GH7B 1LP9E 1JJUA 4EN3C 1WBXA 3QRFM 4LVOB 4OKDA 2P48B 4YHYB 1CGYA 2A2QT 2ADJB 3JWDL 3MGOB 1JE6A 1QFWM 4LCIL 4MQSB 2QSCH 4GSDH 3BISA 4NQCE 5SWZD 1X5HA 4GKSB 3KPOB 2AQ1A 4QRRB 3O8XC 3QNZB 3P0VH 3PNWB 5IVXA 4ZPTA 3CK0L 5DQJB 1FPTH 4LLQB 1U95B 2WP3O 2AABL 4F3FA 5HDBF 4WTZG 3V0VA 1NBYA 2MKLC 2GW5A 3AU1B 4I3RL 1DSFH 4L4TA 3PWLA 2DQJH 4TPRL 1M7DA 4P2RB 4Y4KA 4NZUH 1RU9L 3FO2B 1EDQA 5CILL 3RGHA 5HYFA 1IM3A 4P2QD 3VXUA 2FH6A 3HNVL 1XGPB 1E28B 1QA9A 4EI5A 3T77B 4X9IA 1AO7E 2UWEB 4YR6A 3FJTA 3IU3B 2XQBH 5HSFA 4LK4A 1A1OA 4OUOA 2A74A 4L8DA 5E70A 3EZ8A 1YMMB 3WFCH 5E24E 2G5BA 3DXAE 5D70H 1FC1A 1TJIL 3F7QA 2FL5B 4DGYH 2FHFA 5E6IC 1VADB 3KXFD 4EZMA 5T3ZE 3FQTA 2OP4H 3V9FA 3OAZK 3S97C 4KAQH 1R5VB 1Y0LA 4OGXH 5H37H 1MHHA 4XAWH 1BD2D 3UZEA 2P47B 5IM7B 2BOCA 3PABB 3V6OA 4IRSB 1I7ZB 4QT5A 4XP1L 6CGTA 1IGYA 1IKNC 5F1OB 4DUXA 1VSCA 3HE6C 1D6VH 3BWAB 4K7FA 3GM0A 3MV7E 2P1YA 1JI1A 4OZGF 1FO0B 4WI4A 5KVFH 5B8CA 1MHCB 3DETD 1ZLUH 4C58B 2D9QB 3WNPA 2DTML 4YUEL 3BP4A 5E99L 4GRLA 3F8UB 2D4DA 4JQIH 4YK4B 3UMTA 1RZJL 1OM3L 5L88H 1C08A 4WENB 5HGBB 3EYOA 3RJQB 3SPVA 3WKMH 3GSWA 5HPMB 1OGAB 3P9MB 3W0WD 2ICWJ 1HQ4A 3OKNB 4UOW1 1INDH 1C7TA 5DR5L 2PETA 4Y16D 2AXJA 1TZIA 1JNJA 1U8KB 8FABB 4R26H 5E9DB 4E42A 4PGDA 5FO8B 1OLLA 1CFTB 4NRYB 3F7YA 1TZGL 3SGJC 3LIZL 3RZCD 4CUCA 4NNXB 4IOFC 1OAYL 4U1IB 1C12A 1WTLA 5J1TC 1DZBA 5DI8A 2XZQH 5ITBH 1QNZL 1BZ9A 1MCWW 1P1ZA 3WFBH 2KQNA 3ZTJH 4L8CA 4K7PL 4PJDF 5EFIA 4ZUWA 5I8KL 2COQA 3QUXD 1FGNH 1CFQB 5F7WC 5KZCB 1K3ZA 2D03L 2NR6D 3TO4D 5SWZE 5FCUH 5K9KA 1MY5A 2F8VA 3NCYS 1A3RL 5I1AB 4M8QA 3ARGD 2EIBA 2G2RA 4KMQA 1HKLL 5CINH 5FAAA 2J88H 2N56A 3IDXL 3MV01 4YBLC 2YZ1A 2ZWLT 1YYLH 1VFAB 4PLKC 4BKLA 1EA9C 2Q8BH 4QHNB 4NJAH 5HHNB 3EYUH 3WJLA 2DYPB 2VDNL 1UXWB 1W0VA 1FO0L 3QEHB 1EHLL 2BRRH 4TRPH 3DTXB 4P2QE 1HI6A 4ZD3H 1U92B 3SDDD 5CEZD 2WZPD 2D9CA 1MCKA 5HYSA 4XX1E 2NY6C 1QR4A 4MD5A 5IW3A 5GGTH 5A2KH 5I71C 2KDGA 2JELL 3MRDA 1CFVH 5EOCL 2E7LA 1Z3GH 4Q0XH 1XGTA 3QFDB 1QQDB 1T20A 2EDJA 3U9UB 4QTHA 2H2PC 1QG3A 4NQVA 4KKLD 1HHJA 3ARBC 1ZHLA 2VAAB 4GW1A 4RFOH 4HUUB 1MFEL 4Z77B 4JFDA 1FL5B 2X1QA 1E4WL 4K71C 4V1DA 1WAAF 4M43H 4LDOB 5CD3B 3U4AA 5EUKB 3QAZB 5IQ9B 4ELMB 3BP6A 4JO3L 3RVUD 1BD2E 3Q6GH 1FZKB 2V9RA 4G9FD 2Y25A 4KZDH 3QNYA 5CBEA 2BVQA 2DLFL 2IQAB 2OLDA 3SGDH 4WU5B 2HH0H 3CXHJ 2R4SH 2ERJC 2VISB 4LL9A 4Z7OF 1OSZA 4XNYL 1U93A 1UZ6F 1TFHA 5ICZA 2F54A 3BOVA 1CQKA 1TJGL 4HS3A 3QDJB 4ORGB 4P59H 3W0WE 2J3SA 2DWEA 4XBGB 1RHHB 4HEPG 2YA0A 4FQLH 3B9KC 5FKAA 3Q1SL 1AE6L 4S1QH 4UIKH 4LEXL 4HS6B 4XVUD 1QTYT 3L3DB 4X9GA 5IIEA 1MELA 1HN1A 1XGRA 1QRNA 4XCCH 4CVZB 2YC1B 3IFOB 3F6IA 3M17B 4HX1B 3T04D 4JZJB 3VWJB 1XF3B 1LD9A 2C1PB 2VLJB 1YPZF 4TULL 3RDTA 3CGTA 4YHKL 5JXED 4JHAL 2FSEA 4LFHG 3GHEL 4RGMC 5GGSA 3FFCB 1GJIA 3GJEB 4M5ZL 4Q9RL 5KOMC 3LRGA 4LVHB 1R3IL 1HIML 5D72H 3S9DB 4HS8H 2DAVA 1G9NL 1NMAL 1QSED 1H0DB 4PB9L 3G6JE 1JBJA 2Y06H 4HXBH 5E1AB 3HPLB 4LSSH 4EUPH 2IPTH 2ZSVB 3TN0D 3ARDA 1MY7A 3H9SB 3TFKD 4PG2C 4U6XB 3VMOA 2IBZY 1SY6A 3ZDZE 4LLMB 1CGWA 2LABA 3SE4A 3TH3T 2X1XR 4PRBB 3BSZH 5DTFA 2DM3A 1GOFA 2UYLB 3MRCA 4P5MA 3TLRA 2YD3A 1UENA 1Z9LA 2VITB 2VLKA 2C9AA 3LKSB 2PO6B 3HUJF 3KPQB 2DIJA 4NOFA 3SY0A 1YDPB 4P57B 5HYJD 4FFYL 1AXTL 3KPMA 2AJ3A 4JB9H 2IANA 5E94A 4KDVA 4Y19E 5CZXC 3UPRB 1INQB 1FVEA 1RQ5A 4Y4FD 5CEZE 4I4WA 1U8MB 3RWFA 2XQYK 5GGRY 5HJ3A 5JIKA 4PJ8A 4LLVA 4N8PA 4WGVB 5DMGD 2QADD 4GSDL 4JFOB 3MRJB 4MA1B 1H15A 3WHE1 5E8NB 1LEGB 3C08L 2J5LC 5GSRB 1CGSH 3FQXB 1X9QA 1FPTL 1BX2B 3B3IA 4GBXA 4JY4B 4KJPD 1P9MC 4PP2B 1S8DB 4HD9A 4Q9QH 1AR2A 3D39B 1ZA6B 1QSFA 1DSFL 2FBJH 2FR4B 4NZUL 4G9FE 5I2IA 4R3SB 4PJXE 3VXOA 4WFFD 3VFNA 4NNYA 5DQJA 1M1SA 3GIZL 2W65B 2VL5B 2C3HA 3BQUC 1G1YA 1EK3A 4LLUB 3U7WH 4MCYB 1PVHA 3MZGB 3DMMC 3ZYOA 5J13B 1S78C 3PXJA 3PP4H 5H35A 2VMFA 3EO1A 3INUH 2LTQB 4E41D 4BFEA 2XQBL 4XCNA 1CD9B 4KK8D 2VDKL 1INEH 4ACPA 1U8OB 5HGDB 2JCCA 2P5WD 1RZFL 5J12C 5D70L 3IAPA 1KYOK 3OG4B 5ITFB 4HBCH 4DUWA 1E6JH 1G1CA 4HFWB 5F7DB 4MNQB 2UZIH 4IIQC 4WV1B 3U1SH 1S9KC 3HG1A 1TENA 4FQXD 3GBNH 1NDGB 1BECA 2DICA 3JWOH 2HVJB 2ARJB 4MA7H 4XAWL 1U8QA 1Z9OA 5TF0A 3WD5H 2VUYA 4HCRH 5TDPB 5E5MA 3VFMA 1CG9A 3O6KH 5C0CB 4HUXB 1JNHB 1AR1D 3V7AE 5KVFL 3E6FA 4X4ME 1JZ3A 1KJMB 3DIFA 4M61A 3RPIA 3ULUC 2FJHB 4BK4A 3RX7A 1MCCA 2V7NB 4AEFA 4DKFH 2Z31C 1ZGLB 3WSQH 4JQIL 2VDLH 1QSEE 4KH2A 5CBAA 4HIJA 4D9LH 3BWAA 5C0AD 1ZLVK 4XNZC 2ED9A 1CD1B 2WBJA 1ZS8A 3RGVC 5HDBE 4HKBB 3LN5A 1VFOA 4JM2C 2IBBA 1HDMB 4NQDB 2V5TA 2GK0A 3QUKB 5H2BB 4JDTH 5HPMA 1QSZA 4BK5A 5I8CA 3C8HA 3FO0H 5M7QA 1GGIH 4FTVB 3OKNA 4PJBA 4TSBH 3BD4A 2ZOKA 1ZHNB 1YY8B 1FFPB 1PKQE 5L8LB 4MAYD 5HYJE 3BFOA 5F9JB 2E7HA 2YD8A 2AAVA 2OL3H 4ZUUA 2VXTH 1CFNA 3MCLH 5F3HB 5ITBL 3WFBL 5FO8A 3P73B 4Z8FH 2YD5A 1J1OH 2NY4B 3OBAA 1FGNL 1G9EA 2R29H 5TF1H 4CVXB 2XWJB 3TZVA 1HQRB 3QEQD 5IGXH 2BOBB 5FCUL 4IMKA 4U1IA 2NXZC 4FQQA 2R0ZL 2CKBH 1I7UA 3L3IA 4ISVB 3UDWC 1Z0MA 5I6XC 4ZMAT 4KUCD 2BSSB 4ZUTB 1A4KB 1M71B 4PTTB 3RX5A 1NL0H 5CIPA 4UB0L 4M7JH 1NGYB 4NJAL 3EYUL 4OZGE 4Y2DB 4PGJA 1J0ZA 1NCDL 4YX2H 1R3KA 1JV5B 3HC4H 4OLUH 3GSQA 2BRRL 4Z7VB 4WFFE 4FXLA 3EJJX 4TRPL 4WI5A 5ICXA 2ICWB 4ZD3L 1QFPA 4CGTA 2KZ1B 3MRIA 4LP5A 5C8JB 1JTOA 3GSXB 1CFVL 1UXWA 4E41E 1Z3GL 4NP4H 3S5LA 1SJXA 3UTSA 3DTXA 4L3ED 2R0WH 2HLFD 2P5WE 4OD3H 4LRIA 4X6DF 4EUPB 5FB8B 4HUNB 4RFOL 4KKCC 4XNMA 5FYLE 4L3CA 4OSUH 4ZODA 5CCKH 4G8FB 1QZ1A 2DRUA 3JV5A 3QIUC 1IGCH 3DX8A 4F7PB 3HR5A 4ETQA 4Z6AT 4KZDL 3TWCH 5FYKU 1FL5A 2AV1B 3OJ2C 4NC1C 4QHKI 4PJDE 4F7TA 2HH0L 5CD3A 5DQDH 3MLXL 4HSQA 2O5XL 4R9HA 3KPPB 5IQ9A 5C0BB 2I07A 3ZO0A 4H25B 1VKXA 2I27N 3ZTNH 3X3FH 1BZ7B 4S11A 2ADGA 3CSPA 3VDBA 4LU5H 5DDHA 2G75A 3S3SA 3IU4H 5DWUL 5C0AE 1ZAGA 2WM0A 4ENED 2P5ED 3SHSA 5FHBH 4TOYH 4ZNCD 4Z7UB 1PG7X 4S1QL 4UIKL 4JZNB 2O5YL 4YHLL 2X4NA 1EUUA 1B0RA 1KCUH 1CVRA 4S10A 5C6WH 4NN7B 3FB8A 3BRDA 3HZVB 3G5ZA 5E6YA 1CXFA 3IJHA 4CAGA 3QSKB 4PBXA 1RMFL 3VU2A 4OB5L 2L7JA 3DVGB 5IP4A 1WCQA 3TA3C 1MLBA 1T5WB 4NUJB 5CJBA 3QP3A 4FS0A 5DVOA 4YAQA 1XR8B 1E27A 1LE5A 1XF5A 2CDEB 3UXFA 2YC1A 3IFOA 4ERSL 3MRNB 5C0ND 5D72L 4XVJL 5CGTA 2D0HA 3UTZB 5DEFB 5IBTH 4PBVC 3MLPA 1TTFA 2Y06L 4LSSL 2EKSA 1WAAE 4JN1L 5LGJB 3KYOB 3ARYA 1CWVA 4XMPH 1KT2B 4KTYA 4P4RB 2VE6B 5GSVB 1YJDL 4KTEL 1IEAA 3SKNA 4P49A 4K8RD 1KTDA 4BFIB 5E1AA 1CZ8H 1S9WB 4R4NC 5DK2A 3RWHA 4DZ8A 1S7XA 4POZC 4X7SH 3V8OA 1UH4A 3N1PC 3H0TB 3FZUC 5I0DA 3P30H 1HHHB 4LLMA 4Z7OE 3V7MA 1FAIH 3E3QE 4JB9L 5IVXF 4OCYH 2PTVA 1UZ6E 4FRWA 4LQFH 4DKEH 4PRBA 3UTTD 1NH6A 2FJFB 3O6FC 3JTSB 2UYLA 3TCXA 3OZ9H 4LLDB 3VGAC 4YO0B 1SJEB 3LKSA 2PO6A 2Q76A 4ODBD 5EO9B 1BIIA 1S7WB 5ALCH 3MOBH 3ZYIA 2Q3ZA 3IVKA 2NY5C 5A43C 1P4IH 4OCRL 4YEFA 4LNRA 4GG6B 4HWZA 4ODUB 3K8KA 3SE8L 4RQQA 1INQA 1CGSL 3MRMA 1BJ1J 3MO1A 3F12B 4NKIL 1QLFA 2WWMC 4GXUN 4QRUA 5MEND 5L7XL 5I1LB 1YPZE 1RUML 3IDYB 1BQLL 1WUNT 4TVPH 3WJJA 4Q9QL 4A2MA 1B0GB 1EJ6A 3GFUA 3I50H 3RUGA 5C07E 3SGDI 4PJHA 2VTFA 3U0TB 1UM4H 3MUGA 5GSRA 2VLRD 2CXGA 3S36X 4JANB 1DEDA 3C5ZD 3GIVB 4XTRD 4I18B 3RY6A 4PP2A 3U7WL 1ZTXL 4U6VH 5ETUA 2OL3B 5TQ2L 3QO0B 2ATPB 3D39A 3PP4L 3J8F7 5EZLB 1CGTA 2FR4A 2XN9A 1F4HA 4CU8A 5I17B 2YD9A 3WYRA 1MI5A 5HD8D 1N59B 1UT9A 3AC0A 3NZHH 4KVCL 3V4VH 5D7LD 1C16B 2P5EE 3GMMB 2UZYB 4HBCL 4Y0GA 1E6JL 3LB6D 2CKBB 4NO3B 5BRZA 1KPUA 2NY5L 2UZIL 4HUWB 3IDJB 4X6CA 4YHMH 5EU6D 3MNVA 4X6EA 3HUJE 3GBNL 3WN5A 3E6HB 5C0JA 3JWOL 2ZUQB 3QUYD 3RL2B 5BJTB 4MA7L 4D0CA 1GVIA 4OD1H 3CFKB 3C8KA 3WD5L 4HCRL 5HGDA 2ICWI 4KROC 3GRWH 4P23B 1QO3A 5IHUL 2NX5D 5IHLB 4LLYA 3CFBB 3VA6A 4EIZC 4KK9C 4JFED 5JW5A 2W92A 1ED3B 1AP2A 4RGNC 5E5RB 1BJ8A 2IAMA 3ZZ1A 5I66B 5TPWH 4GKZB 4DKFL 3I85A 3O3AB 1EEYB 2C3VA 1A9BB 1OL0A 4YWGH 3VD9A 1CL7I 1DVFB 4NJ9H 5IB2B 4D9LL 1T83A 3BH9B 5EU5A 1G7HB 4OI9A 3NIDF 3FQNA 4U1GB 4R4BA 4HKXA 4ZXBD 5SWSA 2FJHA 5F7EH 4DFIA 2OTWB 4P5KA 2AGJH 4PJCF 3IKCA 1RHFA 2CPCA 4MD0A 4K2UL 3EJZC 1HNGA 4JDTL 1JZ5A 3L6FB 4PRID 3FO0L 2JIXA 3MSPA 1GGIL 2R2HA 3TBSB 5T1KA 3GMQA 1MHEA 3LKQB 1S9VA 4HK3N 1MCRA 4L9LC 3TESA 5LWYH 1AIFB 1UACL 3RVTC 1A21A 4ALAH 2WNGA 4NO5B 1XMWA 4JVUA 2OL3L 5B21A 3VXMB 2GITA 3MCLL 4NYLA 4O51B 4Z8FL 4XCFH 1ITBB 3UTTE 2ZUTA 4YE4H 3P40A 2Q86B 3CDYA 4WUUA 2WSKA 1CGXA 4FTVA 2R29L 4R97C 5TF1L 5CGYD 2HN7B 5EC2B 4QRTA 5EO1A 3OG6B 1OAKL 3O11A 5CP3H 5F3HA 5EZIH 4YQXH 2BNUA 1L0QA 3RTQB 4P2OB 1SYSB 2HRLA 4S1SL 4M7KH 5GRWA 3JV4B 4PRNB 4Q74A 5MENE 1NGQH 3QCTH 3EDEA 3G5YB 1M6OA 4UMGA 5D1QC 1ZOXA 2M2DA 1NL0L 3DBXB 5C6PB 3EDKA 2XNAA 4M7JL 1OW0A 5B4MD 4YX2L 3QI9C 1T7VA 4KQ4H 2VLRE 3B9EA 3LKNA 2BSTA 2AK4E 4I5BA 1A4KA 2O5ZL 2EYRA 5F1IA 1QVOB 2YA1A 3BD3A 3MBEA 5BS0A 3GSNH 3QDMB 4FMKA 4UU9B 4V2CB 4WIQA 1D5IH 5GRUL 2L0DA 1UJ3B 3G08B 1BEYL 1JI2A 3ZYZA 1UWXK 3L3OB 4P3DA 4PTUA 4WU7B 2DBLH 2BVPA 4FP8H 1FNEB 3KLAB 1T21B 5EU6E 5CCKL 5EOTA 1R0AH 1PJ9A 4OLYH 4WTXA 4HIIA 3VRJB 1GHFL 5K9OB 2NLJA 5HI5C 1A6ZA 3IAQA 5FB8A 4U1HB 3TWCL 4KRPB 2NX5E 5BZDB 2Z9TA 2R4RH 3VWKC 4L8SB 1ACYH 4Z76A 5F97E 1V7NL 2HKHH 4ZFOA 4Y5XA 3EFFA 3NABH 2ZG3A 4X9FA 3CFDA 4X4XB 1VEPA 3OR6B 4F7PA 3GO1H 3ZTNL 3X3FL 2H3NB 1WT5C 5E8EA 4JJ5B 1MCQA 1IC5H 3NOIA 4RBPH 1FDLL 5HHOB 1T1WB 1J1PL 5JLZA 1FVDA 5LBSH 3NFPB 4Y8DC 3HRPA 3WFZA 5C0BA 4PB0H 5F88B 5CJ5A 1LK2A 2HG5B 1KCUL 4LFHD 3V2AR 5ID1A 1T4KA 3AREA 3MODL 4PRIE 1NCBL 3O3BA 2R2CA 1LVEA 3FCTB 4V2BA 4FQHA 2B5IC 3DX7A 3HFMH 4RAUB 3JSSA 2BY1A 1P69B 4JKLA 4P5TC 3MJ8B 5JHDA 2IG2L 1J1XH 4QYOA 1BM3H 4L4TD 3VMPA 3QPQC 3QO1A 3L95A 1JPST 5DVNA 5J11C 1BWWA 3NFSL 1JGVH 3OR7A 3DI3B 1U8NB 3PL6A 3BO8B 4X6DE 5IBTL 1JF5A 1U8JA 3BE1L 3C2AL 4X99B 2Q6WA 4B41A 1DL7H 3WNLA 1X5GA 1RK1B 1I3GH 4OD2A 1I4FB 4XMPL 4ZNEE 4U6HB 1DLFH 5MEOA 4MJID 4QRPA 1J05A 4WW2B 3MRNA 4IRJC 1RPQA 1IAOB 2VNCA 1YN7B 5IKCB 2CLRB 4UAOC 4DVBA 3RI5K 1RIHH 4ODWB 3FQRA 1JPTL 4X7SL 3LEVL 1KT2A 1I8IB 4IHOA 4JGUA 2ID5A 3WIFA 1CVSC 4K94C 3K1DA 4LQFL 2BC4B 1RUQL 1WC7A 3OGCB 3OZ9L 3ZTJG 2JK5B 1A2YB 4NDMB 5T5NG 2NZ9C 4HHAB 4GOSA 1I9IH 4UUJA 3MOBL 3BGFC 4P4KA 1JRHH 1G6RL 2CRIA 3EOBA 1JGUH 3SDXA 4LKXA 3WLBA 5T1DH 2HMIC 1ZA3A 4NZDA 3FRUB 1G9ML 3IAGC 3WXWH 1HXMA 4GG8A 1QSVA 5EO0B 3U82B 5DXWA 1SJEA 1IC4L 4TVPL 4B0MM 5E08H 1W2KT 5DJZB 3I50L 2OJZL 5T3ZH 2NY3D 4HG4J 3HAEH 5CWSA 2OZ4A 3DV6A 2JCCF 5E7BA 5BQ7B 2VDQL 1C5CH 1HHKA 4PGBA 5D2NC 4ZQKA 3BKJH 4PUBH 1DQLL 4W70A 3VXNA 4WHDA 4ZO8A 3U9PL 3SCMB 1C5BL 4U6VL 4UV4H 5EC1B 4UT9H 2XTJE 4G42B 1CR9L 1AFVH 3D0LB 2DQTH 3UJJH 3GSVB 2X4QB 3V6ZA 2AEIT 1YC8A 4BZYA 2XXMB 4OCSH 2KBGA 2NY2B 4JANA 3NZHL 3V4VL 1B4RA 3FAWA 3VG0L 4I18A 3F7VA 5KN5B 3O9WC 5C9KA 4C56B 3D3VA 4YHML 5DJ6A 3TCLB 5IR1A 3TPUB 4ZYKA 3O3EA 4MB3A 3RVVD 2AEQL 3EDDA 2GJ6B 4OD1L 1IMHC 1XGQA 4JO2L 4J7RA 4AT6B 4HF5H 5IVXE 1I8MB 1KXVC 3GUTA 1OOAA 5T33H 3IXTA 1BPVA 3LSOB 2GSIA 4RRPA 5HDLA 1IARB 2AK1L 5DD3L 2LFGA 1IT9L 5E95B 1I1FA 1LO2H 1JUFA 1U41A 4L4TE 3AAZA 4ZSOA 1HSAB 5IB4A 3U2SB 2NY1C 4M4PA 4MXVF 3GSNB 4AEIL 1CD8A 5DMJB 4PJBF 4NJ9L 4YIQA 3RY4A 4U0RB 3KLHC 3MTRA 4M7LH 3SDAA 4NRXB 5I66A 1BBDL 3KPNA 4K3JH 4U7KA 4GKZA 4EDWH 4JR9H 5ESQB 3DYOA 2KPNA 4LQ1A 3HE7A 1KJ2H 1EFQA 1L6XA 3MXWH 1UCBH 1N6QL 4PJFB 2ZSWA 1I3RA 2HAZA 3KWWA 4HWEH 5F1KC 3S37H 4GMSH 2VXUH 3LHPL 5C0GA 2OI9B 2Z92B 5GS2D 3MYJA 5LWYL 2C7UB 3KNBB 5HGGS 2G5RA 3QXDB 1DN0B 4NIKB 3V6OE 4YE4L 4R2GC 4OFYA 3QIBB 1UC6A 2YD1A 1RZIB 2EDKA 1P84K 1IBGH 4TTDD 1K8IB 1A1MA 5ESVA 1AIFA 5DUBB 5I1IH 2BXYA 3UPAA 5E56A 1J0JA 3O81A 3U46B 4EUPG 2GIYA 2QSTA 2X6MA 5I19H 1L0YA 4BQ6A 2YHGA 4NRZB 4GUPB 1MPAH 5EZIL 2MSPA 2F54D 4N90D 5HI3D 1Q94A 2UV3A 2X4TA 2Y5EA 4KGLA 5JHLL 3RWGB 2XZCL 2F74B 3CX2A 2X1WL 4PG9B 4ONFH 1AGEB 5HHME 4GAJL 4J4PC 2VZOA 2FZ3B 4UQ2A 4LPXA 2X4PB 3ALWA 5IFJB 4KPHH 2PXYD 3I3DA 1M7IB 1MJ8H 2CKNA 4KQ4L 4OZHA 3LH2H 1WWBX 1F11B 1X4XA 2RIKA 3D0VA 4HGWA 4LASL 4QF1B 3LEYH 4J3TA 4XHJC 3GSNL 3V0WH 4QEGA 4F33A 1D5IL 3NIDE 4Q6IC 4CMMB 2DQFB 3Q5YA 4KK5C 2EZ0D 4MSWA 1EBPA 5FF6A 4PJCE 5I1EH 3ARBB 3PP3H 4IDJL 5DJ8B 4O5LH 3TYGH 1MLCB 2R8SH 1MVFA 5I74C 3C5JB 3X3GL 5GXBB 1MRDH 5SWQB 5GQBA 4K71B 1FFQA 2NTFA 5AD0A 3QDGD 4HJJH 3OF6A 3QHFL 4NQCB 3PIQA 5E00B 5TDNA 5FYKE 4OLYL 1ZHKA 2HJFA 3T0EA 25C8H 1SYVA 2DDQH 5D93B 1QEWB 8CGTA 3VXRB 4OV5B 4WU7A 3BX7C 2A1WH 5T5FH 4Y1AA 1DP0A 3RQ3A 1FNEA 1XF4A 2FLRT 1MCJA 2R4RL 4FXGA 2V9TA 3ME0A 3FO9B 1KCSH 3NCCB 1N2RB 2IPUG 3V4UH 2ERJB 2HKHL 4GAYA 2ZKHL 4LVNC 2F9BT 1V8HA 3NABL 2N7BA 3HZYA 5KTEH 2Y6SD 2YPLB 3MJ9L 4N0FB 1UCTA 1PZ5A 3AM8C 2BMKA 3MX0A 5AEAA 5DSCA 5AUMB 3DV4A 4HKZA 4PB0L 4KJWC 3BVNA 4P9MH 1KB9K 5CAYB 4JJ5A 3C6LC 1FVCB 3DXAB 5KSAB 3G04B 4APQB 3HN3A 3VXQA 1ZLWH 4BQ8A 4CDHA 3HFML 3HAEB 5KSUA 1KF9B 4Y5YA 1J1XL 4B5EA 1R24B 4X5WB 1TCRA 1KN4H 1BM3L 1QSFD 4F7MA 2HG5A 4KI5C 2XWBA 2XTLA 1V05A 4HK3J 5T1MA 2Q1EA 4QRRD 3EKCA 1QBBA 5EB9A 5D1ZB 3MGTA 1Q72H 2DMKA 1JGVL 1KCKA 3O2DH 3ELAT 3OAZH 4MGXA 3HKFA 4PJ9B 2ADIA 3VH8B 2V5YA 5LKNA 1JPFB 1NMCC 2DIBA 1YC7A 4N1EA 2P24B 5FGCE 1I3GL 3QCVH 2ZPKH 2HFGH 2FBOJ 4MCZA 4P2RD 3U0PA 2F54E 3MCG1 4N90E 2IALB 3HZMB 4MQTB 4CW1B 4AK1A 2AERT 3JTTB 4FQIH 2R1YA 1HH9B 1RK1A 2GY5A 1KIQB 3IDIB 4MXQC 3X11B 3C60A 3I2CH 5FECB 5FGRA 2GTZA 2C4XA 1DQJB 1VEMA 3AMLA 3HG1D 3DURB 1A3QA 1XH3A 4KFZC 4D9RD 4XRCA 4MB5A 1A7QH 3G6DL 5J6GA 1GGTA 4KRLB 1WBZA 2ILLA 1A4JA 1YMMD 3BPNC 3JVGC 1ITCA 4PJIB 1OP3H 4I0PB 1T6WA 2I9LA 3D18A 4QXTA 1PQZB 4CVWA 2PYFA 1WBYA 5KOVC 1JRHL 1S7UB 1I8IA 3GRWA 2D31A 1IEHA 2YEZA 1NBVH 1IRAY 1JGUL 4JPWH 4UOW0 4EN3A 3VFOB 3EO9H 3WXVH 1NGXB 3BP7A 1BVKB 2CXKA 4IRSD 1YEDB 3OGCA 2JK5A 3GMOB 3WDIA 3P4MA 1IAKA 1EX0A 3T1FA 1NUNB 5E08L 1KJ2B 4OLEA 5T3ZL 4PRHA 3O8XA 4L8BB 5IT2H 3BH8B 1SEBB 1NC2B 4K9EC 2ZOLB 2V17H 3QRGL 1BF2A 1EO7A 1OGAD 1MRCH 1NGZA 2FEDC 2XKSA 1FNGB 1TVDA 3K74B 4X6CF 3O6LH 3NCEB 4UT9L 1DQDL 1AFVL 4MJ6A 1NANH 2DQTL 5K93A 4DN3H 2WW8A 2C3GA 2X7LB 3BEWB 4Y4HB 5E9DD 4OCSL 5A3ID 3UYRH 1JHKL 3FQUA 3GGWA 4DTGH 2Z0BA 3FAXA 5DJCA 5L2JA 4NZRL 3VRIA 1AXSB 4IIQB 4WNQA 3UBXB 2WUBH 4N5UA 1K3IA 2CK2A 1OAZH 3EYVB 5FA4B 2V2XA 4R0LC 4NN6C 4OQ1A 1JGLH 2X4SA 4F7CB 5IB3A 2R2EB 1CXHA 4WI3A 5T33L 1CLZH 5GHWL 5KZCD 1BQHA 4OQTH 1KIPB 5E6IA 4BQBA 2CO6B 1LO2L 1QSFE 3MJ6A 3EFDH 2HJKB 3UC0L 5CEXB 1ES0A 4PRDA 2WUCL 1CGVA 1HEZB 3N50A 4D94A 2JB5H 4ZDHB 1IKNA 5JR1L 3E2HC 1FG2A 3DI2B 3HE6A 3LDBB 1I7TB 3GMLA 1JWSB 3G6AA 3FN0H 2BNQA 5F70A 1TITA 4M7LL 4NFCA 3CNKA 1KYOJ 1JHTA 4K3JL 3WIHH 4EDWL 2DYPD 4JR9L 1IEBA 1J8HB 3WS3A 3QJFA 2F5BH 4EEEA 1AKJB 3UTSD 2N4IA 2W60A 2P7TB 2JCCE 3MXWL 1UCBL 4HWEL 1QRKA 4ODSL 3S37L 3MLYH 3BPLB 1HHGB 2VXUL 2FLBT 4NRXA 4KK6D 4BFGA 4HDIB 3HG1E 1PEZA 1RZGA 1F97A 4D9RE 1K5NB 1B4JH 2BVUA 3QIWB 5D6CB 4MVBD 1PY4A 5CGMA 4JG0H 1J5OH 2YBRB 4L4VB 3EO0A 4G6FB 3UYOD 4NM4H 3SGJA 2E9WA 2W0KA 4OM1H 4XGZB 4NO0A 5ABDE 1JRHI 2EEAA 1IBGL 1ONQA 2CGRL 2ZJSH 5I76B 3MRHB 4L29A 3Q48A 3MA9H 2BDNL 4HXAH 5I1IL 2WBKA 2OTUB 4Z7WA 3VI4F 4ZFFA 3O45B 3CZFB 5EIIB 4Y16C 5I19L 4ODTL 4WHTB 1OD7A 3ZDXF 3QHZL 3REWB 4S2SA 4RIRA 5FO9A 5IMOB 43C9B 1UM6H 1F4YH 3IGAA 3OXRA 2QQNL 3RWIA 5FYLH 1K8IA 4GRWF 1X5ZA 4ONFL 5E0QA 1EUTA 3UAJC 3DHMA 1G7QA 4GUPA 1MJ8L 1LNUB 3LH2L 1ZSDA 3QDJD 4MXVE 4D0DA 1OGAE 3LEYL 4P46C 3DOSA 4PJBE 1JNNL 5C08A 5E8PA 5LGKA 4Q7DA 4R7NB 2NR6C 4PJ5A 1IGJB 3TO4C 1UKTA 4MAUL 4Y19B 5E9DE 5CHNB 5I1EL 2VUOA 1R5IB 4O5LL 3TYGL 2R8SL 4MWFB 1V3MA 2YUWA 3EBAA 5C09A 3T09A 3VWJD 4BSWA 4OZIA 4HPOH 3ARGC 1DBKH 4KI1A 2PKDA 3H9ZA 3EYFB 4HJJL 4U3HA 2GTWA 4RGOH 3NAAH 5C9JB 1EEQA 3FFCD 3FMGH 2DDQL 5IHZA 4H8WC 5E1HB 5DJ8A 3VW3H 4YZFF 1MLCA 5JDSB 5TGBA 5T5FL 1EFXB 5CFHA 2VN7A 4F9LC 1VEOA 1KCSL 1Q0XL 1AGFA 3V4UL 4YDVA 5F1SA 2R1WB 1GGBH 3H9SD 4UILH 4DGVH 4JZOB 4OF5A 5DQ9A 4PJXB 5KTEL 5DD5H 3AS3A 1KPRB 5EORH 1KXTB 1JGDA 5CUSL 4LAQL 2J8OA 4X7EC 1LO3L 3GI8H 3FHQA 5DD1H 3ZSSA 3MRPA 3FO9A 4LGRB 1YQVL 1ZHBA 1UB6B 4CN6A 4G5ZH 2FWOA 2PO6D 5IHBA 4QXUL 5I1KH 4JJHA 3CFJA 4XB8A 4P9ML 3UTSE 3TBTB 4C57C 5IESH 4H1LH 4D9QD 3B5HA 4LHQB 3B9KA 2SEBB 4NWUH 1NKRA 4X0KA 1DN2A 1OB1A 4OCNC 4H8WL 3DVFA 3C6SB 3MLRH 5DGQA 1KN4L 1P7QB 3IFNH 1KJVB 4ONGH 5TDOB 2N7AA 2NY7L 3UZVB 1MOEA 3X13A 5FYJU 1NSNH 2OJEB 2HWZH 5CEZL 3O4LA 4EI6A 1TNNA 3HAEA 1JGEB 4J1UB 4GAFB 3UBXI 5I9QC 5E8OA 1YNTB 1EGJH 5JXAH 3D39D 3QCVL 2ZPKL 1RVFL 3OKKB 4JEGB 1L9NA 4BH7A 2HFGL 5JPNA 1CI5A 5E2VH 3PHOB 4XVUC 3HI6H 4GT7A 3TGXA 1MI5D 1KIRA 1RFDH 2IH1B 1Y6KR 1UQSA 5GZND 5EU4A 2FNBA 1MUJB 3ARXA 3W81A 3BI9X 4PG2A 4QTIH 2QKIA 3I6KA 3I2CL 3U36A 3CH8A 5JXEC 2RHEA 2WINA 2CQVA 3GJFK 1ZLVH 3AY4C 4X7DC 3P4OB 3QDJE 1EO8H 1KENH 4YDLC 1FC2D 4G6JL 3HZMA 3O41A 2YPKB 1KFAH 4CW1A 4YHOH 1PKQB 4TQEH 2VZSA 4C59B 3KDMB 1CD0A 4F37K 5FDWA 1HH9A 3IT8D 4MNQD 1RSFA 1IZKA 5LCVH 5A2IH 1T3FB 4GG6F 3TIDA 1NBVL 2XWTB 1CXIA 3TFKC 3MREA 2W0LA 3SKMB 4HUVA 1R5WA 4FXKB 3L7FB 3LPGA 3IF1A 3EGSA 2AQ3A 4PJIA 4DK3A 1XF2B 2QADB 2D7NA 2DLEA 4PRPA 5C0CD 3H7LA 4QRSB 4JQVC 3CDGB 5D7JC 5LJYH 5C3TA 5IG7A 4K7PX 1BWMA 4G8GA 5DJYA 4R90L 1S7UA 1SMOA 3NH7H 1SM3H 5IT2L 4XT1C 3VFOA 3TT1H 1KUMA 1T2QL 5KVDH 1L6ZA 2QEJA 2V17L 3SBWC 5ANMA 1KB5L 2B4CC 1P9MA 5CJ8A 4HJ0D 4YDJB 3QFJA 4Y4FC 4OZGB 3DUSB 4OKVA 3O6LL 4I3GA 3H9SE 1KJ2A 1PBYA 3IFPA 5F6HI 4UTAL 5DMGC 3C5SB 5ACLA 4DN3L 4RFNB 1RIVH 3V6FB 4NQDD 1QFOA 2Z35A 1ZGLM 3BUTA 3S96A 3BQUA 3PGFL 1FNGA 4FTVD 3DMMA 4A2LA 1LEKB 5B38A 1N3NA 5F96L 1T22B 1KCVH 4L5FH 1GRWA 4RAVB 3ZL4L 3X14A 1OAZL 2QLVB 5IMLB 2HLAB 2EYTB 5BVPH 1P5VA 2LAAA 1X4ZA 1OP9A 4KROB 3JXAA 4JPIA 4D9QE 3PQYB 1NUGA 4U6YB 4TSCL 3QXAB 2NY4D 4CL7A 1A7OL 4OQTL 1RZKL 4AL8H 5F9DC 1CT8B 3O4OB 4X4YA 4RGNB 1MCOL 1OP5K 1P7KB 3GNML 4JFXB 5DYOB 1U58A 3MRRA 3BP5B 2X9WA 3JZ7A 1MF2H 3MRGA 2A38A 2APVA 5F72S 4PJDB 2ARWA 2VQ1B 4N0YL 1JPGB 1CK0H 4MLIA 3CDFA 2XA3A 1L7TH 4KK8C 2RQ8A 3MV8B 3U0WH 3FN0L 1HXYA 1NAMH 3D39E 2OMBA 4XH2A 2YA2A 4NHUB 4W68A 2X4OB 5CD5D 4MLSA 2Z31A 4PLJC 4Y2DD 3WIHL 2Z4QA 4NKOB 2VAJA 4HWBH 5FXCH 4KVNH 3CPLA 1AQKH 2F5BL 4LCWA 5C0AB 1MI5E 4XMKH 1TZHB 5EBLA 5DD6A 5BOZG 5IJVA 1EMTH 4XPBH 4OGAD 1H3PL 1JWSA 1T5XB 4UDTB 1WIPA 4Z0XB 3MLYL 3RGVA 3FT3B 2DQDH 4L9LB 1KOAA 1OTSD 4JG1L 4JM2A 4FFWD 5IFAH 2QQKH 4X6CE 5GJTH 2F19H 1U91A 3W2DH 1YNKH 1AR1C 4TUKH 1D9KB 1QYGH 5EBWB 2HA1A 2VWEE 3D69B 3MBXH 2PW2B 1J5OL 3W11D 2FEEL 4NM4L 1ORQB 2FYYA 4LRNL 1KCRL 4MNQE 3MV9A 2ZJSL 3CUPA 3MRBA 4PJAA 4HXAL 2VQTA 4NQSB 4EDXB 1ADQA 1GOHA 4O9HH 1CFBA 1CLOL 1I3UA 3TT3L 3RL1B 3L9RA 1MIMH 4WW1B 4ORZC 4QHUB 2ITDB 2YBRA 1W0WB 4L4VA 2HVKB 1UM6L 5C0CE 4XGZA 1F4YL 3DRQA 3DGCR 5IROC 4J3SA 4CKVX 2E7CA 5FYLL 2AXGB 2B1AH 4AQOA 5L2KA 2GK2A 3CC5B 4EOWH 1R3JB 1BVLB 5SWSE 1JYVA 5C0BD 1RZ8B 1REIA 4JKPL 5ACZB 3UDWA 1JFQH 1Z0NA 4FZEH 3IRZA 4MAYC 4H1LB 3THMH 2HT3D 1AHWC 2VC2H 1AGBA 3QA3A 43C9A 4KGJA 2PNDA 2A73B 1NANI 1I8KB 1OWWA 1U8LA 3LV3B 3T2PA 2CIKA 3RWEA 2MCPH 2H32H 5FIEA 4TTGA 2XRAH 3WL9A 1KNOB 1ORSA 4U6TA 3GBLA 3A67H 1E4KC 4JRWA 4WUUE 1U8HB 4M7ZC 5IJKC 1G7PB 4FTVE 1SHMA 1WCBA 5E7FA 3VFSA 1Q9OA 1EXUA 1LQSR 2BVOB 5EBGA 1GGUA 4BH8B 3QUMH 4RMRA 3RHWF 3RU8H 2DWDB 3FMGL 4I2XA 2AI0H 1F3JB 1DE4B 1JPSH 3VW3L 3ECBB 1MFAH 3FN3A 1HH6B 4LCCB 4X8JA 1OTUD 2EYSB 3E3QC 2C4FU 5DHVA 3QIUA 3WNNA 5L9DH 5C07B 1CXLA 5IQ7H 1GGBL 4UILL 2ZUXA 4DGVL 3VI4E 2OXGA 3SDCB 5EORL 3VH8G 3LQAH 3ZDXE 1DBAL 4OCWL 4JM4H 5DLMH 5EPMA 1K4CB 5DD1L 5BS0E 2HLFC 2PR4H 4M93B 1B9ZA 1CIUA 4G5ZL 4M1GH 3H7BA 2H6PB 5ERWA 2P42B 3PWJB 2GT9A 3WKNA 4GRWE 4JZOA 5FKPA 3MLWH 4WI7A 1HYSD 1KG0A 1NUDA 3BN9C 3PJSB 4DK6A 1F90H 3S4SA 5C0IA 1NFIB 4XPGL 1DQMH 4N5EC 4LKCA 4NBZB 5BZWB 2W1NA 3B83A 4XCEB 3HUJB 3FOLA 1FNHA 4M5YH 3MLRL 3MA7B 1MRFH 5D9SA 1RJYA 3IFNL 4RMSA 5EU3B 4ONGL 1YUHB 2FEEI 2AW2A 1X5FA 2WBWB 1DEEB 2HWZL 4M9PA 1W72A 2BVYA 5HGAB 3TA3A 3PWNB 1ETZB 5EN2A 5JXAL 1P7QA 1TQCC 1RD6A 4JRYA 1D5ZB 4DCQA 5E2VL 3TM6A 2D2OA 4RFEA 3L3HB 1I1AB 2Y4SA 3KPLA 4DW2H 3HI6L 2FATL 4YZFE 3LCYA 2D0FA 2A9MH 2DBJA 5T1LB 4MMXC 1RFDL 1RZ7H 3LKRB 5D7SH 1JGEA 3KLDA 4J1UA 1IAIH 4M48H 5EZOH 5C0BE 3K7UA 4QTIL 3SO3B 3MLVH 2UVEA 4OI8A 1DDHB 2H9GB 5DC4B 3L7EB 1B0WA 1EO8L 1KENL 5A2FA 5K9QI 4P48A 4YXKL 5D5MA 3VFVA 1KTKE 5E2TL 3BZ4A 5F1NB 35C8L 2FX7L 4OIAA 2Q8AH 5C0NC 2UY6A 5ECJE 4JCLA 4H88H 5DA0B 3BGFB 4LSTH 3HLAB 5L8KB 2B0SL 4OLXH 3TYFA 1L7IH 4O58H 4F15C 3TBYA 3VJ6A 1P2CB 3O6FA 1K8DB 3UBXG 1NAMB 1YYML 5DFVC 4ZFZB 1OCWL 3CFIC 5CJQH 3Q6FB 4DN4H 3NZ8B 4K8RC 4KJYA 3C09C 3SJVA 1H5BC 3NH7L 4BYHA 1SM3L 1ZLSL 4HLJA 4FXKA 2FIKB 2J6EA 3PGCB 1DVFD 2V7HB 4N0RA 5F7NC 4PGCA 4PGZA 2VN4A 3E0GA 4XWGH 1DCLA 2PTTB 4U1SA 1EZVX 1O5DT 3U6RB 2A6IA 3BRGC 5ADOH 2AK4B 1R3HB 5KVEH 2I9TB 3H3PL 1GSMA 3LPWA 5CP7A 4KJQD 5CMAA 1U3HB 1KSRA 3L3JB 4RWYL 1BOGB 3STZB 1AQDB 3CSGA 2ZCKH 3D85B 1KCVL 4L5FL 3Q2CA 2VDRH 2X41A 2QR0B 3JUYA 3VXMD 5BVPL 3VFGH 1ND0A 1FE8L 5I1DB 3PWVA 2GAZB 3U30C 1TLKA 5D1XB 5EU6B 1KLFA 3RIFK 3KPSA 3ABZA 1XIWC 5JOPD 1UWXH 2EDRA 3C5ZC 1S9XB 1J88A 1K2DA 4J3UA 4KDWA 4XTRC 5IMMA 3ULVH 5K9JL 4XB7A 5IMLA 2HLAA 2NY1B 2EYTA 4AEEA 4FABH 2JJVA 4AY0A 3W9DA 1T1YB 4GG6E 3RTQD 4P2OD 1VERA 4LSDA 5JIPA 1CK0L 1L7TL 3BXNB 3MLTB 5DMKA 3U0WL 5EDXA 1P7KA 3QWOA 1NAML 2MKWA 2BCKB 5DURB 5EU7E 1W8NA 4HKJA 3HI1B 1WLHA 3LB6C 5MI0C 5DYOA 3BP5A 4HWBL 4CADA 4PJFF 4KVNL 3WMSA 3GKWH 1OSPL 3UP1A 4XMKL 2E7BA 1F6LL 3ARWA 4PV8B 4YHIA 3QUYC 1LK3H 4FG6C 4LEOB 4HIXH 3QUMB 4QGYA 5HTSA 4XPBL 4IRZH 2DOCA 4PR5A 1NCCH 3D25B 3QDMD 5B39B 5CZVL 3EHBD 5GGRA 2QQKL 4MNGB 4K23H 2F19L 1XGUA 3LD8C 4TUKL 3MFFB 1M05A 1PY9A 3BDBA 3NIGF 3G5XA 1QYGL 3L5XH 3OKEA 2EICA 4PRIB 3QZWG 3SE3C 1MCWM 1TZHA 3Q5TA 4R2GB 3ZHKA 4ODXB 3MBXL 1T5XA 3BJLA 2HTKD 1BFOA 4AENA 1TVBA 3T0VA 4L9LA 1LE9B 3RFZC 3BEVA 1G7LA 4XHQA 2VR9A 3ALPA 4ZSOE 4H26B 5GISH 5DS8B 3SQBA 4XNQB 3O3UN 4MQXD 4O9HL 4MHHG 1NGWB 4ZXBC 3QG7H 2V2TB 3D69A 1MIML 3K2MC 4HQQH 4JY6B 2PW2A 4X6BB 1VB9A 4KRPD 2R39A 3VXTB 1DUZB 1F58H 3QHTC 4M3KB 4WJ5B 3ESUF 2NXYC 3QJHB 3HZKB 4XAKD 1EEZA 3HS0B 2B1AL 1YNLH 3LN9A 5FYKH 4UNUA 4XBEL 2HFFA 3F58H 4QNPF 4EDXA 4FZEL 5AG8A 3THML 2VC2L 4WW1A 1T04B 2LU4A 2PYEA 5HHOD 5KSVA 1XEDA 5IEKA 1SEQL 2R56L 3RX8A 5D1QA 1Y18A 4TYUA 5C0FA 4ONHA 2IFFL 4J12A 4MQ7B 4Q6IB 4UTBH 5I0ZA 5MERA 4MX7A 2MCPL 2GCYB 1M4KA 3QI9A 4HAFA 5CGYC 1RJCA 2V5SA 3QUZB 4D3CH 1P84J 3VFRB 2RFXA 2ICEB 2XRAL 2AKRB 5AWNL 5GS0C 3U7YH 4DQOH 1N8ZB 2BNRA 2JKXA 2Q7YA 3A67L 1K6QL 1FJ1B 4TVPD 3RNKA 1UWEH 4MDIA 4HZLA 3LV3A 1V5JA 3LPFA 5FGBC 1KBGH 2MNUA 1N5AB 4XP9L 4IMLB 3VA2C 4WRLA 3OKDA 3VXME 2AI0L 2WIIA 5DEGB 2L4OA 2EIZB 1JZ4A 4HT1H 2EDBA 1G7PA 3A6CH 1MJ7L 4GS7C 1EGJA 4YFEA 3VFUB 5JOPE 3D48R 4JFYA 1NC4B 4U1NA 3H3BC 5L9DL 4PJ7B 3TJHD 1FZMA 4R7DB 5LQBH 1DJSA 3PDOB 3WFHA 2R2BB 1FFOB 5FK9B 3LQAL 2W59A 3VWKA 1ZT1B 4U49A 1UG9A 1QLRA 3QNXA 4JM4L 4M62H 5DLML 3T4YB 5IW6B 2ENSA 3PDDA 2XTJB 2VDML 1U8PA 2P49B 1RURH 1LMKA 3BIKA 4M1GL 2DQHH 1K9TA 2IC2A 2GJJA 4K7PY 4OUUB 4PJGA 3MLWL 1WT5A 1QFHA 3MLSH 3C6LB 2YZ8A 1WBXB 3B8YA 1F90L 4RX4A 2K3TA 5KSBA 5HYIA 5MEPA 5DK0A 1J0HA 1K4CA 2XG4A 3LMJH 3QDME 1MCBA 4O2CA 2DIAA 3DGGA 3MROA 5FYJE 4K3DH 2DQCL 1J0IA 1MRFL 2FB4H 2AQ2A 1GOGA 5GRJH 2BFVH 1MFNA 5IVXB 3AB0B 1FN4A 3O3DA 2DJUA 4F3FB 2FD6L 3V0VB 1NBYB 3T2NL 1B3JA 1ZEAH 4P5TA 3LS4H 4L4TB 3PWLB 1NMCB 4GLRH 1U8IB 2G9HA 5IW1A 5GS1C 4Y4KB 5FUOH 1AGCA 1LWRA 4JRXA 5CJXC 5EU3A