4XP1L

X-ray structure of drosophila dopamine transporter bound to neurotransmitter dopamine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter, isoform B
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Membrane protein/transport protein
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp1L01
1AO7D 2W60A 5ANME 3T2QA 3PG2A 5TQ0H 2AXFB 3QPQD 1KFAH 4OZFH 1PGRB 1DLHB 3P11L 3BKMH 4M03A 4P3CL 3RU8H 4U6YA 2NW3A 3RIFF 5J11C 1RUAH 1G6RA 1J7VR 3MGTB 2W92A 2ICWA 2H3NB 3QUYA 4KGLA 2PKDA 2J2ZA 4WHTB 2V6HA 3WE6B 1P1ZA 4OLVH 3BAEL 2XZQL 4YX2H 3WS6C 4R3SA 2WQRA 1QG3A 4XHJD 1TVDA 4JFPB 4HUVA 5HY9A 2QQNL 5DMJB 2CKBA 3STLA 3LEVL 4B0MM 5EC1A 5EBWB 4IMKA 4O2EA 1MOEA 1SYSB 5ABDE 4WTXA 1AGCA 3CAFA 3OAUH 4LVEA 3NCFB 5I8KH 4EI5C 1GAFL 4PJEE 5D2LA 4EI6A 1EZVX 1B88A 1JHKH 4Y19E 5HI5D 1MHEB 1E6OH 1MLCB 4P5TA 4QRRD 1JGEB 1R24A 4HH9A 2AV7B 1G0DA 4XPAH 5EU6E 1JTTA 1FYTA 3D1MC 4ODTL 5F8QC 1S7TA 5F7YC 3QIBD 1YDPA 2KUTA 5BOPA 2DQJL 3KYOB 5K59F 2MNUA 1GL4B 1NKRA 4KKBD 5CEXA 3BKJH 5I9QC 3CLEL 4K7PY 3ARDA 4OZ4A 2KZWA 2VABA 1FO0L 2VXVL 3N1FC 4HDIB 4UT7H 1EAPA 4QTIH 3LY6A 5J11B 1FL6B 2HT3D 3GRWA 3UPRB 4WI9A 3IDMA 4Q9BA 1QBAA 4KTYA 4H8WC 3STZB 3HPJA 3HAEG 4CAGA 4N5ED 1YEEH 4KDTC 4OM0L 2C3HA 3VXPB 3UZEA 3RVWD 2AJUL 5I74C 3WBDA 4WIQA 1OT1A 1WV7T 4JPWH 1CXKA 4DTGH 4YPGB 5T1KD 4KKAC 3FZUC 4J1UA 3VFOB 3WIFB 1K4DB 5D70L 3R8BB 1DSFH 2J5LB 3ILQD 4F7MA 1LEIB 5FKPB 4QRUA 5IMKA 4EI5B 3IDYC 4OLEA 3MJ6A 3TVMD 5C0BE 2HRLA 4PRID 4NNPL 2XY2A 4MJ5A 4HMDA 3QQ4A 5ECJE 4Y5XA 1MRFH 3P30L 4PJXB 1KSRA 2I07B 3SDXA 1OTSD 3A6OA 1R3KB 5FYJE 2VLJD 2X1PA 3M8OH 1WZLA 4LNVA 2P8MA 3Q1SH 3GMQB 1PLGL 5SX5K 4E41E 4YEFA 4Z7NE 3RRQA 5KSBE 1W72A 2ZUTA 2DLTA 4JY4B 1VFBA 1F4AA 1FORL 3CFCH 1L4IA 5I9QB 2APWA 1AGBB 3SQOL 3CXHJ 5FHBL 4WEUD 2BSSB 2EIZA 5DDHA 1T7VA 4LCWB 2B2XL 1RIVH 4BZ2H 5F89B 4JFED 4CVXA 1S7VB 5MP6H 4ZSOE 4P2RE 5JIKA 1TNMA 2UZIH 1TZGL 4PJ5E 1A7QH 4KMQA 5DHVB 3T77B 5I74B 5C9KA 3G5ZA 5GZOD 1NJ9B 1U3JA 4Y4KA 2PETA 5C0ND 1XZ0B 2HMIC 5DZNA 1HXMA 1OM3H 4WI5A 4O51B 3LS5H 4LHUD 3NTCL 3W11C 4Q9CA 4LSRH 3IS1X 4LDOB 4RMWA 1ZHNB 4OCLC 5IWLA 4OLXL 5FHAL 2BDNH 3B2VH 5EBMB 3IDYB 2BOCB 1IEBB 1UVQB 4M4PA 1OGTA 4PJCB 1EV2E 3WFZA 4MJ2A 4JY5L 5L7XL 3GIZL 4GRLC 4AMKH 3D48R 4NCC2 2V17H 1QSFD 5IG7B 1PX3A 4MNGB 4OB5H 3WKNA 4W70A 3A67H 1TZHA 1JFQL 5DQDL 4HQQH 4NQED 5ICZA 3W9DB 3ARYA 3K4AA 4FNLH 2NY5C 4Y5YC 1KCSH 1VGEL 4U6VH 1YMHB 3IXTA 4HPOL 3CH1A 3U0WH 4M5YH 1U8LB 3PHOA 4KK6C 3FOMA 4NQDA 1PFCA 2DQCH 4U1KB 1EZVY 1H3UA 5DGRA 1D9KC 2DM3A 2YPVH 1YC8A 4HBCL 5FYKU 4GBXA 5C2UB 5ICXA 3VXQA 1TIUA 2DKMA 4FQ1H 1AQKL 2VR5A 3GMRB 2GJZB 2VLRA 3NVQA 4LASL 3F12A 3R1GH 3C60A 3OKNB 3A6CL 1AR1C 1A1OA 4OV5B 4K2UL 3BUTA 3QXDB 3DYPA 3PIQA 4JLRB 4YXKL 1U8HB 1HOCB 5A40E 3BRFA 4L8BA 3I50H 4YHLL 1C5DA 5DMIL 3KWWB 4QRRE 1YEGL 4HXBH 3CDGB 3AM8A 5KOVC 4WTWA 5BRZE 3BQUA 5E94A 5DRZB 1UYWH 3NGBC 3KDMA 4QOKD 4N8CH 4Z7WF 5TGBA 2HVJA 2DLIA 4JN2B 4ZFFB 4L8DA 3D2UD 3UEZA 1YECH 4MXVF 1RUMH 4KKLD 2F54B 3GMPB 1PQZB 1FVCB 4JKLA 3U48A 1YEIH 5ESAA 1HYRC 4PJAA 2AQ3A 4GRLB 4LSVL 4XWOC 3MLUH 1T20A 3FONB 2UWEE 4B41A 1MCIA 1J18A 1EDQA 3KR3H 5DA0B 4DVBB 1WWAX 3O8XD 4X7CC 1I3RB 3QEQB 5SWZB 3A0OA 3P11H 4Y5YB 2ED7A 3UTTD 1B0RA 5FYLD 3V95A 3PWPB 4XXCA 2PYEA 4U7SA 4QRQB 2EH7H 2F5AH 5DFVC 2J3SA 4QO1A 5D7JA 4XPTL 5IFHL 1SMOA 1EEZB 4ZOBA 1D9KB 5DJCB 5E1AA 5GGQL 3O11A 4L4VB 2Y1VA 3FO1A 2CDFA 4ODXB 5DK3A 3MFGB 2QQNH 5K9OA 2D4FA 3IVKB 1NFDE 4KJYB 4M7JL 5CJXA 2FH6A 3QXAB 1T2JA 5HTSA 1UWXK 3ZE0E 4JM2A 2NYYD 4ZODA 2WW8A 1I85C 2VLMD 1CLZL 4XC3L 1GAFH 4AEEA 4X6BB 1OP5K 4M9PA 3BZFB 2D7OA 5K9KA 3ZE2E 3H6JA 3NGBB 4JO2H 5HYQA 1NCCL 3GJFA 5GRXG 5E03A 5DJ6A 4HF5L 5E8EB 1P7KB 4KVCL 1HHIA 4R96A 3FOLA 4PBXA 5JNYA 2GI7A 2ICEA 1FH5L 3E1F1 1KLGA 2VXQH 3P2TA 1A8JH 1ZT4B 4ONOA 3KS0H 1H3GA 1G7PB 4LNRB 4NQUA 1JPFB 1CDJA 3CLEH 5DFWH 3TO2A 3ARBC 3CFBA 4KRPD 2C3WA 3KPNB 3QUKA 5D1QD 1FO0H 2VXVH 1HE7A 3SE3C 3VFMA 2OQJA 4KPHL 4LHQB 2DLFH 1MHPL 3MV8D 3O6FA 1P4LB 3B83A 5CBAB 4RGND 2Q8AH 3RWCB 3BP6B 3C5JB 3GSVA 1KPUB 3SDAD 4OM0H 3C5SA 4JDZB 4AEFA 1EUUA 3IJHB 2AJUH 3S8WA 5IEHA 1CQYA 1S5HB 3CU7A 4P2QB 3K81A 3WJLC 3SDCC 4BSWB 3C5ZD 5EN2A 2EDOA 1L9MA 4UV4L 5DD5L 3D87B 2FJFA 2GKIA 2G75A 4PGEA 1JNHB 1FRGL 5D7KE 1OL0A 2QEJA 4Q9QL 2WBWB 3HAEH 4LLYA 1NCBH 4LLVB 5CEZL 4JO4L 2CSPA 1KIQA 3OGCA 2P5WD 3MJ7A 1CE1H 4GJTB 5GJTL 2YKLH 4AL8L 2X2YA 1QSFE 1M7IA 4JANB 4NNPH 1KPRA 1MCDA 2H2PD 1A0QL 4K8RL 1U8NB 3P30H 3QJFB 4NQEE 3LV3A 2FIKA 4WHDA 2XRAL 2VAAA 4Y4FD 2E9IA 2ZKHL 5JO5A 3CUPB 2DMKA 1PLGH 4NHCH 1CL7L 1EVTC 1DJSA 5D96C 4ZS6D 4ODHH 2XOTA 3G9VA 5BV7C 2D7QA 5AZ2H 1FNSL 4BFIB 3RAJH 1CCZA 3ARBB 1KCLA 3Q6GL 2NTFB 4N8VB 5FHBH 4Z77A 4MA3A 2NY4D 2B2XH 2N7BA 4MD5A 5I8OL 1DQJB 3RVXD 1GZQA 1WLHA 1CGSL 1B0WA 4LLDB 1TZGH 5BO1L 2R2BB 5EZLB 3HZKA 2AXGB 2QKIB 2HJFB 4GW4B 1AE6L 2CIIB 4U7KA 1T66D 5FIEA 4LARL 2E7LA 4QOKE 3SDCB 5C9JB 1Z0MA 5FK9A 3G6AA 2FZ3B 3EOTH 4NZRL 4ZG1A 2CO7B 3G5YA 1I3UA 4NUJB 4DCQA 3NTCH 1CGTA 4X5WA 2BVQB 1YEDA 2YZ8A 4M8QA 1DBAL 2FNBA 2OJEB 1CD0A 3MRRB 4OLXH 4OQTL 3SCMD 4OI7A 1FZOB 3QNZA 4HFWB 3IU4L 4B7IA 1GGIL 3TIDB 1NLBH 3JV4B 5DJ8B 1BFOB 4CU6A 5I0DA 4JY5H 4Q2ZB 2EC9T 2P49B 5J6GB 5L7XH 5DI8B 3UC0L 3ISWA 5CEYA 3GIZH 1RMFL 4MMZC 2FHBA 3DXAD 1RJCA 3LAFA 2FB4L 5H8DA 1OD7A 3ZKQD 4XB8A 4PRIA 2P5EB 5FKAA 3CVIH 3LPGA 4X7TB 3N0PB 2D9QB 4D3CL 3SE8H 1HH9A 4ZO9A 5IT2H 5D96B 4JFDA 2EDTA 1R3IL 5DA4A 1VGEH 2E7MA 3I85A 2C9AA 3I3BA 4MHHI 4NWUL 5BV7B 5D1XD 4WEBL 1IAIM 3RVTC 4WNQA 1J5OL 1RULH 3BPCB 1IRAY 1P5VA 4MJ6A 3TM6A 2QR0B 3HRPA 1CU4H 4QXTA 5JDSB 3RTQD 4XMPL 4HBCH 4LRIC 4K23L 3QNYB 1XGYL 5DEGB 5EULV 4YHPA 4LASH 3ELAT 3O6KL 4Y1AE 4FQJL 3A6CH 2HTLD 2VISA 4BH7A 4K2UH 2VLME 3CXDL 4YXKH 1KC5L 3RL1A 3C2AH 1ONQB 4YHLH 3VRIB 4XCYB 5C0BB 3MRKB 5I1GL 4LEOB 5GS0C 2PXYC 4J6RL 1YEGH 2C3VA 3NACH 1F6FB 2C1OB 1N59A 1JF6A 1NMAL 4YHIA 2EE3A 2WWKT 4HS6B 2JCCF 5KSBB 3PV6B 3VH8G 1T7XA 2LAGB 1UCTA 4PRHB 2WINA 3REVB 1DUYA 2YBRB 2FLRT 4M62L 4MXQC 1QLFA 4EUPA 1X4ZA 3JV6B 1J0ZA 5C8JA 3G6JE 3GSNL 4XB7A 3EO1B 4NKDA 3UAJD 3MRQA 5JW3L 4KAQH 5C0GA 1FNEB 3RA7L 3TBWB 4Z6AT 5JUEH 4LFHD 3MV8E 1A6WL 4AIXA 4ZSOB 4P2RB 3DRTB 3HR6A 2IANA 3QZWG 1AGFB 4KKCC 1SJVA 3RX8A 4OT1L 3MRJB 3B5TA 1SYVB 4E0RB 2Q76B 4XPTH 4OGYH 2GAZB 1ROWA 5GGQH 3PWVA 5FGBC 2QLVB 4KVNL 4OZHE 4IOFC 2W0KA 1U8MB 3CZJA 4CVZB 3L95A 5FECB 1XF3B 5C7XL 1HN1A 2R2HB 4FTVD 4PG9B 4M7JH 5HDQL 1JE6A 2E3VA 3QUMH 1U2HA 2H6PA 1T21A 1G1CA 3ARGA 5KVFL 3O45A 2DQHL 1KJ2B 5A16B 1S9VB 1CLZH 2PXYB 4NN5C 2PTTB 4NSKB 5E95B 4JKWA 2YUXA 1AKJD 1NCCH 2VZTA 3M17A 4C83B 4HF5H 4P46A 5MEQB 3I9GH 3T8XA 4RCAA 1G7LA 5HHVH 2KQNA 3HCVA 5J13C 2W38A 3GUTA 3UDWA 1FH5H 3CH8A 3GMMB 2DS4A 1H3TA 2G60L 4B50A 1I1RA 5EZIL 3F62A 1EXUA 4GKNA 2JJSC 4MCZA 4L29A 3B5GA 2JB6A 2IEPA 1NPUA 4X6DA 1P53A 4ODUB 2DTML 2OR9L 2V2TB 1X5FA 3IXAB 4EIGB 1UQSB 3FQUB 1D5MA 1G7HA 3K0WA 4EN3D 2DM2A 1GCFA 4PLJD 3TVMC 4FS0A 1DP0A 3TWCL 3IKCB 5BRZB 1MRCL 2Y25A 4R4FL 1V3MA 3MJ9A 4UTBL 4UV4H 5DD5H 4JJ5B 5T3ZE 2IAMC 3L9RA 1T1ZB 1FRGH 3SE4C 4YIQA 4Q9QH 3EJZD 1CXHA 3QBTB 3AVEA 5KVGH 5CEZH 3OXSB 4OFYD 4JO4H 5GZNC 1KTDB 2Z91A 2EXYD 4NRZB 3VXSA 3U0TB 1QRND 4NN5B 3LQAC 2FL5B 5IVXE 4F2MB 3DXAE 2OCFD 3OGOE 3HNSH 4ZUTA 4AL8H 4X9GA 2A6KA 3OQ3B 1QKZL 5CP3H 5T1MA 1VA9A 1A0QH 4XBPB 1FFRA 5LBSL 4CU7A 4G8GD 4PJIF 4ODWB 1OLLA 1TTFA 1BGXL 2XRAH 3GBMH 4LCUB 3DTXB 2ZKHH 1TPXC 2X70B 5EOTA 5IFJB 4LQ1A 3BN9D 2X40A 1BX2B 1MCWW 4GAJL 2CUHA 4HUXA 4KDWA 1FNSH 4G6JL 1LHZA 1WAAF 2I26N 3Q6GH 4XX1G 2OTWA 3V79C 4GMSL 3TO4A 3JV5A 1FNAA 1FNGA 1HHGA 1XGUA 3MRIA 4I5BA 1ZGLB 5HJ3B 5I8OH 1PKQE 4WO4A 2XWTB 4LF3A 2A0LD 1NBVL 4QLRA 5I15L 3FFDB 5JW4Q 4HMCA 5CGMA 4G42A 5I1IL 2VB5A 3QJHA 4Y2OA 1A14L 3H9HA 1AE6H 3D25B 5EU4B 4YHNA 2GYSA 3WLWC 2QQKH 4LARH 2APVA 3AFLA 4PJBA 3V7AE 1KGCE 5EBLA 4NZRH 3MV9D 5DUPL 4QHLB 2IAMB 1EUTA 3TT3H 3QEGH 1KB5L 5C09B 4OZIB 5D8JL 4PJFE 3WXWH 1DLHA 2A77L 3BRDA 1OSZB 4L8SC 3MGTA 3IU4H 2DI7A 2H3NA 5BQ7B 2QQLL 4JPIB 3BEWB 4WHTA 5JA9A 3UC0H 3WE6A 3RVUD 2FB4H 1DTUA 5FM8A 3BPOC 4P99A 3F7YB 3RHWF 5AUMB 2EO1A 3JV0A 1KCUL 3QDGD 4OI9A 1TPXB 5ADOH 4JFPA 1BEYL 5JMOC 4D3CH 5I66B 4DZBB 2QTEA 4JHWH 2XN9E 5HHME 1R3IH 2Z8SA 5EBWA 4NWUH 3FO2B 4OD1L 4KJWD 1RZKH 4WEBH 1J5OH 1E0OB 4RMSA 5DRXB 3V6FB 3D18B 2ZG3A 4C4KT 3AU1B 3CGTA 3GMLB 1MHEA 1YYML 4XMPH 2A9ML 1MLCA 4FTVE 1CD1B 1JGEA 1PY4A 4KKLC 1Q1JL 2ZNWA 4KRMB 2AV7A 5D2LF 1ZLUH 3RKPA 1T89C 3O6KH 4FQJH 4TNWK 4G9FD 3CXDH 1KC5H 1F13A 2Q7NA 5DO2C 1I1YB 1IE5A 4EDWH 1I8IB 3KYOA 4XPGH 2NY2C 3ULVF 2UUDH 5EU3A 4DFHA 1NMAH 1H0DB 4PRPD 5E6IC 1A1NB 4HDIA 4WUUD 1RFDL 3RVVC 1I1AC 1WWCA 1FL6A 3K4ZA 3I6GB 4L8SB 5IQ7L 3UPRA 4HJGB 3IDJB 4IRSC 3STZA 4DKAA 5IV2B 3DECA 4ZD3L 1EO7A 4M62H 3B6SB 3VXPA 3BPOB 1MWAH 4TSAL 3GSNH 3GJEB 5JW3H 4XNYL 2EIDA 3RA7H 1FFPB 2NX5D 1A6WH 1J8HE 1KBGL 3QO0B 4YPGA 1S9WB 3MSPA 3LRHA 1E27A 3VFOA 2NYYC 3WIFA 2W07A 4RIRB 1K4DA 5KSUB 1LEIA 5FKPA 2NY1C 5ALCH 4OT1H 3KPSE 4EI5A 4XI5C 5JMRA 3D39E 3OXRB 3EGSB 3PV7A 3NCEB 5JPNB 4IIQC 3I84A 1P4IL 3ZKMD 4APQB 4Y16D 3CMOH 1AY1H 1IQWL 4ZPTB 2V7NB 2F53B 2I07A 4MA8L 5IW1B 2HLFD 1GJIA 5AAMA 1R3KA 2DI8A 2MPAL 3HZVA 4L5FL 5HDQH 3MACL 2E6JA 1QRNE 2DQIL 5E1HB 3GSRB 4MX7B 3WDJA 2XFXB 2NY2B 5TF0A 4JY4A 5FAAA 3VFWB 2X4NB 3NCJL 4GH7B 1LP9E 3TA3D 2D0HA 1U93B 1AGBA 2BSSA 3X14B 5E6IB 1LNUA 1W0VB 2BVTA 4QY8A 2K3TA 1I1AB 1S7VA 5LQBL 3BUYB 4WI6A 5INDB 1ACYL 3IRPX 4IRSB 5CS7A 2ATPB 1NMBH 2FO4B 2EC9U 4RA0C 3GNMH 4KDTA 3T77A 5DHVA 1BD2E 1HYSD 2G60H 1WF5A 5E00B 4LCIH 4JRXD 1NJ9A 3C5ZC 2X4QB 2LQRA 1XZ0A 3V5KA 4D8PB 1IAII 4EDXB 1OW0C 4YC2C 2DTMH 4O51A 2OR9H 4Y1AB 3O3UN 4QGTA 5C0FB 3KPRB 3VD4A 1MEXL 4NZJA 4X6CE 2VSCA 1ZHNA 4LPUA 2NY1B 4NNXB 2R15A 1V7NL 1IAOB 5EBMA 2WNGA 2BOCA 1IEBA 2K9UA 2D7NA 2V7HA 1UVQA 4YWGH 1QO3B 3RP1A 3DO7B 3P9MB 1ZANL 4PJCA 4Z9KB 5GRUH 5BVPL 2NY0C 4IIQB 1MRCH 3CIQA 3VGGA 1UZ6E 4M3KB 1K85A 3E3QC 5IG7A 4MNGA 3P73B 1ZVSB 5CJ5A 3P3YA 3W9DA 4LMQE 4JR9L 5IR1A 2Q1EA 4XVSH 1YMHA 2B1HL 1Z6JT 5EUOF 5F1NB 3V6BR 1G7JB 4NYLB 1U8LA 1NDMB 3G6JB 4E42B 1QKZH 2VZ3A 4U1KA 3QDGE 2YA1A 4U3XA 5LBSH 1S7QB 3UYPA 4E9LA 4JQXA 3QDJB 2ZPKL 1VKXB 1NFIA 4HUUB 4ZDHB 3S35X 3MODL 1ZEAL 1CE6B 3GMRA 2GJZA 3LPFA 4R8WL 3OKNA 2I60L 5GRYA 2HVKB 2ITCB 3PDDA 4GAJH 3ZHKA 3QXDA 4OV5A 1MFAL 3EO9L 1E4XL 1HOCA 2W0FB 4EOWH 4EXPX 3T0AA 4G6JH 1RJYB 1KUMA 3VWKD 5FUZH 4GMSH 2PUQT 3KWWA 4FQCL 4M61B 5L8LB 3CDGA 4NM4L 4S1SH 2FATH 5CINL 4YC2B 5DJ2A 5DRZA 4LPYA 1MFCL 1NBVH 4JN2A 4G9FE 1MIEL 2GTWB 4ZFFA 1XF5B 5I15H 3L3OA 3RWHB 1X5LA 3GMPA 3ME0A 1PQZA 4TPRL 2DQFB 3S3SA 1FVCA 1BOGB 4U4BA 3DO3A 1A14H 1FZMB 1G7QA 2NY0B 2YN3A 3KPTA 3ARTA 3MCLH 4GRLA 3FONA 5J1TC 4PRPE 2DL9A 3I75B 1VB9A 2J4WL 4JFHE 5DUPH 2XYCA 2EE2A 2HN7B 4DVBA 4U1GC 1RK0B 1KB5H 3QEQA 5D8JH 4I9WE 1V7ML 2WWMC 4Y5YA 5D1XC 3C6SB 3QQ3B 3PWPA 4UTAL 2QQLH 3P4OB 2EC8A 3JWDC 4DK6A 4RX4A 4EXKA 2NX5E 3TBSB 2DJUA 1EEZA 3HC3L 1D9KA 3CVHB 5DJCA 2OM5A 2F58L 1RU9L 1KCUH 3RWIB 3JZ7A 3MGAA 3V52L 1BEYH 2KZ1B 2VZVA 1ZS8B 3M1BB 2HWZL 1OSPL 4KJYA 4GSDH 3MV7E 1DBBL 3QXAA 1AH1A 4QRPE 1CGVA 4I48B 1T03L 3FB8B 3FB6A 3WSQL 4HGKC 3BJLA 5EOQL 4TUKH 3BZFA 2VH5L 3IDNA 4JM2F 5CGYC 1YYMH 4MQXD 2A9MH 4PP2B 1C12B 3BP5B 5E8EA 4FMKA 1BP3B 2VWEE 1P7KA 1Q1JH 4WV1C 4Z7UE 5IBLC 3ZDXE 5GGVL 4Y88A 5DTFB 1S9YB 1WICA 5CZVL 3GHBH 1UG9A 1MHHB 3QXWA 4TRPL 4GXUN 1AP2A 1PG7X 1G7PA 3T4YA 3UAJC 1JPFA 1Q38A 3BSZL 1VFUA 1PEWA 1HKFA 3RIAK 3DNKA 4U1GB 4V1DD 3KPNA 5CJOL 4G8FB 3EYFB 3MV9A 1RFDH 3VD5A 4P9HL 5IQ7H 1G7IB 1P4LA 4OIAA 4PREB 5CBAA 1UKSA 2VJXA 3RWCA 3BP6A 3C5JA 4HKBB 2EDEA 1AHWA 3U46B 4M7LL 4KV5F 4G3YL 4JDZA 3IJHA 3RZCD 1QZ1A 4OM1L 4HEME 4TSAH 3WYRA 4BQBA 1GGUA 4XNYH 1X7QB 4P2QA 5CD3B 2WSKA 4BSWA 1MI5D 3P0VH 3AMLA 1KBGH 4MGXA 4MZ2A 3LRSB 3WUWG 1Z5LB 4F9PC 5D7SL 1I7UB 5HYJB 1JNHA 4KXZI 4GO6B 1UA6H 3KNBB 1VEOA 3T04D 2EIBA 4DVRL 1OAQH 3WFDL 4LLVA 1I85A 2WBJD 1DQTA 3AXLA 3BO8B 2FGWH 3VCLB 7FABL 5KN5B 4JANA 1P4IH 4YDIL 5HD8D 4J8RB 3UJIL 4A6YB 1DDHB 1WT5C 1N7ML 1IQWH 3QJFA 4WV1B 1ZLUK 2XTJD 4U31A 2MPAH 1I9RH 3ZKXC 4JRWA 1ADQL 3MACH 3CUPA 5FV1L 2OZ4L 5DSCB 4XNQB 4G43B 5CMAB 4OTXL 4OV6F 1MCHA 4F37F 3NCJH 4FFYL 1UWGL 1H5BA 4BFIA 1MSPA 4OZFB 3ARBA 2NTFA 4N8VA 5DXWA 1BJMA 2QQQA 3SE3A 5B3JE 4K3DH 1LEKB 1CICC 2XN9B 4OSUL 5HHMB 5LQBH 2VDKL 4NJ9H 1DQJA 1ACYH 1PKOA 3IAQA 1YUHB 1ZKAA 4LLDA 1B90A 5J1AB 5FDWB 2R2BA 5EZLA 1V5JA 2QKIA 2XICA 1ZLSH 2HJFA 4TUJB 1K4CB 1MLBB 1CVSC 4GW4A 2CIIA 2GT9B 4I0KA 5MEPB 3SDCA 5C9JA 5A43C 1LO0L 2FZ3A 4CNIB 3VI3F 4NUJA 1UM6L 3E6FA 1A9EB 4O00A 1MEXH 4L8CB 1AXSB 4P2OD 4CVUA 4DUXA 1RHHB 5HPOA 1RQ5A 4ZUSB 5EBGA 2OJEA 1W0WB 4ZFOB 1FZOA 1V7NH 1AKJB 2KKQA 4HFWA 2ILLA 5F1SA 3QEUB 1ZANH 5FM5M 3TIDA 3JV4A 5DJ8A 5BVPH 2FO1A 5J6GA 2ADJA 1JPSL 5DI8A 4JFFD 2WZPD 1P7QD 1VFMA 3V0WL 2P5EA 1D6EB 1GGCL 3ZKXB 2ATKB 1EGJL 1NCTA 3QQ9C 4X7TA 5CEZD 3PL6C 1ED3B 1BLNB 5E5UB 3QIWD 1PSKL 2ADGB 1EJ6A 2B1HH 4IM8A 1F11B 4X7FC 4LPCA 1OARL 5DRNB 4HCRA 4K8RD 1XFPA 2QR0A 3HZMA 4W4NA 1J8HB 1MRDL 1CICB 5JDSA 2ZPKH 4ELMF 3QNYA 3UCRA 5DEGA 3MODH 3H9YA 1UM5L 3DETC 3E0GA 4R8WH 3VW3L 4X4YA 2R8SL 1IVLA 4Z7WB 4U0RC 3D9AH 1MFAH 3KPSB 3LMJL 3EO9H 1ONQA 2E8ZA 3D39B 4HPYL 1S78D 3EAKA 3VRIA 4XCYA 5C0BA 3G5XB 4KK9D 4LEOA 4FQCH 3IDXL 1OAZL 5CINH 2C1OA 2DQUL 4I3SL 4JRXA 3IJYB 1NBZB 1LWRA 4Z7OF 1VDGA 1MIEH 4NO2B 4HS6A 1JZ6A 5GISL 2XKNB 3GM0A 4ETQB 1I7TB 3PV6A 4ZO8A 4TPRH 1TTGA 3VE0B 4MJID 2XQBH 5D71L 3MRFB 3TN0D 1OWWA 4PRHA 3REVA 2YBRA 4ZFGL 1PX4A 4V1DE 3JV6A 1NBYB 1J1OL 5DZLA 2JELL 2APBA 3EO1A 4HXAL 3KJ4C 3QA3B 1FNEA 3TBWA 4OCSL 4ZSOA 3PL6B 4P2RA 1F58H 5D7IE 3DRTA 1OWRM 1WAAE 1G6RL 3O9WC 1IC5L 4ZUUA 1BD2B 4UTAH 1AGFA 4CUCA 5JOEA 5C0AE 3PQYD 5E9DD 2QHRL 1SYVA 5DFTA 2Q76A 4E0RA 1MCLA 2EDLA 3W39B 2GAZA 2VNCA 2PCPB 3DRQB 3SKJH 1RU9H 4LRIA 4XAKD 1HSAB 1U8MA 3V52H 4RGMC 3JWOH 4CVZA 3AY4C 3TFKD 5AG9A 4X6CB 2CKBL 3DPBA 4NJAL 4U1HB 1P9MA 2HWZH 1OSPH 1WFOA 2R2HA 4U0RB 4PG9A 4NCDA 3WSQH 4BUGA 1KJ2A 3H3PH 1S9VA 3WLBB 3ZLQC 2PXYA 5ALBL 2VITB 3LQZB 2PTTA 4NSKA 2VH5H 2IJ0C 3OF6A 1J0KA 4YEEA 1MF2L 4TTDC 5MEQA 2VMFA 2VOTA 2H45A 4J3TA 4GRMB 2N4IA 1SJEB 3ETBF 1NL0L 4PJHF 5GGVH 1CGUA 3BGMB 2AW2A 4J7RA 3NMEA 5C2BH 5CZVH 1VACB 3GMMA 4U6XB 2YD3A 1M71B 4F80A 2JB5L 2ESVE 1INQB 3RPKA 1XEDA 1EH9A 3EO0B 4X7SL 3QISA 5JPMB 3UP1A 4FP8L 1TDQA 2BVUA 3BSZH 3FHQA 1J0HA 3QYCA 2IFGA 4JGJA 3KJ4B 3SGDI 3NCYS 3BYYA 4NPYA 4UILL 4J3VA 4P4KC 2J12B 4ODUA 3O9WB 2V2TA 3GRWL 3ZL4L 4P9HH 1NGYB 5DT1H 1UQSA 3FQUA 2C4FT 3MTRA 3U7AA 1QR1B 4M7LH 3T2NL 5TE6H 1F8TH 2YN5A 1G9NH 3SDDD 4OM1H 1YNKL 1MQ8A 3IKCA 5SWSD 2IALB 2O5YL 5BRZA 1N64L 4RGMB 3T0ED 3QFJD 2VWEC 5E56A 4JJ5A 4NQCE 3MLVL 2R0LH 1FSKC 1OLZA 4N0CC 5D7SH 1T1ZA 5K93A 3T0XA 3MBED 4GAYA 2UY6A 4C56D 1R5IA 4DVRH 2NXZC 2WV3A 3WO3B 3OXSA 4AEIL 3V4PL 1KTDA 2YD9A 3PGCA 2AVGA 4NRZA 2JJUA 3U0TA 2NZIA 4PJ8D 2FL5A 1KCRL 5HHNB 4F2MA 4PRPB 7FABH 3OB0H 3ROOB 4YDIH 2QSCL 1CXEA 4OZGE 3ZYZA 1N4XL 3FFCD 4XBPA 4U1MA 3HE7D 1N7MH 4ODWA 4PJ7A 1N6QL 5CEZE 1EO5A 5HDBF 4NKIH 3GSOA 4I1NB 2P45B 5FEBA 3HR5B 2DJSA 1KTRL 2ZNXA 3DTXA 2X70A 2OZ4H 4Y4HD 5IVZA 1F3DJ 1W72L 3B9KC 1BX2A 4FQHB 4UDTB 4OTXH 4FFYH 3MA7B 1UWGH 4NN7C 4WU5B 4KK5D 5IFAL 2JJSA 3BRGC 2BP3A 1MCPH 1M7DB 2DD8L 4YXLL 4P4KB 1ZGLA 4J4PD 4OSUH 3VWJD 2XWTA 2VDKH 3M45A 1SY6H 4NIKB 3LKRB 3W5NA 1CIDA 3MV7B 1AIFB 1NCWL 4ZAKC 4QRPB 3FFDA 1EMTL 1EO8L 3BD3A 4N1EA 4QYOB 2EYTB 3D25A 5EU4A 1NCDH 4H5SB 3MROB 4JFZL 2YPKB 1AXTL 2X9XA 3KLHD 3WNPA 1WUNT 4QHLA 1FSKB 2IAMA 1OPGL 1UM6H 3FKUS 4YHKL 1CFTB 3SE4A 4M1CD 5IEKB 4BQ6A 3QHZH 2NXZB 4MJIE 5C09A 4OZIA 2A83B 3OR6B 1FGVL 1YPZE 3U1SH 2Y5TB 4RFNC 5E8OB 4QEGA 1OSZA 5KJRL 1R6VA 2YA2A 5BQ7A 4JPIA 3BEWA 4RFOH 3P0YL 2VUYA 1JPSH 4I4WB 1NCNA 5EFIB 3QB7C 1LDPL 5SV4A 1YY8A 3V0WH 3F7YA 1GGCH 3L3JB 3LDBC 3TH3T 4EKXA 4CDHA 1KEML 1EGJH 4XNXH 3S97C 1HI6B 5I66A 4DZBA 3B9KB 2H8PB 3STBA 4WFED 3PQYE 1PSKH 1CIUA 4YDVB 5E9DE 3FO2A 4NN7B 1A7BA 4M1GL 1A6ZB 1F4XL 3OL2A 2X1WL 4RQQB 4KQ4L 4IRJD 3V6FA 5DRXA 2B5IC 3D18A 4XAKE 1MRDH 3AU1A 4QWWD 3T3MF 5LGJB 3GMLA 2IPKB 2VLLB 1MAML 4X9IA 1QFUH 2BOBB 1S7XB 2HA1A 1INEL 1CD1A 4ZAKB 3N1MC 3VW3H 1X5GA 4UU9B 2BNQD 2R8SH 4X6FB 1NGWB 4UBDD 4HJ0D 2OTUB 1I1YA 3MLRL 1H15B 2GY7B 4HPYH 4M7LT 3NCCB 5DJ0A 1I8IA 2JCCB 4DQOH 1WCQA 4J3WA 5DLML 3IDXH 1OAZH 1DQDL 4S1QL 1JYXA 2DQUH 4I3SH 5IK3B 3RI5K 3IGAB 3WFBL 1H0DA 3VXTB 3N9GL 3WKML 1A1NA 1FE8L 5GISH 1FHGA 5MHSE 4Y89A 4RFNB 4GKOA 1F4WH 1QACA 1I75A 4L8SA 4HJGA 2RR3A 3IDJA 4OF7A 5D71H 4MNHB 3NIDE 5IV2A 3CZFB 3DUHA 3HI6H 2HRPL 5I1CL 4ZFGH 3L5XH 3B6SA 4YDLB 2YC1B 3BPLC 4FQQB 1J1OH 2JELH 4HXAH 3GJEA 3LDBB 1FFPA 4JFFA 5DF0A 4QKXB 3KJ6H 3CSPA 1QLRB 3TZVD 3F6LA 3QO0A 3WN5C 4HG4K 2RIKA 1IC5H 2XPGA 3ZDZE 4PGBA 1QBLH 2HFEB 4KJPC 5E24E 1BQLL 2J1KA 1J10A 2B5IB 2RFXB 4DW2H 1BIHA 1FAKT 5C0CA 1WIPA 5L2KE 3S98A 1GYAA 4YGVB 5GIRA 5I17B 1EFXD 3T0EE 1JN6A 3EFFB 3RUGF 2KH2B 5JPNA 4XCFH 4APQA 1RJLB 4DWHA 4L3EB 3H9SE 2Z92B 4R7DB 4NO0A 4ZPTA 2V7NA 2F53A 1T89A 2CKBH 4NJAH 4OLWL 4YZFF 4C56E 5IW1A 4S0SD 1S7RB 5EC2B 4PJXF 1B6UA 3GSRA 4MX7A 2XFXA 2X4NA 2BHZA 4NFCA 3FFCE 1A3RL 1U93A 1MF2H 2BSRB 3GEWB 3X14A 5E6IA 1ZMYA 2M1KA 1W0VA 4H26A 3QWRA 1I1AA 1NL0H 1Q0YL 2Q3ZA 4LBEB 4HZAA 3BUYA 1K3ZA 3QUZC 1U8KB 1PG7W 4IRSA 5DUML 5DD6B 2FO4A 2JB5H 4JM4L 2J8UE 4TVPL 5F44A 5EO9B 5IBUG 3RY6A 4FP8H 1CQKA 3BPLB 4Z8FL 5EA0L 1JPST 5E00A 1YEKL 2X4QA 1DVFC 3BZDA 2PR4H 4D8PA 1FG9C 4DKDC 4X9HA 4DGVL 3WN5B 4EDXA 2FSEA 4Y1AA 3GRWH 5C0FA 3KPRA 4JPVL 3U6RB 3MGOB 3DUSB 4G7VL 4IEFB 2F19L 4UIKL 4X6EB 1BAFL 1BBDL 4NNXA 2MFNA 1IAOA 1Z9OA 1ZT7B 1XGQB 1RSFA 1QO3A 1HQ4B 3NA4A 3P9MA 1WISA 5HD8C 3T2OA 1A7NH 4IIQA 1N64H 2DYPD 3QO1B 5BJTA 4XVJL 4X5XB 3HG1E 4G8IB 3IF1B 1ZVSA 3RY5A 1UXWA 2X5PA 3L6FB 1WCBB 4DN3H 1H3VA 3KYAA 1MFDL 4PJIB 3TH2T 1NAKH 3FN9A 5EWIL 2HT4D 2XZCL 4KDVA 5F1NA 5KSVB 1KIPB 1MCJA 1G7JA 4NYLA 4Z7VE 3G6JA 4E42A 2JIXD 2X4TB 4J3UA 1S7QA 1N6QH 4BUHA 1NSNL 3LVEA 3NPSC 1J8KA 3QDJA 2ED8A 4YQXL 3LKOB 5CBEB 2MHAB 2VE6B 4GG6E 4I3RL 5D7IB 4ZFZB 1VKXA 1OGAD 4LPWA 3QUZB 1MVFA 4HUUA 4ZDHA 2M8XA 5IF0B 1BJ1J 5D6DC 1GOHA 2W65B 1NUGA 2HVKA 2ITCA 5C0AB 2O5XL 5IOPB 5IFAH 2W0FA 4XCCH 1RJYA 1U42A 5HGHA 4X99B 2DD8H 1DVFB 4G8EB 4YXLH 4R0LC 4M61A 4QRSB 1Y0LA 3X11B 1OW0A 5C70A 4HKXA 2NW2B 5J3HD 5DMKB 1PZ5B 5D7LD 3ULVC 5JHDD 2GTWA 3UTZB 3KAAA 4Z7QE 1XF5A 3RWGB 5ADPL 3RWHA 4YGAB 1EMTH 2FBJH 2VO5A 2DQFA 1IGJB 4HK3J 1BOGA 4JFOB 5JXAL 1EX0A 4JFZH 4LCCC 1AXTH 1UFUA 3QUMB 2CO6B 4NQXB 1L7IL 3I75A 5CD5C 1CN4A 4N90D 5FGCE 2Z31D 4AEHL 5SWSA 4WWKC 2HN7A 1JNNL 4YHKH 1P5UA 3VRLE 3OR7B 1RK0A 2JF1A 4LSSH 4H1LB 2ESVB 2B20A 5ESVB 2OP4L 3C6SA 3QQ3A 3HKFA 1MAJA 1I8MB 3VRJA 1TITA 3P4OA 3OB0K 1OAUH 1JF5A 2EO9A 3ULUL 5IESH 3CVHA 1X3DA 3NPSB 3IFPB 3RWIA 4RA3A 1KEMH 3D3VB 5F7NC 2D03L 4GAGL 4QNPF 3WFHB 1ZS8A 3M1BA 2F5BL 4LPXA 4LSTL 1F4XH 2BCKB 5DS8B 2X89A 4HIIB 5F96L 2BZDA 4I48A 3UTQA 1UEMA 3FB8A 1I8LA 4R0LB 4MDJB 4QCIB 5JOPD 1KB9J 25C8L 3IS0X 2FD6L 3FRUB 1CWVA 4NQCB 1MAMH 4PP2A 1C12A 1JJUA 1GHFH 2C4FU 2ADFH 3BP5A 1KIRA 1INEH 3HE6C 3H8NA 4GG8A 3HUJE 1MCOL 3FT4B 2EZ0C 5DTFA 4MZ3A 4Z0XA 1S9YA 1FLTX 35C8L 5B38B 3S96B 4XRCB 3OB8A 1MHHA 4YHZH 2X05A 1T6WA 2X4SA 4LCCB 4EUPG 2F15A 3FL7A 4KI5D 4WWKB 4Z95L 1BZ9A 4WGWB 5CKGA 3WFBH 2R56H 3N9GH 2ENSA 4NN6C 2R1YB 3WKMH 3EYFA 3ARFC 4JFYB 5DURB 2ZOKB 4M9OA 2MQ3A 1G7IA 1HHKB 4MYWB 4H88H 3U46A 1IC4L 2HRPH 3MNVB 1T04A 5EG6C 2DLEA 3TJEL 1JHTB 4HIEB 1X7QA 5TDOB 5CD3A 2HKFH 5DEZA 2ZSVB 1UADC 3LRSA 1RZKC 4RMVA 1Z5LA 3VXUB 1I7UA 3GBNH 4XAWL 5HYJA 5KANI 1WBYA 4GT7A 3QHFH 3QI9C 2F74B 1P84J 5E2TH 1NQBA 1BQLH 3S36H 4YHOL 4MVBC 3BO8A 3HI1B 3VCLA 5KN5A 4J8RA 4R2GD 3HE6B 2FEEL 4A6YA 1DDHA 4WV1A 4X83A 1SJHB 1YPZB 5KG9B 2ED9A 4OLZL 4JCMA 4ZNEA 5KTEL 1RPQA 5DSCA 1G7MA 4XNQA 4G43A 4O9HL 2XACC 5CMAA 1DEDA 1NUDA 3K74B 3LB6D 1AC0A 3GSQB 2XG5A 1LK3H 3RY4A 5C0EB 5T1DL 4RWHA 3GJFH 1A3RH 4OZFA 5CILL 2GUOA 4XP6L 1NC4B 5BZDB 1OGAE 4NN6B 1M4KA 3ARFB 1FC2D 3FQWB 1LEKA 1Q0YH 2XN9A 1J11A 3TNNB 1ETZB 4RNRA 1KJ3H 1OAXL 1YUHA 3NAAH 5INCB 5J1AA 3O4LD 2AJSL 1CTOA 3KXFB 4TUJA 2A74B 1K4CA 5EA0H 5H37H 4Z8FH 4D0CB 1YEKH 2GT9A 1EVUA 2UZYB 5MEPA 2OK0L 2EE6A 5DHYB 4DGVH 1LO3L 5JHDE 4CNIA 3MBEC 4PJEF 3VGFA 2EDBA 4XH2B 1A9EA 4JPVH 4L8CA 3GKWL 4G7VH 2F19H 2RGSA 3QI9B 1AXSA 4LU5L 4UIKH 1RHHA 4ZUSA 1BAFH 1BBDH 1JRHI 1W0WA 3GGWB 3MRNB 2AS5M 3DROB 4XTRC 4OGAC 1RZ8B 2VN4A 3QEUA 4Q74A 4CJ0A 4X9FA 1NLDL 3L3KB 4XVJH 1FPTH 2DQTL 4FXKB 4XPBL 5C08B 1WT5A 3MJ9L 5TH2B 2I5YL 4XC1L 1D6EA 3MC0A 4NQSB 3BJ91 2ATKA 3RNQA 5FO9B 1HWHB 1S9XB 1MCWM 4L4TE 1ED3A 1MFDH 1BLNA 1RUQL 4XP4L 1BF2A 2ADGA 4R4ND 4CADA 1QNZL 1F11A 5DRNA 4FFWD 1BWMA 3S37H 1B0GB 3D6GA 12E8L 1J8HA 3VXMD 1NSNH 4FHBD 1CICA 4YQXH 3MCKB 4I3RH 4UT6L 3JVGC 1MWAB 3MRGB 4JN1L 1U3HD 2XA8L 4Z7WA 5T1LB 3KPSA 3SJVB 2O5XH 1XF1A 5L2KB 1EBAA 3D39A 1A9BB 4H0HB 3DX8B 5JOPE 3G5XA 1OP3H 3VMNA 4PJ9D 1WFTA 1T3FB 3H9SB 4O2CB 3SGKA 3ZHDA 3MBEB 1FBIH 4XBEL 4I13B 3IJYA 4P9ML 1NBZA 4NO2A 3BP4B 5MENB 5ADPH 2XKNA 4ETQA 1I7TA 2X10A 4DOHB 4HX1B 4PR5B 3VE0A 2X1XR 3MRFA 5JXAH 1KTKE 3MUGB 3QG6B 1AGEA 4KI5E 3TJHD 4Z7NF 1VPOL 1QLEL 5KSBF 2X4RB 1IMHC 1WFUA 3E8UL 1LK2B 5HGGS 3MX0A 1NBYA 3LQMA 3EHBD 1JNNH 4ACPA 3OKDA 3QA3A 4FG6D 3PL6A 5H94B 1Q8MA 2AI0L 5I1EL 1E4JA 2OP4H 3UTSD 3MV11 5A2FA 1P4BL 3X3GL 1BD2A 4JZNB 3PGDB 2R69L 2ZP0T 5DEFB 2Y4SA 2OTPA 4ZUWB 3SKUD 3ULUH 2P7TB 3W39A 1JYWA 1H8NA 1YEHL 1DBML 2PCPA 3DRQA 4JRYB 4KTDL 1HSAA 5IQ9A 5DD3L 5F9OL 2FECL 2BY3A 2D03H 4GAGH 4X6CA 5M95B 5B3NA 4U1HA 2FX9L 1GXEA 2F5BH 4LSTH 5LXGH 2P46B 4WW2C 3EYOB 5J1SC 4PFEA 5CZXC 3UYRH 1MJ8H 1YJDC 4TSCL 1H3PH 3WLBA 3HG1B 2CK0L 2VITA 3LQZA 1CG9A 5LWYL 3EYUL 2DLGA 2FD6H 4FOMA 3V9FA 3C6LB 3DVNB 1GRWA 3ZT6A 3U36B 4GRMA 4ZOAA 1MCOH 2FDBP 4XMLL 5J56B 1SJEA 2BNRD 4OFVA 5L6YH 3BGMA 3FO9B 4JKMA 5BS0D 5IMLB 1T2QL 1VACA 35C8H 4MNQE 4U6XA 3WNKA 4OFDA 1INQA 5DYOB 1IEHA 4RDQF 3MOQA 5JPMA 1N6UA 4ONHB 1VADB 5MERB 4ERSL 2YUZA 4KK8D 4AJ0A 2YXMA 1QYGL 4M6OL 4GG6B 1P2CB 1NGPL 3W9EB 4P23A 3WXVH 1SQ2N 4L3AA 1ZT1B 1OTUD 3O9WA 4J2XA 1F90L 2XZAH 4KHTL 1A6VL 1BPVA 1UC6A 4P5KB 3EOAB 1QR1A 5ISZD 4EUPH 5L2JB 5J9PB 1A1MB 1A47A 2N1KA 1K6QL 2IALA 1HILB 1VEPA 1D5XB 4B53A 3AY4A 5C07A 1N5YH 3QXUA 3R06B 1ZVHA 3QUYD 4PB9L 1ND0B 3BP7B 5D9SB 3GMOB 4WW2B 2R9HC 3GM8A 2OMBA 4YHOH 5D5ME 4G6ML 4XNMB 4NDMB 4S1DC 5HHNA 3QNXB 2A2QT 3QULB 1CDHA 1IM9B 3DYMA 4X80L 1KENL 3HLAB 3MLSL 2EDFA 3VJ6B 1OAKL 2UWEF 3MUY1 3MOBL 1U3ZA 3HR5A 1KXTB 4OLZH 1CDCA 1OTTD 5J6HB 2QSVA 3EYQD 5TE7H 4XXDB 2O93L 4PGDB 2W9LA 5I16B 1HKLL 4O9HH 4FQHA 4UDTA 1WZ1L 2Y36L 4ZS7H 2IF7A 1MJ7L 3P77B 3MA7A 4WU5A 4P5TD 1F6AB 5CILH 2X4OA 4BQ9A 5B4MD 4H25B 4XP6H 1FYTD 3P4NB 4P4KA 3RGHA 5I30H 2PW1B 2OR8A 1I3GL 1U8IB 2W9EH 3LKRA 4BFGA 4H8WL 5C6PB 2WIMA 5DC0A 3MV7A 1OAXH 1AIFA 2NZ9C 5CWSA 2PO6C 1F3RB 4BK5A 3QIUB 2AJSH 3FHAA 2M26A 1NFDF 4HIHB 5EH1A 1PVHA 4QYOA 2EYTA 3F7PC 2CRYA 3MROA 4H5SA 3ZE0F 4UQ2A 2YPKA 2JLLA 2OK0H 1FNHA 3K4DA 5F88B 2YD7A 4IJ3C 1LO3H 3R0MA 3RX7A 1KCVL 1WZMA 4TTGA 4Q6IA 3ZE2F 1CFTA 1AC6A 5A2JH 1K5NB 3GKWH 4FQXA 1H8SA 1T83C 3OR6A 2HT2C 5FYLH 2Y5TA 5E8OA 3Q2CA 1GIGL 1R5VA 5E99L 2YPLA 4M48L 1N0XL 3HTLX 3QUXC 5EFIA 2DQTH 3FRPA 3ZTJG 3MJ9H 2CMRL 1MCKA 4YFEA 2I5YH 3BIBX 5T33L 3CJJA 2CDGB 2UYLB 2YR3A 1J1PH 3GMNA 3L3JA 3OKMB 4LGSB 3UTSE 1HI6A 3DIFB 3B9KA 1JHLL 5H2BA 1RUQH 5IROC 4YDVA 4ELMB 4G7YL 1A6ZA 2E27H 4F8QA 1QHOA 1QNZH 3BX7C 3GJFK 3V6OE 2R29L 1S9KC 12E8H 3OKKB 2CLVB 4L1HA 1TVHA 5JLZB 2IPKA 3JTTB 2VLLA 5FM4A 4UMGA 2BOBA 3OBAA 1Y6MR 1S7XA 4KU1A 4ZAKA 4LL9A 4ORGB 1I8KB 4UU9A 5SX5H 2PO6B 3MXVH 2XA8H 1NGWA 1D7FA 1E28A 4I0PD 2OTUA 3LS4H 1MJUL 1H15A 2Z8WC 5IUSA 2JCCA 1DQML 5I75C 4KZDL 1RIHL 2Q20A 5EU7E 4IJ3B 2H1PH 4X4ME 5C3TA 2ZUVA 4P0DA 5HHOB 4XBEH 3IGAA 4P9MH 3VXTA 3CSYB 1UKQA 3RJDA 4LCYB 4HLZG 4Y4KD 4LLAA 4MNHA 4FQ2L 3CZFA 1RZJC 3DVGB 3QUXB 1VPOH 2WUBL 3BHBB 1ZWIA 1T5WB 2YC1A 1BECA 4FQQA 2VDQL 4BK4A 4I2XE 4KJQC 1L0YA 1Q9WB 1QLRA 5JORA 1XGPB 2AI0H 3BVNA 3ZSSA 4YFLI 5I1EH 3V4UL 1TJGH 3X3GH 5JW4R 2HFEA 3RQ3A 2R69H 3F58L 2J88L 4BH8B 2RFXA 4JKKA 3AS3A 3QG7H 3UO1L 3VFTA 4Y2DC 4KKNA 4YGVA 4NT6B 5I17A 1YEHH 3EFFA 4OD2B 3RKDD 5GS3A 4KTDH 1RJLA 3B2UD 4L3EA 3QPXL 5F9OH 2Z92A 4R7DA 4QXUH 4XP9H 1NC2B 3IFNH 4PLNC 2IPUK 4NQDD 1HSBA 1UGNA 1S7RA 5EC2A 5JIIA 3NN8B 4IS6B 1DN0B 1KYOK 1U3HA 4UZGA 3S4SB 4PJHB 3X3FL 5I75B 1CR9L 1OP3K 2CK0H 4MMXC 5LWYH 4R9HA 4CN6A 3EYUH 4GBXD 3GO1H 2VLRD 1ZTXL 5DJAB 3TV3L 1Q0XH 2EDXA 3B9EA 4LVHC 2BSRA 1K3IA 4WJ5A 1NANH 4L4TB 4Z5RB 4LBEA 1FAIL 1U8KA 1T2QH 3ET9F 5DD6A 3VD9A 4UV7L 4HK0B 3LIZH 4HWUA 1TJHH 5EO9A 3U7YL 3BQUD 1JNJA 3KYMB 3TYFB 5CJQL 4ERSH 4XPFL 1M6OB 1A6TB 1DQLH 1HEZB 4M6OH 1X5XA 5CLTA 1NGPH 5HGAB 5L8KB 3WN5A 4G6FB 3W0WE 1TVBB 1JBJA 2Y9RT 1J0JA 2V2WB 1F90H 1RY7B 2VAJA 3U6RA 4KHTH 4HIXL 1X4XA 4LSQH 5J0BA 3K8MA 1JI1A 4X6EA 2FX7L 4P59H 5KSAC 4Y2DB 1ZT7A 1XGQA 2EIEA 3D85B 3JWOC 2HJKB 3CDFA 4JPKL 1K6QH 3MLXL 3VGHA 5DZOA 4X5XA 5T5FL 3OKEB 4HT1L 3AB0B 1SBSL 1O5DT 4G8IA 4YFDB 3IF1A 3CX5J 4PB9H 2PYED 2MOVA 4OFKA 3L6FA 2EH8L 1WCBA 1C5CL 3L7FB 3M07A 5D7JD 4PJIA 2DIJA 2CKNA 5EORL 1UJ3C 1ZLWH 5J89A 2Z93B 3H42L 1CXLA 4RMRA 3MRMB 4JHZA 2E7HA 5KSVA 1KIPA 4LLWB 2SEBB 5F9AC 4N8VG 2X4TA 1AD9B 3NABL 4LVHB 4X80H 1KENH 2Y6SD 2AQ1A 1OAKH 4M3JA 1I9JL 2EXWC 5FYJU 2MHAA 2VE6A 3G6JF 3MOBH 4JM2D 4ZFZA 3QUZA 1WAAA 5IF0A 2GCYB 3CK0L 2IFFH 1UWXH 2ZG2A 5JXEC 2W65A 3BH8B 2JK5B 3BMWA 2Y36H 5C0AA 2X44D 1MJ7H 4YBHA 1OB1B 3HI5H 3SDXE 4CVWA 5BS0A 1DBKH 3PNWB 5SX4H 2LFGA 2LU3A 4YDKL 1ZXQA 4X99A 1DVFA 4M4RA 4QRSA 5B22A 1QVOB 4G6KL 3G9AB 2MQ0A 1YNTB 1I3GH 2NW2A 4OZHF 5DMKA 1G9NC 5J06A 1KEGL 4PS4L 4TVPD 3RWGA 2VDLL 1IFHL 3C9NB 5KSAB 4CW1B 3DHJA 5DMGD 3C8KB 1IGJA 5L8JB 3OTTA 4JFOA 4ONFL 5CIPH 5GGTA 43CAB 1HCFX 1ZK9A 1Q94B 3QUMA 4NQXA 1R3JB 3O6FD 1HIML 3CCHB 1KCVH 1JZ2A 4LLQB 4NFBA 3OR7A 2AJ3B 2A73B 4QXGL 2VC2H 4TULH 5HHQB 4MNQB 3BKCL 4H1LA 1Q9KB 2ESVA 4JO3L 5ESVA 1KULA 1UJ3B 4FRWA 4F58H 1FDLH 1RV6X 1XT5A 1KLFA 4M48H 2VZOA 3CX5K 4JHAL 3V0VA 3VI4E 5E2WL 4E5XB 3NA9L 5D1ZC 3IFPA 5T33H 3N85L 1MNUL 1BF8A 4OLYL 3D3VA 4K55A 2YD1A 5D6DA 2VDRH 3WFHA 1DLFL 5LKNA 5BV7L 1OY3B 4GKSB 4LKXB 2IMMA 2BCKA 5DS8A 4HIIA 4HCRL 3HMXA 5TPWL 3SQBA 3P4LA 2Q8BH 2K1MA 1XCQA 4MDJA 4R0LA 3C8HA 5E8PB 4CKVX 2R29H 3U30C 1XIWC 2WK2A 2NXYD 3FRUA 4NQCA 3L5WB 5GGRB 4NC0B 1UWEH 4ZQKA 1QFWM 4PLKC 1J0IA 1DBJL 4NQDE 4PGCA 3GSXB 4FFZL 3MA9L 5I1JH 4AENB 2FWOB 1T0PB 5B38A 1VGKB 3S96A 4XRCA 3L3HB 5LG1A 1RVFL 3K2MC 3NCYP 2VXTL 2VLRE 4PUBL 1RIHH 4M5ZL 1A6UL 5HBBA 4WWKA 5IVXF 2P44B 3RDTC 4ODSL 3S5LB 2BFVL 2R1YA 2GFBB 5FUOL 3EZ8A 4JFYA 2ZOKA 4OKVB 1HHKA 4YBQD 4JCLA 3VGDA 3WIIL 4FQ2H 5CUSL 4HWEL 3MNVA 3RX5A 3LH2H 3BDBA 3V6OC 5AZEL 2G5RA 5D1ZB 4HIEA 2XXMB 2OJZH 3HC4L 4AYFA 5CCKH 5TDOA 4QHKI 3DURB 2ZSVA 3UJJH 1HHJA 1WWBX 2VL5B 4PJAE 1P69B 4XVUC 4N68A 3VXUA 3MZGB 3V4UH 3RUGB 4RGOL 4AK1A 4R26H 5ID1B 3ULSB 3K46A 2R0ZL 3ULUD 5JZ7C 5GRVL 3JBG7 3L1OL 3UO1H 3HI1A 1YEJL 5LJYH 3EJYD 4QXWA 5TE4L 4WCYH 3U30B 1XIWB 3FQNA 5D6CB 2E7BA 3QPXH 4JFDD 4NKMB 3EDJA 1CDYA 3HB3D 2IBGA 5FM5O 1SJHA 1YPZA 4LP5A 4WGVB 5KG9A 1QSEB 1DFBL 1YZZA 1KJ2L 3VFRB 4JKPL 1P6FA 4UINL 4ALAL 3LHPL 3X3FH 4DAGH 4PJFF 3WEXA 4MWFB 3GSQA 4I0PA 4OBSA 1PY9A 5TFSL 3RDTB 2ID5A 1YC7A 1IGYB 1NC4A 1WWWX 3AS2A 3NIGE 5BZDA 3T1FB 1C7TA 4PV9B 1MREL 3ARFA 3FQWA 3TP4A 4Y8AA 4K3GA 3PGFL 1JYNA 1A5FL 1FAIH 3TNNA 2GJ6B 4TSBL 1ETZA 1U6AL 4XMKL 4UT9L 2DQDH 3H7LA 5INCA 1HDMA 3KXFA 1RUPL 5CJQH 1GOGA 3TGXA 2A74A 2WBKA 3ZKND 4MAYC 4D0CA 3C2SA 4WDIB 1CK0H 3B3IB 1C1EL 1BM3L 4Y5VC 4XP5H 2ZUUA 5DHYA 2I9LB 4XH2A 5IB4A 2Y06H 4HIXH 3QI9A 1Q9LB 2NTSP 5GGRY 2R2EB 4J23A 4O4YL 3DX9B 3GGWA 3MRNA 1XF2B 1W8NA 4PRBB 1RZ8A 1CS6A 1NAMH 5BVJB 5AD0B 3S34H 3R0NA 1AO7E 4JY6B 4NGHL 3MLXH 5CZKA 5T5FH 3V5DB 5TH2A 3P9WB 5C08A 2IAND 5A3ID 1WK0A 1J86A 1YQVL 1G84A 5JIPA 5EUOA 3ES6B 2MKWA 2IWGA 2EH8H 3MRBB 1YEFH 5FO9A 2OXHA 1YMMB 2BHYA 5L9DL 2MKLC 1QPXA 3IDUA 4MXWL 4Z0BH 1I9IL 1URLA 4MQTB 2AJZB 2DQEL 3QFDB 2ZUWA 2LVEA 1B0GA 4I2XB 3FN0L 1W0YT 3GKZA 1ZSDB 1I9JH 3ARGD 1BQHB 3QDAA 2WLYA 3OZ9H 3DSNA 3CXHK 3CK0H 3OAYH 1MWAA 3MRGA 2DAVA 3O2WL 4G5ZL 3ARDC 5T1LA 4GQPH 3VXRB 1XGTB 3SJVA 4P46D 2L4OA 5L2KA 4MAYB 1A9BA 1AXIB 4NRXB 4YDKH 1RZ7H 3DX8A 4OGXH 4Y5VB 5DJDA 2RAMA 4JREC 2ICWB 3O3EB 1T4KB 4O2CA 2ITDB 4UB0L 2XIDA 1X5YA 1CVRA 2QSQA 4KTEL 1R0AH 2P43B 4J3OC 5MENA 3BP4A 1U8OA 4N9GB 5GHWL 5ESQB 5GJSL 3VGEA 4HX1A 3ZKSD 4PR5A 4HMEA 5FCUL 3CC5B 1FZJA 3MUGA 3QG6A 2X4RA 4JAMB 1LK2A 1JGDB 4OCWL 1HIMH 3LEYL 4ZO6A 1S3KL 1LP9F 5KBNC 3SGEH 4P3CH 3FO0L 3FAWA 3BKCH 5H94A 4EVNB 4JO3H 3LSOA 3LQAL 5ITBL 4EBQL 3EKCA 1ZLWK 3PGDA 3BE1L 1B2WL 1FIEA 3BAEH 2XZQH 1UM4L 2D7PA 5DEFA 4JHAH 4G6AD 4ZUWA 5E2WH 4X7EC 2P7TA 4U6HB 2DBJA 1TZIA 4FXGB 4JRYA 3HC0B 2XZZA 3REWA 4POYA 3W0WB 4LIQL 5I1DB 5C6TL 3JVGA 3LEVH 4MHHG 3VXSD 3TBTB 3QDMB 1DLFH 1TFHA 3ARDB 2VN7A 3ULUE 4OZ4B 5BV7H 2X7LB 3P4MA 1A6AB 3CFIC 5ENWA 4R6UA 2P1YA 4PRIE 5GS1A 4HCRH 3EYOA 3U82B 2FRGP 4X6CF 5TPWH 5F21B 4JREB 3O6ML 5HSFA 3MBXL 5L88L 3AREC 2VLJE 3IJSB 1EHLL 3C6LA 3RNKB 4ODTH 4LVOC 3W2DL 1UZ6F 4FFZH 1QTYT 5C6WH 5D4QA 3FO9A 1QFPA 4KROD 5EIIB 4D94A 2DQJH 5IMLA 4MS8D 4DZ8B 3TO4D 1RVFH 3L3IB 1WEJL 4ZNCD 2VXTH 5DYOA 5I19L 5LGHL 2AK4B 4M5ZH 4WO4D 4JFEE 2VXSL 2FJGB 1VADA 5MERA 1A6UH 3WNMA 4F7MB 5FYKL 3ESVF 3S88L 2YWZA 3AROA 1P2CA 2BFVH 1LO2L 2CLZB 7CGTA 4GLRI 5FUOH 4MJ5B 3UMTA 2CXGA 1ZT1A 2QADC 3QQ4B 1A4KB 3JTSB 3ROLB 2VLKB 3PF2A 3SDXB 4P5KA 2VZSA 4ODBD 1GGYA 3L3GB 5I71C 1KT2B 2P8MB 3KLAB 2NY6C 5AZEH 3RKDC 5L2JA 4M8VA 5J9PA 2X4PA 3HC4H 1A1MA 3MCG1 4J12A 1HILA 2Z35A 5IB3A 5K9JL 1D5XA 2OR7A 1JNLL 5D70H 2EIZB 4RGOH 1ND0A 4HBQA 4U6TA 2FCBA 5FA4A 5D9SA 1C8PA 1WVZA 3GMOA 4ETYA 2R0ZH 5F1KC 5DWUL 2RHEA 1EEQA 3AS0A 4GBXC 3AREB 1YEJH 4RMUA 4XNMA 4NDMA 2XT1B 4K94C 3QNXA 2VDNL 3C60C 3WDHA 4R4BB 5ANMB 3QULA 1IM9A 1DANT 3VA2C 5AEAA 4LVOB 3MJGX 3HLAA 1QEWB 3VJ6A 3K3QA 1CFSB 3I2CL 3RGVC 1LO4L 3EFDL 5J6HA 1IC7L 4XXDA 1FORH 4PGDA 5I16A 1KJ2H 4MSWB 3F6IA 5DR5L 1YA5A 2EYRA 3P77A 3SQOH 2GY5A 2HJLA 1F6AA 4RISL 2WMPA 4WFHD 3VU2A 4H25A 4PP1D 4XWGL 2VTFA 5C0IB 3P4NA 1F2QA 2PW1A 4ZOEA 2R1XB 2QADB 3VFUB 1MCNA 1U8IA 1G6VK 4UT9H 4OIBA 2NY3C 4ENEC 1KG0A 1TZHB 4PJEB 3WCYA 1ZHLB 5I71B 3QIUA 1QBML 4Y19B 1RUPH 2NY6B 4HIHA 1A4JB 2X9WA 4YH6A 1BM3H 1EHNA 4LP4A 5EU6B 5JQ6L 1SVCP 5EIQA 4BQCA 3WJJC 2OL3B 5FHAH 4UDUB 3W81A 4L4JA 4YNYB 3OG4B 3WUZA 3K8KA 2H32H 3O0RL 1GH7A 4Z7UF 3X13B 1QFWI 4GBXB 3VXQB 3ZDXF 4X6DE 2IQAB 3DARA 2NR6C 3C60B 2YK1L 4NGHH 2B1AL 5CJXC 1AGDB 2OS7A 4ZYKB 3ALWA 1JFQH 1F4HA 2IMNA 4YDJB 5DQDH 5F70A 3UTTE 1ZHKB 1C5DB 5FYLE 2UYLA 4QHKJ 3A6BL 3OKMA 3RGVB 1YY9C 1I9EA 1BVZA 1IJ9A 2DDQL 5L9DH 3DIFA 5E94B 3S36X 4EI5D 1YN7B 4HPOH 5IM7B 2QL1A 4ELMA 1I9IH 5C0RL 1J88A 1V05A 1RZFL 1MPAL 5IBTL 4LOUC 3FQRB 5A1AA 5B39B 4KQ3L 5F7FA 3FN0H 5KZCB 2V5SA 4LAJH 3OKKA 2CLVA 4PTTB 5HI4D 2MCG1 4FFVC 1AQKH 2VDOL 4PJAB 3UPAA 5JLZA 1T20B 4MQ7B 1U91B 5DMGC 2NY3B 4ORGA 4ZXBC 4IDJL 2PO6A 1WTLA 3O2WH 4G5ZH 4HK3N 2L0DA 5CHNA 5F7MC 5GGSB 3MQIA 2HTKC 5DMIH 3VDAA 4LCWD 4YK4C 3FCTA 5F1OB 4PYGA 1HINL 1F4YL 3N50A 3F8UB 3QPQC 3DGGB 3O3BB 3X17A 4UB0H 2EICA 5HHOA 2LU7A 3Q5YA 2DF3A 4GRWH 1D6VL 1L7TL 5IIEB 4E41B 1T83A 2ZJSL 1AFVL 3CSYA 3IFLL 5SWQB 3KPPA 5GJSH 4LCYA 4PGJA 4MAUL 4KUZL 4LSVH 5FCUH 5DRWB 5K9OB 3AC0A 5F1IB 2YSSB 4XHJC 4F7EB 3DVGA 3QUXA 4ESKA 3BHBA 3FZUD 4DGYL 1T5WA 4OCWH 3LEYH 1NH6A 5CJBA 4RGNE 3V8CA 4X98A 5I2IB 4PJ5B 1Q9WA 5EPMB 2NCMA 4PJBE 4HAGA 3DYOA 5B3JF 5IROA 1A3LL 5ITBH 3FT3B 1HHHB 4LQFL 3BE1H 1B2WH 1NUFA 5HI5C 5IFHH 1UM4H 2CR6A 4BM7A 3CFEB 4BH8A 2UVEA 4DN4L 1CDBA 3CD4A 3MLZL 2AP2A 3CVHL 4NT6A 3ZYJA 4RSVA 4OD2A 4LIQH 2VDPL 2BJML 2KDGA 5C6TH 3QIBC 2C5DC 5EUKB 1FYHB 3BD4A 4ZXBB 3OAYK 1NC2A 3CFBB 2P5WE 4TNWF 4KKBC 3BT2L 5MEOB 3FTGB 3OMZA 4XC3H 3S37X 2GJJA 3LD8C 2OQJB 3NN8A 1DN0A 4IS6A 1IT9L 1DN2A 4P4RB 4YK4B 1AO7B 3OJ2C 1XGRB 1HXYB 4PJHA 1KLUA 3PP3H 5L88H 3P9LA 3MLYL 1FL3B 5T3ZL 2HT3C 2BVPB 3L7EA 4KVCH 5DJAA 2EDDA 1ZA6B 4UIMB 1RZIA 4L4TA 4N5EC 4Z5RA 4YBQC 3OX8B 5CGTA 5EN2B 3RVWC 1EEUA 5IKCB 2HMID 3H2WA 2FJFB 3SKMB 1WEJH 5I19H 1MVUB 3KYMA 1CT8B 3W11D 4LLYB 4NRYB 5FYKH 3MXWL 1M6OA 3S88H 1A6TA 3H3KA 4JE4B 3TNMB 4KPHH 5M7QA 1LO2H 2F54D 1MHPH 3C87A 5FB8B 5HGAA 5I1KL 3ILQC 2VQ1B 1TVBA 5E4IA 4U05A 4UNTA 4PJGE 3D0LB 4GRLD 3JWDL 5F7LB 3QR2A 1TJIL 2VAAB 3CFKB 4QRRB 4Y2DA 4F8TA 3D85A 2BY0A 2HJKA 1FFQA 1OTSC 2IG2L 1II4E 1NGXB 5GGSY 1B4RA 4L3CB 1RUKL 3QEQD 5SWZD 3T3PE 3OKEA 5K9JH 5JDJA 3QIBB 1JNLH 4FQLL 2A6JB 3RWFA 3PWPD 5DD0L 4N0UA 4Z77B 3DMMA 5A2KH 4KK6D 4JG0L 4KMLB 3UBXI 3SKOB 1KN4L 3L7FA 2GTZB 3LD8B 4RX4D 2GK2A 5DWUH 1MHCA 2UWEB 1D9KD 3PP4L 5GJTH 4BA8A 2CPCA 4F33B 4L4VD 2Z93A 3U7WL 4P3DB 4LLWA 4K8RH 4LHJB 2VDNH 4OZFG 1ES0A 2SEBA 4TNVF 5J13B 1AD9A 4A6YL 1AR1D 2BVEA 1TQBC 3I2CH 3QXVA 3R4DA 1CL7H 2Y07L 3EFDH 1K8IB 5L0QC 4GMTL 1IC7H 4JG1L 2GCYA 4PRDB 3FQTB 5GZOC 3BH8A 2JK5A 5C0NC 5EZJB 1OB1A 4OKDA 5D7IF 5TQ0L 1UZ8B 4HW6A 2FH8A 1VCAA 3PNWA 2QHLA 5T1KB 1A7PL 1JGVL 1XR8B 2C4XA 4RISH 3RU8L 3F7VB 1JYVA 3QNZB 1QVOA 1NFDB 1QSZA 5EO1B 1CGSH 4AQ1B 1YNTA 1JMXA 3CNKA 1OQXA 2AJYL 3AUVA 4PTUB 2LU4A 5BO1H 1LD9B 2GITB 4HSQA 4XWOD 3TVMB 4WI3A 3VMPA 4PRIB 4GAFB 4OCMC 2WUCL 4YR6B 5KSAA 2FLBT 5F6IC 4CW1A 3C8KA 2AAVA 5JA8B 3B9DA 1EFQA 8FABA 43CAA 2VLJB 1AR2A 1Q94A 3LN9A 5JQ6H 1R3JA 2JJVA 4WEMB 3MPCA 3OAUL 4MJ6B 3Q5OA 2AXFA 4LLQA 4XZUB 5J8OA 1DBAH 4OQTH 5DFVD 2AJ3A 3ZDYE 1L6ZA 1EA9C 5HHQA 4MNQA 1E6OL 1GGIH 1N26A 3O0RH 5GRVK 1Q9KA 4BZ1L 1UJ3A 2CUMA 4XP1L 3SBWC 4P2QD 1IAIL 4JFEB 1RMFH 2VISB 2YK1H 2ZCKL 1FCCA 2FBOJ 2VKXA 1RK1B 4E5XA 4RMTA 4EQ3A 4NFDA 5IHBA 1TQBB 3MNWB 1EHXA 3A6BH 1JWSB 5L0QB 4PJCE 2PYFB 1VSCA 1EJOL 2DDQH 5JXEA 4WFGD 4YHIB 1SYSA 4U1SB 4GKSA 4LKXA 2IC2A 4MNGE 1RZFH 5IBTH 4BFBD 4UT7L 4QTIL 3WV0A 3LKSB 4LHUB 3UDWC 5ACLA 5EOCJ 4KQ3H 5KVEL 5C0JB 5E8PA 4S1RL 3AGVA 4K23H 3O4OC 1XGYH 4MB3A 4WFFD 4O58L 1MFBL 1YEEL 2WANA 3L5WA 5GGRA 2B7DT 1T22B 3GSXA 4IDJH 1K2DB 4N5UA 4NZTL 1NGQL 5F6IB 5EDXA 4MCYB 2CRZA 4AENA 2FWOA 3ARBD 3HNTL 1QSFB 5I1GH 1ITBB 4J6RH 4P2YA 4NZDA 4N1HB 4S2SB 4NQEB 3O8XC 1L0XA 1NEZB 3U9UB 2YA0A 2RBLA 4W68A 2CRMA 4FA8A 1D6VH 1L7TH 3S5LA 2QJDA 2ZJSH 1AFVH 3IFLH 4OZGF 1T7WA 3PWVB 2GFBA 4OKVA 5FGSA 3QT2A 4MAUH 1JV5B 1ZAGA 3MRDB 3SDCD 3WS6A 1DANU 3GSUB 3M8OL 3Q1SL 4AG4L 2BERA 4DGYH 2H2SD 5D1ZA 3WNNA 2AKRB 4X5LA 2AERT 3TPUB 3PXHA 3CFCL 3DURA 2V2XB 3MRCB 2VL5A 2H41A 2MSPA 3RUGA 1ZLVH 5ID1A 4LQFH 4F7TB 4HS8L 4EQ2A 4QOKB 4DN4H 1SY6A 2P5ED 3QEQE 1LDSA 4KVNH 1DQQB 3D2UB 3V5HB 3O4OB 5A2LH 2UZIL 4C57C 4CN4A 2CIKB 1A7QL 1XIWA 4PJXA 2LV4A 5D6CA 1T0NB 2BJMH 2VDPH 5C7XH 5HI3D 4NKMA 4GKNB 2NY7L 1C16B 4L29B 2P47B 4U1JB 3GMQA 5KVFH 4S10A 3BT2H 3TO4C 2DQHH 1QSEA 5FDYA 4X6DB 1FVEB 1IT9H 3PWLB 3VFRA 4QGYA 4KRPC 4G8GE 3O3DB 1YPZF 3O8XB 4MWFA 3S3PA 4PBWD 5D1QC 4LSRL 1ZE3C 3MLYH 4LCWA 3UTTB 3RDTA 3B2VL 1UB6B 4S0TD 5F89A 3RIAF 4RGNC 3T1FA 4PV9A 3SDAC 5KS9E 4OCRL 1AD0B 2GJ6A 1MCQA 5C0BD 4OCXL 2DBLL 2CDEB 2HKHL 4OB5L 3K2UL 4OIIL 5EZIH 5K9QI 2Y72A 4NO5B 3VXOB 1CDIA 3DOSA 2AGJL 3QCTL 3MXWH 1KCSL 3B3IA 3GI8L 4U6VL 3U0WL 2XG4A 5I1KH 3QWOB 5I73C 4WI4A 1AQDB 1NGZB 4PRHD 1Q9LA 1A2YB 4CBPA 2R2EA 2WQ8A 3JWDH 4QHNB 1TJIH 2YPVL 3DX9A 1XF2A 2H2PC 3TWCH 3T0VA 3MV9E 4FQ1L 4PRBA 4M02A 5BVJA 3G04B 5AD0A 3R1GL 4R4FH 4X4MA 5CJ8A 3RWDB 4JY6A 4Y4FC 3VG0L 4UTBH 4P2RD 1SBBA 3V5DA 1KNOB 4FQLH 4Q0XL 3I50L 3WO4C 1WZKA 4LLUB 3ES6A 3SEPA 4D9RD 4NBZB 3RVTD 4ZS6C 1O7SA 3TO4B 3MRBA 1HHGB 1KN4H 1YMMA 3MRIB 3KVQA 1Z2KA 2E5EA 1MJJB 4U7MA 1KPVB 4KRPB 3RPIB 2NY4C 5D1QB 2AJZA 3PP3K 3FB5B 5H35B 1F97A 1YECL 4XVTL 3QFDA 1FC1A 3MV8B 4WW1B 3NIDF 3RVXC 1BGXH 4A6YH 4RGNB 3H9HB 1ZSDA 3UBXB 3SDAB 5ID0B 3B4NA 2Y07H 5E08L 5F93C 4WFGE 4JG1H 2PXYD 4JLRA 4LDLB 2NPLX 1T66C 3KR3L 1U8HA 3VXRA 3C5ZB 3OF6D 1XGTA 3HHRB 4OZHB 4MAYA 3MRPB 1A7PH 4NRXA 3ZDZF 1JGVH 4X9BA 3QAZC 1XCTB 3IT8D 4Y5VA 4WFFE 4EJ1C 5E5MB 3F5WB 1UEYA 3O3EA 1T4KA 2ITDA 5I73B 4K7FB 3SCMC 2EH7L 2F5AL 2V9RA 2AJYH 1Z9SA 3BZEB 2P5WB 1FZKB 2F54A 3WL9B 4MXQD 1BHGA 2YWYA 5I1IH 4XGZB 3OWEA 2WUCH 3CX2A 5HGBB 4N9GA 4JZOB 5ESQA 2V9TA 1QOKA 3O2DA 3CC5A 3OKLB 4Y4FB 4JO1L 3BIKB 4HWZB 3FRPG 3PABB 4U1IB 4JAMA 4WUUE 1JGDA 3WO4B 1UH4A 2J5LC 4JQIL 1IEAB 4KKCD 1I3RA 4ZUVB 5SWZA 1FG2B 1UH3A 2A77H 4A2MA 1CF8L 4EVNA 4JO2L 5ETUB 4BZ1H 2NY4B 4QRQA 4IOFD 5BRZD 4XP1H 1IAIH 2GQHA 5GS2D 3V8OA 5HYIA 3RTQC 5FGRA 2ZCKH 2OSLB 1XF4B 5F9JB 3MYZA 1NBQA 5HI4C 4L4VA 2J8UF 1TNNA 2VXQL 2NMSA 1F5WA 4U6HA 3KG5A 5J4MA 3OHXB 4ODXA 4FXGA 2HTLC 3HC0A 3EUUA 3W0WA 1V3LA 5I1DA 3J8F7 3IVKA 5EU3B 5EZOL 1EJOH 3TBTA 3QDMA 4KH2A 4U0QB 4OD1H 4JGUA 4PJGB 5FCSH 4LMQI 2X7LA 1A6AA 2P5EE 3I02B 2WP3O 3QAZB 4X6BA 4BYHA 2DLFL 3U83A 5KVEH 5HVGB 4S1RH 2Q8AL 1FCGA 4P3WA 3SCMB 4O58H 4HIJB 1MFBH 3IJSA 5CKAA 3RNKA 3BI9X 4R90L 3ZSTA 3GI9L 4NZTH 3SN6N 1NGQH 4AY0A 3MFFB 5IVXB 2R4RL 4LPTA 1ZT4A 4LPVA 5EIIA 3DXAB 3HNTH 1A3QA 4LNRA 4DZ8A 1IAKB 1E4WL 2Y5EA 3L3IA 1E27B 4V2CB 2AK4A 1V3KA 3BD5A 2JE8A 2FJGA 4GOSA 1NCBL 3GFUA 4Z7VF 2EDQA 4HKZB 5D1XB 1CE1L 2CLZA 2YKLL 1CDGA 1T7ZA 1A4KA 1YNLL 3JTSA 4HC1A 3ROLA 4X4ZA 4GG6F 4ZD3H 5IMMB 1KPUA 1LEGB 2VLKA 4JRXE 3RTQB 1GC1L 3L3GA 3HZVB 1JTPA 5JOFB 1KT2A 4AG4H 2IAMD 3KLAA 1S5HA 4NHCL 1PKQB 3NIFE 4DKFL 3CSBA 5C09D 3OJMB 1EBPA 3Q48A 4ODHL 1WSST 5GZND 5AZ2L 4PRHE 1T80A 3B43A 3K1KC 3RAJL 4X8XA 2VZ1A 1LNUB 4HS8H 4QY8B 1X5KA 4JQXC 3B8SA 4PB0L 4K07A 1ZA3B 4Z7QF 3WHE1 5JW4N 3AREA 1UT9A 3LN5B 1UXSB 3EOYG 2Z4QB 4WW2F 4R4BA 1U8NA 3Q6FB 5ANMA 3SGEI 4D9RE 4MA8H 4NWTL 1VHPA 4PJFB 4XCEB 4BKLB 4L5FH 1QEWA 2NY7H 3HPLB 1CDUA 5CIPB 1VEMA 2JJTC 1CFSA 4D2NA 1FIGL 2DQIH 3V5KB 1F2XK 3PWNB 3ZE1E 5FUCE 3UZQA 3EOTL 4PY8I 5F97E 3VRLF 4Q7DA 4MSWA 1T5XB 3DV6B 5D7KD 4GUPB 4C55A 1F3DH 1J05B 2AV1B 2V7HB 4N8PA 4L9DA 5ICYB 1NLBL 5C0IA 2ZG1A 2O5ZL 1BBJB 2X42A 4EN3C 2R1XA 4JEGB 3VFUA 4OCRH 4PLJC 3WLWD 5DHXB 4NOBA 1M05B 4OCXH 1X5IA 2DBLH 4K3HA 2EYSB 2HKHH 2AXGA 3K80A 5HGDB 1TENA 3K2UH 4OIIH 3CVIL 5F6HI 4PJEA 1ZHLA 4Y19A 3RIFK 5FYKD 3SE8L 3WJLA 2DRUA 5IT2L 3QCTH 2AGJH 1A4JA 5IR1B 3WHE0 2RB8A 4FTVB 2ZOLB 3GI8H 3PWJB 5EU6A 5DQ9B 3C08L 4K3JL 3EJZC 1RULL 2BVQA 4Z78B 2OL3A 3VXNB 2EXYC 4UDUA 3MRRA 3MRHB 4NO3B 1ZLVK 1N0LA 4YNYA 1CU4L 2CXKA 1A7OL 3HUJF 1NFIB 3X13A 1BFOA 4Q2ZA 2IQAA 4GW1B 1N8ZB 1CXIA 3VG0H 4R97C 4ZTPL 2BK8A 1AGDA 3MUJA 3C2AL 4ZYKA 4Q0XH 4YDJA 3BN9C 4CMMB 1ZHKA 4WENB 1LE5B 1IGTB 1SHMA 3RGVA 3EDFA 4K9EL 1CLYL 4JR9H 3NACL 5C0CD 3QWQB 5DJ2B 4LGRB 1YN7A 5IM7A 3VFPB 5IB2B 1TXKA 3BPCA 4H0GA 4APQD 4UNUA 3L3OB 4XVTH 1CLCA 3FQRA 4NO0D 5B39A 4FMFA 5DJXB 2F53D 5FV2A 2A0LC 5E0QA 4KXZH 1A02N 1G7QB 4PTTA 1FL5B 1MH5B 2J6EA 5DO2D 4HS3B 2BXYA 2R4SL 1ZEAH 4EN3B 4HGMA 3PXJA 5E08H 4WTZA 2I60H 2NY2D 4MQ7A 1U91A 2X09A 3QEHB 1E4XH 4KAQL 1A7RL 4GXVL 5JUEL 3QCUL 4PJ7E 4P57B 5GGSA 3MRKA 1IC1A 5KW9L 5E6ID 4NM4H 5GRWA 3RVVD 3QWRD 1I1AD 1VFAB 1MFCH 2IH1B 4FZ8L 3DGGA 3O3BA 3WJJA 1AHWC 4IRSD 2HYMA 4PJDE 4NKOB 1QRNB 5DK0B 5IIEA 4E41A 2BY1A 4OGYL 5KSBA 5SWQA 1FLRL 4H1LG 2R0KL 4KUCF 2Q86B 3RVUC 1LP9B 1RJZB 2APXA 1BJ8A 4G8GB 4P48A 4PBVC 2KQMA 1OF2B 1IM3B 2YZ1A 5DRWA 5GGTL 4UOJA 4JZJC 5F1IA 5AG8A 2YSSA 4JO1H 4GRWE 4R97B 4F7EA 5K33A 2J4WH 2YD4A 2PN5A 1U8JB 3QUML 2Q3AA 4Y1AD 4KGJA 3IB4A 3KPRD 4JQIH 3BKYL 3FB6B 1I4FB 5FF6B 1V7MH 1FQ9C 2NY1D 5KS9B 3L3DB 5I2IA 1CF8H 4JB9L 4KJWC 4PJ5A 3IDNB 1L6XA 4XI5D 5EPMA 2Q6WB 3I9GL 5HHVL 3FT3A 1HHHA 3MUZ1 3MRJA 3S3JA 1WIOA 1U3YA 2DWDB 4Y7MA 3CFEA 3HC3H 1MI5E 5FA3B 2F58H 2ZUYA 5C09E 4OZIE 1D5BB 1AP2B 5HPMB 5I6XC 3T4YB 1XF3A 5FECA 5MI0C 1KJMB 2B4CL 3QRFM 5EZOH 3I3DA 5EUKA 3U0PB 1H5BC 2DICA 4ZXBA 1H8OA 1DBBH 2R0WL 5MEOA 1T03H 3FTGA 5I76B 4XPHL 5A16A 3GSWB 5B38G 3MV9B 3HMXL 5EOQH 4HUKB 4P4RA 4LIQE 3SOBL 1AO7A 1XGRA 1HXYA 4HJJL 3QDJD 1M7XA 5BW7C 2A6IB 4C83A 2XTJE 1FL3A 1AHWB 3UJTL 4NM8L 1DUZB 1E6JL 3RI5F 2BVPA 1D5IL 3ULVL 5FO7B 4LKCB 2VYRE 3BN3B 1ZA6A 4UIMA 4R90H 3DJ9A 1NAMB 5HVFB 3GI9H 3OJVC 4HAFA 3MO1B 3OX8A 2R4RH 4AQOA 4TRPH 4IRZL 4JVUA 5JIHA 1JWMB 5IKCA 5C86A 4JZJB 2BC4B 1E4WH 2EKSB 3SKMA 2H2SC 3IFOB 3QDGB 1OP9A 4M7KL 1F45A 1IAMA 1RIUL 4H0IA 1MVUA 4IHOB 1CT8A 4NRYA 5E8DL 5KVGL 5CJOH 2PW2B 3AXLB 3TNMA 1I3VA 5FB8A 1GSMA 3HNSL 3IXAA 2VQ1A 1TCRB 1YNLH 2NY0D 4KZEL 3VFSB 4G3YH 1V3JA 3D0LA 4MA1C 5FYKE 1IZKA 4HUWB 1GC1H 4Q9RL 4LVNC 3ZKMC 3CFKA 4QRRA 3GBML 5HDLA 5FGBA 4Y16C 3JUYA 4DKFH 2HLFC 5I6XB 1NGXA 5HI3C 4G9FB 4L3CA 5MI0B 3QIBA 3VFVB 4W81A 1H5BB 2A6JA 3ZT7A 5HYSB 1DCLA 4KFZC 3WFDH 2F8OA 3TA3C 3SKOA 3H9ZA 2GTZA 3KLSA 4JFFE 4PB0H 2PTVA 2UWEA 4F33A 1QFHA 3F65A 4P3DA 4WUUB 3UJIH 3WFCL 4NNYB 4F9LC 2G2RB 4NWTH 4KI5F 2DN7A 4LCUA 1ADQH 5C0CE 4D9QD 2DIBA 2QQKL 5IFJA 2X89D 1FIGH 1HYSC 2COQA 1K8IA 4PRDA 4HWBA 4AM0B 4RRPA 3FQTA 4WUKL 3E6FB 3TT3L 2NX5B 4YO0B 5EZJA 3QEGL 1EPFA 2F53E 1UZ8A 5T3ZD 5T1KA 3WXWL 1J12A 2RCSL 2ARJB 4ZTOL 3ZO0A 1XR8A 1BJ1H 3F7VA 4HV8B 5HJ3A 4OLUL 1NFDA 2O5ZH 5EO1A 3T4AB 2ADJB 2GK0B 3ARQA