4XP3A

Crystal structure of erk2 in complex with an inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
347
structure length
339
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 111
structure length 339
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xp3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xp3A01
3BPRA 5C27A 4ACCA 5AADA 4EHVA 2HAKA 4I20A 5HIBA 5HG9A 4P4CA 3MW1A 3QLFA 4DE4A 4J97A 3Q4TA 5HEZA 3A61A 5CQWA 3VC4A 4S31A 1BL7A 3PA5A 3V6SA 1Q8UA 3QHWA 5C8KA 2XIKA 3ZDIA 5AIRA 1YXUA 3UIUA 4CZYB 5DRBA 4QTAA 2X2MA 3PPKA 2CKEA 4L43A 2PVFA 4FZDB 4O0VA 5LXMA 5EDPA 2B9JA 4DTAA 3ID6C 2PMNX 3LIJA 4UXLA 1Q8ZA 4IFGA 1OKWA 4U79A 3I7CA 1BL6A 3PIZA 1AGWA 3WIGA 4DITA 4NTTA 1E1VA 1J7IA 3DNDA 4X6RA 5H8BA 1PRYA 4OR5A 4AP7A 4Y5QA 3AC2A 3REPA 4Z3VA 1FINA 4FUXA 1PW2A 4ANLA 4ACMA 3UIBA 2GQRA 4IZ5A 3A62A 2E9NA 3D5UA 3GT8A 3QAME 4R8QA 4OTGA 4CMTA 5B7VA 5IEYA 4GU9A 2IW6A 3RK7A 3CD8A 5J87A 2QOOA 3ULIA 4JRNA 4CFWA 3HLLA 5I9XA 2PE2A 3NW6A 3AMBA 4BFMA 4ZTQA 4EEVA 5CXHA 4QMVA 5J5TA 2UZOA 3LHJA 4EOMA 5K4IA 3ZSHA 3KREA 1E9HA 3QRKA 3KXMA 3JS2A 4HZRA 5LJJA 2WIHA 3UYSA 4IDVA 2O5KA 4AOIA 3TNQB 1JKSA 3QYZA 2ONLA 3UO5A 4A4LA 2GDOA 3UPXA 3IKAA 4E20A 3CEKA 2ZM3A 3ROYA 5ACBC 1BUHA 2B1PA 3TCPA 5BPYA 4DEGA 1OVEA 1O9UA 1W83A 2X6DA 5ANGA 3QQUA 3PSCA 2YA9A 4R3RA 5FXQA 3QTSA 3SV0A 1Q8TA 3GGFA 3CGOA 4FSRA 4GVAA 4OTWA 3AD5A 5M53A 2WD1A 3MFSA 4M0ZA 2OFVA 5B2KA 1WMKA 2Y7JA 4LV5A 4W9WA 5L2QA 3E62A 3ODZX 2F9GA 4MWIA 4FTAA 1BMKA 4QRCA 2OJGA 4FV2A 4XYFA 2ZDUA 3EQFA 5GNKA 4ZLOA 1H0VA 3PRIA 4QTEA 3AXWA 2GFSA 4QMQA 2XNNA 4FSWA 1WVYA 2C6KA 1SVEA 1CMKE 2XKDA 3R7IA 5M51A 3KFAA 2B54A 2J0KA 3IGOA 1UKHA 4AT4A 2WMXA 2WU6A 5EFQA 2YCFA 5HO8A 1YRPA 2VO0A 3FMNA 4FG8A 4WNMA 3OXZA 2GS2A 4EOSA 4AG8A 3DLZA 4NH1A 5FEEA 2FYSA 4U42A 3ANRA 4FYOA 2IJMA 3D0EA 4J71A 4YR8A 2J6MA 3ORPA 3DK3A 5L2TA 5AP1A 2HXLA 1CDKA 2W0JA 4U6RA 2GQSA 2ZVAA 3EFJA 4LUDA 4DN5A 2R3MA 5EM5A 5M09A 2IN6A 3ANQA 5M07A 1GNGA 2R3OA 3KULA 4CRSA 3BLHA 2XKCA 2J4ZA 4MNFA 4JXFA 3FLQA 2YM6A 4DFZE 4M3QA 3H0ZA 4ZS4A 5IU2A 4NEUA 2W7XA 1YQJA 1ZMUA 1JSUA 4H39A 5DRDA 3UOHA 2WTDA 1Y6BA 3DOGA 5ETAA 1GZOA 5EM6A 3OCTA 4X0MA 2QU6A 3QZGA 4HGEA 5AP7A 4EWHA 3L8SA 4G3EA 4FL1A 5LCJA 3QKMA 4PDSA 3AT4A 2OXYA 3NEWA 4H58A 5HKMA 3U4WA 3KULB 3POOA 3NMUF 1YOLA 3IG7A 3MB6A 4BWPA 3FI4A 2BKZA 3FHRA 4B6LA 3S0OA 5KMJA 4J99A 4F9YA 4J98A 5E91A 3P86A 5AP0A 5BVFA 3IK3A 4PP9A 2QOHA 5CYIA 2W4JA 3OBGA 2VTOA 5K0XA 3C51A 2YABA 1B38A 3H9OA 4FEUA 3FHIA 5IH5A 5IEXA 5L8KA 1NVRA 3G90X 5DH3A 3R7UA 4FKOA 2YDKA 1WZYA 2IZRA 4DG2E 4PMPA 3K3IA 3TI1A 3V6RA 1H28A 2ERKA 4QPSA 4WHZA 3DFCB 4R5YA 4WNPA 1PYXA 3RCJA 3IDPA 4IM3A 4ZIMA 3E92A 3VUGA 4ZY5A 5FRIA 4L52A 4N0SA 3PIXA 3I5NA 5I3OA 3JUHA 3O7LD 3I6WA 2X4ZA 3QQGA 3N4VA 5KMOA 2QHNA 2YIYA 5HLPA 4XP3A 4ZJIA 5TOZA 4E4XA 5HQ0A 3QXOA 3G6GA 3GUBA 1U5RA 3TEIA 4XG4A 3R7VA 3NX8A 4GK4A 4WG5A 3OT3A 4TYHB 4BTFA 4PPBA 4ALUA 4FSMA 3OC1A 1WFCA 1LR4A 2I0VA 2E9OA 2WIPA 5DMZA 3BHUA 5AA8A 2HWOA 2QOBA 2X9FA 3RK5A 3MPMA 4R77A 2B9HA 3R9NA 3GCQA 4L8MA 3DXNA 1MP8A 5CSVA 3BWFA 1XH5A 3CBLA 4OLIA 4YBKA 4C3FA 3PXZA 5KCVA 2G2FA 3PLSA 5AEPA 3OHTA 2XS0A 3E5AA 2QOKA 2HYYA 3S4QA 3ZZEA 3ALOA 2QLQA 2ETRA 2HZ0A 2PVRA 5BVOA 4EYMA 4BBFA 4JI9A 2XK9A 4LOOA 2O3PA 3S3IA 3BV3A 3OT8A 4AZVA 2VTNA 3F61A 2EU9A 4XHKB 5DBXA 5LVLA 2VTJA 4JQEA 2P55A 2BZIB 3KA0A 5AR5A 5A4QA 5F4NA 3PY1A 1SVGA 1R39A 3FY2A 2O8YA 4MCVA 4C3PA 5LMAA 2JDVA 2YN8A 3R1SA 3F7WA 4V05A 4DBNA 4ACHA 4KS7A 5A54A 2R7BA 3MIAA 3ATTA 4PTCA 3NCGA 4RQKA 4ZY6A 4YO4A 4LOQA 4I1ZA 4GUEA 4PY1A 4M69A 3FQSA 1PY5A 5EKNA 3KF7A 4MQ1A 4HGLA 2GNFA 4GT3A 5C9CA 3UZTA 3QRIA 1V0OA 5KHWA 1UVRA 2Y4IB 4M67A 3TKIA 4CLJA 2GPHA 2GNJA 4GK3A 3C0IA 5CU0A 3HRBA 3VBTA 4FV7A 3ZXTA 3A99A 3K3JA 3EMGA 4G34A 3A7GA 5KMIA 2QG7A 3R8UA 3HL7A 2PL0A 4M69B 2UW9A 4QP2A 4LRKA 3KL8A 3GU6A 5HX8A 3AC1A 3CGFA 2BRMA 3R7EA 4BY9E 5L6WL 3SRVA 3CC6A 3DDPA 4CYJA 4E6DA 4ZZMA 4D28A 3HMIA 4CD0A 2P0CA 5HG5A 3MVLA 2C0TA 1OITA 4EOIA 4F4PA 3SLSA 2HELA 4O86A 3FMKA 4AW1A 4KRCA 3EN9A 2JKQA 3UGCA 2W05A 2FSOX 4K2RA 1UNLA 2BILB 4CFUA 1IA9A 4JT3A 2QG5A 5CS6A 5EYKA 4I6FA 5HG8A 1SYKA 4BB4A 4FMQA 5CASA 3LXPA 2PVHA 3FMDA 3RTPA 4D4VA 4EI4A 2UVZA 1PXKA 3PY0A 4JDKA 4XRJA 1LEZA 2A27A 3U4UA 2RFNA 2JKMA 3UOKA 1Q99A 3LJ1A 5CALA 4C4JA 4LMUA 2C6EA 5CEIA 4D0WA 3IPHA 3ENMA 3VUKA 1M2RA 3LCKA 4TKSA 1JBPE 3HKOA 4PNIA 4X3FC 2W5HA 4FL3A 2CLQA 3DAKA 4O0YA 4AOTA 3P7BA 2VX0A 2XM9A 3OXIA 2RIOA 5M08A 4PF4A 3VJOA 2REIA 3WZJA 1Y57A 5C8MA 5AAGA 2XBJA 4P5ZA 5DLSA 5I3RA 3S95A 5DPVA 3R8LA 4EONA 4FTIA 3JPVA 2WTKB 4IANA 4DLJA 3AC3A 3EWHA 4EOOA 3K54A 2UZLA 2W1ZA 3OW4A 4MXOA 5A46A 2VAGA 3UO4A 3U6JA 4RJ4A 3NCZA 4FKLA 3VULA 3GVUA 3WZUA 1M7NA 3MS9A 4E26A 4ZSJA 4G3DA 4V0GB 3FZSA 3QUEA 4P90A 5IH6A 1KOAA 5IMEA 4PMSA 3W2CA 5K4JA 4XOZA 4HNIA 4HW7A 4OTFA 4EUTA 5D7AA 2PMLX 5A6OA 4GG7A 3QZFA 4YJSA 4JS8A 4DH1A 4FKPA 2YM3A 3LFEA 1RE8A 3A7JA 4O96A 4D5HA 3DBQA 3PP0A 3BBTB 2UZNA 2G01A 3E3PA 4QMWA 4G6LA 2GNIA 2WTVA 4J1RA 4XNEA 3BHYA 4MXXA 3BX5A 3R7YA 3DS6A 4U45A 4WKQA 1ZOEA 4B8MA 4O81A 2PUPA 2EVAA 2WMWA 3O8UA 2VWXA 3UC4A 3KQ7A 3PVWA 5AUZA 1DS5A 2F49A 5IQGA 3JXWA 4RQVA 2R9SA 1BX6A 3EL8A 3FYJX 2ITZA 5LQFA 1YI3A 3P23A 4ZJJA 4MNEA 5FTOA 4G5PA 3ZLYA 1IAHA 1GZNA 3RPSA 4EL9A 5I9WA 4BKZA 3LQ8A 3T3VA 3TDVA 2CHLA 3AD4A 1MRYA 3WF9A 3NNUA 4EK6A 4E6AA 1J7UA 2J5FA 2QQ7A 4I5MA 3KXNA 3VW6A 4FV5A 2VTMA 2XIRA 3TG1A 5AP6A 3I6UA 2R2PA 3EL7A 3OS3A 4NFMA 4EH3A 1ZXEA 1K2PA 1M14A 5HD4A 5TR6A 2HY0A 3ZS5A 2BDJA 4AQCA 5BYLA 2C3IB 4R3PA 4EJ7A 3ET7A 3P7AA 3SX9A 4FKVA 1U4DA 2BHEA 4FT3A 4CTBA 3DU8A 3TV7A 3W33A 4QMNA 2JBOA 4P5QA 4RWIA 4RRVA 5JK3A 5E4HA 3ZEWA 4FTQA 2XCHA 2R7IA 2CN5A 4JIKA 4BZNA 3R00A 2VNYA 3LPBA 2VX1A 3WOWA 4EQMA 3QTQA 5AP3A 1OKVA 2X6EA 2A4LA 3DBFA 1L3RE 1XH9A 3BGPA 3H4JA 1OL2A 1ZOHA 4QQJA 5AR3A 3Q96A 4FV0A 4BDAA 1W7HA 2UZTA 4AFEA 3GU8A 3CTJA 5GJDA 5J9ZA 1LPUA 4BYJA 4F9WA 4O82A 1H1PA 2R3LA 2XK3A 2PVLA 3PFQA 2XA4A 4KRDA 3LQ5A 3DT1A 4QYFA 5GZ9A 4ITIA 1ZWSA 4O0WA 5FXSA 3O2MA 5LCKA 3TZ8A 3MTFA 4H05A 4H3BA 2F4JA 3E8DA 4HCVA 4WG3A 3RAHA 3GNIB 5EQYA 2FO0A 3QX4A 1GZ8A 3COIA 3EJ1A 2YACA 2P33A 4GMYA 5BVWA 3G0EA 4OBOA 4IIRA 4RX8A 4C4HA 4OT5A 4Y85A 5I9UA 3ZBFA 4C7TA 4F0FA 4AT3A 3F6XA 1YOJA 1R78A 4I21A 5HE2A 4Y73A 3TTIA 4BI2A 2QOLA 3MVHA 3PUPA 2VTQA 4PX6A 4UMRA 3QZHA 2Q83A 2OJJA 1XBAA 5EH0A 4A9SA 3ATSA 4BDBA 1FQ1B 3UVRA 4D58A 4EORA 2XJ1A 4YU2A 2Q0NA 4FSYA 4QP9A 4CVAA 5K9IA 3KXGA 1PF8A 1Q97A 1WCCA 3IS5A 3QTXA 4WRSA 1U59A 2VWBA 4DCAA 2X8IA 3SOAA 3QTRA 3FSFA 3FZRA 2I40A 3FXWA 4KB8A 4F09A 2LAVA 4P2KA 3P79A 4FV6A 4AN3A 2OJIA 3PA3A 3PE1A 2ZDTA 4K77A 5D7VA 3FLWA 3TV4A 2Z7LA 3LJ2A 3CQWA 3TUDA 4CTCA 1KWPA 2ITOA 3KRLA 4QPAA 3F5PA 3FMEA 1Q41A 3VUMA 2YJSA 4C37A 1OIYA 4M14A 4Q5EA 3PY3A 5EHOA 3G5DA 1SM2A 2E9PA 2QO7A 3KK9A 4BL1A 1JKKA 5J1WA 2C6IA 4ENXA 4HVGA 5C4LA 4BGQA 1NVSA 3FE3A 3DAJA 2YAAA 4O0XA 4AT5A 4HVIA 3PZHA 3LCSA 3EYHA 4J8MA 2X9EA 1Y6AA 1YW2A 3OD6X 4E3CA 5EW8A 3PZEA 3NYXA 3QQKA 3RKBA 3MESA 5JFXA 2OFUA 5DR6A 3NYOA 2ERZE 4RWJA 3T9TA 3NR9A 4FV9A 4D1SA 5AWMA 1BLXA 5HG7A 1GZKA 3IQ7A 4G3FA 5AIKA 2CKOA 5M56A 4C4FA 4H1MA 2YIWA 3CKWA 3EKNA 3SHEA 3QX2A 3F3WA 2PZYA 3KGAA 4UMQA 3QA8A 5CAUA 2JDTA 3DZQA 3W2SA 2RKUA 3JVRA 4G3CA 4IM2A 2UW7A 3PYYA 2V55A 2W1CA 3EZVA 3PPZA 4K33A 3ZSIA 4DBXA 3R01A 1PXLA 1WVWA 4MYGA 1FMKA 5I9YA 1OECA 4X2JA 1QPEA 2F7EE 4YLKA 4FL2A 4YHJA 3AC5A 5T68A 5ANJA 5CEKA 3UOJA 4XOYA 4O7LA 4Y95A 4BDEA 3KC3A 4USDA 1URWA 1UU9A 5KMKA 3OMVA 3NW7A 3C4ZA 4DEBA 4RFMA 4O7WA 5LVNA 1ATPE 3UO6A 4QMUA 4IAKA 2WXVA 3LFFA 4BDGA 3VQHA 4D1ZA 5BMMA 2XP2A 5IA3A 4CG8A 3KRJA 4CFMA 4BTMA 3UG2A 5BX0A 4Z16A 5JFVA 4O0TA 2JC6A 1MQ4A 2OI4X 4IFCA 1FGIA 4QNYA 2QURA 3VS3A 2V5QA 5DR9A 5LMKC 3OROA 4WT6A 3RP9A 4ASEA 3II5A 3R7GA 4FV1A 4UYNA 3RNYA 2V0DA 4ZEGA 4BCOA 5KHXA 2QO9A 4MKCA 2PULA 5KUPA 3CQEA 5CU2A 3MY5A 4RFZA 2CCHA 4GEOA 3UODA 5IQFA 3FMLA 4DGGA 4NM0A 2QR8A 4USEA 4DFUA 3LCOA 3E93A 4TNDA 4FEVA 3VS0A 2OK1A 5EG3A 4AZSA 4CKRA 4IBMA 2VWIA 5JEBA 3QA0A 4WSQA 3LMIA 2OF2A 3I0QA 4IQ6A 1H1RA 1UV5A 4QT1A 4ZTLA 4BDIA 4Y83A 4OBQA 4FF8A 4W4XA 3R7OA 2C1AA 1IG1A 1PXNA 2HENA 4IB5A 2PSQA 4DGNA 4J52A 3EQPA 2B4SB 3PSBA 4M0YA 3MB7A 1ZRZA 3R8VA 5J7HA 2W1EA 3Q2JA 1Y91A 3E7OA 1J1BA 2HZNA 4S34A 4QQ5A 3P1AA 5EYMA 2HXQA 4KIKA 4O0UA 1B39A 1CM8A 4CFNA 4N57A 5AR4A 4ZOGA 4L3LA 3PVGA 4L3PA 3QTUA 1OI9A 4CRLA 4QMOA 3DGKA 5DR2A 2Z2WA 5BVDA 5L2WA 2R0IA 3WZKA 2PVNA 5C01A 1YWNA 3V8WA 3VF8A 4DFXE 3F9NA 2CNUA 4JG6A 5AV4A 3BQCA 4X2NA 2GU8A 4IC8A 4F7JA 4JVGA 3LCDA 4LM5A 4C4IA 3F2AA 5CSXA 5J1VA 1ND4A 4FICA 1MRUA 4WA9A 2G2IA 4QQTA 1OL5A 4FODA 1Y8GA 4ACDA 2OJ9A 4C3RA 4XEYA 3O71A 3QTZA 4ANOA 2XK6A 2YITA 2CSNA 3NWWA 4IW0A 4LOPA 3DLSA 3C4XA 3RWQA 2ESMA 5JFSA 2H34A 4FTJA 4E5WA 4HYSA 3VIDA 4IACA 1GIJA 2IW9A 3E8NA 4CQGA 5GIOE 3RMFA 2PMOX 3ERKA 4CYIA 2ETKA 4YC8A 3S00A 4XBRA 4FGBA 4AAAA 4ANBA 2BRHA 2R3RA 1OM1A 3RPVA 1XR1A 4GFMA 3W2PA 4ZMEA 1S9IA 2PK9A 2YM8A 5DGZA 3UG1A 1GOLA 4R3CA 4C38A 4MXYA 4ZZNA 5FM3A 5EKOA 1XWSA 4ARKA 3QF9A 1DAWA 3DXQA 3WF5A 1KV1A 2BMCA 3IONA 5AR2A 3LFAA 5HICA 4GH2A 3ROCA 5FM2A 4BBEA 3IOPA 5BUIA 3CSVA 1K3AA 1XJDA 2WOUA 3PVBA 3C5UA 5IQDA 3CLYA 2BIKB 3IECA 3L9PA 3ZUTA 4F99A 4B7TA 4AA5A 4JOAA 2XNMA 4MEDA 5CU3A 4XV1A 5H9BA 4WUNA 3D14A 3LZBA 3SVVA 4Y46A 2R3KA 4D2SA 3NUPA 5HVYA 2G1TA 1G3NA 3FLNC 3G0FA 4HGTA 5TO8A 3FUPA 4NKAA 3KN5A 3ZXZA 4E5BA 3G9NA 4C58A 3VNTA 3SD0A 2W9FB 2C3JA 4WD5A 3FXZA 3AMAA 2VTSA 4KA3A 4IVDA 4HJOA 5AA9A 3S1HA 2GNHA 3F2NA 3F3VA 4ANNA 1ZYJA 3VQUA 4BCNA 4I6HA 3NYNA 1OPJA 3OBJA 2VTLA 4TW9A 5IG1A 3ZH8A 3FL5A 2BIYA 4DEAA 4TTHB 3POZA 3TACA 3FY0A 2RG6A 4A9RA 4BGGA 2EB2A 1G8AA 4QTCA 4MTAA 3QQJA 5E1EA 3NAYA 3FZOA 5ACKA 5IQBA 1KV2A 4BIBA 2JKOA 2WMBA 5BMSA 3RZFA 2J0IA 1DAYA 2PVYA 2UZVA 3OTUA 4I41A 5EYCA 3N4TA 2YISA 1I44A 4FKGA 4AZWA 4BVUA 3IOKA 5DA3A 2GCDA 4JDIA 4TXCA 5IA2A 4RX9A 3NVMB 3R73A 2GS7A 4O83A 1Q61A 5E8VA 2BAKA 2OW3A 2XNPA 3JR1A 3QC9A 4KIOA 5J95A 2R3NA 5L6OA 3BHVA 4FT0A 4LFIA 1K9AA 3OF0A 3OOMA 4BHNA 4DHFA 5E8WA 2V7AA 5FTQA 4MXCA 3A7HA 4I23A 5C03A 3AC8A 3G33A 3LVPA 3V04A 3FQHA 4WG4A 4CG9A 1YOMA 3FJQE 3FMMA 1TQMA 4YJRA 4FTKA 1HCKA 3O51A 3FMJA 4F65A 4OTIA 4O27B 3UPZA 5DOSA 4ENYA 3NW5A 5JH6A 5EI6A 5IQCA 4R7IA 1KSWA 4V01A 3UE4A 3JYAA 1PXPA 4I6BA 3MWUA 4FC0A 4O84A 2BZKB 4PPCA 1OMWA 1PKDA 2YCRA 5IUIA 3VUIA 4DH5A 4E6QA 4ERKA 2P3GX 5DI1A 4XX9A 4PNKA 3ACKA 4ZZOA 1OB3A 1REJA 3TNIA 4LL5A 1XH8A 4FEQA 4RMZA 2QOFA 2WQOA 3ZSGA 4FZ6A 2Z02A 4ALVA 4NCTC 5FEDA 2IWIA 4ZK5A 2OIQA 3FI2A 4L67A 1M7QA 3V01A 4QP3A 1FGKA 3HMMA 3Q3BA 4GSBA 4EK5A 4A06A 1JSVA 5EHYA 3B8QA 3O0GA 3H9RA 3VO3A 4BDJA 4YO6A 4ZLZA 4JLCA 4YZMA 3ZYAA 3MFUA 3TZMA 3SDJA 1JOWB 4FVRA 3Q9XA 5HBHA 4UV0A 3TT0A 2PY3A 2BRNA 3TUBA 3OFMA 3D5XA 4K0YA 4NSTA 4OBPA 2RF9A 3VBXA 3CCNA 3GI3A 1WBTA 2CNQA 4QQCA 4RJ6A 5EQEA 4JL9A 4G31A 3QCXA 2JGZA 2XNGA 3HRCA 1ZMWA 3ZM9A 4KKGA 4IZ7A 2Z7SA 4IJPA 5CU6A 4F6SA 2E9VA 4Z7GA 4UMPA 5CXZA 4BCIA 2C5VA 4WOVA 4DTKA 4RIYA 5EI2A 5EW3A 4R1VA 2HW7A 1M17A 4G9CA 2R3FA 2PUNA 5TKDA 5E8SA 3HYHA 3MVMA 4QMPA 4MHAA 4ITHA 2C0IA 3DV3A 4FUYA 3UNZA 3CR0A 4FE2A 3B2TA 4Z55A 2X81A 4WNKA 4BHZA 3V5PA 1OUKA 3NZ0A 3RAKA 2J90A 1XH6A 3DK6A 3GOPA 3KMUA 5L2IA 2ITWA 2NO3A 4RIYB 3RHKA 4TT7A 3GOKA 1CKIA 3EZRA 3IDBA 4MF1A 2R64A 4OUCA 3KKVA 5G6VA 4DC2A 5CY3A 4MBLA 3RPYA 5A4CA 2XIYA 3COMA 5IEVA 4WIHA 4D1XA 4ZSAA 4YJNA 4BN1A 3LJ0A 4EWQA 4YC3A 1VJYA 5HCZA 5HX6A 3L8VA 5KKRB 3E8EA 3FZ1A 5GINE 1WBPA 2ACXA 3HEGA 5CNOA 2BVAA 5CNNA 1ZYLA 4FOCA 2PHKA 4L45A 4CLIA 4DG0E 2W1IA 1W82A 2JFMA 4FVPA 1JKTA 4FT9A 5HORA 3UIMA 4HPUE 3JVSA 2RL5A 3OWLA 3KRRA 3EHAA 2C3KA 1PMNA 3EQHA 4F64A 3UP7A 4TWOA 3VAPA 1VZOA 2QONA 2YEXA 3E8CA 3OEZA 4QYHA 3ZFMA 1RJBA 2OH0E 5M4FA 4EBVA 2ITNA 3H30A 1Q8WA 2RFEA 1YVJA 1H8FA 2JKKA 4IHPA 2OICA 2W4OA 4Q9ZA 3CS9A 1H0WA 1PMUA 4CEGA 5ETIA 3HV4A 2OGVA 5FGKA 3H0YA 4QP1A 4EBWA 5HD7A 2VO3A 3Q5IA 1H01A 2XF0A 3F5XA 3DCVA 3VRYA 2FH9A 3QCYA 4MK0A 3ITZA 4NZWB 4F7NA 1WBVA 2JFLA 4F7LA 2ETMA 3CTHA 1FVRA 4ZTRA 4JDHA 4C2WA 3PG3A 2ITUA 3QCQA 1DM2A 1X8BA 4EYJA 4AWIA 3SQQA 4I94A 3TUCA 1M52A 3QL8A 3FDNA 4U97A 4PUZA 4XCUA 5K5XA 3QD0A 4EH6A 1QPJA 5AAFA 3MVJA 3VS6A 3ALNA 4AGDA 3TL8A 3ZO4A 4AZFA 3A4OX 5IQHA 3EQIA 4JBPA 5IKWA 4Z9LA 2R0UA 4O21A 4NUSA 3VHEA 4EQCA 3AGMA 2VNWA 2JD5A 3QXPA 2WTCA 3NUNA 2XEZA 5CEMA 2B53A 2X8DA 3LFNA 3D7TA 3V5QA 2WMUA 3R8MA 4L01A 2C5YA 3FI8A 4A4OA 1OGUA 3QD3A 3AT3A 3WYXA 4IB3A 3HMOA 3PXRA 4JQ8A 5AMNA 4BI0A 4HOKA 3P9JA 1NY3A 1ZZ2A 2O2UA 4G17A 3KRXA 4GW8A 4IE9A 4CV9A 4HVSA 4PTEA 2HCKA 2IVVA 5ITAA 5IA5A 5E8TA 1OPKA 5D11A 2VWUA 5KZIA 5CENA 3D7TB 1CTPE 5CAQA 3CJFA 5JZJA 3LE6A 2A0CX 2F7ZE 2XBAA 3E63A 3R22A 2QU5A 4FKQA 4NCTA 4D4RA 2PVJA 5IQIA 3EN6A 3TZ7A 1KUTA 3W8QA 3FEGA 3SGCA 4G3GA 4F63A 5LARA 4FKTA 2QD9A 4HYUA 2OIBA 3R9DA 4FNYA 4IB0A 2QKWB 5IMXA 5F1ZA 4S32A 5I9ZA 4C59A 4YUQA 3SA0A 4IWDA 3WE8A 4YLJA 3QWKA 4LYNA 5HNBA 3ZZWA 1R0PA 4C34A 3TDWA 4NJDA 4D0XA 3SRVB 3RZBA 1P4OA 4CGAA 4C36A 1S9JA 3F88A 4BRXA 1NT2A 1QPDA 4YPSA 4J8NA 4CKIA 3QQLA 4C62A 3PLAE 3BE2A 5A4EA 3RAWA 3FQEA 4OAUC 3CPCA 2PYWA 3QTIA 3PTGA 4XV3A 4O7ZA 1Z9XA 2UUEA 5DT0A 1R3CA 1IRKA 3ORLA 3TV6A 1IA8A 5HO6A 2O63A 3UMWA 4ERWA 3CXWA 2B7AA 2VWVA 4ZSLA 4UYAA 4DFYA 4EUUA 4GCJA 4FEWA 2VD5A 1AQ1A 5K3YA 4BDKA 1SNUA 4RWLA 4W4YA 3LKMA 1YDSE 2B9FA 2EWAA 2GMXA 3SG9A 2J51A 3GEQA 3KXZA 3IW7A 2XB7A 3Q53A 2BZJA 4BDDA 1YXVA 2OKRA 2V22A 2NP8A 1Q3DA 1H25A 3QD2B 3ZHPC 4QYYA 1CKPA 4W8EA 4DINA 5DFPA 3BIZA 4PTGA 4OW8A 4ZTHA 3SC1A 3UQFA 4UXQA 2F57A 2QOIA 4CMUA 4DGOA 3QUPA 4QNAA 2J5EA 4ANQA 4GIHA 3CP9A 3UNKA 4L00A 4FKJA 4LGGA 4BICA 2W5AA 1QL6A 3VUDA 3UOLA 3L8PA 3ORZA 4L9IA 3B8RA 5AM7A 3F5GA 3MH3A 4QMLA 4O7SA 1F3MC 1XHAA 4I4FA 4XJ0A 2AYPA 3LXLA 2J9MA 4FKIA 3MFRA 5F95A 4F70A 1L8TA 3L9NA 4A4XA 5AV0A 3DNEA 3O23A 4NM3A 3DJ6A 3U8WA 4MX9A 2WMSA 2A19B 2QNJA 5CSWA 4H36A 3ZDUA 2YERA 1JSTA 5FDPA 1STCE 1OPLA 2HW6A 1SMHA 5EOBA 1WVXA 2VTAA 3PSDA 3C7QA 5BQ0A 5E8UA 4XV2A 2UZDA 5GIPE 1REKA 4TYEA 4RA4A 4U8ZA 4FIFA 5J7BA 2C6OA 5EHLA 2W5BA 3CPBA 4AN9A 2YWVA 4YZBA 2VU3A 3BYUA 3GCPA 2XCKA 3BYSA 3Q4ZA 2IZSA 4FTNA 5CVFA 5AR7A 4Q5HA 5IF1A 4D2PA 1J91A 2VTPA 4BDCA 3D94A 1F5QA 3M11A 1MQBA 3OCSA 3M42A 3D7ZA 3OCGA 3FC2A 3Q9WA 2XZSA 4APPA 4BCJA 3TN8A 2W1DA 4MNEB 4CQEA 5JQ8A 3EIDA 3SOCA 5M4IA 2A2AA 5DN3A 5GJFA 4I5CA 3COHA 5HU3A 4ZSGA 4TZRA 4X21A 2DUVA 2H9VA 3W8LA 2PZIA 4I24A 5IPJA 2GS6A 2DQ7X 3PJ3A 5AAEA 2CMWA 2OU7A 2XNOA 3DB6A 4M66A 1WBSA 2JDSA 4QPMA 3RI1A 3UDBA 5IH4A 2J0MB 2ZM4A 3BLQA 2OF4A 2FGIA 2GFCA 3V5TA 3HP5A 5IQEA 1H24A 4PWNA 4ZS0A 3EH9A 3W2OA 4FTCA 5CTPA 3QCSA 4DYMA 1A48A 3U54A 1ZYDA 4IJ9A 3VRZA 4FK6A 4ZMFA 3QQHA 4KNBA 4AS0A 3EQBA 3I79A 2UZBA 4WNOA 3HA8A 4CT1A 2Z8CA 2XK7A 4QMZA 1QMZA 2CGWA 4QO9A 4FZFB 3R0TA 1IAJA 1H27A 1XO2B 3MI9A 3QALE 3VS1A 4RWKA 4F9CA 3PE2A 3KVWA 3PXFA 2W1GA 5IQAA 3AMYA 3R30A 3DKFA 4YJTA 2PU8A 3DFAA 2CNVA 4PRJA 3HV3A 5TE0A 4AGWA 1Q3WA 4DCEA 5K5NA 4DF3A 5CEOA 4IWOA 3QD4A 3W1FA 4BKYA 3WF8A 3ZC5A 1Q8YA 1IASA 5EQPA 2YLEA 4MH7A 1A06A 2QI8A 3TXOA 3NDMA 2AC5A 3BE9A 2I1MA 1J3HA 2X4FA 4NFNA 3FC1X 3PXQA 3UQGA 2UW4A 3HAMA 4KIQA 2ITYA 3VBWA 3D4QA 5E92A 4ZTNA 4JAIA 4DT8A 3NVKI 3Q5ZA 2HWPA 2IVSA 4RIWA 3DBDA 2WU7A 3HV6A 4RVKA 1GAGA 2X8EA 3R28A 4UMTA 4QP6A 4FIGA 3EN4A 3FLZA 3QZIA 5JT2A 3H10A 5LVMA 3LFDA 4XG2A 3WIKA 4FI1A 1OL6A 2WTWA 1O6YA 2YCQA 3EFKA 4C57A 3F3ZA 4MD9E 4OTHA 4O7TA 3O17A 4RC2A 4YJUA 3W16A 5EDRA 3DJ7A 3ORTA 3Q4UA 3ZCLA 4U80A 5HIEA 5CANA 4RIWB 4OGRA 4KIPA 1V0BA 1LUFA 5LWMA 4H3PA 1YKRA 4FV8A 4JR7A 2UZUE 5ETCA 1JPAA 3C0HA 3QRTA 4FSQA 4X3FA 4DEIA 4FTTA 4R78A 4O22A 3HGKA 4FTUA 3ORMA 1PHKA 3UTOA 4I0SA 2CGVA 3DB8A 3E88A 4U5JA 4PP7A 3AGLA 4GKHA 3P4KA 2ITTA 4EK8A 4GKIA 5AFVA 5E8ZA 4UMUA 3D9VA 3VBQA 5B2MA 4LGHA 1TQIA 5A14A 4Y72A 3GC8A 3PRFA 4FV4A 3KCKA 4KBAA 2IPXA 3LAUA 4L42A 3NLBA 4GV1A 3R2BA 3BYOA 4X3FB 5HE3A 3EN5A 3QWJA 1NA7A 5AUWA 3MPAA 3RGFA 4KUJA 4R6VA 4RIOA 4JX7A 3P5KA 3HECA 3ZONA 2PTKA 3OXTA 4D2WA 3GB2A 3GFEA 2QC6A 4YSJA 3HDNA 4UWBA 1W0XC 2W06A 2ZV7A 4RC3A 4XG6A 5EM7A 4EH7A 3DTWA 1FOTA 2IO6A 3L1SA 4MQ2A 1MUOA 2JBPA 4PQNA 1PJKA 2FSMX 4QTBA 2E2BA 4UY9A 4HVHA 4IMYA 4U3YA 3DPKA 4L7SA 3ORIA 1XH4A 4JR3A 3VW8A 2OLCA 1IEPA 3Q4CA 5FQDC 3H3CA 1OBGA 1WBOA 2JITA 4RIXA 1UU7A 2XJ2A 3C9WA 3KCFA 4FT7A 4TYGA 5FP6A 2Q0BA 2WKMA 4EZ7A 2W1HA 4TWNA 4I22A 3ORXA 4AZTA 2W96B 1JWHA 5JSMA 3UVQA 2XK4A 4S2ZA 2QOQA 3R04A 4ITJA 1ZOGA 2J2IB 3GCSA 4E73A 2Z60A 4YSMA 4X2KA 5C1QB 5IUHA 3MIYA 2YIRA 4O38A 3I0OA 2Y4PA 5B0XA 4UN0C 5L4QA 2ZV2A 4YNOA 3RINA 5JGDA 2XNBA 3BHTA 3KMWA 3R71A 4JBVA 4W4WA 4BDFA 4BCKA 5L6PA 3P7CA 5F9EA 4M12A 4RIXB 4AGCA 5HE1A 4DEDA 4FT5A 4QP8A 5CZHA 3VF9A 4M68A 4D55A 2ONLC 1YXSA 3F66A 2FUMA 2IZUA 2WELA 4YZDA 5AX3A 5CI7A 5J9YA 2B0QA 3C50A 4YJPA 3NNWA 2YDIA 1O6LA 3C4EA 4EH8A 3NUAA 3DQWA 3VUTA 2J7TA 5HBEA 3P08A 2XYNA 4BDHA 2W17A 2XIXA 3LMGA 4YGAA 4NK9A 2ZV8A 4M13A 1R1WA 2P4IA 2PE1A 3HV5A 3LXNA 3OZ6A 3QGYA 4C61A 4RLLA 3SW7A 4O6EA 4PMTA 4FSNA 5DYJA 3ZC6A 5CSHA 4I6QA 2WPAA 5H2UA 5J8IA 5LOHA 4G5JA 1ZMVA 2ZOQA 4WO5A 2O64A 2YM7A 4KBCA 5DIAA 2I0HA 1M2QA 5AUYA 3W2QA 4DAWA 1YWRA 1V0PA 3MH1A 3ODYX 3HV7A 3QGWA 4RC4A 3AT2A 4CXAA 5M06A 3WF6A 2F7XE 4BZDA 4J53A 5K0KA 3FLSA 3C4CA 4YJVA 2IG7A 2X39A 3D83A 4KIKB 4U9AA 4AU8A 2C5NA 5M4CA 3LQ3A 2QOCA 4L68A 3FLYA 4IVCA 2BFYA 3IW6A 4O1OA 4S33A 4UB7A 3T9IA 4I5PA 5J79A 5CX9A 1U54A 2QO2A 5ANKA 3WI6A 4ACGA 5JMSA 1JAMA 2ZB1A 3R1YA 2JDRA 2XH5A 1PYEA 4XG7A 1OIUA 3GBZA 2A1AB 3PA4A 3WZDA 1OUYA 3HP2A 4QYGA 3HMNA 3U6HA 4KSPA 5JRQA 1H1WA 1YHWA 5IA0A 3GU7A 5KZ0A 3OTVA 2YIQA 2YZLA 3BGZA 4I0TA 1ZARA 2YM4A 3A7FA 4IM0A 4O6LA 2BR1A 2PUUA 3G6HA 4AZEA 4F9AA 4ID7A 5CF8A 4HNFA 3WE4A 4BTKA 2VGOA 3FMHA 3F82A 4OT6A 5JRSA 3GU5A 2C6TA 4N6YA 3TNHA 4DEHA 5CF6A 3ZEPA 5CF5A 4R1YA 2CGXA 1ZLTA 3OW3A 4AW0A 1Z57A 4IC7A 2R3JA 3RHXA 5I5ZA 1U5QA 3C4WA 5AV3A 3RNIA 2G9XA 4C2VA 4EOPA 5HO7A 3R63A 1VR2A 3BELA 4IZAA 5D10A 1CKJA 3G51A 5HOAA 1VYWA 5EM8A 5EYDA 1OKYA 2BPMA 3MYGA 2PZPA 2EXEA 2XMYA 4CT2A 4EK4A 4M15A 4ASDA 4FKWA 4RVTA 5CVHA 1Q24A 2OH4A 3NRMA 2X7GA 2XKEA 3JY0A 2OZAA 4G6OA 4C35A 3U55A 5H8EA 3UZPA 4ASXA 2ZMCA 4EKLA 3KU2A 4RPVA 1R0EA 2UVYA 2RG5A 4FSUA 4U43A 4WSYA 2HK5A 1HCLA 1GIHA 3OWKA 3BEAA 4F0IA 5CAVA 3C1XA 2FB8A 2R3QA 2WTIA 1PMEA 4FKRA 4MD7E 3EFLA 4TYJA 2DS1A 4D5KA 2PVKA 1LP4A 4NW6A 3F2RA 3TM0A 3UVPA 2QHMA 4L46A 2OZAB 3CTQA 3R21A 2VGPA 3FL4A 4QMMA 5AP2A 4HZSA 5AR8A 4KKHA 3KVXA 4MD8E 4F0GA 1Y8YA 3LM5A 5AV2A 5BUJA 5DT3A 1ZAOA 2Z7RA 3R1NA 4FA2A 3DZOA 4QTDA 3QTWA 4ZLYA 4CCBA 5BNJA 4S30A 4GVJA 4PL5A 2QR7A 3BYMA 3R83A 2BAJA 2CJMA 3FWQA 3RAIA 4DFNA 5HHWA 2Y8OA 5F94A 1T46A 2KTYA 5HLWA 4HYIA 4BTJA 3V8SA 5TF9A 4BKJA 1YDTE 4O91A 3ORKA 5A6NA 1JVPP 5E8XA 5ETFA 3VWAA 1KE9A 3N51A 2ZAZA 4FTOA 4JX3A 5ANIA 3P78A 3UIXA 4EOLA 3ZU7A 4Q9SA 3UZRA 2VWZA 2OWBA 3HDMA 3KB7A 4FSTA 5LMKA 4C02A 3NS9A 2YFXA 1I09A 1KE8A 3BKBA 4FOBA 2VTHA 2UW0A 2Y6OA 4TNBA 4A9TA 2CKQA 2IVTA 3BHHA 1U46A 4YZNA 4BC6A 4C33A 4USFA 2Y4IC 3V8TA 3CY3A 3RCDA 1ZY5A 5L8LA 3VVHA 3QKLA 1UKIA 1W8CA 2LGCA 2C30A 3UNJA 4WBOA 2YAKA 4L53A 4M97A 5L8JA 5IA1A 3VN9A 5FEQA 4BR3A 3FXXA 1G8SA 3G15A 4XG3A 2EXMA 4YTIA 3RJCA 4WUAA 5LMBA 3H9FA 2WAJA 4XBUA 3TJCA 2HIWA 1UWJA 4AW5A 1P2AA 3PJCA 4LV8A 5CZIA 3DKOA 3FZTA 1H1QA 2R4BA 2XM8A 3BQRA 3COKA 5CI6A 5CT7A 3A8XA 4XLVA 3T3UA 4CMOA 2PZRA 4AXAA 3V5LA 5DEYA 5DT4A 2WZJA 3AC4A 3EQGA 3QLGA 4FNZA 4F1OA 2QVSE 5HTCA 2NPQA 1H26A 4J95A 3IW5A 3MFTA 2I6LA 1UNGA 2GTNA 2WMVA 4MAOA 4QMTA 5AP4A 3ZRKA 4O7NA 4EJNA 3GENA 3UJGA 3R9OA 4YNEA 2BTRA 3NIZA 4KABA 2CN8A 3VS5A 4L6QA 2CKPA 3PWDA 4I4EA 2HOGA 4HCTA 4XH6A 1FPUA 5M57A 2NNWB 1ZY4A 5ANDA 5IDNA 2BZHB 4Q2AA 4RX7A 1YWVA 3E7VA 1JNKA 4EH9A 4MBJA 4ANSA 3R9HA 4GUBA 1WBWA 4UBAA 4FIEA 5A4TA 1XQZA 2JAVA 5JFWA 3LM0A 2J0JA 3U51A 4KSQA 3RM6A 3R2YA 4OAVB 3FI3A 1XBCA 5JQ5A 5LWNA 2VO7A 4G6NA 4LL0A 2UZEA 4U40A 3I7BA 4WRGA 5CAOA 5HLNA 4IWPA 3LLTA 4CCUA 3A4PA 1BKXA 4IX6A 4ZSEA 4LI5A 2OSCA 3AOXA 2I7QA 3HAVA 1PXIA 1SVHA 1VEBA 2HY81 2WTKC 1NXKA 2VTIA 2XUUA 4DH7A 4AUAA 4F7SA 2XVDA 1OKZA 5IISA 1P4FA 4AF3A 3OVVA 5B2LA 3KXHA 3GQIA 2WMTA 2W4KA 1Q62A 3MA3A 3T8OA 1GY3A 2W1FA 3RWPA 4U81A 1Q4LA 4FSZA 3K5VA 3KK8A 3HUBA 4G9RA 5EK7A 2EXCX 4BCHA 3SXSA 4TN6A 5AV1A 3VS7A 5C26A 4APCA 4IWQA 2CGUA 4PDPA 4FR4A 2C3LA 3R8ZA 3M1SA 3K2LA 4FX3A 4DLIA 4PDYA 4A07A 4LUEA 5C8NA 2OIDA 3GCVA 2CLXA 3Q6WA 1T45A 2YCSA 2EB3A 3KXXA 4NIFA 4XUFA 5F20A 3QRUA 3R8PA 5JGAA 3ZOSA 3B2WA 1TKIA 3BU3A 2WEVA 5HBJA 1YXXA 5J5SA 2DYLA 2GHMA 4O2PA 4BCMA 3EQDA 5T3QA 5G1XA 5CWZA 4CFFA 4IADA 2VTRA 3LFSA 3DBCA 1YHVA 3ELJA 4LG4A 3RVGA 3UC3A 3DQXA 2WEIA 3QU0A 4DH3A 3EQRA 3MGYA 4TYHA 5HCXA 3SKCA 4NJ3A 4L7FA 2BCJA 4NIFB 2SRCA 2BDFA 5CU4A 4DGMA 4Z7HA 4BCGA 3G9LX 3KF4A 4II5A 1XKKA 4YJOA 5CF4A 4YP8A 2QKRA 4QD6A 4NKSA 4R7BA 3FKNA 5E9EA 4MXZA 2PVMA 4IDTA 2BAQA 4AN2A 4ZAUA 4YPDA 5FG8A 3W55A 4HVDA 3R02A 4RX5A 4YMJA 4PMMA 5KMLA 4UZDA 5GZ8A 4TY1A 4MF0A 5EOLA 1BI8A 2HZIA 3BZ3A 3OP5A 4BCPA 2C1BA 5IDPA 3IW4A 4FIJA 3V3VA 1APME 2XYUA 3ZO1A 4GK2A 2EUFB 2BROA 2ZYBA 3MJ2A 4G2FA 1J7LA 2RFDA 2WOTA 4PL3A 3W18A 3ZUUA 2XEYA 4NU1A 4JDJA 4IAZA 4PL4A 4XG8A 4GIIA 4JIAA 3C5IA 1SNXA 2ITXA 1YI4A 3KMMA 4N4SA 4DH8A 4E4LA 4F6UA 5KBRA 2HZ4A 4A7CA 1PXOA 4HGSA 2VWYA 3QBNA 3IW8A 3PG1A 4FTRA 2CCIA 4LQMA 1EH4A 3BU5A 3WZEA 3EB0A 1OIQA 2OO8X 2WFYA 4KAOA 3Q2MA 5FD2A 1TVOA 3ZFYA 3ZO2A 5D1JA 3BI6A 2R3PA 4F6WA 3LXKA 5HVJA 4TRLA 3FKLA 3IO7A 2OG8A 4CZUA 2UV2A 5FTGA 3PJ2A 4DG3E 3MJ1A 4C4EA 3SAYA 3BU6A 3NUXA 4J96A 2R3HA 3PIYA 3MBLA 2XJ0A 1O6KA 5H8GA 4E8AA 4GYIA 3FPMA 3O96A 3EYGA 4RG0A 4FK3A 4FYNA 1RW8A 3A60A 3Q52A 4FKSA 5FBOA 5A3XA 1BI7A 2UW3A 4R5SA 1ZZLA 3PJ1A 2FVDA 3MA6A 2VRXA 3ZRMA 2GSFA 3KN6A 4DFLA 1P5EA 2VTTA 4JJRA 4JQ7A 4YBJA 4E1ZA 3NIEA 4IVBA 4X2GA 2GTMA 4IAYA 2BALA 5A9UA 4AOJA 4AE9A 2CDZA 2XRUA 3Q6UA 2IW8A 4IX5A 5HTIA 4U3ZA 2J0LA 3NUSA 3VS4A 4IXPA 2BDWA 3G2FA 4MVFA 3NNVA 1NVQA 3MH0A 1UWHA 3NYVA 3PJ8A 5D41A 2F2CB 1PXJA 4O1PA 2C68A 2Y0AA 3L9MA 3OWJA 4W9XA 5HESA 3QYWA 4RVLA 4B99A 4E5AX 5HU9A 4DFBA 1OIRA 3ZBXA 1RDQE 3AD6A 3KRWA 3V5WA 3DDQA 4RJ3A 3M2WA 4XS2A 3BEGA 2H8HA 1XH7A 5HIDA 4QMYA 2X1NA 3Q32A 2C69A 4AA0A 3C13A 5HZNA 4NYEA 2ITPA 3GCUA 3OWPA 5HNGA 2FSLX 2ZJWA 4D4SA 3BYVA 1UNHA 2Z7QA 4A9YA 5GZAA 5A4LA 2G2HA 4H3QA 1TQPA 1OBDA 3V51A 2WQEA 3MPTA 5IA4A 3LW0A 5BYYA 4B8LA 2WQNA 4O0SA 4IH8A 3L8XA 4X3JA 3ZMMA 2X7FA 2E9UA 2R3GA 3F7ZA 3HZTA 1CSNA 2BHHA 4MBIA 2WB8A 3BV2A 5KX8A 5FLFA 5DG5A 3WBLA 5FWKK 4KBKA 4OTDA 4FV3A 3OG7A 4CV8A 2BRBA 3QKKA 3ZLSA 3DTCA 4YURA 3CQUA 4PDOA 3V5JA 2B55A 4BCFA 3ZTXA 4EKKA 3EN7A 4CNHA 3SXRA 4JG7A 5E90A 4I0RA 3TKHA 3U6IA 4V0GA 4EZ5A 5AUTA 2BUJA 2YZAA 1UU3A 3QHRA 4BIDA 1DI9A 5DHJA 4BF2A 2QLUA 5M44A 4O7YA 2YHVA 2XNEA 4ZJVA 2RGPA 3K5UA 4UZHA 3TIYA 5AUUA 4D2TA 5AP5A 2XKFA 3FBVA 3BGQA 4JBOA 5JZNA 1J1CA 3HVCA 5FP5A 5EW9A 5HNIX 3CE3A 4FBXA 1QPCA 3DXPA 4TWPA 4F9BA 4HPTE 4L44A 1WAKA 5M55A 4FKUA 3MN3A 1DI8A 3D2KA 3R9RA 3I4BA 5KE0A 2JAMA 3ZLWA 4AGUA 3GC0A 4RJ8A 4AA4A 4BWKA 3HMPA 4CZTA 4AE6A 3RK9A 4DEEA 2C0OA 3MDYA 4O0RA 2UW5A 2IVUA 1FBNA 2O65A 3NAXA 4I93A 3BWJA 4EOJA 4FEXA 2FA2A 2C4GA 4TYIA 3A2CA 3FV8A 4OTRA 1B6CB 1JLUE 4E93A 1E1XA 4RSSA 1QCFA 4FTLA 3FKOA 2OXDA 4XMOA 4EHGA 5DNRA 1MRVA 4UEUA 2ZM1A 3CKXA 3U87A 2CPKE 1KOBA 2F2UA 2VV9A 1RQQA 2UVXA 4K8AA 3IGGA 3DY7A 4XLIA 4YHTA 3RALA 3F69A 5I4NA 4I92A 4XV9A 4YZCA 3KEXA 4AW2A 3FZPA 4NL0A 5BYZA 2XK8A 4EH4A 5CAPA 4DTBA 3D5WA 3LLAA 2WMQA 1A9UA 4IAAA 3F3UA 4AACA 3DKGA 5AX9A 4XP2A 2VWWA 3I1AA 4RJ5A 3PPJA 3FYKX 4BCQA 2QCSA 3L9LA 4FVQA 3UMXA 3GXLA 2GQGA 4NW5A 2YWPA 5JN2A 5CEQA 4K1BA 3UP2A 5CLPA 4O7RA 3QRJA 3CY2A 5T6KA 4D2VA 2P2HA 1PKGA 2WQBA 3D5VA 4FIHA 4C4GA 4BZOA 2JDOA 2GHLA 4IAIA 3R6XA 3U9CA 4ZTMA 4L3JA 3ACJA 5ICPA 2FSTX 1G5SA 4YTHA 5LVOA 2QODA 3NUUA 3OCBA 2PMIA 3CJGA 2DWBA 2ZMDA 2O0UA 3LFBA 4EOQA 3BCEA 4GYGA 2JIVA 4TWCA 3Q04A 1NW1A 4FIIA 3BBWA 3FAAA 5IUGA 1YI6A 4K6ZA 4U44A 4F1MA 3HNGA 4OTQA 3OY1A 4ZTSA 4EHEA 2X0GA 4KS8A 2VN9A 5HE0A 3TIZA 4FNXA 1YHSA 4XP0A 5AM6A 3EOCA 1H07A 3LCTA 1Q5KA 4DGLC 3E87A 1OZ1A 5HCYA 3ENHA 4NTSA 4FG7A 4YC6A 2YLFA 3P0MA 4HCUA 5DVRA 3S2PA 4LGDA 4M8TA 2B9IA 4PV0A 2YIXA 3MY0A 4U0IA 5HTBA 4DA5A 4TL0A 4GT5A 2OBJA 4RJ7A 3VJNA 4ZXTA 3ULZA 1H08A 4C0TA 1FVVA 3NSZA 3TKUA 2GNLA 4HYHA 3TTJA 5HI2A 1JKLA 3ZRLA 4UX9A 3F5UA 3ZM4A 4D4YA 3PXYA 4NT4A 4GFOA 1ZYSA 4KWPA 3W10A 3EKKA 1OL7A 1H1SA 4GG5A 2H6DA 2Y6MA 4QMSA 4U7ZA 5CQUA 3AG9A 4N70A 4FGRA 2ZV9A 1W98A 5DWRA 3W2RA 3OUKA 4TPTA 4A9UA 3RM7A 5BVKA 3RPOA 3NUYA 2PWLA 4K18A 4EH5A 4GJ3A 2I0YA 4GFGA 5FDXA 4F1TA 2PPQA 2ITVA 3SW4A 4ONAA 4FZAB 3CIKA 2C6LA 3C0GA 3MTLA 3PVUA 1UA2A 4BBMA 2YJRA 3QUDA 3R1QA 2UZWE 3LOKA 3ETAA 4GT4A 2PE0A 4BYIA 4FTMA 4BWXA 5E7RA 4ALWA 4IVAA 4KINA 3O8TA 3RPRA 2WMAA 5LVPA 4RGJA 5L3AA 3MSSA 2WQMA 5GHVA 5FBNC 5TT7A 5AJQA 4EC8A 4K9YA 4YZ9A 4KKEA 3WF7A 3TJDA 4YLLA 4KD1A 3D2IA 4LRJA 4RT7A 5HGIA 3OUNB 3QC4A 4B0GA 5JGBA 2BKKA 4I5HA 4EQUA 3DJ5A 4I3ZA 2PZ5A 4NM7A 3TNPC 5CEPA 5FXRA 3LFQA 3ZO3A 3LMHA 5EDQA 2OJFE 5I0BA 3UYTA 3PDTA 4RBLA 3TNWA 4D9TA 4D2RA 5I9VA 3JY9A 5JKGA 5IZFA 1FVTA 2UW8A 4GU6A 1H4LA 2WNTA 3E64A 3N9XA 2R3IA 1XBBA 4NWMA 4E6CA 4F08A 2OXXA 2YM5A 1PMVA 3DKCA 2BTSA 4P7EA 4M84A 3FPQA 3O7LB 2AC3A 4FNWA 3O8PA 4O7VA 4ZP5A 3THBA 3ZLXA 3VS2A 4BI1A 2J50A 4XG9A 5KNJA 1V1KA 1UU8A 4RLKA 1LEWA 2BRGA 3A7IA 2YDJA 2V62A 3C4FA 5AUVA 4X6QC 2UW6A 3VUHA 4CSVA 5M4UA 4JNWA 2X2KA 3GU4A 4IAFA 3FSKA 4X2FA 1P14A 4EK3A 3IDCA 4GJ2A 4J7BA 4E7WA 1IR3A 2JIUA 5D12A 5H3QA 4EH2A 4M7IA 4U41A 4FG9A 2VUWA 4GRBA 4ASZA 3E3BX 2X2LA 1ERKA 3EQCA 4JG8A 4X7QA 4FZ7A 2Y9QA 4QYEA 2RFSA 4CFVA 4G1WA 2C6DA 2V7OA 5GJGA 3N4UA 3QFVA 3KY2A 3O50A 3VHKA 1PXMA 2GHGA 4JAJA 2X7OA 3NGAA 4PPAA 4RVMA 5BVNA 3D15A 4E4MA 3LFCA 3UQCA 4YJQA 4LMNA 4RA5A 3NPCA 3I5ZA 4B4LA 3AQVA 3MV5A 2WMRA 1M2PA 2OZOA 4G16A 4H1JA 4V04A 3I81A 3Q9YA 5ANEA 1HOWA 3TZ9A 3RBWA 3PWYA 2RSVA 4IX3A 4EZ3A 5HVKA 4QMXA 2G15A 1SZMA 4QP7A 3DK7A 2KULA 4CFXA 2VO6A 2XRWA 2VX3A 5DEWA 4IB1A 3I60A 5E1SA 2C5OA 2WO6A 4EC9A 1GJOA 3VBYA 1YDRE 4ZY4A 2JIIA 2R5TA 4N6ZA 4E4NA 3HX4A 1JQHA 4UALA 1KE5A 2I0EA 4IX4A 4R7HA 5KBQA 5KO1A 3ZUVA 3F3TA 4O2ZA 3PXKA 5CSPA 1ZYCA 3GQLA 3GFWA 4JRVA 4AX8A 3ZFXA 4W8DA 5FUTA 3CD3A 2C47A 5C4KA 4Y8DA 5BVEA 2WGJA 4K11A 2ITQA 3WYYA 5E8YA 4YTFA 2PUIA 3PP1A 5AUXA 1Z5MA 1KE6A 3VBVA 1BYGA 4XRLA 3ORNA 2ZB0A 5D9HA 2WTJA 3MH2A 1VYZA 2P2IA 4ANMA 3Q60A 4BIEA 5KMMA 4RZVA 5CVGA 1U54B 4YTCA 3GC9A 1KE7A 2JLDA 3DA6A 2WHBA 3BLRA 3U9NA 3HRFA 3WARA 4GL9A 3WILA 2AUHA 2VZ6A 4EHZA 5BUEA 2B52A 1URCA 4UWCA 1F0QA 3OY3A 4EOKA 1AD5A 2W99B 2W9ZB 3TWJA 3W32A 2BFXA 4WBBB 5L2SA 3GC7A 5KKRC 3UBDA 3HA6A 3DBEA 4MXAA 3OEFX 4RZWA 3MY1A 2C5XA 1YXTA 3BRBA 2NRYA 3EFWA 4UWYA 1H00A 5DE2A 5ANOA 5EI8A 1W84A 4C8BA 4D9UA 4DT9A 4GS6A 4BGHA 4CKJA 5KMNA 2NRUA 2XIZA 3SG8A 2C6MA 2H96A 4W4VA 3A8WA 4MWHA 2GNGA 5J9LA 4AFJA 5CT0A 1WBNA 3DAEA 3NNXA 3Q9ZA 3QQFA 4ORKA 4LRMA 4IZYA 4OTPA 2IZTA 3SXFA 4JBQA 4YHFA 4IEBA 4QOXA 1OL1A 4Y5HA 3GP0A 4RFYA 1FMOE 4QP4A 1GIIA 3OOGA 4NM5A 4B9DA 3HUCA 2JEDA
chains in the Genus database with same CATH superfamily
3BPRA 5C27A 4ACCA 5AADA 4EHVA 2HAKA 4I20A 5HIBA 3BLAA 5HG9A 4P4CA 3MW1A 3QLFA 4DE4A 4J97A 3Q4TA 5HEZA 3A61A 5CQWA 3VC4A 4S31A 3TYKA 1BL7A 3PA5A 3V6SA 1Q8UA 3QHWA 5C8KA 2XIKA 3ZDIA 5AIRA 1YXUA 3UIUA 4CZYB 5DRBA 4QTAA 2X2MA 3PPKA 2CKEA 4L43A 2PVFA 4FZDB 4O0VA 5LXMA 5EDPA 2B9JA 4DTAA 3ID6C 2PMNX 3LIJA 4UXLA 1Q8ZA 4IFGA 1OKWA 4U79A 3I7CA 1BL6A 3PIZA 1AGWA 3WIGA 4DITA 4NTTA 1E1VA 1J7IA 3DNDA 4X6RA 5H8BA 1PRYA 4OR5A 4AP7A 4Y5QA 3AC2A 3REPA 4Z3VA 1FINA 4FUXA 1PW2A 4ANLA 4ACMA 3UIBA 2GQRA 4IZ5A 3A62A 2E9NA 3D5UA 3GT8A 3QAME 4R8QA 4OTGA 4CMTA 5B7VA 5IEYA 4GU9A 2IW6A 3RK7A 3CD8A 5J87A 2QOOA 3ULIA 4JRNA 4CFWA 3HLLA 5I9XA 2PE2A 3NW6A 3W0PA 3AMBA 4BFMA 4ZTQA 4EEVA 5CXHA 4QMVA 5J5TA 2UZOA 3LHJA 4EOMA 5K4IA 3ZSHA 3KREA 3W0SA 2XAMA 1E9HA 3QRKA 3KXMA 3JS2A 4HZRA 5LJJA 2WIHA 3UYSA 4IDVA 2O5KA 4AOIA 3TNQB 1JKSA 3QYZA 2ONLA 3UO5A 4A4LA 2GDOA 3UPXA 3IKAA 4E20A 3CEKA 2ZM3A 3ROYA 5ACBC 1BUHA 2B1PA 3TCPA 5BPYA 4DEGA 1OVEA 3W0MA 1O9UA 1W83A 2X6DA 5ANGA 3QQUA 3PSCA 2YA9A 4R3RA 5FXQA 3QTSA 3SV0A 1Q8TA 3GGFA 3CGOA 4FSRA 4GVAA 4OTWA 3AD5A 5M53A 2WD1A 3MFSA 4M0ZA 2OFVA 5B2KA 1WMKA 2Y7JA 4LV5A 4W9WA 5L2QA 3E62A 3ODZX 2F9GA 4MWIA 4FTAA 1BMKA 4QRCA 2OJGA 4FV2A 4XYFA 2ZDUA 3EQFA 5GNKA 4ZLOA 1H0VA 3PRIA 4QTEA 3AXWA 2GFSA 4QMQA 2XNNA 4FSWA 1WVYA 2C6KA 1SVEA 1CMKE 2XKDA 3R7IA 5M51A 3KFAA 2B54A 2J0KA 3IGOA 1UKHA 4AT4A 2WMXA 2WU6A 5EFQA 2YCFA 5HO8A 1YRPA 2VO0A 3FMNA 4FG8A 4WNMA 3OXZA 2GS2A 4EOSA 4AG8A 3DLZA 4NH1A 5FEEA 2FYSA 4U42A 3ANRA 4FYOA 2IJMA 3D0EA 4J71A 4YR8A 2J6MA 3ORPA 3DK3A 5L2TA 5AP1A 2HXLA 1CDKA 2W0JA 4U6RA 2GQSA 2ZVAA 3EFJA 4LUDA 4DN5A 2R3MA 5EM5A 5M09A 2IN6A 3ANQA 5M07A 1GNGA 2R3OA 3KULA 4CRSA 3BLHA 2XKCA 2J4ZA 4MNFA 4JXFA 3FLQA 2YM6A 4DFZE 4M3QA 3H0ZA 4ZS4A 5IU2A 4NEUA 2W7XA 1YQJA 1ZMUA 1JSUA 4H39A 5DRDA 3UOHA 2WTDA 1Y6BA 3DOGA 5ETAA 1GZOA 5EM6A 3OCTA 4X0MA 2QU6A 3QZGA 4HGEA 5AP7A 4EWHA 3L8SA 4G3EA 4FL1A 5LCJA 3QKMA 4PDSA 3AT4A 2OXYA 3NEWA 4H58A 5HKMA 3U4WA 3KULB 3POOA 3NMUF 1YOLA 3IG7A 3MB6A 4BWPA 3FI4A 2BKZA 3FHRA 4B6LA 3S0OA 5KMJA 4J99A 4F9YA 4J98A 5E91A 3P86A 5AP0A 5BVFA 3IK3A 4PP9A 2QOHA 5CYIA 2W4JA 3OBGA 2VTOA 5K0XA 3C51A 2YABA 1B38A 3H9OA 4FEUA 3FHIA 5IH5A 5IEXA 5L8KA 1NVRA 3G90X 5DH3A 3R7UA 4FKOA 2YDKA 1TFFA 1WZYA 2IZRA 4DG2E 4PMPA 3K3IA 3TI1A 3V6RA 1H28A 2ERKA 4QPSA 4WHZA 3DFCB 4R5YA 4WNPA 1PYXA 3RCJA 3IDPA 4IM3A 4ZIMA 3E92A 3VUGA 4ZY5A 5FRIA 4L52A 4N0SA 3PIXA 3I5NA 5I3OA 3JUHA 3O7LD 2XALA 3I6WA 2X4ZA 3QQGA 3N4VA 5KMOA 2QHNA 2YIYA 5HLPA 4XP3A 4ZJIA 5TOZA 4E4XA 5HQ0A 3QXOA 3G6GA 3GUBA 1U5RA 3TEIA 4XG4A 3R7VA 3NX8A 4GK4A 4WG5A 3OT3A 4TYHB 4BTFA 4PPBA 4ALUA 4FSMA 3OC1A 1WFCA 1LR4A 2I0VA 2E9OA 2WIPA 5DMZA 3BHUA 5AA8A 2HWOA 2QOBA 2X9FA 3RK5A 3MPMA 4R77A 2B9HA 3R9NA 3GCQA 4L8MA 3DXNA 1MP8A 5CSVA 3BWFA 1XH5A 3CBLA 4OLIA 4YBKA 4C3FA 3PXZA 5KCVA 2G2FA 3O5AA 3PLSA 5AEPA 3OHTA 2XS0A 3E5AA 2QOKA 2HYYA 3S4QA 3ZZEA 3ALOA 2QLQA 2ETRA 2HZ0A 2PVRA 5BVOA 4EYMA 4BBFA 4JI9A 2XK9A 4LOOA 2O3PA 3S3IA 3BV3A 3OT8A 4AZVA 2VTNA 3F61A 2EU9A 4XHKB 5DBXA 5LVLA 2VTJA 4JQEA 2P55A 4AQKA 2BZIB 3KA0A 5AR5A 5A4QA 5F4NA 3PY1A 1SVGA 1R39A 3FY2A 2O8YA 4MCVA 4C3PA 5LMAA 2JDVA 2YN8A 3R1SA 3F7WA 4V05A 4DBNA 4ACHA 4KS7A 5A54A 2R7BA 3MIAA 3ATTA 4PTCA 3NCGA 4RQKA 4ZY6A 4YO4A 4LOQA 4I1ZA 4GUEA 4PY1A 4M69A 3FQSA 1PY5A 5EKNA 3KF7A 4MQ1A 4HGLA 2GNFA 4GT3A 5C9CA 3UZTA 3QRIA 1V0OA 5KHWA 1UVRA 2Y4IB 4M67A 3TKIA 4CLJA 2GPHA 2GNJA 4GK3A 3C0IA 5CU0A 3HRBA 3VBTA 4FV7A 3ZXTA 3A99A 3K3JA 3EMGA 4G34A 3A7GA 5KMIA 2QG7A 3R8UA 3HL7A 2PL0A 4M69B 2UW9A 4QP2A 4LRKA 3KL8A 3GU6A 5HX8A 3AC1A 3CGFA 2BRMA 3R7EA 4BY9E 5L6WL 3SRVA 3CC6A 3DDPA 4CYJA 4E6DA 4ZZMA 4D28A 3HMIA 4CD0A 2P0CA 5HG5A 3MVLA 2C0TA 1OITA 4EOIA 4F4PA 3SLSA 2HELA 4O86A 3FMKA 4AW1A 4KRCA 3EN9A 2JKQA 3UGCA 2W05A 2FSOX 4K2RA 1UNLA 2BILB 4CFUA 1IA9A 4JT3A 2QG5A 5CS6A 5EYKA 4I6FA 5HG8A 1SYKA 4BB4A 4FMQA 5CASA 3LXPA 2PVHA 3FMDA 3RTPA 4D4VA 4EI4A 2UVZA 1PXKA 3PY0A 4JDKA 4XRJA 1LEZA 2A27A 3U4UA 2RFNA 2JKMA 3UOKA 1Q99A 3LJ1A 5CALA 4C4JA 4LMUA 2C6EA 5CEIA 4D0WA 3IPHA 3ENMA 3VUKA 1M2RA 3LCKA 4TKSA 1JBPE 3HKOA 4PNIA 4X3FC 2W5HA 4FL3A 2CLQA 3DAKA 4O0YA 4AOTA 3P7BA 2VX0A 2XM9A 3OXIA 2RIOA 5M08A 4PF4A 3VJOA 2REIA 3WZJA 1Y57A 5C8MA 5AAGA 2XBJA 4P5ZA 5DLSA 5I3RA 3S95A 5DPVA 3R8LA 4EONA 4FTIA 3JPVA 2WTKB 4IANA 4DLJA 3AC3A 3EWHA 4EOOA 3K54A 2UZLA 2W1ZA 3OW4A 4MXOA 5A46A 2VAGA 3UO4A 3U6JA 4RJ4A 3NCZA 4FKLA 3VULA 3GVUA 3WZUA 1M7NA 3MS9A 4E26A 4ZSJA 4G3DA 4V0GB 3FZSA 3QUEA 4P90A 5IH6A 1KOAA 5IMEA 4PMSA 3W2CA 5K4JA 4XOZA 4HNIA 4HW7A 4OTFA 4EUTA 5D7AA 2PMLX 5A6OA 4GG7A 3QZFA 4YJSA 4JS8A 4DH1A 4FKPA 2YM3A 3LFEA 1RE8A 3A7JA 4O96A 4D5HA 3DBQA 3PP0A 3BBTB 2UZNA 2G01A 3E3PA 4QMWA 4G6LA 2GNIA 2WTVA 4J1RA 4XNEA 3BHYA 4MXXA 3BX5A 3R7YA 3DS6A 4U45A 4WKQA 1ZOEA 4B8MA 4O81A 2PUPA 2EVAA 2WMWA 3O8UA 3UDSA 2VWXA 3UC4A 3KQ7A 3PVWA 5AUZA 1DS5A 2F49A 5IQGA 3JXWA 4RQVA 2R9SA 1BX6A 3EL8A 3FYJX 2ITZA 5LQFA 1YI3A 3P23A 4ZJJA 4MNEA 5FTOA 4G5PA 3ZLYA 1IAHA 1GZNA 3RPSA 4EL9A 5I9WA 4BKZA 3LQ8A 3T3VA 3TDVA 2CHLA 3AD4A 1MRYA 3WF9A 3NNUA 4EK6A 4E6AA 1J7UA 2J5FA 2QQ7A 4I5MA 3KXNA 3VW6A 4FV5A 2VTMA 2XIRA 3TG1A 5AP6A 3I6UA 2R2PA 3EL7A 3OS3A 4NFMA 4EH3A 1ZXEA 1K2PA 1M14A 5HD4A 5TR6A 2HY0A 3ZS5A 2BDJA 4AQCA 5BYLA 2C3IB 4R3PA 4EJ7A 3ET7A 3P7AA 3SX9A 4FKVA 1U4DA 2BHEA 4FT3A 4CTBA 3DU8A 3TV7A 3W33A 4QMNA 2JBOA 4P5QA 4RWIA 4RRVA 5JK3A 5E4HA 3ZEWA 4FTQA 2XCHA 2R7IA 2CN5A 4JIKA 4BZNA 3R00A 2VNYA 3LPBA 2VX1A 3WOWA 4EQMA 3QTQA 5AP3A 1OKVA 2X6EA 2A4LA 3DBFA 1L3RE 1XH9A 3BGPA 3H4JA 1OL2A 1ZOHA 4QQJA 5AR3A 3Q96A 4FV0A 4BDAA 1W7HA 2UZTA 4AFEA 3GU8A 3CTJA 5GJDA 5J9ZA 2NYAA 1LPUA 4BYJA 4MUQA 4F9WA 4O82A 1H1PA 2R3LA 2XK3A 2PVLA 3PFQA 2XA4A 4KRDA 3LQ5A 3DT1A 4QYFA 5GZ9A 4ITIA 1ZWSA 4O0WA 5FXSA 3O2MA 5LCKA 3TZ8A 3MTFA 4H05A 4H3BA 2F4JA 3E8DA 4HCVA 4WG3A 3RAHA 3GNIB 4I6LA 2FO0A 5EQYA 3QX4A 1GZ8A 3COIA 3EJ1A 2YACA 2P33A 4GMYA 5BVWA 3G0EA 4OBOA 4IIRA 4RX8A 4C4HA 4OT5A 4Y85A 5I9UA 3ZBFA 4C7TA 4F0FA 4AT3A 3F6XA 1YOJA 1R78A 4I21A 5HE2A 4Y73A 3TTIA 4BI2A 2QOLA 3MVHA 3PUPA 2VTQA 4PX6A 4UMRA 3QZHA 2Q83A 2OJJA 1XBAA 5EH0A 4A9SA 3AKKA 3ATSA 4BDBA 1FQ1B 3UVRA 4D58A 4EORA 2XJ1A 4YU2A 2Q0NA 4FSYA 4QP9A 4CVAA 5K9IA 3KXGA 1PF8A 1Q97A 1WCCA 3IS5A 3QTXA 4WRSA 1U59A 2VWBA 4DCAA 2X8IA 3SOAA 4O4BB 3QTRA 3FSFA 3FZRA 2I40A 3FXWA 4KB8A 4F09A 2LAVA 4P2KA 3P79A 4FV6A 4AN3A 2OJIA 3PA3A 3PE1A 2ZDTA 4K77A 5D7VA 3FLWA 3TV4A 2Z7LA 3LJ2A 3CQWA 3TUDA 4CTCA 1KWPA 2ITOA 3KRLA 4QPAA 3F5PA 3FMEA 1Q41A 3VUMA 2YJSA 4C37A 1OIYA 4M14A 4Q5EA 3PY3A 5EHOA 3G5DA 4DHZA 1SM2A 2E9PA 2QO7A 3KK9A 4BL1A 1JKKA 5J1WA 2C6IA 4ENXA 4HVGA 5C4LA 4BGQA 1NVSA 3FE3A 3DAJA 2YAAA 4O0XA 4AT5A 4HVIA 3PZHA 3LCSA 5BV3A 3EYHA 4J8MA 2X9EA 1Y6AA 1YW2A 3OD6X 4E3CA 2AEGA 3ML1A 5EW8A 3PZEA 3NYXA 3QQKA 3RKBA 3MESA 5JFXA 2OFUA 5DR6A 3NYOA 2ERZE 4RWJA 3T9TA 3NR9A 4FV9A 4D1SA 5AWMA 1BLXA 5HG7A 1GZKA 3IQ7A 4G3FA 5AIKA 2CKOA 5M56A 4C4FA 4H1MA 2YIWA 3CKWA 3EKNA 3SHEA 3QX2A 3F3WA 2PZYA 3KGAA 4UMQA 3QA8A 5CAUA 2JDTA 3DZQA 3W2SA 2RKUA 3JVRA 4G3CA 4IM2A 2UW7A 3PYYA 2V55A 2W1CA 3EZVA 3PPZA 4K33A 3ZSIA 4DBXA 3R01A 1PXLA 1WVWA 4MYGA 1FMKA 5I9YA 1OECA 4X2JA 1QPEA 2F7EE 4YLKA 4FL2A 4YHJA 3AC5A 5T68A 5ANJA 5CEKA 3UOJA 4XOYA 4O7LA 4Y95A 4BDEA 3KC3A 4USDA 1URWA 1UU9A 5KMKA 3OMVA 3NW7A 3C4ZA 4DEBA 4RFMA 4O7WA 5LVNA 1ATPE 3UO6A 4QMUA 4IAKA 2WXVA 3LFFA 4BDGA 3VQHA 4D1ZA 5BMMA 2XP2A 5IA3A 4CG8A 3KRJA 4CFMA 4BTMA 3UG2A 5BX0A 4Z16A 5JFVA 4O0TA 2JC6A 1MQ4A 2OI4X 4IFCA 1FGIA 4QNYA 2QURA 3VS3A 2V5QA 5DR9A 5LMKC 3OROA 4WT6A 3RP9A 4ASEA 3II5A 3R7GA 4FV1A 4UYNA 3RNYA 2V0DA 4ZEGA 4BCOA 5KHXA 2QO9A 4MKCA 2PULA 5KUPA 3CQEA 5CU2A 3MY5A 4RFZA 2CCHA 4GEOA 3UODA 5IQFA 3FMLA 4DGGA 4NM0A 2QR8A 4USEA 4DFUA 3LCOA 3E93A 4TNDA 4FEVA 3VS0A 2OK1A 5EG3A 4AZSA 4CKRA 4IBMA 2VWIA 5JEBA 3QA0A 1TZDA 4WSQA 3LMIA 2OF2A 3I0QA 4IQ6A 1H1RA 1UV5A 4QT1A 4ZTLA 4BDIA 4Y83A 4OBQA 4FF8A 4W4XA 3R7OA 2C1AA 1IG1A 1PXNA 2HENA 4IB5A 2PSQA 4BJJA 4DGNA 4J52A 3EQPA 2B4SB 3PSBA 4M0YA 3MB7A 1ZRZA 3R8VA 5J7HA 2W1EA 3Q2JA 1Y91A 3E7OA 1J1BA 2HZNA 4S34A 4QQ5A 3P1AA 5EYMA 2HXQA 4KIKA 4O0UA 1B39A 1CM8A 4CFNA 4N57A 5AR4A 4ZOGA 4L3LA 3PVGA 4L3PA 3QTUA 1OI9A 4DDIA 4CRLA 4F78A 4QMOA 3DGKA 5DR2A 2Z2WA 5BVDA 5L2WA 2R0IA 3WZKA 2PVNA 5C01A 1YWNA 3V8WA 3VF8A 4DFXE 3F9NA 2CNUA 4JG6A 1W2CA 5AV4A 3BQCA 4X2NA 2GU8A 4IC8A 4F7JA 4JVGA 3LCDA 4LM5A 4C4IA 3F2AA 5CSXA 5J1VA 1ND4A 4FICA 1MRUA 4WA9A 2G2IA 4QQTA 1OL5A 4FODA 1Y8GA 3W0QA 4ACDA 4FRFA 2OJ9A 4C3RA 4XEYA 3O71A 3QTZA 4ANOA 2XK6A 2YITA 2CSNA 3NWWA 4IW0A 4LOPA 3DLSA 3C4XA 3RWQA 2ESMA 5JFSA 2H34A 4AXDA 4FTJA 4E5WA 4HYSA 3VIDA 4IACA 1GIJA 2IW9A 3E8NA 4CQGA 5GIOE 3KIOC 4QDEA 3RMFA 2PMOX 3ERKA 4CYIA 2ETKA 4YC8A 3S00A 1W2FA 4XBRA 4FGBA 4AAAA 4ANBA 2BRHA 2R3RA 1OM1A 3RPVA 1XR1A 4GFMA 3W2PA 4ZMEA 1S9IA 2PK9A 2YM8A 5DGZA 3UG1A 1GOLA 4R3CA 4C38A 4MXYA 4ZZNA 5FM3A 5EKOA 1XWSA 4DHJA 4ARKA 3QF9A 1DAWA 3DXQA 3WF5A 1KV1A 2BMCA 3IONA 5AR2A 3LFAA 5HICA 4GH2A 3ROCA 5FM2A 4BBEA 3IOPA 5BUIA 3CSVA 1K3AA 1XJDA 2WOUA 3PVBA 3C5UA 5IQDA 3CLYA 2BIKB 3IECA 3L9PA 3ZUTA 4F99A 4B7TA 4AA5A 4JOAA 2XNMA 4MEDA 5CU3A 4XV1A 5H9BA 4WUNA 3D14A 3LZBA 3SVVA 4Y46A 2R3KA 4D2SA 3NUPA 5HVYA 2G1TA 1G3NA 3FLNC 3G0FA 4HGTA 5TO8A 3FUPA 4NKAA 3KN5A 3ZXZA 4E5BA 3G9NA 4C58A 3VNTA 3SD0A 2W9FB 2C3JA 4WD5A 3FXZA 3AMAA 2VTSA 4KA3A 4IVDA 4HJOA 5AA9A 3S1HA 2GNHA 3F2NA 3F3VA 4ANNA 1ZYJA 3VQUA 4BCNA 4I6HA 3NYNA 1OPJA 3OBJA 2VTLA 4TW9A 5IG1A 3ZH8A 3FL5A 2BIYA 4DEAA 4TTHB 3POZA 3TACA 3FY0A 2RG6A 4A9RA 4BGGA 2EB2A 1G8AA 4QTCA 4MTAA 3QQJA 5E1EA 3NAYA 3FZOA 5ACKA 5IQBA 1KV2A 4BIBA 2JKOA 2WMBA 5BMSA 3RZFA 2J0IA 1DAYA 2PVYA 2UZVA 3OTUA 4I41A 5EYCA 3N4TA 2YISA 1I44A 4FKGA 4AZWA 4BVUA 3IOKA 5DA3A 2GCDA 4JDIA 4TXCA 5IA2A 4RX9A 3NVMB 3R73A 2GS7A 4O83A 1Q61A 5E8VA 2BAKA 2OW3A 2XNPA 3JR1A 3QC9A 4KIOA 5J95A 2R3NA 5L6OA 3BHVA 4FT0A 4LFIA 1K9AA 3OF0A 3OOMA 4BHNA 4DHFA 5E8WA 2V7AA 5FTQA 4MXCA 3A7HA 4I23A 5C03A 3AC8A 3G33A 3LVPA 3V04A 3FQHA 4WG4A 4CG9A 1YOMA 3FJQE 3FMMA 1TQMA 4YJRA 4FTKA 1HCKA 3O51A 3FMJA 4F65A 4OTIA 4O27B 3UPZA 5DOSA 4ENYA 3NW5A 5JH6A 5EI6A 5IQCA 4R7IA 1KSWA 4V01A 3UE4A 2ZFYA 3JYAA 1PXPA 4I6BA 3MWUA 4FC0A 4O84A 2BZKB 4PPCA 1OMWA 1PKDA 2YCRA 5IUIA 3VUIA 4DH5A 4E6QA 4ERKA 2P3GX 5DI1A 4XX9A 4PNKA 3ACKA 4ZZOA 1OB3A 1REJA 3TNIA 4LL5A 1XH8A 4FEQA 4RMZA 2QOFA 2WQOA 3ZSGA 4FZ6A 2Z02A 4ALVA 4NCTC 5FEDA 2IWIA 4ZK5A 2OIQA 3FI2A 4L67A 1M7QA 3V01A 4QP3A 1FGKA 3HMMA 3Q3BA 4GSBA 4EK5A 4A06A 1JSVA 5EHYA 3B8QA 3O0GA 3H9RA 3VO3A 4BDJA 4YO6A 4ZLZA 4JLCA 4YZMA 3ZYAA 3MFUA 3TZMA 3UDZA 3SDJA 1JOWB 4FVRA 3Q9XA 5HBHA 4UV0A 3TT0A 2PY3A 2BRNA 3TUBA 3OFMA 3D5XA 4K0YA 4NSTA 4OBPA 2RF9A 3VBXA 3CCNA 3GI3A 1WBTA 2CNQA 4QQCA 4RJ6A 5EQEA 4JL9A 4G31A 3QCXA 2JGZA 2X0OA 2XNGA 3HRCA 1ZMWA 3ZM9A 4KKGA 4IZ7A 2Z7SA 4IJPA 5CU6A 4F6SA 2E9VA 4Z7GA 4AXCA 4UMPA 5CXZA 4BCIA 2C5VA 3VONA 4WOVA 4DTKA 4RIYA 5EI2A 5EW3A 4R1VA 2HW7A 1M17A 4G9CA 2R3FA 2PUNA 5TKDA 5E8SA 3HYHA 3MVMA 4QMPA 4MHAA 4ITHA 2C0IA 3DV3A 4FUYA 3UNZA 3CR0A 4FE2A 3B2TA 4Z55A 2X81A 4WNKA 4BHZA 3V5PA 1OUKA 3NZ0A 3RAKA 3UDTA 2J90A 1XH6A 3DK6A 3GOPA 3KMUA 5L2IA 2ITWA 2NO3A 4RIYB 3RHKA 4TT7A 3GOKA 1CKIA 3EZRA 3IDBA 4MF1A 2R64A 4OUCA 3KKVA 5G6VA 4DC2A 5CY3A 4MBLA 3RPYA 5A4CA 2XIYA 3COMA 5IEVA 4WIHA 4D1XA 4ZSAA 4YJNA 4BN1A 3LJ0A 4EWQA 4YC3A 1VJYA 5HCZA 5HX6A 3L8VA 5KKRB 3E8EA 3FZ1A 5GINE 1WBPA 2ACXA 4DDGA 3HEGA 5CNOA 2XARA 2BVAA 5CNNA 1ZYLA 4FOCA 2PHKA 4L45A 4CLIA 4DG0E 2W1IA 1W82A 2JFMA 4FVPA 1JKTA 4FT9A 5HORA 2XANA 3UIMA 4HPUE 3JVSA 2RL5A 3OWLA 3KRRA 3EHAA 2C3KA 1PMNA 3EQHA 4F64A 3UP7A 4TWOA 3VAPA 1VZOA 2QONA 2YEXA 3E8CA 3OEZA 4QYHA 3ZFMA 1RJBA 2OH0E 5M4FA 4EBVA 2ITNA 3H30A 1Q8WA 2RFEA 1YVJA 1H8FA 2JKKA 4IHPA 2OICA 2W4OA 4Q9ZA 3CS9A 1H0WA 1PMUA 4CEGA 5ETIA 3HV4A 2OGVA 3TMOA 5FGKA 3H0YA 4QP1A 4EBWA 5HD7A 2VO3A 3Q5IA 1H01A 2XF0A 3F5XA 3DCVA 3VRYA 2FH9A 3QCYA 4MK0A 3ITZA 4NZWB 4F7NA 1WBVA 2JFLA 4F7LA 2ETMA 3CTHA 1FVRA 4ZTRA 4JDHA 4C2WA 3PG3A 2ITUA 3QCQA 1DM2A 1X8BA 4EYJA 4AWIA 3SQQA 4I94A 3TUCA 1M52A 3QL8A 3FDNA 4U97A 4PUZA 4XCUA 5K5XA 3QD0A 4EH6A 1QPJA 5AAFA 3MVJA 3VS6A 3ALNA 4AGDA 3TL8A 3ZO4A 4AZFA 3A4OX 5IQHA 3EQIA 4JBPA 5IKWA 4Z9LA 2R0UA 4O21A 4NUSA 3VHEA 4EQCA 3AGMA 2VNWA 2JD5A 3QXPA 2WTCA 3NUNA 2XEZA 5CEMA 2B53A 2X8DA 3LFNA 3D7TA 3V5QA 2WMUA 3R8MA 4L01A 2C5YA 3FI8A 4A4OA 1OGUA 3QD3A 3AT3A 3WYXA 4IB3A 3HMOA 3PXRA 4JQ8A 5AMNA 4BI0A 4HOKA 3P9JA 1NY3A 1ZZ2A 2O2UA 4G17A 3KRXA 4GW8A 4IE9A 4CV9A 4HVSA 4PTEA 2HCKA 2IVVA 5ITAA 5IA5A 5E8TA 1OPKA 5D11A 2VWUA 5KZIA 5CENA 3D7TB 1CTPE 5CAQA 3CJFA 5JZJA 3LE6A 2A0CX 2F7ZE 2XBAA 3E63A 3R22A 2QU5A 4FKQA 4NCTA 4D4RA 2PVJA 5IQIA 3EN6A 3TZ7A 1KUTA 3W8QA 3FEGA 3SGCA 4G3GA 4F63A 5LARA 4FKTA 2QD9A 4HYUA 2OIBA 3R9DA 4FNYA 4IB0A 2QKWB 5IMXA 5F1ZA 4S32A 5I9ZA 4C59A 4YUQA 3SA0A 4IWDA 3WE8A 4YLJA 3QWKA 4LYNA 5HNBA 3ZZWA 1R0PA 4C34A 3TDWA 4NJDA 4D0XA 3SRVB 3RZBA 1P4OA 4CGAA 4C36A 1S9JA 3F88A 4BRXA 1NT2A 1QPDA 4YPSA 4J8NA 4CKIA 3QQLA 4C62A 3PLAE 3BE2A 5A4EA 4O4DA 3FQEA 3RAWA 3CPCA 4OAUC 2PYWA 3QTIA 3PTGA 4XV3A 4O7ZA 1Z9XA 2UUEA 5DT0A 1R3CA 1IRKA 3ORLA 3TV6A 1IA8A 5HO6A 2O63A 3UMWA 4ERWA 3CXWA 2B7AA 2VWVA 4ZSLA 4UYAA 4DFYA 4EUUA 4GCJA 4FEWA 2VD5A 1AQ1A 5K3YA 4BDKA 1SNUA 4RWLA 4W4YA 3LKMA 1YDSE 2B9FA 2EWAA 2GMXA 3SG9A 2J51A 3GEQA 3KXZA 3IW7A 2XB7A 3Q53A 2BZJA 4BDDA 1YXVA 2OKRA 2V22A 2NP8A 1Q3DA 1H25A 3QD2B 3ZHPC 4QYYA 1CKPA 4W8EA 4DINA 5DFPA 3BIZA 4PTGA 4OW8A 4ZTHA 3SC1A 3UQFA 4UXQA 2F57A 2QOIA 4CMUA 4DGOA 3QUPA 4QNAA 2J5EA 4ANQA 4GIHA 3CP9A 3UNKA 4L00A 4FKJA 4LGGA 4BICA 2W5AA 1QL6A 3VUDA 3UOLA 3L8PA 3ORZA 4L9IA 3B8RA 5AM7A 3F5GA 3MH3A 4QMLA 4O7SA 1F3MC 1XHAA 4I4FA 4XJ0A 2AYPA 3LXLA 2J9MA 4FKIA 3MFRA 5F95A 4F70A 1L8TA 3L9NA 4A4XA 5AV0A 3DNEA 3O23A 1G8KA 4NM3A 3DJ6A 3U8WA 4MX9A 2WMSA 2A19B 2QNJA 2X0QA 5CSWA 4H36A 3ZDUA 2YERA 1JSTA