4XP3A

Crystal structure of erk2 in complex with an inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
347
structure length
339
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 111
structure length 339
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xp3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xp3A01
3DZOA 4BDJA 3LCTA 4QMLA 3KRXA 5K4IA 4KUJA 3VBQA 3BGPA 2QVSE 4TY1A 4BZOA 2X6DA 4FGRA 5EOLA 1XKKA 4IHPA 4PWNA 2G1TA 4EH5A 5A6NA 4MCVA 4X2NA 3ZYAA 4EH2A 3GCQA 5L6OA 4H3PA 3BELA 1Y8GA 2XNOA 4ZS4A 4RIXA 4W4YA 5KBQA 3EFLA 2Z7RA 4FIEA 2C4GA 2ETRA 5LMAA 4UXLA 4NFMA 2YM8A 1CM8A 3D5XA 4O6EA 5BQ0A 2O0UA 1YXXA 2XM8A 4DN5A 1JKKA 1FPUA 4HCUA 3FMJA 2C1AA 1Z9XA 3C4CA 4TN6A 3VHEA 1WMKA 4E7WA 4N6YA 1ERKA 3NNWA 5CVGA 3E3BX 4F7NA 3OFMA 3F2RA 4DTBA 4MEDA 3WARA 3FMLA 2WEIA 2W4OA 3GFEA 4EJ7A 3Q6UA 3E8EA 4PRJA 3IGGA 2UV2A 4XG8A 3UOHA 3B8QA 3EH9A 3WF6A 2CMWA 4MKCA 2O3PA 4LQMA 4X3FB 2R3OA 1KE8A 1XR1A 3BBTB 4EH6A 1GIJA 3TDVA 3OOMA 4CKRA 3TIZA 5AFVA 3FQHA 4N57A 4BDKA 5ACBC 4JX7A 3C4FA 2QOLA 3Q5ZA 4CG8A 1WBWA 4YC3A 2VTNA 3NUYA 4QTCA 4LMNA 3SKCA 3WZUA 3MDYA 4AU8A 4QMXA 3C4XA 3HVCA 3FLYA 3SXSA 4PP9A 3A4PA 3CKXA 2WTCA 2OI4X 3WBLA 5T3QA 4OLIA 4F6UA 3BLQA 5JSMA 4QMQA 2J4ZA 5J5SA 2YITA 4F9YA 3TZMA 2E9PA 2J0IA 1QL6A 4ZJVA 2XH5A 1J91A 2AUHA 3TN8A 1KE5A 3I5NA 3Q9ZA 4XJ0A 3KEXA 3NUNA 3V5TA 4KB8A 4RIYB 4C4JA 2I0HA 4BWPA 5CWZA 3VF8A 4CGAA 2ZMCA 3E88A 3WIKA 2HCKA 5LCJA 3CY2A 5AM7A 4ALUA 4O7ZA 4IBMA 4ZLOA 3KCFA 2IW8A 1OB3A 3JR1A 4FV3A 3TV7A 1W7HA 3TKUA 3R7OA 4RA4A 4ZTHA 2BUJA 2LAVA 3DTWA 2ZOQA 4U43A 4CQGA 2ERKA 5HE1A 3TZ7A 2AC3A 2JDTA 3UVRA 5EKOA 3FLWA 1CKIA 5AX9A 1YOJA 5GIOE 5IQEA 4D4YA 2V7OA 1V0BA 1OGUA 3G90X 4UMRA 3ACJA 1H07A 2WELA 2JDRA 3BV2A 4FK3A 3EQRA 5AR3A 4TT7A 3R04A 2X4ZA 1W8CA 5JEBA 4L42A 3JS2A 1BUHA 4GEOA 2VN9A 3EQCA 3Q5IA 1M2PA 4TYHB 4UWCA 2QOCA 3RNIA 3U9CA 3ZBXA 3OY3A 4EHEA 2ACXA 2X2KA 4UV0A 1KV2A 3E7VA 4FV6A 4FZDB 2CKQA 2UW8A 3KXGA 1NA7A 4HNFA 4MYGA 2X81A 3PXFA 3ORNA 3PIYA 2YIQA 4X2KA 5AR4A 1OECA 3R9NA 4FV1A 3SG8A 4DHFA 3G5DA 2PVJA 3GI3A 4FKVA 4G31A 4G3FA 4DLJA 4Z3VA 5K0XA 4O7NA 3GU8A 5AV2A 3Q9WA 2WNTA 3VS0A 2CDZA 3ZSIA 1Q41A 2QLUA 5TT7A 3LPBA 4CXAA 2Z2WA 4WSQA 5FP5A 1LEZA 3LCDA 4N0SA 3BKBA 1YXVA 4U79A 4FMQA 4GH2A 4EYJA 5KKRB 2GNLA 2WQNA 3F7WA 4UB7A 2WXVA 2FGIA 3FL4A 3GU4A 3RAHA 3CD3A 5AA9A 3HMOA 4NIFA 4ASEA 1WVWA 2XZSA 2X2MA 1OKWA 4WUNA 4YLLA 3EB0A 1KWPA 1FVTA 4XV9A 3U6HA 4AN3A 5J87A 3CD8A 5EM7A 3FMNA 3COMA 2JDSA 4RC4A 4JVGA 4CLIA 4ANLA 3DV3A 4LOOA 5IUIA 4Z7GA 2XCKA 5HGIA 5IQBA 1P5EA 2PYWA 3QQGA 2CLXA 1JSVA 3FZTA 5JQ5A 3FI3A 3FWQA 2UW6A 5C9CA 3QD0A 2PE2A 3DBCA 4NSTA 5E92A 4F63A 4G9CA 4IAKA 4GL9A 2YM6A 2PZ5A 5AM6A 3UP2A 1ZMWA 3OXZA 3Q52A 3WI6A 1OBGA 3FMEA 4BTFA 4NTTA 3SD0A 1J1CA 5JRSA 3NNUA 3R2YA 2PUIA 3GCSA 4FT0A 2JKKA 3DKGA 4L8MA 2QOOA 4M0YA 4RVKA 5GJFA 1SZMA 4HCVA 4FSQA 4IIRA 3R1QA 2UZWE 4BCFA 4CMOA 5DA3A 2BZJA 4ZK5A 3UDBA 2B53A 4D5KA 2CCIA 2UZNA 2IVUA 3GUBA 3TNPC 4B9DA 4DFZE 5IA3A 4BFMA 3C4WA 4J8MA 4E6DA 5AUXA 2ZB0A 5AP6A 3F3VA 1IAJA 3BYOA 3RVGA 3N4TA 1ATPE 4JG8A 4EQUA 5FRIA 2JAVA 3F6XA 3OEZA 4A9SA 5HZNA 2PULA 1Z5MA 3KXXA 4QO9A 5HQ0A 5LVOA 2XMYA 4JDIA 3U4UA 3R21A 2F9GA 3PZHA 4FL3A 4OBQA 4QPSA 3S3IA 4CSVA 3UG2A 2VD5A 4QMSA 4BTMA 4E6AA 3LJ1A 4IC7A 3ZSGA 2IW9A 4PMTA 3UQFA 1OL5A 3QHRA 5M4FA 3P9JA 2VGOA 3F3TA 5HICA 1A48A 3AC1A 3II5A 3O7LD 4XG9A 2XK9A 2HOGA 4YURA 2WTDA 3MGYA 4UEUA 3FXXA 1P2AA 3QBNA 4Y73A 1PXJA 4LRMA 5FP6A 2BAJA 3PA5A 4EQCA 3MJ1A 4GK3A 5HESA 1MP8A 3O8PA 4FTIA 5ETIA 2J0MB 3QQLA 3WZJA 4DGLC 4EZ5A 5CALA 2WOUA 4KBAA 3V6SA 3LFDA 4HGLA 4HVGA 1OM1A 3PFQA 2CNUA 4RJ5A 3GQLA 4M67A 3HGKA 4C4GA 4G3CA 3W2CA 4NU1A 3I6WA 3Q53A 4NKSA 5ACKA 3IS5A 3ZU7A 4DEDA 1HOWA 4UYAA 3F61A 1R3CA 1K3AA 3QRUA 1FVRA 1OL7A 4O7RA 4EOSA 3SXFA 2GMXA 3ZLXA 5GZ9A 1H1WA 3DKOA 2ONLA 4AGWA 2B7AA 1U4DA 4Y95A 4OUCA 3LXPA 5CNOA 4BL1A 3ORLA 3MN3A 4NK9A 4EOJA 5CEOA 4JG6A 5AP5A 1G8AA 3ELJA 5HD7A 3VUHA 3W2PA 1STCE 1PXLA 5EKNA 4GG5A 2JAMA 5I9VA 3A60A 4YJRA 3F5PA 2WD1A 4KBKA 3W2QA 4EOQA 2CJMA 2QHMA 2NPQA 3EZRA 3KKVA 2OIBA 2BTRA 4WO5A 5HLPA 5FD2A 5A4TA 5KO1A 3LLAA 2ZDUA 4XG7A 3I6UA 3BWFA 3BPRA 4TTHB 3SLSA 4QMZA 2QC6A 3ZLWA 4DT8A 3FMKA 4D28A 2IZUA 1U54A 2YIXA 3RJCA 1CKJA 3ZLSA 1L8TA 1GZNA 2C69A 4RLKA 2IZSA 3GC8A 1Q97A 2VWXA 2QKRA 4JLCA 3QX2A 2CLQA 1OPKA 4IEBA 2VNWA 2NP8A 3R73A 2A4LA 4XBRA 3ZFMA 1MRVA 3D9VA 4XOZA 3FLNC 1XH8A 3QA0A 5JGDA 3PXYA 5LMKC 3QX4A 2WHBA 4FTQA 5JGBA 4O0TA 2X2LA 2X9EA 2HY0A 4R5SA 4WBOA 3QWJA 2WIPA 3BHHA 4FR4A 2BRMA 2RG5A 2VTOA 3M2WA 4M8TA 2GQRA 4L68A 3MH0A 4IJPA 4IXPA 4CZTA 4N6ZA 2OW3A 4YTFA 2QOIA 4GIHA 4PTCA 4TYJA 4YZNA 4KKGA 5B7VA 4N70A 4FG9A 4RGJA 1JKSA 4FKSA 5CAVA 3QRTA 5E9EA 3ZO4A 2NNWB 4XV1A 1YI3A 3DA6A 3EZVA 2VTMA 3CQUA 2ZM4A 2PTKA 4P2KA 1Q3WA 4DTAA 4EOLA 1SVHA 1QPDA 1DM2A 4WBBB 4APPA 1T46A 2E9OA 3NAYA 5CAOA 4JT3A 1YXTA 4TYEA 4P90A 2ESMA 1YDRE 4G6LA 2I0EA 3E7OA 4BCGA 2BROA 2PPQA 4JDHA 4P7EA 3FQEA 4X2FA 3WF7A 5KNJA 4WG3A 4F0GA 3R1YA 3EFJA 5HE0A 2OO8X 4HYHA 4R3CA 4AFJA 2XK6A 3DK7A 3QD3A 3GU5A 4K0YA 2IW6A 4IWDA 3U4WA 5IA0A 3FXWA 4M66A 4E4NA 5FEDA 2QURA 3PIXA 5EI2A 1MQBA 4QMOA 2XM9A 2GNFA 1YWNA 1ZYJA 3OC1A 1PKGA 4H1JA 5CU2A 4IM0A 2B1PA 3OXIA 1LEWA 5FXSA 3CE3A 4QOXA 4TZRA 2W17A 3KY2A 5CSWA 4D55A 2R3PA 2UUEA 1XHAA 3P0MA 3UG1A 5BVNA 2OJJA 3FSFA 4LV5A 3H0YA 5E8UA 5HU9A 5A9UA 3V01A 1H24A 3KGAA 5CT7A 2OXDA 4U5JA 3TTJA 2ZV8A 3LOKA 2YHVA 4CMUA 4MBLA 2CGUA 3L8SA 4HPTE 4O84A 3MVLA 1F3MC 3GCUA 4ANQA 4LYNA 4D58A 1OMWA 3QU0A 3C51A 3QRIA 3LJ2A 1L3RE 5LWMA 5HX8A 1SVEA 4RIYA 4AZTA 1H0WA 3RK5A 5BX0A 5I4NA 3HMPA 1PYEA 4K18A 4U97A 5FLFA 1YQJA 3I7BA 4I22A 4S30A 5KMMA 5FG8A 3VS7A 3PRFA 4ZY5A 3VQUA 3VWAA 1ZZ2A 2VRXA 2BZHB 4F9BA 4YZMA 2CGXA 3BQCA 3PJ3A 5GINE 3H9FA 4H39A 4YHJA 4BDHA 2XRWA 1JVPP 1U59A 5AP3A 5EG3A 2FYSA 4YJNA 3REPA 3QUPA 4AZVA 3FY0A 1B39A 1WVXA 3O23A 4FIGA 4I4FA 2VWIA 3A7IA 4FV4A 4RFYA 5KE0A 2XKCA 4EJNA 5HTBA 3PJ8A 3ZLYA 3ORMA 3VS1A 5IQAA 3OCSA 4TWOA 3A7JA 3WF5A 4IW0A 4ERKA 2VAGA 4G17A 4U80A 2W1CA 1NVRA 4UMUA 4JQ7A 4GT5A 2ZV2A 3EJ1A 2R3KA 2R3LA 3R83A 3TUDA 4PV0A 2YM5A 5HX6A 3ZOSA 5BVFA 2HZIA 2XIRA 4RZVA 3FHIA 5M08A 1CDKA 5J7HA 2QCSA 3LVPA 4AFEA 4R5YA 4G9RA 4E26A 1FVVA 3DDQA 4YLKA 4HGTA 4KSQA 2C30A 4MD9E 4MWHA 4O21A 4OBPA 4OTGA 2WAJA 3KK9A 1Q3DA 2W1IA 3QAME 4EBWA 3RNYA 3FI4A 5DPVA 2XVDA 1Q8WA 4MK0A 2EXEA 3OVVA 3PWYA 3H3CA 3FPQA 3ID6C 2KULA 3DPKA 4CLJA 1YWVA 4XG6A 5LVPA 5M4CA 3G6HA 4J97A 4CFMA 2JKQA 3QUDA 2R7BA 3D2KA 3DBFA 1Q61A 3R7YA 3MS9A 3D5VA 2GNHA 3PVGA 3VF9A 1WBTA 3F5XA 2OJIA 4AZFA 4F7SA 4BF2A 5JKGA 3QKKA 3SVVA 3IW8A 2BRGA 4QMYA 5EDRA 1F5QA 3MIYA 4ACHA 3ZO1A 4JBQA 4MVFA 2W05A 3F69A 4C4IA 4IZYA 3TDWA 3PDTA 1GNGA 4JBPA 2QONA 3FLQA 4Q9SA 5DR2A 5HVJA 4I92A 1MRYA 2UZUE 2XIYA 1WBNA 2XKDA 3V5QA 4I0SA 5M44A 2OLCA 1UU9A 1V0OA 2C3IB 3O0GA 2YZLA 2ITZA 2R64A 1Y8YA 2WMTA 4FVQA 4Y83A 2GHLA 5FEEA 4X6QC 2WTJA 4GS6A 3BYUA 4Z16A 2QD9A 1H00A 3NW7A 2C6OA 4EZ7A 3KMUA 4ZY4A 2GU8A 2VTQA 5KMIA 2YZAA 5CYIA 3AC8A 3WILA 3COIA 4ZOGA 4YR8A 2CNVA 2UW0A 4G5JA 3C0HA 4GK4A 5EHYA 2JIVA 3VW8A 5GIPE 1Q8UA 2GSFA 3BRBA 3AC4A 3ZEPA 3D5WA 3E8DA 4Y72A 3FBVA 4DYMA 3KULB 2GS2A 3ORPA 3W1FA 3W33A 4DTKA 2OZOA 3QQKA 4HVDA 1XBBA 2RIOA 3K54A 4PPBA 2QOFA 3MY5A 4QP4A 4L45A 1GZ8A 2XS0A 5HG5A 4B0GA 4EEVA 4BCMA 4J95A 4CTCA 4WIHA 5CVFA 3PY0A 2P3GX 4FKGA 4QMWA 4LI5A 5AP7A 2X7OA 2IVTA 5EYKA 1QPEA 4C3PA 4IM2A 1H1RA 3W2RA 2JD5A 1M14A 1PXIA 3Q60A 1UKHA 4KRDA 4MNEA 5E8ZA 5J5TA 1Q8YA 3BE9A 4JNWA 4F9CA 4BDBA 4TYIA 1VZOA 2JIUA 4FZ7A 3ETAA 4O96A 5B0XA 5HHWA 2Y4PA 1BI8A 1YHSA 4OTIA 4W4VA 2ITVA 4GKIA 3HX4A 1R1WA 5EYMA 2I0YA 3FDNA 3MV5A 3B8RA 3SQQA 5L4QA 3QTIA 2RFDA 3HL7A 4FEVA 4QYFA 4CG9A 1KE6A 4IQ6A 3ZUTA 1H01A 2Q0NA 4MQ1A 4AQCA 2YACA 4RLLA 5LVNA 5J95A 1YHWA 4V01A 5TOZA 2QHNA 1J7IA 3BGZA 3QC4A 5E8TA 4RIOA 2R4BA 2P2IA 2BR1A 4EH7A 2I7QA 2B9HA 2OWBA 2ETKA 4LGDA 3COHA 5JFWA 4X2JA 4O7LA 1APME 2QQ7A 3F5GA 2ITTA 2C5YA 4FNYA 4KS7A 4YBJA 5ANDA 5JZNA 5KMKA 1J3HA 2UVZA 3ROYA 5ETFA 3A4OX 1P14A 3L8VA 2YAAA 4C58A 3ZUVA 4DGOA 5K5XA 5IQHA 1TVOA 2RSVA 4GIIA 4XUFA 1E1XA 2X9FA 5LCKA 3ZTXA 3PA4A 2ZM1A 4JG7A 2WO6A 4FNXA 4I0RA 4A9UA 1LP4A 1ZMUA 4WKQA 4U9AA 4HW7A 2OGVA 2BFYA 4L53A 3VW6A 4CRLA 3OOGA 2PWLA 4XV3A 4RIWB 5DBXA 3IW4A 1IA8A 4I93A 3CKWA 3TKHA 3FKOA 4DFLA 5K9IA 2PUPA 3LW0A 4KIPA 5E1SA 5CU3A 4CFFA 4F64A 4ANMA 1WZYA 3I4BA 5ETCA 3E64A 5M55A 4CZYB 4DG0E 3PVBA 5A3XA 4TNDA 3DLSA 1W98A 4I6FA 2A1AB 4EOMA 3QCQA 3PYYA 1KV1A 3UGCA 2YDJA 5JQ8A 4GKHA 3LFAA 4QYYA 3QZHA 4Z9LA 3NW5A 4O0WA 5HBEA 1Q24A 2GFCA 2UZDA 4NM3A 3LM5A 3COKA 1WVYA 2YLFA 5EM5A 2IWIA 4EOKA 3I1AA 4QD6A 3LHJA 3EN7A 4RA5A 3EQPA 1BL7A 1BL6A 2O65A 1PMNA 5D10A 4PTEA 3ZM9A 2PVYA 4IWQA 5BPYA 4PUZA 3R9HA 3ZM4A 2ETMA 3HYHA 3CJFA 3UIUA 3FUPA 3QCSA 1JBPE 5IISA 4GW8A 4OAUC 3HLLA 2C6LA 5AV4A 2WMQA 3I7CA 3LJ0A 4XRLA 1H1SA 3MA6A 1ZOHA 2FSTX 4PY1A 3VUTA 4F1TA 3E92A 2C0TA 4WNOA 4QP7A 5H8BA 5E4HA 5C03A 2YABA 1FQ1B 1ZOEA 2XNNA 5EDQA 4BDIA 2C3LA 4I6QA 3LXKA 3NWWA 3MVJA 3VVHA 4FT3A 1RDQE 4WNKA 4A06A 2DYLA 3MESA 3K3JA 4YLJA 4ENYA 3NNXA 3T9TA 4FBXA 3DJ5A 2R3RA 4BR3A 2PMLX 3NS9A 5A4EA 4BCJA 2WMAA 1ZAOA 4ZY6A 4EH8A 4MD7E 4I20A 4RG0A 3WE4A 4HVSA 3EMGA 3HUBA 5TF9A 2I6LA 2YLEA 4L3PA 1IG1A 5CSVA 5IKWA 4I5PA 1FOTA 1K2PA 4XG4A 3PPKA 2XK8A 4IADA 4CFXA 3OWPA 4IX5A 4JXFA 4XYFA 2GTNA 3HV7A 2QOQA 2WTKB 4G5PA 3FSKA 4A4OA 3EWHA 3QCXA 3I60A 5AP2A 4FX3A 5M4UA 2HYYA 3RM7A 3GOKA 2VWUA 5JFSA 2RFSA 5CAUA 3QWKA 3HRBA 4D4RA 4EC9A 2JDOA 2REIA 3QYWA 3RMFA 3PP1A 4BKZA 4IFGA 3WYYA 4D2TA 2Y6OA 4UN0C 1E9HA 4B4LA 5CSHA 4FA2A 3WF8A 2V22A 4BCHA 3W2OA 5J9LA 4FGBA 4JRNA 5M4IA 3R2BA 4BKJA 1SNUA 1O9UA 2PSQA 4J99A 2HZ0A 4PDPA 1O6YA 3TT0A 4FZFB 3PG1A 5HO8A 1OL2A 3KN5A 4W4XA 1GIIA 1OIQA 3LFFA 4QMVA 4OT5A 2HZNA 5EW8A 2BAQA 3FQSA 3GFWA 3PP0A 3U51A 2WZJA 1BX6A 3BEAA 3QA8A 4ACCA 4C7TA 3R7VA 2XJ1A 4ZEGA 1OZ1A 5IQGA 4AP7A 4FSNA 3B2WA 4L46A 2R3NA 3DAJA 3BZ3A 3DFCB 3OCTA 4BDAA 2PK9A 4UX9A 4QP9A 2PMIA 3MH3A 3TM0A 5FXQA 5IQCA 4EOOA 5DYJA 1XH5A 4M69B 1V0PA 3Q9YA 4OTWA 4CFWA 3DZQA 2JGZA 1T45A 2HELA 3AMYA 5HKMA 5CZIA 5K5NA 2A2AA 4KNBA 5CF4A 3RCDA 3C5IA 1ZYSA 5A46A 5ANKA 3OMVA 2GCDA 2RF9A 3VBXA 4ZTRA 2O5KA 3ERKA 5GZ8A 2W9ZB 1Q4LA 5DR9A 2X0GA 4RPVA 3ZRKA 4CTBA 4ZTMA 4WNPA 4ZZMA 1JWHA 4JQ8A 4XG2A 5FBOA 3MFTA 3OBGA 3E3PA 4UZDA 5BUIA 3N4VA 4OTRA 4ZJJA 4KABA 4IX3A 4AGCA 4CYJA 1R0PA 3AMAA 2QU5A 2OFUA 3ORTA 5IH4A 3AGLA 3R30A 4L7FA 3R9DA 4K11A 1ZRZA 1Y91A 2YCQA 3Q2MA 5HTCA 5KMJA 4MXXA 4WD5A 2VO3A 4BBFA 4E6CA 4G6OA 4BCIA 3GCVA 3HRFA 3BLHA 5IA1A 4QYGA 5AWMA 2A27A 4RVLA 3BHVA 4MHAA 5ETAA 4AW0A 4C37A 4J1RA 3ZXZA 2BIYA 3FEGA 4PL3A 5L8JA 3BLRA 5IDNA 2C68A 2OXXA 2PE0A 3JVRA 4EYMA 2C6IA 4ZTSA 2WMVA 3AG9A 5EW3A 4D2RA 2WMRA 1YVJA 2WQBA 2X8IA 3NUUA 4ZZOA 4TPTA 3AD6A 4CFVA 1UWJA 4FTLA 1Y57A 3DBEA 5ANIA 5DRDA 4R7IA 1LUFA 2BRHA 3FZRA 3R28A 4GJ2A 5HD4A 3C7QA 3K3IA 5CNNA 3N9XA 3THBA 2J51A 2JIIA 3P4KA 3NCGA 4H1MA 4X2GA 4IVDA 5AAGA 1PY5A 1XO2B 1UU8A 1IA9A 4FUXA 2VTHA 4Y5HA 2YM4A 3HV3A 1GIHA 3V5WA 3UP7A 3H9OA 3RINA 4RVTA 3QALE 5HOAA 3FV8A 3I0QA 3OWLA 4TKSA 5TE0A 3ANRA 5HEZA 3CY3A 1W84A 3BU5A 3QFVA 5CU4A 4EC8A 3KULA 3CSVA 5M57A 2SRCA 5HIDA 2O63A 3NUPA 4DFNA 3QUEA 3AD5A 3VBYA 5KMOA 2QO7A 2W96B 1H27A 5M51A 3FC2A 2PVRA 4L6QA 5EDPA 4QMNA 4UMPA 3EIDA 4NM0A 5HVKA 3HMNA 4PL5A 4D9UA 3LM0A 4DEEA 3GXLA 4FYOA 5AEPA 3T9IA 4XBUA 4KWPA 2CSNA 1E1VA 2C6MA 3FZOA 3FY2A 4FTMA 3D7TB 3C4EA 4JS8A 5KZIA 2OIQA 3QQHA 3QXOA 2ZVAA 5TR6A 4IM3A 4IB0A 4J52A 5AV0A 4EKKA 2C3KA 5HG9A 3S2PA 4YPDA 4RT7A 2UZVA 5EM8A 3VBWA 5KX8A 1DI9A 2NRYA 4F7JA 3O50A 2Y4IC 3LE6A 4M68A 5DVRA 4BCOA 2CGVA 1G8SA 4GU9A 4PMSA 4AX8A 5FTGA 3OUKA 3U6IA 2X1NA 3OTUA 4E3CA 3LXLA 4J8NA 3FLSA 5E8VA 5HCZA 3P7CA 4FKPA 4TWNA 3Q04A 3WF9A 1ZYLA 3C5UA 2QO9A 4G16A 4IB3A 3NYOA 4MXCA 4Y46A 2VWYA 4ZAUA 3KVXA 4TRLA 5E90A 3NGAA 3O2MA 2YDKA 4B8LA 3TACA 5C27A 3SW4A 4O0VA 3M1SA 3TZ8A 5CF5A 3PXQA 3KREA 2OF4A 4XEYA 4F7LA 5JT2A 3FMMA 4XLIA 3KRRA 3AC2A 3UODA 4JX3A 4CD0A 5LOHA 1QMZA 4KIQA 3HV4A 4MD8E 1X8BA 4OTPA 4BTKA 4DT9A 3KVWA 4GUEA 2YCSA 3IONA 5K4JA 3G0EA 3TNQB 3VS6A 4FC0A 4EHZA 2OKRA 4JJRA 3PXKA 3QXPA 2CN8A 2YDIA 4YHFA 4RIWA 3TZ9A 5CSPA 3QD2B 4EK5A 5I9XA 3QLGA 4E5WA 3M42A 4BI0A 3CLYA 1H25A 4IAFA 3ROCA 4CYIA 5EFQA 3OTVA 3ATSA 4DEAA 2BVAA 4AN9A 5BVEA 5EQPA 4U6RA 1O6LA 2YN8A 3TJDA 3C1XA 5K3YA 4LFIA 2V7AA 3GVUA 2R3JA 3BGQA 1G3NA 3GB2A 3QTSA 4I21A 4MAOA 5D1JA 4JR7A 4H36A 2XEYA 4RJ8A 4BB4A 2PZPA 2XIZA 4C59A 3POOA 1YOLA 1FBNA 3BBWA 4KIKB 4X7QA 5AR8A 4QYHA 2BKZA 3O51A 2QU6A 4FV5A 4PNIA 5CXZA 4ZMEA 4RWIA 2UW9A 3CCNA 2J0LA 3PUPA 4MQ2A 4K33A 1AGWA 4CT2A 4O7TA 1Z57A 2H96A 2BIKB 1PW2A 2PVKA 5AUZA 4P5ZA 5HNGA 3EL7A 2XB7A 3Q3BA 4YJPA 4X21A 2BCJA 3D15A 4B7TA 4AW1A 4V05A 5H8EA 2EUFB 4XCUA 3V8SA 3TNHA 3NAXA 4RFMA 3ZCLA 1NVSA 4M84A 3EQGA 3EHAA 3QL8A 4YO6A 5T68A 4G2FA 2C5VA 3RTPA 4BCPA 3VJNA 3OT8A 1OVEA 4U8ZA 5BYZA 3DU8A 4XV2A 4M13A 2I0VA 3E8CA 4D1SA 2DUVA 1FINA 1LPUA 2C0IA 4U41A 3IDPA 2GHGA 4D0WA 4NWMA 5KZ0A 4D1XA 2Y8OA 4GCJA 4WG5A 3ZZEA 5CF6A 5AUWA 3A61A 3O8UA 4F4PA 3W8LA 2J6MA 4FEQA 3Q4UA 4AW5A 3TG1A 5C1QB 3PRIA 4QP6A 3ORZA 3VUDA 2A19B 4O83A 5EYDA 4G6NA 3UE4A 2PMOX 4B8MA 2Y7JA 4IZ7A 4ANOA 3V5PA 1O6KA 3CR0A 4AE6A 4C34A 2ZV9A 3UOLA 2R3MA 3QYZA 2RFNA 4USEA 4QMPA 5A54A 4RFZA 2V62A 3RHKA 4U7ZA 2GDOA 4F09A 1OIUA 4E6QA 4OAVB 2WIHA 4E4MA 5HIEA 1VEBA 2XNEA 5CVHA 5EYCA 4W8DA 3VS5A 2JFMA 5BNJA 5DT3A 5J8IA 5I0BA 4O7YA 1BYGA 2Y6MA 1HCLA 2QOBA 1RE8A 3QLFA 4C4HA 3NEWA 5AX3A 4Z55A 5KHWA 2ONLC 3LFEA 4FV0A 4RJ3A 3ULIA 3ODZX 5BVDA 4H58A 3RBWA 5ANOA 4CQEA 3UC4A 4E93A 4WG4A 5A6OA 3P5KA 1UNHA 3GC9A 1UWHA 4NT4A 2ITNA 4IB1A 3U87A 4C4EA 2F57A 3MFRA 4X3FA 2DS1A 4CCBA 1KE9A 3ORKA 4L3JA 3OXTA 3KMWA 3KC3A 1M52A 4XP3A 4R7HA 4Y8DA 4ZTQA 5HVYA 3UJGA 5L2SA 2WTWA 5LQFA 2R3FA 4UWYA 2C5XA 2ITWA 2OJ9A 2PVNA 4D2SA 1P4OA 3ZH8A 3HDNA 4AZSA 3RM6A 3UMXA 1VYWA 3K5VA 3JPVA 5CU0A 2EXCX 5H9BA 3R9RA 2PVMA 4PX6A 2XKFA 4ITHA 3L8PA 4YMJA 3KU2A 1GOLA 1J1BA 3DK3A 4FTRA 1JKLA 3ULZA 3ZONA 4ALVA 3MTLA 2XBAA 5FDXA 4DCEA 4IZAA 3CTHA 4NJ3A 4F0IA 3DB6A 4MBJA 2W1GA 4XNEA 3TCPA 2G2IA 4NCTA 2AC5A 4JRVA 5FWKK 5CI6A 4BIEA 4YUQA 2PUNA 3O17A 3KQ7A 4RZWA 4MX9A 2VTPA 4BICA 2EVAA 5HLNA 4FSMA 2VTIA 4PPAA 2W5HA 5AAFA 3DAEA 5AR7A 3OG7A 4IZ5A 5CENA 4D4SA 2WTVA 4ITIA 4BIDA 4DAWA 4AOTA 1K9AA 2HY81 5E8WA 3GT8A 4WUAA 4U40A 3QZGA 5HCXA 3OF0A 3LAUA 2P33A 4RC2A 1PXOA 4FIFA 2R0UA 2RKUA 2W1HA 1U5RA 4UBAA 3VAPA 2Q0BA 2BZKB 4DG3E 3R8ZA 5BMSA 4UALA 3ORIA 2OICA 1F0QA 5JK3A 4D1ZA 4BDFA 4FKTA 3EFKA 2OH4A 3VS2A 5IZFA 4O1OA 2HENA 1DAWA 3ALNA 4O6LA 2H34A 5CS6A 3C13A 2PMNX 1ZYCA 3V3VA 4TYHA 4A7CA 4XOYA 4M15A 1Q8TA 1IASA 4WSYA 3NPCA 2XEZA 4C0TA 4BKYA 4O0SA 4AXAA 4X3FC 1QCFA 4C2WA 2J0KA 4BI2A 2IVSA 2X4FA 3LCOA 5GJGA 5HNBA 4HVIA 4QP8A 3CEKA 5AIKA 4D0XA 2QG5A 2UZBA 4FSTA 4DFXE 4NJDA 4NM5A 3P1AA 5L3AA 2UZTA 2EB2A 3CPBA 4USDA 5IMXA 2B52A 5L2TA 4ZMFA 2XRUA 3R8UA 4U3YA 2RL5A 3C0GA 3KMMA 4IVCA 3A7GA 4OT6A 4LL0A 5I9ZA 1YWRA 2X7FA 1ZARA 2UW7A 2V0DA 1FGKA 3KRJA 1JLUE 2JBPA 1WBSA 3PXRA 3F88A 1XBAA 4JR3A 5HCYA 4YZDA 4ACDA 3ZC5A 1S9JA 3TWJA 3R7GA 4DF3A 3DDPA 3V6RA 4NCTC 2E9NA 5FBNC 2JITA 2CPKE 5HTIA 5JMSA 2GNGA 4GFMA 3IDCA 4ZZNA 4ID7A 4A07A 1OUKA 3OWKA 4LV8A 4F1MA 3R0TA 4UXQA 4ANNA 4CFNA 3E62A 2P4IA 2UVYA 3OS3A 2BDFA 3A7FA 4DEBA 2XIXA 3VBTA 1M17A 4OW8A 3ORXA 2ZV7A 2OSCA 3R01A 5CAPA 4IX6A 2VTSA 3D7TA 3E5AA 4GRBA 5HNIX 2OFVA 4S2ZA 3L9MA 5KBRA 4FT5A 3R7IA 4FIHA 4KAOA 3R63A 4HYIA 4LRJA 4O27B 4RWJA 3AT2A 5FM2A 4YU2A 2O8YA 1U46A 1UU7A 1JPAA 4HZSA 5IQDA 3P23A 4JL9A 2H8HA 4KKHA 5EOBA 3HAVA 2J5EA 3LFSA 3PIZA 4BRXA 5J7BA 3PVUA 2HWOA 3ANQA 3QTQA 1UA2A 1B38A 3NUAA 4IAZA 4MF0A 2O64A 4Y85A 5E8XA 4QTEA 2WEVA 4O0RA 4RJ6A 5JGAA 2UW5A 1YOMA 4LGHA 2WMSA 5KMLA 2GPHA 5C4LA 4G34A 3UC3A 4FKWA 3PJ2A 3NYNA 2JBOA 1PXKA 1AD5A 3BCEA 5BYYA 4F9AA 1QPCA 4NEUA 4EORA 3BI6A 3OD6X 4AS0A 3IDBA 2UVXA 3V04A 4ZJIA 3F2AA 3NCZA 3VS3A 4C3RA 3LMIA 5AA8A 2GNJA 3OW4A 2ZMDA 4R3PA 2VU3A 1PJKA 1P4FA 4ZSAA 5KKRC 3MH1A 3BHTA 3W10A 2CKPA 4HNIA 4BVUA 2QLQA 1ZMVA 4IDVA 2PE1A 3JY9A 3LLTA 5DRBA 2JKOA 4HCTA 4FNZA 3V5JA 4RQVA 4I5CA 5M56A 1GAGA 3IG7A 4YP8A 4AW2A 3DTCA 3IW7A 4IMYA 5FQDC 5CAQA 4AE9A 2J0JA 2XK3A 3I79A 3O71A 4BWXA 3ZFYA 3GNIB 2YIWA 4I4EA 5FTQA 2GTMA 3UZPA 3MBLA 3HMIA 3HA8A 3L9PA 4OTFA 3MFSA 1R78A 2C6KA 5E8YA 3RAKA 5DGZA 4BYJA 4F9WA 4YSJA 1W83A 3AOXA 2GNIA 4DEHA 4J98A 3VUKA 3CIKA 4AT4A 4CT1A 4OTQA 3PY3A 4L3LA 4D2WA 3CQEA 2RGPA 3B2TA 4ZSLA 5JFVA 1MRUA 4PP7A 4Q5EA 1DI8A 4FL1A 5EQYA 2O2UA 4FVPA 3QGWA 3PVWA 3WZKA 3ZS5A 2FH9A 3NVMB 4BWKA 2H6DA 4QNAA 4C2VA 3KL8A 5DMZA 4E1ZA 2YM3A 4BBEA 5DOSA 4XS2A 5D12A 2ERZE 3FMDA 3LQ8A 4EH3A 2ITYA 5DG5A 2BMCA 5I9YA 5D11A 4FTNA 4NUSA 3EQIA 4G3DA 3NR9A 4WRSA 4ASZA 3R1SA 5CEIA 3W16A 3UOKA 3EYGA 4ACGA 5AV3A 3DKFA 5EI8A 5F1ZA 4AWIA 4D2VA 4QTBA 5HBJA 2C3JA 4GYGA 4ENXA 3BYSA 3UOJA 4FTJA 4F70A 3Q2JA 3G51A 3O8TA 4X6RA 5GHVA 5I9WA 5IA2A 5DWRA 3R71A 2J50A 4I6HA 4CKJA 1DS5A 4NW5A 3QZFA 3W2SA 3H4JA 3GGFA 1SNXA 2BPMA 3DGKA 2R3IA 3L9LA 3VS4A 1CTPE 5FEQA 4U45A 3V8TA 2GS6A 1OKVA 3F9NA 4A4XA 3IGOA 4QTDA 4BHZA 2R3HA 2FO0A 4FV9A 3POZA 1YW2A 5LJJA 2VTTA 4U0IA 4FKJA 4AN2A 4LOPA 4K1BA 5EH0A 4RVMA 4PQNA 5DT0A 2IO6A 3KF7A 4JBVA 3MVMA 4JBOA 3AQVA 3MA3A 2WQOA 2ZAZA 1WBPA 3KXHA 4O0YA 2GQSA 4TWCA 4YZBA 3AD4A 4EWQA 3H10A 1REKA 4ALWA 3LCKA 4DA5A 1CMKE 1H1QA 4PPCA 3UO4A 4AAAA 3FZPA 5IG1A 3Q6WA 3W55A 1H28A 2YWPA 4FSYA 4BGQA 4FT9A 2IZRA 3E93A 2W4JA 3DXPA 1QPJA 1I44A 5CX9A 4B6LA 5E8SA 4FOBA 4BGGA 4C4FA 4JDKA 4UY9A 4YC6A 2FSLX 1I09A 1OL6A 1AQ1A 4W9XA 4KBCA 4EQMA 3RPYA 3JVSA 3QCYA 1PF8A 3R8MA 4YBKA 2H9VA 2B9IA 3QQUA 4V0GB 3VQHA 1OBDA 2QR8A 3R22A 4MTAA 1ZY4A 4LMUA 5JH6A 1IRKA 4FTKA 2WMWA 1VYZA 3R02A 5L8LA 1ZY5A 2G01A 4IX4A 5IH6A 1XH4A 5K0KA 3UYTA 2W1EA 1W0XC 3UQGA 2YA9A 3NSZA 4FKOA 4KSPA 4NL0A 4O38A 2VWZA 5T6KA 3IOPA 3LQ5A 3PXZA 3LCSA 4JIAA 3R8VA 3RWPA 1LR4A 4PL4A 3RKBA 1NT2A 1PHKA 3UIXA 4BI1A 1TKIA 4L7SA 3L1SA 5HO7A 2CHLA 3SG9A 4O0UA 3Q4TA 1KUTA 4GMYA 4PMMA 4PDYA 2WQMA 3VULA 2W99B 4O0XA 3TIYA 4GU6A 2YJRA 4YJUA 5GNKA 3QKLA 4DFBA 4O81A 2XF0A 4H3BA 1UNLA 4OR5A 3TV6A 3AMBA 3A7HA 3CTQA 3OUNB 3UVPA 4AF3A 4DH8A 3MY1A 3QRKA 5AAEA 2J5FA 4O7VA 3ODYX 4EZ3A 3PPJA 4BGHA 4ZS0A 3DK6A 3HZTA 4F1OA 2VX3A 3DBDA 2BKKA 2QODA 2BDJA 3ZRMA 5IDPA 3A8WA 3HNGA 3JY0A 5CY3A 4I5MA 3IO7A 3PJ1A 3NX8A 3OCBA 5HG8A 2HW7A 3MH2A 4FTOA 4YJVA 4OTDA 3UNZA 4PF4A 3SX9A 3PJCA 4S32A 3QTWA 2XA4A 4FE2A 4UWBA 3RK9A 5JRQA 4HGSA 4DBNA 2CKEA 2EU9A 4JAJA 1TQPA 5DI1A 5KMNA 5J1VA 3F7ZA 3U55A 1Q5KA 3D83A 5EK7A 4YTIA 5FGKA 4RQKA 4U42A 3FAAA 5JFXA 1J7UA 5AP0A 2QKWB 3DXQA 3KRWA 1JSUA 2VGPA 4CMTA 4NYEA 2XNMA 2CGWA 2I1MA 5FXRA 4GFOA 4DE4A 3IOKA 5FM3A 5TKDA 4Q2AA 1UU3A 3PE1A 4DH7A 4FV7A 4F99A 1FMOE 5CEKA 2V5QA 4RJ4A 3CBLA 3LFQA 2PY3A 1YKRA 2X8DA 4YHTA 5ANEA 3SRVB 2W0JA 2VV9A 2EB3A 4GVAA 3VNTA 4ANSA 4EK3A 5IA5A 1YRPA 4I3ZA 5DH3A 2C6EA 1OPJA 4XG3A 4YJQA 4BDGA 2WFYA 1KOAA 1WBOA 2YIRA 3TUCA 5CQUA 2HZ4A 4O7WA 4WT6A 5DT4A 4QQTA 5F9EA 3ZO2A 3QD4A 1OITA 2FSOX 2EXMA 2ITPA 3ACKA 3FJQE 5AJQA 4LUEA 4FTUA 5D9HA 3P08A 4A4LA 4EOIA 1CSNA 2BRNA 4RC3A 4AA5A 5M06A 3E87A 2IN6A 3EQBA 4QP1A 4C57A 5BUJA 2BRBA 5CSXA 2F2CB 4DGMA 5IPJA 2YJSA 1NY3A 4AGDA 3BHYA 2E9UA 4CZUA 1PXPA 4LG4A 4QPAA 5I5ZA 3H9RA 5CT0A 3N51A 2UW4A 5C4KA 3PZEA 3ENMA 4NFNA 3HEGA 4D9TA 4EI4A 2GS7A 3LIJA 4K8AA 4Z7HA 5IEYA 3QTXA 2XJ0A 4QTAA 5D7AA 4LRKA 4GUBA 5DN3A 3TV4A 4F6WA 1XH9A 2Q83A 3PG3A 4ZTLA 3W32A 3UIBA 3LFNA 2OU7A 2ITQA 2J2IB 3MYGA 3IPHA 4ZLYA 3OP5A 5AUUA 4AA4A 3MI9A 2I40A 3MWUA 4D4VA 3MB7A 3AXWA 5CZHA 4E5BA 5LMBA 3VRYA 1EH4A 2OZAB 4FODA 4S33A 4FEUA 4HZRA 2A0CX 1NW1A 3IW6A 3L9NA 4HYSA 4G3EA 2BAKA 3QZIA 3TL8A 3N4UA 3F3UA 3GEQA 3V5LA 4N4SA 4FEWA 2F49A 5AMNA 5IUGA 4LUDA 3BV3A 4BDCA 5L8KA 1RQQA 5J79A 4C3FA 4CEGA 2IZTA 3GU6A 4KIOA 3EFWA 4EHGA 5J1WA 3LQ3A 2C5NA 4BTJA 4J7BA 4R77A 5L2QA 4FTAA 4ITJA 2VTLA 3IECA 3F2NA 2XKEA 4JIKA 4RX5A 1A06A 3VUIA 2YWVA 2FVDA 2LGCA 3SV0A 5IEVA 3SAYA 3KXMA 2BFXA 3CTJA 3IK3A 4R3RA 5KHXA 1ZXEA 4B99A 1SMHA 3FI2A 3P7BA 3HV6A 4TXCA 4BDEA 4EUUA 2W4KA 3ENHA 3HMMA 1WCCA 2P55A 2J7TA 2VTAA 3EN4A 5IA4A 3P7AA 1WFCA 4FKQA 2BALA 5HO6A 3U9NA 3AC5A 2YISA 2GQGA 3QHWA 5DEYA 3MIAA 3K5UA 1YDTE 3SA0A 2B55A 3GQIA 3A99A 2BZIB 4GT3A 5CXHA 2VZ6A 4IAIA 4YTCA 4RJ7A 5J9YA 5JN2A 3RPSA 3PSDA 2BILB 4FL2A 2PZYA 2J90A 4IWOA 3OY1A 3RZFA 5C8KA 5CLPA 3R1NA 3EKKA 4JOAA 4BIBA 3KF4A 5E7RA 4ZSGA 1ZLTA 2KTYA 3WZEA 4W4WA 3G33A 3BX5A 4AT5A 3ZSHA 1PXNA 5HG7A 3SOCA 3EQHA 4CV9A 4WNMA 3NUSA 4MF1A 1VJYA 1XWSA 1ZOGA 2XYNA 3G0FA 4Y5QA 4L00A 1W82A 1JKTA 3UYSA 4OBOA 3EN5A 1TQMA 5HI2A 2B0QA 3DJ6A 3BIZA 1RJBA 3CXWA 5EM6A 1OPLA 3F3ZA 3FL5A 3DT1A 3QKMA 1ZZLA 2UZEA 4KD1A 4RRVA 2YIYA 4YJOA 4ONAA 2OXYA 3IQ7A 4FKLA 5CQWA 3EQDA 4FIIA 2IG7A 3SW7A 1PYXA 3GOPA 2HXLA 3FHRA 3FKNA 2W1ZA 5CU6A 1UV5A 5H8GA 5M53A 4RX9A 2JEDA 3IKAA 3ZO3A 1OL1A 1PMVA 4E4XA 3RAWA 3AC3A 3ZEWA 3UNKA 4IDTA 2PU8A 4K2RA 4RWKA 5LMKA 2HW6A 1YI4A 4ZP5A 4ZIMA 2XK7A 5CF8A 3SOAA 1YDSE 3NYXA 4RX7A 2DWBA 3TTIA 3FC1X 3MPMA 2BTSA 4K6ZA 4FEXA 4NM7A 4L44A 3A2CA 3DY7A 3GC7A 4LOQA 4G1WA 3A62A 4YNEA 3WOWA 4AG8A 3S0OA 3L8XA 4MNEB 3QTZA 4P5QA 3TUBA 4I0TA 3NW6A 2WKMA 2YERA 1KE7A 3E63A 4FF8A 4KS8A 3R8PA 1FMKA 4R8QA 4O7SA 3KK8A 1Y6BA 3LKMA 3HUCA 5AP4A 3BYMA 5M09A 4RMZA 4CFUA 3DJ7A 2C0OA 4ZSJA 3CGFA 3KN6A 3OHTA 3RPOA 4O22A 4QQ5A 4O1PA 4GVJA 2XNGA 4R7BA 3KRLA 1UVRA 2DQ7X 4FV2A 1SVGA 3UVQA 4MNFA 3ZBFA 3AT4A 3FPMA 1XQZA 3GENA 4QYEA 4ZTNA 1JOWB 4CKIA 5FDPA 4DGNA 1ND4A 3HAMA 3SC1A 5G1XA 4PMPA 4GFGA 5KCVA 4M14A 3A8XA 5BUEA 4DH3A 4R1VA 5AP1A 2BHHA 5FUTA 4E73A 4APCA 5KUPA 4H05A 4DINA 4M12A 3HP2A 2OIDA 2OH0E 4V0GA 2VTRA 2C5OA 3PWDA 2QR7A 4IH8A 3UBDA 4E4LA 1RW8A 3RPRA 3MW1A 1A9UA 4ANBA 3NDMA 4LL5A 2B9FA 3JUHA 3OEFX 4CVAA 5B2KA 3UO5A 3LFCA 4TW9A 2WQEA 4FKIA 1YXUA 2UW3A 2Z7SA 4FSUA 3ZRLA 3ZUUA 3ZC6A 4NZWB 4RWLA 4DH1A 4UMQA 4EK8A 4EWHA 4QMUA 3PPZA 3GP0A 4FNWA 3S4QA 1M2RA 3GU7A 5AV1A 4DBXA 3FZ1A 4I23A 4UMTA 2W1DA 5BMMA 3TI1A 2VTJA 2X8EA 2ITOA 4W9WA 3D7ZA 3U8WA 3DKCA 1Q99A 2BDWA 4YZ9A 3QTRA 1DAYA 4EK6A 3JXWA 3C0IA 4JI9A 2WTIA 5L6PA 2VX1A 3KXZA 4DEIA 2PUUA 4J71A 4NTSA 1S9IA 1PMEA 2R7IA 3HV5A 3PSCA 4QMMA 4FTTA 4X3JA 4E20A 2R3GA 2Z7QA 3EYHA 2RFEA 2XCHA 4M3QA 1J7LA 4MBIA 1YXSA 4MXZA 3DS6A 2X39A 2R5TA 3HECA 5EW9A 2XUUA 3V8WA 3TEIA 5ANGA 4D5HA 3VO3A 3QGYA 4PDOA 3BQRA 3NYVA 3UQCA 4GT4A 4WRGA 4DFYA 5DFPA 3MTFA 3SDJA 3LZBA 3QQJA 1Q8ZA 4FZ6A 1JNKA 1KOBA 2B54A 2PL0A 3CS9A 4JAIA 4OGRA 5DR6A 4IJ9A 4I24A 3ZDUA 3FYJX 2IJMA 3D4QA 4ZLZA 2WB8A 3H0ZA 2Z02A 3HA6A 3K2LA 1JAMA 2C6TA 4S31A 4KRCA 4O82A 4FIJA 1H4LA 4EBVA 2P0CA 3D94A 1URWA 4C33A 3I81A 1H08A 4M69A 3DQWA 4OTHA 3UTOA 2XJ2A 3C9WA 4FT7A 4C35A 3D0EA 3VRZA 4AACA 3CP9A 3EN9A 4CV8A 4QT1A 3EKNA 3SRVA 3RHXA 2G15A 3OW3A 5AIRA 3CPCA 4W8EA 2YCRA 2R9SA 2WPAA 3FI8A 1NXKA 3ZZWA 2XP2A 5JZJA 2PVLA 4S34A 2F7XE 4USFA 3S1HA 2ZB1A 2IPXA 4GJ3A 2ITXA 3DOGA 4BC6A 4JQEA 3E8NA 5ICPA 4LM5A 3U6JA 4F0FA 1UNGA 3AT3A 3OT3A 4EUTA 2ZJWA 3UZRA 4RIXB 2WOTA 3KXNA 4JDJA 4K77A 3PA3A 4J53A 3DNEA 2WTKC 2C1BA 4EL9A 3ZFXA 4QNYA 1M7NA 5L2IA 5CI7A 2FB8A 4J96A 2W06A 3EOCA 3NZ0A 3UPXA 4DH5A 3Q4ZA 3ITZA 1JSTA 4FI1A 4KA3A 3F66A 4U44A 1OIYA 3RGFA 5L2WA 5M07A 3PE2A 4R6VA 3IW5A 1OUYA 1U5QA 2V55A 5E1EA 4I41A 5AR5A 3UNJA 3UZTA 3LMGA 5DLSA 2WMXA 3HDMA 2XBJA 5D41A 5F94A 4L9IA 4A9RA 4AT3A 5A4CA 1IR3A 4FSWA 3RI1A 4I6BA 1XBCA 3BU3A 1HCKA 4IANA 3FZSA 2Y0AA 4V04A 3R6XA 2FSMX 2HWPA 3QC9A 4DEGA 5I3RA 3KCKA 4AOIA 3EN6A 4IVBA 4II5A 2VNYA 3MVHA 4QQCA 4ARKA 5LXMA 3NMUF 2B4SB 3C50A 4FYNA 4A9YA 3ZDIA 2OZAA 4AZEA 4M7IA 3F82A 4IVAA 3R9OA 1XJDA 3UO6A 4FSZA 4L67A 3UIMA 2FUMA 3H30A 2XNBA 4I5HA 4R1YA 3DFAA 4X0MA 4YPSA 3ALOA 2F7EE 3AGMA 3R7EA 3OBJA 5C01A 2QOKA 4YSMA 2B9JA 2OF2A 4EH9A 4YNOA 4FOCA 2WU6A 3T3VA 3P86A 4HGEA 2BHEA 3MSSA 4XMOA 4C8BA 3S95A 3JYAA 4FTCA 1H1PA 1PRYA 3HP5A 4TWPA 2G9XA 3MJ2A 4MXOA 5G6VA 1REJA 4E5AX 3UPZA 2VUWA 5BVKA 2QNJA 2ITUA 1BMKA 2IVVA 3MFUA 2HK5A 4Q5HA 4U3ZA 3UMWA 4DLIA 3U54A 1GY3A 4C02A 4RBLA 5I9UA 5IF1A 3RPVA 3RAIA 5A4LA 2F2UA 2W5AA 2CN5A 4CCUA 1M2QA 4GV1A 3GBZA 3QF9A 4YTHA 3FYKX 1YHVA 1GJOA 3LXNA 2R2PA 3DXNA 2PVHA 3NUXA 5J9ZA 1IEPA 1OKZA 3G6GA 3TNWA 5AADA 4GG7A 3RK7A 2JFLA 5DNRA 3VUGA 3Q32A 3W18A 4U81A 3V51A 1ZWSA 4I94A 3OROA 1SYKA 2ZM3A 4DGGA 4TYGA 1BKXA 4AOJA 3F5UA 3FE3A 4F65A 4YJSA 5IUHA 4IACA 2Y4IB 4FG7A 2OK1A 4YGAA 4YO4A 1OIRA 3DQXA 4IB5A 1MQ4A 4C38A 4TNBA 5ITAA 3KA0A 1V1KA 2Z8CA 2J9MA 4QMTA 1VR2A 4MXAA 2OG8A 4QP3A 4FK6A 4YZCA 5HLWA 4TL0A 2XYUA 3PSBA 4RX8A 4GSBA 4FKRA 5LVLA 3KB7A 4WOVA 5HU3A 4FVRA 3HKOA 3ZXTA 3LFBA 3DAKA 2OBJA 3VUMA 5IQIA 1ZYDA 1UKIA 2G2HA 4P4CA 5AUTA 5IMEA 1G5SA 3GC0A 3CQWA 5GJDA 4C62A 2F4JA 3CJGA 4IFCA 1KSWA 4XRJA 5EI6A 4G3GA 3OZ6A 3OWJA 4PNKA 3ZHPC 4K9YA 4QQJA 3Q96A 4FG8A 2YFXA 3GCPA 5H3QA 2Z60A 3QQFA 5HE3A 4EOPA 3Q9XA 4NW6A 2C6DA 2WU7A 4GYIA 5EHOA 5HBHA 3RALA 4FZAB 4XP0A 5L6WL 5IH5A 1H26A 3DBQA 3NLBA 4YJTA 4NIFB 4EKLA 5H2UA 2JC6A 5LARA 4IWPA 2YAKA 3BE2A 4A9TA 4D2PA 3ET7A 3LMHA 2Y9QA 1JQHA 3W8QA 4HJOA 3O96A 4L43A 3O7LB 3RWQA 4DITA 4EH4A 5EHLA 5F20A 4CRSA 4ASXA 2PHKA 3DB8A 1CKPA 3ATTA 2JLDA 4IE9A 4KINA 4FUYA 4ASDA 1MUOA 3F3WA 4EONA 5CANA 1BLXA 3NIEA 1BI7A 3FKLA 5GZAA 3BHUA 1TQIA 4KIKA 3G9NA 4FKUA 4F08A 3MPAA 2W9FB 3DCVA 4HOKA 4ORKA 2WMUA 2W5BA 4QPMA 5IU2A 4WA9A 3D5UA 4Q9ZA 5I3OA 5CASA 3BWJA 3TJCA 4DCAA 3QRJA 5AR2A 1R39A 3WYXA 1OKYA 5C8MA 2EWAA 3R00A 5CEMA 2W1FA 2UZOA 5F95A 5C8NA 3VIDA 4BDDA 2E2BA 4XLVA 1XH6A 3G2FA 3NRMA 4BCQA 1H8FA 1PXMA 3C4ZA 3VC4A 5CEPA 3PTGA 4H3QA 1YI6A 4AUAA 3D14A 3D2IA 2C47A 2JDVA 4QRCA 3VBVA 4IC8A 5BYLA 4HPUE 4KKEA 4O2PA 4HVHA 2PZRA 4BZDA 4E8AA 2QOHA 4L52A 5BVOA 2OJGA 2VO6A 5CEQA 4ZXTA 2E9VA 1H0VA 4O86A 3WE8A 3RP9A 5DIAA 5HIBA 4MWIA 2X7GA 2VX0A 3PY1A 4M97A 5DEWA 3PLAE 2VWWA 3WZDA 3VN9A 4IAAA 3SGCA 4NH1A 1URCA 3BEGA 3P79A 5DE2A 3EQFA 5CTPA 3RCJA 4BCKA 5B2MA 2ZDTA 2WGJA 2AYPA 3KFAA 5E91A 2YEXA 3BYVA 2W7XA 2QO2A 5A4QA 3P78A 4FICA 2JKMA 1R0EA 3TNIA 4MXYA 2XIKA 4ZSEA 5IQFA 4WHZA 2VWVA 4ACMA 4AGUA 4BHNA 4BZNA 3NIZA 4C36A 4EK4A 3TXOA 5A14A 5F4NA 5EQEA 2XK4A 2YM7A 4FV8A 1Y6AA 3VJOA 2G2FA 2PVFA 3I0OA 3S00A 2OJFE 2R0IA 4NKAA 2VO0A 3DLZA 3FLZA 3SHEA 5B2LA 5LWNA 2Z7LA 4EHVA 2F7ZE 4DFUA 1XH7A 3I5ZA 1SM2A 3Q4CA 2QG7A 4XHKB 1GZKA 4DC2A 3G15A 1NVQA 2PZIA 3HRCA 3SXRA 2CCHA 3G9LX 4BYIA 2NRUA 3CGOA 4F6SA 1PMUA 2YCFA 3MPTA 2X6EA 2R3QA 3FMHA 4RSSA 3NVKI 2QI8A 2XNPA 2P2HA 1OI9A 5C26A 3R8LA 4BCNA 3T3UA 4M0ZA 2NO3A 3OCGA 4XP2A 4R78A 5FTOA 4O91A 1IAHA 5TO8A 4C61A 3RZBA 2VWBA 3QTUA 3NNVA 5ANJA 3T8OA 5HE2A 4I1ZA 1GZOA 2HIWA 5HORA 5D7VA 2FA2A 3BU6A 4BBMA 2ZYBA 4CNHA 5BVWA 3ZMMA 3M11A 4FSRA 4AZWA 2GFSA 1B6CB 2HXQA 5AUVA 4BY9E 4AA0A 1Q62A 4O2ZA 4PTGA 1U54B 3EL8A 4HYUA 4DG2E 4L01A 4ERWA 2RG6A 3MY0A 1WBVA 4IAYA 4XH6A 5IEXA 5AUYA 3TKIA 2WMBA 3R7UA 3PLSA 2CKOA 1FGIA 5LVMA 2CNQA 3CC6A 1M7QA 3DNDA 1PKDA 3MB6A 4LGGA 4UYNA 4XX9A 3VHKA 4YC8A 5DHJA 2UZLA 4BN1A 2HAKA 4QP2A 4GK2A 4UZHA 2GHMA 3WIGA 4MH7A 4PDSA 1WAKA 2VO7A 3FXZA
chains in the Genus database with same CATH superfamily
3DZOA 4BDJA 3LCTA 4QMLA 3KRXA 5K4IA 4KUJA 3VBQA 3BGPA 2QVSE 4TY1A 4BZOA 2X6DA 4FGRA 5EOLA 1XKKA 4IHPA 4PWNA 2G1TA 4EH5A 5A6NA 4MCVA 4X2NA 3ZYAA 4EH2A 3GCQA 5L6OA 4H3PA 3W0MA 3BELA 1Y8GA 2XNOA 4ZS4A 4RIXA 4W4YA 5KBQA 3EFLA 2Z7RA 4FIEA 2C4GA 2ETRA 5LMAA 4UXLA 4NFMA 2YM8A 1CM8A 3D5XA 4O6EA 5BQ0A 2O0UA 1YXXA 2XM8A 4DN5A 1JKKA 1FPUA 4HCUA 3FMJA 2C1AA 1Z9XA 3C4CA 4TN6A 3VHEA 1WMKA 4E7WA 4N6YA 1ERKA 3NNWA 5CVGA 3E3BX 4F7NA 3OFMA 3F2RA 4DTBA 4MEDA 3WARA 3FMLA 2WEIA 2W4OA 3GFEA 4EJ7A 3Q6UA 3E8EA 4PRJA 3IGGA 2UV2A 4XG8A 3UOHA 3B8QA 3EH9A 3WF6A 2CMWA 4MKCA 2O3PA 4LQMA 4X3FB 2R3OA 1KE8A 1XR1A 3BBTB 4EH6A 1GIJA 3TDVA 3OOMA 4CKRA 3TIZA 3UDSA 5AFVA 3FQHA 4N57A 4BDKA 5ACBC 4JX7A 3C4FA 2QOLA 3Q5ZA 4CG8A 1WBWA 4YC3A 2VTNA 3NUYA 4QTCA 4LMNA 3SKCA 3WZUA 3MDYA 4AU8A 4QMXA 3C4XA 3HVCA 3FLYA 3SXSA 4PP9A 3A4PA 3CKXA 2WTCA 2OI4X 3WBLA 5T3QA 4OLIA 4F6UA 3BLQA 5JSMA 4QMQA 2J4ZA 5J5SA 2YITA 4F9YA 3TZMA 2E9PA 2J0IA 1QL6A 4ZJVA 2XH5A 1J91A 2AUHA 3TN8A 1KE5A 3I5NA 3Q9ZA 4XJ0A 3KEXA 3NUNA 3V5TA 4KB8A 4RIYB 4C4JA 2I0HA 4BWPA 5CWZA 3VF8A 4CGAA 2ZMCA 3E88A 3WIKA 2HCKA 5LCJA 3CY2A 5AM7A 4ALUA 4O7ZA 4IBMA 4ZLOA 2X0PA 3KCFA 2IW8A 1OB3A 1XMMA 3JR1A 4FV3A 3TV7A 1W7HA 3TKUA 3R7OA 4RA4A 4ZTHA 2BUJA 2LAVA 3DTWA 2ZOQA 4U43A 4CQGA 2ERKA 5HE1A 3TZ7A 2AC3A 2JDTA 3UVRA 5EKOA 3FLWA 1CKIA 5AX9A 1YOJA 5GIOE 5IQEA 4D4YA 2V7OA 1V0BA 1OGUA 3G90X 4UMRA 3ACJA 1H07A 2WELA 2JDRA 3BV2A 4FK3A 3EQRA 5AR3A 4TT7A 3R04A 2X4ZA 1W8CA 5JEBA 4L42A 3JS2A 1BUHA 4GEOA 2VN9A 3EQCA 3Q5IA 1M2PA 4TYHB 4UWCA 2QOCA 3RNIA 3U9CA 3ZBXA 3OY3A 4EHEA 2ACXA 2X2KA 4UV0A 1KV2A 3E7VA 4FV6A 4FZDB 2CKQA 2UW8A 3KXGA 1NA7A 4HNFA 4MYGA 2IF8A 2X81A 3PXFA 3ORNA 3PIYA 2YIQA 4X2KA 5AR4A 1OECA 3R9NA 4FV1A 3SG8A 4DHFA 3G5DA 2PVJA 3GI3A 4FKVA 4G31A 4G3FA 4DLJA 4Z3VA 5K0XA 4O7NA 3GU8A 5AV2A 3Q9WA 2WNTA 3VS0A 2CDZA 3ZSIA 1Q41A 2QLUA 5TT7A 3LPBA 4CXAA 2Z2WA 4WSQA 5FP5A 1LEZA 3LCDA 4N0SA 3BKBA 1YXVA 4U79A 4FMQA 4GH2A 4EYJA 5KKRB 2GNLA 2WQNA 3F7WA 4UB7A 2WXVA 2FGIA 3FL4A 3GU4A 4AXFA 3RAHA 3CD3A 5AA9A 3HMOA 4NIFA 4ASEA 1WVWA 2XZSA 2X2MA 1OKWA 4WUNA 4YLLA 3EB0A 1KWPA 1FVTA 4XV9A 3U6HA 4AN3A 2XAMA 5J87A 3CD8A 5EM7A 3FMNA 3COMA 2JDSA 4RC4A 4JVGA 4CLIA 4ANLA 3DV3A 4LOOA 5IUIA 4Z7GA 2XCKA 5HGIA 5IQBA 1P5EA 2PYWA 3QQGA 2CLXA 1JSVA 3FZTA 5JQ5A 3FI3A 3FWQA 2A98A 2UW6A 3QD0A 5C9CA 2PE2A 3DBCA 4NSTA 5E92A 4F63A 4G9CA 4IAKA 4GL9A 2YM6A 2PZ5A 5AM6A 3UP2A 1ZMWA 3OXZA 3Q52A 3WI6A 1OBGA 3FMEA 4BTFA 4NTTA 3SD0A 1J1CA 5JRSA 3NNUA 3R2YA 2PUIA 3GCSA 4FT0A 2JKKA 3DKGA 4L8MA 2QOOA 4M0YA 4RVKA 5GJFA 1SZMA 4HCVA 3W0NA 4FSQA 4IIRA 3R1QA 2UZWE 4BCFA 4CMOA 5DA3A 2BZJA 4ZK5A 3UDBA 2B53A 4D5KA 2CCIA 2UZNA 2IVUA 3GUBA 3TNPC 4B9DA 4DFZE 5IA3A 4BFMA 3C4WA 4J8MA 4E6DA 5AUXA 2ZB0A 5AP6A 3F3VA 1IAJA 3BYOA 3RVGA 3N4TA 1ATPE 4JG8A 4EQUA 5FRIA 2JAVA 3F6XA 3OEZA 4A9SA 5HZNA 2PULA 1Z5MA 3KXXA 2XALA 4QO9A 5HQ0A 5LVOA 2XMYA 4JDIA 3U4UA 3R21A 2F9GA 3PZHA 4FL3A 4OBQA 4QPSA 3S3IA 4CSVA 3UG2A 2VD5A 4QMSA 4BTMA 4E6AA 3LJ1A 4IC7A 3ZSGA 2IW9A 4PMTA 3UQFA 1OL5A 3QHRA 5M4FA 3P9JA 2VGOA 3F3TA 5HICA 1A48A 3AC1A 3II5A 3O7LD 4XG9A 2XK9A 2HOGA 4YURA 2WTDA 3MGYA 4UEUA 3FXXA 1P2AA 3QBNA 4Y73A 1PXJA 4LRMA 5FP6A 2BAJA 3PA5A 4EQCA 3MJ1A 4GK3A 5HESA 1MP8A 3O8PA 4FTIA 5ETIA 2J0MB 3QQLA 3WZJA 4DGLC 4EZ5A 5CALA 2WOUA 4KBAA 3V6SA 3LFDA 4HGLA 4HVGA 1OM1A 3PFQA 2CNUA 4RJ5A 3GQLA 4M67A 3HGKA 4C4GA 4G3CA 3W2CA 4NU1A 3I6WA 3Q53A 4NKSA 5ACKA 3IS5A 3ZU7A 4DEDA 1HOWA 4UYAA 3F61A 1R3CA 1K3AA 3QRUA 1FVRA 1OL7A 4O7RA 4EOSA 3SXFA 2GMXA 3ZLXA 5GZ9A 1H1WA 3DKOA 2ONLA 4AGWA 2B7AA 1U4DA 4Y95A 4OUCA 3LXPA 5CNOA 4BL1A 3ORLA 3MN3A 4NK9A 4EOJA 5CEOA 4JG6A 5AP5A 1G8AA 3ELJA 5HD7A 3VUHA 3W2PA 1STCE 1PXLA 5EKNA 4GG5A 2JAMA 5I9VA 3A60A 4YJRA 3F5PA 2WD1A 4KBKA 3W2QA 4EOQA 2CJMA 2QHMA 2NPQA 3EZRA 3KKVA 2OIBA 2BTRA 4WO5A 5HLPA 5FD2A 5A4TA 5KO1A 3LLAA 2ZDUA 4XG7A 3I6UA 3BWFA 3BPRA 4TTHB 3SLSA 4QMZA 2QC6A 3ZLWA 4DT8A 3FMKA 4D28A 2IZUA 1U54A 2YIXA 3RJCA 1CKJA 3ZLSA 1L8TA 1GZNA 2C69A 4RLKA 2IZSA 3GC8A 1Q97A 2VWXA 2QKRA 4JLCA 3QX2A 2CLQA 1OPKA 4IEBA 2VNWA 2NP8A 3R73A 2A4LA 4XBRA 3ZFMA 1MRVA 3D9VA 4XOZA 3FLNC 1XH8A 3QA0A 5JGDA 3PXYA 5LMKC 3QX4A 2WHBA 4FTQA 5JGBA 4O0TA 2X2LA 2X9EA 2HY0A 4R5SA 4WBOA 3QWJA 2WIPA 3BHHA 3W0QA 4FR4A 2BRMA 2RG5A 2VTOA 3M2WA 4M8TA 2GQRA 4L68A 3MH0A 4IJPA 4IXPA 4CZTA 4N6ZA 2OW3A 4YTFA 2QOIA 4GIHA 3W0SA 4PTCA 4TYJA 4YZNA 4KKGA 5B7VA 4N70A 4FG9A 4RGJA 1JKSA 4FKSA 5CAVA 3QRTA 5E9EA 3ZO4A 2NNWB 2IEWA 4XV1A 1YI3A 3DA6A 3EZVA 3AKLA 2VTMA 3CQUA 2ZM4A 2PTKA 4P2KA 1Q3WA 4DTAA 4EOLA 1SVHA 1QPDA 1DM2A 4WBBB 4APPA 1T46A 2E9OA 3NAYA 5CAOA 4JT3A 1YXTA 4TYEA 4P90A 2ESMA 1YDRE 4G6LA 2I0EA 3E7OA 3W0OA 4BCGA 2BROA 2PPQA 4JDHA 4P7EA 3FQEA 1ST0A 4X2FA 3WF7A 5KNJA 4WG3A 4F0GA 3R1YA 3EFJA 5HE0A 2OO8X 4HYHA 4R3CA 4AFJA 2XK6A 3DK7A 3QD3A 3GU5A 4K0YA 2IW6A 4IWDA 3U4WA 5IA0A 3FXWA 4M66A 4E4NA 5FEDA 2QURA 3PIXA 5EI2A 1MQBA 4O4DA 4QMOA 2XM9A 2GNFA 1YWNA 1ZYJA 3OC1A 1PKGA 4H1JA 5CU2A 4IM0A 2B1PA 3OXIA 1LEWA 5FXSA 3CE3A 4QOXA 4TZRA 2W17A 3KY2A 5CSWA 4D55A 2R3PA 2UUEA 1XHAA 3P0MA 3UG1A 5BVNA 2OJJA 3FSFA 4LV5A 3H0YA 5E8UA 5HU9A 5A9UA 3V01A 1H24A 3KGAA 5CT7A 2OXDA 4U5JA 3TTJA 2ZV8A 3LOKA 2YHVA 4CMUA 4MBLA 2CGUA 3L8SA 4HPTE 4O84A 3MVLA 1F3MC 3GCUA 4ANQA 4LYNA 4D58A 1OMWA 3QU0A 3C51A 3QRIA 3LJ2A 1L3RE 5LWMA 5HX8A 1SVEA 4RIYA 4AZTA 1H0WA 3RK5A 5BX0A 5I4NA 3HMPA 1PYEA 4K18A 4U97A 5FLFA 1YQJA 3I7BA 4I22A 4S30A 5KMMA 5FG8A 3VS7A 3PRFA 4ZY5A 3VQUA 3VWAA 1ZZ2A 2VRXA 2X0OA 2BZHB 4F9BA 3PFYA 4YZMA 2CGXA 3BQCA 3PJ3A 5GINE 3H9FA 4H39A 4YHJA 4BDHA 2XRWA 1JVPP 1U59A 5AP3A 5EG3A 2FYSA 4YJNA 3REPA 3QUPA 4AZVA 3FY0A 1B39A 1WVXA 3O23A 4FIGA 4I4FA 2VWIA 3A7IA 4FV4A 4RFYA 5KE0A 2XKCA 4EJNA 5HTBA 3PJ8A 3ZLYA 3ORMA 3VS1A 5IQAA 3OCSA 4TWOA 3A7JA 3WF5A 4IW0A 4ERKA 2VAGA 4G17A 4U80A 2W1CA 1NVRA 4UMUA 4JQ7A 2NYAA 4GT5A 4QDVA 2ZV2A 3EJ1A 2R3KA 2R3LA 3R83A 3TUDA 4PV0A 2YM5A 5HX6A 3ZOSA 5BVFA 2HZIA 2XIRA 4RZVA 3FHIA 5M08A 1CDKA 5J7HA 2QCSA 3LVPA 4AFEA 4R5YA 4G9RA 4E26A 1FVVA 3DDQA 4YLKA 4HGTA 4KSQA 2C30A 4MD9E 4MWHA 4O21A 4OBPA 4OTGA 2WAJA 3KK9A 1Q3DA 2W1IA 3QAME 4EBWA 3RNYA 3FI4A 5DPVA 2XVDA 1Q8WA 4MK0A 2EXEA 3OVVA 3PWYA 3H3CA 3FPQA 3ID6C 2KULA 3DPKA 4CLJA 1YWVA 4XG6A 5LVPA 5M4CA 3G6HA 4J97A 4CFMA 2JKQA 3QUDA 2R7BA 4AAYA 3D2KA 3DBFA 1Q61A 3R7YA 3MS9A 3D5VA 2GNHA 3PVGA 3VF9A 1WBTA 3F5XA 2OJIA 4AZFA 4F7SA 4BF2A 5JKGA 3QKKA 3SVVA 3IW8A 2BRGA 4QMYA 5EDRA 1F5QA 3MIYA 4ACHA 3ZO1A 4JBQA 4MVFA 2W05A 3F69A 4C4IA 4IZYA 2XANA 3TDWA 3PDTA 1GNGA 4JBPA 2QONA 3FLQA 4Q9SA 5DR2A 5HVJA 1W2FA 4I92A 1MRYA 2UZUE 2XIYA 1WBNA 2XKDA 3V5QA 4I0SA 5M44A 2OLCA 1UU9A 1V0OA 1G8JA 2C3IB 3O0GA 2YZLA 2ITZA 2R64A 1Y8YA 2WMTA 4FVQA 4Y83A 2GHLA 5FEEA 4X6QC 2WTJA 4GS6A 3BYUA 4Z16A 2QD9A 1H00A 3NW7A 2C6OA 4EZ7A 3KMUA 4ZY4A 2GU8A 2VTQA 5KMIA 2YZAA 5CYIA 3AC8A 3WILA 3COIA 4ZOGA 4YR8A 2CNVA 2UW0A 4G5JA 3C0HA 4GK4A 5EHYA 2JIVA 3VW8A 5GIPE 1Q8UA 2GSFA 3BRBA 3AC4A 3ZEPA 3D5WA 3E8DA 4Y72A 3FBVA 4DYMA 3KULB 2GS2A 3ORPA 3W1FA 3W33A 4DTKA 2OZOA 3QQKA 4HVDA 1XBBA 2RIOA 3K54A 4PPBA 2QOFA 3MY5A 4QP4A 4L45A 1GZ8A 2XS0A 5HG5A 4B0GA 4EEVA 4BCMA 4J95A 4CTCA 4WIHA 5CVFA 3PY0A 2P3GX 4FKGA 4QMWA 4LI5A 5AP7A 2X7OA 2IVTA 5EYKA 1QPEA 4C3PA 4IM2A 1H1RA 3W2RA 2JD5A 1M14A 1PXIA 3Q60A 1UKHA 4KRDA 4MNEA 5E8ZA 5J5TA 1Q8YA 3BE9A 4JNWA 4F9CA 4BDBA 4TYIA 1VZOA 2JIUA 4FZ7A 3ETAA 4O96A 5B0XA 5HHWA 2Y4PA 1BI8A 1YHSA 4OTIA 4W4VA 2ITVA 4GKIA 3HX4A 1R1WA 5EYMA 2I0YA 3FDNA 3MV5A 3B8RA 3SQQA 5L4QA 3QTIA 2RFDA 3HL7A 4FEVA 4QYFA 4CG9A 1KE6A 4IQ6A 3ZUTA 1H01A 2Q0NA 4MQ1A 4AQCA 2YACA 4RLLA 5LVNA 5J95A 1YHWA 4V01A 5TOZA 2QHNA 1J7IA 3BGZA 3QC4A 5E8TA 4RIOA 2R4BA 2P2IA 2BR1A 4EH7A 2I7QA 2B9HA 2OWBA 2ETKA 4LGDA 3COHA 5JFWA 4X2JA 4O7LA 1APME 2QQ7A 3F5GA 2ITTA 2C5YA 4FNYA 4DHIB 4KS7A 4YBJA 5ANDA 5JZNA 5KMKA 1J3HA 2UVZA 3ROYA 5ETFA 3A4OX 1P14A 3L8VA 2YAAA 4C58A 3ZUVA 4DGOA 5K5XA 5IQHA 1TVOA 2RSVA 4GIIA 4XUFA 1E1XA 2X9FA 5LCKA 3ZTXA 3PA4A 2ZM1A 4JG7A 2WO6A 4FNXA 4I0RA 4A9UA 1LP4A 1ZMUA 4WKQA 4U9AA 4HW7A 2OGVA 2BFYA 4L53A 3VW6A 4CRLA 3OOGA 2PWLA 4XV3A 4RIWB 5DBXA 3IW4A 1IA8A 4I93A 3CKWA 3TKHA 3FKOA 4DFLA 5K9IA 2PUPA 3LW0A 4KIPA 5E1SA 5CU3A 4CFFA 4F64A 4ANMA 1WZYA 3I4BA 5ETCA 3E64A 5M55A 4CZYB 4DG0E 3PVBA 5A3XA 4TNDA 3DLSA 1W98A 4I6FA 2A1AB 4EOMA 3QCQA 3PYYA 1KV1A 3UGCA 2YDJA 5JQ8A 3NFFB 4GKHA 3LFAA 4QYYA 1ST4A 3QZHA 4Z9LA 3NW5A 4O0WA 5HBEA 1Q24A 2GFCA 2UZDA 4NM3A 3LM5A 3COKA 1WVYA 2YLFA 5EM5A 2IWIA 4EOKA 3I1AA 4QD6A 3LHJA 3EN7A 4RA5A 3EQPA 1BL7A 1BL6A 2O65A 1PMNA 5D10A 4PTEA 3ZM9A 2PVYA 4IWQA 5BPYA 4PUZA 3R9HA 3ZM4A 2ETMA 3HYHA 3CJFA 3UIUA 3FUPA 3QCSA 1JBPE 5IISA 4GW8A 4OAUC 3HLLA 2C6LA 5AV4A 2WMQA 3I7CA 3LJ0A 4XRLA 1H1SA 3O5AA 3MA6A 1ZOHA 2FSTX 4PY1A 3VUTA 4F1TA 3E92A 2C0TA 4WNOA 4QP7A 5H8BA 5E4HA 5C03A 2YABA 1FQ1B 1ZOEA 2XNNA 5EDQA 4BDIA 2C3LA 4I6QA 3LXKA 3NWWA 3MVJA 3VVHA 4FT3A 1RDQE 4WNKA 4A06A 2DYLA 3MESA 3K3JA 4YLJA 4ENYA 3NNXA 3T9TA 4FBXA 3DJ5A 2R3RA 4BR3A 2PMLX 3NS9A 5A4EA 4BCJA 4DHJA 2WMAA 1ZAOA 4ZY6A 4EH8A 4MD7E 4I20A 4RG0A 3WE4A 4HVSA 3EMGA 3HUBA 5TF9A 2I6LA 2YLEA 4L3PA 1IG1A 5CSVA 5IKWA 4I5PA 1FOTA 1K2PA 4XG4A 3PPKA 2XK8A 4IADA 4CFXA 3OWPA 4IX5A 4JXFA 4XYFA 2GTNA 3HV7A 2QOQA 2WTKB 4G5PA 3FSKA 4A4OA 3EWHA 3QCXA 3I60A 5AP2A 4FX3A 5M4UA 2HYYA 3RM7A 3GOKA 2VWUA 5JFSA 2RFSA 5CAUA 3QWKA 3HRBA 4D4RA 4EC9A 2JDOA 2REIA 3QYWA 3RMFA 3PP1A 4BKZA 4IFGA 3WYYA 4D2TA 2Y6OA 4UN0C 1E9HA 4B4LA 5CSHA 4FA2A 3WF8A 2V22A 4BCHA 3W2OA 5J9LA 4FGBA 4JRNA 5M4IA 3R2BA 4BKJA 1SNUA 1O9UA 2PSQA 1W2CA 2HZ0A 4J99A 4PDPA 1O6YA 3TT0A 4FZFB 3PG1A 5HO8A 1OL2A 3KN5A 4W4XA 1GIIA 1OIQA 3LFFA 4QMVA 4OT5A 2HZNA 5EW8A 2BAQA 3FQSA 3GFWA 3PP0A 3U51A 2WZJA 1BX6A 3BEAA 3QA8A 4ACCA 4C7TA 3R7VA 3P5JC 2XJ1A 4ZEGA 1OZ1A 5IQGA 4AP7A 4FSNA 3B2WA 4L46A 2R3NA 3DAJA 3BZ3A 3DFCB 3OCTA 4BDAA 2PK9A 4UX9A 4QP9A 2PMIA 3MH3A 3TM0A 5FXQA 5IQCA 4EOOA 5DYJA 1XH5A 4M69B 1V0PA 3Q9YA 4OTWA 4CFWA 3DZQA 2JGZA 1T45A 2HELA 3AMYA 5HKMA 5CZIA 5K5NA 2A2AA 4KNBA 5CF4A 3RCDA 3C5IA 1ZYSA 5A46A 5ANKA 3OMVA 2GCDA 2RF9A 3VBXA 4ZTRA 2O5KA 3ERKA 5GZ8A 2W9ZB 1Q4LA 5DR9A 2X0GA 4RPVA 3ZRKA 4CTBA 4ZTMA 4WNPA 4ZZMA 1JWHA 4JQ8A 4XG2A 5FBOA 3MFTA 3OBGA 3E3PA 4UZDA 5BUIA 3N4VA 4OTRA 4O4BB 4ZJJA 4KABA 4IX3A 4AGCA 4CYJA 1R0PA 3AMAA 2QU5A 2OFUA 3ORTA 5IH4A 3AGLA 3R30A 4L7FA 3R9DA 4K11A 1ZRZA 1Y91A 2YCQA 3Q2MA 5HTCA 5KMJA 4MXXA 4WD5A 2VO3A 4BBFA 4E6CA 4G6OA 4BCIA 3GCVA 3HRFA 3BLHA 5IA1A 4QYGA 5AWMA 2A27A 4RVLA 3BHVA 4MHAA 5ETAA 4AW0A 4C37A 4J1RA 3ZXZA 2BIYA 3FEGA 4PL3A 5L8JA 3BLRA 5IDNA 2C68A 2OXXA 2PE0A 3JVRA 4EYMA 2C6IA 4ZTSA 2WMVA 3AG9A 5EW3A 4D2RA 2WMRA 1YVJA 2WQBA 2X8IA 3NUUA 4ZZOA 4TPTA 3AD6A 4CFVA 1UWJA 4FTLA 1Y57A 3DBEA 5ANIA 5DRDA 4R7IA 1LUFA 2BRHA 3FZRA 3R28A 4GJ2A 5HD4A 3C7QA 3K3IA 5CNNA 3N9XA 3THBA 2J51A 2JIIA 3P4KA 3NCGA 4H1MA 4X2GA 4IVDA 5AAGA 1PY5A 1XO2B 1UU8A 1IA9A 4FUXA 2VTHA 4Y5HA 2YM4A 3HV3A 1GIHA 3V5WA 3UP7A 3H9OA 3RINA 4RVTA 3QALE 5HOAA 3FV8A 3I0QA 3OWLA 4TKSA 5TE0A 4DDGA 3ANRA 5HEZA 3CY3A 1W84A 3BU5A 3QFVA 5CU4A 4EC8A 3KULA 3CSVA 5M57A 2SRCA 5HIDA 2O63A 3NUPA 4DFNA 3QUEA 3AD5A 3VBYA 5KMOA 2QO7A 2W96B 1H27A 5M51A 3FC2A 2PVRA 4L6QA 5EDPA 4QMNA 1TFFA 4UMPA 3EIDA 4NM0A 5HVKA 3HMNA 4PL5A 4D9UA 3LM0A 4DEEA 3GXLA 4FYOA 5AEPA 3T9IA 4XBUA 4KWPA 2CSNA 1E1VA 2C6MA 3FZOA 3FY2A 4FTMA 3D7TB 3C4EA 4JS8A 5KZIA 2OIQA 3QQHA 3QXOA 2ZVAA 5TR6A 4IM3A 4IB0A 4J52A 5AV0A 4EKKA 2C3KA 5HG9A 4LV7A 3S2PA 4YPDA 4RT7A 2UZVA 5EM8A 3VBWA 5KX8A 1DI9A 2NRYA 4F7JA 3O50A 2Y4IC 3LE6A 4M68A 5DVRA 4BCOA 2CGVA 1G8SA 4GU9A 4PMSA 4AX8A 5FTGA 3OUKA 3U6IA 2X1NA 3OTUA 4E3CA 3LXLA 4J8NA 3FLSA 5E8VA 5HCZA 3P7CA 4FKPA 4TWNA 3Q04A 3WF9A 1ZYLA 3C5UA 2QO9A 4G16A 4IB3A 3NYOA 4MXCA 4Y46A 2VWYA 4ZAUA 3KVXA 4TRLA 5E90A 3NGAA 3O2MA 2YDKA 4B8LA 3TACA 5C27A 3SW4A 4O0VA 3M1SA 3TZ8A 5CF5A 3PXQA 3KREA 2OF4A 4XEYA 4F7LA 5JT2A 3FMMA 1TZDA 4XLIA 3KRRA 3AC2A 3UODA 4JX3A 4CD0A 5LOHA 1QMZA 4KIQA 3HV4A 4MD8E 1X8BA 4OTPA 4BTKA 4DT9A 3KVWA 4GUEA 2YCSA 3IONA 5K4JA 3G0EA 3TNQB 3VS6A 4FC0A 4EHZA 2OKRA 4JJRA 3PXKA 3QXPA 2CN8A 2YDIA 4YHFA 4RIWA 3TZ9A 5CSPA 3QD2B 4EK5A 5I9XA 3QLGA 4E5WA 3M42A 4BI0A 3CLYA 1H25A 4IAFA 3ROCA 4CYIA 5EFQA 3OTVA 3ATSA 4DEAA 2BVAA 4FRFA 4AN9A 5BVEA 5EQPA 4U6RA 1O6LA 2YN8A 3TJDA 3C1XA 5K3YA 4LFIA 2V7AA 3GVUA 2R3JA 3BGQA 1G3NA 3GB2A 3QTSA 4I21A 4MAOA 5D1JA 4JR7A 4H36A 2XEYA 4RJ8A 4BB4A 2PZPA 2XIZA 4C59A 3POOA 1YOLA 1FBNA 3BBWA 4KIKB 4X7QA 5AR8A 4QYHA 2BKZA 3O51A 2QU6A 4FV5A 4PNIA 5CXZA 4ZMEA 4RWIA 2UW9A 3CCNA 2J0LA 3PUPA 4MQ2A 4K33A 1AGWA 4CT2A 4O7TA 1Z57A 2H96A 2BIKB 1PW2A 2PVKA 5AUZA 4P5ZA 5HNGA 3EL7A 2XB7A 3Q3BA 4YJPA 4X21A 2BCJA 3D15A 4B7TA 4AW1A 4V05A 5H8EA 2EUFB 4XCUA 3V8SA 4AQKA 3TNHA 3NAXA 4RFMA 3ZCLA 1NVSA 2ZFYA 4M84A 3EQGA 3EHAA 3QL8A 4YO6A 5T68A 4G2FA 2C5VA 3RTPA 4BCPA 3VJNA 3OT8A 3BLAA 1OVEA 4U8ZA 5BYZA 3DU8A 4XV2A 4M13A 2I0VA 3E8CA 4D1SA 2DUVA 1FINA 1LPUA 2C0IA 4U41A 3IDPA 2GHGA 4D0WA 4NWMA 5KZ0A 4D1XA 2Y8OA 4GCJA 4WG5A 3ZZEA 5CF6A 5AUWA 3A61A 3O8UA 4F4PA 3W8LA 2J6MA 4FEQA 3Q4UA 4AW5A 3TG1A 5C1QB 3PRIA 4QP6A 3ORZA 3VUDA 2A19B 4O83A 5EYDA 4G6NA 3UE4A 2PMOX 4B8MA 2Y7JA 4IZ7A 3UDZA 4ANOA 3V5PA 1O6KA 3CR0A 4AE6A 4C34A 2ZV9A 3UOLA 2R3MA 3QYZA 2RFNA 4USEA 4QMPA 5A54A 4RFZA 2V62A 3RHKA 4U7ZA 2GDOA 4F09A 1OIUA 4E6QA 4OAVB 2WIHA 4E4MA 5HIEA 1VEBA 2XNEA 5CVHA 5EYCA 4W8DA 3VS5A 2JFMA 5BNJA 5DT3A 5J8IA 5I0BA 4O7YA 1BYGA 2Y6MA 1HCLA 2QOBA 1RE8A 3QLFA 4C4HA 3NEWA 5AX3A 4Z55A 5KHWA 2ONLC 3LFEA 4FV0A 4RJ3A 3ULIA 3ODZX 5BVDA 4H58A 3RBWA 5ANOA 4CQEA 3UC4A 4E93A 4WG4A 5A6OA 3P5KA 1UNHA 3GC9A 1UWHA 4NT4A 2ITNA 4IB1A 3U87A 4C4EA 2F57A 3MFRA 4X3FA 2DS1A 4CCBA 1KE9A 3ORKA 4L3JA 3OXTA 3KMWA 3KC3A 1M52A 4XP3A 4R7HA 4Y8DA 4ZTQA 5HVYA 3UJGA 5L2SA 2WTWA 5LQFA 2R3FA 4UWYA 2C5XA 2ITWA 2OJ9A 2PVNA 4D2SA 1P4OA 3ZH8A 3HDNA 4AZSA 3RM6A 3UMXA 1VYWA 3K5VA 3JPVA