4XP9H

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9H01
4XAWL 1DL7L 2GJ6D 1VACA 5CSGA 1FVCA 2A38A 2CPCA 2XWBA 1AHWB 4OLEA 4ONGH 1BEYH 4ONOA 1BF8A 2MPAL 3KR3L 5C70A 3C60C 3ARDB 4Z7WA 4BH8A 1JF1A 5IQ9B 3RVTD 2BMKB 5E99L 5DA4A 4M43H 1HYSC 5HHVH 2JIXA 5AUMB 5CD3A 2XN9B 3GJEA 1MSPA 3SO5A 3TIDA 4OCRL 4R2GB 4R4NC 5EU6A 4U7MA 2OMBA 4PJGB 1MAMH 3CXHJ 1A7NL 4PJFB 1MJ8L 1T04A 4MS8D 4QRUA 3E3QE 2BOCB 3OXRB 4OFYD 4A2LA 3TT1L 1BIHA 3BGAA 3RWGA 4KH2A 4LBEB 4Z7VB 2JTDA 1U8KB 4P23D 3PL6B 2NY3D 3BVNA 3JV4B 4X98B 3V7AG 3P4NB 3K2UH 3C5JA 1JZ6A 4GMTL 5IMMB 2BSRB 4R0LA 3I2CL 5LCVH 2EZ0C 1IQDB 1V7NH 5E5MB 1UB5B 4XB7A 3RVVD 3IJYB 3LD8C 1KXTB 4JFQA 3VGDA 2LAAA 1W2KT 2XACC 1LK3L 5TFSL 4WU5A 5JXAH 4NFBA 2OL3A 1CCZA 5H37H 3U9UB 3ZT6A 3ET9F 1ZLSL 4KPHH 5EC1A 1X4ZA 2XWJB 4PREA 5DRWB 5IQ9A 3QUYC 4GG6B 5ALBH 4M7LL 1IJ9A 1GGBL 3NCBB 4EN3C 4X9GA 4Z95H 2CSPA 3CUPB 4WI8A 5DMYA 1X9QA 3JWDC 4NHCH 1QBML 3RZCD 3BIAX 4OZHB 3SDAD 1HK6A 3U2SB 1EUTA 4P2RB 5SWZB 2EDWA 3D87B 5JHDE 2B1AL 4DKFH 2XG4A 3GSXB 4EDXB 1O7VA 5F1IB 1ZSDA 4ZPTA 4LBEA 2MCG1 4OZFB 3QFDB 3QRGL 4GQPH 2WP3O 3O2DA 4NO5A 3ULVE 2BHYA 2E9IA 4PY7A 3SE4A 4LLVA 1YEEL 4A2MA 1G9MH 1RZIB 1KEGH 3PGDB 5IMMA 4DKEL 4MNHB 5E5MA 3RU8H 3CZJA 2DYPD 1RULL 2NXYD 3VFWA 3IJYA 1FLRL 3PQYA 4NBZB 2VLRB 5FKPB 5L8KB 3KPTA 2VDLH 4UILL 3UJTL 4APQD 1HXMA 3GB7A 3U9UA 4TSBL 3G6DL 5DVNA 3VXTB 1K3IA 3H9SD 3WFCH 5T3XD 1JPST 4GG6A 4OV5B 3ELAT 3EO1A 2W9DH 3QUZA 3TA3C 1TCRA 3CUPA 4U1KB 3SKMB 1GHFL 2X4TA 4X5WB 4I3RL 5IHBA 4M93C 1I8MB 1Q0YL 3NCYS 3PHSA 1JL8A 4OGAD 1WWAX 1YEDB 4J3SA 1JPSH 4H25B 4HPOH 1BD2E 3SPVB 3CCHB 3PUCA 1XGUB 1MJUL 3H9HB 5MEND 1JPTL 4U1MA 2W59A 4OZFA 4NKIL 3QFDA 1RZ8A 1IAIL 4NUJA 1ZT1B 4AH2A 3EZJB 3VFMB 1I3RB 1I9JL 3L3IB 2QR0B 3F6LA 4PRIA 4TRPL 2BRRL 3D0VA 1C5DB 1RURH 4IRSD 4GG6F 4M6NL 3EFDH 1C7SA 4HUVB 2GY5A 3QDMA 1NEUA 1UWEH 3GSVB 2JK5B 5C0BA 2VLRA 3EAKA 1NJ9B 4GKZA 1C8PA 3NCEB 2AKRA 4FTVE 3P11H 3NFSH 1T1WB 4M61B 1S3KH 4QCIB 1B90A 4GKNA 5JW4Q 4QOKB 3VXTA 4S1QL 2XQYG 3K4DA 4FABL 3LQAC 4PV9B 4DW2L 1YEFL 3H8NA 3KYMA 3FN0H 3E6FA 3VWJD 3SGKA 2DDQL 1EX0A 2R4SL 5EIVA 4A6YH 2CO7B 1ZHNA 2HAZA 2XZQH 3OKOB 3T0WA 3ZDXF 4TVPL 3HZYA 3LEXA 4Z7QE 5TF1H 1I8MA 1R0AL 2J4WL 5FDWA 1LMKA 2F54D 1D6VL 5MI0C 4YHKL 5IVNA 2GSIB 2R23A 4RNRA 4OGZA 1H8SA 5JW5A 4JDTH 2FYYB 3CCHA 3SE3C 1XGUA 3H9HA 2C4FU 5I15H 1FJ1A 3THML 1MF2L 2ENSA 5EBWB 3HRZA 1ZA3B 4RMVA 4QT5B 3O6FB 1ZT1A 3GSNL 4EI5A 4Z8FL 2QR0A 4ORGA 2R1YB 4PB9L 2EKSB 3CXDL 1HQ4A 3QDJA 3MLZL 3QXWA 1JTOA 3LKPA 4HX1B 1MWAA 1B4RA 3T4YB 4HUVA 2FO1A 4DN3L 3PJSB 3RL1B 3FTGB 2ZSVB 3TVMB 1AGBB 1Z9OA 2DQIL 1T1WA 1DVFB 2VXSH 3BP7A 3OAYH 1L7IL 2YD7A 3MLSL 3GSNB 3DYPA 2WBJB 1G7LB 3D3VE 3KYKH 2Z0BA 2ESVB 3O4LA 4EOWL 4M7JH 2IAND 3HNTH 3P4OB 4MJ2A 4MLIA 3FFDA 1A6UL 4JFPA 3C5ZB 1P9MA 4NQVB 5C0AE 5BS0E 4OZGB 4CNIA 4OD3L 5H2BB 5I17B 1IKFH 2AK4E 5BQ7B 4JY4A 4JM4H 4BFIA 5IHZA 3NIGE 3GSRB 5C3LD 5C1MB 4WO4C 5L88H 1R3HB 4LVNB 4OCSH 4P5TD 3TPUB 4Q9BA 4BZ1H 2BCKB 2Y9RT 4LLAA 4L4VA 4QT5A 4HGWA 1QYGH 2J8UB 4IS6B 4GQ9H 4OLUH 4NM8L 3LEVL 4N0FB 2AJVL 1RUQL 4HMEA 5TDNA 2YPLA 4KKCD 5I19H 4DTGH 3WXVL 3SE8L 2EKSA 4EBQL 5J6HB 2EDOA 1OTSC 3B8SA 1G7QA 3MV9E 3VGAB 1AGCB 1IEAA 3T4YA 1HI6A 4PS4H 1MCHA 2RCSH 4K9EL 4F7PB 3DMMB 1XR8B 2CK2A 1YN7B 2K9UA 3DNKA 3BPNB 3GSNA 4GAFB 3W2DH 5LQBH 3IXAB 3KPRA 2OM5A 4HUXB 4Z7OF 2OR7A 1Q9OA 3DX7A 1QSFB 3P4OA 5L7XL 1OARL 1RU9H 3GIZL 3ULUL 4PRPB 3TCXA 2FH8A 3MRQB 3GRWL 5H2BA 3ARGD 4XX1G 2WZPD 1CDHA 5BQ7A 3DV4A 3OGCB 2R39A 3ILQC 3GSRA 4J3OC 1HXYA 1IILE 4CJ1A 1R3HA 4ZS7H 5DURD 3AY4C 3WE6A 1X4XA 4V2BA 1MRDH 2XZCL 1LP9E 1U2CA 3BN9C 5DLMH 4HS8H 1IC7H 4J4PD 3BWAB 5IB4A 1KB5L 4Y4HC 3ZSTA 2CLRB 3QCTH 5J6GB 4CJ0A 4O5LH 4PJBB 5TQ0H 3MLPA 1AGCA 3FZUD 3U0TB 3O9WC 1HHJB 3EYOB 1N4XL 4NQEA 3UZEA 1HH6B 4OLYH 3RX7A 5EZJB 4F7PA 4CRPA 3DMMA 5B4MD 3FQNB 3FMGH 4K3DH 2Z91B 4P3DB 6FABH 1LO0L 5F21B 3VXPB 3AS1A 3PV6B 1IGML 3IXAA 3RVXC 1NCWH 2GT9B 4HUXA 5JDSA 4WW2C 4D9RD 2I5YH 1XF5B 3OKMB 4NRYA 2Q8AH 4JO3L 4XNUH 1A6VL 3MRQA 2BHZA 1ZAGA 3CGTA 5GPRA 1EVTC 3VXME 4JKPH 2GTWB 4JM2A 3GBNH 3DGCR 4XP6L 3OR7B 3UPRA 5E9DD 4XVUC 4MNGB 4P2QE 5FK9B 4F80A 3MOAH 4RFNC 5L2KA 2ICCA 3JWDH 4NDMB 2R1WB 2XTJD 5EO0B 4HFWB 1BM3H 2DL9A 3F7YA 4OKVB 3Q6GL 5MEPB 3GM8A 1KTDA 1A21A 2XWTB 3NABL 5DQ9B 4AIZB 3EYOA 3MRJA 3HNSL 1R3IH 2E8ZA 4FQLH 4LU5H 2OSLA 1E28B 1EEZB 1MCRA 5HHOE 5IHUH 3PWPB 5KN5A 4RQQB 3P9WB 3S96A 1CVRA 1KG0A 2IG2L 3PV6A 4JM2F 3CFJA 3S6CA 1KB5A 3CC5A 3WLWD 3Q6FB 2CKNA 2UY6A 2AEQL 4MDJB 4K8RC 3OKMA 2Q87A 1LO5B 1WWBX 2IAMA 1XH3B 4LHJB 4PJ7A 5DD1H 1EJ6A 3ULUF 1AXSB 5JW3L 3C6LA 1NGWA 1YY8A 5DJ0B 5I1EH 2FBJL 4OSUL 4MCYB 4LCWE 2VJXA 2DQFB 3DGGB 4N68A 2G9HB 3BPCA 1H8NA 2ZNWA 3CDCA 5FB8A 1GPOH 3T2OA 3CU1A 3MBXH 2X89A 4HFWA 4L3EB 3NA4A 5I1AA 4NZDA 1YNLH 5AD0B 1K85A 3CK0L 3UTTD 5F96H 4RGNB 5DR5H 2XWTA 3MJ6A 4PP1C 1TZIA 8FABA 1NC4D 4MVBC 1JGDA 3IETA 1EEQA 5KAQG 4PJ7F 1O5DT 3W0WB 2AERT 2HFGH 2PYEE 3FAXA 4K7FA 1N0LA 4RQQA 3RPIB 4PY8I 1D9KC 1TQCB 2J88L 2DWEA 3Q6FA 1MCIA 1CFVL 2BDNL 4NQXB 4XPGL 4L1DA 2DBLL 3PQYD 4DVRL 9CGTA 4X6FA 1KCUH 3KPNA 1BOGA 4F7EB 3BESR 1U58B 4KI5E 1WBYB 4M5ZL 3JVGA 5E1AB 1F4XL 1I8IA 3LQAH 3QUMH 2E3VA 4YXLL 3T0EB 4Y2DA 5ID1A 4ZUSA 1FNGB 2DQFA 5ILTL 4M8VA 5J3HC 2QQLH 4ZSOA 3R8BB 1CT8B 4PTTA 3SQOL 1F42A 1MLCB 3HE6A 4L9LC 5F7KC 5T1KB 3UX9B 2IJ0C 3V8CA 3F7QA 5DMKA 2WUCH 1OP3K 3G5VA 3RY6C 4HJ0D 4KROB 2CXGA 4XC1H 2C3VA 3H3PL 2QSCH 2CRIA 4DCQB 5L2JA 2EXWD 4EVNB 4PRID 1I1AC 3RPIA 5CEYA 1WTGT 4I13B 2CD0A 5IM7A 2ADFH 2R0KL 4M48H 2LTQB 3OAZK 4ERSL 3QDMD 2CIKB 4L4TE 2BRQA 3ALPA 5C0BD 3OKLB 5L0QB 1ND0A 1TJGL 4N5EC 1CLCA 3L3GB 1S7SB 4FQ1H 3BPLB 3BSZL 4OFDA 2VQUA 1YEIL 1NGPH 2F58L 15C8H 5CJQH 3OKYA 4UT7L 4M6ML 4HAFA 1CQYA 4JFDD 1MQKH 3V4VH 1OQOA 4J23A 1MLCA 4GXVL 1DBAH 2QBWA 3REWB 1MUJB 5I74B 3S3SA 2X4PB 3BHBB 2OX5A 5I30L 1BAFH 5HSFA 3MRBB 3ZE0F 3VRIB 3H6JA 2VR5A 4U33A 5IB3A 2W65A 1EBAA 4EI5D 1R6VA 4HUMB 1A6PA 4LLMB 3I84A 1C5CH 1J0HA 1LO3H 1T6WA 1VERA 3QDJD 1FSKC 1YYMH 4TTDC 4KQ3L 4KZDL 1ZWIB 2R69H 5B8CB 4NN7C 1PG7H 4N0CD 4LHUD 3WMSA 3TBTA 3OKLA 4Z7UA 1Z5LA 4JVPA 3ZT5A 1NCCH 4WJ5A 1KFAH 3VGFA 5GGTL 1IFHL 4KQ4L 4G7YL 4NNXB 2X1XR 5E94B 4YWGH 4XCNA 3VI3F 3UP1A 2EE3A 4KKLD 4RFEA 2ILLA 2Y72A 4LSVH 1D5MB 3KYOB 4G8FB 3O4LD 1JF6A 4MB5A 1SYVB 2X4RB 4NPYA 1UM6L 2EH7L 4Q0XL 4WWKC 2GJ6B 3TWCL 4U1JB 3UROR 4HG4K 4XRCB 4DVBB 5CSBA 1DBKH 1MRFH 5GGVY 3UJJH 4M3KB 1JPFA 5KSBE 4LGSB 3VFOA 2ICWB 2CDFA 1XF4B 3P77A 3O2WL 1GGCL 4L4VD 2IPKB 2ORBH 2HN7A 4Z7UF 5IG7A 3OKNA 5E8NB 4CMHB 1AHWC 2VXVL 3PGFL 4YPJA 2YD6A 4LSTH 5T3XH 4YFLF 3ARDC 4F7MB 1FFQA 4H1LB 1Q72H 1CDGA 3MJ8B 5GZOD 3LKQB 4FFWD 1JK8A 1S78C 4X83A 2HLAA 4ACPA 4ZOAA 2DLHA 5DJ6A 4BUGA 3MOQA 2HP4A 2VH5L 1VPOH 3F58L 3EYSL 4IRJA 4JANB 3MLWL 4R2GC 3HAEG 4UIKH 4RMSA 5HGAB 5A2KH 5F7UA 4NO0A 3NZHH 3PWVB 5KANG 4X6CB 1E4JA 2NY3B 3VD3A 4NNXA 5E94A 5I1GL 1ERNA 3K4ZA 4KDTC 3HA0A 4CN6A 3KPRD 4HWBH 2CGRL 1F11A 4MXQC 5TDPA 1D5MA 3REVB 5C2BL 2IALA 2AEWA 2A0LC 4CVUA 4QHMA 3MRFB 1S5IH 4LMQE 5EIQA 3P0GB 1HKLL 3PL6C 1J8HE 2NY0B 4V1DE 1CI5A 4W4OC 1Z2KA 3EOAB 4AG4L 2WINB 2ZJSH 2R8SL 4I0PB 5E7FA 3FRPG 5HYQB 2NZIA 1YYLH 3PXHA 1C7TA 4LOUD 5D7LA 1I9RL 1XF4A 1CN4A 3GEWB 1DFBH 2L7JA 3DPBA 2H8PB 3K1KC 1H9VA 1SJEB 1MFDH 5E8NA 1NFIB 2F5BH 4GRMA 4UI2A 5TPWH 5DJZA 1KXQE 4XP9L 4ISVA 4KDVA 3U6RB 3MJ8A 3MUHL 4G6JL 3QXTA 3P9MB 4XMLL 3GHEH 1NCUA 4AENB 5IBTH 5ERWA 1LEIA 3OAUH 4W70A 4NQED 5IVOA 5IKCB 1N8ZA 3IB4A 5DO2D 1IM3B 3PWVA 5CMAB 3QQ3A 1KTRL 1RZ7L 1RHFA 4D9QD 4GMSL 4YFDB 4Q6IA 3WO4B 1MEXH 4XP4H 4Y16A 3EYFA 3REVA 2YKLL 1C16A 1GGTA 4K8RH 2ICWI 5ITFB 1FNFA 3MRFA 4J3XA 4X9FA 5B38G 2NXYB 4C59B 1C12B 3BZFB 3D9AH 5DK2A 4G80B 3VH8B 3EOAA 1QG3A 1KN4L 2WINA 2VUYA 4YDIL 1KC5L 1CGYA 3W9DB 4I0PA 3ECBB 2H32A 3TYGL 2CXKA 4JM2D 4HUKB 3DLQR 4UTAH 4Z0XB 1IGFH 4HEPG 1Q0XL 3U1SL 2JE8A 2QL1A 4G6AC 2X1PA 2GI7A 4R4BB 4RDQF 5HHMD 5CZVL 4KVNL 1A0QL 2PR4L 2G60H 1J0KA 4P5MA 3DURA 2R4RH 4R96B 4YEEA 4XCEA 1KTKE 2HFFB 3U6RA 3CU7A 3IXTA 1FBIH 3MRNB 4P0DA 1OB1A 3B2UD 1KCVL 1A6AB 4H5SA 2XA8H 3SCMC 1BVKB 4I2XE 2DOCA 2R2EA 4RIRB 2FEDC 4LCIH 5IKCA 4ZDHB 5DK3A 4Z5RB 5BZWB 5CMAA 3ZDZE 3UBXI 3ILPB 4LRNL 5EOQH 5GRYA 1Z3GL 4ODVL 4IRSB 4U7KA 2A6IB 4LNRB 2VLJE 4Z7WE 3DUUA 2CRMA 4M3JA 5BV7L 1W0VB 4JN1H 2IAMD 5KVEL 2OR9H 4QNPF 1P84J 3MV8A 4KY1L 1GIGH 4KK8D 1UH3A 3OSKA 1BFTA 3B6SA 1FZMB 3IDNB 4Z0XA 3RBSA 1U8NA 1K4DB 1LO2H 4NRXA 3LS5H 2YRZA 1IC1A 2P5EE 4QYOB 4R96A 4I18A 3CDGB 4XPBL 1VEPA 1U3HA 2X89D 5BV7B 1F3RB 2HFFA 5ICXB 3VFGL 5I73C 4Z76B 1EXUB 2F54B 5T3ZL 3EO0A 3MRNA 3VXSA 5LGKA 4FNLL 1BVKA 5JUEL 4I0CC 1TJHL 2Q8BL 2ZUSA 2W9LA 5JOFB 4ZDHA 2CUIA 1YC7A 5BZWA 1B2WH 1ZV5A 3ETBF 3N85L 4M1CC 1MJJA 5C0EB 2YS4A 3DTXA 3GKWL 1LDPH 3I02B 3QEUB 2C4XA 3CPLA 2IADB 4QF1B 3SDYH 5FO7B 1JNJA 3I9GL 3O6FC 4HBCH 3NA9L 3OKEA 1G0XA 3BKCH 3OG6B 4FQCH 4NQCA 4P4KD 4X4YB 3TT3L 5EUKB 2XN9E 1B4JH 1F13A 3MA9H 1BFVH 5EU4B 1JHKH 4JY6B 2HT3D 4PJGE 3IDNA 1T89A 4PJFE 4Y2DD 1T7ZA 4FFYL 1JP5A 2YEZB 3TVMC 3ARXA 5CILL 5C08A 4Y2OA 1DVFC 1NCAH 4OF7A 2XXCB 3K8MA 4HCRH 4Z7VE 2WBJC 3CDGA 4NRZB 3K8KA 5ICXA 1J05A 4Z76A 1EXUA 4FQHA 1U8MB 2A9NH 4M5YL 3KDMA 5T1MB 3TM6A 2P4AB 4YZFF 4OD1L 1CDBA 4FP8L 3C5ZC 4HMCA 1LE5A 2R56L 3KYNA 1W0WA 5M94B 2GKIA 5GIRA 5FHAH 4AIXA 4L9DA 3U7AA 1AY1H 2RJMA 1G9NL 2XKSA 1MHPL 1K5NA 1DQQB 4QF1A 4ODHH 3DECA 3BZDA 2NY7H 3TC9A 3T0AA 3IDMB 1N0XH 4H88L 5HY9B 5F1NB 4X4YA 4G6FD 3VD7A 1N6VA 3O3EB 4AZ8A 3NBNA 4ZO8A 4OZHE 4YQXH 4OIAA 1WBZB 5EU4A 4LSRL 4NP4L 3VGAC 3QI9A 3S5LG 4HGKC 3SKOB 1REIA 4G6ML 1DN0A 4P2RE 5SWZE 2YEZA 3PNWA 4G3YH 4MDIB 3O6LH 4WENB 3KJ4B 3IVKB 3VMOA 3FCTA 1ACZA 3LN5B 4Q9QL 1OCWL 1M7DB 5TE6H 3M8OL 4NKMB 3BPNC 3DBXB 1BPVA 5BVJB 1A6WL 2DTML 2A9ML 2NX5B 2M8XA 3GO1H 4NQDD 4ONFL 2EKJA 1A1NB 4P99A 4OLVL 3V5HB 3B9KB 4MJID 4XHJC 4Y5VA 5FO8A 4X7SL 2FJGB 2VLRE 1AD9A 4K9EC 1GL4B 1HZHH 4PJ5A 1O0VA 2F53B 5T33L 2ZPKL 4QHUB 5DD5H 5T1LB 4OI7A 4E5XA 4PLKC 1N5YH 5D2NA 4ZUTA 1TITA 3GHBL 5HY9A 1S9XB 3DROA 4G6KH 4XAWH 2UV3A 1DL7H 4JQVC 1SEQH 1U8JA 2AJ3B 1CE1L 1G0YR 4R90L 3O3EA 1FNEA 3KLHC 4KK6D 2MPAH 5C0NC 3KR3H 1MHCA 1X5KA 3SKOA 5EZLB 2Z93B 5E99H 3L7FB 4MDIA 4YHOL 4U1HA 4PYHA 3EJZC 4WFFE 1FZOB 2EDKA 4OCRH 5BW7C 1ZHLB 3DXAB 5D5MA 3SGJC 1DE4B 2AV7B 3HI1B 3QUKB 1VENA 5C0FB 1A7NH 4N9GB 3VGHA 1MJ8H 3VA6A 1UT9A 1A1NA 2W92A 4N8CL 2P46B 3TT1H 1UH4A 2VL5B 1D6EB 2DM3A 1IGTB 3KHQA 2W91A 2X05A 3RWEB 3TP4A 2G5RA 3SDXB 4K23L 4NFCA 1E0OB 3IAGC 4XBGB 4QOKE 5T1LA 4GMTH 2VO5A 3BXNA 4IRJD 4NO0D 1LK3H 4LDEB 3U30B 5D5MF 4NNYB 2DN7A 3OMZA 3FOMB 1G7HB 2BJML 5FGSA 2NY2B 4X0KA 3MGAA 4YXKL 3QIBD 4WRLA 4E41A 1JN6A 2Z93A 1HH9A 4OZFH 4NOBA 1QHPA 5GS0C 1X5AA 5D72H 3VFUB 4R3SB 1GGBH 3CD4A 4TUJA 2E7BA 1JZ2A 1F4HA 1FZOA 1ZHLA 1QBMH 3WIHL 1DE4A 1CICB 4L8DA 5C0FA 4TVPE 3TNNA 3D6GA 3RWHA 2H9GA 1MHHB 4N9GA 3LKNB 5ACZB 3DX9A 4ZYKB 8CGTA 3W5MA 3EYUH 1BZ9B 4HK0B 1S7UA 2B1AH 5ENWA 3W11C 4OI9A 1TTFA 1D6EA 5C6TL 2NY5L 2VQ1B 4B5EA 4LKCB 4HH9B 1OAZL 2C3HA 1U92B 3S37L 4IRZL 4ZQKB 3BJLA 4OUUA 4XBGA 4PYGA 4P57B 1QNZL 4NZTL 1LDSA 2HKHL 4DKEH 1WUNT 5INCB 3HS0B 3UTTB 1HWGB 5F8RC 5FOBA 1NBVL 1RULH 3MCKB 3NCCB 1NC4B 1CS6A 1FLRH 2ESVE 4BM7A 4HHAA 4HJJL 3UJTH 5SWQB 4HKXB 4LPYA 4OZGE 4TSBH 3G6DH 4UDTA 2LU4A 2X09A 5GSVA 1EHLL 1WICA 4RGNC 3ZZ1A 4XXDB 1TVBA 4EUPG 1IARB 1WTLA 3CLFL 1PKOA 4JCLA 2MCPL 1F90H 2YSSA 1I7ZB 1S9WB 2DLTA 1GHFH 4I3RH 1IAKA 1TQCC 5KAQF 2J8UE 3QEQB 1Q0YH 1CICA 3KXFA 3DSNA 4LCCB 1MAKA 5HYSB 5IK3B 1RMFH 4U4BA 3UXFA 1DEEA 1XFPA 5GQBA 2Q76A 1MJUH 1RUKL 1JPTH 2G5BA 2HJKA 4NKIH 2VQ1A 1IAIH 5D1XD 3D1MC 1I9JH 4TRPH 5ELIA 1HOCA 2BRRH 4P2OB 3EGSB 3T0EC 1RZKL 5FAAA 5TF0A 2W0KA 4M6NH 5DHYA 2KZWA 4LLQB 5D8JL 1QSFE 5ESVA 4HKXA 1MVUA 4PRPE 3D0LA 4XAKD 5TDOB 4S1QH 4FABH 5EO9B 1NMBL 3L3HB 1T21A 5SX5H 1MCEA 4KROC 5IB2A 3PDOA 4DW2H 1YEFH 1KCSL 4LDOB 2DDQH 4UMGA 1WIOA 3DARA 5IVZB 1YEKL 3OBAA 1CGWA 4GRLA 3IKCB 1S9WA 1PYWB 5I16B 4KK9C 3IGAB 1T5XB 5CGYC 3CFDA 4JFXA 4YHLL 2HYMA 4QWWC 1FVDA 1R0AH 2J4WH 1U93A 1D6VH 4ZUWB 4GLRI 4YHKH 4LCCA 3QFJD 5HYSA 4QHKJ 4PJBE 1RFDL 5L0QC 2R2HB 1S9KC 4F7CB 3THMH 1MF2H 4M7KL 4KTDL 4YK4B 4ODWB 3SEPA 3GSNH 4JFDB 4BSVB 3O6KL 4Z8FH 1IEBA 3WLBA 2XI9A 3GMOB 3FQUB 3UTZA 3E6HB 3CXDH 3GIVA 3VXSD 1MY5A 4HIIB 4JO1L 4U6HA 1HSAA 3MLZH 4LLQA 5AEAA 2HJLB 3GMPB 1P7KA 4QRSA 5HI5C 3PXJA 5CS7A 2BVOA 2F8XC 5HPOA 2ICEB 1KULA 2DQIH 3UTSA 5I74C 3RJDA 5TDOA 1U41A 3MLSH 3MRDB 1FC1A 1PY4A 3BYYA 1R3LA 2I07A 1X3DA 3OJDB 3MRMB 3IFOB 5JR1L 1DQJA 1PYWA 4LHUB 4MNGE 3QPQD 4JQIH 4NQCD 3K46A 3WNOA 3TBWB 2GFBB 1N2RA 2VXQL 2Q7NA 1SVCP 1WZLA 1DQDH 5D7JB 5B8CC 4F9LA 5MERA 4PRBB 7FABL 2R2HA 1IM9B 3L5WA 5C08D 2NXZD 3RDTA 5JXEC 1I8LC 4NM8H 1Q9KB 2AJVH 1RUQH 4HWZB 3MRIA 5KVMC 3PWPE 3SE8H 4EBQH 3QJFB 1S7RA 5E2VL 4HIIA 3IDJA 5EBGA 4JRXA 1I7RB 3AC0A 4N5UA 1E4XL 1P4BL 4NO2B 3S4SA 1FPTL 2WBWB 1P69B 4YX2H 4OIIL 4K9EH 1NFKA 3HAEA 1JNHA 1F58L 4C54A 5F7HA 1RPQA 3FN3A 2GJJA 3DUSA 1C1EL 1QBBA 3NMEA 4CMHC 1OARH 4PP2B 3EDJA 5K59F 3ULUH 3SGEH 1H0DB 1JZ8A 3MCG1 1JUFA 4JHAL 1DQTA 3GRWH 1BP3B 4L3EE 2GAZA 5D7JA 3QIWB 1I1FA 3QI9D 4PRBA 3FRPA 1IM9A 2XZCH 2IH3B 4RGNE 5JPMA 5E8PA 1A22B 1CXLA 4UINL 2NY3C 4M4RA 3W0WE 1KB5H 3AU1B 3MQIA 4ZUVB 2NZ9C 4LLDA 1U42A 2GCYA 4F57L 3WFDH 2GHWB 3I6LD 1ZS8A 2NY0C 4NO2A 1MCJA 3VXUD 1N4XH 3MODH 5ANME 5JOPE 3QQ9D 1CBVL 1VFBB 2HT4C 2YXMA 3BW9A 4TQEL 3ZYJA 2ZUUA 2BNRD 3BQUA 5D71L 5DJAB 2UWEB 1EA9C 4PJ5D 1LO0H 4G43B 1NCBH 3ZTNL 3NH7L 3T3PF 3G6AA 4YHPA 4OGXH 1G7MA 3PWLB 4I9WE 4PJXA 3LHPH 4YBQD 4QXTA 3T0EE 1PFCA 2V5MA 4PP2A 1U8QA 4LSPH 4LEOB 5EFIA 4Y8DC 4JO3H 3ZHKA 3SDAC 3AREB 1A6VH 2EDXA 5DGQA 1PSKH 4S10A 4PRHB 3MA7A 5F8QC 1CFSB 3WL9B 1F4YH 3BH9A 1NAML 3QIWA 3OL2A 1G7IB 4OD2A 4R7NB 4XP6H 1MI5A 4YLQT 3G6JB 3F7VA 3TZVA 4OF0A 1UEMA 3PWUA 3VE0B 1J1XL 3FRUA 3QULA 3KS0J 2KL6A 5DJCA 3L7EB 5DC0A 1M6OA 3WO4C 5DS8A 5EBLA 4GAGL 2X4QA 2F9BT 2Z92A 4Y4FA 3BEVB 4PJXF 3CDYA 2NXYC 1NAMB 3NABH 2AJZB 4JREC 4G8GB 3ARSA 4APQC 3HNSH 5HYEA 1E4XI 5K9KB 1AGEB 5D7IB 2A74B 1CXKA 1H3XA 1XGYL 2JJTC 1UACL 3CJJA 1TNMA 2IG2H 3GKZA 4XP1L 4V2CB 2KZ1B 1ZVSB 3O41B 1JGVL 4QXUL 4MZ2A 1I9EA 4XGZB 5JW3H 4OQTA 5BOPA 5I8KL 5F70A 2FBJH 4OSUH 3VRLF 3LZFL 1G7IA 4E41D 4R7NA 4XXCC 4Z7NF 3STBA 4Y0GA 4U1SB 3PF2A 5ISZB 2VABA 4ZO7A 4LARL 4LDLB 1RZJL 4EIZC 5BRZA 1DLHB 3LRSA 3VXRA 5KSUA 1T2XA 4XVTL 2WIMA 5HHNB 2X1OA 4IRSC 5A40E 1UH2A 2C5DC 3CK0H 4Y5XB 4XNMB 3O45B 1U36A 1RSFA 1KIPB 2CQVA 4OLXL 5K9KA 1AGEA 4PD4K 4KMQA 3C8DA 4G8IA 2ZWLT 5EOCL 4GRWB 2VZOA 3V0WH 1KB9J 5HYJA 2J88H 1VFAA 4F15B 3QNYB 1AJ7L 1CFVH 4UAOB 2Z8RA 1ZVSA 3E8UL 4PLJC 3WJJA 5GGRA 2DBLH 1Q8MA 4DVRH 5BV7C 3VFPB 2X4OB 3X12A 4WW1B 1NMCB 2IGFL 3ARPA 2QQNL 3T77A 3ARZA 1YN6B 3TYFB 3LN4A 3MRKA 4M5ZH 2GJ6E 5JLZB 1F4XH 3RL2A 2A6DB 4YXLH 1LD9A 5AWNL 5SX4H 3FO0L 4OCYH 5ICZB 3HZMA 4K7PY 3WUWB 3GMRB 1YPZB 1TJIL 1Q94A 1D5XA 4IM8A 3L5JA 4P4KB 3SQOH 3P0YL 3A67L 3I75A 4MA1C 3ZTJG 2PW1B 1IBGH 4NCC1 2AGJL 1GRWA 1NSNL 3H3PH 3O45A 4PUBL 4CL7A 1KT2A 3ARFB 1OHQA 3DVGB 2BVPA 4X6CE 4IOIA 4MWFB 2VN7A 2UUDH 5KG9B 4N8VB 1P7QB 5C0DA 5J4MA 3S8WA 2BVTA 4WW1A 4L5FL 1AIFA 1TJGH 2PXYD 1KTLB 1T2JA 3BSZH 3I3BA 3RIAK 3NIFF 3B9EA 2F58H 5EU5B 3QJHA 4UT7H 4M6MH 1XGRB 2VUOA 4IHOB 2XKNA 4GRLD 1YPZA 3IDYB 3VFTB 4U49A 2VKWA 3I50L 1NBQA 5H35B 2X4SA 4GXVH 3MFFB 4H20L 4I77H 4MD5B 2IQAB 5KSAB 1SEBA 5IGXL 1IZKA 4RCAA 2ED8A 5C92A 5CGMA 1Y6KR 4NZJA 5I30H 3TCLB 5KVDL 3VFSA 1WT5C 1FG2B 3FB6A 2Y36L 4WI7A 1UENA 1U91B 2VITB 4ZAKA 1EDQA 4F9PA 4MWFA 3GMLB 4LCUB 1MCPL 4NQDB 4KQ3H 4YGAB 4BQ9A 4KZDH 5KG9A 3BRFA 2NTFB 1V8HA 4IMLB 4N8VA 5LGJB 1QSZA 3V5KB 1QRNB 5TH2B 3RWIB 5ESQB 3ARGC 1A2YB 3U0WL 3KNBB 3KPSD 5KSVB 1YQ2A 1RZGA 5GGSY 1QO3B 4U6YB 4N90D 5GGTH 4KQ4H 5LWYL 1E6OL 4WU7A 5E08L 3B9KC 3LH2L 2PO6B 1FE8L 1XGRA 3JUYA 4J4PC 1TZHB 1QFOA 5I6XB 1UM6H 1OW0A 2EH7H 4C55A 4Q0XH 4H1LH 1YDPA 2E7MA 4PJ8D 5TE7L 2X1QA 1ZXQA 2H3NB 4NZUL 1IZJA 3FZUC 4MXVF 1UM5L 2AJXL 4ORZC 3CFBA 2YWZA 3O2WH 2DWDB 4YFEA 1EHXA 3FT3B 1FG2A 1GGCH 3EDKA 4U1LB 3AROA 3HCVB 1NLDL 2V6HA 2VXVH 3PGFH 5I1CL 4BJLA 3AUVA 5I9QB 3I3EA 1UB6A 2FZ3B 1GZPB 3WKNA 4LCUA 3T3ME 4OZIB 1IE5A 4JRXD 2E7CA 2FHCA 2VH5H 4E42B 3EYSH 2HFEA 1QRNA 4ETYA 3RWIA 3HR5B 3FFCB 1KELH 3G04A 3P3YA 2X44D 3FB5A 4OCLC 2EYSB 3WFHA 5JW4N 1AR1D 2IH1A 5I1GH 3JXAA 3KPMB 2PO6A 5C2BH 3FB7B 1B0GA 4F7TB 1TZHA 2X4NB 1HKLH 1T0PB 2R0WL 2DBJA 1VFOA 4AG4H 2R8SH 3N06B 3UEZA 4BZYA 2DQTL 3EIFA 2H3NA 4FQIL 4ETQB 2F54E 2PUQT 3QIBB 4FQQB 3C09B 1VADB 2MQCA 2V2WA 1U0QA 4O2CA 2CJUL 3GBLA 4KHTH 3TH3T 1A02N 3ZYOA 5MP6L 5DEZA 1AE6H 2NY2C 2D9CA 4XP9H 4PFEA 3E0GA 1VFUA 2C1PB 2M1KA 4JJHA 1MOEA 2I60L 4G6JH 1GOHA 4XMLH 4TOYL 2V2TA 4U31A 5DRNA 4E42A 1VSCA 1X5GA 5T3ZE 4UNVA 1U9KA 1X7QA 4L8CB 2MJWA 3LQZA 4J6RL 4GG8B 1RZ7H 2EYSA 5DA0B 5SWSA 5A2LH 1ORQB 1H3TA 4GMSH 3KPMA 4NWUH 2ADGA 1HEZA 1S9VA 2YKLH 4O00A 5FXCH 3BIKB 4EUPA 2APWA 5JIKA 5AG9A 4HF5L 3C2SA 2XFXB 2AW2A 1FIGL 1KN4H 3AXLA 4YDIH 3BP6A 5HDBF 1XF2B 3HKFA 3W9EB 1RIVL 4UUJA 3TYGH 3JBG7 4ETQA 4FQQA 4U6XB 1MI5D 1Q0XH 4XBPB 3U1SH 4S11A 3V2AR 2BSTB 3DRQB 3QO0B 5CZVH 4KVNH 1QSED 1A0QH 2NY5C 2PR4H 3LB6D 2Q86A 2ATKA 3VD9A 4PGDA 2J8OA 1JRHL 2B1HL 35C8L 3O3DA 5MHSD 1FYTB 2QKIB 3C87A 1K8DB 2N1KA 4FMFA 4KXZH 5IJKC 4Y4FD 4NCDA 1KBGH 3EOBB 3IJHB 5DK0A 1NEZB 5INDB 5FYLD 1BREA 3S36H 4GG8A 5D1XB 3VFRB 1OTUC 3LV3A 3QDGD 4LRNH 3TO4A 4GT7A 3U46B 1E6JH 1Z3GH 5DZLA 1KGCE 1RUPL 5EC2B 1D5IL 4OLWL 4JE4B 3RWDB 1QVOB 5I1DA 3X3GL 1OAUL 1CF8L 3MRRB 5BV7H 3T2PA 1KJ2A 5E6IB 5FM4A 4MA8L 5KVEH 4HKBB 4D0CB 1D5ZB 4P2OC 3T1FA 1XF2A 4KY1H 3W9EA 3O81A 4MB3A 3CVHL 3NACL 4HJ0C 1XZ0B 4BFGA 5L8LB 3S88L 1JNNL 2NX5E 4XBPA 1XGTB 4LSSL 4CAGA 3C2AL 3QO0A 3DWTA 2RB8A 3LQMA 5BRZD 1Y0LA 2D31B 2EXWC 3OHXB 4FQJL 4JFEA 3UTOA 2HTLD 4PGBB 3VXRD 4XPBH 5H94B 3T0XA 1WZKA 3VFGH 3FB8A 3D2UB 5T3ZH 2F53E 5HVWA 1RZKC 5CJXA 3CIQA 1GC1L 5ACMA 3CVHB 3QFJB 2R0LH 4FNLH 4QRPB 3MX0A 3EOBA 2EDEA 4HQQL 2DD8L 1TJHH 3RA7L 1NEZA 2Q8BH 1S8DA 1J0YA 5I76B 1Q9WA 4D8PB 2CKBL 4KUCF 5IJVA 3SDDD 1OPGL 1LE9B 2VERN 3GKWH 2VLKD 2HVJA 4K3HA 4NHUB 1X6LA 1J12A 5EC2A 2VLLA 4L8BB 3Q5TA 4YK4C 5EWIL 3I9GH 3TH4T 5E6IA 4HKBA 3RWCB 4GW5B 3TT3H 3OQ3B 1JVKA 3DXAE 2CKBB 1EO5A 5F88B 4FQPA 3C6SA 1MHEB 4FFYH 1PJ9A 1BVZA 5CILH 2G2RA 2FO4A 1F6AA 3RVWD 3OHXA 3TO2B 3I6KA 3SKNA 4KU1A 5H94A 3FT2A 2QSQA 1Z0MA 3IFPB 2ID5A 1EFXB 3SDXE 5JNYB 4ZTPH 5C6PB 4M5YH 4UQ3A 1JRHI 3CVHA 4N0CC 2B5IB 4OD1H 3HC0A 3LSOA 5JMOC 4FP8H 5C0IB 5DEFB 5IEHB 2RAMA 2R56H 2UYLB 3H42L 1XIWD 2A77L 2BC4B 1PLGL 3OZ9L 3VGGA 5FA4A 4X4ME 2HH0L 3JTTA 1G9NH 3I6GB 1X5ZA 4KKLC 3PWJA 4NHUA 1NDMB 1SYSB 1MHPH 1OSPL 4L8BA 4O2EB 4X6DB 1FFNB 2VDML 1BFOA 4HT1L 4H88H 4LLYB 1DANT 4X9IA 3GZKA 3ZKND 1D3CA 4PJ9B 3VFNA 5E1HB 5DRZB 4NP4H 5E4EB 4Q9CA 2D7QA 4G6MH 3CLEL 3UTPE 4I5BA 3ULVL 4Q9QH 1T0NA 1OCWH 4ODXB 3PP4L 4QRRD 3VJ6B 3M8OH 4KTYA 1G6RL 1WIUA 2ATPB 5GGVH 5HI3D 5GGSB 1A6WH 2F15A 3WV0A 5GZOC 4FFWC 2I9TB 4ONFH 32C2B 2YMXL 4XP5L 4DGIL 2OQJA 5F3HA 4OLVH 1HYRC 5IEHA 5SV3A 3UTTE 1F3JB 3Q0HA 4DEPB 2JLLA 4BQ8A 2CLVB 1ADQA 2BC4A 4XB8A 3DRTA 4ENEC 4O4YL 1QR1B 1J0IA 1Z9LA 5DSCA 5GXBB 3DIFB 1NKRA 1T1XA 2P8PA 3W82A 1G6RB 3GBML 1SYSA 4EXKA 4MAYD 5C09B 2BY3A 5I8EB 5CLWA 2D3VA 1N59A 3BOVA 1XF3A 4R8WL 2HVKA 3HPJB 4ZFFA 5D6DA 1CD0A 3LKRB 4GSDL 4R90H 5AYUL 2BNRB 3O3UN 3QEQE 4YE4L 3HI6H 3ULSB 5HVFB 2V17H 4WWID 4IEFB 3BGMB 3IDGB 4NYLA 4YHOH 1UCBH 4NZRL 1HHKB 1XCTA 4ODXA 2EEBA 1KPRB 3VXNB 5EA0H 3CFIC 3V6OC 5HGDB 5DUPL 1FNLA 1IC5L 5FYKU 3U83A 2I9TA 5DHVA 2X42A 3TBYB 4N8CH 4DUVA 5JHDA 2HMIC 4YHIA 3TF7C 4HKJA 3AREC 5D1ZD 2XNAA 1XR9B 3TNMB 4UDUB 1QR1A 1K6QL 3QO1A 4K23H 3IFLL 2ADJB 4Y19D 5KW9L 5DJ8A 1B6UA 5IFAL 1URLA 1UXWB 3ES6A 3DO3A 3LKRA 1I85A 1B9ZA 3HE7D 2ZG2A 4BK5A 1CD1A 3VD5A 1QLFB 2BJMH 5EIIA 4YXKH 3KPQA 2EEDA 3BGMA 4HS3B 3STZA 4M8QB 4KKAC 4S1SL 1HHKA 1PZUB 1K2DB 3MGTA 3ULVF 3TLRA 4GLRH 3TGXA 1MRCL 3WO3B 3WIHH 4JPVL 4JFDE 2A83B 4IOSD 1J0JA 1KACB 2IBGA 3HZKB 4AT6A 1JZ5A 1R5IA 4HC1L 4OZ4B 3L5HA 1BD2A 4FA8A 4JZJA 1K8IA 1QLEL 2P5WB 2V7NA 5C6TH 4D9LH 5K9JL 1JWSB 2CH8A 3C60B 4XCCL 3H2WA 3MMEA 5HTSA 5A2FA 3S37H 4IRZH 4KJWC 4GBXA 4JLRA 1QD0A 2MOVA 1QNZH 1DDHA 2K7QA 4NZTH 2HKHH 5C0CB 1BLNB 4TUOB 1NBVH 1MIEL 5IT2L 1FGVL 4GW4B 5JW4M 1S7XA 3HUJB 4HIJA 3NZ8B 4HJJH 2BSSA 4KK8C 3VMNA 2OP4L 3MNWB 4YPGB 1R5VA 2R1XA 4JDVA 4QY8B 1H5BA 5SWSD 5FOJA 3H0TB 3L95A 4Y5XC 3D69B 4I48A 3STLB 5DQDL 3ZLQC 3CLFH 3TV3L 2UY7A 1B0WA 4OGYL 4X7TB 3R0MA 3T65B 1JCKA 4JVWA 4M6OL 3K0WA 4YAQB 1K2DA 1CXIA 1RZJC 1J1PL 4WEUD 4JFOA 1H15B 4P5KA 5BS0B 2H45A 4F15C 2EDHA 3HZKA 4MSWB 2XY2A 4NO3B 4UAOC 5BZDB 2I27N 2JJVA 4OZ4A 1LK2A 1CFQA 3OGOE 2GUOB 1CFTB 1JWSA 1FNAA 3ROLA 3C60A 2GSGA 5IV2A 4LF3B 4LLWB 1AO7B 4HJGA 2FR4B 4ESKA 5E8EA 5DZOA 4WFHE 3U36B 2OZ4L 1LEGA 5LG1A 1WC7A 5F9JA 5D8JH 4P4KC 4O51B 3BFOA 4HC1A 5C0GA 5IBLD 3IFNL 3IF1B 4Z7QF 1A9BA 4QY8A 2FL5B 3MNZB 4MNQB 5I75B 3TO4D 2HT3C 3H0TA 1NMBH 1QLRB 3FO1A 3D3VA 4Y2DC 1A14L 3F5WA 5KTEL 2EIBA 4RMTA 3RGVB 4X7TA 3FN9A 4MX7A 2D0HA 1YEKH 2JB6B 3ARFC 2FBOJ 2RGSA 4YHLH 1H15A 4KUCD 5C0AA 5BS0A 1FL5A 2PXYB 5CLTA 1EH9A 2VDOL 4MSWA 2M2DA 5D1QD 1RFDH 3V5DB 4C4KO 2GUOA 3DUHA 4KTDH 4M7KH 3CSYA 3ROOB 2PKDA 4JFED 3QUYA 1KJVB 4ZG1A 3O6KH 5HHQB 3PHOA 3QDAA 3V79C 1BQHB 5C8JA 2BY0A 3TA3B 2ICES 4EN3A 2UWEE 5DMGC 3JSSA 5GHWH 3V6OE 4JO1H 3IDYC 3MV9A 4E9LA 3V4UL 3LKOA 5KSAC 4XZUB 4N0UB 2FL5A 4JPWL 2A6JB 3UYRL 4PRHE 3NIGF 4KV5E 1DTUA 4XTRD 3WIFA 5CBEB 1TCMA 4XWOD 2H1PL 2JB6A 2I9LA 2YWYA 1JHLL 2AXGA 3G6JE 3OXSB 4PPTA 5GGUA 1UVQB 5CIPA 4DKAA 4RBPH 5FM5O 3WFZA 2VXQH 4FG6D 4NSKB 4POZD 1NAKL 4P3CL 4PR5B 4KTEL 5J0BA 1AI1L 4Y4KB 2FIRT 1F5WA 3V5DA 7FABH 4HIHB 3DX6A 1E4KC 2YD2A 4HULB 1XGQA 4OZFG 3ROOA 4G8GE 4YR6A 5GZND 5IR1A 1NGYB 1TDQA 5D7IE 3TA3A 1EHNA 1BIIB 5E2VH 4HFUL 5JIIA 5IW3A 4UT6L 2CK0L 3O8XD 3RI5K 5I6XC 1P4BH 3RKDC 2WLYA 2KH2B 3BYTA 5IROC 1MCBA 4OIIH 4YO0B 4N0UA 4YBHA 3QUXD 4KK6C 2BVUA 5KVFL 2NW2A 4P4RB 3TBVB 2VC2L 1F58H 3SKJH 5IQ7L 5A43C 3AAZB 1C1EH 1LP9F 1OD7A 2EDBA 4RAHA 3U4AA 5IFJA 5I9QC 2LABA 5ISZE 3OKDB 1J86A 3U79A 2QQKL 3VXOB 1TFHA 2CR6A 2ZSWA 3ISWA 4ONHB 3SE9L 1P2CB 4NSKA 3CFCL 3VXMA 2NLJA 3LKSA 1EGJL 3BZEA 3D5OF 3QUMA 4UINH 1X5FA 4P2QA 4G8EB 4ELME 2FRGP 5D2LB 5E8OA 2PCPB 1K3ZA 1NGYA 4CVZB 1BBDL 4I4WB 2VDRL 2V9TA 3RP1A 4KMTL 3QIUB 1RHHA 4GRWE 3FQTB 4F57H 4WHTA 3MREA 4JAMA 1MCOL 5E8DL 2AK1L 3UDWC 5DVLA 4WUKL 3M07A 1B88A 1X5LA 1N64L 3OR6B 2FH6A 1SM3L 1KNOB 2VRAA 1J8KA 4TQEH 2JB5L 1WZMA 3SE3A 2VN4A 5D71H 5HHOA 3QIBC 1OAQL 3C09C 1CIUA 2N56A 4M7ZB 3TBVA 3ZTNH 3NH7H 4X7CC 5KZCD 3EDDA 3K7UA 1ORSB 3IKKA 1DZBA 1RK1A 1MIML 5JORB 1FFPB 4XH2A 2WWKO 1AFVL 2OJEB 1YPZE 4ONHA 1MJ7L 3GSWA 3GSQB 1NAMH 1LNUB 2A6KB 3ZDYE 1NANI 4NN6C 1WCBA 3F12B 3VXQA 1JGUH 4LCWA 1PG7X 5HGBB 4KKBC 2DQCH 1AGDB 1ZA6B 5B22A 5E2WH 1T3FA 1LVEA 2PCPA 3X3FL 1A9EB 1M7IB 1CYGA 4RWYL 3QNXA 5B38B 3FQWB 2QADB 2P8LA 4GAGH 4BUHA 2QSTA 5JHDD 1IGYA 1FN4B 2OBGA 3D18A 5BJTB 2LE9A 4WO4A 1A1OB 1QSEB 1OY3B 1S9YB 4PJDB 2VZTA 2PYEA 3IRZA 1T5WB 3FO2B 2VXUL 43C9A 4Q6IC 1XGYH 4WUUB 2DLFL 1I7TA 4CADB 2BNUA 2XG5A 3PHQA 5KANI 1BBJB 3QG7L 5CGTA 2RR3A 3FONA 5CJ5A 4XP1H 4OI8A 3C9NB 4BZ2L 1MLBB 3H7BA 3HC3H 3S35L 2DQDL 2ZP0T 3X11B 1FFPA 4UBDC 4Q9RL 5ETUB 2OJEA 5GRVK 1UG9A 3WBDA 2YRPA 1N6QL 5GRJL 4XPFL 3O9WB 1RK0A 3IJSA 5I8KH 2GITB 3QDGB 5FKAA 5J57B 2A6KA 4KK5D 1UZ6E 4N1EA 1N3NB 3LZFH 1L4IA 2ITDB 1WITA 1LO4H 4HS6B 5HGBA 1HHGB 3MUGA 3MLUL 2B4CH 1KPUB 4LARH 5D1XC 3QQ4B 4GRWH 2X4UB 3QG6A 1LGVA 1M7IA 2EE9A 3GI9L 4FXGA 4XVTH 3T1WA 5F7DA 5LAXB 4ZPVA 2W60A 4M1GL 4QO1A 3BEWA 3RTQD 4NQDE 4DOHB 3EOTL 2DL2A 4WFEE 4UOW0 1SMAA 2AXFB 3T8XB 2X1WL 2PTTA 4OLXH 3AY4A 1QRNE 4BQ6A 1NC2B 3L1OL 3MRCA 4KI5F 5EOCH 5IEKB 4GBXD 1JGEA 4MD0B 1YJDL 5E6YA 3T2NL 3SDCB 1AJ7H 4JB9H 2F74B 4Y4HA 2D2OA 3DV6A 4Q74A 5J12B 1HHIB 4L4TA 3CVIL 1R5WA 2IGFH 4MQ7B 5IW1B 4FTVD 4NWTL 3O9WA 3HG1D 1PQZB 5C2UB 3UC0L 1N3NA 2VLKB 3BKJL 4QRQA 2EEAA 4P9ML 3GJFB 3GNML 1EZVX 1HHGA 1H3WM 1P4LA 3B9AA 3CFEA 2JJSC 1TJIH 1ZT7A 2X4UA 3H7LA 3OPZL 1UM4L 3C8KA 4FHBD 4HWBA 4JRWA 4WW2A 3P0YH 4KDWA 2CMRL 5DMIL 5GS1B 4ZD3L 3A67H 1CXEA 3GGWB 1N7ML 3RX5A 5HD8C 5T5FL 1EIBA 1PDKA 4G7VH 1FL3A 1GC1C 4J8RB 4XT1C 2AGJH 4OZIE 1TLKA 1NSNH 3DSFL 2AXFA 4PUBH 2BVQB 1PZ5B 1T1YB 5E00A 2VDPH 2D0FA 2YD8A 1CG9B 5I1JL 1HKFA 3FFCE 4OV6F 3F62A 3MYJB 4MD0A 4MLSA 2FLRT 2AQ1A 1WSST 2NW3A 1HIML 3V7AE 4L5FH 1YEGL 2VISA 4WW2F 4XPTL 5DJXA 1PQZA 1OLZA 4PLOB 1WBXB 2WV3A 5HPMB 2B5IC 4LLUB 1Z9SA 2SEBB 2AP2A 3D3VD 5CEZL 3MGOB 5C9JB 1PY9A 3MCLH 3WNMA 2EZ0D 1G7JB 4LSUL 4V1DB 1JNLL 2APFA 5FYJL 4W6YB 5C0AD 4H20H 4PTUB 3MRPB 3U48A 5IGXH 4AIOA 2AK4D 3PWNA 4QHNB 2V9QA 5FCUL 4J8RA 4JKMA 3RQ3A 43CAB 4HIXL 5KSBA 4WHDA 3EKCA 1HINL 5KVDH 1SJHB 4PJ9C 2H6PB 3WEXA 4KAQL 2L4OA 2BVQA 3MRLA 2W9EL 3QUYD 3SGDI 1WVZA 1T1YA 2Y36H 4QRRB 1PKQB 1RY7B 2FHFA 4LGRB 1KN2L 2ARJQ 3HMXL 3ALWA 4EN3D 2FGWL 3SJVB 1ED3B 4S1DC 4O2FB 2D7PA 2EE6A 2BK8A 4MMXC 4L9LB 4KI1A 2EH8L 5DJYB 5F6HI 2R0ZH 1ZGLM 3EYQC 4CMMB 3U0WH 4K94L 2BXYA 1OP9A 1BWMA 1WBXA 1KPVB 5F3BB 1EEUA 1VCAA 1E6OH 5F7EL 5E08H 1WISA 3LH2H 2AQ2A 5KSBF 3CH8A 4MAYB 1FE8H 1MFCL 2BX5A 1KLUA 1D9KA 4URTB 1DBBL 5FGRA 5DJDB 1RAMA 1G7JA 1J8HA 4V1DA 5LKNA 1CVSC 4H8WL 4PTUA 3MRPA 5TE7H 1Y18A 1QRKA 3MC0A 4ZO6A 5HBBA 4NZUH 4Y1AB 3UCRA 1FYTE 3OV6A 4NM4H 3L3JA 4YUEL 2AJXH 3QXAA 3L5XL 1FL6B 1I8KB 1FVEA 3BO8B 1OAKL 1X5HA 1NLDH 1PKQA 2B39A 1YY9C 5F7YC 3B2VH 3VFVB 3JV6A 1FDLL 3KPPB 1KYOJ 1ACYL 4JHZA 4N0YH 4YBQC 3LCYA 3IDUA 3QHFL 4AEHL 5IMOA 1OSZA 1QQDA 4PGCB 4L9LA 1S7WA 2EDLA 4LPTA 4GKSA 2ZOLA 1OAXL 4RMRA 3RY6A 4PV8B 5I8OL 3GFUA 2IWGA 1U8PA 3WIIL 4TNVK 3FO9B 4XAKE 1MCDA 3D39D 3X17A 3C5SA 3OF6A 5C7XL 3HMXA 1QSVA 1P1ZA 4FFVD 1I1AA 1NPUA 2EYTB 4EI6B 1RUAL 3AGVA 2R0WH 5IMLB 2V7HB 4NN7B 2VDNL 3HE7B 2DQTH 2YC1B 2XPGA 3IU4L 4FQIH 3VXMD 2FJFA 3ARBB 3PDDA 3DVIA 4LP5A 2VIRB 3G5ZB 3QFJE 4GO6B 4QRPE 4FQXB 4ZXBB 5C71A 1FZJA 2RQ8A 4S0SD 5MP6H 1U8OA 2HRPH 1U8LA 4X6EB 4NJ9L 2X41A 5J13B 3KPPA 4Q2ZA 1OP3H 3OX8A 4JZOA 2P7TB 4HCRA 2I60H 1IGJB 4WWKB 4PGCA 4TOYH 2NNAB 5CINL 2F8VA 4I2XA 1A7QL 4C83B 3TEUA 2D7TL 4YH6A 1GOFA 4MQSB 4U0QB 4HZLB 4DZBA 1FC2D 4J6RH 5HHOD 5J8OA 4NGHH 4RRPA 1U95B 3P73A 5EOTB 3OAZH 1FO0L 2VLJA 3P30L 5ICYB 3KVQA 4HF5H 5E56A 1MFAL 3CAFA 4HWNA 2EIZB 1VGKB 1MNUL 1CIDA 5L9DL 3ZKMD 5KOVC 1Z0NA 1LHZA 1EMTL 1BF2A 3U4EB 1QBLL 4LCWD 4OFIA 3FQRA 5EO1A 3CH1A 5F1KC 4BH7B 1FO0B 1VDGA 1II4E 3MO1B 2P5EA 3ZDZF 1YZZA 3ZYIA 5KJRL 2B1HH 35C8H 4X6EA 1PW3A 5K9OA 3QZWB 2HJFA 1YMMD 3CFKB 2IC2A 3LIZL 4WWKA 5F6IB 2NNAA 1H3PL 4Z7WF 1GYAA 1BQUA 3ZE2E 4C83A 4JO4L 4NNPH 4WO4D 4X6DE 4P49A 3OKKA 4ZFGH 2PYED 2FWOB 4OCNC 3VWKD 2A73B 1FRGH 4RBPK 3RIFK 3HMWL 5BVPL 4J7RA 1JV5B 1RUPH 1AHWA 1A6ZB 1D5IH 4OLWH 4XI5D 1INDL 3KPLB 1UYWL 3X3GH 3ARDA 1CF8H 1XGPB 2BMKA 4I0KA 4M62L 2EIZA 4MA8H 2ZUTA 4HWEL 1VGKA 5AUMA 2GTZB 4Y88A 4HUWB 2XN9A 4KI5D 3CVHH 4K3EL 5DJ2B 5IB5B 1NUFA 2WMPA 2R15A 3S88H 1E4WL 1JNNH 4PJGA 2CDEB 2VOTA 1L0XA 4K7PH 4PJFA 4XX1E 1CDIA 2WLZA 3C2AH 5D6CB 1CWVA 4KDTA 3HRPA 5B39B 1FO0A 2BOCA 3OXRA 5I75C 1WZ1L 3RUGB 2WBKA 3F8UB 5J9PB 4Z7VA 5GRUL 4JG1H 4H1LG 3RGVC 1U8KA 2FECL 1NCDL 3PL6A 4W4OA 3JV4A 4HXAL 4X98A 5D1QB 1MAML 1CDCA 3P4NA 3N9GL 3R06B 3G08B 4HQQH 1JWMB 2BSRA 2DD8H 5C09E 3ILQD 1IQDA 4RDQG 3GM0A 1JE6A 1UB5A 2V5SA 3L9RB 1P84K 2PXYC 2BY2A 3VXUE 2CKBH 3B5HA 3QXDB 3BN9D 1ZANL 1RUML 2V5YA 2BNRE 5IIEB 4PJGF 4XNQB 2VQTA 1INEH 4PJFF 1QPPA 4UZGA 1P5UA 2XWJA 4Y4HD 5DRWA 5EWIH 5M7QA 1DUYB 3MTRA 4WIQA 4P46D 2CR3A 4L4TD 3W39B 2Y6SC 4Z7VF 3SCMB 4DFIA 1T7VA 1JHTB 1AC0A 1F4WL 4OZHA 2AABL 3BZ4B 1UADC 3RIAF 5LJYH 2CDEA 4IMKC 4PG9B 3U2SA 4ODTL 4P2RA 5IESL 1AD0B 1ADQH 3EJYC 5SWZA 4XNYL 5B39A 3GSXA 3RVXD 4EDXA 5F1IA 5ALBL 5JZ7D 4M1DL 4C56D 4DQOL 4TTGA 1TPXB 1EAJA 3HNVH 5GISL 3G5YB 3HPLB 5C6WH 1YUHB 1RZIA 5HI4C 2VNCA 3B8YA 1T22B 3PGDA 3SY0B 4MNHA 2OTPA 4QGTA 3H42H 5DD0L 2FEEL 2A77H 1PLGH 3G9VA 3OZ9H 3QXDA 2D4FA 5FKPA 4FMKA 2HH0H 1U3JA 2Y7QB 4Y4KC 1I1YB 4OZHF 3NIDE 4RAUB 3MRGB 3D85B 4F8QA 1FYHB 1JZ4A 1OSPH 2ERJC 5B3JE 3O8XB 1KEGL 3G9AB 4IBLT 4OV5A 5I73B 1KCRL 3VH8G 3CZFB 2APBA 3W39A 4PJ8C 3BJ91 3SCMA 5DHVH 3QUXB 4U1KA 3SKMA 2IBZX 4X5WA 5FIEA 1BHGA 1YEDA 2VR4A 3CLEH 4H25A 3ULVH 3SPVA 3O11B 4KVCH 5HYFA 1ZT4B 2P5WE 4XNZC 4PJEE 4I3SH 3ZL4L 4K8RD 4JPIB 3VFMA 1I3RA 3L3IA 5DT1H 2OK0L 2YMXH 3LPFA 4XP5H 4JO2L 1C5DA 2ITCB 4DGIH 2FECI 4LGPB 5C0CE 4GAYB 1JPSL 5E4IA 4PGZA 1T4KB 3I3DA 2XT1B 3AS2A 5FGBC 3GSVA 3HUJE 2JK5A 4O4YH 5LGHL 3UMTA 1NJ9A 4C57C 2PW2B 4M61A 3GBMH 4QCIA 3D85A 4QOKA 2YXFA 3OJMB 1T2QH 3RGHA 3FQXB 2DLEA 3B4NA 1J1OH 4PV9A 4JRYB 1T7WA 2EIEA 5MEQB 1K9TA 3EFDL 4PJIB 4LL9A 3V52L 4GSDH 3OKOA 3QIUC 5AYUH 4HPYL 1T83C 4MVBD 1G1CA 3LMJL 4LCYB 2C7UB 4YE4H 3VDAA 1S3KL 1CL7H 2GSIA 4PGJA 2FYYA 3O11A 1D9KD 4WV1C 1ZT4A 3BP5B 1RQ5A 1J8HD 4M7ZC 5EBWA 4JPIA 1ZA3A 3O6FA 1AO7E 1IC5H 3BRDA 1TVHB 2K3TA 5TF1L 4LK4A 5GRXG 2R1YA 4P9HC 4NUGL 3T4AB 1A6TB 4CVXB 4GAYA 3MLXL 5SV4A 5TQ2L 4JDTL 2Q20A 2CIIB 4HX1A 3U4BL 3PJSA 3RL1A 5DD6B 4RAVB 3FTGA 3QXVA 5D96B 2MFNA 3Q3GB 2NR6C 1K6QH 2ZSVA 3TVMA 2PETA 2FEEI 3BKYH 1AGBA 4WGVB 4WI4A 3IFLH 4MNQE 5A16B 4A6YB 1DVFA 5KW9H 2WBJA 1G7LA 4F33B 4UOW1 5IFAH 4TULL 3P4LA 4JFZL 2ESVA 4YXHL 2QADC 1YEHL 2PTUA 3C5ZA 2WSKA 4NQVA 4OZGA 1FAIL 2EYRB 1AKJD 1V3KA 2DJ4A 5E2UL 5I17A 3OF6D 2W07A 4JFFB 1L9NA 3GI8L 3U9PL 4W68A 4HUUB 3TPUA 4S1SH 2BCKA 5DQJB 1MRCH 1B0RB 4DK3A 4JPVH 1KIQB 1L0YA 1TMCB 2J8UA 4IS6A 2HKFL 4N0FA 2BHUA 4ZUUB 3MROB 4CN1A 3T4AA 1JFQH 4HC1H 4JM4L 5J6HA 5I1LB 4HDIB 3ARWA 1QLEH 2P42B 1XCQB 1WFOA 5K9JH 2MWCA 5D93B 4BZ1L 4XCCH 5DD6A 4TVSa 2XZZA 3QRFM 3LVEA 1DN2A 3WN5B 4OZGF 4N0UE 2ARJB 5A16A 4GQ9L 1XR8A 2VAAB 1YN7A 3DHMA 3QWOB 1GZQB 1MIEH 5IT2H 4FQ2L 4RSVA 1HDMB 4DAGL 1X6NA 1QSFA 3BE1L 1BX2B 2OP4H 3MJGX 4HK3N 4PRPA 2J8UF 4LNVA 3N1PC 1WGOA 2RCSL 3L3DB 4FZEL 3OGCA 4JFFA 3TV3H 4X8JB 2WW8A 1A3RL 4OGYH 5FUCC 3LEYL 2ED7A 3BDYH 4M6OH 1VFMA 4WTZA 5GS0L 1N5AB 2HTLC 2JIXD 1RU9L 1S5HB 3MLYL 2Z35B 3BWAA 5KS9E 4UQ2B 2FIKB 5EU6D 3SDCC 3E1F1 2CLRA 4JQVA 5J12C 4X99B 1WAAE 4PB0L 5J6GA 3GRWA 4HDIA 4JHBA 4PJBA 5FO9B 4ZTOL 1T03L 4DZ8B 4CDHA 2DRUA 2K7PA 1EFQA 3U0TA 3SDDC 1HHJA 1PX4A 2P5ED 3A6BL 1HH6A 4Q58C 4HS8L 4KJQD 1I4FB 1K4CB 5EZJA 3FQNA 4P3DA 2Z91A 1YJDC 2DI9A 5BW7A 2D0GA 3QCTL 1S7TB 3VXPA 2OZ4H 3SGJA 1IC4L 1OT1A 2N7BA 5CIPH 2GT9A 3QH3B 3WHE0 1HDMA 4H26B 2NY1D 5GS1C 1XT5A 1XF5A 2OTWB 5JQ6L 3M17B 5JA8B 2WNGA 1FGNL 6CGTA 4YIQB 1A4KB 2B8OT 5KTEH 5E70A 2HWZL 4MB4A 2GTWA 4PJBF 3FOLB 4NC1C 3ARDD 3MBEB 3OR7A 1SQ2N 4RWHA 4MNGA 5FK9A 4X9BA 1ZEAL 1CDJA 5D2LE 2XN9D 3O6ML 4NDMA 2R1WA 5EO0A 2VDOH 3EFFB 2I26N 4G9FB 1EERB 2YA2A 2YPKB 4OKVA 5MEPA 5GJSH 2AXHA 1XIWC 4JDZB 2YBRB 3UTQB 1BQSA 3QPXL 5DQ9A 4AIZA 5DDHB 5EUOB 1Q1JL 2A0LD 5JOEA 3MOAL 4L3AA 1E28A 1EEZA 3RNQB 5CD5C 3PL6D 3PWPA 5J11C 1M7XA 3IS1X 4AEEA 5JTWA 1S7TA 1Y6NR 4PJAE 1VA9A 3QH3A 4MDJA 1G84A 1W72L 3V4UH 3ZKNC 1BZ7B 3PIQB 2YR3A 5ANMB 1LO5A 3M17A 4JPWH 1XH3A 3QWQB 3UYRH 1BJ8A 1JYWA 1AXSA 4MJ4A 2D7NA 3SOBH 1AXTH 5DJ0A 3KWWB 5LBSL 5ID0B 4NQSB 4JQXC 4MCYA 3FOLA 3U0PB 4Z77B 2H1PH 3MR9B 1AQKH 1JHLH 5EU3B 5IB1B 1FFOB 3DGGA 2G9HA 3QEGL 2H2SC 3QUZD 4WNQB 1RIHL 3MUJA 1W72B 3WSQL 1ZVYA 3WS6C 1UWXK 5DD1L 3K4AA 1NAKH 3EFFA 4L3EA 2J3SA 4PD4J 4KTEH 4MA7L 4F58L 1AI1H 2YPKA 5GSRB 5AD0A 5SWZD 4XCYB 5F9OL 3ARQA 3UTQA 1FG9C 2Z31B 1WLHA 1LEKB 1QSEE 3HB3C 4PJDE 3W0WA 2X7LB 1OGAB 2WANA 4MAYC 4WUUE 4HFUH 5MHSE 3S3JA 2CK0H 2OXGA 3QR2A 2IBBA 5F96L 4IIQB 2DM2A 5DR5L 1KLFA 4UB0L 5ANMA 4NQXA 5K9QG 2JELL 2VTFA 5HJ3B 1O7SA 2VLRD 4K94C 5IMKB 2EXYD 2CLZB 2PNDA 3V0AC 4IJ3B 4F7EA 2C1OB 2HFGL 1U58A 1R3JB 1WBYA 2VC2H 3A6CL 2P24B 3QDGE 1RI8A 2F8OA 5FYKL 5E1AA 4YC2B 3KWWA 5IQ7H 3MNVB 1CFBA 5DVOA 5A3IC 4RX4A 3MV7B 4MJ6B 1JGLL 3MR9A 3T0EA 4WI9A 1UC6A 2RBLA 1FNGA 4XVJL 4WNQA 2QQKH 1EK3A 3SE9H 1CT8A 4H8WC 2QEJA 2HFTA 2FEDD 3CFCH 5T1KA 5HYSG 4NCC2 5GSRA 4MHHG 4LKXB 2OCFD 5D1ZC 4CW1B 5BO1L 4OTXH 4DOHE 4WFFD 4LQFL 5FUCE 5CUSL 1BBDH 2VDRH 4DCQA 5C07B 1TETL 5HHXL 4KMTH 2BNQB 4EVNA 5LXGL 2L7UA 5D4QA 2GY7B 3N1QC 1MCOH 5E8DH 2AK1H 2XQYK 5HDLA 2WUCL 4WUKH 3NCMA 1N64H 3BIBX 4PJHB 2CIKA 2MSPA 3HE7C 3JV0A 2JB5H 1OF2B 4OB5L 4LHQB 1RJZB 3ARBC 2C1OA 1QFUL 1OAQH 3L3GA 5CKAA 1S7SA 2FX8L 3WJLC 4XPHL 2GK0B 3EUUA 3ZMRA 4QOKD 5TGBB 2VDKL 2VLKE 4FQXC 4ZXBC 3MV7A 3TN0B 5CJ8A 5F1OB 1CZ8L 4YHNB 3RVUD 3NPZB 1AFVH 3D25B 2VZUA 4UIMB 5J13C 1MJ7H 4U1GB 2H26B 4XWGL 4KJPD 3REWA 1MUJA 1GCFA 4M1CD 1FCGA 2X4PA 1R24B 3BHBA 1IVLA 2OTUB 5GRZA 3MRBA 4F2MB 3VRIA 3X3FH 4NC1E 2AXJA 4RWYH 4D3CH 5FECB 2FGZA 4QEGA 3V0VB 2IMMA 1AGFB 3KAAA 4G5ZH 4I3GA 5I1KL 1MQKL 1QTYT 4MZ3A 1VESA 4LLMA 3DHJA 4TVPD 2YPLD 1T6VN 2Y5EA 2EC9U 5D7KE 1ZLUH 3X13B 1ZWIA 3S4SG 4J3VA 5B8CA 5JO5B 2ZG1A 5DWUL 1I1CA 2PN5A 1DVFD 2WUBH 3KLDA 2DLFH 3G5XB 2GK0A 4P23B 5JXEA 1YMMB 1I8LA 2WBJD 1PAMA 1ZVHA 1D5BB 2X70B 3S35H 2DQDH 3P9LB 4ZFOL 3KYOA 1CGVA 1PG7L 2ESVD 4G8FA 1SYVA 2X4RA 4NJAL 5GRJH 1N6QH 4AM0B 3C5ZD 3F6IA 4HIEB 2GJ6A 5F6IC 3UBXB 4LAQL 4U1JA 2P8MB 2C26A 4XRCA 1KFAL 4DVBA 2O61B 3WHXB 4YWGL 3TESA 1R24A 3MLUH 4PRNB 5IF0B 2OTUA 4EIGB 5GGTA 1E27B 2ICWA 4AMKH 5CEZE 3ZKSD 3GI9H 2IPKA 3C08L 4QRRE 1EO7A 4ZFOB 1PKQE 2ZNXA 3L3KB 2VL4A 1EHAA 3F7RA 3RZCB 5FYJE 3SDAB 3SJVE 4F7MA 4H1LA 4PRDB 1WF5A 3O3AB 2Q6WB 3EOTH 3HLAB 3LKQA 3QWRA 2N7AA 3BMWA 4OFYA 4JANA 3IDIB 3L1OH 1FH5L 5HGAA 3VD4A 1OLLA 3GJFH 2UZIL 5EZOL 5JPNB 3DMMD 1QBAA 4LSTL 4WY7L 4X6CA 5T3XL 5T5NG 4TYUA 3P4MB 4XNXL 1YEJL 1GGIL 4MQXD 3T2QA 2VZ1A 1A7PH 3P9LA 5CFHA 1QSFD 4MJ5B 3BPOC 2DYPB 1WFTA 4PRPD 4KC3B 2WK2A 5FM8A 4JREB 3UC0H 4XHJD 5D1QC 5DTFB 3UBXA 4APQB 2ZOKB 5FA3B 1F6FB 3BKJH 4P9MH 3VW3L 4Y1AE 3GNMH 3H9SB 3QA3B 1JMXA 3CSBA 5HYQA 3WNLA 1U8HB 3X14B 3BKML 3VU2A 1UJ3C 1FZKB 5FF6B 3FL7A 3OPZH 4XMKH 1UM4H 4ODSH 4PLKD 3ABZA 5DMIH 2CMRH 2H8PA 4ZD3H 1SJEA 5L2KD 2IQ9H 1NFIA 3L3OB 3L3KA 1N7MH 4X6CF 5T5FH 3T0DA 3ULUD 1HQRB 4HWUA 4KJYB 2P48B 1RV6X 2AV1B 3SDAA 3K80A 5I8CB 3DSFH 3P9MA 5C0ND 4AENA 1FV1B 3KJ6L 1KIRB 3PABB 1NDGB 3IDIA 5MENB 4C56B 3MPCA 4KFZC 5I1JH 1IM3A 5C0JB 1JJUA 2RFXB 4MCZB 4KKNA 3EDEA 1NUDA 1QFHA 4XWOC 1N6UA 4Y19E 1DP0A 2DKMA 4XC3H 4EXPX 1INQB 1HIMH 5ESAB 1TIUA 5ITFA 3GHEL 2X9WA 1YEGH 1TPXC 4XPTH 1F3DH 5CSZB 1C12A 3BZFA 3BI9X 3GSUB 4FG6C 4G80A 4POZC 3VH8A 4HV8B 4APQA 4HKZB 2YPVL 3W9DA 5CZXC 3C6LD 4UOJA 5CEZH 3ECBA 3H9SA 2Z8WC 1DLFL 1U8HA 2JJTA 3DETC 2DLGA 1V05A 3H3BC 4AK1A 3VWJB 1FZKA 4RZCB 1EUUA 3S36X 4R4BA 3WFEL 4LSUH 1NFDB 4RFOL 2GQHA 1MQ8A 5I71C 2E7LC 3U7WL 3V7MA 5FCUH 3O8XC 4KJYA 4JKWA 4LIQL 1UGNA 4HIXH 1NGZB 5EORH 1X5XA 1A6AA 4KAQH 2DS4A 3QUXC 2W9EH 1KIRA 4XXCA 5MENA 5D70H 4RIRA 4LSQL 1KN2H 3EHBC 5C0JA 3HMXH 4ODUB 4Z5RA 4MCZA 2FGWH 3ILPA 1RZFL 12E8L 2VSCA 3ZKQD 3B5GA 3GUTB 3MLTB 1G9MC 4IRSA 1FBIL 2A6IA 2EH8H 4LNRA 4MA1B 3RI5F 1U8IB 4OAWB 5DMJB 2XA8L 5CSZA 1W0VA 4K94H 2ZZUT 1YNKH 3W11D 4YDJB 1I3GL 3QSKB 3SN6N 5F7EH 2JCCB 1ZLWK 5ALCH 1C08B 1FZMA 1MFCH 4OLZL 1CGXA 1K4DA 1DBBH 5GRVL 1V7ML 2IANB 1KUMA 3S3PA 4QYOA 2OR9L 3U7YL 2FJHB 1JTPA 4L3ED 2GJZB 3HE6D 3T3MF 3WS3B 2F54A 2GW5A 4YUEH 4R97B 4EKXA 1ZHKB 1AQDB 1ETZB 4P5TB 4FZ8H 1OAKH 2WQ8A 2NPLX 4DKDC 1Z9MA 5FGCB 5JOFA 3W0WD 4QXWA 4ODUA 1RJYB 1UQSB 1HILB 1AP2B 1FDLH 4WGWB 1A7OH 3UPCA 1ACYH 5C0EA 3MRHB 3QHFH 4GW1B 1YECL 3I02A 3MOBL 2CRZA 2J6EL 3QEUA 2Y5TB 1HSBB 2CUMA 1A8JH 2IADA 1OAXH 3BP4B 5FO7A 5JOPD 1QZ1A 4DWHA 3KLAB 5EUKA 3M1BB 1B2WL 4YDLB 1J11A 2JCCA 1LDPL 4JY6A 1C08A 3ZYZA 4I9WD 1YNTB 4PY8J 2YZ1A 4YGVB 3T0ED 3LAFA 5D96C 4CKVX 1J7VR 2IANA 3ARUA 2YUXA 3RUGE 2WM0A 2VDNH 3BKCL 5EN2B 4NRZA 5BXFB 3IU4H 1AKJB 1L6XA 5T1KD 3ARGB 3MA9L 1U8MA 4H0IA 1AR2A 5T1MA 2APXA 4MD4B 1M71B 3VCLB 4KROD 5DURB 5JHLL 4QHLB 1G9EA 1NCAL 3HI5L 2DICA 1T20B 2YD1A 4NJ9H 5CGYD 2JCCF 2XRAL 5HVHB 3OTTA 5CINH 4N8VG 3AM8C 1A7QH 1DQQA 2D7TH 3IDMA 1FHGA 2LQRA 5F1NA 3KLAA 5DEGB 4I8DA 1WT5A 1L7TL 2MQ0A 5FHAL 3WHE1 1AY1L 1WBZA 1FO0H 3P30H 5I2IB 1YNTA 4JFHD 5D93C 4YGVA 3QDHA 1SJXA 1OTTC 1I1RA 3WN5C 1MFAH 1Q9LB 4LMQI 1ONQB 3IVKA 2NY7L 1MNUH 3RZWA 3LN5A 5J06A 5HI5D 1N0XL 1M7DA 5L9DH 4UTBL 4NKMA 1A5FL 3QQNA 3V9FA 5BXFA 3DBXA 3RTQC 2OLDA 1JPGB 4JR9L 5ADOL 3ARGA 5BVJA 1FVCB 3NFNB 2XWBB 1EMTH 1TXKA 2NX5A 1QBLH 3MXVL 3LDBC 1NCNA 4MD4A 4BH8B 1JF1B 3V5HA 3B9KA 4G3YL 4OFKA 5E9DB 3O6LL 4QHLA 2HLFC 2JIXB 4OCMC 2AEPL 3JZ7A 5KJRH 2FJGA 3GJEB 4J4PA 3TIDB 2XTJB 2OS7A 1KLGB 4K07A 2F53A 3LIZH 3BT2L 4QHUA 1H3PH 1OP5H 1T04B 3I2CH 4QRUB 4BQCA 1BECA 4JO4H 2BERA 4M7LT 1S9XA 3RWGB 2OL3L 5DEGA 3M45A 5TFSH 2KQNA 4K3GA 4OCWL 2AJ3A 2FB4L 3HMWH 2YA0A 5BVPH 5JXED 1QA9B 4OJFL 1ZLSH 1MFEL 5J1AB 1INDH 1PBYA 1UYWH 3C5JB 1EJOL 5EZLA 4J3WA 4R0LB 3S97C 3L7FA 4M62H 4M7LH 4HWEH 4JFQB 4K3EH 5ADPL 3DXAA 1SEQL 4WU5B 1JPGA 2AV7A 2OL3B 3HI1A 3QUKA 1E4WH 1HE7A 3NFNA 3O2VL 2Q1EA 5EC1B 1F2XK 4PREB 5D7LD 4R26L 5E9DA 3O2DL 1V3JA 1WZ1H 4OM0L 2WWMC 1FIEA 2VL5A 3QRGH 4J12A 5GRUH 1IGTA 2ZUXA 1NCDH 3RWEA 1YEEH 1KLGA 4U7SA 3SDXA 2VAJA 4XBEL 3MBEC 4HXAH 2J7LA 4JZNB 3N9GH 5GGQL 3MLRL 5IBUG 2D03L 3QWRD 4JRYE 2Z4QB 1ZSDB 4PJIE 4ZPTB 4EDWL 1U6AL 4NO5B 4X4MA 4UILH 1ZANH 1RUMH 4NNYA 4PY7B 4LLVB 3FOMA 5JDJA 1QA9A 4U1IB 2VSDA 1G7HA 5J1AA 2NYYD 4Y16D 4YBLB 2NZ9D 3JWOL 3VFUA 4R3SA 3VFWB 2NY0D 2DF3A 3PQYB 3S37X 1DR9A 1F4WH 3SDXF 1HXMB 2AABH 2HT4D 3GB7B 3R1GL 4I0PD 3RWFB 1MHHA 3LKNA 4IOFD 4ODTH 4ZYKA 5ACZA 5IESH 4W6WB 1CLYL 1BZ9A 4HK0A 4XNYH 5EZIL 4M1DH 3VGBA 5D72L 3EO1B 1DQLL 3QUZB 5FUZL 4MXWL 1TCRB 4DQOH 4LKCA 4HH9A 1U92A 2X4TB 3AS0A 5GISH 4ZQKA 1ZOXA 3N0PB 2IFFL 4JZNA 4P57A 4M00A 3WIHA 2BP3A 2VLMD 1L6ZA 4TUKL 3HS0A 5INCA 4JY5L 3EYUL 3UTTA 5DD0H 2W0FB 2Z4QA 3MCKA 2ENYA 1NC4A 4U1MB 4MQTB 1IMHC 2ADIB 4JEGB 4R9HA 1RZ8B 3GMQB 4NUJB 5SWQA 4AH2B 1ZGLB 4PRIB 4U1IA 5K93A 4XXDA 2Z31C 3D0VB 5EULV 4JFFE 1MCNA 1KCRH 2R4SH 5IJKA 3BX7C 1I7ZA 5E03A 3QDMB 4JCMA 4TVPH 5C0BB 2XICA 1CLZL 2XXMB 4FOMA 4GKZB 2MKLC 2AKRB 3MV8D 5DFTA 3QEQA 1EO8L 2R9HC 3RWFA 4GKNB 4IIQC 2NY6D 1X44A 3KYMB 5IK3A 3E6FB 2Q7YB 4XMPL 1ZLUK 4IJ3C 3VI4E 1F90L 1ZHNB 2ICWJ 1ZE3C 4X6BB 3ZL4H 4K55A 5J1SC 4YC2C 3HZYB 2LV4A 3LEXB 1U3HD 2OK0H 4U3HA 4HGMA 2XV6B 4JO2H 3EGSA 4P2OA 5FDWB 4PB9H 4L1HA 1MWAL 3Q5OA 2R23B 4RNRB 5DGRA 1NEZG 5JW5B 1RMFL 2W0FA 5FM5M 4G9DB 4DN3H 5ITBL 5A2JH 1FJ1B 5LGHH 2ADIA 2GK2A 2YOCA 3HRZB 3GMQA 4EI5B 1L9MA 1ZGLA 4FFVC 1L7IH 5EO9A 4ORGB 3L3HA 5LVEA 3QDJB 1HQ4B 2EDRA 4N1CA 3KLSA 3RX8A 3LKPB 1BFSA 5IVZA 1MWAB 3V52H 4EOWH 1KSRA 1IT9L 4OFPA 3IKCA 5I16A 4HPYH 3IGAA 1T5XA 1A6UH 2COQA 3LMJH 4OD3H 3HG1E 4TNVF 1DBML 4ZUWA 3BP7B 5H37G 4EJ1C 2Q7YA 4JVUA 4F7CA 3O4LB 4X6BA 2O26U 2FX9L 1CR9L 4ODWA 4TSAL 3FFDB 4PLJD 4JFDA 4BSVA 2J12B 4JFPB 2ZCKL 3LEVH 4CNIB 3TN0C 3GMOA 3FQUA 2J5LB 4NUGH 3WXVH 3E6HA 2ZKHL 2DMBA 3GJFK 4JY4B 4BFIB 5IHZB 2DQUL 2X6MA 3MLXH 4X80L 1I3VA 5TQ2H 2HJLA 3GMPA 3PP3K 1IKNC 4G9DA 3U4BH 1NH6A 1OD9A 4U1GC 2ICEA 1ITCA 2BY1A 5FYJU 4L4VB 3V4PL 2EC8A 4HGWB 3LY6A 3GMNB 2YPLB 3MRDA 5TDNB 2EICA 1T66D 3RVTC 5IOPB 4C58B 4TULH 1G7QB 3OJDA 4JFZH 5T3ZD 2AJSL 1IEAB 3MRMA 4YXHH 3IFOA 3ZKMC 5IFHL 5L7XH 1YEHH 1HI6B 3E2HB 3GIZH 5F97E 4JFYB 4LHUA 3OB0H 3HC4L 1QP1A 1FAIH 4H0GA 3TBWA 2GFBA 3CX5K 4YDVB 5E2UH 3TJHD 4MS8C 5L8JB 2E27L 3GI8H 4G9FE 3U9PH 3AS3A 3KPRB 5C0RL 1Q9OB 1H3GA 3DX7B 3AB0C 3T0BA 4OF6A 1NCTA 2WP3T 5IUSA 4P23C 5EUOE 4JQIL 2HKFH 1Q9KA 4UV7L 4HWZA 4F8TA 3DV4B 3QJFA 1DQDL 1HXYB 3HHRB 1I7RA 3WE6B 3RVVC 3VWKC 1TVDA 4X7DC 1HN1A 4XI5C 5IB4B 1P6FA 3GMNA 1CLOL 2MQ3A 1IAII 3QB7C 5DHXB 1IGMH 5IOPA 4POUB 4FQ2H 4DAGH 3BE1H 4Q6YA 4IDJL 4KI5C 4JFYA 4NQEB 1H0DA 4JKLA 3RZCC 2BSED 4YX2L 4YDVA 4FZEH 3RIFF 1KGCD 1A3RH 3K1DA 3LEYH 5JDSB 5E7BA 2IH3A 5GS0H 2AVGA 1FAKT 3MLYH 3KGRA 4NRYB 4NKDB 3VRJB 1OGAE 4BA8A 3AU1A 2NX5D 3ZTJH 4PB0H 4ZUVA 3Q6GH 5FV1L 5T5NF 4JM2B 4ZTOH 1T03H 2WAHA 3RPKA 1KENL 3UPRB 2E7HA 3B9KD 3A6BH 5HHMB 4ZNEE 1VFBA 5L2KB 4HD9A 5DJAA 2UWEA 2F53D 4UU9B 3V6OA 4LPUA 1JF5A 4G43A 4P46C 1SBBA 1IGIL 3F7YB 1IC4H 5T1LD 2APTA 1KTDB 4TPRL 3MV7E 2AEQH 3PWLA 5F9DC 4BELD 3WFDL 4D94A 5JQ6H 3MRJB 3MODL 4LEOA 5AZEL 1UJTA 2YZ8A 3AREA 1FGNH 1U3YA 1UEYA 2OSLB 4OGAC 4PRHA 4XVSL 1CFSA 5KN5B 2HWZH 3WL9A 3UO1L 3S96B 3D39E 1NCBL 1KG0B 4L8SC 3CFJB 1OWRM 1KB5B 3CC5B 5JZ7C 4OGXL 3G6JA 5FYKE 3LHPL 4GOSA 4EQ2A 2OJZL 1ZEAH 4LSPL 4JG0L 3O6MH 3VE0A 2IAMB 4NKDA 4OT1L 1QPXA 4PJ7B 5C07E 3DXAD 3VRJA 3L7EA 2UWEF 1PSKL 2BNQE 3C6LB 1UZ8B 1NGWB 1F4YL 1YY8B 3KYAA 3PE9A 3BEVA 3P0VL 1NAMA 2AJZA 3QPXH 3O3BB 1EAPB 4RISL 4ELMB 4G8GA 1HCFX 4PJHE 3BPCB 1Q1JH 3B43A 3P2TA 4NQTA 4B0MM 3WCYA 5D7IA 4LRIC 5FB8B 1F8TL 2A74A 4KV5F 4UU9A 3H3KA 5I1AB 3VWJC 2J2ZA 2FD6L 3G6JF 1W72H 2BDNH 1TZIB 8FABB 4XPGH 2D4DA 1JGDB 3O41A 3IETB 4CVWA 1M4KA 3NVQA 1FORL