4XP9H

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9H01
1KN4H 3K8KA 4K8RL 4RQQB 4JPVL 2QKIA 4NSKB 2D7QA 5KN5B 3MRHB 5CHNA 1AXTL 5JXEC 5ESVA 1DVFD 3BKYL 3BYYA 1U91A 4NC2B 5DTFB 1U92B 4PGEA 3O3BA 3RTQD 3IDMA 1CS6A 1TPXC 1NLBH 3WEXB 1I1AA 1JPTH 3FO0H 5KSBE 1FVCA 3ILPB 2PW2A 4PB0H 4H5SA 3TVMA 5DJ6B 1D5ZB 3K1KC 2AJUL 2DIAA 3C08H 5TDPA 4Y4FD 3KJ4C 4PJ9D 4OCSL 3X3FL 1RULL 5HGDB 1TMCB 3OV6A 1SVZA 3NACH 5D6CA 4W81A 4M1GH 3FB6B 4X0KA 1VERA 3C60B 4J8RA 1VADB 4Y0GA 3GK8L 4JGMA 5BO1H 2IFFH 4TSAH 4ERSH 3V52L 5BV7C 1KPVA 2CO6B 3S35L 3GSOA 2CKBH 5ALCL 4P3DB 5A16B 2AJSL 4OM0H 3KXFB 2WZPD 5CP3H 3BN3B 1SVCP 3TFKD 3I9GL 4TSCL 4OD3H 5GJSH 4YHYB 4L4TB 4WFHE 4AIOA 3CU7A 4QOKD 5B8CB 1T1WA 4M62L 1QFWL 1F58H 4N0YH 4G6AD 2X4TA 3CLEL 4XC1H 4HWUA 1J8HD 4R6UA 2GCYA 4PP2A 5I19L 1GZQB 2P5ED 1N7ML 1UWEL 4KY1H 4YXHL 3QA3B 4KU1A 2YSSB 4V1DD 3IU3B 4KAQH 4E42A 5C0AB 1OD7A 3VWKA 4XRCA 4PJDA 5KVGL 2K3TA 1WWWX 1R3HA 3BO8B 2QSQA 4JFDB 4E5XA 1EJOL 1W8NA 5EZLB 4C56E 4YHKL 4P5MA 5L88L 1QQDA 5EOQH 1U8JA 4JDVA 4U6XB 3ZHDA 1Q9KB 1DQDL 5CD3B 3KLHD 3GBNH 4J2XA 2HT2D 3L3DA 3SQOL 5EZOH 1HH6B 3GI8L 2CO7B 5CKAA 3VI4F 2ICWA 2EH7H 3EDFA 3IRPX 1F11B 1M7DA 4MQ7B 2W9LA 5I8EA 3U6RB 4JQXC 3TO2B 3L5WB 5A2LH 3VRLE 3HFMH 3RP1A 5SWZE 1QSEA 3MODL 2EO9A 1W2KT 3B83A 4ZXBD 3LN4A 4YBHA 4K94C 1D5BB 1FN4A 2Z92B 5F1SA 3WIFB 3L7FB 4AY0A 1G7JB 4XB7A 1N59A 5GIRB 4CVZB 2IGFH 3QH3A 1SMOA 4M7JL 5ENWB 3U46B 3X13A 5SX5H 4W6WB 1MWAH 5D6DA 4D0DB 2PKDA 1LNUB 5E0QA 1KF9B 2VDKL 3QT2A 4LSTH 2VDNL 5F3HA 4U1GB 2NLJB 4KPHH 1RI8A 5E6ZA 4MA3B 12E8H 3EOBA 1W72A 5HHMD 3LKRA 5IF0B 5DD6A 3BQUB 5BOZG 3BE1L 2KUTA 4FZ8H 1WJ3A 1MJ7H 2W0LA 3P9MA 4A2MA 1QNZH 1YY9D 4Y1AA 3EYFB 4C83B 3IDXL 4XVJH 1I1FA 1UJ3B 5D2LB 3RL1B 2J8OA 2VJXA 2VXUL 4QWWD 4PYGA 1DVFA 1G0DA 2D7TH 1BBJA 1BIIB 2R1YA 2MKWA 3BKCL 3DVGB 5C0BE 5E1AB 4Y88A 3V79C 3B8YA 1NBYA 3LDBC 2NXZD 3QUML 4PJ7A 1DBJH 1YJDH 2FEEL 1EVUA 2NY1D 2E27H 3VXUE 2C3WA 1IM9B 4PJBE 5EZIL 4NQVA 3LRHA 4XP5L 1DEDA 2VLLB 4HUVA 2ORBH 5KSAB 5F7EL 4MAUL 2CLZA 1XR8A 3DMMB 3ELAT 4PJ9A 1UWGL 4M1DL 3RVTD 1A6PA 1MF2L 1PG7H 4L3EB 1F4XL 2OCFD 3KPOB 4HWEL 4PD4K 3QIUB 1V7NH 1MCPH 5I15L 2FEDC 2XQYG 4IIQC 3BH8B 3DI2B 1KUMA 2DQEH 4ZDHA 3JVGC 4NHCL 5F9DC 2O5XH 4YUEH 2VXVH 1A3LH 2I24N 4PTTA 4L3AA 2YOCA 5IFJA 5HHOE 4ZQKB 3VFMB 3OKOA 1LE5A 2F9BT 3GMOB 3CDCA 5K9OB 1FO0H 3CZJA 1ZHKA 2Z8VC 4M4PA 3BGMA 5MENE 3MGTA 4WGWB 4QOKA 2JCCF 5CCKL 1OCWH 1H8SA 3O2VH 5TF0A 4I5BA 4DZBB 1RV6X 4LLWB 4M6OL 4KKAC 1MAML 4QGTA 4X99B 3A6CH 4OZ4B 1GHFH 4RISL 1KLGA 5EIIA 4DVRL 3GUTA 2WWKO 4NNXA 2HH0L 4IJ3B 1YN6A 4Y19B 4RIRA 1DDHB 3VDAA 5CUSH 5DJDA 3CPLA 4Z95H 3VGBA 4NUGH 4ODXA 1GSMA 1QA9B 1KCUH 2MTPA 1QSFA 3JV4B 4HKBA 1T83C 1JK8A 4KJYA 3UBXA 3RIFF 2DMBA 2DF3A 4QRRA 1SEQH 4G6MH 3RPIB 4XMKL 1CFQB 2FBJL 1Q1JH 4KQ4L 3FO1B 1A8JH 1I8MB 3GBMH 1S7XA 2AK4E 5F7UA 2JELH 5ADPH 1BQLL 3NPSC 3UMTA 3D69A 1ZSDB 1U3HD 1CL7I 1NEZA 2APBA 2EDYA 1R3KB 4M7KH 1PG7W 3TZVA 3FQUA 1UA6L 4UOJA 5T1KB 4O2EB 1WFNA 5AUMB 3EYUH 4JJHA 3MJ7A 4KMTL 5GRXG 5C3TA 4XVSH 3RWCA 4Z76A 1WWCA 3MV01 1NMBH 2VKWA 1MREL 4NZRL 4XBEL 2JJWA 5I75B 1CF8H 1KTRL 5EU7E 2F54E 1CU4H 5ACZB 3MRGA 2DWDA 3HRZB 2NY3D 2EDKA 5KOMC 5JA8B 5HDQH 2OTPA 2GSIA 5C0DB 4OZFG 1JHLL 1SJXA 3H9SD 4N5EC 1YEDB 3L3GB 5D7JD 4KKCC 1FPTH 4PREA 3VXNA 3DROA 1QBML 5JZ7D 4EUPG 3BDYL 4HIXH 2MKLC 2NY4D 5JW4Q 2ENSA 4OKVA 2OJZH 1FZOB 2WWKT 3HMXA 4M93C 1BF2A 5SWSE 1FZMB 1NMAL 3UPCA 1YEHH 1IMHC 4HXAL 2E7MA 3KDMA 4F8QA 1N6QL 1UADC 2W07A 3NA9L 3MROA 4KK6C 1EMTH 3DSFH 4OCWH 5HI4C 4LRIA 5JLZA 4HJJH 3VXTB 2DD8L 3D2UD 5IBTH 1P1ZA 2UY6A 2A6JB 5EOTA 2KH2B 4JFXA 3QEQA 3D87B 3ARGC 1N6VA 4LCYB 4OGYH 2QSVA 3BP5A 5I66B 3DYOA 4DFHA 4I0PB 1QSVA 1XCTB 4LPYA 1A7OH 3FFDB 4I4WA 2EZ0D 1T4KB 1X4ZA 4M48H 1BZ9B 4QHKJ 1DR9A 2R1XA 3EOAB 5HYSB 1NCDL 1CBVH 1ODAA 5J4MA 4CGTA 4UIKH 3QPQC 2BX5A 4OF0A 3T0ED 1WISA 3SKOA 1Y0LA 2M2DA 3FONA 2R39A 5B4MC 3MLYL 4QHUA 1WUNT 3QUXA 2GK0B 5DVKA 1V8HA 4X8XA 3O41A 3HR6A 4WJ5B 4G8IA 4DCQB 5J7CC 1FNGB 2XV6B 1SEBA 2AJZA 4PP1D 1FV1B 5C9JB 3MLTB 5GGUA 1VESA 4F7EB 4TRPL 1BVLA 2EKSA 2ADGA 2BHYA 5CINH 3EFFA 4JM2C 2JB6A 4OFDA 5TQ2L 3KLSA 2EDQA 3DV4B 5E9DB 2A6DB 1TETL 3QUYB 2BSRA 1K4CA 4G6KL 3V5DA 2Y36H 2DDQH 4NUJA 1U8OA 4WO4D 4RMWA 2V5TA 1S9WB 2EIDA 2B8OT 4K3EH 1M4KA 1U0QA 4QXTB 1QKZH 4M7LL 4OLWL 5ESQA 5JW4M 4UT6H 2CRMA 3IF1B 4KK8D 2ZOLA 5D7IB 3A6BH 5GPRA 3CH1B 3P4NA 3OKLA 4PJCB 3TBTB 3C8KB 4XTRD 3LKNA 4KRLB 5D7LE 2Z8RA 3OKMA 5IBUG 3RZCD 3FOMA 2YHGA 3NN8A 4HKJB 4X6CE 5FM5M 5B39G 4OZIA 1DCLA 2YD2A 1U3HA 1U8QB 2OL3B 3QWQB 5MEQB 2EO1A 1G7LA 4HS8L 1T2JA 3QFDB 1JGVL 4LEOB 3MCLH 3H9HB 3ARBC 3G6AA 2BSSA 1MCIA 3QDJA 4PRHD 1RZKH 2WUBH 2X4NA 4I2XA 1N3NB 3FAXA 2G9HA 5C0EA 3T3MF 1D5MB 4U6VH 4IRJD 3GM0A 5E03A 5GGVL 3S35X 2YPLA 2DLGA 4YFEA 4JY5L 5DMKA 4YNYA 1ULVA 1ZHBB 3DBXA 1PD6A 2W9DH 3AB0B 4RMRA 4ODSL 4QRPE 3STLA 4O9HL 1XF2A 4NRYB 3ROLA 3U9UB 1NDMB 1S5HB 2WLYA 4Y8AA 4JZJC 1ORSB 5D7JA 3F58H 3SKNB 1AGDB 1KCVL 1FL6A 5GRWA 1G9NL 2BVTA 2WSKA 4Z18A 1WEJH 5DJCB 3R8BB 5C07E 1CYGA 4YLQT 3WLWD 4FRWA 4GKZB 4MJ4A 3D39E 1OW0C 1FFNB 1SBSL 3GSQA 5JMOC 5DMGC 4XAKD 3TYFA 1DQJA 1E4KC 1Q9LA 2D03H 3C60D 4G80A 5ANMA 2M1KA 1EXUB 3HS0A 3K4ZA 4I0KA 5IBLC 3S6CA 1I7ZB 4OZHF 2EDNA 4OF8A 3ARGA 4Z0XA 5GSVB 5A3ID 2IPUK 3O81A 5C08B 3RWEA 3ULUF 3JWOH 3RX8A 1OGAB 2X40A 3EYSL 3W39B 4APQB 1AD9B 4FABH 1YEKL 3KXFD 1DQQA 2HT3C 3D85B 4L4TD 3UTSA 1YEIH 4UNUA 1B4JL 4BSWA 4N68A 1CK0H 5ID1B 1ND0A 3LSOA 4K7PH 1FNAA 2C5DC 3ZT5A 3TH3T 4YXLH 3UJIL 1T7WA 3MLPA 4M8QB 5FA4B 1UM5L 3JUYA 1ZVHA 3I75A 4NGHH 3PGDA 4HW6A 4OFVA 4JFYA 5C0AD 5HHXH 1X4XA 1TPXB 3U83A 4GQ9H 2ITCA 2A73A 2XT1B 3D18B 2Q3ZA 4JFDD 3VXRB 5HYJB 4DGIH 2NY7H 5T3ZL 3OKKB 5F9AC 3EOTL 3UTTA 1TCRB 1KJMB 4H1LB 2BNQA 2YPVH 1HWHB 3KJ4B 3HI5H 1U8HB 1CVRA 4JM2A 5F9WC 2HFGH 4Q0XL 5BZDA 4JPIB 4PJHE 4H26A 4PJEF 5CEXB 4YDIL 4ODWA 3OSKA 5D72L 4F3FB 1G1CA 4OTXH 3BP6A 4LEXH 1NKOA 3IDGA 4JR9H 4KK5D 4WTZA 5BV7B 4X6EB 1E4WL 4GRMA 4NQDA 5FXCH 1XF5A 4KTDL 3V6OA 3RUGB 3JV5A 4U1LA 5D5MA 3MV8A 4DOHB 3EAKA 4GUPB 4KWUA 4UDTB 4WCYH 2F5BL 3DX8B 1A7PH 3BKJH 4GRWB 2FWOB 5FGCE 2XZAL 3RZCA 3P4MA 1HINL 3T2OA 3GNML 4KRMB 4OD1H 5DJAA 2UV3A 3KPNB 4LNVA 4TVSa 4F7CB 4YAQA 5DRWB 4K3DH 3GHBL 3LRSB 3ZLQC 3DYMA 5JHLL 1TQBC 1YMHA 1J1PH 4JKPL 1YDPB 1N4XL 3LOWA 4XWGL 4EVNB 3BQUD 2NNAB 3VH8G 1JPSL 1CDIA 4ELKB 2OZ4H 2Z93A 2ZG1A 1T0NB 3G08A 4O2CA 3QULB 2FGWH 3H7BA 4FNLL 5HXMA 5KN5A 4QRSA 4OFIA 3QIBA 2APFA 4JFEB 1IGMH 3IJYA 5D1QA 5DD1H 1OWRM 3RA7H 5T3XE 3NZHL 2H1PH 2GYSA 3DVNA 4DN3H 3DO7A 1HNFA 3NIDF 1IM9D 1A6WL 2JB5H 1C08A 1HXMB 4JQVC 2GK2A 4NC1C 3ILPA 3MRQA 5I76A 5I30L 4QGYA 4PJDE 4ZYKB 4DGVL 5KSAD 1OTUC 2DI8A 1S7UA 4G6JL 4PB9H 3DMMD 1KJ2H 4N0RA 3UYRL 3FT3A 4ZFOA 4MXWH 5HGDA 1CLOH 4G7VL 4L3ED 2HMIC 1OAYL 1RUQH 1OW0A 3QIUD 2OS7A 3HR5B 4HPOH 5I2IA 3V4UH 4WNQB 3BJ91 4XHJD 1HHIA 1NBQA 1U3JA 1S8DB 2FDBP 2VABA 3DI3B 3O0RL 5IB3A 4PIRF 5IR1A 3X17A 3I6LD 3G9VA 1O5DT 5ETUA 3WYRA 5KS9A 5FGBC 3FT2A 4XNMB 3QNXB 3MUY1 1JNLL 3M17B 3OR7A 3DXAA 4RAUB 1J5OH 4PBXA 3MMEA 3UAJC 4DKDC 4ONFH 5KZCB 1G9NC 3HPLB 2RFXB 1QSEE 4EI5B 3G6JA 3MYJA 4L1DA 4V2BA 4P23D 1DLFL 2X2YA 3QCUH 4I18B 5GGSY 1SYSB 5GGRY 2X44D 4CDGC 3MLSL 4JFPB 4K07A 4MWFA 3VG0H 1X5AA 3KYMA 5HHVL 4Y16A 5FYKE 3O8XB 4X4YA 1ZAGA 1B0GB 2BVPB 1HOCA 1QD0A 1U8IB 2QR0B 1UZ6E 3BKML 5C6TL 3REVB 4KJPC 4Y19D 3TN0C 1VPOL 4WI5A 1H3PL 2IPKB 3ZL4L 3TIDA 1CFSB 1ZKAA 5CD3A 4TNVK 3IJSB 2NX5A 2VIRB 3SJVA 4MQXC 2V2WB 2EEDA 1FQ9C 1HH6A 1AGBB 4HKZA 4Y1AE 3IKCB 5I1JL 1EGJA 3P73B 4ZO6A 4D9RD 15C8H 1KBGH 2OQJA 3ZT6A 5CEZL 4DKEL 4HGWA 3U6RA 5IFAL 1R5WB 2EXWC 2FJHB 2IC2A 5FECB 4PJ7E 5DJXA 1CXKA 3KWWA 1S9YA 3P4LA 2R0KL 1PZ5A 1G6RH 1RK1B 4TUJA 3LZFH 2R0WL 1MY7A 1QSZA 5GSRA 4NJAH 1PY4A 4K2UL 4ODTH 1BQSA 5T1KD 5E8OA 3JTSA 1ACYL 5FK9B 4Q97A 5DK2B 5IMOB 1KOAA 4XPBH 3T2PA 5DURB 4U6YB 3OWEA 1AGCB 3TF7C 5L8LB 4X4XA 5J57B 1GGYA 3Q6FA 1RJLA 3PL6C 4WI3A 3DARA 1A6UL 4PJGA 4BUHA 2R2CA 4LLDA 4XCNB 4ZS6D 2CRZA 3GMNB 3M45A 5HDOA 3WNKA 3PDDA 3VXMB 3HNTL 5AD0B 1S7QB 5HHPB 2WIIB 5DWUH 4AEIH 4BZ2H 3GMQB 3UJTL 1A21A 3CSYB 5CLWA 4FQ2H 3Q1SH 1VENA 1ETZA 5JDJA 5IV2B 1HEZB 4A6YA 4TULH 1AHWA 3RJDA 1OAKL 4LCIL 1HNGA 4ALAH 4XWOC 3BRFA 4HIJA 2W38A 3B5TA 4QOKE 4P2RB 4LKCA 3K0WA 3V2AR 4HXBH 4XPFH 1QLFB 1S7TB 2X05A 1J86A 4LLAA 4RX4D 3QUKA 3OKYA 4RGOH 4NOFA 5TJWK 5ISZA 4MJIB 1MLBA 3TH4T 5DD0H 3EO1B 3ILQD 2E6QA 5EC1B 3CXHK 1LEIA 1JZ7A 3O3AA 2KBGA 3VWJC 4R9HA 4I0PD 2ZCHL 3V0VA 2DTMH 2B4CL 3HAEA 5CJQH 1BFOB 2H3NA 1RU9H 2G5BA 3MBEB 4Z7VF 3VI3E 4L3EA 4X7FC 3TO4A 1CE1H 5DLML 2ARJB 4MSWA 4F7MA 1QSFE 3QO0A 1BZ7B 4HJ0C 2FYYB 1K9TA 1IQDA 1IC4H 4FFYH 2VB5A 3VMNA 3ULSA 2WWMD 4QRRE 4KHXH 2W65A 2W0FA 1MNUL 2HFTA 3GMOA 2BMKB 5FGBA 5F1NA 1CLYH 5ADOH 1TXKA 4JZOB 1EFXB 3PWLA 1KIPA 3MRFA 3P0GB 2R2HB 5MERB 4WWID 1QFOA 4WI8A 3SO3C 4CADB 4P23A 5EU3A 1JPGB 3NABL 3SE8L 4M93B 3WSQH 5IB4B 3WJLA 3TLRA 4S1SL 4QRQB 3ULVE 1H15A 3KPLB 4PBVC 4BSJA 3VDBA 2C1PB 5E9DD 3QUYD 4Q6IA 1CDYA 4FQCH 3QJFA 3TNNB 1AO7B 3ARDA 3ABZA 3G5ZA 4F7PB 4YBQD 4TTDC 3QIWC 4S10A 3MV9B 4YHOH 3GMRB 3HI6H 1T1XB 3VFOB 1A1MB 5F6IC 3HHRB 5E2WH 5IROC 2R23B 3GO1L 2HWZL 4YHNA 1ZWIA 1T22A 1QA9A 1BD2D 1UENA 2JE8A 4FHBD 3TN0A 4O51A 1MQKL 5EUOB 1XGUA 4KK9D 3JV4A 4KXZH 4IS6B 4CW1B 1AKJB 1FFQA 3FB8B 4KZEH 4ZUTA 4JHZA 1S9VB 4KZDH 4R4NC 3HB3C 2NYYD 3U48A 3LKSA 3WS3A 5GGTL 1H5BB 2CRIA 3K2UH 3U1SL 3HI1A 1MLCB 3QUMB 2DJSA 3LHPL 4PTUB 3KYNA 3L3OA 5T3XH 5J9PA 4KGLA 5B21A 3WLBB 2F8VA 4LP5A 3C5JA 3WE6A 3P77A 3QXTA 5F7HA 1ZLUK 5IVXF 3QEQE 1R3LB 4O2EA 4NKIH 4WDIB 5EBWA 2VERN 4LPVA 2RBLA 4JO3H 3MZGB 1I3GH 1AFVH 1A1OA 2R69H 5FUCE 4CVXB 2OI9C 1JN6A 2X5PA 1J9CT 2AQ2A 4JEGB 1JMZA 1D5XB 2G2RB 1SBBA 5BVJA 3H3PL 5D8JL 2A1WH 4IDJL 2YRPA 3MBXH 1DN0B 3T1WA 4UV7H 2IBZY 1MEXL 5LAXB 3WIHL 2ZPKL 3DX9B 3EFDL 4IMLB 2Q3AA 5J11C 4Y2OA 3FHQA 3LRGA 2MQ0A 1C1EL 1RSFA 4XBGA 1FZMA 4HS6B 4U1MA 4L4VA 2BFVL 3RY6C 1JVKA 5C0GB 4PR5B 2H9GB 2PYEB 4QRUB 5F9JA 2V2XB 4KI5D 1YYLH 2IMNA 2N4IA 2Q6WA 3DUUB 5EBLA 3GJFB 4NFBA 2Y72A 3LKPB 4XCEA 4P99A 1AQDB 4XNZC 3IFLL 2W91A 5FYKH 2P8PA 4X9HA 5EOCH 1FGVL 4I0PA 4C57C 4YGVB 2BERA 4WW2F 3HMWL 4JAMB 4G8EA 5C08D 4JM4L 3EOAA 3ARBB 1OGAD 2DQDH 3KPSB 1GPOL 4GG6A 3WJJA 2CXGA 8FABB 3EBAA 4X5WB 4OCLC 3IDJA 3GDBA 1A0QH 1W72H 2VE6B 2X4OA 2BNUA 3D85D 4NO2A 1MH5B 3REWA 4U1KB 5E1HB 4GAFB 2B1HL 3ARSA 4FFZL 5E8DH 4ZTOH 5JXED 1UXSB 1PLGH 5HSFA 3WUWG 4G9FB 3BH9A 3ES6B 2X4PA 4WJ5A 1ZEAL 3ZYJA 4AK1A 4QHNA 1N8ZB 4OZIE 2VDOL 1WT5C 4EN3C 1RZFH 5J6GA 3OG4B 2R29L 3VXRD 5HYJD 4XNXH 1I8KB 2B4CC 2XWJA 1S9XB 5IGXL 4QHLA 1GGIH 4DZ8B 1NPUA 3S5LG 4C59B 1JGEA 3QDJE 2IPTL 2B1AH 5T1MA 1LP9F 1D9KA 4I2XE 2XQBH 3HUJF 2WANA 4ODHL 2DQHH 4RAHA 2YPLE 1N5YL 4LKXB 1NGYB 2XZQH 3O6MH 3CCHA 3QCVL 4PLKD 1P7HL 3BT2L 1VB9A 5E6IC 5EU5B 4X80H 2XWBA 3TM6A 2EE2A 4MLSA 1UGNA 5I1AA 4M6MH 4LVOC 3SKMA 1BD2A 2X1OA 4NO3A 4LU5H 1GGCL 3GSNL 1T1YB 2JJUA 4U1HB 4HKXB 2DKUA 2DL2A 4HLJA 4JREB 5BRZA 5FOBB 2OK0L 3MJ9H 2D7OA 3DGGA 2R2BB 1IC5L 3LS5H 2XKSA 4JFHD 4KJQD 5DO2C 5HY9A 1BM3L 2VOTA 3C2AL 1XGQB 4Z0BH 5DD5H 2FJFA 4LCCC 1OVZA 4AENB 4YDKH 4Z7WF 5E00A 5ESAA 4S1DC 5GS0C 3D5OF 3SDCA 2B0SH 3DURA 3SE9H 4JRXA 4DJMA 4QNPF 1Q0XL 4HWBL 3ZYIA 1FRGL 3HLAB 5D93C 2YK1L 1BECA 4PJAA 2D2OA 4GBXC 1GIGH 2E9JA 3OKDB 2PNDA 1A22B 4UT7L 5ANME 2OTWB 4KROC 4AT6B 4GRWH 2H2SC 1KIQB 3TJEH 3MRPA 4BH8A 4MDIB 2EIEA 3PJSA 1ZGLB 2MWCA 4MAYC 1Z0NA 4HIHB 2VYRE 4G8GA 5DJ8B 4BM7A 5LGJB 1NDGB 1PFCA 1K5NB 4KXZI 5I0DA 2CLVB 3IETA 4JO1L 1VGEH 3TIEB 3UTSE 4D9LL 1IFHL 4MA8L 4JFED 4ZPVB 1AD0B 1KN2H 4XMPL 1JWSB 2P8MB 1HI6B 1I4FA 1CR9L 4JO2H 3LS4L 4J3UA 1A7RL 3SKNA 3WHE0 4ZTPL 2IQ9L 3KJ6L 4KV5E 4ZUUA 3UZEA 5K9QG 5C70A 3OB0H 1F6AA 2ATKA 4BZYA 2RIKA 4LFHG 3S98A 5IK3B 1J0YA 3UTTE 3VGGA 2CKNA 2BNQE 1A9EA 3U30C 2HVJA 4E0RB 1SJHB 2H2PC 3L9RA 2BVUA 3ULVH 1EXUA 4YO0B 1ZTXH 2I26N 2LV4A 4UU9A 3AGVA 2OJEB 2AJ3A 1U8MA 4WV1C 5DRZA 3RVXC 5H2BA 1NC2A 3GB7A 4MNGB 5EPMA 1QFUL 4U4BA 3QI9C 2EDHA 1OGAA 4FXGA 3OF6A 5IVZB 1YPZB 1UM6H 4JG1H 2ICWI 4JLRA 5KZCD 4NC0B 2VH5L 3U9PL 2C1OB 2X1XR 1QHPA 5DYOB 4X9IA 4DAGL 5C0CA 3DX6B 4EI5D 4NCC2 4NQDE 3V6OE 2HVKB 2VXSL 2PTVA 5D5ME 3MV8E 4N0FA 3OAUL 3ARVA 5FHBH 1U2CA 5DS8A 4HUXB 3K81A 1M7IB 2ED7A 4OFYA 3MNWB 3O8XD 3IYLW 1L4IA 3S3PA 5IJVA 4PJEB 4C4KO 1T03L 1LD9A 3PWVA 3IAQA 1OP3H 1VDGA 5AG9A 5JPNB 1IC7H 3BZEB 3T4AA 5K59E 5ELIA 1AGFA 2P1YA 2L7JA 3VXRA 4L8SC 3OB8A 5EO0A 4S2SB 1JHTB 1EH9A 1JIBA 2EYSA 4EN3A 4P2QA 3SPVB 1NAML 1MRDH 2YD1A 3LQZA 5E5MA 5EO9B 1CDHA 3BW9A 5A1AA 1YNTB 4LSQH 4XCYA 2GFBA 1KIRB 1E4XI 2VITB 2ILLA 3HZKB 1XGRB 5I8OH 5DDHA 3DX7B 3ZYZA 3NH7H 5J12C 1NSNL 4BFBD 3BESR 1S7VA 1QFPA 4IRSC 4XP1L 3Q48A 2EDFA 4YWGH 3Q5TA 5EORH 4ZFZB 2ZUYA 4P4KC 4R26L 3T0BA 5DRNB 1A5FL 1WQVT 3HN3A 4NO0B 2JKXA 1MRFH 4OQTL 4LLMA 1ZOXA 4PJIA 4LP4A 4HUNB 5DURD 1T21A 3KG5A 2FWOA 1JYVA 3LD8B 5E6YA 4LCCA 3T2QA 3L3JA 3IDIB 3T8XB 4Q9BA 2QJDA 1X3DA 4KKAD 2A83A 2YUZA 3MQIA 3MTRA 5LCVL 1QTYT 2QLVB 4LSUH 2DQGL 4TVPD 3V95A 4LBEA 4ZUWB 5BS0B 1NCWH 5KS9E 5TE6L 3VXMD 1RZIB 3PWUB 5BXFB 2QHRH 1FG2B 4WW1A 1E6JL 1KCRH 3O6LL 5IQ9A 1T0NA 4TVPH 3WNMA 3GSUA 4C4KT 3DXAE 1S3KH 4POZC 5E2UH 1DUYB 4PGCA 3RI5F 2VQ1B 5E94B 3V4PH 3G6JE 2QBWA 1IBGH 1T20B 2IH3A 5IWLA 3NTCH 1QRNA 3GJEB 2NTFA 3VFVB 5F88A 1KB9J 3QHFH 4JFQA 3W9EA 2ZKHL 4MJID 3BZFB 4HZLB 3BGFC 5SWQB 1I8LA 3RWGA 5IB1A 3VD5A 1CICC 4JN1L 4MXQC 4HPYH 3WN5A 4POUB 3RQ3A 2VXTH 1V3LA 1NGPL 2CR3A 1IGFL 1ROWA 3MBED 3QO1A 3GSWB 3FQTB 3CVIL 2NX5E 4XZUB 1WC7A 3SJVE 2CJUL 1JGUH 4MX7B 3MRDA 4ZS7H 3PL6B 4X4ZA 5B3JE 1FNFA 2FNBA 4XNMA 1NGZB 1TLKA 1OSZB 4LPTA 4TOYH 3O9WC 4L8BB 3T77B 3F5WA 1F90H 4DEPC 3PV7A 5HDBE 1NLBL 1EFXD 4W4OC 4KKCD 4Z7UA 1JPTL 4EI5A 3FO0L 1JI2A 3OAZH 4DUVA 3FRUB 3HCVA 2YN3A 4I48A 4ODVH 4PB0L 4FQPA 3UPAA 5FUZH 4NJ9H 1ZVSA 2ZSWB 1IJ9A 1JF6A 4JFPA 4K71C 3O8XA 5TE7H 4HK0B 1TJGH 3NACL 1AO7D 4M1GL 3OHXA 3MV9D 3OG6B 2ZUWA 1WZMA 3IS1X 4J1UA 1VFBB 4PJGE 3MREB 5BO1L 1JGDB 2BNRB 4TSAL 4ERSL 4CKVX 4JCLA 2AXFA 3G04B 3VWJB 1B0RB 3H42H 3L3HA 5CEYA 1Y6NR 1AC6A 2CKBL 5DK0A 2VIRA 1KXVC 1XCQA 3PHOA 2V2WA 2FX9H 4OCYH 4Z8FH 1RZGB 2DQTH 1BX2A 1AKJD 4OD3L 3HNVH 5GJSL 3TBWB 1HSAA 2ICEA 4Y2DC 4YIQB 1YMMA 1HCVA 1L0QA 5FB8A 4RAVA 3K4AA 3UTOA 3V5KB 1MIMH 2VDPH 1T7ZA 2X89A 3S97C 4UQ2A 3H9ZA 5JHDB 1R5IB 1F58L 2FJHA 4N0YL 1CD8A 4M6AA 3I6KA 2AXGA 2GKIA 4P5KA 1PVHA 3HG1B 2UWEB 5B4MD 5C7XH 5ISZE 1RAMA 3BMVA 3ARUA 4KAQL 5D1ZC 3UTZB 4JN2B 5LKNA 4KH2A 2CDFB 4U1SB 5C1MB 4FMFA 1T7XA 3QDAA 1DBBH 3SO3B 4NC1E 5E8EB 1TVHB 5EOQL 2B2XH 4L3EE 3RNKB 3GBNL 4NZDA 1WBZA 5D2NA 1BEYH 2Q76B 5EZOL 1M71A 4Y5VC 4NKDA 4ZO8A 1HQRB 5FDWB 2DJ4A 1VKXA 3I6LE 2EH7L 4GW4A 3CSGA 1KYOK 4CMMB 3WHXA 1S7QA 5HHPA 2BOBA 4O00A 5D1XA 1WAAF 4NO5A 1BFTA 2APVA 1V05A 2FCBA 4N9GA 1HDMB 2CIIA 2OMBA 1FG9C 1BWWA 1CE6B 1DANT 3QJHB 1T2QH 1M05A 1T80A 2PYED 4UAOC 3BN9C 1NCNA 5HBBA 1DUZB 2IGFL 5I1GH 2VLJB 3EO0B 1YN7A 1MWAL 1JV5B 1IAIM 4LSTL 3GMPA 3FOLB 5K9JH 2ESVA 3TCLA 4Y19E 4KPHL 5IMKB 2A6KA 12E8L 4OF5A 4MHHG 3ARBD 3CZFB 2PW1A 1NMCC 4Y5YC 3KPSD 3NCFB 2CDEB 2JCCA 1I9EA 4FZ8L 1MJ7L 1UH3A 4NN5C 5D7SH 4NDMB 2OI9B 4YDVB 1QNZL 3K8MA 3E1F1 5HPMB 4R0LB 4XVJL 1LEKB 2WW8A 2FR4A 4C58B 3F8UB 5ID0B 1K4DB 4ELMA 2D7TL 4MCZB 5DZLA 4L5FH 1AIFA 2R1WB 3JV6A 3E6FA 3RWJB 4G9FD 1DBJL 1YJDL 4OLXH 5I1KH 2E27L 4AMKH 4K23H 4HS3A 1J0KA 3U0WH 3AY4C 3V6BR 2F15A 3I50H 4Q74A 1PKOA 3THMH 5TDNB 2BVOB 2VLKB 1PG7L 4KDTC 3C5ZB 2C1PA 2DL9A 4QKXB 3AM8A 5LJYH 3TNNA 1VHPA 3OX8A 5C09A 1V7NL 1MCPL 1QR4A 1I7UA 43C9A 2FATH 1FORH 2F53A 4JFOB 4QTHB 3RIFK 4AJ0A 5L2JB 2DQEL 1MHCA 1C12B 1T89A 4XNZB 4D0BB 1XMWA 1IKNA 4G43A 2O5XL 3MO1A 4YUEL 2VXVL 1A3LL 2AJXH 5KG9B 5IVXB 4YX2H 2X7LB 2I9TA 4N0CD 3AREB 1E28B 2GITB 1FBIH 1FO0L 4DVBB 2XIDA 3HC3H 5E2TH 1GZPA 3BFOA 3V5HA 5HVFB 1TVBB 3CFEB 4L4VE 2WUCH 1OCWL 3O2VL 2Y9RT 4Y2DA 4FQXC 1A14H 4E41B 2Z8SA 1MJJA 3T09A 1WCQA 3B9KC 3QUMA 5DUBA 4MDJA 5FM8A 4ETQB 4PJXF 4PPTA 1HIMH 2IWGA 3O4OC 2O5YH 3O2WH 1GHFL 3QDGB 1FCCA 4LRNH 4R4BB 4D2NA 3LIZH 3BVNB 3I6GB 5CZKA 3M8OL 1EEQA 4WDIA 1A7NH 1ONQA 3QUZC 5D1ZA 1RIVH 3C2SA 4Z78A 4Z95L 4N8PA 4NUGL 3AFLA 3T65B 4YJZL 1KCUL 3GSXB 1U3ZA 4JRYB 2G2RA 3SHSA 5JQ6H 4M61B 4GG6E 1KTLA 2FLBT 4DUXA 1PKQA 1ADQL 2HFEB 5IHZA 1E0OB 2DWEB 3C6SA 1F4WL 1EO8H 3MRCB 1TZHA 1I9IH 4G6ML 4HGMA 4OAWB 1LO5B 1G1YA 3DX9A 5E8NA 5BJTB 2RGSA 5E6IB 5DFWH 3SCMC 1Q1JL 2OR7A 4WU5A 2YD4A 3GBML 2QSTA 2JELL 4LVOB 5ADPL 4PV9B 2IEPA 2NW3A 5ERWB 4H88L 4ZUSA 2IPUG 3DO3A 1UB6A 4M7KL 5AG8A 1IAOB 3T3PE 3HZMA 4PGDB 1S7SA 2PYEA 4P9MH 4QRUA 2VXQH 3RU8H 1H0DB 2BVYA 2R0ZH 4NQTA 4YHIB 1BQHG 4XVSL 4HAGA 1NMBL 3BI9X 1ZT1B 2FZ3B 1EA9C 1PW3A 1CF8L 1NGWB 2WQ8A 5H35B 4GBXB 1CU4L 4H20H 4YGVA 3GJFK 3U4EA 3VFSA 3JWNC 1CD1A 1WTLA 3BZDA 5HDQL 4KROB 1UH4A 1IVLA 2OP4H 3RDTC 1BD2E 2DQJH 1FCGA 4X5WA 1FPTL 1LWRA 2XTJE 2XRAH 4GKOA 3ZSTA 4W6XB 4HIXL 5BRZE 4Y5YA 3UYOD 5D7IE 1LP9B 4XPTH 5EULV 4GW1A 1YEHL 3QQNA 1V7MH 3VE0B 3WXWH 1KPRA 2PXYA 5H94A 4A6YH 1EMTL 3DSFL 4OCWL 3D0LA 4QT5A 3BD4A 2PN5A 2DKMA 4HJJL 4JRXE 2R9HC 3WS6C 1HILB 3MRMA 3UZVB 2IADB 1ITCA 5IBTL 1N8ZA 2WBJA 3VXPB 3AMKA 4L9LC 3O45A 4PJAE 1PEZA 2ZCLH 4OGYL 1T04A 4OZGA 3W11C 4Y4KC 1I7TB 4MD5A 1A7OL 4GKNB 1OTUD 4M48L 4FXKB 4BH7B 1UH2A 1CBVL 4HX1B 3HAEH 2ZP0T 4Z7WB 4UIKL 4G8GE 2FIRT 4LMQE 2VL5B 3WL9A 2YPKA 3KLAA 3MUZ1 4UUJA 2HRPH 1BHGA 3UPRB 1ZXQA 3FZUC 1IEBA 2VLMD 5F7DB 1QYGH 1KXTB 4WV1B 3PXJA 3L3KB 1YJDC 1T1YA 6FABL 4ZUVB 1MHPH 5DJYB 3OZ9L 4NNYB 4NO0D 3SDDC 3UAJD 3LPGA 2IALA 3OQ3B 1A2YB 2IJ0C 4YZFF 3VXSB 2VWEE 1PQZA 2ADJB 1P4BH 5CINL 2JF1A 4FN0A 1X5HA 4RZCB 4NKOA 4ZMAT 1U58A 5JW5A 2MCPH 5DI8B 1QEWB 3FB7B 1LDPH 2EE3A 5IHUH 1DL7H 4IOFD 5MEOB 4GAYB 3WKNA 4X7CC 2Y36L 2DDQL 1XFPA 2V7HB 4GKSB 5BS0D 3VFPB 4MNHA 1WITA 4X6DF 4L3CB 3KYOA 4L8SB 2ATPB 4TYUA 5JXAH 4K3EL 5DEFB 1FJ1B 1KSRA 2NY2B 4OIIH 2IBBA 1QKZL 1OGAE 4X9FA 5MEPA 1CFTB 4OD2B 2H6PB 2DQFB 4Q58C 4UT6L 2C3XA 1NDGA 3RWFB 4MQXD 5C0CE 3TIEA 3C5SA 1FL5A 3A6BL 3S96B 4FTVB 5L2KB 5IHLB 4BFGA 5FOJA 4AM0B 1CZ8H 4WHTA 5J12B 2AEWA 2YD5A 3E2HC 5KAQF 2IANB 2ZUSA 2Z31A 3MUJA 2EXWD 4OZHA 5B38B 1Z3GH 3IXTB 3JSSA 4R96B 4P4KB 2QEJA 3B3IA 4PLNC 1P6AB 3B5GA 5F1KC 3VXRE 4MCYA 3MCLL 4RMTA 5GS1B 3QQ3B 4OZFA 4P2QE 1YECL 1RZKL 2IQAB 2WUBL 5T3ZD 3BPCB 3LKQA 5FKAB 3OXRB 4EUPA 4HHAA 4OV5B 4HBCH 1I3RA 1E27A 3C87A 3GMMA 3KPRB 3ALXA 3PL6D 5CIPA 5TH2A 2A77L 2W9DL 1VFAA 1FYHB 5IG7B 2ERJC 3QQ9D 4M5ZH 4NKMA 2EDJA 5JW4N 3F58L 5DVNA 4KKLD 5H8DA 3LH2H 3GSNB 3DX6A 3TA3C 1FVEB 5E7FA 1WEJL 3FN0H 1G7HB 1A64A 4I77H 3CX2A 4PJIE 3SE3A 3STZB 4XWOD 5GJTH 5LBSH 3U36A 3MRNA 1EZVX 2DMKA 4PY7A 3ZHKA 4G8FB 5JPNA 3S4SB 3U0TB 4BSVB 5I71C 2D03L 3BZEA 5HYQA 3BGFB 5SV4A 1CTOA 5ILTH 2BNRD 1IZJA 2BSTA 4XI5C 4DKFL 4L9LA 1CICB 4IRZH 4P59H 1KB5B 3VWJD 5EC2A 4Y4HA 1Q8MA 3JWOL 4JDTH 4Y4KA 3VRLF 3OJ2C 1GC1H 4HCRA 4FABL 5FO8B 4GSDL 1NJ9B 2P7TB 2ADIB 1XGRA 4JFZH 3CX5K 1R3JA 1N64H 1FC1A 1YEIL 4HJ0D 3KLDA 3H0TA 1CK0L 2FO4A 1JNJA 4ZSOA 2XN9B 1TTGA 1ZT4A 4GOSA 4PS4H 1ED3B 4BK4A 2E9WA 1X7QB 4LCWB 5DZOA 5JHDD 4MQTB 2D0FA 4PG2C 1QRNE 2F5AH 1MCSA 4ZFZA 1FIGH 1P9MC 4LLYA 4YXLL 3HG1D 3CFJB 3O9WB 1MIEH 3EO9H 2XNAA 5C0FA 5D96C 4NGHL 4PGJA 3O3DA 4KRPD 3CDGB 4GQ9L 5BVPH 4DGIL 3SDDA 4FOMA 4LF3B 1IL1A 4QF1A 5CGTA 5J1AA 5CSZA 4M00A 5FYLE 4NBZB 1A6TB 5IP4A 3W82A 2YPVL 2NY6C 3VXOB 3HI5L 4D0CA 3S3JA 1P2CB 1ZT7A 4QXUH 2HFGL 3BZ4B 1A6AA 3ARFC 1IGYB 4GRLB 1EBPA 4D3CL 2I9LB 4TTDD 4P5TB 3L5IA 3HPJB 5BXFA 1NFDB 4OTXL 1JPFB 1BAFH 5JNYB 4LEXL 1G7IB 4S11A 5TDOB 5B39A 4JKWA 3D25A 2LVCA 4JR9L 2E8YA 3Q5YA 1G6VK 2LTQC 2ZWLT 4PJBF 5ACMA 4WFED 1F3DH 4XPGH 1HQ4B 3OKEA 3ZE0E 5H37G 1NCCH 4NQSA 3VW3H 3AMLA 4PRAA 4WUUA 3HB3D 4WCYL 2VLJD 1A7PL 3BKJL 3HE7C 5EBGA 3BWAB 2GSGB 2J1KA 4U7SA 3VI4E 4LIQE 3BRGC 2O5ZH 1EHXA 3IAGC 4OD1L 43CAA 4Z6AT 1RUML 1AGEA 5SWQA 2FJGA 3IFPA 4RWYH 5J6HB 2GUOB 4OQ1A 4H0IA 3DTXB 4OGAD 4K3DL 1MHHA 3SDXF 5EFIB 1FNEB 2GJ6B 1J1PL 4G5ZH 1D7FA 1Q94A 1N2RB 1RJZB 1I9JL 1FNHA 5INCA 1FAIH 1NAMB 3FQTA 4G9DB 3V7AE 2OZ4L 2HFFB 5JDSB 1WF5A 4HIEA 3SDAA 5HTSA 3I02B 2FGWL 5FYJU 2FLRT 3KYKH 2OSLB 1YMME 1IGML 2NY5H 5DD1L 1LE9B 5CEZD 3RA7L 5CILH 4X4MA 5F89A 3QWOB 2H1PL 4DN3L 1J05A 3DYPA 2JB5L 4BKLB 1X5IA 2I07A 3VRJB 5JORA 3QEHA 2R4RH 4BFIB 4MYWB 1WCBB 2HG5B 3FQWB 3EJYD 4N9OB 4YBLC 2D4DA 5T1LB 2BDNL 3VFUB 4PB9L 4X7SH 1CT8B 1KJ2L 2VLKD 3M07A 3MRJA 1WZ1H 4MXWL 3C5ZD 4U3XA 5CZXD 1FDLH 1CIDA 1RUQL 4HPOL 3V4UL 4F9LC 1CXHA 1YEFH 2BOCA 3B2VH 5D2NE 1SM3H 1P69B 2HT4C 1RURH 5E5RB 1U93A 4PGBA 5M7QA 1ES0A 4WU7A 4LDOB 2X1QA 2VN4A 2X4SB 3I3EA 3S37X 1SHMA 2UYLB 3ARED 1J18A 2ZUUA 4PD4J 4XVUC 5DEGB 1ZLWK 1KEGH 1J5OL 1NMCB 4ONFL 5DUPL 3TWCH 3BAEH 4OM1H 1IGTA 1UQSB 2MHAB 3MLXH 1NGXA 4XP4H 3QCUL 4MD4B 4E41D 3VG0L 5GGSA 5GGRA 2XFXB 3JXAA 1NUFA 3ZKQD 4GFTB 4NFCA 1V5JA 3QDGD 3WFHA 3M1BA 1ZV5A 1BFSA 2BY2A 3UROR 1ZE3C 5FO7B 5IOPA 5ALBH 2ESVE 3TJHC 3E6HB 3IJHB 2HJLB 3JWOC 5CFHA 5DHXB 5IM7A 1FZJA 2FRGP 4JRYD 2IH1B 4EXPX 5ICXA 3TH2T 2X4QA 2JCCE 1KPUA 4IEFB 5FDWA 4XBPB 3GI9H 4CMMA 1JUFB 15C8L 1KBGL 4N0UB 4R3SA 3UP1A 4HBQA 2FL5A 3FTGA 4ELME 2DQIH 5E6ID 1NGQH 1HKFA 3JUZA 3QAZC 4X8JA 5EWIH 1UWXK 5C2UB 4CNIB 4FFVC 4P49A 5J06A 3S34H 1U2HA 1G6RL 1OGTA 4Z7VA 1G0XA 3LZFL 5IW6A 1DQTA 2NW2A 1RK0A 3QJHA 4MZ2A 4NJAL 4ODTL 1ZS8A 2XTLA 4P46A 4DUWA 3IGAB 3PNWB 4OUUB 3VH8A 5HYSG 4LAQH 4XPBL 3CVHH 3WFZA 1EBAA 4ZAKA 5GS0D 2JJTA 1URLA 2AERT 3D3VA 2L0DA 2VDLH 3P9LB 4FQXB 1JV5A 2NCMA 4LVNC 4L8CB 3B9KB 5EA0H 5C09E 1JTPA 4GBXD 3FOLA 3HZVA 2F53E 5IEHA 2R2EA 1BVKA 1ZVYA 2VZ1A 1EHLH 3DUHA 2J6EL 4MB4A 4YHPB 5I1LA 3FHAA 3TBYB 5GS0H 3B4NA 2H2SD 5DVLA 5DWUL 3QUZB 4AEIL 4BZ2L 4NDMA 2CKBB 2VLRB 4FQ2L 3Q1SL 4R0LA 4U6HA 1MCOH 1LEKA 3H6JA 4WWKA 4TULL 3GBLA 3QXVA 1J0HA 4ZO7A 2A38A 4ALAL 4LCUB 3VD4A 4MCZA 3ZSSA 2YA2A 3QISA 5CJ8A 4HXBL 2E7CA 4XPFL 3EYQD 3MUGB 4X7TB 3RWJA 5HYEA 3SCMB 4RGOL 4NHUA 2WIMA 3V6FA 2AJVH 2DQUH 5DD0L 1DANU 1KNOB 1I1YB 5EO1B 3WFDH 1KG0B 5J8OA 1OAXH 4LHUB 2DTML 5CWSB 1A7BA 3B9VA 4AEEA 1VGKB 5CJQL 1RU9L 4OFPA 3OPZH 3VD9A 3OJDA 1CE1L 5I73C 2Y6SC 1KENH 5FYLH 3K46A 1OQXA 1PKQE 2H2PD 1IC4L 4FFYL 4FQ1H 4ONHB 1RY7B 1UCBH 3DVFA 1C5DB 4U3HA 1TITA 5IUSA 1TZGH 4KHXL 4NQEA 5IVXA 1FHGA 4PJ8C 4LMQI 3T4YA 5F1IB 4J3SA 3MRIB 1CLYL 5ADOL 5I8KH 1UB5A 4X6CF 3RDTB 5ITFA 2J8UF 3IFOA 1RHHB 4XH2B 3WNOA 3RBGA 2CDGB 1MI5A 4MA1C 3VXSD 2EKJA 2FSEA 1HXYB 3NIGE 3WSQL 4HDIB 2PYEE 2YC1A 3ARRA 4HWZA 4GW5B 3Q3GB 2Z8WC 2AI0H 3X14A 1JF5A 2BCKA 5F71A 3UC0H 2Z4QB 3ZKNC 2W60B 4FQCL 2IFGA 2NXYC 3RWDB 5I18L 1T5XB 3LKOA 4LIQH 3ROOB 3HI6L 5FF6B 1MSPA 5E2WL 4B53A 3NMEA 1OAUH 1UZ8B 4FG6D 4O2FB 2NY2D 3Q5OA 1T66C 4RRPG 1X5KA 3BD5A 2DQCL 3UEZA 3CFBA 3CC5A 4KZEL 4FTVD 5L2KD 4KZDL 1SY6H 1GOFA 1G7PA 4QHMA 2AKRB 5FEBA 3MCG1 2JK5B 4YPGA 5DD3H 4NRZB 2IAND 3K2UL 4K8RH 1F4YH 4ISVA 2YD7A 1ORQA 2DBLL 3ET9F 1XZ0B 4WW2A 3IVKA 4QYOA 5J13C 2X9WA 3SQBA 3CK0H 5KSUB 2PYFB 3AAZA 5GRVL 4PGDA 3WV0A 4EXKA 4NKIL 5F8QC 4OZGE 3SE4A 2AK1H 2BK8A 4K9EH 3SKJL 2DYPA 2E5EA 1Q72H 1I3GL 1AFVL 1FVDB 2AEQH 2ZOKB 5I1IH 5KVFH 1LO3H 2R69L 4Z5RA 3RJQB 1OP5K 3QFJA 5C8JA 3QDMB 3FFCA 3QWRD 2GJJA 3ZDXE 3KPRD 5CAYB 1CD0A 2ITDB 1JI1A 2A1WL 2X6MA 1HHGB 4CRPA 3FB5A 3MBXL 4ETYA 4UV7L 1Z9SA 4EQ2A 2D9CA 3RVUD 4PRPB 3DRQA 1AI1H 4FQLH 4U2YA 4HIIB 4F7TB 4K7PX 3DJ9A 4MS8C 2B20A 1K85A 4G6FB 1CXIA 1P7QB 1RIUH 3MJ6A 4POZD 3HUJA 1KJ3H 1HN1A 3T3ME 3P0VH 2YEZB 1A9BB 4L29B 4H1LG 3BEVA 1BOGB 3BUYA 5GGTA 3UTQA 3G5XB 1QR1A 1YYLL 1JZ3A 3E2HB 4HAFA 3DHJA 2ICES 4GJTB 1CVSC 3MOQA 4LLVB 3BMWA 4NQCB 1JWUA 3WCYA 2XA8H 5IVOA 2CK0H 1OL0A 1R5VA 1SMAA 2CUHA 5EOCL 2MJWA 3FQRA 1CICD 3EJZC 2V2TB 3RKDC 2IBZX 3O11B 4LVHB 5JW4R 3PQYA 3IDNA 4U1JB 4XPHH 3PHQB 3VGHA 2QADC 2DQDL 2LAAA 1QP1A 2A9NL 4GAJH 5BW7A 2HJKA 3TESA 5HGBB 4HV8A 3PV6A 3LEXA 4AIZA 1A0QL 1W72L 3MJGX 4MJ6A 2K7QA 3MLZH 1LO0H 4JHBA 7FABH 3FCTA 4TUKH 3GIVA 3ECBA 2XN9D 5DQJA 2GY5A 2HTKD 3CD4A 1JZ6A 2XACC 4LCWD 3MV7A 5E8DL 3WIHA 3MNVA 4ZTOL 1PLGL 4PUBH 2HJFA 3GI8H 2ERJB 1EV2E 3O9WD 1MHEA 5ICZA 2EH8H 3NFNB 3RVVC 2VL4A 3QEGL 4OZHE 3X11A 4PJ8A 2J8HA 3ALWA 4B0MM 3C6LA 3QP3A 3ULUE 1IQWH 1Q38A 3TA3B 4OCNC 3ZDZE 4XNXL 3TPUB 3GMLB 4NZUH 3BPNC 1GGIL 4P2YA 1H3XA 3SBWC 1WFOA 5KSBB 1NBVH 4XP9H 2B1AL 4XMLH 4ODBD 4I13B 5EUKA 3VFNB 3O6FC 1FGNH 3FB7A 2DQHL 3KNBB 4HG4J 1VA9A 2PCPB 3QNZA 5MEOA 4YPJA 5IMLB 4FFWD 4GRLD 1VEMA 2XZQL 3O6ML 4P5TD 4X80L 3SY0B 1CLCA 2PTTA 4O4YH 2VQTA 1BLNB 3B2UC 3N1MC 4M6ML 4MNGE 4PJCF 4LU5L 3ZMRA 3MR9B 2EDOA 3DV6B 4FQQB 4UBDC 3CFKB 3U0PB 2DQFA 5KSVA 1ITBB 2ZCKH 3RWFA 3MJ9L 3RHWK 3LS5L 2EIZB 4Z0BL 1CQKA 4AM0A 4PRBB 5DD5L 1J0ZA 1PYWA 2YWYA 4YDKL 1I1AC 4PJ5A 5BV7L 4DQOH 3VFTB 3C9NB 1RPQA 2B0SL 4J3TA 3SE9L 3IDXH 3U7YH 4TN9A 3TVMC 1ZHNA 2M26A 2WINB 3H7LA 1IAMA 4NM4H 5C2BH 5IW1A 1ZANH 1B0WA 1GIGL 5JR1H 3PWJB 5D96B 2XKUA 1DBAH 2W1NA 3X12B 3G5YB 5D7KE 3TJEL 5DC0A 5JO5B 2Z35A 4GMTH 5KVMC 5A40E 3ARTA 3BIKB 4Z9KB 1ZK9A 4OV5A 5CBAB 4LLQA 2NY6B 1XIWB 5E8PB 1OM3H 1FFOB 5IW3A 1JRHH 1FFPA 1FYTA 1VGEL 2VAAB 3ARFB 4WGVB 4JANA 4WHYG 4WRLA 1KN2L 4ZSOE 1A4KA 4JVPA 4RA0C 2AW2A 4KTEH 1JHKH 4YFLF 4JO2L 1IT9L 1I1CA 1EAPB 4MJ2A 3AU1B 1RD6A 3P0YL 1WLHA 2LTQB 2MQ3A 3EDDA 1WV7T 5T1LD 4UDUB 5IB2B 4RGNE 4N5UA 5SWZB 1IM3A 2VAJA 3RGVB 4EEEA 2LABA 2WBWB 1KTDB 5F7NC 3VG9C 5ICYB 1RJYB 3EDKA 3N50A 4RFOH 1JTOA 3HE7B 3MJ8A 3SDYH 3UDWA 3ULVL 1JL8A 2PO6A 2RHEA 4YXKH 1ZTXL 5IESH 2V9TA 3NIDE 2FHFA 3T0VA 4YC2C 3WUWA 3FO9A 2FECI 5J0BA 2HH0H 2V5RA 1UM6L 4JG1L 3WDHA 4JCMA 2PR4H 3B9AA 1NFIA 4QXGH 4QRTB 3IDYB 5A2IH 3RNQA 3S5LA 4K3JH 5FHBL 1VACB 2YZ8A 2AV7A 4WUUE 1QPXA 1YYMH 4MMXC 3FMGH 2Q86B 2Q8BH 5KTEH 1TDQA 1IAKB 2P46B 3MRKA 1C7TA 2P49B 1D6EA 4LPXA 1XF3B 4J4PC 5MHSE 1IC7L 4KGJA 4XMKH 2MMXA 5C0BB 5FA3B 4AH2A 3ZZ1A 3CDGA 2A6IA 5SX4H 1F02I 4KQ4H 4F9PA 4LF3A 4HJGB 5JOFA 5D6DC 3QNYB 1QUNA 1U42A 4XXDB 2OXHA 5F6HI 4YBLB 3VXUB 4PJBB 4I3GA 5FYJE 1MRDL 2FO1A 2GY7B 4CMHC 3PWPB 4LSQL 1P2CA 1DE4B 5EBMA 1U8KB 4GRLA 3RI5K 2JLLA 5L0QC 5I8OL 3CLFH 3NH7L 5AYUH 1DZBA 3LB6C 3VFGH 3RUGF 5CD5D 3VXQA 3G5VA 1E4JA 4EI6B 4NZRH 1X44A 1UYWH 4X4ME 4XBEH 3MCKB 4MJ5B 4YWGL 5EORL 5T33H 1QBAA 4MNQB 3PUCA 5FCSH 1DVFC 1MAKA 3MLRH 1B6UA 1XEDA 1UJTA 4GRWF 2YD6A 1MRFL 2C3VB 1BFVH 1W0WA 1KJVB 1A6VH 1FLTX 4IHOB 4OUOA 3FQXA 3RTQC 5HHOB 3QZWB 1CGSH 4M5YH 5EDXA 3F7QA 1DQMH 2BVQA 5EIQA 2P47B 1SJEB 1P4LB 3CUPA 4AZ8A 3PWNB 4W6YB 3NCJH 2GTWB 3VI3F 3AS3A 4W68A 4FQXD 3AVEA 3K80A 5GS2H 1UC6A 3B9KD 4Y4FC 5EU6A 4PJ9C 1NCUA 3LV3B 4LSUL 1N5AB 3LQAC 4ACPA 4P4RB 1Y18B 3RWHA 1NCWL 3ZE1F 2X70B 4TNWF 5D9SB 1NLDH 1JNHA 1NAMA 2QHRL 2C26A 3QBTB 2BC4B 1KCRL 2W92A 4TVPL 4ZNCD 2VLRD 5I17A 1S3KL 5E2UL 4HWNA 5CBEB 5INDB 2WM0A 3I02A 4IBLT 4HUUB 3TT1H 3NFPA 4JZNB 3V4PL 1NAKL 4QY8A 1IBGL 4R90H 4QO1A 1LE9A 5I16B 3TYGH 3NTCL 4NRXB 3QWOA 4X6BB 2J5LC 3AXLB 3D0VB 5DT1H 3SCMD 4P2OA 3QHFL 4NFDA 2EYRA 3S36X 1CCZA 2DI9A 4LOUD 3K3QA 1K2DB 3VFRB 1K8DB 3EYVA 4LHUD 2AK4B 4OQTA 5HI3C 2ADFH 2VXTL 2FEEI 3ULUH 4LNRB 1NCBH 1CL7H 1O7VA 5BZWA 4XNQA 4OZFH 3W0WA 1SYVA 1JGUL 3OXSA 4N8VB 1OP9A 1ZLSH 2GIYA 4UQ3B 3AROA 4ZS7L 5C0NC 1JRHI 3QXAA 1LEGA 1P84K 2HT2C 4EUPH 2KDGA 2X4RA 5C6PB 2XYCA 3U4BH 4TOYL 1C16B 2F74B 2UYLA 4H25A 2IAMA 2JIXA 35C8H 4WFFD 1KTKE 3VGEA 5HGHB 2F54B 1F90L 2YXFA 3RDTD 5I74C 3VU2A 2QQQA 2XY2A 2QL1A 4WFEE 4Z7VE 4PRDB 4NYLA 4ODVL 4J3WA 4AQ1B 3DRTA 5FUZL 4HT1H 4D8PA 4NJ9L 5CMAB 4ZXBC 4JDZA 4HUWB 3TZVC 2XFXA 4JFFA 3O4LA 1P5VA 5SWSB 1TJGL 3D3VE 4NWUH 2R9HD 1A6ZA 2MSPA 2XPGB 2C4FT 3ULVC 1WAAA 4JY6A 4MZ3A 5CJXC 2BRRH 2DLFH 1U8LB 1AQKH 4NPYB 1U8PA 4J4PA 1RMFL 5DUMH 3H42L 4HC1A 1YY8A 2P24B 1RQ5A 4OCYL 2FX9L 4Z8FL 1JGVH 4HMDA 1TTUA 3SKUD 3MA9H 2DQTL 5I73B 2V17H 4OSUH 1FZKA 5F44A 3HNVL 5C0RH 3QXDB 4RSVA 1HHJB 5FYKU 1JUFA 2K1MA 4HCRH 3ESVF 2E3VA 1A7QH 1MIML 2VDPL 4U2ZA 1Z5LB 2OMNA 5CEZE 3QDHA 3FZUD 3U2SB 3OGCA 1L6ZA 1DBMH 2VR5A 2VRAA 3J7HA 5DSCA 3MRRA 2EE6A 4Z77A 5C7XL 4LRIC 4NQXA 2X1PA 1OTTC 3FT4B 5SX4I 4OUUA 4P2CG 4QXWA 3CFIC 1HKLH 4MA1B 1DBBL 3VFWB 2FIKB 3RTQA 2I60H 3DIFB 3W9DB 1OHQA 5DR5L 1KJ2B 3RL2B 5MP6L 2B2XL 1XH3A 1XGPA 3QDMD 1DEEA 4X5XB 2NR6C 5FUCC 3AUVA 1BEYL 4HFWB 4N8CH 2K9UA 4DKAA 2EC9T 2OR9H 2NXYB 3WO3B 3O3EA 5I1DB 4Y4FA 4PRPD 4UIMB 4HH8A 3TBSA 4NQEE 5IVXE 3KPMA 1LDSA 3GGWB 3JTTB 4ZPTA 4ZFFB 2DS4A 3CFCL 4G6FD 1P7QD 32C2A 2FH8A 3MFFA 4OZIF 5CP3A 1XGTB 3P2TA 4WEBH 4PRNB 4RGMC 5F7YC 3V0WH 3K2MC 3QUXC 4JQIH 4HFUL 1MI5E 3TP4A 1PAMA 4XNYH 5TGBB 4Z7QF 3LY6A 3BEWB 5DHYB 5JW3H 2FX8H 1HH9B 3MUGA 5AYQA 4GAGL 5I1GL 1QVOA 5DRXA 5AAWA 5C0IA 2C7UB 5EN2B 3KPTA 1Y6MR 3UJJH 1B6DA 4NQCD 2E7HA 3KHQA 4MD0B 5IJKC 1EEYA 4RFEA 5HHNA 3R0MA 4I3SH 3PP3H 5D7LB 5J13B 1A1NA 4N90E 1KELH 1LQSR 3LN5A 3BIAX 5K9JL 4X6CB 4EJ1C 2F8OA 2J8UB 5CJBA 5E4EC 1J8HA 3EGSA 3G6DH 2P5EA 4OCXH 3TV3L 3WXVH 4V1DA 5DQ9A 4ODUB 4RMQA 5DJZB 5ITBH 5FYJH 5D7SL 4U3CA 3F6LA 3L7EB 1F3JA 2ED9A 2HLAB 3KPPA 4RNRA 3OL2A 4PJXA 4G3YH 3I2CH 1MCFA 1C5DA 3HC0A 5FM4A 5C86A 2XZCH 4D9QE 1MJ8L 4L5FL 2CXKA 3L6FA 4OLXL 5I1KL 4P57B 1HSBB 4AMKL 1M6OB 1QLRB 2J88H 2MNUA 4K23L 4QRPB 3EKCA 3U0WL 2XKNB 3S37H 3TA3D 4CU6A 5F3BA 1G6RB 3I50L 5C0JA 1R24A 1T5WB 1U3HC 1UXWA 3PIQB 4JPWH 3THML 1AXSB 4LASH 2X4UB 3NFSH 4KTDH 3MXVH 1P4IL 2YBRA 2VUYA 5C07B 4TPRH 1RUAH 3QFJE 4LSVH 3D39B 3DUSB 4K7FA 5HGAB 4ZXBA 1MWAA 3FFCE 4EDXB 1T0MB 4ZFOL 1FORL 2FATL 3BP4B 5EUOF 4MVBC 5IMMB 2COQA 5EU4B 2CLRB 1QO3A 1WBYA 5CJXA 5SX5K 2AJXL 4X98A 4XI5D 1JNNL 2GEEA 1WBXB 2D7NA 4LLUB 4YX2L 2A74A 3GSRB 2QSCH 3ZO0A 2Y5TB 2D4FA 2QADB 5LWYH 5J3HD 2EECA 1G7QB 4Y89A 2F8XC 1LO4H 1A02N 3R06A 5D7JC 3LVEA 5E2TL 1T7YA 3HUJE 1XF4A 4IOIA 2G5RA 4Y5XA 3P4OA 4Q2ZA 5HVWA 4WFHD 3HKFA 4KC3B 1XZ0A 4Q6YA 2VUOA 3CFDB 1HIML 3B6SB 1XGYH 3O2WL 2VKXA 2PYFA 1DSFL 1F3DJ 3FO2A 4JM2F 4L8DB 4LRNL 4RDQG 3VCLA 3F7YB 5C71A 3N0PB 3PGCA 3S88H 3LIZL 4H0HB 1HHKB 1ZHLB 1A7NL 1ZA6A 1RIVL 4LVEA 1U95A 1I8IB 3INUH 3PQYE 4QCIA 2AV1A 1WICA 1MUJB 3BSZH 3IXAB 1S5IH 4BA8A 2NY6D 1XIWD 2GT9B 5JQ6L 4G6JH 4F33A 3O6FB 4JY4A 3ARFD 3WFBH 4QNPE 2ARJQ 1OSPH 1EO8L 1T3FB 4JJ5A 1I9IL 1OAYH 3F7VA 3HE6B 5D5MF 3KS0J 5HHQB 3MV7E 1W0VB 4UMGA 3DOSA 4PJHB 3VRIA 1DLHA 4NBYB 2QKIB 4B41A 2I5YH 1F6LL 5CHNB 1YUHA 5ESVB 1FO0A 2LVEA 1U91B 4XX1G 1VFUA 5K59F 4PGEB 3O3BB 5SWZD 4P9ML 3RGVD 1OF2A 2VXQL 1Q9WA 3IDMB 3MLUH 3RU8L 3TCXA 2R0ZL 1UACH 1I1AB 2N7BA 1FVCB 2DIBA 2P48B 3HE7D 3KPQA 2PW2B 4NQCA 4PRIB 4H5SB 3TVMB 4U0QB 1EHNA 4NNPH 3MLSH 4P3WA 5TDPB 1NBZA 5FGCB 4H20L 4J6RL 5DQDH 5IJKA 3O11A 3N1PC 4HGKC 5D6CB 1X5ZA 4HLZG 1KT2A 4LARH 4X0KB 1EUTA 1P7KA 2OP4L 5JPMA 4J8RB 1QPPA 1VPOH 2XRAL 3GSVA 2EICA 4B7LA 1AR1D 1ADQA 5DJ0A 4XT1C 4XPTL 1KPVB 4Q9QH 3QEUA 1Q9OB 3GSOB 4LL9A 4XNUH 1V7ML 1C5CH 3WXWL 4PJ5E 3V6OC 4A6YL 4NOBA 5F7WC 4X6DA 3NFNA 2P8LA 4DN4H 1KEMH 1U8NA 1QFWM 1JTTA 3B8SA 5C0BD 1T1WB 1CFNA 2ARWA 4RCAA 2ZCLL 5GS3A 5J1TC 1KIUA 3RZCC 5DZNA 4ZO9A 2X4TB 3E0GA 3VXUD 5L8KB 5DHVA 2GCYB 4PP2B 3PWPD 2N7AA 5E24E 3VFNA 3VWKB 3BP7A 2H8PA 3ISWA 1MFNA 4G42A 1ACYH 2PCPA 1R3HB 4E5XB 1G9MC 3B9DA 4PG9A 4B5EA 4P5MB 2Q7YA 3P11H 2HRPL 2HT4D 1FYTE 3QG6A 1U8JB 3PABA 4FA8A 3WNLA 1OB1A 4RMVA 2SEBA 4P9HC 2D7MA 2LE9A 1QYGL 3L3DB 4YC2B 4FQQA 3QIBC 4MNQD 1MHPL 2B5IC 2ICWB 5D1QC 1OWWA 2CIKA 3SGJA 2JJVA 5F7MC 1M7DB 5I8EB 3DVIA 5FV2A 5HHOD 3UX9B 1KB9K 3F12A 2YMXH 1FSKC 1P4BL 3MC0A 3H9SA 1QSEB 4BQ8A 1D6VH 4CJ1A 3LN4B 3PGFH 2MCPL 1BJ8A 4LSRH 1FN4B 1LDPL 5IHUL 1DL7L 5EG6C 1G7MA 1N59B 2BXYA 5B3JF 3QH3B 4NKQB 5JO5A 1X4YA 1X5XA 3X13B 5JXAL 1E6OH 1FL3A 2FX7H 3D2UA 4OIIL 1TZIA 3O6KH 4E9LA 1I7RB 2ZCHH 4CMHB 5F3HB 5HDBF 4ONGH 1LK2A 2KQNA 1UT9A 4FQHB 3EOBB 1W72B 2BHUA 3LKRB 4I9WD 4HH9A 5DD6B 1Z6JT 5IIEA 4LQFH 5HVGB 5IKCA 4YHYC 1F2XK 3TT3H 1BQHA 3P9MB 3SN6N 1MFEL 3BDBA 5GGVY 4Y1AB 5HYIA 1EAPA 1GCFA 2RCSL 1KC5H 1F5WA 1INQB 4POYA 1I1FB 4OCRH 1CXEA 1Z3GL 3MRLA 3T0EA 4FFVD 1DVFB 4UTAH 2HN7A 1BBJB 2R1YB 5LGHH 2LQRA 4Y16C 2AK4D 1NBYB 2EEAA 1CI5A 3ME0A 4PJ7B 2OTUA 5E70A 4KQ3H 3RGVA 4NZTH 3ZTJG 4RDQF 2Q8AH 4A2LA 3DLQR 4NQVB 1RJYA 2FB4H 2IG2H 4F2MA 4XVTH 4N1HB 4WEUD 3IKKA 4HUVB 2P5WB 3PDOA 4HBCL 2CLZB 1YPZF 4YE4H 3L95A 1XR8B 4PJ9B 3ZDYE 1HHHB 4UB0H 1M1SA 3ZHLA 1MPAH 1MCNA 3P40A 1O0VA 4M5ZL 2F54D 3L5HA 3Q2CA 4ZDHB 3LH2L 2CSPA 5I1HH 3BHBA 2DJUA 2HWZH 2BRQA 1MCRA 4WO4A 4KK5C 4OB5H 1L7TH 1A4JA 3GEWB 4I77L 3OKOB 1LE5B 4OI8A 4P3CH 3UTPD 5GJTL 5LBSL 4KKNA 1S7RB 1YEGH 1K8IA 5SWSD 5HJ3A 1ZHKB 2EYTA 1IARB 3BGMB 2J5LB 4HMEA 1TJHH 3JBG7 5GGTH 5EU6E 5IEKA 1JZ8A 4I5BB 3U1SH 5ILTL 3QNYA 2KKQA 3UZQA 4IRZL 1JF1A 1WTGT 3PWPA 1KLGB 5EIIB 4WHCA 1JYNA 3GUTB 4JDTL 2VZVA 1TQCC 1GC1L 3IRZA 4NNXB 4GG8A 4X6FA 3BQUC 1INEH 1YN6B 2DLIA 4JFZL 3OAYH 4NT6A 4RIRB 2Y6SD 4CUCA 1N64L 2O61A 1KLUA 5DJDB 3CPLB 4K55A 4PV8A 4YQXH 4ODXB 1KGCE 4R8WH 3MRBA 3QXWA 4PRHA 4PS4L 1QSFB 1AHWC 3MYZA 4IRJA 3SDXA 4HKBB 1JK8B 1FIGL 4MNQA 4ZOCA 2H26A 4KJYB 3UBXB 1MIEL 3EO9L 4RQQA 5GGQH 4F37F 4QRRB 4NSKA 2C3VA 3QSKB 2EXYC 3H3BC 3MRHA 3EJJX 3SEPA 4LPCA 1YZZA 1B2WH 5DTFA 1U92A 5BVPL 1S7XB 4I3RH 3PWNA 2AABH 5HGGS 3D69B 1NEZB 3WEXA 1FIEA 1QLEH 3TZVB 4QXUL 1I85A 2HTLC 3FQUB 2R56H 3W0WE 3TO4C 5LQBH 2X1WL 2NXYD 3MJ7B 5DJ6A 1D5ZA 1EVTC 4M03A 4ZOBA 3RWCB 4Z76B 3VD3A 1BAFL 3FB6A 3BPLC 3C8HA 3C60A 1FNSH 1VADA 3MRGB 4BFEA 5I9QC 3HMWH 2UUDH 2YS4A 2HYMA 4JM4H 2A2QT 2GSIB 1NCCL 3VW3L 3AC0A 2EDWA 4PREB 2ZG3A 4P3DA 5A16A 3VXNB 3DROB 4BQCA 3KXFA 4P23C 2DN7A 4OKVB 2O5ZL 5CGMA 4JFFE 3WJLC 3O4LE 5EH1A 4L4TA 5CJOH 1IGCH 4RWYL 2V7NB 2QQLH 3KDMB 5B8CA 2DI7A 1WAAE 3MROB 5SV3A 1YNKL 4Q6IC 5JLZB 1GGBH 4G5ZL 3ARDC 1ZEAH 4PLJC 1P1ZB 5EOTB 1FAIL 1GZQA 3LDBB 4JFXB 2APTA 3QA3A 4KVCH 2YSSA 3QEQB 3IU3A 5C0AA 1H3VA 3BP5B 5K33A 1ZGLM 2BY1A 4F8TA 3BO8A 4JFDA 4DGYH 4I4WB 5EZLA 1WIPA 4X9BA 2DAVA 2IPTH 5F6HJ 3KYKL 2R1XB 2C4XA 3BJLA 4MXVF 2NY5L 4U6XA 1AJ7L 1Q9KA 2D0HA 2BP3A 1HK6A 3QCVH 2A0LC 2DRUA 3SKOB 5E99H 1Y0LB 4QRPD 1PDKA 4MS8D 2R4RL 3FONB 4CN4A 4IIQB 1F11A 4MQ7A 1ZA3B 5CMAA 1I75A 3TO2A 1GGCH 3L5WA 4RGMB 5CGYC 4QHUB 2Y4SA 3QUXB 4X7SL 3GKZA 4XP6H 3O41B 2OK0H 4G8IB 1WZ1L 2ZUQC 2AJZB 5C07D 5IQ7H 1FDLL 1TIUA 3D39D 5GGUB 1YEFL 4GG6F 1BVLB 2EKSB 2ADGB 1D5BA 3B2VL 4TSBH 1SM3L 2Z92A 3EFFB 3WIFA 3L7FA 1RURL 1HZHH 1G7JA 5GIRA 1NCTA 4CVZA 4PGZA 1QG3A 2HAZA 5A2JH 3HC4L 5I75C 5ENWA 3EJZD 3U46A 3RKDD 2BSRB 4D0DA 5E4EB 3UO1H 1LNUA 3V5DB 3SOBH 3T08A 2QADD 1JZ2A 4ENED 4NUJB 4UNVA 1U8OB 4CVWA 1IAIH 4ESKA 5IB5B 3TWCL 2HA1A 3BAEL 2NLJA 3QXDA 2UWEF 1H3WM 4OM1L 4MA3A 3F7PC 5IF0A 3BQUA 4XXCA 3MLXL 4HUKB 4XP4L 1ZLVH 3FJTA 3STBA 4FQJH 5ESQB 4H8WH 2ZOLB 3EYFA 4C83A 5CS7A 4WFGD 1UJ3A 1QFHA 2DMCA 5D2LA 4U05A 3RL1A 5DEZA 3P4NB 3OKLB 4GH7B 1YEEH 1AXIB 5DF0A 2DM2A 2J2ZA 1BIIA 3LKNB 3DVGA 5E1AA 4HF5H 4U31A 3OKMB 5GZND 3ILQC 5ALBL 3FOMB 4HK3J 3NN8B 4OZIB 1IM9A 1KJ2A 1J8HE 1SQ2N 4I0PC 1GC1C 1G7LB 2P5EE 3NPSB 4V1DE 2VLLA 2C4FU 3G6AB 3O6FD 5KSAA 2BSSB 5IT2H 1OTSC 3QDJB 2H32H 2NZIA 3DMMA 3GI9L 3H3KA 2X4NB 4I2XB 3WJJC 4F15C 4LHJB 4PJXE 2G9HB 3HE6D 5C0EB 1LMKA 4UIMA 1MCBA 1RUKH 1NGQL 2YPLB 3KPOA 3QIUA 3KVQA 3B2UD 4QTIH 2YRZA 5DMKB 2WWMC 3MFGB 4YNYB 5EWIL 3BH8A 2MFNA 3DBXB 3S34L 3VJ6B 2AXJA 4JGUA 4PRNA 5MI0C 3STLB 4PJAF 1XF2B 3ROLB 3U7WH 5DHYA 3DETC 4ZQKA 3VFMA 1FL6B 4LAQL 3CVHL 5K9OA 1I1AD 2D31B 4PRID 5CJ5A 4M43H 1D5IH 1BREA 5EA0L 4UT9H 5AWNH 1D9KC 1HYSD 1EHLL 2W59A 3GSQB 5DXWA 3S36H 4DZBA 2P42B 5GS0L 1CQYA 2J8UA 4LLWA 4R4FH 2PTUA 3TYFB 3E3QE 2FD6L 1DQJB 4X99A 1Q9LB 4OZ4A 1QZ1A 4G80B 5ANMB 4M7ZC 3HS0B 4NCC1 4EKXA 3EDJA 1MCOL 5KBNC 2HLAA 4Y19A 2F58H 2EC9U 1PBYA 1DDHA 3ARGB 2XTJC 3RWEB 3N9GH 1CGUA 4ZODA 5HHME 3MGOB 1DQQB 2Y25A 2A9ML 1MRCH 2NZ9C 2VZUA 3UTSB 1M6OA 4BSWB 2QQKH 2AJVL 3SDCC 2DQUL 1ND0B 5T3XD 3LSOB 1U3YA 1UKSA 3RPIA 5F72S 1CFQA 1OAXL 1S78C 4Q7DA 1AXSA 3EIFA 3FO1A 1I8MA 3I75B 3OPZL 4JFYB 3VWKD 2B7DT 1ZSDA 5LG1A 4AQOA 4LSPH 1R3KA 2ITCB 2A73B 4YH6A 1KENL 5FYLL 5E7BA 3V9FA 5T1KA 2Y06H 5BOPA 3N06B 3UTTB 5AUMA 5LVEA 1UCBL 1IE5A 2BNQB 2NY5C 2J6EA 3L5XH 1TZGL 1KFAL 4JM2B 5BZDB 3AB0C 1F3RB 5F96H 5B38G 4H26B 1NUDA 4ODWB 2V5SA 1Z9LA 1G7QA 5ACZA 3HRZA 5D70H 3BP6B 4JG0H 3RRQA 5C0DA 1E6JH 1ZLVK 3IDGB 3O6LH 4LAJH 1QSED 1YEDA 3L3GA 3SGKA 2VWEC 2AI0L 4GRMB 4NQDB 1XF5B 3UC0L 4JHWH 1FZOA 3MV8B 4U1LB 5D5MB 4NQCE 5ABDE 3CXDH 5HD8C 4LIQL 5DA0B 5FYKD 5K93A 4TQEH 1OAUL 3P4MB 3VXTA 5LGKA 4RX4A 1J1XH 5DJAB 2G60H 4OI9A 2A6JA 4NM8L 3VGAC 1JYWA 4YAQB 4YZFE 4LCYA 1YMHB 3OKNB 4KMQA 5I66A 2BSED 1IAII 1XCTA 4HC1H 3FFDA 1T4KA 1SY6L 1BZ9A 3HE6A 4CAGA 2HRLA 4O58H 5HYSA 5TQ0H 4APQD 2Z93B 4OGXH 2ZSVB 3LB6D 1E4XH 4Y1AD 3NAAH 3G08B 1F4YL 4O2CB 5KJRH 3H7BB 3QYCA 3S4SG 1YA5A 3KHOA 4QRSB 4X6DE 3QIBB 3TPKA 4F80A 2JJSA 4X5LA 3CK0L 2B5IB 3IJYB 5D1QB 5AZEH 3DVNB 5GQBA 1GOHA 5JUEH 4DFIA 4C54A 3DO7B 2AK1L 1OARH 4K9EL 1C08B 1Q72L 7CGTA 5I1IL 2AEQL 3GHEH 5KVFL 1LO3L 2GK0A 2GQHA 4LSDA 1FSKB 4KDVA 4DCQA 1KCLA 1FNGA 3MRQB 5I76B 4JZJB 4PRIA 2P5WD 4UOW1 1FV1A 5C9JA 1WVZA 1S7UB 3MLTA 4F7EA 3OR6B 3IT8D 3S7GA 1FFRA 3FT3B 4ZFOB 3C8DA 2XG5A 5I2IB 1AI1L 2FECL 4FQLL 4PLKC 3DV4A 5E9DA 2A6DA 1HHIB 2VABB 3QUYA 4OCMC 5IR1B 5IB3B 1U36A 2MPAH 4OIAA 3OMZA 5ETUB 5AZ2L 5KS9B 3MLWH 4OBSA 3LQAH 1RIUL 3FT2B 3EUUA 4OLVH 1S9WA 1Q9OA 1KJ3L 3CMOH 3W5MA 1MCWM 4QXTA 3OR7B 3P0VL 3DXAB 3MMEB 4KJQC 3LEYH 3H9SE 3G6JB 3GKWH 3IF1A 3MYJB 5D7IA 1EERB 4KRNA 3CH1A 2XA8L 4PJCA 2CK0L 3TBTA 5JTWA 4FZEH 3C8KA 4MWFB 4CN1A 1EJ6A 5F7KC 4J7RA 4NCDA 3KYMB 4Y16B 3GRWA 4X4YB 2AQ1A 2M8XA 5HI3D 1HOCB 5DGQA 4XPHL 4HKJA 3WIIH 1U8QA 2OL3A 5MEQA 4GAJL 5EB9A 3L1OH 5GRVK 4JE4B 1X5LA 1N6UA 1H8NA 4WY7H 3QFDA 4LEOA 5BMFH 3MLZL 3H9HA 1LO0L 1KB5L 7FABL 1AY1H 4Z7UF 4TUKL 3TIDB 1TNNA 3ZE0F 5AEAA 1II4E 4OIBA 1N3NA 1QSFD 5C0ND 2NX5B 1D5MA 1LK3H 3SJVB 5K9QI 4PUBL 4TUOB 4HKZB 3EW3B 5IWLC 2EH8L 4QRRD 3CX5J 2OQJB 3O2DA 1ZHBA 4JKKA 5F9WB 3T0EE 3KAAA 4HGWB 1MCEA 1IQWL 4S0TD 3RZWA 4NRYA 3U9UA 4GLRI 1NDMA 1S5HA 4NZUL 4M7LT 1BMGA 3QXUA 3B5HA 5DJXB 1ORSA 3KWWB 1AGDA 1I8LC 1S9YB 3CIQA 4RRPA 1NBVL 4XP9L 1PZ5B 4TUJB 4XMLL 1GAFH 3TZVD 3WN5C 4M6NH 5GSRB 3WD5H 3RHWF 1FGNL 5DJCA 5E56A 5E8OB 3JTSB 3JWDC 4GKZA 2ENYA 3ULVD 1FFNA 4OF6A 4X4XB 3F7RA 4O4YL 3Q6FB 1RJLB 1I7RA 4PJGB 4U0RC 2YUXA 4LLDB 2ZCKL 4OKDA 1TQCB 4LSSH 4FQHA 2VZTA 5FUOH 3AS2A 2YR3A 1I7ZA 1MCHA 4YDJB 2APXA 5GSVA 1TQBB 5C08A 4ZNEA 5C9KA 4S1QH 2KZWA 4APQA 4EI5C 3W39A 1HE7A 1AD9A 4DQOL 1H3GA 1ETZB 3RWIB 1INQA 3U7YL 4A6YB 1AHWB 1F97A 4I18C 5FAAA 3D85A 4NM4L 5C2BL 2E7LC 4Z7NE 1ZANL 2VTFA 4HIJB 5ID1A 3KR3H 3O8XC 4LKCB 5JR1L 1IGIH 1DBAL 5JXEA 1OTTD 3QUKB 3BUTA 3HMXH 5ISZB 1MLBB 4M8QA 4AL8H 4GMTL 5FA4A 3QEQD 3PWPE 4JVUA 2KPNA 1LEIB 3O3AB 2P5WA 1X6NA 3MA7B 3QG7H 3V0VB 3D18A 5HYJA 3HAEB 1OM3L 2NR6D 1JRHL 1XR9B 1HHHA 1OT2A 2H3NB 2G5BB 3OKKA 1TCRA 1KJMA 4H1LA 3TO4B 4OLZH 4MSWB 4PRHE 4F7MB 1K6QH 3QO0B 1U8HA 4K8RC 1JHKL 4KTEL 4O02H 1FE8H 1OPGH 3SDXE 1IQDB 1GXEA 4JPIA 4MNQE 1GGUA 4G7YH 3ULSB 1T1ZB 3BPLB 2FEDD 3QQ4B 5CEXA 2YD8A 3BPOC 3PF2A 3MJ9A 2W65B 1W0YT 2W0FB 4F3FA 5I9QB 1JZ4A 4K9EC 5F1NB 3QUXD 1S7RA 5KVEH 1YQVH 3PWLB 1KIPB 1QBLH 1W8OA 3MRFB 4X6EA 4RFOL 1H8OA 3RUGA 1K3IA 1A3RH 4P23B 5EU3B 3SDYL 4GUPA 4YXKL 4UDTA 5IESL 1PY9A 4PBWD 3DX8A 1H15B 5D2NC 4DW2H 4ELMF 4Q6IB 1I1RA 3QJFB 2EDTA 3ARDB 3G5ZB 3X3GH 4XAKE 5KVDH 3KPNA 3M8OH 4F7CA 2PR4L 5DRWA 4EBQH 3LRSA 2R8SH 5D1XC 1YDPA 4QXGL 4YHNB 4WENB 1ZWIB 1LGVA 4EVNA 5L9DH 1T22B 4I9WE 3B9EA 4JO4H 2NNAA 3TN0B 4O51B 4BQ9A 4K3JL 1R0AH 4ELKA 1XGUB 1WZLA 1DJSA 1EK3A 1YYML 3FMGL 1ADQH 3FRPG 2Q8BL 5KTEL 3KXFE 4ZUTB 1F4WH 2UZIH 4HULB 3QULA 2NMSA 4GXUN 1KV3A 1CGXA 3N85H 4XB8A 4L4TE 3LKSB 3WS3B 4JFEA 3RGHA 5M94B 4P2RD 5DMIH 3NGBC 3HI1B 5K9KB 4TNWK 4KFZC 4H88H 4JQXA 3KYNB 3L3OB 5J9PB 2CR6A 2VO5A 1HXMA 5TF1H 3WE6B 3C5JB 3P77B 3OB0K 1NFDF 5DHVH 5J1SC 2GHWB 1UKQA 2ZUQB 5C0AE 3MBEC 4ZYKA 5EBWB 3QDJD 4JFDE 3CLFL 1A1OB 5AYUL 1JN6B 2R0LH 4MVBD 3VFGL 1YC8A 3O3UN 5F8RC 1GYAA 2YPLD 5D71H 5DA4A 4PFEA 3HR5A 4XPAH 1UYWL 5BVJB 4WNQA 5T33L 5DFVC 5I1CH 1S8DA 1NEUA 3MLRL 3VDCA 1KN4L 1MFDH 1BFVL 1V3KA 1A6VL 2HKHH 4LHUG 3QNXA 1JPST 1CGSL 4M5YL 2QQNH 1DQML 3M17A 3E8UH 4RAUA 4WUKH 3UTPE 3WDIA 3NCJL 3R1GH 3HPLA 2RFXA 4N5ED 5GRYA 2L4OA 4XBGB 4U1MB 1A47A 4L4VB 4MGXA 3WMSA 1JMXA 4YK4C 2V7NA 2AEPH 2D3VA 1KCKA 4I18A 5F9JB 3AM8C 1SYSA 2E7LA 3C08L 2Q6WB 1C5BH 2RJMA 5E5UB 5EBLB 2FGZA 4KK6D 5HI4D 1OP3K 1NLDL 1B0GA 2BVPA 3OBAA 1U8IA 4XCEB 1T89C 4WEMB 1IKNC 2QR0A 2P8PB 3K74B 5GISH 4KVNH 3REVA 3ARGD 3TT1L 2IFFL 4G8EB 2IPKA 5HDLA 3NCBB 4WTXA 4R90L 1CFSA 3NIFF 1IEAB 4HQQH 3TYGL 3NIGF 4GG6B 4F15B 3IJSA 3IDJB 3D6GA 2X4OB 2BNUB 1L7IH 5DT1L 4NO2B 4OM0L 3UTSD 1AGBA 4M9PA 1H5BC 3IKCA 4U1NB 3EZJB 3REWB 3BRDA 3P73A 3QPQD 1LILA 4IIQA 4J3VA 5D2LE 4CU7A 5F97E 1UKTA 1ZA3A 1RZ8B 3JVGA 1R5WA 6FABH 5MI0B 2ADFL 1GJIA 1UFUA 2Y23A 3BH9B 5FECA