4XPAH

X-ray structure of drosophila dopamine transporter bound to 3,4dichlorophenethylamine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xpaH01
2PN5A 5I6XB 3MXWH 5J56B 4CVZA 1RZFL 1U8HB 1YN6B 4DEPB 2B4CL 1XCQB 5K9JH 2FH8A 4DGIL 4PFEA 2DM2A 3D2UB 5IVZA 5FDWB 4EDWL 2PO6A 1PKQB 1AXSA 2MFNA 2R1XB 2BCKB 1GC1L 3HE7C 4FQLH 1TCRA 3FO1A 4XXDA 1WC7B 2YN5A 5HHPA 3O4LE 2EDHA 5I8CB 4PUBH 1EJOL 2CJUH 4LNRA 3SQBA 2VR4A 5SWSA 4QTIH 1GGIH 3ZKXC 4TRPH 2OTUA 1UYWH 5BO1L 3BUYB 2X5PA 2D7TL 1IKNC 1K9TA 2AEQL 1DVFC 4OT1L 3QHFL 4DZBB 2P8PA 3HZYB 1JPTL 1J88A 3PXJA 4GUPB 4JPIA 3LKPB 3MV9E 2J4WH 3I50L 5EO0B 3HNSH 1RMFH 4RAVB 3ARVA 4PJEE 2YUVA 4CVZB 1X5ZA 2MCG1 4MDIB 5H37G 5DRZA 1IILE 4P2OD 5HJ3A 1DQTA 3O2WL 5IVZB 5T3XD 1CT8A 2PW1A 2PO6B 1AXSB 1NAMH 5FB8B 1CXIA 2XY1A 4O2CA 3C8DA 2Y25A 4L3EE 4ZNCD 1J1XH 5TE6L 4PJ8A 1TCRB 1YA5A 3OPZL 3FO1B 1EAPA 2J12B 4XXDB 2FIRT 3C6LA 4L29A 5HHPB 4WTWA 3C08H 4FXLA 4XPHL 5EC2A 2DBLH 4LNRB 4EOWL 5SWSB 4JG1L 1KBGL 1CICC 2NX5A 3S96A 4I8DA 4Z95L 4JM4L 2EIDA 2GITA 1N6QL 3GMNA 4GS7B 1Q8MA 2OTUB 5IB4A 1BGXH 4ZFOL 4OF7A 5I2IA 3RIFK 4YZFF 1G6VK 4V2BA 5CZVL 1XF1A 3UBXG 1LO3H 4PJGA 1Q94A 2P8PB 2CRMA 3VXSD 1ERNA 1GGBL 4UAOB 4JPIB 3VH8G 5I18H 4HJ0D 4WY7L 1YC7A 3GSRA 4XGZA 1A6UH 1T4KA 1Q72L 4OGYH 4Q0XH 4RGNC 2LABA 4LFHG 1DN2A 2WBJD 5MEOA 2FB4L 5DO2C 5DWUL 5M95B 1DQQA 4NC2B 1YEKL 2BFVH 5DRZB 5HJ3B 2VR5A 3WIIL 1CT8B 4WI6A 2PW1B 2P48B 4HPYL 5CKGA 5D7LE 4O2CB 4N0CC 5DJZA 4Y4HD 5EU7C 5J12B 4G9DA 5TE7L 3EOTL 1LO5A 4PJ8B 5D6CA 2W9DL 4XPAL 3HN3A 3JUYA 3EDJA 1MJUH 1EAPB 1DBJL 5L2KA 3C6LB 2ZNXA 4JM2D 4L29B 2JE8A 4EXPX 3IJSA 4L5FL 5EC2B 4XP4H 3CH1B 3FT4A 3SDYH 4JCMA 2NX5B 1I1AC 3S96B 1JF6A 4D0CA 3OG6B 2GITB 5LXGL 3GMNB 1VCAA 5C0RH 5IB4B 4OZIF 3BRGC 1ETZA 1Q9WA 3PWJA 5I2IB 3LQAH 2FSEA 1Q0XL 1TVDA 1F45A 1AXIB 4PJGB 3VW3L 4X8XA 1LO2H 1Q94B 4N5EC 4MB4A 1T2XA 1EEQA 4QOKD 5KSAA 1E4WH 4MJID 3GSRB 4XGZB 1J0ZA 2QL1A 1T4KB 3U1SL 5FM4A 3RZCA 3V5DB 3BYYA 3RWIB 4GRWE 2A77H 4QKXB 5MEOB 5D2NE 3CLFL 2FWOA 1KPVA 4PGEA 1DQQB 3EO9H 4YXLH 3QWQB 4X5LA 4R4FL 3LHPL 1JNHA 4BELD 4EUPH 1F4WH 2WINA 2BZDA 4KK9C 4J3UA 3CVIH 5DJZB 4UDUA 4G9DB 1KCSL 2AP2A 4O02H 4Z7QE 1LO5B 1OWRM 5D6CB 1BJ1J 4JM2F 1MCBA 1NEZG 5MHSD 4NN6B 5L2KB 5KZCD 2A6DA 3IJSB 5F9WB 4U1GC 1FL5A 4JQXA 4QYOA 4PRPE 2ADFH 1UM5H 4TYUA 3LQMA 3FT4B 3GIZH 2QQNL 4YHNA 5IESH 3TJHD 1DDHA 4JHWH 4D0CB 5HVGB 4UB0H 1ETZB 1Q9WB 3PWJB 5CP3H 1DANU 3JWDC 4P2RD 5C70A 5DT1H 1JHLL 4KXZI 3RU8L 3UJJH 1F4HA 2FSEB 3OR7A 2H2PD 3C9NB 1YUHA 3GSUA 3B5TA 1F4YL 3R0NA 5KSAB 2IANE 2DTMH 1ED3A 3HTLX 5FYJE 1BJ1H 3INUL 3LSOA 3RZCB 3WBDA 3HC4L 4U1LA 1YMMD 1KGCE 5BMFL 2O5YH 1DJSA 4Z7VE 3GNMH 2DQUH 3LH2L 1IKFH 2UWEF 3MLRH 2F53A 2AK1H 3ZL4L 4X4YA 2FWOB 1KPVB 4PGEB 1QFUH 1UZ6F 1NFDF 2YKLL 1BWWA 1ZHKA 4HMEA 2VZTA 1JNHB 2WINB 5GHWL 1X5FA 5A2JH 1YN7A 4UDUB 2Q7YA 4KAQH 5C2UB 5HVHC 1JFQH 4XWOD 4S2SA 2YSSA 3BE1H 2O5XH 2HT4D 2DLGA 5HD8C 3KXFE 4ZO8A 1MFDH 2KQMA 4MQXC 4MQTB 4G6JL 2A6DB 4RMWA 1FL5B 3EHBD 4QYOB 5EO9A 1OPGH 2GJ6D 4XBPA 1FLTX 2HKFH 3IJHA 3HMXH 1CBVH 4F7MA 4YHNB 1N59A 2NY1C 3AM8C 1DDHB 5ILTL 1E27A 4HV8A 1WAAA 5IUSA 4NN7B 1IAIM 4MAYD 4MNQA 3MLSH 2JJWA 5JUEH 4R3SA 4OBRA 3F7QA 3OR7B 2BNQE 4V1DE 4LBEA 4WTZG 1YUHB 4M62H 3CK0L 1EVUA 1CR9L 2LVCA 1PDKA 3OB8A 4JN1L 4JEGB 4I3GA 5DFVC 1ED3B 4NUJA 3AB0B 1B6UA 1HOCA 3ZDZF 5I1IH 3LSOB 4U1LB 5GISL 3KPMA 1RZJH 5E8DL 4GH7B 2A2QT 5IFHH 5EOQL 2F53B 4X4YB 4JO3L 5DURD 4KMLB 1N0LA 3H9SD 2R29H 5E2UH 4JO4H 3HI5H 1ZHKB 4EQ2A 5ERWA 4HIXH 2DQIH 4FP8H 3BPNB 5CJOH 1YN7B 2Q7YB 4PJIF 3MRHA 1QQDA 3S6CA 1ZT7A 4XP9H 4S2SB 2YSSB 5HHQA 2CDGA 3QCTH 3WE6A 2H9GA 4YO0B 4EIZC 5KVGL 1T6WA 5BRZD 1T20A 4G8EA 5EO9B 5DRWA 3S3PA 2OBGA 2VUYA 4XBPB 1EBPA 2XZAL 3IJHB 3GZKA 4F7MB 1N59B 3CDYA 2GKIA 1BD2A 5TF1H 3MO1A 1E27B 4HV8B 4P2QE 1L7IH 4JRXD 4MNQB 3JV4A 1JMZA 4KRPD 2BRRH 1K8DA 4K8RL 3BJLA 3VFSA 1NAKL 4R3SB 4XNMA 3WCYA 3FB6A 1YECH 3WFDL 2XA8H 4LKCA 5E9DE 4LBEB 3WJJC 2NXZB 2AEPL 3RVUD 2YRPA 1MY5A 2G9HA 2R56L 3HFMH 3VI4F 4NUJB 1UWEL 4PJDA 1U92A 2DKMA 4QWWD 1HOCB 3H42L 4X98A 2Z31C 5FGRA 5CKAA 5GSVA 3KPMB 4NC0B 5HHMB 5BXFA 2VXQH 4IOFD 1RFDL 1QUNA 1X5GA 1QFOA 3V9FA 2VDNL 4HWUA 3D9AL 2NY2D 3RJQB 2AABH 5ERWB 5E70A 4KY1H 1BFVH 4ZXBD 4LPXA 1QQDB 4X6FA 2SEBA 1ZT7B 4NIKB 4R97C 4KROD 3L3DA 5HHQB 1WCBA 2CDGB 1WJ3A 1T1ZA 3B2VH 3GEWB 5C0CA 3WFBH 4HKXA 3WE6B 1JWUA 2H9GB 3I6GA 4BH8A 1MCQA 2QADB 4PY8I 3QPXH 1T20B 4G8EB 4WWKD 4WEBL 3S35H 5DRWB 1AC0A 2DYPA 3SCMC 3W9DA 3UZEA 3G6DH 1BD2B 3CX5K 3MO1B 3WLWD 5JNYA 1JTOA 4G42A 2Y6SD 3JV4B 4LCWA 4HIIA 1KXTB 1QFWH 2HA1A 4OQ1A 3VFSB 1T04A 2VRAA 3QBTB 1DQJA 4XNMB 5BS0A 1ACZA 5C0NC 3FB6B 1OW0A 3T0BA 4Y2DD 3DARA 4LKCB 5H37H 4TQEH 3REWA 2WBKA 3MRQA 5IW6A 4HIJA 3QIUA 4PPTA 4L1DA 2DMCA 3OWEA 4PJDB 2VZUA 4X98B 5GSVB 1DCLA 1N6VA 5BXFB 2VDLH 3NGBC 1TFHA 1RZGA 2ARWA 2WLYA 2DLHA 1ZLSH 2JTDA 3RZWA 5IGXL 3ARSA 1S7XA 4J6RH 4MVBC 3V6OC 1BF8A 4JY4A 2OM5A 1AH1A 4Q9RL 2EKJA 1HKFA 3WO4B 2ERJC 4X6DE 2X2YA 4X6FB 2SEBB 1NGYA 3L3DB 4OD1L 4LAJH 3GO1L 1WCBB 4YHOL 1T1ZB 4M7LH 5C0CB 2I9LA 4HKXB 4ZFGL 3ZKNC 1A7NL 1JWUB 4D9RD 3I6GB 4BH8B 4UTBH 4I18C 4QTHA 1ZMYA 2F8VA 4KKBD 3T0EC 3MX0A 4CMHC 2HT3D 4FFWC 2DYPB 3W9DB 3U6RA 1IE5A 5D2LE 4KQ3L 4IM8A 4P9MH 3O6FD 5JNYB 5B3JF 4G42B 1EJ6A 4LCWB 4HIIB 5J9PA 2CKNA 1NUNB 5IFJA 1T04B 3ZTNL 3H3PH 5BS0B 4YHIA 5E99H 4OFIA 2IPUG 3MNWA 5E8NA 4HSQA 2GT9A 4PJAA 5IKCA 3C60D 3UPAA 5F9JA 2V17H 3MRQB 5IW6B 1JI1A 3BSZL 3EAKA 4HIJB 1CXLA 3QIUB 1S78D 5I8EA 3QP3A 1O7VA 4FQQA 5DGRA 4HD9A 1MRDH 5J89A 2APXA 1RK1B 1F8TL 2BMKA 4JFZH 1JZ7A 4UI2A 1RZGB 4ONFL 1X44A 1P84J 3LIZL 2ZUXA 1C5CL 3NFSL 3OG4B 3O2DL 3OGOE 1S7XB 3D85A 4JY4B 3NPSB 1MRFL 3RVWC 1VDGA 3CVHA 4XI5C 4GAJL 4ELKA 1X5AA 1E6OH 4Y1AA 5CILH 4NJAL 3GBNL 2ED8A 3L9RA 4HUKB 5SX4H 1NGYB 3K8MA 3L5JA 3L6FA 2Y1VA 3GI9L 2I9LB 1OP3H 1JL8A 4OAWA 2DQJH 1N0XH 3HMWH 2LU7A 1S9YA 3DURA 5JZ7D 2EECA 4Q97A 1RHFA 2L4OA 5D1ZD 4OFYD 2VN4A 3CDFA 4H8WH 2J8HA 1V05A 4MLIA 3U6RB 4LEXH 3I9GH 1MCOH 2XTLA 5LVEA 2F58L 2GSGA 4Q9QL 5J9PB 5EBLA 5KS9F 4GFTB 2NY5L 5IFJB 3KLDA 3NFPA 4GG8A 4YHIB 4P2RE 3MNWB 5E8NB 2GT9B 4PJAB 5IKCB 3FO0H 3WFEH 5HYSA 5F9JB 3SDAA 4JREB 2E7MA 5ICXA 5C08A 5I8EB 4FQQB 1QYGH 1X4ZA 3E3QE 5IEHA 3FFDA 2BMKB 3E1F1 4WFED 5IP4A 5B38G 1JRHI 4TUOA 2VISB 1YMME 1Z0NA 3KAAA 1NCBL 1GYAA 4OV6F 2BVEA 3O9WD 4L4TA 4MQ7A 4HJ0C 3QHZH 5GS1A 4HK0A 1G7HA 5KTEH 4JZNA 2UZYB 1A5FH 3ORJA 1A47A 3D85B 2EDTA 3CVHB 3HR6A 1IAIH 2J8OA 1JHTA 4ELKB 4Y1AB 4NQEA 4XB8A 3GSOA 1NFKA 3QEUA 3L9RB 3HG1D 1MIEH 4HK3N 3L6FB 4XP6L 4HCRH 3NAAH 4OAWB 2G5BA 5MP6L 5KAQF 1BVLA 3KPOA 1OTTD 4G8GA 1UG9A 1S9YB 1AE6H 3PWNA 3DURB 3QIBD 4Y4HC 1A3LL 1ZANH 3L7EA 3KPRD 4ZFFA 4JFDA 1F3RB 4WCYH 1FBIH 3VFNA 4IRSA 4M43H 3MLZL 3QH3A 5FIEA 2GSGB 3B5HA 1T22A 5H8DA 5I9QB 2BK8A 5EBLB 4L8CA 3NFPB 4GG8B 1KEGH 1A14L 5HYSB 3SDAB 5ICXB 3BKYL 1DBMH 2ICCA 3HAEA 4X7EC 5D1XA 1A64A 1H15A 5IEHB 1RY7B 4F8TA 1KENH 3FFDB 1XGRA 5I15H 2HMIC 5D7JA 1LP9E 1MAJA 4TUOB 3IU4L 1XZ0A 4FQCL 3KR3H 5T3ZH 3NIDF 7CGTA 4L4TB 4MQ7B 5CFHA 1G9ML 2DQHH 4S1SH 5GS1B 4HK0B 4U1HA 1G7HB 2N56A 4JFYA 1EH9A 4JZNB 2DDQH 4L8SC 3H9SE 2EXWD 4FXGA 2GI7A 5JPNA 2KL6A 4JRYE 4D3CH 1JHTB 4BFGA 3GSOB 3QEUB 1Y18A 1C5BL 2VLKA 4GQPH 4N90E 4OB5H 1MFAL 3C2AL 3IDNA 4QGYA 3Q6GL 5C0JA 2G5BB 1TQCC 4JJHA 5I75C 1RV6X 1BVLB 3KPOB 1MCPH 4G8GB 3PWNB 4D2NA 3DYPA 3WNPA 4OLYL 3L7EB 4OLZH 2AXGA 4JFDB 4TUJA 4ZFFB 4WO4A 5DC4B 1OQXA 4MDJA 4IRSB 3VFNB 4GSDL 3ARFA 1RJZA 3QH3B 5HDBE 3RTQD 3BUTA 4DCQA 4YGAB 1WT5A 1M7IA 4XNXH 4L8CB 2BY1A 3UTQA 1UGNA 3NVQA 3AMLA 5DJXA 1R3JA 5JMOC 1I8KA 4P99A 1EO8H 3HAEB 5D1XB 4GRLD 1WBYA 4WI4A 4PS4H 1H15B 1CDJA 2HN7A 2RBLA 3VGHA 5D7JB 2BSSA 2H2PC 4E0RA 4U0RB 3DETD 1XZ0B 3KJ4C 3SKJH 3TWCL 4EN3D 2QQLH 3SGEI 4U1HB 1YYML 1QRND 2DS4A 4G9FD 4HUXA 3MREA 4O9HH 4FXGB 5I1KL 5JPNB 1DLHA 3GB7A 1R5WA 1KXQE 5I17A 4H20L 4LL9A 3WD5L 1Y18B 5L88L 3UP1A 3OJMB 2VLKB 4LPCA 5EUKA 5C0JB 1K6QH 3NH7H 2YWYA 1U9KA 3SE3A 1WZ1H 2OJZH 2CKBH 3MRIA 5JOFA 1BIIA 2AKRA 1W72A 2AXGB 3MRBA 4TUJB 4Q2ZA 4WO4B 1DQML 3NABH 4MDJB 1CXHA 3OR6A 1GJIA 2XOTA 3ARFB 1RJZB 1U8LA 5HTSA 4NC1C 5B39G 4DCQB 3MA9L 5ACMA 1M7IB 1L4IA 4NRXA 1HCFX 3UTQB 3PQYB 3C09C 4RISH 1OB1A 5DJXB 1R3JB 2L7JA 5CP7A 5CEYA 4OIAA 4MAYC 4OIBA 4PREA 4AIZA 1WBYB 2VLJA 4XPFL 2HN7B 4X6BA 2NY7L 3RGVA 2BSSB 3KPPA 4O4YH 4E0RB 1F6LL 4WEUD 4HFUL 4UQ3A 2X1OA 1JN6A 4XAKE 4CL7A 5H35A 5F89B 2LE9A 1C8PA 2XA3A 2VXTH 3DX7A 3MFFA 1BBDH 1YY9D 4F9LC 1JWSA 5JHDA 4HUXB 3MREB 2ITCA 1NC4A 5DC0A 4NNXA 2Z92A 4E41D 2FJFA 3RAJL 5E56A 1L0QA 1DLHB 3GB7B 1R5WB 1DSFL 5I17B 1CE6A 3ARWA 4R0LA 1NQBA 3RBSA 1YEHH 3HI6L 3UO1L 4YHLH 5EU3A 3VWKC 3VGGA 4BSJA 5EUKB 1GGCH 2HFGH 3HE6C 4D9RE 2I26N 1KTRL 2X40A 3GMRA 2D0FA 1UXWA 7FABL 3MRIB 1TZGL 5JOFB 1BIIB 2YZ1A 1HZHL 2AKRB 4AMKL 1W72B 5EULV 4ZOCA 3MRBB 2VLRA 4Q2ZB 5E2TL 1GAFL 3OR6B 1KV3A 1EFXD 1U8LB 4RWHA 5E6IC 4N0YH 1LEIA 1UM6H 5EORL 4L4VE 4HK3J 3ESUF 4K9EL 1EHLH 4NRXB 3HUJF 2VITA 5GS0L 3FQUA 3ET9F 3WO3B 4XB7A 1OB1B 4JFOA 3TT3H 1IZJA 5CP7B 5CEYB 1JYNA 2V7HA 4KI5C 1IGIL 1N7MH 3AAZA 4YK4C 5INCA 3NCJH 5DEFA 4QCIB 4AIZB 4CVUA 2VLJB 4NNYA 4UT9L 4LASL 4LLDA 4X6BB 1A6WH 3RGVB 3MLVH 3KPPB 2EC9U 4AIOA 1F3JA 4I2XA 5ALBH 4UQ3B 5H35B 2Y9RT 1JN6B 3TO4A 1R3KA 1X5HA 3DX7B 3KLAA 3MFFB 3J7HA 2P43B 4M1GL 5F9AC 1JWSB 4M4PA 5JHDB 4YUEL 2ITCB 1NC4B 1A22B 1P5VA 2Z92B 1AI1H 2BRQA 3GK8H 1SEBA 3IRPX 2FJFB 5J11C 3WMSA 2YPKA 2A1WH 3DI3B 3F65A 2VDOL 4IOFC 1CE6B 4PB9L 4R0LB 2PYED 1JRHL 5EU3B 2Y72A 1CZ8H 1QLEH 5FO8A 5CD5D 3DNKA 2PF6A 4JKMA 3SHSA 1KCVH 3B9VA 4KUZL 1BJ8A 2WMPA 4ORGA 3GMRB 5T33H 4M02A 1QSFE 1UXWB 4KROC 4N8VG 4ZS7H 3NA4A 2VLRB 3MV01 3GBLA 4RFEA 4PJCE 4I4WA 1EO7A 4YFLI 4YWGL 4WWKC 1LEIB 1QOKA 4KHXH 2MCPL 2FNBA 1A9BA 3LMJL 2VITB 3FQUB 4JFOB 5IJKC 3ESVF 2V7HB 4HEPG 1RUMH 2CXGA 3MBEA 3AAZB 5INCB 3NA9L 2XQBL 5DEFB 3FN0H 4NNYB 2AI0L 5ESQA 4LLDB 3U7WL 5HPOA 3D0VA 3QUMA 4P2YA 3W11D 3L3GA 1P53A 4WFEE 3MLYH 1F3JB 1GHFL 3ZYZA 4M1DL 1HNGA 4I2XB 5D71H 3TO4B 1R3KB 4LARH 3KLAB 3U9PH 4BJLA 4QHKI 2FHFA 2IAMC 1PLGH 1A6PA 5E7FA 1SEBB 4HJGA 2YPKB 4P23C 3TV3H 3V52L 2NY3B 2CGRH 4X6CF 1IGJB 4KK5D 3DIFA 4LIQE 4JPVH 4KZEL 4R4BA 2NYYD 1HN1A 2R0ZH 3LB6D 3HG1E 2VZ1A 3EW3B 1YJDL 1YYLH 4YHYB 4RSVA 4OQTH 4YE4L 5EUOA 2OZ4L 3QG6A 4ORGB 1OD9A 1JVKA 3TZVC 2AQ3A 4LP4A 1C1EL 5IB1A 4CADA 4MMXC 3QULA 1OSZA 3ARED 4UT6H 2OS7A 3WFCH 4Y19A 3RY6A 5B4MD 4XPBL 4P5TA 3WXVH 3BKJH 4ORZC 4FFVC 1BWMA 4HS8L 2UVEA 5EU7E 4AYFA 4L3CA 3MBEB 2BERA 3BHBA 3EJYC 4GRMA 1ACYL 1CG9A 1UCTA 5ESQB 5GGRA 3D0VB 1YEIL 3QUMB 1VFUA 1MJ8H 2DMKA 3L3GB 3JZ7A 3ZKMD 4AQ1B 4KJYA 1S78C 5DVNA 1LE5A 1GC1H 1RZKL 1SBBA 4LPYA 1LK3L 3WLBA 2C4FT 1T7WA 5BOZG 3IFPA 4ZTOL 4RCAA 3NIGF 4KRMB 4HJGB 2QHRL 3DIFB 1EJOH 4R4BB 2JJSC 1ZLUH 4P46C 1JBJA 4U31A 1DBBH 5CJ8A 5EUOB 3QG6B 4S1QL 4S1DD 5HI4D 3EO1A 5C0BD 2AXFA 3VXMA 1Q9OA 4CADB 5IWLC 4JFFD 4BH7A 3QULB 1OSZB 2FZ3A 3QHFH 1P7QD 4UV4L 4PJ9C 4Y19B 5E8EA 1EHXA 2FEEI 4ONOA 3MODL 4M93B 4P5TB 4HUMB 2DLFL 3VXOA 1SMAA 2ZSVA 4KKLC 3ZKQD 4DUXA 1IKNA 4XVJH 4BFIA 5IF0A 2VL4A 4LFHD 4L3CB 5GGTL 3BHBB 3LKRA 1BQLL 2M26A 5D7IA 4PJXA 5GRWA 1FL6A 4X7SL 4GRMB 2HAZA 1CG9B 3QDMD 4XAWL 4JDZB 4UNTA 3M1BA 4XPGL 2D7NA 4M5YL 5GGRB 4RFOL 2VDQL 1YZZA 3H6JA 4OCRL 2COQA 4GKSA 2NZ9C 1CU4L 1NLBL 3P11L 4KJYB 2DQTL 3S36L 5CZXC 4PBXA 3WKML 1LE5B 5TE6H 1KCUL 4HAFA 3SGJA 2DQDH 2R2BA 3WLBB 4G9FE 3OPZH 1G0DA 1IC5L 2R4RL 3IFPB 2J6EH 4YEEA 2ZG1A 2CO6B 3O9WC 4JO2L 4XPHH 3MRGA 4Z0BL 3MJ7A 5EZIH 2P5WA 4OLEA 4EOWH 3IKCA 2ORBL 1KBGH 1ZVHA 4JG1H 5I1HL 1DFBH 5HYEA 1N6QH 1JPSL 1QPXA 5J13C 3ROLA 3EO1B 4DTGH 2CRZA 3VXMB 1Q9OB 4NZJA 4BH7B 2FX9L 1CICA 3JXAA 4Q6IA 3TEUA 2FZ3B 5E8EB 1B88A 3O4OC 5HHOA 1D5IL 1I9JL 3PDGA 4HH9A 1ZV5A 4WY7H 3OAUH 3VXOB 1IGMH 3CXHJ 1Q72H 5IF0B 4BFIB 3OAZH 3LKRB 4D9LH 2D4FA 5D7IB 4PJXB 5F7UA 1FL6B 4ZQKA 4AL8L 5DWUH 3M1BB 1U36A 2JB5L 2HYMA 5LGHH 3WIIH 3HC3H 2DTSA 5LQBL 4HPYH 4GKSB 1SVCP 3FQWA 4G5ZH 5TE7H 4TTDC 2R2BB 3DSFL 3H9HA 2OMBA 4XPAH 1FH5H 1IBGH 1JF1A 1DBJH 1FVCA 1R3LA 3F6LA 4I3RH 3I84A 4IRZL 3DVNA 3Q5YA 3MRGB 4HGWA 3GJEA 3MJ7B 2P5WB 4HUWA 1CLZL 3IKCB 1DZBA 1QA9A 4LSQH 5FCUL 1FGNL 3CSPA 4GO6B 3ROLB 2PXYD 4HAGA 2F15A 3MR9A 3RVTD 1CICB 1I1AA 1F02I 2NY6C 3L5XL 4Q6IB 3P0VH 3OZ9H 4XTRC 1CVRA 9CGTA 2ZUWA 5HHOB 3CCHA 4HH9B 2QHLA 4X9HA 2VSDA 1CXEA 2ICEA 4LLQA 3EJJX 1CD0A 4UNUA 1FAKT 5D8JH 5E6ZA 4LQFH 4R7NA 3P0YL 4O2EA 3O3UN 4ZQKB 5CUSL 1YNKL 5GGUA 1A4KA 5IHLB 3E2HC 4RGNB 5DMYA 3MGOA 4R4FH 1F42A 1VEPA 5IB5A 3A6CL 4OUOA 3FQWB 4NJ9H 4NYLA 3P4LA 4RAUB 4GRLC 2EDQA 3H9HB 2FD6L 1B4RA 1JF1B 5FGSA 3IJYA 1FVCB 1R3LB 3DETC 1CD9B 1LEGA 5A3ID 3G6JF 3M8OL 5T3ZD 3RFZC 1QACA 2ESVD 4MD5A 3GRWH 3DVNB 5FKAA 1R6VA 3GJEB 4HGWB 2IQAA 2PYEE 5D5MF 3IXAA 4HUWB 4XMPL 4DN3H 1W72L 5D72L 4HLZG 1QA9B 1U2HA 5DYOA 1OTUC 4GKZA 1E28A 2WWMD 3DUSA 4QRQA 3T08A 3VA6A 3MR9B 4QRPA 1I1AB 3KNBA 2EZ0D 4UOW0 3T3MF 4PLJD 3V4UL 3CCHB 4P4RA 3VXRD 1I7ZA 3HC4H 2GJZA 4LLQB 1ZAGA 2H2SD 4R7NB 3LH2H 4O2EB 4QRRA 4M6NH 3T09A 2NY4D 2AEWA 2VZOA 2XRAH 5GGUB 1A4KB 1DE4A 2HT2D 2YKLH 1LHZA 5IJVA 2EH7L 3MGOB 4AEIL 1EIBA 5IB5B 2XZCL 5DJDA 3NFNA 4HKZA 1A1MA 3I75A 1NCNA 4NYLB 3OJVC 1CL7I 5F3HA 2RIKA 2FGWH 1XIWC 5HVWA 5I1JL 3DJ9A 4MNGA 1INEH 3IJYB 2Q87A 5HDLA 3TVMD 5DMGD 1LEGB 4G6JH 3VGDA 2EDKA 2X70A 4MD5B 1VPOL 1K85A 1G7PA 5FKAB 4YHPA 3BZFA 5L6YH 1SJXA 4WFGD 2IQAB 3IXAB 1A1NA 4NQTA 4RQQA 1G0YR 1INQA 5SWZD 5DYOB 4OGZA 4Y5XC 3IDGA 3KYAA 4HWBA 4GKZB 4BZ2H 5I1CL 3VI3E 1LGVA 3FO9A 1CVSC 4D0DB 3Q5TA 1E28B 3VFWA 4ODBD 2UY6A 3DUSB 4QRQB 5CIPA 1OLZA 3G04A 2BOBB 1GIGL 4QRPB 3KNBB 3AM8A 3T2OA 1RIUL 4FFZL 3WNNA 2R69H 4GAFB 3S3JA 4JN1H 3EKCA 2VXUL 3PG2A 4P4RB 4LVOB 5ANMA 5C0AA 5F7EH 1H3PH 4M48H 4M9OA 3ULVD 4FTVD 1I7ZB 4DGYL 1JNNH 4CRPA 2GJZB 1A7OH 3N1MC 2HJLA 3WXWL 4M7LT 4QRRB 2AJUL 4HT1L 4DK6A 2UUDH 3T3PE 2DI8A 2GK2A 3K7UA 1DE4B 2FEEL 2Q6WA 1V7NL 4JPKL 5IJVB 1XH3A 3DX6A 1J8HA 3LDBB 1U93A 5DJDB 3NFNB 3N06B 1A1MB 4HKZB 4U49A 3I75B 3SQOL 1DQDH 3TF7C 1X6NA 5F3HB 2W59A 4MNGB 4KVCL 1FNFA 2X70B 4Y88A 1A7BA 1FNEA 4NM4L 5D2NA 4BYHA 1G7PB 4YHPB 1FPTL 3BZFB 5HVHB 3CX2A 4OCMC 4PJHA 1A1NB 4UT7L 4KGLA 3GSWA 4RQQB 3U7AA 3MXVH 1INQB 3CSBA 4I5BA 1EUTA 5JR1H 2X4QA 3IDGB 1L6XA 3FO9B 3JBG7 3VCLA 3VFWB 5C0BE 5CIPB 3WDIA 3G04B 3BDBA 5TGBA 3SKNA 2WM0A 3SDXE 5CD5C 2M8XA 4YBLC 4HF5H 4PRPA 5ISZA 1BJMA 5ANMB 5C0AB 2GHWB 1HQ4A 4FABH 5IVXA 1UWXH 4YPGA 3QUML 1D5MA 2ZPKH 4N0UE 1D5ZA 1CLOL 2HJLB 4QRUA 2V5SA 2XACC 5D70L 4LDEB 1RFDH 3T0VA 1WQVT 3G5VA 2VDNH 4Z18A 3X17A 3D9AH 3CXDL 3QXWA 4WGVB 2Z31A 2VDKH 1XH3B 3DX6B 4P57A 1J8HB 1A7PL 2E27L 1U93B 3TN0D 2VLMD 3QUYC 1MCNA 3T2NL 3X3FL 4QY8A 5IQ9A 1V7ML 4RX4A 4K8RC 3WS3A 3PWVA 3FT2A 5D2NB 1NSNL 1TETL 3BH9A 4BZYA 2MWCA 1AGBA 4LLVA 4PJHB 3GSWB 1MF2H 1TVHA 3TBTA 4I5BB 4LCCC 3VXUA 2W0PA 2X4QB 3BMWA 4FZEH 3ZDXF 1SEQH 4OFVA 4FQJH 4JY6A 1OL0A 1HHIA 4OCXH 3DXAE 3VCLB 1X6LA 4P4KD 4HWEL 5TGBB 3VFRA 3SKNB 1MQKL 3SCMA 3A0OA 2MSPA 1IGCH 2FLBT 5TFSH 5B8CC 2RAMA 4PRPB 5ISZB 1NUFA 3SDCA 2HVKA 1Z9SA 2W92A 3GHEL 2DLIA 3CSYA 3E6HA 1CN4A 1HQ4B 5IVXB 4OD3H 1WICA 3V0AC 4YPGB 1D5MB 1J86A 1EFQA 2EXYD 1D5ZB 5B4MC 4QRUB 4YDLB 1WIUA 5DD3L 2D7MA 1T7YA 1QNZH 3I6LD 5C09D 3QXTA 1LO0H 3ABZA 2GFBA 2B0SH 3G5VB 4UMGA 5IGXH 5L2JA 3QAZC 4WEMB 2Z31B 4CKVX 5DMKA 1T1XA 4CN1A 4P57B 1DBAL 4Q9RH 2X89A 3LRGA 1VACA 4NP4L 4G80A 4P3DA 3V4VH 4QY8B 1S7VA 2V2XA 3WSQL 1D6VH 5IQ9B 2RGSA 4OD1H 5CMAA 4KVNL 3GO1H 4YHOH 3V6OA 4ZFGH 3WS3B 1WIOA 3PWVB 1JGLL 3FT2B 3V5KA 1ORSA 4BFEA 2VZ3A 1OSPH 1H3GA 1SY6H 2X1PA 1DP0A 3BH9B 1TXKA 1S7SA 2Q7NA 2A0LC 1AGBB 4LLVB 3NN8A 4R97B 1TVHB 5TDNA 4WGWB 3TBTB 1UM4L 3VXUB 4X80L 5DJ8B 2FBOJ 3RPIA 3E6FA 4I18A 1JMXA 4JY6B 1OAKL 1HHIB 3ARPA 2PO6C 3ZTNH 2I5YL 2DD8H 2YPLE 3DX9A 3S5LA 4HQQL 3SCMB 3TA3D 1D9KD 3BDXA 1RD6A 4WWID 1YEEH 1NC2D 1OAYH 4NWTH 3GMMA 4S1DC 2W9EL 3SDCB 2HVKB 3W2DL 1MCSA 5HGBA 3CSYB 3E6HB 3MUJA 2CMRH 1F8TH 2NW2A 5DUBA 4NKIL 4TVPL 4WRLA 5FKPA 3UEZA 3M17A 2MKLC 4KXZH 5DFWH 1MI5D 4PR5A 1U8JA 3LIZH 4L9DA 2GFBB 3PUCA 3NFSH 4CBPA 3O2DH 5L2JB 3D39B 1MRFH 1TDQA 4HULB 5DMKB 1T1XB 1TVBA 2YA0A 5J6GA 1VACB 5HGAA 4N5UA 1QBMH 4HX1A 4G80B 4P3DB 4NJAH 2VZSA 1FORL 1S7VB 2V2XB 3QNZA 1Q9LA 3UTOA 5CMAB 1FYTD 5EA0H 1IARB 2V7NA 2ICWJ 3ZYOA 1MAKA 5D1QD 3V5KB 1ORSB 3RUGF 3UJIL 4URTB 4MAUH 2ESVE 2MNUA 1FE8L 1S7SB 4JLRA 3P4MA 3NN8B 3OAYH 5TDNB 4M00A 3RPIB 4YXHL 1CL7L 3E6FB 4BQBA 4Q9QH 4I18B 5KW9H 4KTDL 5HVFB 1NGZA 1K4CA 2NY5H 4OF8A 3U4EB 4K2UL 3DX9B 3S5LB 1HKLH 5FDYA 5KVEL 4ETQA 3HA0A 1A0QL 3SY0A 1A1OA 3B83A 1ZT1A 4PJ8C 4FZ8H 3AS2A 4KJQD 3GMMB 5HGBB 1KJ2H 1ODAA 2I60L 1N26A 4W6YB 3WNOA 2N7BA 2NW2B 5DUBB 2AERT 1FC2D 3QHTC 5ACLA 4PJBE 5FKPB 4KU1A 1GGYA 2JELL 1NMBH 2BNRE 3M17B 1AGDA 2WUCL 4PR5B 1U8JB 4OZIA 2HFFA 4H8WC 1F11A 3QO1A 4QF1A 1OD7A 3VFVB 4S10A 1TVBB 4HLZH 3VXSA 5J6GB 2GK0A 2EDXA 5HGAB 1L7TH 4HX1B 5F21B 4HBQA 2CRYA 3V6ZA 4XP1H 2YD4A 2W07A 3QNZB 1Q9LB 3AS1A 3IDIA 5C07A 2J88H 3EOBA 4NC1E 1MQ8A 2V7NB 4MXWH 2WBJA 5MP6H 1KEMH 3ARZA 4PJ7E 1X5IA 5F9DC 3QEHA 3C5SA 1PY9A 3RWJA 1A3LH 4JLRB 1E4KC 3P4MB 5EH1A 3PNWA 4U6VL 1OP5H 4HUVA 2Y07H 4M6OH 1NCDH 3KVQA 5IMKA 2E9JA 4P9HC 5TPWH 4W70A 4ZS6C 2OR7A 1H5BC 2XWTA 3U83A 5SV4A 1X4XA 2XICA 1SVZA 1NGZB 4Y4HA 4IDLA 1K4CB 4NQDA 1OCWL 5E00A 4Y2OA 4ACPA 1PBYA 1A14H 3D6GA 4YFEA 2J8UE 4ETQB 3SY0B 1A1OB 2B2XL 1ZT1B 4BUGA 1DANT 4JM2A 5MEND 4DW2L 4WDIA 5CBEA 2X4TA 4HJJH 3RVXC 4PJFF 1P4BL 3MV7A 1BZ9A 5HYSG 3ULVE 2UZIH 3BGAA 4WFHD 1F97A 1KTDA 4E9LA 1OAUH 4QRSA 5J4MA 1G9MH 2AJVL 1AGDB 3LKNB 4DQOH 2PR4L 2DKSA 4M61A 3Q1SH 4OZIB 2HFFB 4KPHL 4NUGL 1F11B 3NIFE 4PY8J 1BQHG 3FKUS 3QO1B 1FLRL 4QF1B 5HHNA 3VXSB 2GK0B 4JE4B 5ACZA 3HNTL 1S9WA 4QOKA 1EBAA 4MJIA 1S5IL 3V6ZB 1AGFA 2APFA 3IDIB 1C5BH 5C07B 3EOBB 4L8SA 1VEMA 3MRFA 3OKOA 1WBZA 4ETYA 2O26U 2WBJB 4KK6C 1J1OL 2ZG3A 3QEHB 3C5SB 3RWJB 5BV7H 5JTWA 2UWEA 3PNWB 4HUVB 3MOQA 5C92A 1M6OA 5IMKB 3VGFA 3BZ4A 4GSDH 3LZFL 1NFDA 2XWTB 3SJVE 3QPQD 4XMKL 4Y4HB 4NQDB 1P6AB 3PP3H 5D7SL 2CK2A 5E00B 3JWDL 35C8L 3BGMA 2XG5A 2WW8A 3MLPA 1RZ7H 1DUYA 4JM2B 5J7CC 1FZMA 4WDIB 5CBEB 2X4TB 4QRTA 4I13B 2A9ML 3QDGD 5FGCE 1EXUA 3L5HA 4JQXC 3MV7B 1BZ9B 4PGCA 1FVEA 3IFNH 1KTDB 4QRSB 4LPTA 2XIDA 3KPSD 4CDHA 3HRPA 4CNIA 3K8LA 4POYA 3X11A 4EBQH 1GZPA 4M61B 5HI5C 4P2RA 4N1EA 4PRBA 2VDRL 3O8XD 2IMNA 1NCUA 5HHNB 3MCLL 3ZSSA 1S9WB 4QOKB 1AHWC 4MJIB 4I3SL 1U8PA 3WD5H 4LSRL 4C58B 1AGFB 2XTJD 2E3VA 3H7BA 3L1OL 4GXUM 4L8SB 3MRFB 3OKOB 3A67L 1MCEA 4HWBL 1RU9H 4OLVL 1RUAL 4ONHA 2LAAA 3O3BA 1WEJH 4J3XA 2UWEB 4LRNH 3ARYA 4YDJA 1M6OB 3LEYL 4HC1H 1MEXH 4OZHE 1KC5L 3WS6C 3TVMC 3BZ4B 1UA6L 3FO2A 4OBSA 1NFDB 5JOPD 1TQCB 5I75B 3FRPA 5J3HD 4PTTA 4BSVA 3UTSE 1ONQA 3BGMB 5I16A 3EFDL 4PJIA 5DR5L 1MLBA 1F90H 1LD9A 1DUYB 5KZCB 1JZ6A 4LSUH 1FZMB 2YRLA 3UJTH 3JV5A 4QRTB 3ARXA 2GJ6A 1XGUA 1VADA 4XPFH 1EXUB 1JE6A 2NY7H 3FZUD 3GJFH 3O6KH 3F5WA 4H25A 4PGCB 1AO7A 1FVEB 4U1JA 1T66D 4OSUH 4GXUN 4NNPH 4HFUH 5AG8A 4F7EA 4MAYA 4CNIB 1I8IA 3X11B 5E24E 1GZPB 4P2RB 5CSBA 5F96H 4JVWA 4PRBB 1NBVL 4R4NC 3QCUH 3OKKA 4GW5A 3NTCH 4M7ZB 2XPGA 2IQ9L 2XZZA 3KJ4B 4JHAH 4OJFH 3ULUE 4NPYA 3U0WH 4J3SA 4PBVC 4GRWH 1U8PB 4XC1H 4ELMF 3HI6H 2NXZC 2PW2A 3BIBX 3PGFL 4F9LA 3JWNC 4IDJL 3C5ZC 2W65A 1CGVA 5GJTL 3T8XA 3WDHA 1T1YA 1X7QA 3TFKD 1G6RA 4YDVA 5JW3H 4UV7H 3I2CL 5JXED 5IV2A 1F58L 4ZTPL 4JDVA 4ONHB 3O3BB 3O41A 3MJ6A 2B1HL 1IC7H 1QRKA 3VWKA 5EU5A 4AMKH 4QLRA 2VSCA 4YDJB 5E2TH 3EDDA 4X4ZA 3BFOA 3BDYH 1QSEE 5DQJA 1A9EA 3FO2B 3DI2B 5E03A 3MC0A 4KKCD 4GAGL 5I8OL 3P2TA 3UDWC 5EORH 4PTTB 4BSVB 4K9EH 3CJJA 1ONQB 5I16B 4DVRL 2HTKD 4PJIB 1MLBB 2IEPA 2GCYA 4XCCL 1LD9B 3BVNA 3SOBL 2KKQA 1FJ1A 2KPNA 5BRZA 5EBMA 2K1MA 4B0MM 4DWHA 3G5XA 2GJ6B 1XGUB 4UT9H 2F54E 1VADB 2Y06L 2QADC 2DMBA 3C09B 3F5WB 4H25B 1AO7B 2YD2A 3PDOA 4U1JB 1R5IB 1KELH 1Q0YL 3F8UB 4GG6F 1R3IL 3VRIA 4F7EB 4MAYB 1YPZE 4JRXA 4AG4H 2VAAA 2IJ0C 1I8IB 3LQZA 3MCG1 4TVSa 1DN0A 4PLKD 4DOHB 2OTPA 3OKKB 4GW5B 1TZHA 3SO5A 2XPGB 3LEXA 2QKIA 2IGFL 4KFZC 4NPYB 3IDYC 1N6UA 4GW1A 2EE9A 3BZEA 4M7KL 2H8PA 3QXVA 3L3IA 2PW2B 5CGYC 3L3OA 2ADGA 2W65B 3BQUC 3OGCA 3T8XB 1T1YB 1X7QB 2HFTA 1G6RB 4ZD3L 4YDVB 5FYKL 2NY0D 4OGXL 3P9MA 5IV2B 4JDVB 5IBUG 3O41B 2GEEA 4S0TD 3VWKB 5EU5B 1CFQA 5DQJB 5HHVL 1A9EB 2A9NL 4U6XA 1MREL 3HE6B 5IBLD 3HNVH 5J1AA 4ZXBA 5BW7A 15C8L 2BOCA 3LMJH 1DQLH 5FUOL 1V5JA 4QXUL 3LV3A 4UQ2B 5FM8A 4ODXA 5DQDL 2GCYB 4YBQD 3BVNB 3NA9H 2XQBH 1FJ1B 2WUBH 4H1LG 4HG4J 5BRZB 4WWKA 5KOVC 5EBMB 3G5XB 3F7YA 4WUKH 2AI0H 3SPVA 5KJRL 3MUZ1 3PL6D 5I1GL 1FN4A 1I1RA 4LHUG 2E7HA 5EBWA 3PDOB 4UILH 3ZHLA 1GHFH 4K3DL 4PJFE 3VRIB 4GXVL 3J8F7 4JRXB 2VAAB 1GL4B 3LQZB 1KT2A 4MB5A 1DN0B 1A7RL 3MSPA 3D2UD 4Y2DA 4OM1L 5KSBE 1TZHB 3LEXB 2QKIB 1OP3K 3V52H 4OUUA 3JWOC 3BEVB 3BZEB 4KZEH 4XC3L 1JHKH 2H8PB 4OCYL 3L3IB 4M8VA 3VD9A 3PP4H 4GMSL 3L3OB 2ADGB 2IAMA 2EYTA 1NANI 1YJDH 3OGCB 3QJFA 3TH2T 2W60A 4JFED 1QR4A 4YE4H 3VRLF 4P23A 4BQ6A 5J11B 2OZ4H 4J7RA 3RKDD 4C57C 2OK0L 5KANG 3P9MB 4C56E 1G9NH 5EDXA 4Z76A 3EJZD 5DUML 1MRCL 5F9OL 2AGJL 2NY2B 1CFQB 3IDXH 4U6XB 2IH1A 4N8PA 4UIMA 2R39A 4G8IA 1VKXA 3TZVA 1IC4L 2AXHA 3NPSC 5C6PB 5J1AB 4WI7A 4ZXBB 4WFFE 3BAEH 4ZNEA 3QIWD 2BOCB 1DLFL 1RUPL 4KROB 3LV3B 5GZNC 4ODXB 2AAVA 2YA2A 1RUQL 4IBLT 1YDPA 4WWKB 4JB9L 5MENE 2B8OT 3FONA 1HEZA 1MJJA 3LN9A 3SPVB 1YEIH 1FN4B 5EBWB 1ZLWH 1MJ7L 1D9KC 4WFHE 4G7VH 3WDJA 2LFGA 2VDMH 3TNNA 1KT2B 2HG5A 5F1NA 5DJ0A 4PY7A 4YDKH 1LK3H 4XVUD 2BXZA 4Y2DB 1ZEAL 4YQXH 5KS9A 3C60A 4ZTOH 3ZE0F 4NCDA 3VXTA 5HSFA 4PB0H 4OUUB 4FA8A 4X4XA 2N4IA 1K3ZA 4G6AD 1NBZA 4JREC 2IAMB 1A6TA 4C83A 5C71A 1WCQA 2EYTB 4JJ5A 3RJDA 1S9VA 4XMLL 5T3XL 2LQRA 1U3ZA 1RULL 2W60B 2C7UA 3QJFB 5B22A 3QDJE 4P23B 4Z7UE 1YEJL 4S1QH 3VG9B 3OF6A 3B6SA 2JJSA 5JXAL 1MCHA 2IFFL 4KDWA 2V5RA 4Z76B 3H3KA 3IDMA 5IIEA 3B4NA 2IH1B 1VKXB 3TZVB 2DLFH 2HWZH 1JZ2A 1UCBL 1SJEA 2KH2B 2CLRA 4PJ9A 5GGTH 3S37X 2I07A 1YDPB 5HDOA 3FONB 1HEZB 4WUUD 2LU3A 1MJJB 3N1PC 3SO3C 1IEHA 2FX7H 1TZIA 5D1ZA 4M5YH 4JKLA 3ZE2F 4X6EA 2VDQH 4HS3A 1KXVC 2AJ3A 2YHGA 5DD1H 1H8SA 4OCRH 1NLBH 4DGVL 2DQTH 3TNNB 1BPVA 2HG5B 2R0WH 1KCUH 3KYMA 5DJ0B 4PY7B 5F1NB 3ZTJG 2W38A 3THML 5SX5K 2R4RH 5KS9B 5I9QC 2VIRA 4LSVH 3VXTB 4MHHI 4X4XB 2NXYD 4JO2H 4I0KA 1MFBL 3ZKSD 1NBZB 5AZEL 2ORBH 2XTJE 1A6TB 3IFLH 1M71A 1PAMA 3EOAA 4JJ5B 4C83B 1S9VB 2P44B 2P49B 3DYOA 2C7UB 4JDTH 1JPSH 3HB3D 3O9WA 5E2WH 4U6YA 3MJGX 3B6SB 4X83A 2JCCF 2VDPL 2OP4L 3IDMB 5IIEB 2F19H 1D5IH 1I9JH 1NJ9A 4H88H 2H32H 4XPTH 2F74A 5ADOH 1SJEB 4M5ZL 1J18A 2V9RA 1YQVH 1INDL 4BQCA 2CLRB 4PJ9B 1CE1L 1CTOA 4GOSA 1NAMA 2I07B 4PJ5E 5D1ZB 1TZIB 4X6EB 2JB5H 4N0RA 4HS3B 3KPRA 2AJ3B 2DQEL 5HY9A 2ZUQC 2PTVA 4DVBA 5DD5L 2P5EE 1MAMH 4K3EL 4PRHE 3KYMB 4IRSC 4OCWL 4Z7WE 1VFAA 3DSFH 2ZNWA 5DJ6A 1RIHL 4XVTL 2VIRB 1U58A 4N8CL 5E1HB 3GI8L 3QR2A 4HBCL 3SGDI 1U3YA 1OAXL 1PKOA 1U6AL 1M71B 3EOAB 5CCKL 4YPJA 5FCUH 1FGNH 1M7XA 4OZGE 2DN7A 3P9LA 3O9WB 4PRIE 4AH2A 3GGWA 1CS6A 3MLTA 4U6YB 2FEDD 3NBNA 1SYVA 3I02A 1A6VH 4QNPF 3L5XH 1UWGL 3SDDD 5J13B 1NJ9B 3RY5A 5T1KA 3SE8H 3UX9B 4BUHA 4MXQC 2F74B 4DZ8A 1K8IA 2NPLX 1NDMA 5JMRA 3X3GL 2QBWA 3WUWG 3L95A 4AEEA 1AKJA 3WIFA 1NAMB 2XKSA 3NCFB 5CEZL 4HUNB 4KV5F 3O4LD 4H5SA 1N8ZA 2CH8A 5E1AA 2ZCHL 3KPRB 3NZ8A 4OZFG 5HY9B 3BYTA 3HZKA 3A6CH 4APQD 4DVBB 3RTQA 5DK2A 3KJ6H 4WO4C 5I30H 1A8JH 1JZ5A 6FABL 1NLDL 3ARFC 5DD0H 1VFAB 5I66A 5I74C 1AQKL 1J0IA 2FD6H 1KIPA 4QHNA 5DJ6B 1WT5C 5IFAH 1NPUA 3M8OH 1U58B 4GRLA 3TYGH 4BM7A 4M1CD 4XMPH 1W72H 2CLZA 1AGEA 4ODTH 5D72H 4ERSL 1EAJA 3ZE1E 3P9LB 4RMUA 5CS7A 4AH2B 3GGWB 3MLTB 1NGPL 3VRLE 5E4EC 1QRNA 2YEZA 1WWWX 1SYVB 4KH2A 3I02B 4JVPA 5FUCC 2EDWA 5K9KA 3V4UH 1TJHL 1VENA 2E7BA 4NT6A 5T1KB 1S7TA 3FQRA 5I1DA 3WV0A 5EWIL 1CK0L 3T0AA 4DZ8B 1K8IB 1JNLL 2V5MA 4W81A 4XP5L 1NDMB 2NY6B 3BP4B 3L95B 4K3GA 4IJ3C 2ZCLH 3QZWA 4EUPA 1VGKA 1AKJB 3WIFB 2UVFA 1F2XK 4KJPD 1NGWA 5H2BA 5J3HC 3UC0H 4H5SB 1N8ZB 5E1AB 4PG2A 3DMMD 3NZ8B 5C0GB 2BDNL 1H3VA 4OIIL 3UYOD 4AEIH 2XZCH 3HZKB 5ALCL 2Z35A 4DKDC 5DK2B 2F53D 2RFXA 1BP3B 5I66B 2ZUTA 3FZUC 5I1JH 1KIPB 4QHNB 3E2HB 5IVOA 1T66C 4NHCL 2IPUK 4JR9L 1G6RL 3HUJA 1PKQE 2V2WA 3QJHA 4J3TA 3T2QA 4F9PC 1AIFA 3MACL 4WI2A 1NCWH 4PV8A 3B2UD 4K94C 4GRLB 5CP3A 2EH8L 2VL5A 1P1ZA 1XIWA 2CLZB 1AGEB 1HWGB 3A6OA 4PJEF 3TJEH 1QHOA 2XYCA 5FYJU 2IALA 5FFLA 1CFBA 4H1LH 3C8HA 1G1CA 3W0WB 1QRNB 2YEZB 1GIGH 5K9KB 4E41A 3GDBA 4Y5XA 4MNQD 3QDHA 2RB8A 4Y4KC 4TPRH 4NT6B 5I1DB 1S7TB 3FQRB 5JXEC 4S1RL 1NCCL 5D7LD 5JQ6H 4GKOA 2AVGA 4OFDA 2N1KA 3QZWB 3OX8A 4EUPB 1VGKB 2M1KA 3WXWH 2QQKH 1NGWB 2AJUH 2EE3A 5H2BB 5GPRA 5KVFL 4HT1H 1XEDA 1OTSD 3F7RA 1V3KA 2VXVH 3K46A 4P49A 4O58L 1V3JA 1V7NH 3ZZ1A 1WFOA 2A73A 1A3RL 2DI7A 3PGCA 4JPKH 4K7FA 5GGSY 2R4SH 3I3EA 1Z2KA 1EFXA 2Z35B 4P48A 2RFXB 3BKCL 5GGVL 3SQOH 2ZJSH 2APVA 3HMXA 1FGVL 4U1NA 4NO5A 3FJTA 2ID5A 1ROWA 3ILQD 4KHTH 3WUZA 2KUTA 3HUJB 2V2WB 3QJHB 1HQRA 1FPTH 4PV8B 4JGJA 2R9HD 5E0QA 3ZLQC 2VL5B 1JYWA 1P1ZB 1XIWB 4PLKC 2MOVA 3REVA 4HXAL 3KPQA 3QXAA 2ZOKA 2CD0A 2IALB 5C8JA 1XMWA 3TESA 1V8HA 1VEOA 1BD2D 5I19H 3ARGD 5SWSE 4AM0A 1F13A 5F6HJ 4E41B 2IBGA 4Y5XB 1I9IL 3ETBF 4K3JL 3LN5A 4EI6A 3LKQA 3D5OF 3MYZA 4J4PD 4X6CA 2JJUA 1CLOH 2CSPA 4XXCC 2AV7A 3OX8B 5D70H 4FQIH 1BZQK 4OKDA 4A6YH 3FRUA 4TSBL 5DMJB 1KLGA 4JQIL 3C2SA 4TNVF 2O5ZL 2Q76A 4ALAH 2A73B 4K7FB 3PGCB 1MFCL 1OT1A 4G6FB 4NQUA 1EFXB 1J5OL 1HIMH 4IMLA 2H6PA 3T2NH 3DX8A 3IS1X 3ZYJA 4U1NB 4NO5B 3PL6C 3H9YA 1PEWA 2DIAA 3BT2H 2ATPA 2XZQL 3MOAH 1N4XL 3SE4C 1NSNH 1HQRB 1TETH 4G3YH 3IAPA 5FO7A 4L1HA 1ADQA 3MBEC 4ZO7A 4MA1B 4LPWA 2XWJA 3REVB 4GRWF 1WIPA 2CPCA 4FQ2L 3MV8A 1HH6A 3BPOC 3KPQB 4YX2H 3QXAB 2FATL 2ZOKB 1HE7A 1KGCD 1FIGH 2X4NA 1Y0LA 3OHXA 4LMQE 5C8JB 1I1CA 5LWYL 5ESVA 1MQKH 4DKEH 4AM0B 1DL7L 4LCCA 3P40A 3GMPA 4W68A 4YH6A 2F5AH 2BSED 2OLDA 4Q9CA 2JIXA 3LN5B 3T0XA 4QNPE 4EI6B 3LKQB 4Z7QF 1IT9H 2YA1A 3CFEA 5CAYB 3ZTJH 4X6CB 1P9MC 1Z9LA 4KKNA 5HHXL 3KLHD 4PJGE 4HUUA 2AV7B 4WI8A 3QIUD 5ITBH 3V6BR 2R0KL 3X13A 3FRUB 5C2BH 4PRNA 1KLGB 2HJKA 2E9WA 1NCAH 3O6LL 4MD0A 2Q8BL 2AJYL 2Q76B 2DAVA 2DQGL 3AREA 4M03A 1DBAH 2V9TA 2DIBA 4D0BA 4NP4H 4IMLB 3TT1L 1XGYL 2PTTA 2H6PB 4J12A 3DX8B 1OM3L 3CFCH 4GJTB 1IL1A 1AXTL 2HKHL 1BREA 2KDGA 1IZKA 1JZ4A 2ATPB 5ICZA 2BNQD 4V1DD 4MLSA 3QUYB 5FO7B 5IHBA 5TE4L 3DV6A 2FBJL 1YNLL 4JPWH 1UM4H 2YD5A 2XWJB 4KKAD 3IU3A 5L2KE 3MV8B 1BLNB 1HH6B 4Z7VF 2I24N 3LVEA 4JQVC 2J5LB 2X4NB 5IBTL 1QPPA 1Y0LB 3VFTA 3OHXB 3MCKA 4G6AC 5ESVB 5K9JL 1L0XA 3UTTA 2BP3A 3CZFA 4HQQH 3T4AA 2D7OA 4LCCB 1IMHC 3GMPB 3DHMA 1FYHB 3OAZK 2DF3A 2JIXB 5EN2A 3W2DH 4FQLL 3CFEB 3OJ2C 3X14A 1EHAA 4HUUB 3P30L 1YEDA 5B8CB 4MGXA 4PUBL 2WWKT 4PRNB 2HJKB 4MD0B 4JFFA 1E4XH 4UUJA 3S4SG 3UBXA 1KF9B 3AREB 4IRJD 2BY2A 2E8ZA 2H26A 4D0BB 1HYSC 1BFOA 3VH8A 2PTTB 1RZIB 1FORH 1B6DA 4P2QD 5JIHA 1A3QA 5KN5A 5I73B 2QSTA 1IL1B 3D85D 3QAZB 3OMZA 4HDIA 1MHHA 2BVPA 5EU4A 5ICZB 5E9DD 5A40E 1CLYH 4ODUA 4Y1AD 1FE8H 3NZHH 3QDMA 5AD0A 1EGJH 2Z4QA 3DV6B 1PYWA 1S8DA 5KBNC 3QXDA 3IU3B 2DKUA 5DFTA 1NGQH 3VFTB 4XNZC 3DRTA 2HFEA 3MCKB 4K2UH 1TQBB 1RURH 1U8MA 2GW5A 4Y7MA 3RVVD 3UTTB 3CZFB 3KYKL 3T4AB 4LIQH 5KVEH 3MFGB 4OZFH 3FQNA 3SGJC 1NAML 5IT2H 4WW2F 5EN2B 4C54A 3X14B 3HRZA 3F62A 1ES0A 3SDAD 4G6KL 4LU5H 1YEDB 3C08L 2DQCL 1XGQA 4WHDA 2WUCH 4POZD 1MNUL 1UB5A 4JFFB 5FOBA 4UUJB 1OY3B 3UBXB 2MMXA 5JQHC 5K59F 1HWHB 4L4TD 2H26B 4Q6IC 1BFOB 1EX0A 2F53E 5KN5B 1WZLA 5HYJA 4OV5A 1LO3L 1IRAY 4HDIB 1MHHB 2BVPB 2VR9A 3GM0A 5EU4B 5I18L 5AYQA 4U1SA 2IMMA 4ODUB 4ZUTA 4WHTA 3QDMB 4NKDA 1J1PH 2Z4QB 1I3RA 1PYWB 2D7QA 1S8DB 4OGYL 2QSCL 2OR8A 1TLKA 2FX8L 1ZVSA 1EEYA 4HIEA 4L8BA 4JAMA 5D7KD 3QDAA 5I1EL 3DRTB 2HFEB 3RDTD 1E4KA 4MXVE 1U8MB 1D5XA 5MI0B 1NEZA 5F7KC 1S3KL 2B2XH 4JFPA 1A7QH 3FQNB 1H5BA 1L9NA 1WAAE 4LSTH 4DW2H 2FDBP 1CD1A 4MNQE 1HH9A 1LDSA 4P3WA 3G6JA 2LAGB 2NTFA 1QFWI 3LKOA 3HRZB 4NM8H 5D5MA 5KG9A 2OL3H 3CU7A 1ES0B 5FGBC 3SDDC 5D1XD 2AJVH 1XGQB 2PR4H 4WI3A 1FDLL 2W0KA 4RFNC 3MUGA 3SDYL 4KPHH 1UB5B 5D7JD 5FOBB 1M4KA 1AD0A 1FLRH 2VC2L 4HCRA 4ZAKC 3HNTH 5C0RL 2EYSA 3EDFA 1ZHBA 1S5IH 4MA7L 2EDEA 3EYUH 5HYJB 1ZHLA 4OV5B 1LO2L 4GQ9H 4ENED 3VFGH 5C1MB 4APQC 1E4WL 4U1SB 1J1OH 5CJQL 4ZUTB 4S0SD 1NDGA 4WHTB 1UACL 4NKDB 2BVQA 3IVKA 2VLKD 1IGYA 4B5EA 1F5WA 2OMNA 2A77L 3EBAA 3UBXI 1ZVSB 1EEYB 4HIEB 4L8BB 4TUKH 4JAMB 4XMKH 1ZWIA 5D7SH 5GRJL 2ADIA 35C8H 5GGQH 1D5XB 3EO9L 1S5HA 1BD2E 1NEZB 3SKUD 4JFPB 5AAMA 1H5BB 1QD0A 1A21A 1D7FA 2ESVA 1CD1B 1HH9B 3QYCA 1I8LA 4O02L 4X6DF 2A9MH 3G6JB 3V7AE 1ZTXL 3PQYD 4NFDA 3V5HA 2NTFB 3MRPA 2VZVA 3LKOB 1KN2H 1UKSA 5KG9B 5D5MB 4CU7A 3QWRA 5DEGA 5IQ7L 1J0HA 2ARJQ 1UM5L 3GIZL 5BV7C 5IMOA 5IESL 5TDPA 4KMQA 2ZUYA 4JHWL 4OCNC 3O3AA 1AD0B 3KHQA 4HWZA 1F3DJ 5D2LF 3BN9D 5HYIA 3AXLA 5JW5A 4WTZA 2EYSB 4LQ1A 3VXRA 1OGAA 3UJJL 1ZHLB 3QB7C 4BQ8A 3DMMC 4LVOC 3A67H 2J1KA 3TH3T 4NOBA 3ZSTA 2KBGA 4LCIH 1AHWA 1NDGB 2BVQB 3IVKB 4M8QA 1D3CA 1IGYB 4AEHH 5FYLE 5C0CE 1KC5H 1KN4H 1U8QA 4TULH 3GNML 1IKFL 2FJGA 4C4KO 4WV1C 4LOUD 1ZWIB 3KHOA 2AK1L 1R3HA 1PD6A 4XHJC 3LDBC 2ADIB 4F37F 1BFTA 3SGKC 2WLZA 1UWXK 3UTPD 1S5HB 1F3DH 2OX5A 3VD4A 3WS6A 3TVMA 4LF3A 1JPGA 3N0PB 2ESVB 1C16A 3NCEB 4LCWE 2AJZA 2XQYG 4HGMA 4L9LC 5BS0E 3BE1L 3V5HB 2YRZA 3MRPB 3TIEA 1MFDL 5SWZA 5DEGB 1KULA 4U7MA 1OPGL 5CINH 3HMXL 1CBVL 5IMOB 5TDPB 3PWLA 3RGVD 3QRGL 1P4IL 3O3AB 3L3HA 4HWZB 2JKXA 1HILA 2YK1L 3AXLB 5JW5B 3PV7A 1KNOA 2A74A 3VXRB 5E4IA 1OGAB 2CKBA 3PGFH 4IDJH 4FTVA 2EEDA 2JB6A 1MY7A 5GJTH 4UDTA 4WIQA 3PWUA 1AHWB 5ITFA 1F58H 4ZTPH 1IAII 4MD4A 4M7JH 3GSUB 1T03L 4M8QB 2XN9A 5I1IL 3C5ZA 3ILQC 4YHMH 1AR2A 1U8QB 3CLEL 2FJGB 4RMSA 1U3JA 4GAGH 5I8OH 4O00A 1R3HB 1JGEA 2R29L 3BXNA 4DVRH 2VLRD 3GHBH 2FLRT 3HI5L 4XCCH 4HIXL 3FRPG 2DQIL 3TVMB 2VUOA 3SOBH 4LF3B 1JPGB 3RX7A 5CJOL 1C16B 5C0FA 3UDWA 2VQ1A 2ATKA 4JRYD 4OF5A 4XP9L 2AJZB 3V8OA 5K9QG 3BP6A 4JVUA 5D2NC 3ARGC 3TIEB 3QCTL 2EDRA 4LHUD 2Q3AA 5SWZB 2WQ8A 1Q0YH 3U4BL 1R3IH 4N90D 4ZUVA 4TOYH 1FFNA 3MJ8A 1QKZH 3F58L 1U8NA 3KYOA 2FECI 3QQ4A 4TNWF 3PWLB 4RWYH 2EDFA 4TTGA 4K55A 4QEGA 5F6IC 3L3HB 4UZGA 5EO1A 1FHGA 3G5YA 1HILB 1L7IL 3JVGC 2A74B 4M7KH 1ADQL 2CKBB 2Q20A 5K59E 2AS5M 4FTVB 2JB6B 4NRZA 4UDTB 3PWUB 3MGTA 3K80A 4ZD3H 2NY3D 3SE9L 5FYKH 5C6TH 4OGXH 3QG7H 5ITFB 4Y1AE 4MD4B 4YDLC 4F15C 3UZQA 2XN9B 3C5ZB 3BQUA 4B53A 1LP9F 4FG6C 2YUZA 2VXQL 2CLVA 4Y5YC 4JZJC 3WIHL 4YFDB 2QLVB 1PG7X 3O6MH 15C8H 1JGEB 1BEYL 1ZSDA 4OLXH 3BXNB 3O45A 4KC3B 1PEZA 3CUPA 1J05A 4PBWD 2PNDA 2AABL 2CUHA 1U3HD 5IM7A 3ARTA 2EE6A 2D3VA 3R8QA 4AZ8A 5C0FB 5ADPH 1IM9D 2VQ1B 2G60H 2ATKB 2P47B 1BX2A 5KJRH 1NEUA 3BP6B 4RIRA 3B2VL 2MKWA 4RMVA 4PD4K 3WFBL 3MRHB 4K3DH 4ZUVB 3VXPA 3K2MC 4GXVH 2YD3A 1FFNB 3S35L 1CQYA 3MJ8B 1GZQA 1U8NB 3KYOB 1JPST 2VXSL 4P4KA 3G6DL 1NBYA 1XF4A 5EO1B 3G5YB 3ROOA 3GBML 5HDBF 3OKNA 3MUY1 4L4TE 2P45B 1QFWL 4XC3H 5JW4R 3ARBC 1I8MA 3AUVA 3GFUA 3OAYK 4NRZB 3SDCC 2R2CA 3OKDA 4H0GA 1K8DB 25C8L 2X4SA 3MGTB 3N50A 3VE0A 1QR1A 5DUPL 4OM0H 3IDYB 3BD3A 5C09A 3BN3B 3O0RL 1BM3L 4RBPH 2G9HB 3BQUB 2P1YA 1NBQA 1MRCH 4KDTA 1U92B 2Y4SA 2CLVB 3T4YA 3V6FA 1IC4H 1ZLSL 1KPUA 4G8GE 1JCKA 5D7KE 4XAKD 3Q2CA 1DLFH 3IF1A 5GQBA 3O45B 5EB9A 3CUPB 1J05B 1LK2A 2CQVA 4J6RL 4Y19D 4JFDE 1IQWL 5IM7B 3UZVB 5DRXA 1RUQH 4P5TD 1X5JA 4JB9H 2APWA 1BX2B 5DHVH 3RUGA 4J23A 4RIRB 1PG7W 3QEQA 4ZG1A 4KTEL 5TH2A 4UTBL 3VXPB 5HI3D 4RA3A 4D9QE 1GZQB 3DTXA 4QHUA 3DROA 1G9NC 4XWGH 2O93L 4U3HA 4I0PD 1IQDA 4P4KB 2BXYA 2Z8VC 1NBYB 1D9KA 1XF4B 1I7TA 4WVRA 4OQTA 5D9SA 4P9ML 3ROOB 1GVIA 1NC2A 1JUFA 3OKNB 4C4KT 3GKWL 3QEGL 1JP5A 3H3PL 1I8MB 2VJXA 1O0VA 5IW3A 8CGTA 2CR3A 4L4VD 2YBRA 2NW3A 3OKDB 1QP1A 5B38A 2ZCKH 2X4SB 3ECBA 2V17L 3QFJA 4GMTH 1DQJB 3MBXH 1QR1B 4QHMA 1TJIL 4HPOH 2VKWA 3HE7D 3REWB 1MI5A 1MRDL 5C09B 2H3NA 5EIIA 4UTAH 3MOBL 1MFEH 3LAFA 5J06A 4JFZL 2VLKE 2D4DA 4LRIC 3O3DA 1JTTA 3W5NA 3T4YB 1TENA 2BHUA 4KWUA 3V6FB 3DV4A 4OLWL 1KPUB 3VXMD 2K3TA 3FN9A 1MHEA 1UCBH 3E0GA 1QBAA 3IF1B 1FYTA 1IFHH 1LK2B 1N3NA 3EYFA 1Q38A 1PG7L 4JFXA 5DRXB 4MJ2A 5TQ2L 1E6OL 5CILL 4KQ4H 3P4NA 3FAXA 1LVEA 3RUGB 2X9YA 3PQYE 1DVFD 5KVDH 3QEQB 1IM3A 3PV6A 2EDYA 5TH2B 4Y16D 4MCYA 4BZ1L 1N0XL 4DGVH 4P2OC 2YN3A 5JHLH 3DTXB 3DROB 2AJXL 5GZOD 2EC8A 4P2CG 2X7LA 3FFCD 1IQDB 5DS8A 4QTHB 1QSFD 4H8WL 1T0MA 1QZ1A 1D9KB 1I7TB 1FNSL 3IKKA 1MCOL 4EI5D 2I27N 1NC2B 1JUFB 2Y36H 3G5ZA 3KLSA 4CU8A 1MFBH 4IMKA 3ZT5A 4F33A 5AZEH 1ZA3A 2Y23A 3FO0L 2YBRB 4PJFA 5B38B 3ECBB 3QFJB 1JZ8A 1W8NA 2NZIA 3BP7A 2C26A 4QHMB 2BJMH 4ZODA 2P5WD 1MI5B 2DWDA 5GRVK 2WP3O 1QYGL 2FO4A 2H3NB 3PP3K 5EIIB 1BQSA 2OP4H 3K1DA 5M7QA 4P9HL 3O3DB 2C4FU 4AIXA 2IFGA 5T1DH 3DV4B 3QHZL 4EIGB 1MHEB 5KTEL 5L8KB 3DO3A 1A5FL 1CICD 2VQTA 1FYTB 1N3NB 3EYFB 1INDH 3GSNA 3BESR 5EZLA 3UTPE 4JFXB 1CDCA 1KSRA 3QI9D 3P4NB 2WBJC 1MIEL 4EJ1C 1AP2A 4LP5A 1IM3B 3PV6B 5GRXG 4HCRL 2DQEH 1F2QA 2J6EA 2IADA 3NAAL 2HRPH 4MCYB 4FOMA 1T1WA 1AE6L 3UPCA 4XNUH 4IIQA 2VLJE 3QO0A 3SO3B 1I3GH 4JCLA 2X7LB 5EU6D 2ICES 5DS8B 1T0MB 1RIHH 3D69A 4WCYL 1XR9A 3LEVL 4PJCF 4XVTH 1FBIL 4FQXD 4M43L 3BPCA 5DZOA 1I7UA 4N8CH 2GJJA 3G5ZB 1SYSA 5DO2D 4XCYA 3GI8H 4ZFOA 4HBCH 1FZKA 4JM2C 1KEGL 4F33B 4JKPL 2IH3A 1ZA3B 5JHDE 3Q6FA 3RP1A 4PJFB 3L5WA 1QBLH 3BP7B 2FECL 5LBSH 4LCYA 1DBML 4N0CD 4OFKA 4UOW1 2DLTA 2DWDB 4RA0C 5FAAA 2FO4B 5IB3A 5I15L 5C08B 1T21A 4NZUL 1KFAH 3VG0H 1S7UA 3R1GH 2WQRA 3KR3L 5T3ZL 4TNVK 4LDOB 5I71C 3ILPA 3RHWF 4S1SL 3DUHA 1Y6NR 4DFHA 5E08L 2XV6B 1CIDA 4NOFA 2DDQL 1B2WH 2X6MA 3X3GH 3GJFK 1OAQL 2VLRE 4FS0A 3OKMA 3GSNB 5EZLB 1CGTA 4D3CL 5I0DA 3V8CA 4U4BA 5CEZH 5A2IH 3S37H 4ODHL 4OB5L 1AP2B 5CHNA 4N5ED 4UNVA 4NQEB 3TIDA 2IADB 4NWUL 2E9IA 2EDJA 1T1WB 3AS0A 4JRWA 2C1OA 1P4LA 5B39A 6FABH 4IIQB 3QO0B 4NKOA 1PQZA 1T5XA 3BD4A 3D69B 1XR9B 2DOCA 5MEQA 3BPCB 2ZUQB 4I2XE 3IB4A 1SYSB 3LN4A 4XCYB 4ZFOB 5C0EA 4WHYG 4XNXL 4R7DA 1FZKB 3LRHA 1VHPA 4GKNA 4BK5A 3QDGA 2IH3B 3D48R 4LCUA 3PDDA 3Q6FB 1T22B 3DSNA 4ERSH 3L5WB 5FHBH 5BVPL 1EO8L 1I1YA 4LCYB 3PHQA 2VKXA 3KPSA 1WV7T 1DEEA 3TJHC 1GGUA 5GJSH 4PS4L 1UKQA 5IB3B 2YMXL 1T21B 3X12A 5DZLA 1S7UB 1TJHH 1FCCA 1XGRB 3ILPB 5EWIH 4M7ZC 3N85L 4XP5H 4ELMA 3EZJB 4NRYA 1L6ZA 2DWEA 3OKMB 2DIJA 4JFYB 4LDLB 2PKDA 1BBJA 5CHNB 5CJXC 3TIDB 1U41A 1K6QL 3NH7L 5ALCH 3MRLA 4JG0L 1OF2A 3GRWA 1I1FA 2C1OB 1WZ1L 3IDNB 1P4LB 3RNQA 2G2RA 4NKOB 1PQZB 1T5XB 3FL7A 2IF7A 4NHCH 1ZHNA 3NABL 5MEQB 5E6YA 1G6RH 2QTEA 4XWOC 2GYSA 3ULVH 3Q5OA 3MACH 3LN4B 3VGAC 2HT4C 5C0EB 3G08A 4MB3A 1DBKL 4R7DB 4GKNB 2C4XA 2EH8H 3QDGB 4R96A 2IPTL 5I74B 4LCUB 3EHBC 3PXHA 4LSPH 1OGTA 2YD9A 3RI5F 3BZDA 1B4JH 4LSDA 1I1YB 1F00I 3PHQB 4F9PA 2X42A 3KPSB 1VA9A 1DEEB 1ZGLP 4GG6A 3E8UL 1NL0L 1I8KB 2QV2A 3X12B 3D3VA 4MQXD 4O4YL 3P3YA 32C2A 4RGOL 2YD8A 1DUZA 4XBEL 4N9GA 4Y4FD 1QEWA 5AEAA 1BBDL 4FQ1H 5E4EB 2XTJB 5F3BA 2NY1D 4XNYH 4ELMB 4NRYB 3BMVA 1S7QA 2DWEB 5IHZA 4Y19E 1Y6KR 4Y4KA 3KPNA 1KCKA 4JN2A 5JXEA 2Q8AL 3HPJA 1BBJB 1NH6A 3QUXD 5B21A 3DLQR 2E6QA 4EQ3A 4IJ3B 2HFGL 3MRLB 1OF2B 2G75A 3DWTA 1I1FB 2NNAA 3BKCH 4FN0A 3RNQB 2G2RB 2WP3T 3TCLA 1FGVH 2L0DA 2AQ2A 3EYSH 1ZHNB 2ED9A 2ZOLA 5BOPA 5H94A 4HG4K 1T2QL 3G08B 2VE6A 1EHLL 1J87A 4R96B 1OGTB 1E0OB 2ENYA 1CGUA 4MNHA 5F44A 4GG6B 3STZA 2YWZA 5L8LB 3UAJD 1A6WL 3MLVL 4PREB 1FC1A 3D3VB 4KRPC 32C2B 1I9IH 4JY5L 1DUZB 5ALBL 4N9GB 4K3JH 5I0ZA 1QEWB 2P8LA 1XF5A 4QGTA 4NQCD 2K9UA 3VXME 3RVUC 5F3BB 3WN5A 3MRKA 1S7QB 1ZLWK 5IHZB 1AY1H 2A1WL 5DVKA 5JPMA 1JYXA 4QWWC 2RR3A 3DOSA 4Y4KB 5FYLL 3KPNB 4NNXB 4JN2B 4YHZH 1FG2A 3HPJB 4KI1A 4LAQL 1CZ8L 1B0WA 3L3JA 4M6AA 2DICA 5J1TC 4ZSOA 4YJZL 1BECA 4XXCA 1EUUA 2G75B 2D03H 5D7IE 5T33L 5DVOA 4PJXE 2NNAB 1E6JL 4ZFZA 2NY2C 4TSAH 2V5YA 12E8L 3FFCE 3SEPA 4MZ2A 4XH2A 4ZXBC 5BW7C 2ZOLB 3JTSA 4TVPE 2OR9H 3JWOL 1N4XH 5H94B 5CBAA 3U36A 2VE6B 3U82B 5T1MA 2YOCA 3PL6A 3LOWA 1MPAL 3WEXA 5F7YC 1XFPA 5ABDE 1RUML 4FQ2H 3U4AA 4MNHB 5KVMC 3SE4A 4OLUH 3FN0L 4M6ML 3ULUH 3STZB 5LWYH 2P5WE 3WLWC 1FFOA 2B1AH 3AFLA 1BAFL 2VN7A 2Y6SC 1DL7H 3MLYL 3SGDH 1G0XA 5FYKD 1QSZA 2P8LB 3S36X 2R1XA 4Y2DC 4QXGH 1XF5B 4YNYA 3T0DA 2FYYA 4UINL 3SCMD 3WN5B 1PLGL 3MRKB 5HHXH 2OTWA 1V3MA 3EYOA 4JFEA 2BX5A 5JPMB 5HHOE 2CGRL 2NY0B 4FRWA 4JPVL 1FG2B 4ZPVA 5DK0A 2Q8BH 2R0ZL 4P3CL 1RSFA 2AJYH 3HHRB 2DQGH 1P9MA 3VG9C 1YYLL 3L3JB 4OQTL 3L5IA 3MZGB 4ZSOB 1SBSH 1OARL 2H1PL 5FO8B 3TT1H 3VD7A 4NGHL 3B8YA 2IG2L 4ZFZB 1EVTC 3B43A 3CFKA 1BVZA 3NCYS 4Z9KB 5DLML 3QIWA 1H3WM 4X5WA 3D39D 2R8SL 5EU6E 4UT6L 4ODVH 3WFCL 2A38A 4RGNE 3MLWL 4XH2B 1B90A 2HKHH 3JTSB 4LSSH 3B5GA 4WU5A 5HI3C 5MERA 5CBAB 3U36B 5JIKA 4RFEB 3WXVL 4I4WB 1BOGA 5T1MB 1KIRA 4Y0GA 2FBJH 3PL6B 2GY7B 4MVBD 3WEXB 4FFYL 4KKBC 3VJ6A 5AWNL 1D6EA 1A9BB 2HT3C 3TNMA 1AFVL 5IBTH 1J0KA 4MDIA 6CGTA 3ZDYE 4DKAA 4GBXD 2ARJA 3O6FC 1FFOB 1MJ8L 3LPGA 3TCXA 3ZKND 1RZFH 1LDPL 2B4CH 3ARUA 3BPOB 4DGIH 5FB8A 4JQVA 2OSLA 3C60C 3T0ED 3SKMA 3MLUL 4EDWH 4YNYB 2FYYB 3CVHL 4FFWD 1CTNA 2OTWB 1UJ3A 3P30H 3TBSA 3EYOB 4JFEB 5C9JA 3RA7L 1WGOA 5I1LA 3PIQA 3VFUA 1J11A 4PLOB 4ZPVB 1UC6A 5DK0B 1CQKA 3V2AR 1X5KA 1KB9J 5SWQA 1U0QA 4F80A 1DBBL 4W4NA 2JCCA 3VI3F 4Q58C 2X4RA 1SY6A 3CFKB 5EC1A 3QIWB 4X5WB 4AK1A 5BO1H 1WFUA 5IB1B 4F37K 4Y16C 4WU5B 4M3JA 5MERB 3WJLA 4HWNA 2D7TH 2AEQH 4OT1H 3CFJA 3GMOA 4WUUA 3S7GA 1BOGB 1JPTH 5GZOC 1KIRB 2AK4A 3KG5A 4YDIL 5DA4A 1EDQA 4XVJL 3RVWD 4NBZB 3VJ6B 5JZ7C 3I50H 4XI5D 1D6EB 4EI5C 5D1ZC 4J3OC 3TNMB 3MROA 1AQDA 2HJFA 5C3LD 3T3PF 4R8WL 2X1QA 2ARJB 3KYKH 4HKBA 5F70A 3IETA 3I3DA 3GSNL 4L4JA 2OSLB 3O2WH 3SKMB 3GM8A 1C08A 3OQ3B 2FGZA 2DQDL 3O2DA 4WU7A 4L8DA 4OI7A 1KJ3L 1UXSA 4QRPE 1UJ3B 2J6EL 4G6ML 3TBSB 1GSMA 4G6KH 5C9JB 2DQCH 4F3FA 5I1LB 3PIQB 1X3DA 3CH1A 5EZIL 3VFUB 3FAWA 4WHYH 4C55A 3ZHDA 1MNUH 1S9XA 1SJHA 3MRDA 5FO9A 5T5FL 2GQHA 5SWQB 3NCYP 1DFBL 4MJ4A 3PF2A 2JCCB 4QRRE 3T0WA 2X4RB 4DTGL 5DVLA 4Z95H 3QI9C 4JM4H 5EC1B 1UEMA 2Z8SA 3DXAD 3SDXF 4N1HB 1PX4A 5EIQA 2V2TA 2CIIA 2AXFB 5CWSA 5CZVH 3QNYA 3OAUL 3OXSA 3CFJB 1IGML 3GMOB 4WUUB 5C07D 2X09A 1GGBH 2AK4B 4CDGC 2QSCH 3CMOL 5BCAA 1OTTC 4MNGE 3V5DA 3QIBC 3RWIA 2ZSVB 4FQXC 5BVJA 2FX8H 4D9LL 2D9QB 3MROB 1AQDB 3H0TA 4U6TA 2HJFB 3BJ91 5JW4Q 1QFWM 5I1EH 4Z7OE 1KJ2A 2C1PA 4HKBB 3IETB 2FB4H 4XX1E 5LGHL 3HC3L 2ICWA 1S3KH 4TNWK 3WYRA 3TBVA 3UYPA 4U3CA 1YEKH 4NQDD 2NXYB 4G5ZL 2MTPA 2P42B 4XNZB 3DVIA 1C08B 1CFSA 4X4MA 4HMDA 5EFIA 5EG6C 4WU7B 1FH5L 4L8DB 1IBGL 1UXSB 3QUZD 3TC9A 3EOTH 4I3RL 1R5VA 2W9DH 2HP4A 3K74B 5CGMA 2D2OA 1KG0A 4F3FB 2IC2A 1FDLH 5ANME 5C0AE 3MV7D 1S9XB 1SJHB 4X0KA 3MRDB 4L5FH 5FO9B 5F72S 4LSQL 2VC2H 3UMTA 1JYVA 5FGBA 3ULSA 3SDDA 4J2XA 2EXWC 4MA7H 5LXGH 3AMKA 1J9CT 2HMID 1ZLVH 1EA9C 3P0VL 3C9NA 3OZ9L 2V2TB 2CIIB 2M2DA 5CWSB 4ZAKA 2YPLD 5F7WC 3QNYB 3HCVA 1J8HE 1Q0XH 2E6PA 2X4UA 5CJQH 3VW3H 3OXSB 4DUVA 1UACH 2DB8A 2GTZA 1UQSA 3TO2A 3O4LA 1KYOK 1BVKA 3HKFA 2DLEA 5CZKA 4F7PA 5D8JL 5FECA 5BVJB 2C3HA 4LQFL 1QO3A 5IR1A 3U1SH 2YD1A 3B9KD 4APQA 3H0TB 5GRJH 2OXHA 1CDHA 1SJVA 2MPAL 1KJ2B 4PJHE 2C1PB 3RTQC 3MRCA 3CLFH 2ICWB 4DK3A 2LVEA 3TBVB 5GRYA 4NJ9L 1CFSB 1ZTXH 3LHPH 5EFIB 4NQCE 3MV9A 1KCSH 3FTGA 1R5VB 5IQ7H 1UKTA 3LQAC 3GRWL 5TQ0L 2R0LL 1KG0B 5ISZE 3U48A 1ZGLA 4PJEA 5DJCA 5IVXE 3KWWA 4DN3L 3B9DA 4X0KB 4EN3C 2D0HA 5HBBA 2C3GA 2QQNH 3ULSB 5HYQA 3SDDB 5CEZD 1Y6MR 4RFNB 2G5RA 5F8RC 2VB5A 1B0RA 4L3EA 2YXMA 4ZAKB 3HCVB 1JHLH 3RU8H 4OZ4A 3L3KA 2X4UB 4IOSD 1NKRA 3PE9A 4K94L 1UH3A 2GTZB 1F4YH 1UQSB 4XT1C 3TO2B 3O4LB 4LMQI 1BVKB 5K93A 1CGSL 3DMMA 4F7PB 5FECB 1QO3B 3LPWA 5IR1B 2ICEB 3INUH 4APQB 5JIPA 4M6NL 4PG2C 1CFNA 3FQTA 5BMFH 2XRAL 2BNRD 2FRGP 2HLFD 3KPTA 2P24A 1JV5A 3MRCB 1IJ9A 3VXUE 3ZL4H 1ULVA 5CSGA 1EEZA 1HYRC 4R2GD 2OI9C 5FYKE 4WV1A 2XG4A 3LRSA 4A2LA 3T1WA 2DBJA 1JGDA 2FGWL 5GHWH 2WBWB 3PGDA 3SGKA 2VMFA 4DKFL 1INEL 3MV9B 3FTGB 4YO0A 4JFQA 1UB6A 3ZYIA 4YR6A 4Y4FC 3VWJD 1GOGA 5L6YL 1IEAA 1ZGLB 4A2MA 4PJEB 3CFBA 1MWAA 4YHKL 5DJCB 1TJGL 3QRGH 4L9LA 5IEKA 3KWWB 1P4IH 1AO7D 1XF3A 4YIQA 3ZO0A 1YY9C 2YK1H 4BZ2L 2B20A 5HYQB 2ICWI 5ILTH 1OAZL 2D7PA 4PP2A 5BV7B 5D7LA 3U2SA 4J1UA 1XGTA 3QUXC 1B0RB 4L3EB 3MRRA 5HXMA 3D39E 4HC1A 2R69L 5J6HA 4RZCA 2HVJA 4PIRF 4OZ4B 3L3KB 5ICYA 4K71C 4GLRI 3K2UL 2X4PA 5F7EL 1H3PL 4M48L 1T03H 2W91A 3CK0H 4Y89A 1CR9H 1JNNL 4PRDA 3V6OE 1A7OL 3DMMB 4PJBF 3H8NA 5C6WH 1UADC 3CLEH 1PZUB 3BIKA 5GISH 1CFNB 1LO4L 3FMGL 3FQTB 5E8DH 3VWKD 3GJFA 2P24B 1JV5B 1C5DA 5EOQH 1GH7A 4JO3H 1FQ9C 4OCSL 3HE6D 1EEZB 4NSKA 5GS2H 3RWFA 4WV1B 3LRSB 3OTTA 4FHBD 1DQDL 3T0EE 1JGDB 3VFOA 3UAJC 3PGDB 3C87A 3MJ9A 3U4BH 4JFQB 1UB6B 4LKXA 4YR6B 5E6ID 4PJ7F 4MA1C 2XXCB 1IEAB 1U95A 3F58H 3CFBB 5T1LA 1MWAB 5KVGH 5IEKB 4L9LB 3MXVL 3RPKA 1XF3B 3ARGA 1GPOL 4W6WB 5C7XL 4YIQB 4KI5D 2XZAH 5JR1L 1MCKA 4WW1A 1MVUA 1PGRB 5A2FA 2A6IA 4PP2B 43C9A 1ADQH 1RZJC 3SJVD 5D7LB 1OVZA 3U2SB 4J1UB 1NKOA 1XGTB 4J4PA 4X5XA 5CLWA 2J8UF 1KTLA 3MRRB 5ESAA 4RMQA 2HH0L 4NKMA