4XPLA

The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
141
Chain Sequence
b'LIKLKNFTELNSQEIELIFKWRKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acetyltransferase, PseH
molecule tags Transferase
source organism Campylobacter jejuni subsp. jejuni pt14
publication title Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation.
pubmed doi rcsb
total genus 41
structure length 141
sequence length 150
ec nomenclature
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xplA00
2GANA 4KOVA 5F46A 1Y7RA 1S3ZA 2B3UA 1I21A 3LD2A 3F5BA 1KUYA 2G3AA 4HNXB 5JPHA 5H86A 2R8VA 4NF1A 4AVBA 1M44A 4AB7A 4Y49B 3R96A 2FL4A 3D8PA 3S6FA 2FCKA 3R9GA 1Y9WA 1YK3A 3D2MA 3S6HA 1MJBA 2B5GB 5I0CA 4XPDB 4MY0A 4E8OA 2PSWA 2JDCA 1Z4EA 3FRMA 4FD5A 4M85A 2JDDA 2KCWA 2ZPAA 1IYKA 3WR7A 2HUZA 2VZYA 2JLMA 3K9UA 4JWPA 4PK2A 2OZUA 2R98A 4YRHA 4R3KA 3I3GA 4KZTA 1P4NA 4DNCA 4NXYA 3FNCA 4NCZA 4PV6A 3EXNA 2I79A 3F0AA 1J4JA 4JD6A 1WWZA 2FXFA 1XIXA 4E0AA 3P2FA 4JXQA 1R57A 2ATRA 1PU9A 4JJXA 4IF5A 4J3GA 1U6MA 2Q0YA 4KVOE 3PGPA 3TO6A 4AG9A 2VI7A 2D4OA 1QSOA 3DSBA 4PSXA 5J8CA 3R9FA 2HQYA 2BEIA 5J8FA 1L0CA 2EUIA 4H6UA 1KUXA 2F5IA 4MJ8A 5CNPA 2O28A 2DXQA 3QAHA 2FT0A 3BJ8A 5IB0A 3PP9A 3CXSA 1MK4A 2B4DB 2C27A 4HKFA 2FIAA 3GYAA 2GE3A 2ZW7A 1S5KA 3D3SA 1S7FA 3NE7A 1I12A 5H84A 1YVKA 3CXPA 4R57A 4L89A 3G3SA 1YR0A 3CXQA 2D4PA 2IL4A 1IB1E 4PSWA 2AE6A 2BUEA 3EC4A 2J8MA 2WPWA 2Z0ZA 4MBUA 1IICA 4KOSA 4Y49C 3N7ZA 4RS2A 3DR8A 3UY5A 4HNWB 4FD7A 2B58A 3IWGA 1UFHA 4IUSA 3R1KA 1NMTA 3FYNA 4RI1A 2QMLA 4XNHB 4B5PB 1YREA 4B5PA 3JVNA 2B4BA 3BJ7A 3TOAA 4MY3A 2FIWA 1S7LA 2ZW4A 4MI4A 2PQ8A 4U9ZA 2BL1A 4H6ZA 4KOWA 1CM0A 1CJWA 5EBVA 1XEBA 2OZGA 3I9SA 3T90A 1IYLA 2BSWA 1MJ9A 4CRYB 4UWJA 1MJAA 4II9A 1QSMA 2PR8A 2Q4YA 1YLEA 4QC6A 4JXRA 2VZZA 3OWCA 1XE4A 4KLVA 4QBJA 5IX3A 2Q4VA 3MGDA 2ZXVA 5C88A 2B4DA 4F6AA 1QSTA 4JLYA 1Z4RA 2CNTA 4KUAA 2G0BA 1M1DA 1M4IA 4XPLA 3TOBA 3W6XA 2PDOA 2ARHA 2CNMA 2REFA 2QECA 5DWNA 4AG7A 3FXTA 1VKCA 4R3LA 1RO5A 4OADA 1BO4A 3ZZIA 5E96A 3DDDA 3TCVA 3VWDA 2REEA 2P0WA 3E0KA 5F48A 3JUWA 3QB8A 1PUAA 2VBQA 5KTCA 3RYOA 2OU2A 1YX0A 3TE4A 4FD4A 4CAVA 4L8AA 3BLNA 3W6SA 2R1IA 5EC4A 3DR6A 5GCNA 4LUAA 4ONUA 4BMHA 2R7HA 1GHEA 3EFAA 4KOUA 5KTAA 3R95A 2G3TA 3SHPA 2PC1A 5FVJA 4KLWA 4YFJA 1OZPA 2K5TA 3VWEA 3SXOA 1KUVA 1M4GA 2P6EA 4XPKA 4R87A 3TO9A 4R9MA 4E2AA 4OAEA 2ZW5A 2B5GA 4CRZB 5C82A 4XPDC 4KOTA 2Q04A 3V8IA 5HMNA 1KZFA 3TO7A 1V0CA 1K4JA 5JQ4A 1QSRA 5ISVA 4KORA 2FE7A 1NE9A 1LRZA 2OZHA 4X5KA 4KVME 4XNHC 3R9EA 3T9YA 4OLLA 1I1DA 2Y0MA 3FB3A 1S60A 4KUBA 1FY7A 1B6BA 1Q2CA 2OH1A 1SQHA 3LODA 4AVCA 1VHSA 1XMTA 2RC4A 1Y9KA 2VEZA 3ZJ0A 2AJ6A 2QIRA 4HNYB 1P0HA 2VQYA 2Q44A 4B5OA 2Z11A 4PK3A 2FS5A 3S6KA 1IIDA 3TT2A 5DWMA 3EO4A 1YVOA 2ZW6A 4ZBGA 3FBUA 1Q2DA 1RXTA 1S7NA 2PRBA 2PR1A 4QVTA 4ORFA 5KTDA 4KOYA 1XF8A 1YGHA 3IGRA 4NSQA 2A4NA 4EVYA 4H89A 4YGOA 1N71A 4QUSA 3GKRA 3EY5A 1QSNA 3F8KA 3S6GA 4CAXA 3G8WA 4MHDA 3TFYA 2JEVA 2Z10A 4UWIA 2GIVA 4NEXA 3DNSA 1NSLA 3B8GA 4UBRA 2J8RA 2WPXA 3FIXA 4LX9A 4AVAA 1S7KA 3P2HA 5F47A 2NMTA 4F0YA 4CS0B 5HH1A 1TIQA 2EVNA 2Q7BA 1Z9UA 2CY2A 2H5MA 2J8NA 2VXKA 2HV2A 3C26A 5IV0A 4GS4A 2OB0A 4U9YA 4U5YA 4KVXA 3W91A 5F49A 4K30A 4CAWA 3H4QA 3TTHA 2P6GA 1ON0A 4QB9A 1Q2YA 1M4DA 3KKWA 3GY9A 4FD6A 2B3VA 2X7BA 2CNSA 2P6FA 2I00A 4UA3A 1B87A 2FSRA 4I49A 4KOXA 1BOBA 4M3SA 3D2PA 3SXNA 1WK4A 3PZJA
chains in the Genus database with same CATH superfamily
2GANA 4CPAA 4KOVA 5AG4A 5F46A 4MHNA 1Y7RA 1S3ZA 2B3UA 1I21A 3LD2A 2PJ8A 3F5BA 4MFQA 2C6CA 4M6GA 1KUYA 3LACA 4ZGYB 2G3AA 3K9TA 2PJCA 4HNXB 8CPAA 5JPHA 3S9LA 5H86A 2R8VA 2YGWA 4NF1A 4KS9A 4AVBA 1M44A 4BINA 4AB7A 4Y49B 3R96A 1ARMA 4MHYA 2FL4A 3KGQA 3L2NA 4A32A 3D8PA 4DYOA 3S6FA 2FCKA 2ZEDA 3R9GA 3H8GA 1Y9WA 5JH9A 4NGSA 1YK3A 4P4BA 3PB8X 3D2MA 4UF4A 2WSAA 5LRKA 2Z3KA 3S6HA 1MJBA 5LRJA 2B5GB 4MRIA 5I0CA 4XPDB 3GUXA 4CGMA 4MY0A 3PB4X 4KSAA 2WZNA 4E8OA 2PSWA 2PJ4A 3JRUA 2JDCA 1Z4EA 3FRMA 4FD5A 2ZEGA 1YMEA 2XEFA 4M85A 4CGOA 2JDDA 3I1UA 4OC0A 1TXRA 3FEDA 1AUGA 2KCWA 2ZPAA 5AG5A 3S9MA 3VARA 4R8FA 1IYKA 4RUHA 3WR7A 1BAVA 2HUZA 2VZYA 3VH9A 1NSAA 4A2ZA 4AXVA 2JBJA 2JLMA 3K9UA 2BO9A 4DJLA 1YLOA 3D7HA 4JWPA 1DE4C 3IFEA 3SI2A 4PK2A 2YNDA 1VIXA 2Q51A 4C68A 2OZUA 2R98A 4YRHA 4ZY2A 3RO0A 4R3KA 4NGMA 3I3GA 4KZTA 1P4NA 1TF8A 2O4HA 4DNCA 4NXYA 2YNCA 4F9UA 2AFWA 1VHOA 2F8HA 3D4UA 3FNCA 4NCZA 4WJBA 4PV6A 3EXNA 3WT4A 7CPAA 2I79A 2V77A 1ZG8A 3F0AA 1J4JA 5J1QA 4JD6A 1WWZA 2FXFA 5G1ZA 3NFZA 1XIXA 2PCUA 3P2FA 4E0AA 2PJ5A 1R57A 2ATRA 4JXQA 1PU9A 4JJXA 3WC5A 4IF5A 2V8DA 4J3GA 2AFSA 5HXDA 1U6MA 2ZEHA 3D66A 2Q0YA 5G22A 4AVCA 4C7HA 3PEIA 4KVOE 3PGPA 4IHMA 3B3VA 2ZENA 3TO6A 4AG9A 2JEWA 2VI7A 4A33A 4G1PA 3B3WA 3D68A 1JQGA 2DF5A 2D4OA 3DLJA 1QSOA 4EMEA 3LWUA 3DSBA 4PSXA 1PCAA 5J8CA 2EK8A 3R9FA 3VATA 5LYLA 2HQYA 2BEIA 4NJQA 5JGFA 5J8FA 1L0CA 3WC7A 2EUIA 4H6UA 2EK9A 1KUXA 4MHPA 2F5IA 4NGPA 4F8ZA 4MJ8A 5CNPA 2O28A 3KR4A 2DXQA 1CP6A 2Z3MA 1BPNA 3CPXA 3IWWA 3QAHA 4ZY0A 2FT0A 1CP7A 3BJ8A 4NGTA 3T8WA 5IB0A 3PP9A 1MK4A 3BI1A 3CXSA 2B4DB 3PB6X 2C27A 3D7FA 4HKFA 1XBUA 2FIAA 3GYAA 4OC3A 2GE3A 2Z3PA 1S5KA 2ZW7A 3D3SA 4BBHA 4X3RA 4HPSA 1S7FA 4B12A 3NE7A 1I12A 4F9VA 5H84A 1YVKA 3CXPA 5LRGA 4UIAA 4R57A 4DUKA 4L89A 2CTCA 4JZ0A 4UCNA 3D67A 3G3SA 5ELYA 1YR0A 3CXQA 2IMOA 2D4PA 1Z8TA 4ZX8A 3KQZA 2IL4A 1IB1E 4P4JA 2XEIA 2AE6A 1X10A 4PSWA 2BUEA 4TNUA 3EC4A 5D8NA 4A38A 1FT7A 2J8MA 4JYWA 2WPWA 1HEEA 4ZI6A 2Z0ZA 5HVHA 4MBUA 4OC1A 2PVVA 1IICA 3CPAA 4KOSA 1AMPA 2OOTA 1Z8LA 4Y49C 3N7ZA 4RS2A 4CGPA 1IOFA 2NSMA 2PJBA 3RAMA 1CG2A 2IQ6A 3DR8A 3UY5A 2POKA 4HNWB 2PJ7A 4FD7A 2GU2A 4A31A 1F57A 2B58A 2ZEEA 4MCQA 4CYQA 3IWGA 1UFHA 4IUSA 3R1KA 1NMTA 3FYNA 1ZLIA 4RI1A 4MCSA 2QMLA 1LOKA 3PBEA 4UCMA 4XNHB 4B5PB 1YREA 4B5PA 2EO8A 3JVNA 1YQEA 2B4BA 3FF3A 3IJ3A 3BJ7A 3TOAA 4MY3A 4A95A 1LFWA 4P4EA 2FIWA 2AFUA 1S7LA 1XMBA 2GLFA 2V8VA 1CBXA 2ZW4A 2PQ8A 4MI4A 1XOVA 2GREA 4FWUA 4PXBA 4X2TA 4U9ZA 4OKOA 2BL1A 4H6ZA 3PBBA 5BWAB 4KOWA 3WABA 2CXAA 3H8EA 1CM0A 5K8OA 1CJWA 3ISZA 1ZG7A 5EBVA 4CAFA 2AFMA 5CPAA 2PJ9A 2OZGA 1XEBA 3I9SA 3FECA 1IYLA 1IGBA 2EWBA 3IC1A 3T90A 5THWA 3K2KA 2BSWA 1XJOA 1MJ9A 2DEAA 3NH5A 5A27A 2G9DA 4CRYB 4UWJA 1HDUA 1FNOA 4OC4A 2Z3NA 1MJAA 3KL9A 4II9A 2HB6A 1QSMA 2GFQA 2PR8A 2Q4YA 5K8PA 4PXCA 1YLEA 2BCOA 4QC6A 3A9LA 4JXRA 2VZZA 3OWCA 1XE4A 4KLVA 4B6ZA 3SJEA 2PIYA 3FX6A 4P10A 4CGNA 4QBJA 1R3NA 2Q4VA 5IX3A 2XEGA 1F2OA 2C6GA 1Q7LA 3RZAA 4NFRA 3JTKA 5HVFA 3MGDA 2NYQA 4NGRA 2ZXVA 5C88A 2PVWA 2B4DA 4F6AA 1QSTA 3SJGA 4JLYA 1Z4RA 1HDQA 2CNTA 4IAVA 4K3NA 4KUAA 2G0BA 4PXEA 1H8LA 4P4FA 3ISXA 1M1DA 1M4IA 3IWEA 4XPLA 4UCPA 1CPSA 3TOBA 1LANA 3PFEA 3B3CA 3W6XA 2PDOA 1JWQA 2ARHA 2CNMA 2REFA 4R7MA 1Z2LA 2QECA 5DWNA 1Z5RA 2Q4ZA 3FXTA 4AG7A 1VKCA 4R3LA 4C2ZA 3IO1A 1RO5A 1ELMP 4OADA 1BO4A 2ANPA 3GLJA 5HVGA 3ZZIA 5E96A 3DDDA 2PJAA 2DPSA 3NE8A 2CF4A 4KSFA 3KASA 2REEA 2P0WA 4MCPA 3TCVA 3VWDA 2Z3OA 3E0KA 5F48A 3JUWA 3QB8A 1PUAA 2WYRA 4R6TA 4EFDA 2VBQA 5G20A 5KTCA 3RYOA 2OU2A 1YX0A 2EBJA 3FJUA 3TE4A 3KQXA 4A37A 2BOAA 3LMSA 1BPMA 4FD4A 4CAVA 3H8FA 3FEEA 4CYOA 4L8AA 3BLNA 2ZEOA 3W6SA 2R1IA 5EC4A 1X12A 1A2ZA 3DR6A 4A39A 3B3TA 4A94A 5GCNA 3FVLA 1ELLP 4LUAA 4P45A 3TC8A 4NJRA 4ONUA 2PE3A 4BMHA 2R7HA 1GHEA 3EFAA 4KOUA 3TX8A 1Y7EA 5KTAA 3R95A 2G3TA 3SHPA 1TKFA 2PC1A 1VGYA 3PB9X 5FVJA 3RBUA 4KLWA 4WWVA 5F09A 4MHZA 1AYEA 4YFJA 1OZPA 4OP4A 4UFWA 2K5TA 2PJ1A 6CPAA 4C2XA 4OC2A 5AGEA 3NA6A 2RB7A 1IY7A 5LYDA 3SXOA 3VWEA 1LCPA 1KUVA 1CX8A 3B2YA 1M4GA 2P6EA 1RTQA 4UFXA 4XPKA 4R87A 3TO9A 4R9MA 4E2AA 4OAEA 2ZW5A 2B5GA 3S9NA 3PFOA 4CRZB 2DPTA 1LAPA 1Y0RA 5C82A 1LAMA 3QNVA 4XPDC 4KOTA 2Q04A 2YNEA 3HLPA 3V8IA 5CBMA 5HMNA 1KZFA 4FUUA 3MRUA 3TO7A 1V0CA 5EMIA 1F2PA 1K4JA 2OR4A 1VHEA 4M6HA 1QSRA 4MXUA 5JQ4A 2Q7SA 5ISVA 4KORA 4B11A 2FE7A 1NE9A 1LRZA 4IK2A 4OMEA 4MMOA 1ZO0A 3CDXA 4X8IA 2PJ6A 2OZHA 4X5KA 4KVME 4XNHC 4CYPA 3R9EA 3KHXA 3T9YA 4C2YA 1XRYA 4OLLA 2ZEPA 1I1DA 2Y0MA 3FB3A 1S60A 3RNZA 4KUBA 2QJ8A 1FY7A 4UEFA 3NH8A 1B6BA 1Q2CA 2OH1A 2ZELA 3KI9A 3PRTA 1SQHA 3LODA 3PB7X 1VHSA 1XMTA 2RC4A 3KR5A 5AG7A 1Y9KA 2VEZA 1YSJA 2AJ6A 2QIRA 1P0HA 2V8HA 2Q44A 2VQYA 4HNYB 2CTBA 4PQAA 2Z11A 1YW4A 4B5OA 2PJ0A 3IU2A 1UWYA 5JM6A 3HUVA 3IU1A 2HC9A 4PK3A 1TKJA 2FS5A 2ZEMA 1IOIA 3S6KA 1IIDA 4OC5A 3TT2A 1XFOA 2IJZA 5DWMA 3EO4A 1YW6A 1M4LA 1YVOA 4ZY1A 4C7IA 2ZW6A 4ZBGA 4OIDA 4M6IA 3CZXA 3B35A 3FBUA 4P6YA 1Q2DA 2YNCC 4R76A 1RXTA 1S7NA 1Y0YA 2PRBA 2QVPA 4A30A 1BLLE 1ZG9A 4UEEA 2PR1A 4QVTA 2Q43A 4ORFA 5KTDA 2I3CA 3BI0A 4KOYA 1XF8A 5D29A 3BHXA 1YGHA 4UIBA 3GIUA 3IGRA 2ODFA 4NSQA 2A4NA 2GLJA 5LYFA 1Z8WA 3MN8A 1OBRA 1QQ9A 2XEJA 1ARLA 4EVYA 3FH4A 4H89A 4NGQA 4YGOA 1KWMA 1N71A 3IEHA 4QUSA 3GKRA 3EY5A 3V38A 4RN7A 1QSNA 4Q36A 5A28A 3F8KA 4Q38A 3IIBA 3S6GA 3N5FA 4CAXA 3G8WA 4MHDA 3SJFA 4UEZA 3KHZA 4CGLA 3TFYA 2JEVA 3ZJ0A 2Z10A 4FAIA 4UWIA 4YU9A 2GIVA 2PRQA 1EE3P 4FBEA 2ABZA 4P44A 4P4IA 2CIJA 4EWTA 2O53A 4MFZA 4NEXA 3DNSA 5K8NA 5G21A 4ZX9A 1NSLA 3B8GA 3B3SA 1R43A 4UBRA 2VL1A 4PPZA 2J8RA 2WPXA 3CT9A 3NH4A 2AFZA 3V7ZA 2JBKA 3FIXA 4LX9A 4ZYQA 2J9AA 4AVAA 3FMCA 2PJ3A 4MCRA 2FVGA 4B13A 1S7KA 3DGVA 3P2HA 2C6PA 5F47A 3WC6A 2AFOA 4Z65A 4YWYA 2NMTA 2F7VA 4F0YA 3QAYA 4CS0B 2QYVA 4ONWA 5HH1A 4Q7AA 1TIQA 2EVNA 2Q7BA 4O23A 4CYNA 3SJXA 4GXHA 4BD9A 1Z9UA 3GB0A 2CY2A 2H5MA 2J8NA 1QMUA 1TF9A 2VXKA 2HV2A 4PXDA 5AG6A 3SI1A 4CAEA 4MFJA 1CPXA 2ZEFA 3C26A 3BXMA 4KSIA 4LQ6A 4B14A 5IB9A 5IV0A 4GS4A 4F0XA 2OB0A 1PYTB 4H2KA 4U9YA 1ZLHA 1Z8XA 3KZWA 4LQGA 4U5YA 2V8GA 4OIWA 4KVXA 3W91A 4TWEA 5F49A 3D7GA 4K30A 4NGNA 5DS0A 4CAWA 3H4QA 3TTHA 2P6GA 1ON0A 3D7DA 2PIZA 4W9YA 2AFXA 2PJ2A 2ZOFA 4QB9A 5K8MA 1Q2YA 4GM5A 2ZOGA 5LYIA 4B10A 4MFPA 1M4DA 3KKWA 4UFVA 1IU8A 1DTDA 3H5ZA 1GYTA 3GY9A 4FD6A 4MFKA 2RFHA 2B3VA 2X7BA 2WUUA 3SI0A 3B7IA 2CNSA 2P6FA 2I00A 4UA3A 2C1CA 1B87A 2FSRA 2Z3LA 4I49A 1BOBA 1TKHA 4KOXA 4M3SA 5I4MA 4MFLA 4P4DA 3D2PA 3SXNA 1WK4A 3PZJA
chains in the Genus database with same CATH topology
2GANA 4KOVA 5AG4A 5F46A 1Y7RA 1S3ZA 2B3UA 1I21A 3LD2A 3F5BA 4MFQA 1KUYA 4ZGYB 2G3AA 4HNXB 5JPHA 5H86A 2R8VA 2YGWA 4NF1A 4KS9A 4AVBA 1M44A 4AB7A 4Y49B 3R96A 2FL4A 4A32A 3D8PA 3S6FA 2FCKA 3R9GA 1Y9WA 1YK3A 3D2MA 2WSAA 2Z3KA 3S6HA 1MJBA 2B5GB 5I0CA 4XPDB 4CGMA 4MY0A 4KSAA 4E8OA 2PSWA 2JDCA 1Z4EA 3FRMA 4FD5A 4M85A 4CGOA 2JDDA 2KCWA 2ZPAA 5AG5A 1IYKA 3WR7A 2HUZA 2VZYA 4A2ZA 2JLMA 3K9UA 4JWPA 4PK2A 2YNDA 4C68A 2OZUA 2R98A 4YRHA 4R3KA 3I3GA 4KZTA 1P4NA 4DNCA 4NXYA 2YNCA 3FNCA 4NCZA 4PV6A 3EXNA 2I79A 3F0AA 1J4JA 4JD6A 1WWZA 2FXFA 5G1ZA 1XIXA 4E0AA 3P2FA 4JXQA 1R57A 2ATRA 1PU9A 4JJXA 4IF5A 4J3GA 1U6MA 5G22A 2Q0YA 4C7HA 4KVOE 3PGPA 3TO6A 4AG9A 2VI7A 4A33A 2D4OA 1QSOA 3DSBA 4PSXA 5J8CA 3R9FA 2HQYA 2BEIA 5J8FA 1L0CA 2EUIA 4H6UA 1KUXA 2F5IA 4MJ8A 5CNPA 2O28A 2DXQA 2Z3MA 3QAHA 2FT0A 3BJ8A 5IB0A 3PP9A 3CXSA 1MK4A 2B4DB 2C27A 4HKFA 2FIAA 3GYAA 2GE3A 2Z3PA 1S5KA 2ZW7A 3D3SA 4BBHA 1S7FA 4B12A 3NE7A 1I12A 5H84A 1YVKA 3CXPA 4R57A 4L89A 4UCNA 3G3SA 1YR0A 3CXQA 2D4PA 2IL4A 1IB1E 4PSWA 2AE6A 2BUEA 3EC4A 2J8MA 2WPWA 2Z0ZA 4MBUA 1IICA 4KOSA 4Y49C 3N7ZA 4RS2A 4CGPA 3DR8A 3UY5A 4HNWB 4FD7A 4A31A 2B58A 4CYQA 3IWGA 1UFHA 4IUSA 3R1KA 1NMTA 3FYNA 4RI1A 2QMLA 4XNHB 4B5PB 4UCMA 1YREA 4B5PA 3JVNA 2B4BA 3BJ7A 3TOAA 4MY3A 4A95A 2FIWA 1S7LA 2ZW4A 4MI4A 2PQ8A 4U9ZA 2BL1A 4H6ZA 5BWAB 4KOWA 2CXAA 1CM0A 1CJWA 5EBVA 4CAFA 1XEBA 2OZGA 3I9SA 3T90A 1IYLA 2BSWA 1MJ9A 5A27A 4CRYB 4UWJA 2Z3NA 1MJAA 4II9A 1QSMA 2PR8A 2Q4YA 1YLEA 4QC6A 3A9LA 4JXRA 2VZZA 3OWCA 1XE4A 4KLVA 4QBJA 5IX3A 4CGNA 2Q4VA 3JTKA 3MGDA 2ZXVA 5C88A 2B4DA 4F6AA 1QSTA 4JLYA 1Z4RA 2CNTA 4KUAA 2G0BA 1M1DA 1M4IA 3IWEA 4XPLA 4UCPA 3TOBA 3W6XA 2PDOA 2ARHA 2CNMA 2REFA 2QECA 5DWNA 4AG7A 3FXTA 1VKCA 4R3LA 4C2ZA 1RO5A 4OADA 1BO4A 3ZZIA 5E96A 3DDDA 2DPSA 3TCVA 3VWDA 4KSFA 2REEA 2P0WA 2Z3OA 3E0KA 5F48A 3JUWA 3QB8A 1PUAA 2VBQA 5G20A 5KTCA 3RYOA 2OU2A 1YX0A 3TE4A 4FD4A 4CAVA 4CYOA 4L8AA 3BLNA 3W6SA 2R1IA 5EC4A 3DR6A 5GCNA 4LUAA 4ONUA 4BMHA 2R7HA 1GHEA 3EFAA 4KOUA 5KTAA 3R95A 2G3TA 3SHPA 2PC1A 5FVJA 4KLWA 4YFJA 1OZPA 4UFWA 2K5TA 4C2XA 5AGEA 3VWEA 3SXOA 1KUVA 1M4GA 2P6EA 4UFXA 4XPKA 4R87A 3TO9A 4R9MA 4E2AA 4OAEA 2ZW5A 2B5GA 4CRZB 2DPTA 5C82A 4XPDC 4KOTA 2Q04A 2YNEA 3V8IA 5HMNA 1KZFA 3TO7A 1V0CA 1K4JA 5JQ4A 1QSRA 5ISVA 4KORA 4B11A 2FE7A 1NE9A 1LRZA 1ZO0A 2OZHA 4X5KA 4KVME 4XNHC 4CYPA 3R9EA 3T9YA 4C2YA 4OLLA 1I1DA 2Y0MA 3FB3A 1S60A 4KUBA 1FY7A 1B6BA 1Q2CA 2OH1A 1SQHA 3LODA 5AG7A 1VHSA 1XMTA 2RC4A 4AVCA 1Y9KA 2VEZA 3ZJ0A 2AJ6A 2QIRA 4HNYB 1P0HA 2VQYA 2Q44A 4B5OA 2Z11A 3IU2A 3IU1A 4PK3A 2FS5A 3S6KA 1IIDA 3TT2A 5DWMA 3EO4A 1YVOA 4C7IA 2ZW6A 4ZBGA 3FBUA 2YNCC 1Q2DA 1RXTA 1S7NA 2PRBA 4A30A 2PR1A 4QVTA 4ORFA 5KTDA 4KOYA 1XF8A 1YGHA 3IGRA 4NSQA 2A4NA 4EVYA 4H89A 4YGOA 1N71A 4QUSA 3GKRA 3EY5A 1QSNA 4Q36A 5A28A 3F8KA 4Q38A 3S6GA 4CAXA 3G8WA 4MHDA 4CGLA 3TFYA 2JEVA 2Z10A 4UWIA 2GIVA 4MFZA 4NEXA 3DNSA 5G21A 1NSLA 3B8GA 4UBRA 2J8RA 2WPXA 3FIXA 4LX9A 4AVAA 4B13A 1S7KA 3P2HA 5F47A 2NMTA 4F0YA 4CS0B 5HH1A 1TIQA 2EVNA 2Q7BA 4CYNA 1Z9UA 2CY2A 2H5MA 2J8NA 2VXKA 2HV2A 5AG6A 4CAEA 4MFJA 3C26A 4B14A 5IV0A 4GS4A 4F0XA 2OB0A 4U9YA 4U5YA 4KVXA 3W91A 5F49A 4K30A 4CAWA 3H4QA 3TTHA 2P6GA 1ON0A 4QB9A 1Q2YA 4B10A 4MFPA 1M4DA 3KKWA 4UFVA 3H5ZA 3GY9A 4FD6A 4MFKA 2B3VA 2X7BA 2WUUA 2CNSA 2P6FA 2I00A 4UA3A 4I49A 4KOXA 1B87A 2FSRA 1BOBA 2Z3LA 4M3SA 4MFLA 3D2PA 3SXNA 1WK4A 3PZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAN A;  4KOV A;  5F46 A;  1Y7R A;  1S3Z A;  2B3U A;  1I21 A;  3LD2 A;  3F5B A;  1KUY A;  2G3A A;  4HNX B;  5JPH A;  5H86 A;  2R8V A;  4NF1 A;  4AVB A;  1M44 A;  4AB7 A;  4Y49 B;  3R96 A;  2FL4 A;  3D8P A;  3S6F A;  2FCK A;  3R9G A;  1Y9W A;  1YK3 A;  3D2M A;  3S6H A;  1MJB A;  2B5G B;  5I0C A;  4XPD B;  4MY0 A;  4E8O A;  2PSW A;  2JDC A;  1Z4E A;  3FRM A;  4FD5 A;  4M85 A;  2JDD A;  2KCW A;  2ZPA A;  1IYK A;  3WR7 A;  2HUZ A;  2VZY A;  2JLM A;  3K9U A;  4JWP A;  4PK2 A;  2OZU A;  2R98 A;  4YRH A;  4R3K A;  3I3G A;  4KZT A;  1P4N A;  4DNC A;  4NXY A;  3FNC A;  4NCZ A;  4PV6 A;  3EXN A;  2I79 A;  3F0A A;  1J4J A;  4JD6 A;  1WWZ A;  2FXF A;  1XIX A;  4E0A A;  3P2F A;  4JXQ A;  1R57 A;  2ATR A;  1PU9 A;  4JJX A;  4IF5 A;  4J3G A;  1U6M A;  2Q0Y A;  4KVO E;  3PGP A;  3TO6 A;  4AG9 A;  2VI7 A;  2D4O A;  1QSO A;  3DSB A;  4PSX A;  5J8C A;  3R9F A;  2HQY A;  2BEI A;  5J8F A;  1L0C A;  2EUI A;  4H6U A;  1KUX A;  2F5I A;  4MJ8 A;  5CNP A;  2O28 A;  2DXQ A;  3QAH A;  2FT0 A;  3BJ8 A;  5IB0 A;  3PP9 A;  3CXS A;  1MK4 A;  2B4D B;  2C27 A;  4HKF A;  2FIA A;  3GYA A;  2GE3 A;  2ZW7 A;  1S5K A;  3D3S A;  1S7F A;  3NE7 A;  1I12 A;  5H84 A;  1YVK A;  3CXP A;  4R57 A;  4L89 A;  3G3S A;  1YR0 A;  3CXQ A;  2D4P A;  2IL4 A;  1IB1 E;  4PSW A;  2AE6 A;  2BUE A;  3EC4 A;  2J8M A;  2WPW A;  2Z0Z A;  4MBU A;  1IIC A;  4KOS A;  4Y49 C;  3N7Z A;  4RS2 A;  3DR8 A;  3UY5 A;  4HNW B;  4FD7 A;  2B58 A;  3IWG A;  1UFH A;  4IUS A;  3R1K A;  1NMT A;  3FYN A;  4RI1 A;  2QML A;  4XNH B;  4B5P B;  1YRE A;  4B5P A;  3JVN A;  2B4B A;  3BJ7 A;  3TOA A;  4MY3 A;  2FIW A;  1S7L A;  2ZW4 A;  4MI4 A;  2PQ8 A;  4U9Z A;  2BL1 A;  4H6Z A;  4KOW A;  1CM0 A;  1CJW A;  5EBV A;  1XEB A;  2OZG A;  3I9S A;  3T90 A;  1IYL A;  2BSW A;  1MJ9 A;  4CRY B;  4UWJ A;  1MJA A;  4II9 A;  1QSM A;  2PR8 A;  2Q4Y A;  1YLE A;  4QC6 A;  4JXR A;  2VZZ A;  3OWC A;  1XE4 A;  4KLV A;  4QBJ A;  5IX3 A;  2Q4V A;  3MGD A;  2ZXV A;  5C88 A;  2B4D A;  4F6A A;  1QST A;  4JLY A;  1Z4R A;  2CNT A;  4KUA A;  2G0B A;  1M1D A;  1M4I A;  4XPL A;  3TOB A;  3W6X A;  2PDO A;  2ARH A;  2CNM A;  2REF A;  2QEC A;  5DWN A;  4AG7 A;  3FXT A;  1VKC A;  4R3L A;  1RO5 A;  4OAD A;  1BO4 A;  3ZZI A;  5E96 A;  3DDD A;  3TCV A;  3VWD A;  2REE A;  2P0W A;  3E0K A;  5F48 A;  3JUW A;  3QB8 A;  1PUA A;  2VBQ A;  5KTC A;  3RYO A;  2OU2 A;  1YX0 A;  3TE4 A;  4FD4 A;  4CAV A;  4L8A A;  3BLN A;  3W6S A;  2R1I A;  5EC4 A;  3DR6 A;  5GCN A;  4LUA A;  4ONU A;  4BMH A;  2R7H A;  1GHE A;  3EFA A;  4KOU A;  5KTA A;  3R95 A;  2G3T A;  3SHP A;  2PC1 A;  5FVJ A;  4KLW A;  4YFJ A;  1OZP A;  2K5T A;  3VWE A;  3SXO A;  1KUV A;  1M4G A;  2P6E A;  4XPK A;  4R87 A;  3TO9 A;  4R9M A;  4E2A A;  4OAE A;  2ZW5 A;  2B5G A;  4CRZ B;  5C82 A;  4XPD C;  4KOT A;  2Q04 A;  3V8I A;  5HMN A;  1KZF A;  3TO7 A;  1V0C A;  1K4J A;  5JQ4 A;  1QSR A;  5ISV A;  4KOR A;  2FE7 A;  1NE9 A;  1LRZ A;  2OZH A;  4X5K A;  4KVM E;  4XNH C;  3R9E A;  3T9Y A;  4OLL A;  1I1D A;  2Y0M A;  3FB3 A;  1S60 A;  4KUB A;  1FY7 A;  1B6B A;  1Q2C A;  2OH1 A;  1SQH A;  3LOD A;  4AVC A;  1VHS A;  1XMT A;  2RC4 A;  1Y9K A;  2VEZ A;  3ZJ0 A;  2AJ6 A;  2QIR A;  4HNY B;  1P0H A;  2VQY A;  2Q44 A;  4B5O A;  2Z11 A;  4PK3 A;  2FS5 A;  3S6K A;  1IID A;  3TT2 A;  5DWM A;  3EO4 A;  1YVO A;  2ZW6 A;  4ZBG A;  3FBU A;  1Q2D A;  1RXT A;  1S7N A;  2PRB A;  2PR1 A;  4QVT A;  4ORF A;  5KTD A;  4KOY A;  1XF8 A;  1YGH A;  3IGR A;  4NSQ A;  2A4N A;  4EVY A;  4H89 A;  4YGO A;  1N71 A;  4QUS A;  3GKR A;  3EY5 A;  1QSN A;  3F8K A;  3S6G A;  4CAX A;  3G8W A;  4MHD A;  3TFY A;  2JEV A;  2Z10 A;  4UWI A;  2GIV A;  4NEX A;  3DNS A;  1NSL A;  3B8G A;  4UBR A;  2J8R A;  2WPX A;  3FIX A;  4LX9 A;  4AVA A;  1S7K A;  3P2H A;  5F47 A;  2NMT A;  4F0Y A;  4CS0 B;  5HH1 A;  1TIQ A;  2EVN A;  2Q7B A;  1Z9U A;  2CY2 A;  2H5M A;  2J8N A;  2VXK A;  2HV2 A;  3C26 A;  5IV0 A;  4GS4 A;  2OB0 A;  4U9Y A;  4U5Y A;  4KVX A;  3W91 A;  5F49 A;  4K30 A;  4CAW A;  3H4Q A;  3TTH A;  2P6G A;  1ON0 A;  4QB9 A;  1Q2Y A;  1M4D A;  3KKW A;  3GY9 A;  4FD6 A;  2B3V A;  2X7B A;  2CNS A;  2P6F A;  2I00 A;  4UA3 A;  1B87 A;  2FSR A;  4I49 A;  4KOX A;  1BOB A;  4M3S A;  3D2P A;  3SXN A;  1WK4 A;  3PZJ A; 
#chains in the Genus database with same CATH topology
 2GAN A;  4CPA A;  4KOV A;  5AG4 A;  5F46 A;  4MHN A;  1Y7R A;  1S3Z A;  2B3U A;  1I21 A;  3LD2 A;  2PJ8 A;  3F5B A;  4MFQ A;  2C6C A;  4M6G A;  1KUY A;  3LAC A;  4ZGY B;  2G3A A;  3K9T A;  2PJC A;  4HNX B;  8CPA A;  5JPH A;  3S9L A;  5H86 A;  2R8V A;  2YGW A;  4NF1 A;  4KS9 A;  4AVB A;  1M44 A;  4BIN A;  4AB7 A;  4Y49 B;  3R96 A;  1ARM A;  4MHY A;  2FL4 A;  3KGQ A;  3L2N A;  4A32 A;  3D8P A;  4DYO A;  3S6F A;  2FCK A;  2ZED A;  3R9G A;  3H8G A;  1Y9W A;  5JH9 A;  4NGS A;  1YK3 A;  4P4B A;  3PB8 X;  3D2M A;  4UF4 A;  2WSA A;  5LRK A;  2Z3K A;  3S6H A;  1MJB A;  5LRJ A;  2B5G B;  4MRI A;  5I0C A;  4XPD B;  3GUX A;  4CGM A;  4MY0 A;  3PB4 X;  4KSA A;  2WZN A;  4E8O A;  2PSW A;  2PJ4 A;  3JRU A;  2JDC A;  1Z4E A;  3FRM A;  4FD5 A;  2ZEG A;  1YME A;  2XEF A;  4M85 A;  4CGO A;  2JDD A;  3I1U A;  4OC0 A;  1TXR A;  3FED A;  1AUG A;  2KCW A;  2ZPA A;  5AG5 A;  3S9M A;  3VAR A;  4R8F A;  1IYK A;  4RUH A;  3WR7 A;  1BAV A;  2HUZ A;  2VZY A;  3VH9 A;  1NSA A;  4A2Z A;  4AXV A;  2JBJ A;  2JLM A;  3K9U A;  2BO9 A;  4DJL A;  1YLO A;  3D7H A;  4JWP A;  1DE4 C;  3IFE A;  3SI2 A;  4PK2 A;  2YND A;  1VIX A;  2Q51 A;  4C68 A;  2OZU A;  2R98 A;  4YRH A;  4ZY2 A;  3RO0 A;  4R3K A;  4NGM A;  3I3G A;  4KZT A;  1P4N A;  1TF8 A;  2O4H A;  4DNC A;  4NXY A;  2YNC A;  4F9U A;  2AFW A;  1VHO A;  2F8H A;  3D4U A;  3FNC A;  4NCZ A;  4WJB A;  4PV6 A;  3EXN A;  3WT4 A;  7CPA A;  2I79 A;  2V77 A;  1ZG8 A;  3F0A A;  1J4J A;  5J1Q A;  4JD6 A;  1WWZ A;  2FXF A;  5G1Z A;  3NFZ A;  1XIX A;  2PCU A;  3P2F A;  4E0A A;  2PJ5 A;  1R57 A;  2ATR A;  4JXQ A;  1PU9 A;  4JJX A;  3WC5 A;  4IF5 A;  2V8D A;  4J3G A;  2AFS A;  5HXD A;  1U6M A;  2ZEH A;  3D66 A;  2Q0Y A;  5G22 A;  4AVC A;  4C7H A;  3PEI A;  4KVO E;  3PGP A;  4IHM A;  3B3V A;  2ZEN A;  3TO6 A;  4AG9 A;  2JEW A;  2VI7 A;  4A33 A;  4G1P A;  3B3W A;  3D68 A;  1JQG A;  2DF5 A;  2D4O A;  3DLJ A;  1QSO A;  4EME A;  3LWU A;  3DSB A;  4PSX A;  1PCA A;  5J8C A;  2EK8 A;  3R9F A;  3VAT A;  5LYL A;  2HQY A;  2BEI A;  4NJQ A;  5JGF A;  5J8F A;  1L0C A;  3WC7 A;  2EUI A;  4H6U A;  2EK9 A;  1KUX A;  4MHP A;  2F5I A;  4NGP A;  4F8Z A;  4MJ8 A;  5CNP A;  2O28 A;  3KR4 A;  2DXQ A;  1CP6 A;  2Z3M A;  1BPN A;  3CPX A;  3IWW A;  3QAH A;  4ZY0 A;  2FT0 A;  1CP7 A;  3BJ8 A;  4NGT A;  3T8W A;  5IB0 A;  3PP9 A;  1MK4 A;  3BI1 A;  3CXS A;  2B4D B;  3PB6 X;  2C27 A;  3D7F A;  4HKF A;  1XBU A;  2FIA A;  3GYA A;  4OC3 A;  2GE3 A;  2Z3P A;  1S5K A;  2ZW7 A;  3D3S A;  4BBH A;  4X3R A;  4HPS A;  1S7F A;  4B12 A;  3NE7 A;  1I12 A;  4F9V A;  5H84 A;  1YVK A;  3CXP A;  5LRG A;  4UIA A;  4R57 A;  4DUK A;  4L89 A;  2CTC A;  4JZ0 A;  4UCN A;  3D67 A;  3G3S A;  5ELY A;  1YR0 A;  3CXQ A;  2IMO A;  2D4P A;  1Z8T A;  4ZX8 A;  3KQZ A;  2IL4 A;  1IB1 E;  4P4J A;  2XEI A;  2AE6 A;  1X10 A;  4PSW A;  2BUE A;  4TNU A;  3EC4 A;  5D8N A;  4A38 A;  1FT7 A;  2J8M A;  4JYW A;  2WPW A;  1HEE A;  4ZI6 A;  2Z0Z A;  5HVH A;  4MBU A;  4OC1 A;  2PVV A;  1IIC A;  3CPA A;  4KOS A;  1AMP A;  2OOT A;  1Z8L A;  4Y49 C;  3N7Z A;  4RS2 A;  4CGP A;  1IOF A;  2NSM A;  2PJB A;  3RAM A;  1CG2 A;  2IQ6 A;  3DR8 A;  3UY5 A;  2POK A;  4HNW B;  2PJ7 A;  4FD7 A;  2GU2 A;  4A31 A;  1F57 A;  2B58 A;  2ZEE A;  4MCQ A;  4CYQ A;  3IWG A;  1UFH A;  4IUS A;  3R1K A;  1NMT A;  3FYN A;  1ZLI A;  4RI1 A;  4MCS A;  2QML A;  1LOK A;  3PBE A;  4UCM A;  4XNH B;  4B5P B;  1YRE A;  4B5P A;  2EO8 A;  3JVN A;  1YQE A;  2B4B A;  3FF3 A;  3IJ3 A;  3BJ7 A;  3TOA A;  4MY3 A;  4A95 A;  1LFW A;  4P4E A;  2FIW A;  2AFU A;  1S7L A;  1XMB A;  2GLF A;  2V8V A;  1CBX A;  2ZW4 A;  2PQ8 A;  4MI4 A;  1XOV A;  2GRE A;  4FWU A;  4PXB A;  4X2T A;  4U9Z A;  4OKO A;  2BL1 A;  4H6Z A;  3PBB A;  5BWA B;  4KOW A;  3WAB A;  2CXA A;  3H8E A;  1CM0 A;  5K8O A;  1CJW A;  3ISZ A;  1ZG7 A;  5EBV A;  4CAF A;  2AFM A;  5CPA A;  2PJ9 A;  2OZG A;  1XEB A;  3I9S A;  3FEC A;  1IYL A;  1IGB A;  2EWB A;  3IC1 A;  3T90 A;  5THW A;  3K2K A;  2BSW A;  1XJO A;  1MJ9 A;  2DEA A;  3NH5 A;  5A27 A;  2G9D A;  4CRY B;  4UWJ A;  1HDU A;  1FNO A;  4OC4 A;  2Z3N A;  1MJA A;  3KL9 A;  4II9 A;  2HB6 A;  1QSM A;  2GFQ A;  2PR8 A;  2Q4Y A;  5K8P A;  4PXC A;  1YLE A;  2BCO A;  4QC6 A;  3A9L A;  4JXR A;  2VZZ A;  3OWC A;  1XE4 A;  4KLV A;  4B6Z A;  3SJE A;  2PIY A;  3FX6 A;  4P10 A;  4CGN A;  4QBJ A;  1R3N A;  2Q4V A;  5IX3 A;  2XEG A;  1F2O A;  2C6G A;  1Q7L A;  3RZA A;  4NFR A;  3JTK A;  5HVF A;  3MGD A;  2NYQ A;  4NGR A;  2ZXV A;  5C88 A;  2PVW A;  2B4D A;  4F6A A;  1QST A;  3SJG A;  4JLY A;  1Z4R A;  1HDQ A;  2CNT A;  4IAV A;  4K3N A;  4KUA A;  2G0B A;  4PXE A;  1H8L A;  4P4F A;  3ISX A;  1M1D A;  1M4I A;  3IWE A;  4XPL A;  4UCP A;  1CPS A;  3TOB A;  1LAN A;  3PFE A;  3B3C A;  3W6X A;  2PDO A;  1JWQ A;  2ARH A;  2CNM A;  2REF A;  4R7M A;  1Z2L A;  2QEC A;  5DWN A;  1Z5R A;  2Q4Z A;  3FXT A;  4AG7 A;  1VKC A;  4R3L A;  4C2Z A;  3IO1 A;  1RO5 A;  1ELM P;  4OAD A;  1BO4 A;  2ANP A;  3GLJ A;  5HVG A;  3ZZI A;  5E96 A;  3DDD A;  2PJA A;  2DPS A;  3NE8 A;  2CF4 A;  4KSF A;  3KAS A;  2REE A;  2P0W A;  4MCP A;  3TCV A;  3VWD A;  2Z3O A;  3E0K A;  5F48 A;  3JUW A;  3QB8 A;  1PUA A;  2WYR A;  4R6T A;  4EFD A;  2VBQ A;  5G20 A;  5KTC A;  3RYO A;  2OU2 A;  1YX0 A;  2EBJ A;  3FJU A;  3TE4 A;  3KQX A;  4A37 A;  2BOA A;  3LMS A;  1BPM A;  4FD4 A;  4CAV A;  3H8F A;  3FEE A;  4CYO A;  4L8A A;  3BLN A;  2ZEO A;  3W6S A;  2R1I A;  5EC4 A;  1X12 A;  1A2Z A;  3DR6 A;  4A39 A;  3B3T A;  4A94 A;  5GCN A;  3FVL A;  1ELL P;  4LUA A;  4P45 A;  3TC8 A;  4NJR A;  4ONU A;  2PE3 A;  4BMH A;  2R7H A;  1GHE A;  3EFA A;  4KOU A;  3TX8 A;  1Y7E A;  5KTA A;  3R95 A;  2G3T A;  3SHP A;  1TKF A;  2PC1 A;  1VGY A;  3PB9 X;  5FVJ A;  3RBU A;  4KLW A;  4WWV A;  5F09 A;  4MHZ A;  1AYE A;  4YFJ A;  1OZP A;  4OP4 A;  4UFW A;  2K5T A;  2PJ1 A;  6CPA A;  4C2X A;  4OC2 A;  5AGE A;  3NA6 A;  2RB7 A;  1IY7 A;  5LYD A;  3SXO A;  3VWE A;  1LCP A;  1KUV A;  1CX8 A;  3B2Y A;  1M4G A;  2P6E A;  1RTQ A;  4UFX A;  4XPK A;  4R87 A;  3TO9 A;  4R9M A;  4E2A A;  4OAE A;  2ZW5 A;  2B5G A;  3S9N A;  3PFO A;  4CRZ B;  2DPT A;  1LAP A;  1Y0R A;  5C82 A;  1LAM A;  3QNV A;  4XPD C;  4KOT A;  2Q04 A;  2YNE A;  3HLP A;  3V8I A;  5CBM A;  5HMN A;  1KZF A;  4FUU A;  3MRU A;  3TO7 A;  1V0C A;  5EMI A;  1F2P A;  1K4J A;  2OR4 A;  1VHE A;  4M6H A;  1QSR A;  4MXU A;  5JQ4 A;  2Q7S A;  5ISV A;  4KOR A;  4B11 A;  2FE7 A;  1NE9 A;  1LRZ A;  4IK2 A;  4OME A;  4MMO A;  1ZO0 A;  3CDX A;  4X8I A;  2PJ6 A;  2OZH A;  4X5K A;  4KVM E;  4XNH C;  4CYP A;  3R9E A;  3KHX A;  3T9Y A;  4C2Y A;  1XRY A;  4OLL A;  2ZEP A;  1I1D A;  2Y0M A;  3FB3 A;  1S60 A;  3RNZ A;  4KUB A;  2QJ8 A;  1FY7 A;  4UEF A;  3NH8 A;  1B6B A;  1Q2C A;  2OH1 A;  2ZEL A;  3KI9 A;  3PRT A;  1SQH A;  3LOD A;  3PB7 X;  1VHS A;  1XMT A;  2RC4 A;  3KR5 A;  5AG7 A;  1Y9K A;  2VEZ A;  1YSJ A;  2AJ6 A;  2QIR A;  1P0H A;  2V8H A;  2Q44 A;  2VQY A;  4HNY B;  2CTB A;  4PQA A;  2Z11 A;  1YW4 A;  4B5O A;  2PJ0 A;  3IU2 A;  1UWY A;  5JM6 A;  3HUV A;  3IU1 A;  2HC9 A;  4PK3 A;  1TKJ A;  2FS5 A;  2ZEM A;  1IOI A;  3S6K A;  1IID A;  4OC5 A;  3TT2 A;  1XFO A;  2IJZ A;  5DWM A;  3EO4 A;  1YW6 A;  1M4L A;  1YVO A;  4ZY1 A;  4C7I A;  2ZW6 A;  4ZBG A;  4OID A;  4M6I A;  3CZX A;  3B35 A;  3FBU A;  4P6Y A;  1Q2D A;  2YNC C;  4R76 A;  1RXT A;  1S7N A;  1Y0Y A;  2PRB A;  2QVP A;  4A30 A;  1BLL E;  1ZG9 A;  4UEE A;  2PR1 A;  4QVT A;  2Q43 A;  4ORF A;  5KTD A;  2I3C A;  3BI0 A;  4KOY A;  1XF8 A;  5D29 A;  3BHX A;  1YGH A;  4UIB A;  3GIU A;  3IGR A;  2ODF A;  4NSQ A;  2A4N A;  2GLJ A;  5LYF A;  1Z8W A;  3MN8 A;  1OBR A;  1QQ9 A;  2XEJ A;  1ARL A;  4EVY A;  3FH4 A;  4H89 A;  4NGQ A;  4YGO A;  1KWM A;  1N71 A;  3IEH A;  4QUS A;  3GKR A;  3EY5 A;  3V38 A;  4RN7 A;  1QSN A;  4Q36 A;  5A28 A;  3F8K A;  4Q38 A;  3IIB A;  3S6G A;  3N5F A;  4CAX A;  3G8W A;  4MHD A;  3SJF A;  4UEZ A;  3KHZ A;  4CGL A;  3TFY A;  2JEV A;  3ZJ0 A;  2Z10 A;  4FAI A;  4UWI A;  4YU9 A;  2GIV A;  2PRQ A;  1EE3 P;  4FBE A;  2ABZ A;  4P44 A;  4P4I A;  2CIJ A;  4EWT A;  2O53 A;  4MFZ A;  4NEX A;  3DNS A;  5K8N A;  5G21 A;  4ZX9 A;  1NSL A;  3B8G A;  3B3S A;  1R43 A;  4UBR A;  2VL1 A;  4PPZ A;  2J8R A;  2WPX A;  3CT9 A;  3NH4 A;  2AFZ A;  3V7Z A;  2JBK A;  3FIX A;  4LX9 A;  4ZYQ A;  2J9A A;  4AVA A;  3FMC A;  2PJ3 A;  4MCR A;  2FVG A;  4B13 A;  1S7K A;  3DGV A;  3P2H A;  2C6P A;  5F47 A;  3WC6 A;  2AFO A;  4Z65 A;  4YWY A;  2NMT A;  2F7V A;  4F0Y A;  3QAY A;  4CS0 B;  2QYV A;  4ONW A;  5HH1 A;  4Q7A A;  1TIQ A;  2EVN A;  2Q7B A;  4O23 A;  4CYN A;  3SJX A;  4GXH A;  4BD9 A;  1Z9U A;  3GB0 A;  2CY2 A;  2H5M A;  2J8N A;  1QMU A;  1TF9 A;  2VXK A;  2HV2 A;  4PXD A;  5AG6 A;  3SI1 A;  4CAE A;  4MFJ A;  1CPX A;  2ZEF A;  3C26 A;  3BXM A;  4KSI A;  4LQ6 A;  4B14 A;  5IB9 A;  5IV0 A;  4GS4 A;  4F0X A;  2OB0 A;  1PYT B;  4H2K A;  4U9Y A;  1ZLH A;  1Z8X A;  3KZW A;  4LQG A;  4U5Y A;  2V8G A;  4OIW A;  4KVX A;  3W91 A;  4TWE A;  5F49 A;  3D7G A;  4K30 A;  4NGN A;  5DS0 A;  4CAW A;  3H4Q A;  3TTH A;  2P6G A;  1ON0 A;  3D7D A;  2PIZ A;  4W9Y A;  2AFX A;  2PJ2 A;  2ZOF A;  4QB9 A;  5K8M A;  1Q2Y A;  4GM5 A;  2ZOG A;  5LYI A;  4B10 A;  4MFP A;  1M4D A;  3KKW A;  4UFV A;  1IU8 A;  1DTD A;  3H5Z A;  1GYT A;  3GY9 A;  4FD6 A;  4MFK A;  2RFH A;  2B3V A;  2X7B A;  2WUU A;  3SI0 A;  3B7I A;  2CNS A;  2P6F A;  2I00 A;  4UA3 A;  2C1C A;  1B87 A;  2FSR A;  2Z3L A;  4I49 A;  1BOB A;  1TKH A;  4KOX A;  4M3S A;  5I4M A;  4MFL A;  4P4D A;  3D2P A;  3SXN A;  1WK4 A;  3PZJ A; 
#chains in the Genus database with same CATH homology
 2GAN A;  4KOV A;  5AG4 A;  5F46 A;  1Y7R A;  1S3Z A;  2B3U A;  1I21 A;  3LD2 A;  3F5B A;  4MFQ A;  1KUY A;  4ZGY B;  2G3A A;  4HNX B;  5JPH A;  5H86 A;  2R8V A;  2YGW A;  4NF1 A;  4KS9 A;  4AVB A;  1M44 A;  4AB7 A;  4Y49 B;  3R96 A;  2FL4 A;  4A32 A;  3D8P A;  3S6F A;  2FCK A;  3R9G A;  1Y9W A;  1YK3 A;  3D2M A;  2WSA A;  2Z3K A;  3S6H A;  1MJB A;  2B5G B;  5I0C A;  4XPD B;  4CGM A;  4MY0 A;  4KSA A;  4E8O A;  2PSW A;  2JDC A;  1Z4E A;  3FRM A;  4FD5 A;  4M85 A;  4CGO A;  2JDD A;  2KCW A;  2ZPA A;  5AG5 A;  1IYK A;  3WR7 A;  2HUZ A;  2VZY A;  4A2Z A;  2JLM A;  3K9U A;  4JWP A;  4PK2 A;  2YND A;  4C68 A;  2OZU A;  2R98 A;  4YRH A;  4R3K A;  3I3G A;  4KZT A;  1P4N A;  4DNC A;  4NXY A;  2YNC A;  3FNC A;  4NCZ A;  4PV6 A;  3EXN A;  2I79 A;  3F0A A;  1J4J A;  4JD6 A;  1WWZ A;  2FXF A;  5G1Z A;  1XIX A;  4E0A A;  3P2F A;  4JXQ A;  1R57 A;  2ATR A;  1PU9 A;  4JJX A;  4IF5 A;  4J3G A;  1U6M A;  5G22 A;  2Q0Y A;  4C7H A;  4KVO E;  3PGP A;  3TO6 A;  4AG9 A;  2VI7 A;  4A33 A;  2D4O A;  1QSO A;  3DSB A;  4PSX A;  5J8C A;  3R9F A;  2HQY A;  2BEI A;  5J8F A;  1L0C A;  2EUI A;  4H6U A;  1KUX A;  2F5I A;  4MJ8 A;  5CNP A;  2O28 A;  2DXQ A;  2Z3M A;  3QAH A;  2FT0 A;  3BJ8 A;  5IB0 A;  3PP9 A;  3CXS A;  1MK4 A;  2B4D B;  2C27 A;  4HKF A;  2FIA A;  3GYA A;  2GE3 A;  2Z3P A;  1S5K A;  2ZW7 A;  3D3S A;  4BBH A;  1S7F A;  4B12 A;  3NE7 A;  1I12 A;  5H84 A;  1YVK A;  3CXP A;  4R57 A;  4L89 A;  4UCN A;  3G3S A;  1YR0 A;  3CXQ A;  2D4P A;  2IL4 A;  1IB1 E;  4PSW A;  2AE6 A;  2BUE A;  3EC4 A;  2J8M A;  2WPW A;  2Z0Z A;  4MBU A;  1IIC A;  4KOS A;  4Y49 C;  3N7Z A;  4RS2 A;  4CGP A;  3DR8 A;  3UY5 A;  4HNW B;  4FD7 A;  4A31 A;  2B58 A;  4CYQ A;  3IWG A;  1UFH A;  4IUS A;  3R1K A;  1NMT A;  3FYN A;  4RI1 A;  2QML A;  4XNH B;  4B5P B;  4UCM A;  1YRE A;  4B5P A;  3JVN A;  2B4B A;  3BJ7 A;  3TOA A;  4MY3 A;  4A95 A;  2FIW A;  1S7L A;  2ZW4 A;  4MI4 A;  2PQ8 A;  4U9Z A;  2BL1 A;  4H6Z A;  5BWA B;  4KOW A;  2CXA A;  1CM0 A;  1CJW A;  5EBV A;  4CAF A;  1XEB A;  2OZG A;  3I9S A;  3T90 A;  1IYL A;  2BSW A;  1MJ9 A;  5A27 A;  4CRY B;  4UWJ A;  2Z3N A;  1MJA A;  4II9 A;  1QSM A;  2PR8 A;  2Q4Y A;  1YLE A;  4QC6 A;  3A9L A;  4JXR A;  2VZZ A;  3OWC A;  1XE4 A;  4KLV A;  4QBJ A;  5IX3 A;  4CGN A;  2Q4V A;  3JTK A;  3MGD A;  2ZXV A;  5C88 A;  2B4D A;  4F6A A;  1QST A;  4JLY A;  1Z4R A;  2CNT A;  4KUA A;  2G0B A;  1M1D A;  1M4I A;  3IWE A;  4XPL A;  4UCP A;  3TOB A;  3W6X A;  2PDO A;  2ARH A;  2CNM A;  2REF A;  2QEC A;  5DWN A;  4AG7 A;  3FXT A;  1VKC A;  4R3L A;  4C2Z A;  1RO5 A;  4OAD A;  1BO4 A;  3ZZI A;  5E96 A;  3DDD A;  2DPS A;  3TCV A;  3VWD A;  4KSF A;  2REE A;  2P0W A;  2Z3O A;  3E0K A;  5F48 A;  3JUW A;  3QB8 A;  1PUA A;  2VBQ A;  5G20 A;  5KTC A;  3RYO A;  2OU2 A;  1YX0 A;  3TE4 A;  4FD4 A;  4CAV A;  4CYO A;  4L8A A;  3BLN A;  3W6S A;  2R1I A;  5EC4 A;  3DR6 A;  5GCN A;  4LUA A;  4ONU A;  4BMH A;  2R7H A;  1GHE A;  3EFA A;  4KOU A;  5KTA A;  3R95 A;  2G3T A;  3SHP A;  2PC1 A;  5FVJ A;  4KLW A;  4YFJ A;  1OZP A;  4UFW A;  2K5T A;  4C2X A;  5AGE A;  3VWE A;  3SXO A;  1KUV A;  1M4G A;  2P6E A;  4UFX A;  4XPK A;  4R87 A;  3TO9 A;  4R9M A;  4E2A A;  4OAE A;  2ZW5 A;  2B5G A;  4CRZ B;  2DPT A;  5C82 A;  4XPD C;  4KOT A;  2Q04 A;  2YNE A;  3V8I A;  5HMN A;  1KZF A;  3TO7 A;  1V0C A;  1K4J A;  5JQ4 A;  1QSR A;  5ISV A;  4KOR A;  4B11 A;  2FE7 A;  1NE9 A;  1LRZ A;  1ZO0 A;  2OZH A;  4X5K A;  4KVM E;  4XNH C;  4CYP A;  3R9E A;  3T9Y A;  4C2Y A;  4OLL A;  1I1D A;  2Y0M A;  3FB3 A;  1S60 A;  4KUB A;  1FY7 A;  1B6B A;  1Q2C A;  2OH1 A;  1SQH A;  3LOD A;  5AG7 A;  1VHS A;  1XMT A;  2RC4 A;  4AVC A;  1Y9K A;  2VEZ A;  3ZJ0 A;  2AJ6 A;  2QIR A;  4HNY B;  1P0H A;  2VQY A;  2Q44 A;  4B5O A;  2Z11 A;  3IU2 A;  3IU1 A;  4PK3 A;  2FS5 A;  3S6K A;  1IID A;  3TT2 A;  5DWM A;  3EO4 A;  1YVO A;  4C7I A;  2ZW6 A;  4ZBG A;  3FBU A;  2YNC C;  1Q2D A;  1RXT A;  1S7N A;  2PRB A;  4A30 A;  2PR1 A;  4QVT A;  4ORF A;  5KTD A;  4KOY A;  1XF8 A;  1YGH A;  3IGR A;  4NSQ A;  2A4N A;  4EVY A;  4H89 A;  4YGO A;  1N71 A;  4QUS A;  3GKR A;  3EY5 A;  1QSN A;  4Q36 A;  5A28 A;  3F8K A;  4Q38 A;  3S6G A;  4CAX A;  3G8W A;  4MHD A;  4CGL A;  3TFY A;  2JEV A;  2Z10 A;  4UWI A;  2GIV A;  4MFZ A;  4NEX A;  3DNS A;  5G21 A;  1NSL A;  3B8G A;  4UBR A;  2J8R A;  2WPX A;  3FIX A;  4LX9 A;  4AVA A;  4B13 A;  1S7K A;  3P2H A;  5F47 A;  2NMT A;  4F0Y A;  4CS0 B;  5HH1 A;  1TIQ A;  2EVN A;  2Q7B A;  4CYN A;  1Z9U A;  2CY2 A;  2H5M A;  2J8N A;  2VXK A;  2HV2 A;  5AG6 A;  4CAE A;  4MFJ A;  3C26 A;  4B14 A;  5IV0 A;  4GS4 A;  4F0X A;  2OB0 A;  4U9Y A;  4U5Y A;  4KVX A;  3W91 A;  5F49 A;  4K30 A;  4CAW A;  3H4Q A;  3TTH A;  2P6G A;  1ON0 A;  4QB9 A;  1Q2Y A;  4B10 A;  4MFP A;  1M4D A;  3KKW A;  4UFV A;  3H5Z A;  3GY9 A;  4FD6 A;  4MFK A;  2B3V A;  2X7B A;  2WUU A;  2CNS A;  2P6F A;  2I00 A;  4UA3 A;  4I49 A;  4KOX A;  1B87 A;  2FSR A;  1BOB A;  2Z3L A;  4M3S A;  4MFL A;  3D2P A;  3SXN A;  1WK4 A;  3PZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...