4XPLA

The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
141
Chain Sequence
LIKLKNFTELNSQEIELIFKWRKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acetyltransferase, PseH
publication title Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni pt14
molecule tags Transferase
total genus 41
structure length 141
sequence length 150
ec nomenclature
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xplA00
1KUXA 1YGHA 2PRBA 1YR0A 4L89A 3TT2A 4KZTA 4KOUA 1XE4A 4CAXA 2EUIA 3E0KA 4QBJA 1CM0A 2OH1A 4E8OA 3VWEA 2QECA 4OAEA 2GANA 2ZXVA 3VWDA 1IB1E 3V8IA 1CJWA 4E0AA 3PGPA 3I9SA 2G0BA 3WR7A 4KOVA 2CNMA 2B4DA 2R1IA 3I3GA 4CRZB 1IIDA 1YX0A 3LODA 3FXTA 4E2AA 4JXRA 2Y0MA 2Z11A 1RXTA 1V0CA 3FRMA 5F46A 2JEVA 4M85A 3EC4A 2EVNA 1M1DA 3EO4A 1Y9KA 1Y7RA 4JLYA 2R7HA 4KOYA 1YREA 3DNSA 1KUYA 4KVME 3C26A 4KOTA 1N71A 2Q4VA 3D3SA 4PSWA 2J8RA 1KZFA 4AG9A 2AE6A 4MY0A 1BO4A 1IICA 3S6FA 5KTAA 3GKRA 2VZYA 4H89A 4QVTA 4XPDC 4ORFA 3R9EA 3FIXA 3CXQA 2BUEA 3K9UA 2H5MA 2P0WA 3FYNA 3TO9A 4MHDA 5F48A 3LD2A 3CXSA 2VXKA 3ZZIA 4R9MA 2HV2A 5IV0A 1YK3A 2VZZA 1QSRA 4NF1A 4CRYB 2K5TA 2WPWA 4B5OA 4UA3A 2FSRA 1TIQA 3QB8A 3GY9A 4QB9A 2P6GA 2OU2A 5JPHA 2B3UA 2B3VA 2DXQA 2VEZA 2Q04A 5FVJA 4YFJA 3TE4A 3FNCA 1S5KA 5H86A 1Q2CA 3OWCA 5I0CA 2GIVA 4OLLA 5KTDA 4CAVA 1LRZA 4U5YA 1MJAA 4ONUA 2B4DB 4NEXA 3DSBA 4MI4A 3G8WA 4II9A 2FS5A 2FE7A 3TO7A 5ISVA 3T9YA 4CS0B 2B4BA 3R1KA 3R9FA 4CAWA 4FD7A 1Q2DA 4BMHA 4GS4A 4PSXA 2ATRA 4KUAA 2I79A 2PR1A 3PZJA 4XNHB 4NCZA 2B5GB 3CXPA 5KTCA 1NSLA 3SHPA 3TCVA 1ON0A 2VBQA 1U6MA 3BLNA 2G3TA 4J3GA 1R57A 2ARHA 3S6KA 4HKFA 1S7FA 4IF5A 2P6EA 2RC4A 4FD5A 1B87A 4F6AA 3TTHA 3IGRA 4KVOE 4KOSA 4H6ZA 5H84A 3EFAA 1GHEA 2QMLA 3DR6A 4UWJA 5IX3A 2ZW5A 3T90A 1XF8A 2ZW4A 1S7LA 2BEIA 4RS2A 1QSOA 2KCWA 5EBVA 1SQHA 3JVNA 2Z10A 2BSWA 4OADA 2PC1A 2ZW7A 3S6HA 1M44A 2WPXA 1Y9WA 3QAHA 3IWGA 3TFYA 4PK2A 2REEA 3ZJ0A 1XEBA 4X5KA 5C88A 3MGDA 2CNSA 2R8VA 4R87A 2PQ8A 4Y49C 1P4NA 2FCKA 3W6XA 1YVOA 1Z9UA 2PSWA 2R98A 2JDCA 2Q44A 3PP9A 4KLWA 4EVYA 3FBUA 3P2HA 4NXYA 4I49A 2J8NA 3R96A 1QSNA 4IUSA 2PDOA 4JJXA 3W6SA 2A4NA 4MBUA 4U9YA 1J4JA 3D2MA 3F0AA 4F0YA 4UBRA 2FIAA 1L0CA 2F5IA 3W91A 3F8KA 4KLVA 3EY5A 2JLMA 2C27A 1Q2YA 5F47A 5F49A 1Z4EA 4DNCA 4JXQA 5CNPA 2FT0A 1S7NA 1XIXA 4LUAA 1FY7A 1WWZA 2NMTA 4KOXA 4HNWB 3KKWA 5DWMA 4YGOA 3TOAA 1WK4A 4AB7A 1M4GA 2JDDA 5EC4A 3D2PA 1MJBA 2AJ6A 4XPKA 3P2FA 4L8AA 4FD6A 2Q4YA 1M4DA 2O28A 1IYLA 4AVAA 2J8MA 1I21A 4B5PA 1K4JA 4XPDB 1S7KA 2PR8A 3BJ8A 3TO6A 4JWPA 1BOBA 4M3SA 4Y49B 3SXNA 1Z4RA 4JD6A 1I1DA 5C82A 1I12A 2BL1A 1PU9A 1OZPA 1P0HA 2OZHA 3F5BA 3NE7A 1XMTA 1M4IA 2ZW6A 4R57A 1B6BA 2G3AA 2FXFA 5HMNA 2OZUA 2P6FA 4PV6A 4MY3A 1IYKA 5HH1A 3H4QA 1MK4A 3S6GA 4ZBGA 4KORA 4UWIA 2REFA 4XNHC 1YVKA 1PUAA 2Q7BA 4HNYB 2X7BA 2B5GA 1KUVA 4HNXB 2I00A 4KUBA 1RO5A 3R95A 2OZGA 5GCNA 3TOBA 5J8FA 2ZPAA 4QC6A 3BJ7A 5IB0A 2VQYA 2D4OA 4K30A 4XPLA 3SXOA 4FD4A 2QIRA 2CNTA 3UY5A 3D8PA 3FB3A 2VI7A 1UFHA 3R9GA 4B5PB 1S3ZA 4LX9A 4YRHA 4RI1A 4H6UA 2OB0A 2CY2A 1NMTA 3N7ZA 5JQ4A 1S60A 4R3KA 2D4PA 2FL4A 3B8GA 4AG7A 4PK3A 1VHSA 3RYOA 4AVBA 4U9ZA 4NSQA 1MJ9A 1QSMA 3GYAA 2Q0YA 2GE3A 2HUZA 1VKCA 3JUWA 1QSTA 3G3SA 2IL4A 3DDDA 5DWNA 2Z0ZA 4MJ8A 1YLEA 2FIWA 4KOWA 3EXNA 4R3LA 5J8CA 2B58A 4QUSA 4AVCA 5E96A 3DR8A 2HQYA 1NE9A 4KVXA
chains in the Genus database with same CATH superfamily
1KUXA 1YGHA 7CPAA 2PRBA 3PFEA 4PXEA 1YR0A 4R6TA 4L89A 3TT2A 4KZTA 2AFMA 4KOUA 2WZNA 3BXMA 4NGTA 1XE4A 1Z8LA 4P6YA 4CAXA 2DF5A 2EUIA 5LYIA 3SI2A 3E0KA 4QBJA 3FVLA 1CM0A 2OH1A 4X8IA 4F9UA 4E8OA 3VWEA 5A28A 1TKHA 2QECA 1M4LA 3SJXA 4OC3A 4OAEA 4R76A 4LQGA 2NYQA 2GANA 2ZXVA 2G9DA 1IB1E 3V8IA 4JZ0A 3VWDA 2PJ2A 1CJWA 4E0AA 3PGPA 3I9SA 2G0BA 3WR7A 1BAVA 2CNMA 2B4DA 2R1IA 4KOVA 3I3GA 4CRZB 1IIDA 1HEEA 1VIXA 1YX0A 4C2YA 2QYVA 1YQEA 3LODA 5LRJA 3B3CA 3FXTA 4E2AA 4JXRA 1CP6A 2Y0MA 1UWYA 4MFLA 4KS9A 2Z11A 2DPTA 2Z3PA 1RXTA 1V0CA 2XEJA 3FRMA 3GIUA 3KQXA 5F46A 2JEVA 3K2KA 6CPAA 4M85A 3EC4A 2EVNA 1M1DA 3IFEA 1YMEA 3EO4A 3D66A 1Y9KA 1Y7RA 3I1UA 1CP7A 4JLYA 3FEEA 2R7HA 5HVFA 4KOYA 1YREA 1QQ9A 3DNSA 1KUYA 4IAVA 3C26A 4KOTA 2PJBA 4KVME 1N71A 2Q4VA 4PXBA 3D3SA 3V38A 1H8LA 4PSWA 2J8RA 4GM5A 3WABA 4RN7A 1YSJA 5LYLA 1KZFA 4AG9A 2YNCC 2YNCA 2J9AA 2AE6A 4MY0A 1BO4A 1IICA 3KGQA 5K8MA 1LAPA 3S6FA 1XJOA 2ZEMA 5KTAA 2GLFA 2ZOGA 3GKRA 3PB7X 2VZYA 4H89A 4QVTA 4XPDC 4ORFA 5AG7A 3MRUA 3R9EA 2EBJA 4CGPA 3LWUA 4BBHA 3FIXA 3CXQA 4X2TA 2WUUA 2BUEA 2PJ8A 2H5MA 3K9UA 2P0WA 4C7IA 3FYNA 3TO9A 4MHDA 1DE4C 2GLJA 5F48A 3LD2A 3CXSA 2VXKA 3ZZIA 5F09A 5K8OA 3PB8X 2HV2A 1IOIA 1OBRA 1XFOA 2GU2A 4R9MA 3HUVA 5IV0A 5CPAA 1YK3A 2VZZA 1QSRA 1EE3P 4NF1A 4CRYB 2CIJA 5G1ZA 2K5TA 2PIYA 4MFKA 4ZX9A 4MXUA 5A27A 2WPWA 2ZEGA 4Z65A 2Z3KA 4B5OA 1ARLA 4UA3A 2FSRA 4C2ZA 1TIQA 4UEFA 3QB8A 3GY9A 4QB9A 3WC5A 2P6GA 2OU2A 4OP4A 2EK8A 3SJGA 5HXDA 5JPHA 1TF9A 2PJ1A 2B3UA 2B3VA 2DXQA 5AG4A 2VEZA 1QMUA 2Q04A 4ONWA 4PXDA 5FVJA 4YFJA 3TE4A 1S5KA 3FNCA 4M6GA 2AFXA 5H86A 4MCSA 1Q2CA 3D7HA 4IK2A 3OWCA 5I0CA 2GIVA 4O23A 4OLLA 4P4FA 4CAVA 5KTDA 1LRZA 4U5YA 1MJAA 1X10A 4ONUA 1XOVA 2B4DB 4NEXA 2AFUA 3DSBA 4A38A 4MI4A 4UIBA 2XEIA 3G8WA 4II9A 3B2YA 3KASA 1XMBA 4NGNA 1F57A 4EMEA 2FS5A 3IIBA 2FE7A 1X12A 3DGVA 3S9MA 4X3RA 3LACA 4PXCA 2AFOA 3TO7A 5ISVA 3T9YA 4CS0B 2B4BA 4P45A 3R1KA 4R8FA 2I3CA 4C2XA 2PJ7A 3R9FA 1AMPA 4FD7A 4CAWA 1JQGA 4EFDA 4B11A 1Q2DA 4BMHA 4W9YA 3IU1A 2F7VA 4IHMA 3SI1A 3S9NA 4CGNA 4GS4A 4PSXA 2PJ4A 2DEAA 1Z5RA 4B6ZA 2ATRA 3BHXA 4KUAA 4CYQA 2I79A 4G1PA 4CGLA 2PR1A 3PZJA 1ELLP 4XNHB 4NCZA 1HDUA 2B5GB 3CXPA 3SI0A 3RZAA 1FT7A 1NSAA 5KTCA 1NSLA 3SHPA 3TCVA 2VL1A 1ON0A 1IY7A 2PVWA 1CG2A 2VBQA 4MCQA 3H8EA 1U6MA 3BLNA 3GB0A 3SJEA 2O4HA 4NGSA 1KWMA 2G3TA 4J3GA 1R57A 4UCPA 2ARHA 2CTBA 3S6KA 4HKFA 1S7FA 3BI1A 4IF5A 2P6EA 2RC4A 4MHYA 4B13A 3SJFA 4FD5A 1B87A 2FVGA 4F6AA 3PB9X 4WWVA 1CPXA 3TTHA 3IGRA 4KVOE 4A37A 4KOSA 3D7DA 4P4IA 3GLJA 3ISZA 4H6ZA 2AFSA 4UCMA 5H84A 3FJUA 2BOAA 2C1CA 3EFAA 3KHXA 5LYDA 3KR4A 1GHEA 1IGBA 3L2NA 4C68A 5D8NA 1LAMA 2QMLA 1BLLE 1Y0YA 3DR6A 4A39A 4UWJA 1VGYA 2ZW5A 2ZEPA 5IX3A 2EWBA 4KSFA 5CBMA 3T90A 1XF8A 3MN8A 4UEZA 2ZW4A 1S7LA 2PVVA 4ZY1A 2BEIA 5JH9A 2HC9A 3D68A 4RS2A 1QSOA 3FMCA 1LANA 4ZYQA 2KCWA 5EBVA 4C7HA 1IOFA 3IJ3A 1SQHA 1IU8A 3JVNA 4CGOA 3D4UA 2Z10A 4H2KA 2BSWA 2EK9A 4OADA 2PC1A 2ZW7A 3FH4A 4NFRA 3KQZA 3S6HA 1M44A 4F8ZA 3B3VA 2JBKA 2WPXA 1Y9WA 1ZO0A 1F2PA 3KI9A 3QAHA 3PFOA 3IWGA 2QVPA 3B35A 4LQ6A 2OR4A 4A94A 3TFYA 4PK2A 2REEA 5AG6A 3ZJ0A 4B10A 1XEBA 4X5KA 5C88A 3MGDA 2CNSA 2R8VA 4R87A 2PQ8A 4PPZA 4NGPA 4R7MA 3D7FA 2V8GA 4Y49C 5HVHA 5HVGA 4Q7AA 1LOKA 3FX6A 3B3WA 1P4NA 2FCKA 2EO8A 2GFQA 1Y7EA 3KHZA 1HDQA 3W6XA 3PB4X 1YVOA 1Z9UA 2PSWA 5K8NA 2GREA 2R98A 2JDCA 3CZXA 4WJBA 2Q44A 3PP9A 4KLWA 2BO9A 1ZLIA 4EWTA 4EVYA 3FBUA 3P2HA 4UIAA 1TF8A 4NXYA 4NGQA 4B14A 3CPXA 2J8NA 1GYTA 4I49A 3R96A 3WT4A 1QSNA 2OOTA 1VHEA 4NGRA 3D7GA 2PIZA 3GUXA 4IUSA 4OC1A 2PDOA 1LFWA 4JJXA 3W6SA 5DS0A 2A4NA 1FNOA 2Q4ZA 2ZEOA 4MBUA 4U9YA 1J4JA 3D2MA 3F0AA 4F0YA 3IO1A 4KVXA 4CAEA 4UBRA 4FUUA 2FIAA 3H8FA 2CF4A 1L0CA 2F5IA 3W91A 5LRKA 3F8KA 2WSAA 4KLVA 4FAIA 2Z3LA 3PB6X 3EY5A 2JLMA 2C27A 2PRQA 4RUHA 1Q2YA 5F47A 2HB6A 4P10A 5F49A 1Z4EA 4MCRA 4DNCA 4JXQA 3IWWA 5CNPA 2FT0A 2V8HA 2C6PA 3TX8A 1S7NA 3NH8A 3D67A 1XIXA 1YW4A 2PJAA 5G22A 3KZWA 4LUAA 1FY7A 1CBXA 1WWZA 2NMTA 2Z3OA 4KOXA 4OIDA 3CPAA 1R43A 5THWA 4HNWB 3KKWA 5DWMA 3VH9A 3B3SA 4PQAA 4MFZA 4YGOA 4FBEA 2V8DA 3TOAA 4GXHA 4MFJA 3QAYA 5K8PA 1WK4A 3KR5A 4AB7A 2PCUA 2V8VA 4Q38A 1M4GA 4UCNA 1ZG9A 4JYWA 3VATA 2JDDA 5EC4A 2YNDA 4CYPA 2QJ8A 1TXRA 3D2PA 1MJBA 4MRIA 2AJ6A 3PBEA 2IMOA 2RFHA 4XPKA 3P2FA 2CXAA 4L8AA 4A32A 3H5ZA 3RAMA 3T8WA 4CAFA 1R3NA 1Y0RA 4HPSA 4NJRA 5I4MA 2IQ6A 3CDXA 4FD6A 2C6CA 2Q4YA 3V7ZA 1M4DA 2O28A 4CYOA 1IYLA 2AFZA 4AVAA 2J8MA 1I21A 3IU2A 4Q36A 3RBUA 1K4JA 4NJQA 4XPDB 4B5PA 4CPAA 2ZENA 1S7KA 2XEFA 2ZEDA 1TKFA 2PR8A 4YWYA 4F9VA 2BCOA 2ZEFA 3FF3A 3BJ8A 3WC7A 3TO6A 4A95A 4MFPA 4JWPA 3JTKA 1BOBA 5G20A 2Z3NA 1XRYA 4M3SA 3BI0A 4Y49B 4UFVA 3B7IA 3SXNA 1Z4RA 1DTDA 3NH5A 4JD6A 1Z8WA 4ZY2A 4DYOA 4B12A 2F8HA 1I1DA 2CTCA 4MHPA 1AYEA 1I12A 2BL1A 2JEWA 5C82A 1PU9A 1OZPA 1F2OA 1P0HA 2OZHA 2PE3A 1Z8XA 1ZG8A 3JRUA 3F5BA 4OKOA 2Q7SA 2Z3MA 3NE8A 5J1QA 1JWQA 5D29A 3NE7A 1XMTA 4OC4A 1M4IA 2ZW6A 4R57A 5AGEA 2ODFA 1ZLHA 1B6BA 2JBJA 2G3AA 2ZELA 3H8GA 4FWUA 2ZOFA 3NH4A 2DPSA 2FXFA 3VARA 1BPNA 5HMNA 5JM6A 2OZUA 2P6FA 4KSAA 1RTQA 3IEHA 4M6IA 4PV6A 5LRGA 4OIWA 1YW6A 2PJ6A 3N5FA 4ZX8A 4MY3A 1IYKA 4UFWA 4OC2A 5BWAB 5HH1A 1PCAA 4MHNA 1XBUA 3H4QA 3NFZA 1MK4A 4A31A 3S6GA 4ZBGA 3WC6A 3RNZA 4P4EA 4KORA 1Z8TA 4UWIA 1Z2LA 2REFA 4XNHC 1YVKA 1PUAA 2Q7BA 4HNYB 2X7BA 1CX8A 2B5GA 4AXVA 4DJLA 1KUVA 4HNXB 4P4JA 2ZEEA 4CGMA 5IB9A 2I00A 4KUBA 4BD9A 1VHOA 4MCPA 1RO5A 1PYTB 3R95A 2YGWA 2OZGA 3KL9A 4TNUA 4MMOA 5GCNA 4UF4A 4KSIA 3TOBA 5J8FA 1ELMP 2Q51A 4OC0A 3DLJA 4BINA 2ZPAA 3B3TA 8CPAA 4QC6A 1CPSA 4DUKA 3BJ7A 5EMIA 5IB0A 2VQYA 1ARMA 2RB7A 3FECA 3RO0A 3PEIA 2D4OA 4K30A 4P44A 4XPLA 3SXOA 3PBBA 3A9LA 4FD4A 4CYNA 5JGFA 2POKA 2QIRA 3QNVA 2V77A 2CNTA 2IJZA 3ISXA 3UY5A 3D8PA 2PJCA 1BPMA 2VI7A 1UFHA 3FB3A 2PJ0A 1S3ZA 4NGMA 4TWEA 3R9GA 4LX9A 4A33A 4YRHA 4B5PB 1ZG7A 3TC8A 2C6GA 3LMSA 4RI1A 2AFWA 4F0XA 3K9TA 4H6UA 2OB0A 4M6HA 4A30A 2CY2A 1NMTA 4YU9A 4ZI6A 3N7ZA 2PJ3A 5JQ4A 1S60A 2XEGA 4MFQA 2NSMA 4R3KA 2D4PA 2FL4A 2PJ5A 3B8GA 4P4BA 4AG7A 2ABZA 4PK3A 4P4DA 3IWEA 1VHSA 3RYOA 4AVBA 4U9ZA 3PRTA 4NSQA 1MJ9A 1TKJA 2ZEHA 1QSMA 2ANPA 3GYAA 2Q0YA 1AUGA 3NA6A 1LCPA 2GE3A 3HLPA 4OC5A 4UFXA 2HUZA 2PJ9A 1VKCA 3JUWA 3CT9A 1QSTA 4A2ZA 3G3SA 2IL4A 1A2ZA 3DDDA 5DWNA 2Z0ZA 4OMEA 4MJ8A 3FEDA 2O53A 1YLEA 4ZY0A 2FIWA 5AG5A 1YLOA 4KOWA 3EXNA 3IC1A 2Q43A 4MHZA 4R3LA 3S9LA 5G21A 5J8CA 2B58A 4UEEA 2WYRA 4QUSA 5ELYA 4AVCA 4ZGYB 5E96A 3DR8A 5LYFA 1Q7LA 2HQYA 2YNEA 1NE9A 4K3NA
chains in the Genus database with same CATH topology
1KUXA 1YGHA 2PRBA 1YR0A 4L89A 3TT2A 4KZTA 4KOUA 1XE4A 4CAXA 2EUIA 3E0KA 4QBJA 1CM0A 2OH1A 4E8OA 3VWEA 5A28A 2QECA 4OAEA 2GANA 2ZXVA 3VWDA 1IB1E 3V8IA 1CJWA 4E0AA 3PGPA 3I9SA 2G0BA 3WR7A 2CNMA 2B4DA 2R1IA 4KOVA 3I3GA 4CRZB 1IIDA 1YX0A 4C2YA 3LODA 3FXTA 4E2AA 4JXRA 2Y0MA 4MFLA 4KS9A 2Z11A 2DPTA 2Z3PA 1RXTA 1V0CA 3FRMA 5F46A 2JEVA 4M85A 3EC4A 2EVNA 1M1DA 3EO4A 1Y9KA 1Y7RA 4JLYA 2R7HA 4KOYA 1YREA 3DNSA 1KUYA 3C26A 4KOTA 4KVME 1N71A 2Q4VA 3D3SA 4PSWA 2J8RA 1KZFA 4AG9A 2YNCC 2YNCA 2AE6A 4MY0A 1BO4A 1IICA 3S6FA 5KTAA 3GKRA 2VZYA 4H89A 4QVTA 4XPDC 4ORFA 5AG7A 3R9EA 4CGPA 4BBHA 3FIXA 3CXQA 2WUUA 2BUEA 3K9UA 2H5MA 2P0WA 4C7IA 3FYNA 3TO9A 4MHDA 5F48A 3LD2A 3CXSA 2VXKA 3ZZIA 4R9MA 2HV2A 5IV0A 1YK3A 2VZZA 1QSRA 4NF1A 4CRYB 5G1ZA 2K5TA 4MFKA 5A27A 2WPWA 2Z3KA 4B5OA 4UA3A 2FSRA 4C2ZA 1TIQA 3QB8A 3GY9A 4QB9A 2P6GA 2OU2A 5JPHA 2B3UA 2B3VA 2DXQA 5AG4A 2VEZA 2Q04A 5FVJA 4YFJA 3TE4A 3FNCA 1S5KA 5H86A 1Q2CA 3OWCA 5I0CA 2GIVA 4OLLA 5KTDA 4CAVA 1LRZA 4U5YA 1MJAA 4ONUA 2B4DB 4NEXA 3DSBA 4MI4A 3G8WA 4II9A 2FS5A 2FE7A 3TO7A 5ISVA 3T9YA 4CS0B 2B4BA 3R1KA 4C2XA 3R9FA 4CAWA 4FD7A 4B11A 1Q2DA 4BMHA 3IU1A 4CGNA 4GS4A 4PSXA 2ATRA 4KUAA 4CYQA 2I79A 4CGLA 2PR1A 3PZJA 4XNHB 4NCZA 2B5GB 3CXPA 5KTCA 1NSLA 3SHPA 3TCVA 1ON0A 2VBQA 1U6MA 3BLNA 2G3TA 4J3GA 1R57A 4UCPA 2ARHA 3S6KA 4HKFA 1S7FA 4IF5A 2P6EA 2RC4A 4B13A 4FD5A 1B87A 4F6AA 3TTHA 3IGRA 4KVOE 4KOSA 4UCMA 4H6ZA 5H84A 3EFAA 4C68A 1GHEA 2QMLA 3DR6A 4UWJA 5IX3A 2ZW5A 4KSFA 3T90A 1XF8A 2ZW4A 1S7LA 2BEIA 4RS2A 1QSOA 2KCWA 5EBVA 4C7HA 1SQHA 3JVNA 4CGOA 2Z10A 2BSWA 4OADA 2PC1A 2ZW7A 3S6HA 1M44A 2WPXA 1Y9WA 1ZO0A 3QAHA 3IWGA 3TFYA 4PK2A 2REEA 5AG6A 3ZJ0A 4B10A 1XEBA 4X5KA 5C88A 3MGDA 2CNSA 2R8VA 4R87A 2PQ8A 4Y49C 1P4NA 2FCKA 3W6XA 1YVOA 1Z9UA 2PSWA 2R98A 2JDCA 2Q44A 3PP9A 4KLWA 4EVYA 3FBUA 3P2HA 4NXYA 4B14A 4I49A 2J8NA 3R96A 1QSNA 4IUSA 2PDOA 4JJXA 3W6SA 2A4NA 4MBUA 4U9YA 1J4JA 3D2MA 3F0AA 4F0YA 4CAEA 4UBRA 2FIAA 1L0CA 2F5IA 3W91A 3F8KA 2WSAA 4KLVA 2Z3LA 3EY5A 2JLMA 2C27A 1Q2YA 5F47A 5F49A 1Z4EA 4DNCA 4JXQA 5CNPA 2FT0A 1S7NA 1XIXA 5G22A 4LUAA 1FY7A 1WWZA 2NMTA 2Z3OA 4KOXA 4HNWB 3KKWA 5DWMA 4MFZA 4YGOA 3TOAA 4MFJA 1WK4A 4AB7A 4Q38A 1M4GA 4UCNA 2JDDA 5EC4A 2YNDA 4CYPA 3D2PA 1MJBA 2AJ6A 4XPKA 3P2FA 2CXAA 4L8AA 4A32A 3H5ZA 4CAFA 4FD6A 2Q4YA 4CYOA 1M4DA 2O28A 1IYLA 4AVAA 2J8MA 1I21A 3IU2A 4Q36A 4B5PA 1K4JA 4XPDB 1S7KA 2PR8A 3BJ8A 3TO6A 4A95A 4MFPA 4JWPA 3JTKA 1BOBA 5G20A 2Z3NA 4M3SA 4Y49B 3SXNA 4UFVA 1Z4RA 4JD6A 4B12A 1I1DA 5C82A 1I12A 2BL1A 1PU9A 1OZPA 1P0HA 2OZHA 3F5BA 2Z3MA 3NE7A 1XMTA 1M4IA 2ZW6A 4R57A 5AGEA 1B6BA 2G3AA 2DPSA 2FXFA 5HMNA 2OZUA 2P6FA 4KSAA 4PV6A 4MY3A 1IYKA 4UFWA 5BWAB 5HH1A 3H4QA 1MK4A 4A31A 3S6GA 4ZBGA 4KORA 4UWIA 2REFA 4XNHC 1YVKA 1PUAA 2Q7BA 4HNYB 2X7BA 2B5GA 1KUVA 4HNXB 4CGMA 2I00A 4KUBA 1RO5A 3R95A 2YGWA 2OZGA 5GCNA 3TOBA 5J8FA 2ZPAA 4QC6A 3BJ7A 5IB0A 2VQYA 2D4OA 4K30A 4XPLA 3SXOA 4FD4A 3A9LA 4CYNA 2QIRA 2CNTA 3UY5A 3D8PA 3FB3A 2VI7A 1UFHA 3R9GA 4A33A 1S3ZA 4B5PB 4LX9A 4YRHA 4RI1A 4F0XA 4H6UA 2OB0A 4A30A 2CY2A 1NMTA 3N7ZA 5JQ4A 1S60A 4MFQA 4R3KA 2D4PA 2FL4A 3B8GA 4AG7A 4PK3A 3IWEA 1VHSA 3RYOA 4AVBA 4U9ZA 4NSQA 1MJ9A 1QSMA 3GYAA 2Q0YA 2GE3A 4UFXA 2HUZA 1VKCA 3JUWA 4A2ZA 1QSTA 3G3SA 2IL4A 3DDDA 5DWNA 2Z0ZA 4MJ8A 1YLEA 2FIWA 5AG5A 4KOWA 3EXNA 4R3LA 5G21A 5J8CA 2B58A 4QUSA 4AVCA 4ZGYB 5E96A 3DR8A 2HQYA 2YNEA 1NE9A 4KVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUX A;  1YGH A;  2PRB A;  1YR0 A;  4L89 A;  3TT2 A;  4KZT A;  4KOU A;  1XE4 A;  4CAX A;  2EUI A;  3E0K A;  4QBJ A;  1CM0 A;  2OH1 A;  4E8O A;  3VWE A;  2QEC A;  4OAE A;  2GAN A;  2ZXV A;  3VWD A;  1IB1 E;  3V8I A;  1CJW A;  4E0A A;  3PGP A;  3I9S A;  2G0B A;  3WR7 A;  4KOV A;  2CNM A;  2B4D A;  2R1I A;  3I3G A;  4CRZ B;  1IID A;  1YX0 A;  3LOD A;  3FXT A;  4E2A A;  4JXR A;  2Y0M A;  2Z11 A;  1RXT A;  1V0C A;  3FRM A;  5F46 A;  2JEV A;  4M85 A;  3EC4 A;  2EVN A;  1M1D A;  3EO4 A;  1Y9K A;  1Y7R A;  4JLY A;  2R7H A;  4KOY A;  1YRE A;  3DNS A;  1KUY A;  4KVM E;  3C26 A;  4KOT A;  1N71 A;  2Q4V A;  3D3S A;  4PSW A;  2J8R A;  1KZF A;  4AG9 A;  2AE6 A;  4MY0 A;  1BO4 A;  1IIC A;  3S6F A;  5KTA A;  3GKR A;  2VZY A;  4H89 A;  4QVT A;  4XPD C;  4ORF A;  3R9E A;  3FIX A;  3CXQ A;  2BUE A;  3K9U A;  2H5M A;  2P0W A;  3FYN A;  3TO9 A;  4MHD A;  5F48 A;  3LD2 A;  3CXS A;  2VXK A;  3ZZI A;  4R9M A;  2HV2 A;  5IV0 A;  1YK3 A;  2VZZ A;  1QSR A;  4NF1 A;  4CRY B;  2K5T A;  2WPW A;  4B5O A;  4UA3 A;  2FSR A;  1TIQ A;  3QB8 A;  3GY9 A;  4QB9 A;  2P6G A;  2OU2 A;  5JPH A;  2B3U A;  2B3V A;  2DXQ A;  2VEZ A;  2Q04 A;  5FVJ A;  4YFJ A;  3TE4 A;  3FNC A;  1S5K A;  5H86 A;  1Q2C A;  3OWC A;  5I0C A;  2GIV A;  4OLL A;  5KTD A;  4CAV A;  1LRZ A;  4U5Y A;  1MJA A;  4ONU A;  2B4D B;  4NEX A;  3DSB A;  4MI4 A;  3G8W A;  4II9 A;  2FS5 A;  2FE7 A;  3TO7 A;  5ISV A;  3T9Y A;  4CS0 B;  2B4B A;  3R1K A;  3R9F A;  4CAW A;  4FD7 A;  1Q2D A;  4BMH A;  4GS4 A;  4PSX A;  2ATR A;  4KUA A;  2I79 A;  2PR1 A;  3PZJ A;  4XNH B;  4NCZ A;  2B5G B;  3CXP A;  5KTC A;  1NSL A;  3SHP A;  3TCV A;  1ON0 A;  2VBQ A;  1U6M A;  3BLN A;  2G3T A;  4J3G A;  1R57 A;  2ARH A;  3S6K A;  4HKF A;  1S7F A;  4IF5 A;  2P6E A;  2RC4 A;  4FD5 A;  1B87 A;  4F6A A;  3TTH A;  3IGR A;  4KVO E;  4KOS A;  4H6Z A;  5H84 A;  3EFA A;  1GHE A;  2QML A;  3DR6 A;  4UWJ A;  5IX3 A;  2ZW5 A;  3T90 A;  1XF8 A;  2ZW4 A;  1S7L A;  2BEI A;  4RS2 A;  1QSO A;  2KCW A;  5EBV A;  1SQH A;  3JVN A;  2Z10 A;  2BSW A;  4OAD A;  2PC1 A;  2ZW7 A;  3S6H A;  1M44 A;  2WPX A;  1Y9W A;  3QAH A;  3IWG A;  3TFY A;  4PK2 A;  2REE A;  3ZJ0 A;  1XEB A;  4X5K A;  5C88 A;  3MGD A;  2CNS A;  2R8V A;  4R87 A;  2PQ8 A;  4Y49 C;  1P4N A;  2FCK A;  3W6X A;  1YVO A;  1Z9U A;  2PSW A;  2R98 A;  2JDC A;  2Q44 A;  3PP9 A;  4KLW A;  4EVY A;  3FBU A;  3P2H A;  4NXY A;  4I49 A;  2J8N A;  3R96 A;  1QSN A;  4IUS A;  2PDO A;  4JJX A;  3W6S A;  2A4N A;  4MBU A;  4U9Y A;  1J4J A;  3D2M A;  3F0A A;  4F0Y A;  4UBR A;  2FIA A;  1L0C A;  2F5I A;  3W91 A;  3F8K A;  4KLV A;  3EY5 A;  2JLM A;  2C27 A;  1Q2Y A;  5F47 A;  5F49 A;  1Z4E A;  4DNC A;  4JXQ A;  5CNP A;  2FT0 A;  1S7N A;  1XIX A;  4LUA A;  1FY7 A;  1WWZ A;  2NMT A;  4KOX A;  4HNW B;  3KKW A;  5DWM A;  4YGO A;  3TOA A;  1WK4 A;  4AB7 A;  1M4G A;  2JDD A;  5EC4 A;  3D2P A;  1MJB A;  2AJ6 A;  4XPK A;  3P2F A;  4L8A A;  4FD6 A;  2Q4Y A;  1M4D A;  2O28 A;  1IYL A;  4AVA A;  2J8M A;  1I21 A;  4B5P A;  1K4J A;  4XPD B;  1S7K A;  2PR8 A;  3BJ8 A;  3TO6 A;  4JWP A;  1BOB A;  4M3S A;  4Y49 B;  3SXN A;  1Z4R A;  4JD6 A;  1I1D A;  5C82 A;  1I12 A;  2BL1 A;  1PU9 A;  1OZP A;  1P0H A;  2OZH A;  3F5B A;  3NE7 A;  1XMT A;  1M4I A;  2ZW6 A;  4R57 A;  1B6B A;  2G3A A;  2FXF A;  5HMN A;  2OZU A;  2P6F A;  4PV6 A;  4MY3 A;  1IYK A;  5HH1 A;  3H4Q A;  1MK4 A;  3S6G A;  4ZBG A;  4KOR A;  4UWI A;  2REF A;  4XNH C;  1YVK A;  1PUA A;  2Q7B A;  4HNY B;  2X7B A;  2B5G A;  1KUV A;  4HNX B;  2I00 A;  4KUB A;  1RO5 A;  3R95 A;  2OZG A;  5GCN A;  3TOB A;  5J8F A;  2ZPA A;  4QC6 A;  3BJ7 A;  5IB0 A;  2VQY A;  2D4O A;  4K30 A;  4XPL A;  3SXO A;  4FD4 A;  2QIR A;  2CNT A;  3UY5 A;  3D8P A;  3FB3 A;  2VI7 A;  1UFH A;  3R9G A;  4B5P B;  1S3Z A;  4LX9 A;  4YRH A;  4RI1 A;  4H6U A;  2OB0 A;  2CY2 A;  1NMT A;  3N7Z A;  5JQ4 A;  1S60 A;  4R3K A;  2D4P A;  2FL4 A;  3B8G A;  4AG7 A;  4PK3 A;  1VHS A;  3RYO A;  4AVB A;  4U9Z A;  4NSQ A;  1MJ9 A;  1QSM A;  3GYA A;  2Q0Y A;  2GE3 A;  2HUZ A;  1VKC A;  3JUW A;  1QST A;  3G3S A;  2IL4 A;  3DDD A;  5DWN A;  2Z0Z A;  4MJ8 A;  1YLE A;  2FIW A;  4KOW A;  3EXN A;  4R3L A;  5J8C A;  2B58 A;  4QUS A;  4AVC A;  5E96 A;  3DR8 A;  2HQY A;  1NE9 A;  4KVX A; 
#chains in the Genus database with same CATH topology
 1KUX A;  1YGH A;  7CPA A;  2PRB A;  3PFE A;  4PXE A;  1YR0 A;  4R6T A;  4L89 A;  3TT2 A;  4KZT A;  2AFM A;  4KOU A;  2WZN A;  3BXM A;  4NGT A;  1XE4 A;  1Z8L A;  4P6Y A;  4CAX A;  2DF5 A;  2EUI A;  5LYI A;  3SI2 A;  3E0K A;  4QBJ A;  3FVL A;  1CM0 A;  2OH1 A;  4X8I A;  4F9U A;  4E8O A;  3VWE A;  5A28 A;  1TKH A;  2QEC A;  1M4L A;  3SJX A;  4OC3 A;  4OAE A;  4R76 A;  4LQG A;  2NYQ A;  2GAN A;  2ZXV A;  2G9D A;  1IB1 E;  3V8I A;  4JZ0 A;  3VWD A;  2PJ2 A;  1CJW A;  4E0A A;  3PGP A;  3I9S A;  2G0B A;  3WR7 A;  1BAV A;  2CNM A;  2B4D A;  2R1I A;  4KOV A;  3I3G A;  4CRZ B;  1IID A;  1HEE A;  1VIX A;  1YX0 A;  4C2Y A;  2QYV A;  1YQE A;  3LOD A;  5LRJ A;  3B3C A;  3FXT A;  4E2A A;  4JXR A;  1CP6 A;  2Y0M A;  1UWY A;  4MFL A;  4KS9 A;  2Z11 A;  2DPT A;  2Z3P A;  1RXT A;  1V0C A;  2XEJ A;  3FRM A;  3GIU A;  3KQX A;  5F46 A;  2JEV A;  3K2K A;  6CPA A;  4M85 A;  3EC4 A;  2EVN A;  1M1D A;  3IFE A;  1YME A;  3EO4 A;  3D66 A;  1Y9K A;  1Y7R A;  3I1U A;  1CP7 A;  4JLY A;  3FEE A;  2R7H A;  5HVF A;  4KOY A;  1YRE A;  1QQ9 A;  3DNS A;  1KUY A;  4IAV A;  3C26 A;  4KOT A;  2PJB A;  4KVM E;  1N71 A;  2Q4V A;  4PXB A;  3D3S A;  3V38 A;  1H8L A;  4PSW A;  2J8R A;  4GM5 A;  3WAB A;  4RN7 A;  1YSJ A;  5LYL A;  1KZF A;  4AG9 A;  2YNC C;  2YNC A;  2J9A A;  2AE6 A;  4MY0 A;  1BO4 A;  1IIC A;  3KGQ A;  5K8M A;  1LAP A;  3S6F A;  1XJO A;  2ZEM A;  5KTA A;  2GLF A;  2ZOG A;  3GKR A;  3PB7 X;  2VZY A;  4H89 A;  4QVT A;  4XPD C;  4ORF A;  5AG7 A;  3MRU A;  3R9E A;  2EBJ A;  4CGP A;  3LWU A;  4BBH A;  3FIX A;  3CXQ A;  4X2T A;  2WUU A;  2BUE A;  2PJ8 A;  2H5M A;  3K9U A;  2P0W A;  4C7I A;  3FYN A;  3TO9 A;  4MHD A;  1DE4 C;  2GLJ A;  5F48 A;  3LD2 A;  3CXS A;  2VXK A;  3ZZI A;  5F09 A;  5K8O A;  3PB8 X;  2HV2 A;  1IOI A;  1OBR A;  1XFO A;  2GU2 A;  4R9M A;  3HUV A;  5IV0 A;  5CPA A;  1YK3 A;  2VZZ A;  1QSR A;  1EE3 P;  4NF1 A;  4CRY B;  2CIJ A;  5G1Z A;  2K5T A;  2PIY A;  4MFK A;  4ZX9 A;  4MXU A;  5A27 A;  2WPW A;  2ZEG A;  4Z65 A;  2Z3K A;  4B5O A;  1ARL A;  4UA3 A;  2FSR A;  4C2Z A;  1TIQ A;  4UEF A;  3QB8 A;  3GY9 A;  4QB9 A;  3WC5 A;  2P6G A;  2OU2 A;  4OP4 A;  2EK8 A;  3SJG A;  5HXD A;  5JPH A;  1TF9 A;  2PJ1 A;  2B3U A;  2B3V A;  2DXQ A;  5AG4 A;  2VEZ A;  1QMU A;  2Q04 A;  4ONW A;  4PXD A;  5FVJ A;  4YFJ A;  3TE4 A;  1S5K A;  3FNC A;  4M6G A;  2AFX A;  5H86 A;  4MCS A;  1Q2C A;  3D7H A;  4IK2 A;  3OWC A;  5I0C A;  2GIV A;  4O23 A;  4OLL A;  4P4F A;  4CAV A;  5KTD A;  1LRZ A;  4U5Y A;  1MJA A;  1X10 A;  4ONU A;  1XOV A;  2B4D B;  4NEX A;  2AFU A;  3DSB A;  4A38 A;  4MI4 A;  4UIB A;  2XEI A;  3G8W A;  4II9 A;  3B2Y A;  3KAS A;  1XMB A;  4NGN A;  1F57 A;  4EME A;  2FS5 A;  3IIB A;  2FE7 A;  1X12 A;  3DGV A;  3S9M A;  4X3R A;  3LAC A;  4PXC A;  2AFO A;  3TO7 A;  5ISV A;  3T9Y A;  4CS0 B;  2B4B A;  4P45 A;  3R1K A;  4R8F A;  2I3C A;  4C2X A;  2PJ7 A;  3R9F A;  1AMP A;  4FD7 A;  4CAW A;  1JQG A;  4EFD A;  4B11 A;  1Q2D A;  4BMH A;  4W9Y A;  3IU1 A;  2F7V A;  4IHM A;  3SI1 A;  3S9N A;  4CGN A;  4GS4 A;  4PSX A;  2PJ4 A;  2DEA A;  1Z5R A;  4B6Z A;  2ATR A;  3BHX A;  4KUA A;  4CYQ A;  2I79 A;  4G1P A;  4CGL A;  2PR1 A;  3PZJ A;  1ELL P;  4XNH B;  4NCZ A;  1HDU A;  2B5G B;  3CXP A;  3SI0 A;  3RZA A;  1FT7 A;  1NSA A;  5KTC A;  1NSL A;  3SHP A;  3TCV A;  2VL1 A;  1ON0 A;  1IY7 A;  2PVW A;  1CG2 A;  2VBQ A;  4MCQ A;  3H8E A;  1U6M A;  3BLN A;  3GB0 A;  3SJE A;  2O4H A;  4NGS A;  1KWM A;  2G3T A;  4J3G A;  1R57 A;  4UCP A;  2ARH A;  2CTB A;  3S6K A;  4HKF A;  1S7F A;  3BI1 A;  4IF5 A;  2P6E A;  2RC4 A;  4MHY A;  4B13 A;  3SJF A;  4FD5 A;  1B87 A;  2FVG A;  4F6A A;  3PB9 X;  4WWV A;  1CPX A;  3TTH A;  3IGR A;  4KVO E;  4A37 A;  4KOS A;  3D7D A;  4P4I A;  3GLJ A;  3ISZ A;  4H6Z A;  2AFS A;  4UCM A;  5H84 A;  3FJU A;  2BOA A;  2C1C A;  3EFA A;  3KHX A;  5LYD A;  3KR4 A;  1GHE A;  1IGB A;  3L2N A;  4C68 A;  5D8N A;  1LAM A;  2QML A;  1BLL E;  1Y0Y A;  3DR6 A;  4A39 A;  4UWJ A;  1VGY A;  2ZW5 A;  2ZEP A;  5IX3 A;  2EWB A;  4KSF A;  5CBM A;  3T90 A;  1XF8 A;  3MN8 A;  4UEZ A;  2ZW4 A;  1S7L A;  2PVV A;  4ZY1 A;  2BEI A;  5JH9 A;  2HC9 A;  3D68 A;  4RS2 A;  1QSO A;  3FMC A;  1LAN A;  4ZYQ A;  2KCW A;  5EBV A;  4C7H A;  1IOF A;  3IJ3 A;  1SQH A;  1IU8 A;  3JVN A;  4CGO A;  3D4U A;  2Z10 A;  4H2K A;  2BSW A;  2EK9 A;  4OAD A;  2PC1 A;  2ZW7 A;  3FH4 A;  4NFR A;  3KQZ A;  3S6H A;  1M44 A;  4F8Z A;  3B3V A;  2JBK A;  2WPX A;  1Y9W A;  1ZO0 A;  1F2P A;  3KI9 A;  3QAH A;  3PFO A;  3IWG A;  2QVP A;  3B35 A;  4LQ6 A;  2OR4 A;  4A94 A;  3TFY A;  4PK2 A;  2REE A;  5AG6 A;  3ZJ0 A;  4B10 A;  1XEB A;  4X5K A;  5C88 A;  3MGD A;  2CNS A;  2R8V A;  4R87 A;  2PQ8 A;  4PPZ A;  4NGP A;  4R7M A;  3D7F A;  2V8G A;  4Y49 C;  5HVH A;  5HVG A;  4Q7A A;  1LOK A;  3FX6 A;  3B3W A;  1P4N A;  2FCK A;  2EO8 A;  2GFQ A;  1Y7E A;  3KHZ A;  1HDQ A;  3W6X A;  3PB4 X;  1YVO A;  1Z9U A;  2PSW A;  5K8N A;  2GRE A;  2R98 A;  2JDC A;  3CZX A;  4WJB A;  2Q44 A;  3PP9 A;  4KLW A;  2BO9 A;  1ZLI A;  4EWT A;  4EVY A;  3FBU A;  3P2H A;  4UIA A;  1TF8 A;  4NXY A;  4NGQ A;  4B14 A;  3CPX A;  2J8N A;  1GYT A;  4I49 A;  3R96 A;  3WT4 A;  1QSN A;  2OOT A;  1VHE A;  4NGR A;  3D7G A;  2PIZ A;  3GUX A;  4IUS A;  4OC1 A;  2PDO A;  1LFW A;  4JJX A;  3W6S A;  5DS0 A;  2A4N A;  1FNO A;  2Q4Z A;  2ZEO A;  4MBU A;  4U9Y A;  1J4J A;  3D2M A;  3F0A A;  4F0Y A;  3IO1 A;  4KVX A;  4CAE A;  4UBR A;  4FUU A;  2FIA A;  3H8F A;  2CF4 A;  1L0C A;  2F5I A;  3W91 A;  5LRK A;  3F8K A;  2WSA A;  4KLV A;  4FAI A;  2Z3L A;  3PB6 X;  3EY5 A;  2JLM A;  2C27 A;  2PRQ A;  4RUH A;  1Q2Y A;  5F47 A;  2HB6 A;  4P10 A;  5F49 A;  1Z4E A;  4MCR A;  4DNC A;  4JXQ A;  3IWW A;  5CNP A;  2FT0 A;  2V8H A;  2C6P A;  3TX8 A;  1S7N A;  3NH8 A;  3D67 A;  1XIX A;  1YW4 A;  2PJA A;  5G22 A;  3KZW A;  4LUA A;  1FY7 A;  1CBX A;  1WWZ A;  2NMT A;  2Z3O A;  4KOX A;  4OID A;  3CPA A;  1R43 A;  5THW A;  4HNW B;  3KKW A;  5DWM A;  3VH9 A;  3B3S A;  4PQA A;  4MFZ A;  4YGO A;  4FBE A;  2V8D A;  3TOA A;  4GXH A;  4MFJ A;  3QAY A;  5K8P A;  1WK4 A;  3KR5 A;  4AB7 A;  2PCU A;  2V8V A;  4Q38 A;  1M4G A;  4UCN A;  1ZG9 A;  4JYW A;  3VAT A;  2JDD A;  5EC4 A;  2YND A;  4CYP A;  2QJ8 A;  1TXR A;  3D2P A;  1MJB A;  4MRI A;  2AJ6 A;  3PBE A;  2IMO A;  2RFH A;  4XPK A;  3P2F A;  2CXA A;  4L8A A;  4A32 A;  3H5Z A;  3RAM A;  3T8W A;  4CAF A;  1R3N A;  1Y0R A;  4HPS A;  4NJR A;  5I4M A;  2IQ6 A;  3CDX A;  4FD6 A;  2C6C A;  2Q4Y A;  3V7Z A;  1M4D A;  2O28 A;  4CYO A;  1IYL A;  2AFZ A;  4AVA A;  2J8M A;  1I21 A;  3IU2 A;  4Q36 A;  3RBU A;  1K4J A;  4NJQ A;  4XPD B;  4B5P A;  4CPA A;  2ZEN A;  1S7K A;  2XEF A;  2ZED A;  1TKF A;  2PR8 A;  4YWY A;  4F9V A;  2BCO A;  2ZEF A;  3FF3 A;  3BJ8 A;  3WC7 A;  3TO6 A;  4A95 A;  4MFP A;  4JWP A;  3JTK A;  1BOB A;  5G20 A;  2Z3N A;  1XRY A;  4M3S A;  3BI0 A;  4Y49 B;  4UFV A;  3B7I A;  3SXN A;  1Z4R A;  1DTD A;  3NH5 A;  4JD6 A;  1Z8W A;  4ZY2 A;  4DYO A;  4B12 A;  2F8H A;  1I1D A;  2CTC A;  4MHP A;  1AYE A;  1I12 A;  2BL1 A;  2JEW A;  5C82 A;  1PU9 A;  1OZP A;  1F2O A;  1P0H A;  2OZH A;  2PE3 A;  1Z8X A;  1ZG8 A;  3JRU A;  3F5B A;  4OKO A;  2Q7S A;  2Z3M A;  3NE8 A;  5J1Q A;  1JWQ A;  5D29 A;  3NE7 A;  1XMT A;  4OC4 A;  1M4I A;  2ZW6 A;  4R57 A;  5AGE A;  2ODF A;  1ZLH A;  1B6B A;  2JBJ A;  2G3A A;  2ZEL A;  3H8G A;  4FWU A;  2ZOF A;  3NH4 A;  2DPS A;  2FXF A;  3VAR A;  1BPN A;  5HMN A;  5JM6 A;  2OZU A;  2P6F A;  4KSA A;  1RTQ A;  3IEH A;  4M6I A;  4PV6 A;  5LRG A;  4OIW A;  1YW6 A;  2PJ6 A;  3N5F A;  4ZX8 A;  4MY3 A;  1IYK A;  4UFW A;  4OC2 A;  5BWA B;  5HH1 A;  1PCA A;  4MHN A;  1XBU A;  3H4Q A;  3NFZ A;  1MK4 A;  4A31 A;  3S6G A;  4ZBG A;  3WC6 A;  3RNZ A;  4P4E A;  4KOR A;  1Z8T A;  4UWI A;  1Z2L A;  2REF A;  4XNH C;  1YVK A;  1PUA A;  2Q7B A;  4HNY B;  2X7B A;  1CX8 A;  2B5G A;  4AXV A;  4DJL A;  1KUV A;  4HNX B;  4P4J A;  2ZEE A;  4CGM A;  5IB9 A;  2I00 A;  4KUB A;  4BD9 A;  1VHO A;  4MCP A;  1RO5 A;  1PYT B;  3R95 A;  2YGW A;  2OZG A;  3KL9 A;  4TNU A;  4MMO A;  5GCN A;  4UF4 A;  4KSI A;  3TOB A;  5J8F A;  1ELM P;  2Q51 A;  4OC0 A;  3DLJ A;  4BIN A;  2ZPA A;  3B3T A;  8CPA A;  4QC6 A;  1CPS A;  4DUK A;  3BJ7 A;  5EMI A;  5IB0 A;  2VQY A;  1ARM A;  2RB7 A;  3FEC A;  3RO0 A;  3PEI A;  2D4O A;  4K30 A;  4P44 A;  4XPL A;  3SXO A;  3PBB A;  3A9L A;  4FD4 A;  4CYN A;  5JGF A;  2POK A;  2QIR A;  3QNV A;  2V77 A;  2CNT A;  2IJZ A;  3ISX A;  3UY5 A;  3D8P A;  2PJC A;  1BPM A;  2VI7 A;  1UFH A;  3FB3 A;  2PJ0 A;  1S3Z A;  4NGM A;  4TWE A;  3R9G A;  4LX9 A;  4A33 A;  4YRH A;  4B5P B;  1ZG7 A;  3TC8 A;  2C6G A;  3LMS A;  4RI1 A;  2AFW A;  4F0X A;  3K9T A;  4H6U A;  2OB0 A;  4M6H A;  4A30 A;  2CY2 A;  1NMT A;  4YU9 A;  4ZI6 A;  3N7Z A;  2PJ3 A;  5JQ4 A;  1S60 A;  2XEG A;  4MFQ A;  2NSM A;  4R3K A;  2D4P A;  2FL4 A;  2PJ5 A;  3B8G A;  4P4B A;  4AG7 A;  2ABZ A;  4PK3 A;  4P4D A;  3IWE A;  1VHS A;  3RYO A;  4AVB A;  4U9Z A;  3PRT A;  4NSQ A;  1MJ9 A;  1TKJ A;  2ZEH A;  1QSM A;  2ANP A;  3GYA A;  2Q0Y A;  1AUG A;  3NA6 A;  1LCP A;  2GE3 A;  3HLP A;  4OC5 A;  4UFX A;  2HUZ A;  2PJ9 A;  1VKC A;  3JUW A;  3CT9 A;  1QST A;  4A2Z A;  3G3S A;  2IL4 A;  1A2Z A;  3DDD A;  5DWN A;  2Z0Z A;  4OME A;  4MJ8 A;  3FED A;  2O53 A;  1YLE A;  4ZY0 A;  2FIW A;  5AG5 A;  1YLO A;  4KOW A;  3EXN A;  3IC1 A;  2Q43 A;  4MHZ A;  4R3L A;  3S9L A;  5G21 A;  5J8C A;  2B58 A;  4UEE A;  2WYR A;  4QUS A;  5ELY A;  4AVC A;  4ZGY B;  5E96 A;  3DR8 A;  5LYF A;  1Q7L A;  2HQY A;  2YNE A;  1NE9 A;  4K3N A; 
#chains in the Genus database with same CATH homology
 1KUX A;  1YGH A;  2PRB A;  1YR0 A;  4L89 A;  3TT2 A;  4KZT A;  4KOU A;  1XE4 A;  4CAX A;  2EUI A;  3E0K A;  4QBJ A;  1CM0 A;  2OH1 A;  4E8O A;  3VWE A;  5A28 A;  2QEC A;  4OAE A;  2GAN A;  2ZXV A;  3VWD A;  1IB1 E;  3V8I A;  1CJW A;  4E0A A;  3PGP A;  3I9S A;  2G0B A;  3WR7 A;  2CNM A;  2B4D A;  2R1I A;  4KOV A;  3I3G A;  4CRZ B;  1IID A;  1YX0 A;  4C2Y A;  3LOD A;  3FXT A;  4E2A A;  4JXR A;  2Y0M A;  4MFL A;  4KS9 A;  2Z11 A;  2DPT A;  2Z3P A;  1RXT A;  1V0C A;  3FRM A;  5F46 A;  2JEV A;  4M85 A;  3EC4 A;  2EVN A;  1M1D A;  3EO4 A;  1Y9K A;  1Y7R A;  4JLY A;  2R7H A;  4KOY A;  1YRE A;  3DNS A;  1KUY A;  3C26 A;  4KOT A;  4KVM E;  1N71 A;  2Q4V A;  3D3S A;  4PSW A;  2J8R A;  1KZF A;  4AG9 A;  2YNC C;  2YNC A;  2AE6 A;  4MY0 A;  1BO4 A;  1IIC A;  3S6F A;  5KTA A;  3GKR A;  2VZY A;  4H89 A;  4QVT A;  4XPD C;  4ORF A;  5AG7 A;  3R9E A;  4CGP A;  4BBH A;  3FIX A;  3CXQ A;  2WUU A;  2BUE A;  3K9U A;  2H5M A;  2P0W A;  4C7I A;  3FYN A;  3TO9 A;  4MHD A;  5F48 A;  3LD2 A;  3CXS A;  2VXK A;  3ZZI A;  4R9M A;  2HV2 A;  5IV0 A;  1YK3 A;  2VZZ A;  1QSR A;  4NF1 A;  4CRY B;  5G1Z A;  2K5T A;  4MFK A;  5A27 A;  2WPW A;  2Z3K A;  4B5O A;  4UA3 A;  2FSR A;  4C2Z A;  1TIQ A;  3QB8 A;  3GY9 A;  4QB9 A;  2P6G A;  2OU2 A;  5JPH A;  2B3U A;  2B3V A;  2DXQ A;  5AG4 A;  2VEZ A;  2Q04 A;  5FVJ A;  4YFJ A;  3TE4 A;  3FNC A;  1S5K A;  5H86 A;  1Q2C A;  3OWC A;  5I0C A;  2GIV A;  4OLL A;  5KTD A;  4CAV A;  1LRZ A;  4U5Y A;  1MJA A;  4ONU A;  2B4D B;  4NEX A;  3DSB A;  4MI4 A;  3G8W A;  4II9 A;  2FS5 A;  2FE7 A;  3TO7 A;  5ISV A;  3T9Y A;  4CS0 B;  2B4B A;  3R1K A;  4C2X A;  3R9F A;  4CAW A;  4FD7 A;  4B11 A;  1Q2D A;  4BMH A;  3IU1 A;  4CGN A;  4GS4 A;  4PSX A;  2ATR A;  4KUA A;  4CYQ A;  2I79 A;  4CGL A;  2PR1 A;  3PZJ A;  4XNH B;  4NCZ A;  2B5G B;  3CXP A;  5KTC A;  1NSL A;  3SHP A;  3TCV A;  1ON0 A;  2VBQ A;  1U6M A;  3BLN A;  2G3T A;  4J3G A;  1R57 A;  4UCP A;  2ARH A;  3S6K A;  4HKF A;  1S7F A;  4IF5 A;  2P6E A;  2RC4 A;  4B13 A;  4FD5 A;  1B87 A;  4F6A A;  3TTH A;  3IGR A;  4KVO E;  4KOS A;  4UCM A;  4H6Z A;  5H84 A;  3EFA A;  4C68 A;  1GHE A;  2QML A;  3DR6 A;  4UWJ A;  5IX3 A;  2ZW5 A;  4KSF A;  3T90 A;  1XF8 A;  2ZW4 A;  1S7L A;  2BEI A;  4RS2 A;  1QSO A;  2KCW A;  5EBV A;  4C7H A;  1SQH A;  3JVN A;  4CGO A;  2Z10 A;  2BSW A;  4OAD A;  2PC1 A;  2ZW7 A;  3S6H A;  1M44 A;  2WPX A;  1Y9W A;  1ZO0 A;  3QAH A;  3IWG A;  3TFY A;  4PK2 A;  2REE A;  5AG6 A;  3ZJ0 A;  4B10 A;  1XEB A;  4X5K A;  5C88 A;  3MGD A;  2CNS A;  2R8V A;  4R87 A;  2PQ8 A;  4Y49 C;  1P4N A;  2FCK A;  3W6X A;  1YVO A;  1Z9U A;  2PSW A;  2R98 A;  2JDC A;  2Q44 A;  3PP9 A;  4KLW A;  4EVY A;  3FBU A;  3P2H A;  4NXY A;  4B14 A;  4I49 A;  2J8N A;  3R96 A;  1QSN A;  4IUS A;  2PDO A;  4JJX A;  3W6S A;  2A4N A;  4MBU A;  4U9Y A;  1J4J A;  3D2M A;  3F0A A;  4F0Y A;  4CAE A;  4UBR A;  2FIA A;  1L0C A;  2F5I A;  3W91 A;  3F8K A;  2WSA A;  4KLV A;  2Z3L A;  3EY5 A;  2JLM A;  2C27 A;  1Q2Y A;  5F47 A;  5F49 A;  1Z4E A;  4DNC A;  4JXQ A;  5CNP A;  2FT0 A;  1S7N A;  1XIX A;  5G22 A;  4LUA A;  1FY7 A;  1WWZ A;  2NMT A;  2Z3O A;  4KOX A;  4HNW B;  3KKW A;  5DWM A;  4MFZ A;  4YGO A;  3TOA A;  4MFJ A;  1WK4 A;  4AB7 A;  4Q38 A;  1M4G A;  4UCN A;  2JDD A;  5EC4 A;  2YND A;  4CYP A;  3D2P A;  1MJB A;  2AJ6 A;  4XPK A;  3P2F A;  2CXA A;  4L8A A;  4A32 A;  3H5Z A;  4CAF A;  4FD6 A;  2Q4Y A;  4CYO A;  1M4D A;  2O28 A;  1IYL A;  4AVA A;  2J8M A;  1I21 A;  3IU2 A;  4Q36 A;  4B5P A;  1K4J A;  4XPD B;  1S7K A;  2PR8 A;  3BJ8 A;  3TO6 A;  4A95 A;  4MFP A;  4JWP A;  3JTK A;  1BOB A;  5G20 A;  2Z3N A;  4M3S A;  4Y49 B;  3SXN A;  4UFV A;  1Z4R A;  4JD6 A;  4B12 A;  1I1D A;  5C82 A;  1I12 A;  2BL1 A;  1PU9 A;  1OZP A;  1P0H A;  2OZH A;  3F5B A;  2Z3M A;  3NE7 A;  1XMT A;  1M4I A;  2ZW6 A;  4R57 A;  5AGE A;  1B6B A;  2G3A A;  2DPS A;  2FXF A;  5HMN A;  2OZU A;  2P6F A;  4KSA A;  4PV6 A;  4MY3 A;  1IYK A;  4UFW A;  5BWA B;  5HH1 A;  3H4Q A;  1MK4 A;  4A31 A;  3S6G A;  4ZBG A;  4KOR A;  4UWI A;  2REF A;  4XNH C;  1YVK A;  1PUA A;  2Q7B A;  4HNY B;  2X7B A;  2B5G A;  1KUV A;  4HNX B;  4CGM A;  2I00 A;  4KUB A;  1RO5 A;  3R95 A;  2YGW A;  2OZG A;  5GCN A;  3TOB A;  5J8F A;  2ZPA A;  4QC6 A;  3BJ7 A;  5IB0 A;  2VQY A;  2D4O A;  4K30 A;  4XPL A;  3SXO A;  4FD4 A;  3A9L A;  4CYN A;  2QIR A;  2CNT A;  3UY5 A;  3D8P A;  3FB3 A;  2VI7 A;  1UFH A;  3R9G A;  4A33 A;  1S3Z A;  4B5P B;  4LX9 A;  4YRH A;  4RI1 A;  4F0X A;  4H6U A;  2OB0 A;  4A30 A;  2CY2 A;  1NMT A;  3N7Z A;  5JQ4 A;  1S60 A;  4MFQ A;  4R3K A;  2D4P A;  2FL4 A;  3B8G A;  4AG7 A;  4PK3 A;  3IWE A;  1VHS A;  3RYO A;  4AVB A;  4U9Z A;  4NSQ A;  1MJ9 A;  1QSM A;  3GYA A;  2Q0Y A;  2GE3 A;  4UFX A;  2HUZ A;  1VKC A;  3JUW A;  4A2Z A;  1QST A;  3G3S A;  2IL4 A;  3DDD A;  5DWN A;  2Z0Z A;  4MJ8 A;  1YLE A;  2FIW A;  5AG5 A;  4KOW A;  3EXN A;  4R3L A;  5G21 A;  5J8C A;  2B58 A;  4QUS A;  4AVC A;  4ZGY B;  5E96 A;  3DR8 A;  2HQY A;  2YNE A;  1NE9 A;  4KVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...