4XPLA

The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
141
Chain Sequence
LIKLKNFTELNSQEIELIFKWRKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni pt14
molecule tags Transferase
molecule keywords N-Acetyltransferase, PseH
total genus 41
structure length 141
sequence length 150
ec nomenclature
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xplA00
3IWGA 2F5IA 2R98A 1J4JA 4B5PB 5JPHA 2OH1A 3FXTA 2REFA 3S6FA 1OZPA 2ZW4A 4MI4A 2J8MA 4R3LA 4ONUA 4KOTA 2H5MA 5C82A 3D2PA 2PDOA 4XPDC 2Q7BA 4AG7A 3V8IA 2FIWA 4NSQA 4JLYA 4CRZB 2CNSA 4M3SA 4MJ8A 1VHSA 1M4DA 2FSRA 4PSXA 2FIAA 2VEZA 2ZPAA 3N7ZA 5F47A 2FS5A 3UY5A 4LX9A 4FD7A 5C88A 2B4DB 4CAXA 4MBUA 1YLEA 2KCWA 2P6EA 1Q2DA 2JEVA 4MY0A 3QB8A 2FXFA 4QBJA 3SXNA 3ZJ0A 1S5KA 3S6KA 5CNPA 1P0HA 4IUSA 4YFJA 4FD4A 2ZW7A 1S7LA 3BJ7A 4XPKA 5KTAA 2HUZA 1MJBA 1Z9UA 4OLLA 2OU2A 2GANA 3LD2A 4MHDA 4KVXA 4KZTA 3R9FA 4XPDB 1XMTA 2B58A 3G3SA 5F46A 3SHPA 4M85A 2Q44A 3GKRA 3OWCA 3R1KA 2PRBA 4Y49B 2Q0YA 4KORA 2J8RA 3DR8A 3EO4A 3TFYA 2HV2A 1KUXA 3D3SA 1KUVA 4CRYB 5GCNA 4XPLA 2OZGA 3P2HA 1ON0A 4YGOA 1YR0A 1Z4RA 3RYOA 3EY5A 4HNYB 5KTCA 4PV6A 4JJXA 2PSWA 2FE7A 3H4QA 1S7NA 2P0WA 4AVCA 4QVTA 4B5OA 2VQYA 1QSOA 4AVBA 4AVAA 3FBUA 1BOBA 2HQYA 5HMNA 4BMHA 3PZJA 3C26A 4QUSA 4PSWA 1Y9WA 2D4OA 5IX3A 2ZXVA 2Z11A 3R9EA 4HKFA 2B4BA 4NCZA 1K4JA 4JXQA 1MJAA 1LRZA 3FB3A 3B8GA 4KOYA 3TO9A 1WWZA 2B5GA 4H89A 2VZZA 1XIXA 3S6HA 3W91A 2Q04A 3BJ8A 2Y0MA 3IGRA 4NF1A 4Y49C 3R96A 4F0YA 1RXTA 2FL4A 2BUEA 3FNCA 4JD6A 3FYNA 4UWIA 1YREA 2VI7A 4YRHA 1B6BA 1BO4A 5FVJA 2G3AA 1IYLA 3GYAA 1I12A 2CY2A 4RS2A 1I1DA 2G3TA 4UA3A 1M4GA 3F5BA 3P2FA 1QSMA 4KOVA 2Q4YA 1Y7RA 3TE4A 1NMTA 5IV0A 3TCVA 2OZUA 1UFHA 3K9UA 4KUAA 4KOUA 4CAWA 4CS0B 4UWJA 1V0CA 1B87A 4L89A 2Z10A 1L0CA 5DWMA 1IICA 5JQ4A 4X5KA 2PR8A 5I0CA 2R1IA 4R3KA 1KZFA 5IB0A 4K30A 3W6SA 4HNWB 4KLWA 1PUAA 1XEBA 3ZZIA 4U5YA 5J8FA 1FY7A 1YX0A 2VXKA 3KKWA 4RI1A 1M4IA 4R57A 1QSNA 4KOXA 5H86A 1QSTA 1P4NA 2PR1A 2OB0A 2BSWA 3GY9A 2C27A 4XNHC 2ARHA 2PQ8A 3D2MA 4II9A 1QSRA 2D4PA 5ISVA 3MGDA 1N71A 3BLNA 4L8AA 1XE4A 4CAVA 4J3GA 2X7BA 4LUAA 2BEIA 3TO6A 2B4DA 1S7KA 1YGHA 4PK3A 1WK4A 3EFAA 3QAHA 2O28A 2AE6A 5F49A 4I49A 3FIXA 2ZW5A 3TTHA 4B5PA 2I00A 4AG9A 4E0AA 5EBVA 4FD6A 1S7FA 4NXYA 2GIVA 4IF5A 3TT2A 1MJ9A 4HNXB 4OADA 3E0KA 4H6ZA 5J8CA 2A4NA 3EXNA 4KOWA 3FRMA 4U9ZA 4E2AA 3DR6A 3S6GA 3LODA 3WR7A 4F6AA 4KUBA 5DWNA 4JWPA 2I79A 1IYKA 3SXOA 2NMTA 2B3VA 4GS4A 3VWDA 2CNTA 4OAEA 3R9GA 3DNSA 4U9YA 2JLMA 3F8KA 5F48A 3PP9A 2AJ6A 1CJWA 1RO5A 4NEXA 3D8PA 4QB9A 1Y9KA 3TOBA 3NE7A 2FT0A 4R87A 2JDCA 2B3UA 1CM0A 5HH1A 1S60A 2K5TA 3TO7A 5E96A 1SQHA 4H6UA 1IB1E 4DNCA 3EC4A 1YVOA 2PC1A 2ATRA 2QECA 4PK2A 2R7HA 1Q2CA 2GE3A 4ZBGA 2Q4VA 3T90A 3JVNA 2QIRA 2BL1A 3CXSA 2EVNA 1Q2YA 3G8WA 2R8VA 4KVOE 1S3ZA 2J8NA 2RC4A 2B5GB 4R9MA 2ZW6A 2JDDA 1VKCA 2QMLA 4ORFA 2P6FA 4E8OA 2CNMA 1MK4A 1U6MA 1NSLA 3T9YA 1PU9A 2IL4A 5KTDA 2WPWA 3PGPA 4KVME 3TOAA 1M1DA 2Z0ZA 4MY3A 3DDDA 3CXQA 5H84A 2REEA 2WPXA 3DSBA 1GHEA 4XNHB 2P6GA 1YVKA 2OZHA 4EVYA 4AB7A 1TIQA 3F0AA 1R57A 2VBQA 1I21A 4JXRA 4UBRA 4KLVA 3VWEA 2FCKA 3JUWA 4QC6A 3R95A 3W6XA 2DXQA 1IIDA 3CXPA 4KOSA 5EC4A 3I3GA 1NE9A 4FD5A 3I9SA 1YK3A 2EUIA 1Z4EA 1KUYA 2VZYA 1XF8A 1M44A 2G0BA
chains in the Genus database with same CATH superfamily
3IWGA 2F5IA 2R98A 1VHEA 1YW6A 1J4JA 4B5PB 4UFXA 2ODFA 2OH1A 3FXTA 5JPHA 2REFA 1X12A 3S6FA 4ZI6A 1OZPA 2ZW4A 4MI4A 2J8MA 1JWQA 2PJ0A 4NGQA 5AG5A 4R3LA 3NFZA 1HDUA 4ONUA 4KOTA 4UFWA 2C6PA 2ZEMA 2C6GA 2Q43A 3PFEA 2H5MA 2RFHA 4A38A 5C82A 3D2PA 2PDOA 2PJ3A 3B3TA 5J1QA 4XPDC 2ABZA 3JRUA 3QAYA 3PB4X 5AG6A 2Q7BA 2QJ8A 3V8IA 4AG7A 2FIWA 4CAFA 4NSQA 4JLYA 4PXDA 4CRZB 6CPAA 3JTKA 5JGFA 3H8GA 2CNSA 7CPAA 4M3SA 4MJ8A 3IJ3A 4MFLA 1VHSA 1GYTA 1M4DA 2FSRA 4PSXA 4NJQA 2FIAA 2VEZA 4C7IA 1XMBA 2ZPAA 3N7ZA 4TNUA 5F47A 2FS5A 5ELYA 3UY5A 4LX9A 4FD7A 5C88A 4OC5A 2B4DB 4CAXA 4MBUA 4MXUA 1CPSA 1YLEA 2KCWA 5JM6A 2P6EA 2IJZA 1Q2DA 2ZEHA 2CTCA 3WT4A 2JEVA 3RO0A 4MY0A 3HLPA 4F9UA 5AG4A 5CPAA 3QB8A 2FXFA 1F2OA 4QBJA 3SXNA 4MFZA 1S5KA 3ZJ0A 3ISZA 3NH8A 3S6KA 5CNPA 3A9LA 2POKA 1P0HA 4IUSA 3K2KA 2GLJA 4YFJA 1UWYA 4FD4A 2ZW7A 1ARLA 1S7LA 2PIZA 1ZG7A 3BJ7A 3PBBA 4XPKA 5KTAA 2HUZA 3B7IA 1MJBA 1Z9UA 4NGMA 1BLLE 4OLLA 4B12A 2OU2A 4EWTA 3D68A 8CPAA 1AUGA 4MRIA 2GANA 3LD2A 4MHDA 2HC9A 4KVXA 3IWWA 3D7DA 3D66A 2YGWA 3WC7A 4C2XA 2JBJA 3IU2A 3FEDA 4KZTA 3R9FA 4XPDB 3PEIA 1XMTA 2B58A 3G3SA 4CYOA 4NJRA 2F8HA 3NH5A 4OIDA 3SHPA 4M85A 5F46A 2AFMA 2Q44A 4RUHA 2C6CA 3GKRA 3L2NA 4F8ZA 3V7ZA 2DPSA 1FT7A 3OWCA 3R1KA 2PRBA 5AGEA 4NGSA 4Y49B 5AG7A 1X10A 2GU2A 2Q0YA 4KORA 4ZY0A 4A95A 1IOFA 2YNCA 5G20A 2J8RA 3DR8A 3MRUA 4R76A 3EO4A 1QMUA 3PB6X 1CP6A 1VGYA 3TFYA 5LYIA 3BXMA 2HV2A 4OC3A 1KUXA 3D3SA 1KUVA 2IMOA 4CRYB 5GCNA 4XPLA 4CGNA 2OZGA 3P2HA 2Z3OA 1ON0A 2EBJA 1YR0A 1M4LA 4YGOA 4CYQA 3BI1A 5HXDA 1ELLP 1Z4RA 3RYOA 3EY5A 3KASA 4FAIA 4HNYB 5KTCA 4PV6A 4JJXA 2PSWA 2FE7A 3KI9A 5BWAB 1LAPA 3H4QA 1S7NA 2P0WA 3PRTA 4AVCA 2ZEEA 4QVTA 4B5OA 2VQYA 1QSOA 3B35A 2OR4A 4AVBA 4AVAA 5K8MA 1LANA 4C68A 3FBUA 3RNZA 1BOBA 2HB6A 2HQYA 1R3NA 3WABA 4DJLA 5HMNA 4P10A 4JZ0A 2QYVA 4UEFA 5A27A 1LCPA 4OC1A 5F09A 1F2PA 4BMHA 4M6IA 3PZJA 3C26A 3SJGA 3CPXA 4PXCA 4QUSA 3H8FA 3VH9A 1XJOA 4PSWA 3H8EA 1Y9WA 3D7GA 4MHZA 2ZENA 2D4OA 5IX3A 4MHPA 4IHMA 1TF9A 3SJFA 4A37A 2ZXVA 2Z11A 2V8VA 3TC8A 2ZEGA 3KHXA 1HDQA 2DF5A 2B4BA 4HKFA 4NCZA 1K4JA 4NGNA 4JXQA 3R9EA 1MJAA 1LRZA 3FB3A 4G1PA 4P4FA 3B8GA 2ZEDA 3GUXA 4KOYA 1WWZA 4MCRA 3TO9A 5HVGA 2B5GA 3KZWA 1IGBA 4H89A 1Y0YA 4CYNA 3D67A 2PJBA 1XIXA 2VZZA 4MFJA 4NGPA 4PXEA 3S6HA 3W91A 1RTQA 2Q04A 3BJ8A 2Y0MA 3IGRA 4OMEA 4NF1A 1ZG9A 4Y49C 1XBUA 3R96A 1AMPA 3CT9A 4H2KA 3RZAA 1RXTA 4F0YA 2ANPA 2J9AA 2Z3PA 4MFPA 2FL4A 2BUEA 4B10A 3FNCA 2WUUA 2V8DA 2ZEOA 3S9LA 2Q51A 1ARMA 3FYNA 4JD6A 4P4JA 4UWIA 2CIJA 4OIWA 1YREA 2BCOA 2PJ9A 3KQXA 2VI7A 1TXRA 4YRHA 1B6BA 1BO4A 5FVJA 2EO8A 2G3AA 4MCQA 4B6ZA 3SI2A 5LRGA 1IYLA 3GYAA 1I12A 3KHZA 2PJ4A 2CY2A 4RS2A 1I1DA 3B2YA 2G3TA 4MFQA 4UA3A 2PJ1A 4FUUA 1M4GA 2V77A 3F5BA 3P2FA 1QSMA 4KOVA 4UF4A 1NSAA 1DTDA 3FH4A 3SJXA 5K8NA 2ZEFA 2Q4YA 1VIXA 1Y7RA 1IY7A 1Z8LA 1Q7LA 3IO1A 5HVHA 4GM5A 3V38A 3IWEA 4CYPA 2Z3NA 4KSFA 3B3WA 3TE4A 1NMTA 4BINA 5IV0A 2AFZA 2WYRA 3CDXA 4C2YA 3TCVA 2OZUA 4TWEA 1UFHA 3K9UA 5DS0A 4KUAA 4KOUA 4CAWA 4P4IA 2XEIA 3FMCA 4CS0B 4R8FA 3IIBA 4UWJA 1V0CA 3H5ZA 2GLFA 4A31A 5IB9A 5G21A 1B87A 4L89A 4ZX8A 2AFWA 2Z10A 1L0CA 3B3VA 5DWMA 1LAMA 4YWYA 1IICA 4Q36A 5JQ4A 1Z8TA 4GXHA 4X5KA 3PB9X 2PR8A 3D4UA 2AFSA 5I0CA 2R1IA 1R43A 1KZFA 1IU8A 4K30A 2F7VA 3GLJA 4HNWB 4R3KA 3W6SA 5IB0A 4KLWA 1ZLIA 1PUAA 1XEBA 2AFUA 3ZZIA 4U5YA 3MN8A 4C2ZA 5CBMA 1H8LA 4UEZA 1BPNA 4OC0A 1CG2A 5J8FA 1FY7A 1YX0A 2VXKA 3KR5A 1EE3P 2PJCA 4A39A 2VL1A 2PE3A 5D29A 4CPAA 4A30A 1CP7A 3KKWA 4RI1A 5HVFA 1M4IA 3FX6A 4R57A 1QSNA 4KOXA 4EMEA 3RBUA 4MHNA 3PFOA 4LQGA 5H86A 1Y0RA 3SJEA 2C1CA 1QSTA 1P4NA 2PR1A 3B3CA 2OB0A 4P6YA 2BSWA 2WZNA 3GY9A 4OC4A 4P45A 2C27A 1OBRA 4XNHC 2ARHA 2PQ8A 3D2MA 4O23A 1XRYA 4R7MA 4X8IA 3VATA 4AXVA 4UFVA 1QSRA 2D4PA 4II9A 5ISVA 4P44A 4R6TA 3CPAA 3MGDA 2ZOFA 2JBKA 2ZELA 1N71A 3BLNA 4L8AA 3TX8A 1XE4A 2PCUA 1CBXA 4UCNA 4CAVA 4J3GA 2X7BA 3SI1A 4LUAA 1TKJA 1KWMA 2BEIA 4FWUA 3B3SA 3FVLA 3TO6A 4OKOA 1ZLHA 4NFRA 2B4DA 1S7KA 1YGHA 2DEAA 4PK3A 3IEHA 2O53A 1WK4A 4X2TA 3EFAA 3QAHA 4IK2A 2BO9A 5LRJA 3T8WA 2O28A 1TKFA 2XEGA 5JH9A 2AE6A 2PJ8A 3I1UA 3IU1A 5F49A 4CGLA 1Z8WA 4I49A 3FIXA 2ZW5A 3TTHA 4M6HA 4B5PA 2I00A 3IC1A 4AG9A 5I4MA 4E0AA 5EBVA 4FD6A 1LOKA 3KQZA 2I3CA 4MCPA 1S7FA 2Q7SA 3PBEA 2GIVA 4NXYA 4IF5A 5A28A 3TT2A 4B11A 1MJ9A 4HNXB 2Z3MA 1ELMP 4OADA 4MFKA 3E0KA 4H6ZA 4MCSA 4DYOA 3IFEA 5J8CA 4A94A 2A4NA 3EXNA 4KOWA 3FRMA 1Y7EA 2Q4ZA 4U9ZA 3FJUA 4E2AA 3DR6A 3S6GA 3RAMA 3LODA 2QVPA 2EWBA 3WR7A 2WSAA 4F6AA 4KUBA 1F57A 5DWNA 2V8HA 4JWPA 1YQEA 4A2ZA 2I79A 1IYKA 4JYWA 4ONWA 4A32A 2PVWA 4P4DA 4Q38A 3SXOA 2NMTA 2FVGA 2B3VA 4GS4A 3VWDA 1BAVA 3N5FA 1PCAA 2Z3KA 5LYDA 2CNTA 4OAEA 4YU9A 3R9GA 3DNSA 4U9YA 2JLMA 3F8KA 4ZX9A 3FEEA 5K8OA 5F48A 4B13A 4UCMA 3PP9A 4ZGYB 2AJ6A 4P4EA 1CJWA 2NYQA 3PB7X 3D7FA 1RO5A 4NEXA 3D8PA 4QB9A 4UIBA 4CGMA 2CTBA 2EK8A 4C7HA 2CF4A 4MHYA 5K8PA 4ZYQA 4FBEA 1Y9KA 4PPZA 3NE7A 2FT0A 4UCPA 3TOBA 4R87A 1IOIA 2PRQA 2DPTA 3FF3A 2JDCA 2B3UA 1JQGA 1CM0A 5LRKA 3QNVA 5HH1A 4P4BA 1S60A 1ZO0A 2K5TA 3TO7A 1FNOA 4M6GA 2PJ6A 2Z3LA 4F9VA 3ISXA 5E96A 3DLJA 4ZY1A 1SQHA 2GREA 1DE4C 4H6UA 1IB1E 4WWVA 4DNCA 3EC4A 5G22A 1YVOA 2PC1A 2ATRA 4KSIA 2QECA 3SI0A 4PK2A 2R7HA 4PXBA 1CX8A 3CZXA 1Q2CA 3WC5A 4HPSA 4CAEA 2JEWA 4UEEA 2GE3A 4ZBGA 4EFDA 2AFOA 4ZY2A 1CPXA 2Q4VA 4KSAA 4BD9A 2BOAA 3T90A 3VARA 3JVNA 2QIRA 1YLOA 2BL1A 4BBHA 4Z65A 3LACA 3CXSA 2EVNA 1Q2YA 3G8WA 4X3RA 2R8VA 4KVOE 4A33A 1S3ZA 2NSMA 2PJAA 3NH4A 3BI0A 5THWA 2J8NA 2RC4A 1TF8A 2B5GB 2ZOGA 2PVVA 4CGPA 4R9MA 2ZW6A 5LYFA 3BHXA 3LMSA 4OP4A 2JDDA 2ZEPA 3S9MA 1YMEA 1VKCA 2QMLA 4DUKA 4ORFA 5EMIA 4OC2A 4KS9A 2P6FA 2RB7A 4E8OA 4RN7A 2CNMA 3FECA 1TKHA 4UIAA 1BPMA 3WC6A 2CXAA 4Q7AA 3KL9A 2G9DA 2PJ5A 1XOVA 1MK4A 1U6MA 2O4HA 1NSLA 3T9YA 2XEJA 1PU9A 2IL4A 5KTDA 3S9NA 2WPWA 3GIUA 1VHOA 3PGPA 4MMOA 2PIYA 4KVME 3TOAA 1M1DA 2Z0ZA 4IAVA 4MY3A 5LYLA 4W9YA 3DDDA 3D7HA 3CXQA 1PYTB 4B14A 5H84A 1Z8XA 2YNCC 2REEA 5D8NA 2XEFA 2WPXA 2PJ7A 1YW4A 3DSBA 1GHEA 3NA6A 2V8GA 4XNHB 2P6GA 1YVKA 2YNDA 2IQ6A 2AFXA 2OZHA 4NGTA 4AB7A 1TIQA 3KGQA 4EVYA 3F0AA 1R57A 2VBQA 3K9TA 3GB0A 5G1ZA 1I21A 4JXRA 1QQ9A 4UBRA 4KLVA 2OOTA 1AYEA 4WJBA 3VWEA 3HUVA 2FCKA 3DGVA 3JUWA 4PQAA 1LFWA 4QC6A 3R95A 2DXQA 3KR4A 3LWUA 1IIDA 3W6XA 2EK9A 3CXPA 4KOSA 1YSJA 5EC4A 3I3GA 1ZG8A 3NE8A 1NE9A 3PB8X 4FD5A 1Z2LA 2YNEA 4NGRA 3I9SA 1YK3A 2GFQA 2EUIA 1Z4EA 2PJ2A 4F0XA 1KUYA 1A2ZA 1XF8A 1Z5RA 1M44A 2VZYA 1HEEA 4K3NA 4CGOA 2G0BA 4LQ6A 1XFOA
chains in the Genus database with same CATH topology
3IWGA 2F5IA 2R98A 1J4JA 4B5PB 4UFXA 2OH1A 5JPHA 3FXTA 2REFA 3S6FA 1OZPA 2ZW4A 4MI4A 2J8MA 5AG5A 4R3LA 4UFWA 4ONUA 4KOTA 2H5MA 5C82A 3D2PA 2PDOA 4XPDC 5AG6A 2Q7BA 4AG7A 3V8IA 2FIWA 4CAFA 4NSQA 4JLYA 4CRZB 3JTKA 2CNSA 4M3SA 4MJ8A 4MFLA 1VHSA 1M4DA 2FSRA 4PSXA 2FIAA 2VEZA 4C7IA 2ZPAA 3N7ZA 5F47A 2FS5A 3UY5A 4LX9A 4FD7A 5C88A 2B4DB 4CAXA 4MBUA 1YLEA 2KCWA 2P6EA 1Q2DA 2JEVA 4MY0A 5AG4A 3QB8A 2FXFA 4QBJA 3SXNA 4MFZA 1S5KA 3ZJ0A 3S6KA 5CNPA 3A9LA 1P0HA 4IUSA 4YFJA 4FD4A 2ZW7A 1S7LA 3BJ7A 4XPKA 5KTAA 2HUZA 1MJBA 1Z9UA 4B12A 4OLLA 2OU2A 2GANA 3LD2A 4MHDA 4KVXA 2YGWA 4C2XA 3IU2A 4KZTA 3R9FA 4XPDB 1XMTA 2B58A 3G3SA 4CYOA 5F46A 3SHPA 4M85A 2Q44A 3GKRA 2DPSA 3OWCA 3R1KA 2PRBA 5AGEA 4Y49B 5AG7A 2Q0YA 4KORA 4A95A 2YNCA 5G20A 2J8RA 3DR8A 3EO4A 3TFYA 2HV2A 1KUXA 3D3SA 1KUVA 4CRYB 5GCNA 4XPLA 4CGNA 2OZGA 3P2HA 2Z3OA 1ON0A 4YGOA 1YR0A 4CYQA 1Z4RA 3RYOA 3EY5A 4HNYB 5KTCA 4PV6A 4JJXA 2PSWA 2FE7A 5BWAB 3H4QA 1S7NA 2P0WA 4AVCA 4QVTA 4B5OA 2VQYA 1QSOA 4AVBA 4AVAA 4C68A 3FBUA 1BOBA 2HQYA 5HMNA 5A27A 4BMHA 3PZJA 3C26A 4QUSA 4PSWA 1Y9WA 2D4OA 5IX3A 2ZXVA 2Z11A 3R9EA 4HKFA 2B4BA 4NCZA 1K4JA 4JXQA 1MJAA 1LRZA 3FB3A 3B8GA 4KOYA 3TO9A 1WWZA 2B5GA 4H89A 4CYNA 2VZZA 1XIXA 4MFJA 3S6HA 3W91A 2Q04A 3BJ8A 2Y0MA 3IGRA 4NF1A 4Y49C 3R96A 4F0YA 1RXTA 2Z3PA 4MFPA 2FL4A 2BUEA 4B10A 3FNCA 2WUUA 4JD6A 3FYNA 4UWIA 1YREA 2VI7A 4YRHA 1B6BA 1BO4A 5FVJA 2G3AA 1IYLA 3GYAA 1I12A 2CY2A 4RS2A 1I1DA 2G3TA 4MFQA 4UA3A 1M4GA 3F5BA 3P2FA 1QSMA 4KOVA 2Q4YA 1Y7RA 3IWEA 4CYPA 2Z3NA 4KSFA 3TE4A 1NMTA 5IV0A 4C2YA 3TCVA 2OZUA 1UFHA 3K9UA 4KUAA 4KOUA 4CAWA 4CS0B 4UWJA 1V0CA 3H5ZA 4A31A 5G21A 1B87A 4L89A 2Z10A 1L0CA 5DWMA 1IICA 4Q36A 5JQ4A 4X5KA 2PR8A 5I0CA 2R1IA 4R3KA 1KZFA 5IB0A 4K30A 3W6SA 4HNWB 4KLWA 1PUAA 1XEBA 3ZZIA 4U5YA 4C2ZA 5J8FA 1FY7A 1YX0A 2VXKA 4A30A 3KKWA 4RI1A 1M4IA 4R57A 1QSNA 4KOXA 5H86A 1QSTA 1P4NA 2PR1A 2OB0A 2BSWA 3GY9A 2C27A 4XNHC 2ARHA 2PQ8A 3D2MA 4UFVA 1QSRA 2D4PA 4II9A 5ISVA 3MGDA 1N71A 3BLNA 4L8AA 1XE4A 4UCNA 4CAVA 4J3GA 2X7BA 4LUAA 2BEIA 3TO6A 2B4DA 1S7KA 1YGHA 4PK3A 1WK4A 3EFAA 3QAHA 2O28A 2AE6A 3IU1A 5F49A 4CGLA 4I49A 3FIXA 2ZW5A 3TTHA 4B5PA 2I00A 4AG9A 4E0AA 5EBVA 4FD6A 1S7FA 4NXYA 2GIVA 4IF5A 5A28A 3TT2A 4B11A 1MJ9A 4HNXB 2Z3MA 4OADA 4MFKA 3E0KA 4H6ZA 5J8CA 2A4NA 3EXNA 4KOWA 3FRMA 4U9ZA 4E2AA 3DR6A 3S6GA 3LODA 3WR7A 2WSAA 4F6AA 4KUBA 5DWNA 4JWPA 4A2ZA 2I79A 1IYKA 4A32A 4Q38A 3SXOA 2NMTA 2B3VA 4GS4A 3VWDA 2Z3KA 2CNTA 4OAEA 3R9GA 3DNSA 4U9YA 2JLMA 3F8KA 5F48A 4B13A 4UCMA 3PP9A 4ZGYB 2AJ6A 1CJWA 1RO5A 4NEXA 3D8PA 4QB9A 4CGMA 4C7HA 1Y9KA 3TOBA 3NE7A 2FT0A 4UCPA 4R87A 2DPTA 2JDCA 2B3UA 1CM0A 5HH1A 1S60A 1ZO0A 2K5TA 3TO7A 2Z3LA 5E96A 1SQHA 4H6UA 1IB1E 4DNCA 3EC4A 5G22A 1YVOA 2PC1A 2ATRA 2QECA 4PK2A 2R7HA 1Q2CA 4CAEA 2GE3A 4ZBGA 2Q4VA 4KSAA 3T90A 3JVNA 2QIRA 2BL1A 4BBHA 3CXSA 2EVNA 1Q2YA 3G8WA 2R8VA 4KVOE 4A33A 1S3ZA 2J8NA 2RC4A 2B5GB 4R9MA 2ZW6A 2JDDA 1VKCA 2QMLA 4ORFA 4KS9A 2P6FA 4E8OA 2CNMA 2CXAA 1MK4A 1U6MA 1NSLA 3T9YA 1PU9A 2IL4A 5KTDA 2WPWA 3PGPA 4KVME 3TOAA 1M1DA 2Z0ZA 4MY3A 3DDDA 3CXQA 4B14A 5H84A 2YNCC 2REEA 2WPXA 3DSBA 1GHEA 4XNHB 2P6GA 1YVKA 2YNDA 2OZHA 4EVYA 4AB7A 1TIQA 3F0AA 1R57A 2VBQA 5G1ZA 1I21A 4JXRA 4UBRA 4KLVA 3VWEA 2FCKA 3JUWA 4QC6A 3R95A 3W6XA 2DXQA 1IIDA 3CXPA 4KOSA 5EC4A 3I3GA 1NE9A 4FD5A 2YNEA 3I9SA 1YK3A 2EUIA 1Z4EA 4F0XA 1KUYA 2VZYA 1XF8A 4CGOA 1M44A 4CGPA 2G0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWG A;  2F5I A;  2R98 A;  1J4J A;  4B5P B;  5JPH A;  2OH1 A;  3FXT A;  2REF A;  3S6F A;  1OZP A;  2ZW4 A;  4MI4 A;  2J8M A;  4R3L A;  4ONU A;  4KOT A;  2H5M A;  5C82 A;  3D2P A;  2PDO A;  4XPD C;  2Q7B A;  4AG7 A;  3V8I A;  2FIW A;  4NSQ A;  4JLY A;  4CRZ B;  2CNS A;  4M3S A;  4MJ8 A;  1VHS A;  1M4D A;  2FSR A;  4PSX A;  2FIA A;  2VEZ A;  2ZPA A;  3N7Z A;  5F47 A;  2FS5 A;  3UY5 A;  4LX9 A;  4FD7 A;  5C88 A;  2B4D B;  4CAX A;  4MBU A;  1YLE A;  2KCW A;  2P6E A;  1Q2D A;  2JEV A;  4MY0 A;  3QB8 A;  2FXF A;  4QBJ A;  3SXN A;  3ZJ0 A;  1S5K A;  3S6K A;  5CNP A;  1P0H A;  4IUS A;  4YFJ A;  4FD4 A;  2ZW7 A;  1S7L A;  3BJ7 A;  4XPK A;  5KTA A;  2HUZ A;  1MJB A;  1Z9U A;  4OLL A;  2OU2 A;  2GAN A;  3LD2 A;  4MHD A;  4KVX A;  4KZT A;  3R9F A;  4XPD B;  1XMT A;  2B58 A;  3G3S A;  5F46 A;  3SHP A;  4M85 A;  2Q44 A;  3GKR A;  3OWC A;  3R1K A;  2PRB A;  4Y49 B;  2Q0Y A;  4KOR A;  2J8R A;  3DR8 A;  3EO4 A;  3TFY A;  2HV2 A;  1KUX A;  3D3S A;  1KUV A;  4CRY B;  5GCN A;  4XPL A;  2OZG A;  3P2H A;  1ON0 A;  4YGO A;  1YR0 A;  1Z4R A;  3RYO A;  3EY5 A;  4HNY B;  5KTC A;  4PV6 A;  4JJX A;  2PSW A;  2FE7 A;  3H4Q A;  1S7N A;  2P0W A;  4AVC A;  4QVT A;  4B5O A;  2VQY A;  1QSO A;  4AVB A;  4AVA A;  3FBU A;  1BOB A;  2HQY A;  5HMN A;  4BMH A;  3PZJ A;  3C26 A;  4QUS A;  4PSW A;  1Y9W A;  2D4O A;  5IX3 A;  2ZXV A;  2Z11 A;  3R9E A;  4HKF A;  2B4B A;  4NCZ A;  1K4J A;  4JXQ A;  1MJA A;  1LRZ A;  3FB3 A;  3B8G A;  4KOY A;  3TO9 A;  1WWZ A;  2B5G A;  4H89 A;  2VZZ A;  1XIX A;  3S6H A;  3W91 A;  2Q04 A;  3BJ8 A;  2Y0M A;  3IGR A;  4NF1 A;  4Y49 C;  3R96 A;  4F0Y A;  1RXT A;  2FL4 A;  2BUE A;  3FNC A;  4JD6 A;  3FYN A;  4UWI A;  1YRE A;  2VI7 A;  4YRH A;  1B6B A;  1BO4 A;  5FVJ A;  2G3A A;  1IYL A;  3GYA A;  1I12 A;  2CY2 A;  4RS2 A;  1I1D A;  2G3T A;  4UA3 A;  1M4G A;  3F5B A;  3P2F A;  1QSM A;  4KOV A;  2Q4Y A;  1Y7R A;  3TE4 A;  1NMT A;  5IV0 A;  3TCV A;  2OZU A;  1UFH A;  3K9U A;  4KUA A;  4KOU A;  4CAW A;  4CS0 B;  4UWJ A;  1V0C A;  1B87 A;  4L89 A;  2Z10 A;  1L0C A;  5DWM A;  1IIC A;  5JQ4 A;  4X5K A;  2PR8 A;  5I0C A;  2R1I A;  4R3K A;  1KZF A;  5IB0 A;  4K30 A;  3W6S A;  4HNW B;  4KLW A;  1PUA A;  1XEB A;  3ZZI A;  4U5Y A;  5J8F A;  1FY7 A;  1YX0 A;  2VXK A;  3KKW A;  4RI1 A;  1M4I A;  4R57 A;  1QSN A;  4KOX A;  5H86 A;  1QST A;  1P4N A;  2PR1 A;  2OB0 A;  2BSW A;  3GY9 A;  2C27 A;  4XNH C;  2ARH A;  2PQ8 A;  3D2M A;  4II9 A;  1QSR A;  2D4P A;  5ISV A;  3MGD A;  1N71 A;  3BLN A;  4L8A A;  1XE4 A;  4CAV A;  4J3G A;  2X7B A;  4LUA A;  2BEI A;  3TO6 A;  2B4D A;  1S7K A;  1YGH A;  4PK3 A;  1WK4 A;  3EFA A;  3QAH A;  2O28 A;  2AE6 A;  5F49 A;  4I49 A;  3FIX A;  2ZW5 A;  3TTH A;  4B5P A;  2I00 A;  4AG9 A;  4E0A A;  5EBV A;  4FD6 A;  1S7F A;  4NXY A;  2GIV A;  4IF5 A;  3TT2 A;  1MJ9 A;  4HNX B;  4OAD A;  3E0K A;  4H6Z A;  5J8C A;  2A4N A;  3EXN A;  4KOW A;  3FRM A;  4U9Z A;  4E2A A;  3DR6 A;  3S6G A;  3LOD A;  3WR7 A;  4F6A A;  4KUB A;  5DWN A;  4JWP A;  2I79 A;  1IYK A;  3SXO A;  2NMT A;  2B3V A;  4GS4 A;  3VWD A;  2CNT A;  4OAE A;  3R9G A;  3DNS A;  4U9Y A;  2JLM A;  3F8K A;  5F48 A;  3PP9 A;  2AJ6 A;  1CJW A;  1RO5 A;  4NEX A;  3D8P A;  4QB9 A;  1Y9K A;  3TOB A;  3NE7 A;  2FT0 A;  4R87 A;  2JDC A;  2B3U A;  1CM0 A;  5HH1 A;  1S60 A;  2K5T A;  3TO7 A;  5E96 A;  1SQH A;  4H6U A;  1IB1 E;  4DNC A;  3EC4 A;  1YVO A;  2PC1 A;  2ATR A;  2QEC A;  4PK2 A;  2R7H A;  1Q2C A;  2GE3 A;  4ZBG A;  2Q4V A;  3T90 A;  3JVN A;  2QIR A;  2BL1 A;  3CXS A;  2EVN A;  1Q2Y A;  3G8W A;  2R8V A;  4KVO E;  1S3Z A;  2J8N A;  2RC4 A;  2B5G B;  4R9M A;  2ZW6 A;  2JDD A;  1VKC A;  2QML A;  4ORF A;  2P6F A;  4E8O A;  2CNM A;  1MK4 A;  1U6M A;  1NSL A;  3T9Y A;  1PU9 A;  2IL4 A;  5KTD A;  2WPW A;  3PGP A;  4KVM E;  3TOA A;  1M1D A;  2Z0Z A;  4MY3 A;  3DDD A;  3CXQ A;  5H84 A;  2REE A;  2WPX A;  3DSB A;  1GHE A;  4XNH B;  2P6G A;  1YVK A;  2OZH A;  4EVY A;  4AB7 A;  1TIQ A;  3F0A A;  1R57 A;  2VBQ A;  1I21 A;  4JXR A;  4UBR A;  4KLV A;  3VWE A;  2FCK A;  3JUW A;  4QC6 A;  3R95 A;  3W6X A;  2DXQ A;  1IID A;  3CXP A;  4KOS A;  5EC4 A;  3I3G A;  1NE9 A;  4FD5 A;  3I9S A;  1YK3 A;  2EUI A;  1Z4E A;  1KUY A;  2VZY A;  1XF8 A;  1M44 A;  2G0B A; 
#chains in the Genus database with same CATH topology
 3IWG A;  2F5I A;  2R98 A;  1VHE A;  1YW6 A;  1J4J A;  4B5P B;  4UFX A;  2ODF A;  2OH1 A;  3FXT A;  5JPH A;  2REF A;  1X12 A;  3S6F A;  4ZI6 A;  1OZP A;  2ZW4 A;  4MI4 A;  2J8M A;  1JWQ A;  2PJ0 A;  4NGQ A;  5AG5 A;  4R3L A;  3NFZ A;  1HDU A;  4ONU A;  4KOT A;  4UFW A;  2C6P A;  2ZEM A;  2C6G A;  2Q43 A;  3PFE A;  2H5M A;  2RFH A;  4A38 A;  5C82 A;  3D2P A;  2PDO A;  2PJ3 A;  3B3T A;  5J1Q A;  4XPD C;  2ABZ A;  3JRU A;  3QAY A;  3PB4 X;  5AG6 A;  2Q7B A;  2QJ8 A;  3V8I A;  4AG7 A;  2FIW A;  4CAF A;  4NSQ A;  4JLY A;  4PXD A;  4CRZ B;  6CPA A;  3JTK A;  5JGF A;  3H8G A;  2CNS A;  7CPA A;  4M3S A;  4MJ8 A;  3IJ3 A;  4MFL A;  1VHS A;  1GYT A;  1M4D A;  2FSR A;  4PSX A;  4NJQ A;  2FIA A;  2VEZ A;  4C7I A;  1XMB A;  2ZPA A;  3N7Z A;  4TNU A;  5F47 A;  2FS5 A;  5ELY A;  3UY5 A;  4LX9 A;  4FD7 A;  5C88 A;  4OC5 A;  2B4D B;  4CAX A;  4MBU A;  4MXU A;  1CPS A;  1YLE A;  2KCW A;  5JM6 A;  2P6E A;  2IJZ A;  1Q2D A;  2ZEH A;  2CTC A;  3WT4 A;  2JEV A;  3RO0 A;  4MY0 A;  3HLP A;  4F9U A;  5AG4 A;  5CPA A;  3QB8 A;  2FXF A;  1F2O A;  4QBJ A;  3SXN A;  4MFZ A;  1S5K A;  3ZJ0 A;  3ISZ A;  3NH8 A;  3S6K A;  5CNP A;  3A9L A;  2POK A;  1P0H A;  4IUS A;  3K2K A;  2GLJ A;  4YFJ A;  1UWY A;  4FD4 A;  2ZW7 A;  1ARL A;  1S7L A;  2PIZ A;  1ZG7 A;  3BJ7 A;  3PBB A;  4XPK A;  5KTA A;  2HUZ A;  3B7I A;  1MJB A;  1Z9U A;  4NGM A;  1BLL E;  4OLL A;  4B12 A;  2OU2 A;  4EWT A;  3D68 A;  8CPA A;  1AUG A;  4MRI A;  2GAN A;  3LD2 A;  4MHD A;  2HC9 A;  4KVX A;  3IWW A;  3D7D A;  3D66 A;  2YGW A;  3WC7 A;  4C2X A;  2JBJ A;  3IU2 A;  3FED A;  4KZT A;  3R9F A;  4XPD B;  3PEI A;  1XMT A;  2B58 A;  3G3S A;  4CYO A;  4NJR A;  2F8H A;  3NH5 A;  4OID A;  3SHP A;  4M85 A;  5F46 A;  2AFM A;  2Q44 A;  4RUH A;  2C6C A;  3GKR A;  3L2N A;  4F8Z A;  3V7Z A;  2DPS A;  1FT7 A;  3OWC A;  3R1K A;  2PRB A;  5AGE A;  4NGS A;  4Y49 B;  5AG7 A;  1X10 A;  2GU2 A;  2Q0Y A;  4KOR A;  4ZY0 A;  4A95 A;  1IOF A;  2YNC A;  5G20 A;  2J8R A;  3DR8 A;  3MRU A;  4R76 A;  3EO4 A;  1QMU A;  3PB6 X;  1CP6 A;  1VGY A;  3TFY A;  5LYI A;  3BXM A;  2HV2 A;  4OC3 A;  1KUX A;  3D3S A;  1KUV A;  2IMO A;  4CRY B;  5GCN A;  4XPL A;  4CGN A;  2OZG A;  3P2H A;  2Z3O A;  1ON0 A;  2EBJ A;  1YR0 A;  1M4L A;  4YGO A;  4CYQ A;  3BI1 A;  5HXD A;  1ELL P;  1Z4R A;  3RYO A;  3EY5 A;  3KAS A;  4FAI A;  4HNY B;  5KTC A;  4PV6 A;  4JJX A;  2PSW A;  2FE7 A;  3KI9 A;  5BWA B;  1LAP A;  3H4Q A;  1S7N A;  2P0W A;  3PRT A;  4AVC A;  2ZEE A;  4QVT A;  4B5O A;  2VQY A;  1QSO A;  3B35 A;  2OR4 A;  4AVB A;  4AVA A;  5K8M A;  1LAN A;  4C68 A;  3FBU A;  3RNZ A;  1BOB A;  2HB6 A;  2HQY A;  1R3N A;  3WAB A;  4DJL A;  5HMN A;  4P10 A;  4JZ0 A;  2QYV A;  4UEF A;  5A27 A;  1LCP A;  4OC1 A;  5F09 A;  1F2P A;  4BMH A;  4M6I A;  3PZJ A;  3C26 A;  3SJG A;  3CPX A;  4PXC A;  4QUS A;  3H8F A;  3VH9 A;  1XJO A;  4PSW A;  3H8E A;  1Y9W A;  3D7G A;  4MHZ A;  2ZEN A;  2D4O A;  5IX3 A;  4MHP A;  4IHM A;  1TF9 A;  3SJF A;  4A37 A;  2ZXV A;  2Z11 A;  2V8V A;  3TC8 A;  2ZEG A;  3KHX A;  1HDQ A;  2DF5 A;  2B4B A;  4HKF A;  4NCZ A;  1K4J A;  4NGN A;  4JXQ A;  3R9E A;  1MJA A;  1LRZ A;  3FB3 A;  4G1P A;  4P4F A;  3B8G A;  2ZED A;  3GUX A;  4KOY A;  1WWZ A;  4MCR A;  3TO9 A;  5HVG A;  2B5G A;  3KZW A;  1IGB A;  4H89 A;  1Y0Y A;  4CYN A;  3D67 A;  2PJB A;  1XIX A;  2VZZ A;  4MFJ A;  4NGP A;  4PXE A;  3S6H A;  3W91 A;  1RTQ A;  2Q04 A;  3BJ8 A;  2Y0M A;  3IGR A;  4OME A;  4NF1 A;  1ZG9 A;  4Y49 C;  1XBU A;  3R96 A;  1AMP A;  3CT9 A;  4H2K A;  3RZA A;  1RXT A;  4F0Y A;  2ANP A;  2J9A A;  2Z3P A;  4MFP A;  2FL4 A;  2BUE A;  4B10 A;  3FNC A;  2WUU A;  2V8D A;  2ZEO A;  3S9L A;  2Q51 A;  1ARM A;  3FYN A;  4JD6 A;  4P4J A;  4UWI A;  2CIJ A;  4OIW A;  1YRE A;  2BCO A;  2PJ9 A;  3KQX A;  2VI7 A;  1TXR A;  4YRH A;  1B6B A;  1BO4 A;  5FVJ A;  2EO8 A;  2G3A A;  4MCQ A;  4B6Z A;  3SI2 A;  5LRG A;  1IYL A;  3GYA A;  1I12 A;  3KHZ A;  2PJ4 A;  2CY2 A;  4RS2 A;  1I1D A;  3B2Y A;  2G3T A;  4MFQ A;  4UA3 A;  2PJ1 A;  4FUU A;  1M4G A;  2V77 A;  3F5B A;  3P2F A;  1QSM A;  4KOV A;  4UF4 A;  1NSA A;  1DTD A;  3FH4 A;  3SJX A;  5K8N A;  2ZEF A;  2Q4Y A;  1VIX A;  1Y7R A;  1IY7 A;  1Z8L A;  1Q7L A;  3IO1 A;  5HVH A;  4GM5 A;  3V38 A;  3IWE A;  4CYP A;  2Z3N A;  4KSF A;  3B3W A;  3TE4 A;  1NMT A;  4BIN A;  5IV0 A;  2AFZ A;  2WYR A;  3CDX A;  4C2Y A;  3TCV A;  2OZU A;  4TWE A;  1UFH A;  3K9U A;  5DS0 A;  4KUA A;  4KOU A;  4CAW A;  4P4I A;  2XEI A;  3FMC A;  4CS0 B;  4R8F A;  3IIB A;  4UWJ A;  1V0C A;  3H5Z A;  2GLF A;  4A31 A;  5IB9 A;  5G21 A;  1B87 A;  4L89 A;  4ZX8 A;  2AFW A;  2Z10 A;  1L0C A;  3B3V A;  5DWM A;  1LAM A;  4YWY A;  1IIC A;  4Q36 A;  5JQ4 A;  1Z8T A;  4GXH A;  4X5K A;  3PB9 X;  2PR8 A;  3D4U A;  2AFS A;  5I0C A;  2R1I A;  1R43 A;  1KZF A;  1IU8 A;  4K30 A;  2F7V A;  3GLJ A;  4HNW B;  4R3K A;  3W6S A;  5IB0 A;  4KLW A;  1ZLI A;  1PUA A;  1XEB A;  2AFU A;  3ZZI A;  4U5Y A;  3MN8 A;  4C2Z A;  5CBM A;  1H8L A;  4UEZ A;  1BPN A;  4OC0 A;  1CG2 A;  5J8F A;  1FY7 A;  1YX0 A;  2VXK A;  3KR5 A;  1EE3 P;  2PJC A;  4A39 A;  2VL1 A;  2PE3 A;  5D29 A;  4CPA A;  4A30 A;  1CP7 A;  3KKW A;  4RI1 A;  5HVF A;  1M4I A;  3FX6 A;  4R57 A;  1QSN A;  4KOX A;  4EME A;  3RBU A;  4MHN A;  3PFO A;  4LQG A;  5H86 A;  1Y0R A;  3SJE A;  2C1C A;  1QST A;  1P4N A;  2PR1 A;  3B3C A;  2OB0 A;  4P6Y A;  2BSW A;  2WZN A;  3GY9 A;  4OC4 A;  4P45 A;  2C27 A;  1OBR A;  4XNH C;  2ARH A;  2PQ8 A;  3D2M A;  4O23 A;  1XRY A;  4R7M A;  4X8I A;  3VAT A;  4AXV A;  4UFV A;  1QSR A;  2D4P A;  4II9 A;  5ISV A;  4P44 A;  4R6T A;  3CPA A;  3MGD A;  2ZOF A;  2JBK A;  2ZEL A;  1N71 A;  3BLN A;  4L8A A;  3TX8 A;  1XE4 A;  2PCU A;  1CBX A;  4UCN A;  4CAV A;  4J3G A;  2X7B A;  3SI1 A;  4LUA A;  1TKJ A;  1KWM A;  2BEI A;  4FWU A;  3B3S A;  3FVL A;  3TO6 A;  4OKO A;  1ZLH A;  4NFR A;  2B4D A;  1S7K A;  1YGH A;  2DEA A;  4PK3 A;  3IEH A;  2O53 A;  1WK4 A;  4X2T A;  3EFA A;  3QAH A;  4IK2 A;  2BO9 A;  5LRJ A;  3T8W A;  2O28 A;  1TKF A;  2XEG A;  5JH9 A;  2AE6 A;  2PJ8 A;  3I1U A;  3IU1 A;  5F49 A;  4CGL A;  1Z8W A;  4I49 A;  3FIX A;  2ZW5 A;  3TTH A;  4M6H A;  4B5P A;  2I00 A;  3IC1 A;  4AG9 A;  5I4M A;  4E0A A;  5EBV A;  4FD6 A;  1LOK A;  3KQZ A;  2I3C A;  4MCP A;  1S7F A;  2Q7S A;  3PBE A;  2GIV A;  4NXY A;  4IF5 A;  5A28 A;  3TT2 A;  4B11 A;  1MJ9 A;  4HNX B;  2Z3M A;  1ELM P;  4OAD A;  4MFK A;  3E0K A;  4H6Z A;  4MCS A;  4DYO A;  3IFE A;  5J8C A;  4A94 A;  2A4N A;  3EXN A;  4KOW A;  3FRM A;  1Y7E A;  2Q4Z A;  4U9Z A;  3FJU A;  4E2A A;  3DR6 A;  3S6G A;  3RAM A;  3LOD A;  2QVP A;  2EWB A;  3WR7 A;  2WSA A;  4F6A A;  4KUB A;  1F57 A;  5DWN A;  2V8H A;  4JWP A;  1YQE A;  4A2Z A;  2I79 A;  1IYK A;  4JYW A;  4ONW A;  4A32 A;  2PVW A;  4P4D A;  4Q38 A;  3SXO A;  2NMT A;  2FVG A;  2B3V A;  4GS4 A;  3VWD A;  1BAV A;  3N5F A;  1PCA A;  2Z3K A;  5LYD A;  2CNT A;  4OAE A;  4YU9 A;  3R9G A;  3DNS A;  4U9Y A;  2JLM A;  3F8K A;  4ZX9 A;  3FEE A;  5K8O A;  5F48 A;  4B13 A;  4UCM A;  3PP9 A;  4ZGY B;  2AJ6 A;  4P4E A;  1CJW A;  2NYQ A;  3PB7 X;  3D7F A;  1RO5 A;  4NEX A;  3D8P A;  4QB9 A;  4UIB A;  4CGM A;  2CTB A;  2EK8 A;  4C7H A;  2CF4 A;  4MHY A;  5K8P A;  4ZYQ A;  4FBE A;  1Y9K A;  4PPZ A;  3NE7 A;  2FT0 A;  4UCP A;  3TOB A;  4R87 A;  1IOI A;  2PRQ A;  2DPT A;  3FF3 A;  2JDC A;  2B3U A;  1JQG A;  1CM0 A;  5LRK A;  3QNV A;  5HH1 A;  4P4B A;  1S60 A;  1ZO0 A;  2K5T A;  3TO7 A;  1FNO A;  4M6G A;  2PJ6 A;  2Z3L A;  4F9V A;  3ISX A;  5E96 A;  3DLJ A;  4ZY1 A;  1SQH A;  2GRE A;  1DE4 C;  4H6U A;  1IB1 E;  4WWV A;  4DNC A;  3EC4 A;  5G22 A;  1YVO A;  2PC1 A;  2ATR A;  4KSI A;  2QEC A;  3SI0 A;  4PK2 A;  2R7H A;  4PXB A;  1CX8 A;  3CZX A;  1Q2C A;  3WC5 A;  4HPS A;  4CAE A;  2JEW A;  4UEE A;  2GE3 A;  4ZBG A;  4EFD A;  2AFO A;  4ZY2 A;  1CPX A;  2Q4V A;  4KSA A;  4BD9 A;  2BOA A;  3T90 A;  3VAR A;  3JVN A;  2QIR A;  1YLO A;  2BL1 A;  4BBH A;  4Z65 A;  3LAC A;  3CXS A;  2EVN A;  1Q2Y A;  3G8W A;  4X3R A;  2R8V A;  4KVO E;  4A33 A;  1S3Z A;  2NSM A;  2PJA A;  3NH4 A;  3BI0 A;  5THW A;  2J8N A;  2RC4 A;  1TF8 A;  2B5G B;  2ZOG A;  2PVV A;  4CGP A;  4R9M A;  2ZW6 A;  5LYF A;  3BHX A;  3LMS A;  4OP4 A;  2JDD A;  2ZEP A;  3S9M A;  1YME A;  1VKC A;  2QML A;  4DUK A;  4ORF A;  5EMI A;  4OC2 A;  4KS9 A;  2P6F A;  2RB7 A;  4E8O A;  4RN7 A;  2CNM A;  3FEC A;  1TKH A;  4UIA A;  1BPM A;  3WC6 A;  2CXA A;  4Q7A A;  3KL9 A;  2G9D A;  2PJ5 A;  1XOV A;  1MK4 A;  1U6M A;  2O4H A;  1NSL A;  3T9Y A;  2XEJ A;  1PU9 A;  2IL4 A;  5KTD A;  3S9N A;  2WPW A;  3GIU A;  1VHO A;  3PGP A;  4MMO A;  2PIY A;  4KVM E;  3TOA A;  1M1D A;  2Z0Z A;  4IAV A;  4MY3 A;  5LYL A;  4W9Y A;  3DDD A;  3D7H A;  3CXQ A;  1PYT B;  4B14 A;  5H84 A;  1Z8X A;  2YNC C;  2REE A;  5D8N A;  2XEF A;  2WPX A;  2PJ7 A;  1YW4 A;  3DSB A;  1GHE A;  3NA6 A;  2V8G A;  4XNH B;  2P6G A;  1YVK A;  2YND A;  2IQ6 A;  2AFX A;  2OZH A;  4NGT A;  4AB7 A;  1TIQ A;  3KGQ A;  4EVY A;  3F0A A;  1R57 A;  2VBQ A;  3K9T A;  3GB0 A;  5G1Z A;  1I21 A;  4JXR A;  1QQ9 A;  4UBR A;  4KLV A;  2OOT A;  1AYE A;  4WJB A;  3VWE A;  3HUV A;  2FCK A;  3DGV A;  3JUW A;  4PQA A;  1LFW A;  4QC6 A;  3R95 A;  2DXQ A;  3KR4 A;  3LWU A;  1IID A;  3W6X A;  2EK9 A;  3CXP A;  4KOS A;  1YSJ A;  5EC4 A;  3I3G A;  1ZG8 A;  3NE8 A;  1NE9 A;  3PB8 X;  4FD5 A;  1Z2L A;  2YNE A;  4NGR A;  3I9S A;  1YK3 A;  2GFQ A;  2EUI A;  1Z4E A;  2PJ2 A;  4F0X A;  1KUY A;  1A2Z A;  1XF8 A;  1Z5R A;  1M44 A;  2VZY A;  1HEE A;  4K3N A;  4CGO A;  2G0B A;  4LQ6 A;  1XFO A; 
#chains in the Genus database with same CATH homology
 3IWG A;  2F5I A;  2R98 A;  1J4J A;  4B5P B;  4UFX A;  2OH1 A;  5JPH A;  3FXT A;  2REF A;  3S6F A;  1OZP A;  2ZW4 A;  4MI4 A;  2J8M A;  5AG5 A;  4R3L A;  4UFW A;  4ONU A;  4KOT A;  2H5M A;  5C82 A;  3D2P A;  2PDO A;  4XPD C;  5AG6 A;  2Q7B A;  4AG7 A;  3V8I A;  2FIW A;  4CAF A;  4NSQ A;  4JLY A;  4CRZ B;  3JTK A;  2CNS A;  4M3S A;  4MJ8 A;  4MFL A;  1VHS A;  1M4D A;  2FSR A;  4PSX A;  2FIA A;  2VEZ A;  4C7I A;  2ZPA A;  3N7Z A;  5F47 A;  2FS5 A;  3UY5 A;  4LX9 A;  4FD7 A;  5C88 A;  2B4D B;  4CAX A;  4MBU A;  1YLE A;  2KCW A;  2P6E A;  1Q2D A;  2JEV A;  4MY0 A;  5AG4 A;  3QB8 A;  2FXF A;  4QBJ A;  3SXN A;  4MFZ A;  1S5K A;  3ZJ0 A;  3S6K A;  5CNP A;  3A9L A;  1P0H A;  4IUS A;  4YFJ A;  4FD4 A;  2ZW7 A;  1S7L A;  3BJ7 A;  4XPK A;  5KTA A;  2HUZ A;  1MJB A;  1Z9U A;  4B12 A;  4OLL A;  2OU2 A;  2GAN A;  3LD2 A;  4MHD A;  4KVX A;  2YGW A;  4C2X A;  3IU2 A;  4KZT A;  3R9F A;  4XPD B;  1XMT A;  2B58 A;  3G3S A;  4CYO A;  5F46 A;  3SHP A;  4M85 A;  2Q44 A;  3GKR A;  2DPS A;  3OWC A;  3R1K A;  2PRB A;  5AGE A;  4Y49 B;  5AG7 A;  2Q0Y A;  4KOR A;  4A95 A;  2YNC A;  5G20 A;  2J8R A;  3DR8 A;  3EO4 A;  3TFY A;  2HV2 A;  1KUX A;  3D3S A;  1KUV A;  4CRY B;  5GCN A;  4XPL A;  4CGN A;  2OZG A;  3P2H A;  2Z3O A;  1ON0 A;  4YGO A;  1YR0 A;  4CYQ A;  1Z4R A;  3RYO A;  3EY5 A;  4HNY B;  5KTC A;  4PV6 A;  4JJX A;  2PSW A;  2FE7 A;  5BWA B;  3H4Q A;  1S7N A;  2P0W A;  4AVC A;  4QVT A;  4B5O A;  2VQY A;  1QSO A;  4AVB A;  4AVA A;  4C68 A;  3FBU A;  1BOB A;  2HQY A;  5HMN A;  5A27 A;  4BMH A;  3PZJ A;  3C26 A;  4QUS A;  4PSW A;  1Y9W A;  2D4O A;  5IX3 A;  2ZXV A;  2Z11 A;  3R9E A;  4HKF A;  2B4B A;  4NCZ A;  1K4J A;  4JXQ A;  1MJA A;  1LRZ A;  3FB3 A;  3B8G A;  4KOY A;  3TO9 A;  1WWZ A;  2B5G A;  4H89 A;  4CYN A;  2VZZ A;  1XIX A;  4MFJ A;  3S6H A;  3W91 A;  2Q04 A;  3BJ8 A;  2Y0M A;  3IGR A;  4NF1 A;  4Y49 C;  3R96 A;  4F0Y A;  1RXT A;  2Z3P A;  4MFP A;  2FL4 A;  2BUE A;  4B10 A;  3FNC A;  2WUU A;  4JD6 A;  3FYN A;  4UWI A;  1YRE A;  2VI7 A;  4YRH A;  1B6B A;  1BO4 A;  5FVJ A;  2G3A A;  1IYL A;  3GYA A;  1I12 A;  2CY2 A;  4RS2 A;  1I1D A;  2G3T A;  4MFQ A;  4UA3 A;  1M4G A;  3F5B A;  3P2F A;  1QSM A;  4KOV A;  2Q4Y A;  1Y7R A;  3IWE A;  4CYP A;  2Z3N A;  4KSF A;  3TE4 A;  1NMT A;  5IV0 A;  4C2Y A;  3TCV A;  2OZU A;  1UFH A;  3K9U A;  4KUA A;  4KOU A;  4CAW A;  4CS0 B;  4UWJ A;  1V0C A;  3H5Z A;  4A31 A;  5G21 A;  1B87 A;  4L89 A;  2Z10 A;  1L0C A;  5DWM A;  1IIC A;  4Q36 A;  5JQ4 A;  4X5K A;  2PR8 A;  5I0C A;  2R1I A;  4R3K A;  1KZF A;  5IB0 A;  4K30 A;  3W6S A;  4HNW B;  4KLW A;  1PUA A;  1XEB A;  3ZZI A;  4U5Y A;  4C2Z A;  5J8F A;  1FY7 A;  1YX0 A;  2VXK A;  4A30 A;  3KKW A;  4RI1 A;  1M4I A;  4R57 A;  1QSN A;  4KOX A;  5H86 A;  1QST A;  1P4N A;  2PR1 A;  2OB0 A;  2BSW A;  3GY9 A;  2C27 A;  4XNH C;  2ARH A;  2PQ8 A;  3D2M A;  4UFV A;  1QSR A;  2D4P A;  4II9 A;  5ISV A;  3MGD A;  1N71 A;  3BLN A;  4L8A A;  1XE4 A;  4UCN A;  4CAV A;  4J3G A;  2X7B A;  4LUA A;  2BEI A;  3TO6 A;  2B4D A;  1S7K A;  1YGH A;  4PK3 A;  1WK4 A;  3EFA A;  3QAH A;  2O28 A;  2AE6 A;  3IU1 A;  5F49 A;  4CGL A;  4I49 A;  3FIX A;  2ZW5 A;  3TTH A;  4B5P A;  2I00 A;  4AG9 A;  4E0A A;  5EBV A;  4FD6 A;  1S7F A;  4NXY A;  2GIV A;  4IF5 A;  5A28 A;  3TT2 A;  4B11 A;  1MJ9 A;  4HNX B;  2Z3M A;  4OAD A;  4MFK A;  3E0K A;  4H6Z A;  5J8C A;  2A4N A;  3EXN A;  4KOW A;  3FRM A;  4U9Z A;  4E2A A;  3DR6 A;  3S6G A;  3LOD A;  3WR7 A;  2WSA A;  4F6A A;  4KUB A;  5DWN A;  4JWP A;  4A2Z A;  2I79 A;  1IYK A;  4A32 A;  4Q38 A;  3SXO A;  2NMT A;  2B3V A;  4GS4 A;  3VWD A;  2Z3K A;  2CNT A;  4OAE A;  3R9G A;  3DNS A;  4U9Y A;  2JLM A;  3F8K A;  5F48 A;  4B13 A;  4UCM A;  3PP9 A;  4ZGY B;  2AJ6 A;  1CJW A;  1RO5 A;  4NEX A;  3D8P A;  4QB9 A;  4CGM A;  4C7H A;  1Y9K A;  3TOB A;  3NE7 A;  2FT0 A;  4UCP A;  4R87 A;  2DPT A;  2JDC A;  2B3U A;  1CM0 A;  5HH1 A;  1S60 A;  1ZO0 A;  2K5T A;  3TO7 A;  2Z3L A;  5E96 A;  1SQH A;  4H6U A;  1IB1 E;  4DNC A;  3EC4 A;  5G22 A;  1YVO A;  2PC1 A;  2ATR A;  2QEC A;  4PK2 A;  2R7H A;  1Q2C A;  4CAE A;  2GE3 A;  4ZBG A;  2Q4V A;  4KSA A;  3T90 A;  3JVN A;  2QIR A;  2BL1 A;  4BBH A;  3CXS A;  2EVN A;  1Q2Y A;  3G8W A;  2R8V A;  4KVO E;  4A33 A;  1S3Z A;  2J8N A;  2RC4 A;  2B5G B;  4R9M A;  2ZW6 A;  2JDD A;  1VKC A;  2QML A;  4ORF A;  4KS9 A;  2P6F A;  4E8O A;  2CNM A;  2CXA A;  1MK4 A;  1U6M A;  1NSL A;  3T9Y A;  1PU9 A;  2IL4 A;  5KTD A;  2WPW A;  3PGP A;  4KVM E;  3TOA A;  1M1D A;  2Z0Z A;  4MY3 A;  3DDD A;  3CXQ A;  4B14 A;  5H84 A;  2YNC C;  2REE A;  2WPX A;  3DSB A;  1GHE A;  4XNH B;  2P6G A;  1YVK A;  2YND A;  2OZH A;  4EVY A;  4AB7 A;  1TIQ A;  3F0A A;  1R57 A;  2VBQ A;  5G1Z A;  1I21 A;  4JXR A;  4UBR A;  4KLV A;  3VWE A;  2FCK A;  3JUW A;  4QC6 A;  3R95 A;  3W6X A;  2DXQ A;  1IID A;  3CXP A;  4KOS A;  5EC4 A;  3I3G A;  1NE9 A;  4FD5 A;  2YNE A;  3I9S A;  1YK3 A;  2EUI A;  1Z4E A;  4F0X A;  1KUY A;  2VZY A;  1XF8 A;  4CGO A;  1M44 A;  4CGP A;  2G0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...