4XPLA

The crystal structure of campylobacter jejuni n-acetyltransferase pseh in complex with acetyl coenzyme a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
141
Chain Sequence
LIKLKNFTELNSQEIELIFKWRKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acetyltransferase, PseH
publication title Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni pt14
molecule tags Transferase
total genus 41
structure length 141
sequence length 150
ec nomenclature
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xplA00
2VZYA 1J4JA 2KCWA 4NXYA 3IGRA 1S3ZA 3QB8A 3FB3A 3EXNA 4OLLA 2ZW7A 5F49A 2G3TA 2R98A 5F46A 4AVBA 4KOXA 5J8FA 2OZGA 3EC4A 1I1DA 2VXKA 2K5TA 1I12A 4KOUA 1XEBA 4L8AA 1YREA 3D2MA 2JLMA 2ZW5A 1V0CA 1KUYA 4I49A 2I00A 3FIXA 1YLEA 5I0CA 4E8OA 1YK3A 1FY7A 1S7KA 4B5PB 1S5KA 5F48A 4GS4A 1YVKA 5ISVA 1Z9UA 2QIRA 2VZZA 4BMHA 3FRMA 3TO9A 1Q2DA 3G3SA 1MJ9A 4M3SA 3W91A 4LUAA 3W6XA 1IB1E 2NMTA 1CM0A 2VQYA 2FCKA 4JXQA 2Z11A 4JD6A 4YRHA 1UFHA 2OZHA 4KUBA 3W6SA 2PQ8A 3TTHA 2Z0ZA 5EC4A 4F6AA 2QMLA 1NSLA 3S6FA 1PUAA 1Q2YA 4ZBGA 1MK4A 3CXQA 2BUEA 3P2FA 4CAVA 4B5OA 1QSOA 1P4NA 4L89A 2EUIA 3I9SA 5C82A 5KTAA 3S6GA 4YFJA 4IUSA 2REEA 3GKRA 2P6GA 5IB0A 2P6FA 4KOYA 4KOWA 2GIVA 2ZW4A 4KUAA 5HH1A 4MJ8A 5CNPA 4CAWA 5JQ4A 3R9FA 5DWNA 4FD6A 2O28A 4HNYB 5KTDA 3TFYA 2Q04A 1BO4A 2P0WA 2FIAA 2JEVA 2Q44A 3DNSA 2J8MA 3JVNA 2EVNA 4KLWA 4MBUA 3R95A 3BJ7A 3R1KA 4AG7A 2PSWA 4PSWA 3G8WA 2Z10A 4H89A 2OB0A 1YVOA 4OAEA 5IX3A 1XE4A 3CXSA 4XNHB 2H5MA 3BLNA 4PK3A 1S7FA 2A4NA 4YGOA 4PV6A 1XF8A 2F5IA 1Q2CA 4UWJA 4FD5A 3PP9A 1QSRA 1PU9A 1OZPA 3DR8A 2I79A 3D3SA 1RO5A 2RC4A 3KKWA 4K30A 4HNWB 2B3UA 2CNMA 1P0HA 2BSWA 4R87A 4II9A 4CS0B 1S60A 2D4OA 3B8GA 1XIXA 3IWGA 1QSNA 4U9YA 2J8RA 3CXPA 1Z4EA 4UA3A 4CRZB 2ZXVA 4XNHC 4KVXA 2DXQA 5IV0A 4R9MA 1M44A 2PR8A 4NSQA 1MJAA 3OWCA 1KUVA 2OH1A 4AVCA 1IYKA 1MJBA 1YGHA 3T90A 3FYNA 5GCNA 5HMNA 1IICA 1TIQA 4E0AA 2Q4YA 2Y0MA 2FIWA 4OADA 1B6BA 3FNCA 3EO4A 2IL4A 3VWDA 3D2PA 3FXTA 2PRBA 1U6MA 2Q4VA 4U5YA 4KOTA 2OZUA 4KOVA 5H86A 2B5GA 4AB7A 5KTCA 5JPHA 5F47A 2VEZA 3DR6A 1Y7RA 2CNTA 5H84A 1SQHA 3EFAA 1VKCA 2B4DA 5E96A 1YR0A 3H4QA 1IYLA 3F5BA 3DSBA 2REFA 2CNSA 4QVTA 3F0AA 2ZPAA 2VI7A 2JDCA 3FBUA 4R3LA 4XPLA 3LD2A 5J8CA 2CY2A 4KOSA 3TOBA 4AVAA 4ORFA 1Y9KA 4QUSA 4HNXB 4HKFA 1GHEA 1NE9A 2B58A 3R9EA 4RS2A 4X5KA 2X7BA 2QECA 3TE4A 4H6UA 2AE6A 1M1DA 4IF5A 5DWMA 1L0CA 4QBJA 3R96A 4RI1A 4ONUA 3NE7A 3R9GA 3SXOA 4JXRA 2GE3A 4M85A 4NEXA 2P6EA 4XPDB 4UWIA 3TO7A 2AJ6A 2FXFA 2PR1A 1KZFA 5FVJA 1I21A 2G3AA 2WPWA 4JWPA 4PK2A 2B4BA 1WK4A 4J3GA 2HV2A 3RYOA 2FSRA 4KORA 4FD4A 4E2AA 4JJXA 2ZW6A 4Y49B 3LODA 2R8VA 2OU2A 2PC1A 1N71A 2Q0YA 4PSXA 4R57A 1QSMA 3ZZIA 3BJ8A 3PZJA 4KVOE 3TT2A 2GANA 4XPKA 1XMTA 2VBQA 4XPDC 3C26A 4U9ZA 4DNCA 3SXNA 1KUXA 2FS5A 3EY5A 4JLYA 1BOBA 3TO6A 1Z4RA 2WPXA 4AG9A 1M4DA 2FL4A 4R3KA 2ATRA 3MGDA 3SHPA 3GY9A 3UY5A 2J8NA 3VWEA 1YX0A 4CRYB 4Y49C 2PDOA 1LRZA 4QB9A 1VHSA 2JDDA 4CAXA 3I3GA 4MY3A 1S7NA 2ARHA 2D4PA 3E0KA 4F0YA 1K4JA 2B3VA 4QC6A 1M4IA 3P2HA 1M4GA 3QAHA 3D8PA 3F8KA 1R57A 3GYAA 4MHDA 1QSTA 1ON0A 3S6HA 4LX9A 2G0BA 3K9UA 4H6ZA 3ZJ0A 3S6KA 4KVME 4MI4A 1B87A 2R1IA 2Q7BA 3JUWA 2B5GB 4NF1A 1Y9WA 3T9YA 3V8IA 2BL1A 1S7LA 2C27A 2BEIA 2FT0A 3DDDA 1CJWA 1WWZA 2B4DB 4EVYA 3TCVA 1NMTA 3WR7A 2HUZA 5EBVA 2FE7A 4FD7A 3TOAA 1IIDA 2R7HA 1RXTA 4UBRA 4B5PA 4NCZA 4KLVA 4MY0A 2HQYA 3N7ZA 3PGPA 5C88A 4KZTA
chains in the Genus database with same CATH superfamily
2VZYA 1J4JA 2KCWA 1OBRA 3K2KA 4NXYA 4R6TA 4KSIA 3IGRA 1S3ZA 3SJFA 3QB8A 3FB3A 4OC1A 4PXBA 3EXNA 1CPSA 1VHOA 4OLLA 4B12A 2V8HA 2ZW7A 5IB9A 5LRJA 4M6HA 5F49A 2G3TA 2R98A 5F46A 1LAPA 5JGFA 4AVBA 1Z5RA 2PJ4A 1XRYA 4KOXA 5J8FA 1F57A 2OZGA 3EC4A 3GIUA 2C6CA 1I1DA 2VXKA 2K5TA 4CYNA 3B3CA 1I12A 4KOUA 3BXMA 2CTCA 1XEBA 4L8AA 2YNDA 1NSAA 1YREA 3D2MA 2JLMA 2ZW5A 1V0CA 1KUYA 4I49A 2NSMA 2I00A 2BOAA 3BI1A 3FIXA 1YLEA 4H2KA 5K8PA 4OP4A 5AG6A 4C68A 1IOFA 5I0CA 4E8OA 1YK3A 1FY7A 4P44A 2QYVA 1S7KA 4B5PB 5AGEA 1S5KA 5F48A 3SI0A 4GS4A 1XOVA 2JBKA 3KR4A 5LYDA 1YVKA 3FX6A 5ISVA 1Z9UA 1HDUA 2QIRA 1Z8LA 2VZZA 4BMHA 3FRMA 3TO9A 1Q2DA 3B3TA 3CDXA 3RO0A 4ZY2A 3G3SA 2Z3NA 2Q43A 1MJ9A 2PJ7A 3I1UA 1X12A 4M3SA 3W91A 3SI1A 1YQEA 3PB6X 4EWTA 3HUVA 4P4IA 2PJ9A 4LUAA 2V8VA 4KSFA 3W6XA 3S9NA 1IB1E 1TF8A 2Z3PA 2ODFA 4ONWA 1PCAA 2Z3OA 2NYQA 2NMTA 3D7FA 3H8FA 4UIBA 1CM0A 2VQYA 2XEFA 3WABA 2FCKA 1TF9A 1CP6A 4JXQA 4P4BA 2Z11A 2XEJA 1ZG9A 4JD6A 4LQ6A 4YRHA 2AFWA 1FT7A 1UFHA 1VGYA 2PJAA 4CPAA 2OZHA 4KUBA 5G20A 3HLPA 3D7GA 1QMUA 5G21A 3KHXA 4M6GA 3W6SA 2PQ8A 2WZNA 3TTHA 2ABZA 4EFDA 1IY7A 2Z0ZA 4R8FA 5EC4A 2EK9A 3V38A 4DJLA 4F6AA 1Y7EA 5LRGA 3TC8A 2QMLA 4A37A 1PYTB 2QJ8A 4A33A 4A30A 1BAVA 1NSLA 3ISZA 2PJ0A 3S6FA 2PJCA 1LAMA 1PUAA 1Q2YA 4ZBGA 1MK4A 3CXQA 3H8EA 1XMBA 3PFOA 4UCMA 4UEFA 4UFVA 2BUEA 3P2FA 4CAVA 2PJ3A 4FWUA 2Z3MA 4B5OA 3NH4A 4UCPA 1QSOA 4Z65A 5JH9A 1TXRA 1P4NA 1LOKA 4L89A 2EUIA 2WSAA 2AFSA 4NGSA 4GM5A 5THWA 2PE3A 3FEEA 3I9SA 3PFEA 1Y0YA 2HB6A 4NFRA 5C82A 5KTAA 3S6GA 4YFJA 4IUSA 1HEEA 4MHNA 3B35A 4Q36A 5D29A 1ZLIA 2REEA 5HVHA 5AG5A 3GKRA 2P6GA 4MRIA 5IB0A 1ZLHA 1VHEA 2P6FA 1QQ9A 2Q51A 4KOYA 4IK2A 4KOWA 4UF4A 2GIVA 2ZW4A 3FJUA 3MRUA 1CX8A 3IU1A 3PEIA 4KUAA 4MJ8A 4TWEA 5CNPA 5HH1A 4MFJA 4AXVA 2RB7A 4CAWA 5JQ4A 5JM6A 3S9MA 3R9FA 2VL1A 4FD6A 5DWNA 3WC5A 5I4MA 2O28A 4HNYB 4MHYA 1BPMA 5KTDA 3TFYA 2Q04A 4OIDA 5CBMA 1BO4A 2P0WA 5LYIA 4P4FA 2FIAA 2JEVA 3RZAA 1IOIA 1CG2A 2Q44A 4OMEA 3DNSA 2J8MA 2IQ6A 3JVNA 5K8NA 2EVNA 4KLWA 4MBUA 1A2ZA 3CPXA 3R95A 3BJ7A 5DS0A 3H8GA 3R1KA 4AG7A 2PSWA 4MFQA 4PSWA 3QNVA 3G8WA 2PCUA 2Z10A 4H89A 5CPAA 2Q7SA 2YNEA 2OB0A 4OIWA 1YVOA 4OAEA 5IX3A 1XE4A 3CXSA 4XNHB 2H5MA 3BLNA 3FEDA 4PK3A 1S7FA 2A4NA 3LWUA 4YGOA 4EMEA 4PV6A 3QAYA 1XF8A 2F5IA 2PIZA 2Q4ZA 4W9YA 1Q2CA 4CYPA 4UWJA 4CYQA 4FD5A 1IGBA 3PP9A 4CGNA 4DUKA 1EE3P 2AFMA 5A28A 1QSRA 3B3WA 3KZWA 1PU9A 1ELLP 4B6ZA 2ZENA 1XFOA 1OZPA 3CZXA 4ZY0A 3DR8A 2QVPA 2I79A 3D3SA 1RO5A 2IMOA 3SJXA 3A9LA 2RC4A 3B2YA 4R7MA 3KKWA 4K30A 4HNWB 2B3UA 2CNMA 3IWEA 1P0HA 3CT9A 4FBEA 1AYEA 3NFZA 2BSWA 4R87A 2CXAA 4II9A 3IEHA 3PB8X 4CS0B 1S60A 2D4OA 3B8GA 1XIXA 3IWGA 1YLOA 2PJBA 4FAIA 1QSNA 4U9YA 1BLLE 2GFQA 2J9AA 3LACA 2J8RA 3CXPA 3JTKA 1Z4EA 2GLFA 1KWMA 4A39A 2C6GA 4P4JA 4UA3A 4X3RA 4CRZB 2ZXVA 3PB4X 1YW6A 2ANPA 3FVLA 3VH9A 4F9UA 4XNHC 3PB9X 4KVXA 2JEWA 2PIYA 2DXQA 3B7IA 4MCQA 4R9MA 3IJ3A 4BD9A 1TKHA 5IV0A 1M44A 2PJ5A 2PR8A 4NSQA 1MJAA 3OWCA 1KUVA 3WC7A 4OC3A 2AFXA 4B13A 1F2PA 4F0XA 4C2ZA 4NGPA 2F7VA 2OH1A 5AG7A 1UWYA 4AVCA 5K8MA 3KHZA 1IYKA 2ZELA 1MJBA 1YGHA 2YNCA 5G22A 3T90A 3FYNA 5GCNA 3KQZA 3SJEA 5HMNA 1IICA 1TIQA 3KI9A 1YMEA 4E0AA 1DTDA 2Q4YA 2Y0MA 2FIWA 3NA6A 4OADA 5LYLA 1B6BA 1YW4A 5K8OA 3FNCA 3EO4A 4F8ZA 2IL4A 3VWDA 2POKA 5G1ZA 3D2PA 3FXTA 2PJ6A 1BPNA 2PRBA 4A31A 1U6MA 2ZEOA 1Z2LA 5A27A 2CF4A 2Q4VA 4WJBA 4U5YA 4KOTA 2O4HA 2OZUA 2PJ2A 4KOVA 1LFWA 4OC5A 5H86A 4R76A 1TKFA 4P10A 1H8LA 2ZEHA 2B5GA 3IO1A 4AB7A 5KTCA 5JPHA 4LQGA 5F47A 1LCPA 2VEZA 3DR6A 1XBUA 1Y7RA 4MCRA 3SJGA 1ZO0A 2CNTA 1YSJA 4OC0A 8CPAA 5H84A 1SQHA 2ZEPA 3EFAA 4CGLA 2I3CA 4MFPA 1VKCA 2WUUA 2B4DA 3GB0A 1X10A 5E96A 1YR0A 3RAMA 4C7HA 4UEEA 2EWBA 3H4QA 1IYLA 1JQGA 3F5BA 4UFXA 3S9LA 2CTBA 3DSBA 4P4DA 2REFA 3SI2A 3KASA 4B10A 2CNSA 4QVTA 3F0AA 4MFZA 5LRKA 4CGOA 3WC6A 2ZPAA 2VI7A 2JDCA 4B11A 3FBUA 4R3LA 4XPLA 3LD2A 5J8CA 2RFHA 3B3SA 2CY2A 2DEAA 4KOSA 3TOBA 1CP7A 3FH4A 3TX8A 4AVAA 5HVGA 4ORFA 1Y9KA 3GUXA 2CIJA 4QUSA 4HNXB 4HKFA 1GHEA 3D7HA 4NGQA 5HVFA 1NE9A 2B58A 3R9EA 2V8DA 4RS2A 5AG4A 1RTQA 4X5KA 4A2ZA 3GLJA 4WWVA 1R43A 4A38A 2X7BA 2QECA 4A95A 4NGTA 3TE4A 2BO9A 4JYWA 4H6UA 1VIXA 1M1DA 1ZG7A 2AE6A 4IF5A 3KL9A 2AFOA 4A94A 3CPAA 3FMCA 5DWMA 4CAEA 1DE4C 3DLJA 5D8NA 4MHPA 1L0CA 2OR4A 2DPTA 4QBJA 2DF5A 3D7DA 4MMOA 4RI1A 4ZX9A 3R96A 2Z3LA 3NH8A 4ONUA 3NE7A 3R9GA 3N5FA 1LANA 3SXOA 4JXRA 2GE3A 2PVWA 4M85A 4NEXA 4PPZA 3VARA 2EBJA 3JRUA 2P6EA 2YNCC 4ZGYB 2JBJA 4XPDB 3K9TA 2V8GA 4UWIA 3TO7A 3ISXA 3FECA 2AJ6A 3DGVA 3VATA 2FXFA 2HC9A 2ZEEA 2PR1A 4RUHA 4NJRA 5ELYA 1CPXA 4PXDA 1KZFA 5EMIA 3B3VA 5FVJA 1I21A 2G3AA 2WPWA 3KGQA 3H5ZA 4JWPA 4PK2A 4P4EA 4MXUA 2B4BA 2GREA 1WK4A 4J3GA 3IWWA 4O23A 2HV2A 3RYOA 2FSRA 2WYRA 4KORA 4OKOA 4FD4A 4M6IA 4E2AA 4F9VA 4JJXA 1Z8WA 2ZW6A 3PBBA 4Y49B 3LODA 1HDQA 2R8VA 2OU2A 2PC1A 1N71A 4NGRA 4MFKA 4CGMA 3MN8A 2Q0YA 4CYOA 4PSXA 3V7ZA 4R57A 1QSMA 3ZZIA 3BJ8A 3PZJA 4PXCA 4KVOE 2XEIA 3TT2A 4BINA 1ELMP 4MCSA 1Y0RA 4TNUA 2V77A 4YU9A 3PRTA 7CPAA 5J1QA 4P45A 3D66A 3NE8A 4C2XA 2GANA 3LMSA 4XPKA 2PJ1A 4OC2A 5BWAB 4FUUA 2BCOA 1XMTA 2VBQA 4XPDC 4UEZA 3C26A 4U9ZA 4ZY1A 4DYOA 4OC4A 3T8WA 1AUGA 2XEGA 3RBUA 4DNCA 3SXNA 1KUXA 2ZEMA 2O53A 3KR5A 2FS5A 2G9DA 3EY5A 4BBHA 4JLYA 4IHMA 1BOBA 2ZEDA 3TO6A 1Z4RA 2PRQA 2WPXA 4NGMA 1TKJA 4Q7AA 4AG9A 1ZG8A 1M4DA 2FL4A 4R3KA 4NGNA 2ATRA 3MGDA 4Q38A 1ARLA 3GY9A 3SHPA 3UY5A 2J8NA 4X8IA 4C2YA 5F09A 3VWEA 1YX0A 3D4UA 4CRYB 4Y49C 4ZYQA 2PDOA 3IFEA 4B14A 1LRZA 3BI0A 3NH5A 2DPSA 4KS9A 4QB9A 4YWYA 3KQXA 3RNZA 1VHSA 2JDDA 4IAVA 3I3GA 4MY3A 1S7NA 4CAXA 2ARHA 2OOTA 4CAFA 2D4PA 3E0KA 4F0YA 1JWQA 1K4JA 2B3VA 2Z3KA 4MCPA 1CBXA 4CGPA 4QC6A 4UFWA 2EK8A 3IC1A 5LYFA 3FF3A 1GYTA 4MHZA 1M4IA 3P2HA 1M4GA 3PB7X 6CPAA 2ZOGA 3QAHA 4UCNA 3D8PA 3F8KA 1F2OA 1R57A 3GYAA 4MHDA 4P6YA 1QSTA 4MFLA 1ON0A 1AMPA 3S6HA 4LX9A 2G0BA 3K9UA 2C1CA 4H6ZA 2EO8A 2ZEGA 3ZJ0A 4ZX8A 2PVVA 4KVME 3S6KA 4MI4A 2ZOFA 1B87A 2R1IA 2ZEFA 4KSAA 4X2TA 2Q7BA 5HXDA 1Z8XA 2GU2A 1Z8TA 2B5GB 3JUWA 3WT4A 4NF1A 4ZI6A 2GLJA 1XJOA 1Y9WA 3T9YA 3BHXA 1FNOA 3L2NA 2BL1A 3V8IA 2YGWA 1S7LA 4G1PA 2C27A 2BEIA 2AFZA 4UIAA 2FT0A 3PBEA 4NJQA 3DDDA 1CJWA 2PJ8A 1WWZA 3IIBA 2B4DB 4EVYA 3TCVA 1M4LA 1NMTA 2AFUA 4PXEA 3WR7A 3D68A 1Q7LA 2FVGA 2F8HA 2HUZA 4PQAA 5EBVA 2C6PA 2FE7A 3D67A 2IJZA 4K3NA 4FD7A 4JZ0A 4HPSA 3TOAA 1IIDA 4C7IA 2R7HA 1IU8A 1RXTA 1R3NA 4RN7A 4UBRA 3IU2A 4NCZA 4KLVA 4B5PA 4MY0A 2HQYA 3N7ZA 3PGPA 4GXHA 5C88A 4A32A 1ARMA 4KZTA
chains in the Genus database with same CATH topology
2VZYA 1J4JA 2KCWA 4NXYA 3IGRA 1S3ZA 3QB8A 3FB3A 3EXNA 4OLLA 4B12A 2ZW7A 5F49A 2G3TA 2R98A 5F46A 4AVBA 4KOXA 5J8FA 2OZGA 3EC4A 1I1DA 2VXKA 2K5TA 4CYNA 1I12A 4KOUA 1XEBA 4L8AA 2YNDA 1YREA 3D2MA 2JLMA 2ZW5A 1V0CA 1KUYA 4I49A 2I00A 3FIXA 1YLEA 5AG6A 4C68A 5I0CA 4E8OA 1YK3A 1FY7A 1S7KA 4B5PB 5AGEA 1S5KA 5F48A 4GS4A 1YVKA 5ISVA 1Z9UA 2QIRA 2VZZA 4BMHA 3FRMA 3TO9A 1Q2DA 3G3SA 2Z3NA 1MJ9A 4M3SA 3W91A 4LUAA 4KSFA 3W6XA 1IB1E 2Z3PA 2Z3OA 2NMTA 1CM0A 2VQYA 2FCKA 4JXQA 2Z11A 4JD6A 4YRHA 1UFHA 2OZHA 4KUBA 5G20A 3W6SA 5G21A 2PQ8A 3TTHA 2Z0ZA 5EC4A 4F6AA 2QMLA 4A33A 4A30A 1NSLA 3S6FA 1PUAA 1Q2YA 4ZBGA 1MK4A 3CXQA 4UCMA 4UFVA 2BUEA 3P2FA 4CAVA 2Z3MA 4B5OA 4UCPA 1QSOA 1P4NA 4L89A 2EUIA 2WSAA 3I9SA 5C82A 5KTAA 3S6GA 4YFJA 4IUSA 4Q36A 2REEA 5AG5A 3GKRA 2P6GA 5IB0A 2P6FA 4KOYA 4KOWA 2GIVA 2ZW4A 4KUAA 3IU1A 5HH1A 4MJ8A 5CNPA 4MFJA 4CAWA 5JQ4A 3R9FA 5DWNA 4FD6A 2O28A 4HNYB 5KTDA 3TFYA 2Q04A 1BO4A 2P0WA 2FIAA 2JEVA 2Q44A 3DNSA 2J8MA 3JVNA 2EVNA 4KLWA 4MBUA 3R95A 3BJ7A 3R1KA 4AG7A 2PSWA 4MFQA 4PSWA 3G8WA 2Z10A 4H89A 2YNEA 2OB0A 1YVOA 4OAEA 5IX3A 1XE4A 3CXSA 4XNHB 2H5MA 3BLNA 4PK3A 1S7FA 2A4NA 4YGOA 4PV6A 1XF8A 2F5IA 1Q2CA 4CYPA 4UWJA 4CYQA 4FD5A 3PP9A 4CGNA 5A28A 1QSRA 1PU9A 1OZPA 3DR8A 2I79A 3D3SA 1RO5A 3A9LA 2RC4A 3KKWA 4K30A 4HNWB 2B3UA 2CNMA 3IWEA 1P0HA 2BSWA 4R87A 2CXAA 4II9A 4CS0B 1S60A 2D4OA 3B8GA 1XIXA 3IWGA 1QSNA 4U9YA 2J8RA 3CXPA 3JTKA 1Z4EA 4UA3A 4CRZB 2ZXVA 4XNHC 4KVXA 2DXQA 5IV0A 4R9MA 1M44A 2PR8A 4NSQA 1MJAA 3OWCA 1KUVA 4B13A 4F0XA 4C2ZA 2OH1A 5AG7A 4AVCA 1IYKA 1MJBA 1YGHA 2YNCA 5G22A 3T90A 3FYNA 5GCNA 5HMNA 1IICA 1TIQA 4E0AA 2Q4YA 2Y0MA 2FIWA 4OADA 1B6BA 3FNCA 3EO4A 2IL4A 3VWDA 5G1ZA 3D2PA 3FXTA 4A31A 5A27A 2PRBA 1U6MA 2Q4VA 4U5YA 4KOTA 2OZUA 4KOVA 5H86A 2B5GA 4AB7A 5KTCA 5JPHA 5F47A 2VEZA 3DR6A 1Y7RA 1ZO0A 2CNTA 5H84A 1SQHA 3EFAA 4CGLA 4MFPA 1VKCA 2WUUA 2B4DA 5E96A 1YR0A 4C7HA 3H4QA 1IYLA 3F5BA 4UFXA 3DSBA 2REFA 4B10A 2CNSA 4QVTA 3F0AA 4MFZA 4CGOA 2ZPAA 2VI7A 2JDCA 4B11A 3FBUA 4R3LA 4XPLA 3LD2A 5J8CA 2CY2A 4KOSA 3TOBA 4AVAA 4ORFA 1Y9KA 4QUSA 4HNXB 4HKFA 1GHEA 1NE9A 2B58A 3R9EA 5AG4A 4RS2A 4X5KA 4A2ZA 2X7BA 2QECA 4A95A 3TE4A 4H6UA 2AE6A 1M1DA 4IF5A 5DWMA 4CAEA 1L0CA 2DPTA 4QBJA 3R96A 4RI1A 2Z3LA 4ONUA 3NE7A 3R9GA 3SXOA 4JXRA 2GE3A 4M85A 4NEXA 2P6EA 2YNCC 4ZGYB 4XPDB 4UWIA 3TO7A 2AJ6A 2FXFA 2PR1A 1KZFA 5FVJA 1I21A 2G3AA 2WPWA 3H5ZA 4JWPA 4PK2A 2B4BA 1WK4A 4J3GA 2HV2A 3RYOA 2FSRA 4KORA 4FD4A 4E2AA 4JJXA 2ZW6A 4Y49B 3LODA 2R8VA 2OU2A 2PC1A 1N71A 4CGMA 4MFKA 2Q0YA 4CYOA 4PSXA 4R57A 1QSMA 3ZZIA 3BJ8A 3PZJA 4KVOE 3TT2A 4C2XA 2GANA 4XPKA 5BWAB 1XMTA 2VBQA 4XPDC 3C26A 4U9ZA 4DNCA 3SXNA 1KUXA 2FS5A 3EY5A 4BBHA 4JLYA 1BOBA 3TO6A 1Z4RA 2WPXA 4AG9A 1M4DA 2FL4A 4R3KA 2ATRA 3MGDA 4Q38A 3SHPA 3GY9A 3UY5A 2J8NA 4C2YA 3VWEA 1YX0A 4CRYB 4Y49C 2PDOA 4B14A 1LRZA 2DPSA 4KS9A 4QB9A 1VHSA 2JDDA 4CAXA 3I3GA 4MY3A 1S7NA 2ARHA 4CAFA 2D4PA 3E0KA 4F0YA 1K4JA 2B3VA 2Z3KA 4CGPA 4QC6A 4UFWA 1M4IA 3P2HA 1M4GA 3QAHA 4UCNA 3D8PA 3F8KA 1R57A 3GYAA 4MHDA 1QSTA 4MFLA 1ON0A 3S6HA 4LX9A 2G0BA 3K9UA 4H6ZA 3ZJ0A 3S6KA 4KVME 4MI4A 1B87A 2R1IA 4KSAA 2Q7BA 3JUWA 2B5GB 4NF1A 1Y9WA 3T9YA 3V8IA 2BL1A 2YGWA 1S7LA 2C27A 2BEIA 2FT0A 3DDDA 1CJWA 1WWZA 2B4DB 4EVYA 3TCVA 1NMTA 3WR7A 2HUZA 5EBVA 2FE7A 4FD7A 3TOAA 1IIDA 4C7IA 2R7HA 1RXTA 4UBRA 4B5PA 3IU2A 4NCZA 4KLVA 4MY0A 2HQYA 3N7ZA 3PGPA 5C88A 4A32A 4KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZY A;  1J4J A;  2KCW A;  4NXY A;  3IGR A;  1S3Z A;  3QB8 A;  3FB3 A;  3EXN A;  4OLL A;  2ZW7 A;  5F49 A;  2G3T A;  2R98 A;  5F46 A;  4AVB A;  4KOX A;  5J8F A;  2OZG A;  3EC4 A;  1I1D A;  2VXK A;  2K5T A;  1I12 A;  4KOU A;  1XEB A;  4L8A A;  1YRE A;  3D2M A;  2JLM A;  2ZW5 A;  1V0C A;  1KUY A;  4I49 A;  2I00 A;  3FIX A;  1YLE A;  5I0C A;  4E8O A;  1YK3 A;  1FY7 A;  1S7K A;  4B5P B;  1S5K A;  5F48 A;  4GS4 A;  1YVK A;  5ISV A;  1Z9U A;  2QIR A;  2VZZ A;  4BMH A;  3FRM A;  3TO9 A;  1Q2D A;  3G3S A;  1MJ9 A;  4M3S A;  3W91 A;  4LUA A;  3W6X A;  1IB1 E;  2NMT A;  1CM0 A;  2VQY A;  2FCK A;  4JXQ A;  2Z11 A;  4JD6 A;  4YRH A;  1UFH A;  2OZH A;  4KUB A;  3W6S A;  2PQ8 A;  3TTH A;  2Z0Z A;  5EC4 A;  4F6A A;  2QML A;  1NSL A;  3S6F A;  1PUA A;  1Q2Y A;  4ZBG A;  1MK4 A;  3CXQ A;  2BUE A;  3P2F A;  4CAV A;  4B5O A;  1QSO A;  1P4N A;  4L89 A;  2EUI A;  3I9S A;  5C82 A;  5KTA A;  3S6G A;  4YFJ A;  4IUS A;  2REE A;  3GKR A;  2P6G A;  5IB0 A;  2P6F A;  4KOY A;  4KOW A;  2GIV A;  2ZW4 A;  4KUA A;  5HH1 A;  4MJ8 A;  5CNP A;  4CAW A;  5JQ4 A;  3R9F A;  5DWN A;  4FD6 A;  2O28 A;  4HNY B;  5KTD A;  3TFY A;  2Q04 A;  1BO4 A;  2P0W A;  2FIA A;  2JEV A;  2Q44 A;  3DNS A;  2J8M A;  3JVN A;  2EVN A;  4KLW A;  4MBU A;  3R95 A;  3BJ7 A;  3R1K A;  4AG7 A;  2PSW A;  4PSW A;  3G8W A;  2Z10 A;  4H89 A;  2OB0 A;  1YVO A;  4OAE A;  5IX3 A;  1XE4 A;  3CXS A;  4XNH B;  2H5M A;  3BLN A;  4PK3 A;  1S7F A;  2A4N A;  4YGO A;  4PV6 A;  1XF8 A;  2F5I A;  1Q2C A;  4UWJ A;  4FD5 A;  3PP9 A;  1QSR A;  1PU9 A;  1OZP A;  3DR8 A;  2I79 A;  3D3S A;  1RO5 A;  2RC4 A;  3KKW A;  4K30 A;  4HNW B;  2B3U A;  2CNM A;  1P0H A;  2BSW A;  4R87 A;  4II9 A;  4CS0 B;  1S60 A;  2D4O A;  3B8G A;  1XIX A;  3IWG A;  1QSN A;  4U9Y A;  2J8R A;  3CXP A;  1Z4E A;  4UA3 A;  4CRZ B;  2ZXV A;  4XNH C;  4KVX A;  2DXQ A;  5IV0 A;  4R9M A;  1M44 A;  2PR8 A;  4NSQ A;  1MJA A;  3OWC A;  1KUV A;  2OH1 A;  4AVC A;  1IYK A;  1MJB A;  1YGH A;  3T90 A;  3FYN A;  5GCN A;  5HMN A;  1IIC A;  1TIQ A;  4E0A A;  2Q4Y A;  2Y0M A;  2FIW A;  4OAD A;  1B6B A;  3FNC A;  3EO4 A;  2IL4 A;  3VWD A;  3D2P A;  3FXT A;  2PRB A;  1U6M A;  2Q4V A;  4U5Y A;  4KOT A;  2OZU A;  4KOV A;  5H86 A;  2B5G A;  4AB7 A;  5KTC A;  5JPH A;  5F47 A;  2VEZ A;  3DR6 A;  1Y7R A;  2CNT A;  5H84 A;  1SQH A;  3EFA A;  1VKC A;  2B4D A;  5E96 A;  1YR0 A;  3H4Q A;  1IYL A;  3F5B A;  3DSB A;  2REF A;  2CNS A;  4QVT A;  3F0A A;  2ZPA A;  2VI7 A;  2JDC A;  3FBU A;  4R3L A;  4XPL A;  3LD2 A;  5J8C A;  2CY2 A;  4KOS A;  3TOB A;  4AVA A;  4ORF A;  1Y9K A;  4QUS A;  4HNX B;  4HKF A;  1GHE A;  1NE9 A;  2B58 A;  3R9E A;  4RS2 A;  4X5K A;  2X7B A;  2QEC A;  3TE4 A;  4H6U A;  2AE6 A;  1M1D A;  4IF5 A;  5DWM A;  1L0C A;  4QBJ A;  3R96 A;  4RI1 A;  4ONU A;  3NE7 A;  3R9G A;  3SXO A;  4JXR A;  2GE3 A;  4M85 A;  4NEX A;  2P6E A;  4XPD B;  4UWI A;  3TO7 A;  2AJ6 A;  2FXF A;  2PR1 A;  1KZF A;  5FVJ A;  1I21 A;  2G3A A;  2WPW A;  4JWP A;  4PK2 A;  2B4B A;  1WK4 A;  4J3G A;  2HV2 A;  3RYO A;  2FSR A;  4KOR A;  4FD4 A;  4E2A A;  4JJX A;  2ZW6 A;  4Y49 B;  3LOD A;  2R8V A;  2OU2 A;  2PC1 A;  1N71 A;  2Q0Y A;  4PSX A;  4R57 A;  1QSM A;  3ZZI A;  3BJ8 A;  3PZJ A;  4KVO E;  3TT2 A;  2GAN A;  4XPK A;  1XMT A;  2VBQ A;  4XPD C;  3C26 A;  4U9Z A;  4DNC A;  3SXN A;  1KUX A;  2FS5 A;  3EY5 A;  4JLY A;  1BOB A;  3TO6 A;  1Z4R A;  2WPX A;  4AG9 A;  1M4D A;  2FL4 A;  4R3K A;  2ATR A;  3MGD A;  3SHP A;  3GY9 A;  3UY5 A;  2J8N A;  3VWE A;  1YX0 A;  4CRY B;  4Y49 C;  2PDO A;  1LRZ A;  4QB9 A;  1VHS A;  2JDD A;  4CAX A;  3I3G A;  4MY3 A;  1S7N A;  2ARH A;  2D4P A;  3E0K A;  4F0Y A;  1K4J A;  2B3V A;  4QC6 A;  1M4I A;  3P2H A;  1M4G A;  3QAH A;  3D8P A;  3F8K A;  1R57 A;  3GYA A;  4MHD A;  1QST A;  1ON0 A;  3S6H A;  4LX9 A;  2G0B A;  3K9U A;  4H6Z A;  3ZJ0 A;  3S6K A;  4KVM E;  4MI4 A;  1B87 A;  2R1I A;  2Q7B A;  3JUW A;  2B5G B;  4NF1 A;  1Y9W A;  3T9Y A;  3V8I A;  2BL1 A;  1S7L A;  2C27 A;  2BEI A;  2FT0 A;  3DDD A;  1CJW A;  1WWZ A;  2B4D B;  4EVY A;  3TCV A;  1NMT A;  3WR7 A;  2HUZ A;  5EBV A;  2FE7 A;  4FD7 A;  3TOA A;  1IID A;  2R7H A;  1RXT A;  4UBR A;  4B5P A;  4NCZ A;  4KLV A;  4MY0 A;  2HQY A;  3N7Z A;  3PGP A;  5C88 A;  4KZT A; 
#chains in the Genus database with same CATH topology
 2VZY A;  1J4J A;  2KCW A;  1OBR A;  3K2K A;  4NXY A;  4R6T A;  4KSI A;  3IGR A;  1S3Z A;  3SJF A;  3QB8 A;  3FB3 A;  4OC1 A;  4PXB A;  3EXN A;  1CPS A;  1VHO A;  4OLL A;  4B12 A;  2V8H A;  2ZW7 A;  5IB9 A;  5LRJ A;  4M6H A;  5F49 A;  2G3T A;  2R98 A;  5F46 A;  1LAP A;  5JGF A;  4AVB A;  1Z5R A;  2PJ4 A;  1XRY A;  4KOX A;  5J8F A;  1F57 A;  2OZG A;  3EC4 A;  3GIU A;  2C6C A;  1I1D A;  2VXK A;  2K5T A;  4CYN A;  3B3C A;  1I12 A;  4KOU A;  3BXM A;  2CTC A;  1XEB A;  4L8A A;  2YND A;  1NSA A;  1YRE A;  3D2M A;  2JLM A;  2ZW5 A;  1V0C A;  1KUY A;  4I49 A;  2NSM A;  2I00 A;  2BOA A;  3BI1 A;  3FIX A;  1YLE A;  4H2K A;  5K8P A;  4OP4 A;  5AG6 A;  4C68 A;  1IOF A;  5I0C A;  4E8O A;  1YK3 A;  1FY7 A;  4P44 A;  2QYV A;  1S7K A;  4B5P B;  5AGE A;  1S5K A;  5F48 A;  3SI0 A;  4GS4 A;  1XOV A;  2JBK A;  3KR4 A;  5LYD A;  1YVK A;  3FX6 A;  5ISV A;  1Z9U A;  1HDU A;  2QIR A;  1Z8L A;  2VZZ A;  4BMH A;  3FRM A;  3TO9 A;  1Q2D A;  3B3T A;  3CDX A;  3RO0 A;  4ZY2 A;  3G3S A;  2Z3N A;  2Q43 A;  1MJ9 A;  2PJ7 A;  3I1U A;  1X12 A;  4M3S A;  3W91 A;  3SI1 A;  1YQE A;  3PB6 X;  4EWT A;  3HUV A;  4P4I A;  2PJ9 A;  4LUA A;  2V8V A;  4KSF A;  3W6X A;  3S9N A;  1IB1 E;  1TF8 A;  2Z3P A;  2ODF A;  4ONW A;  1PCA A;  2Z3O A;  2NYQ A;  2NMT A;  3D7F A;  3H8F A;  4UIB A;  1CM0 A;  2VQY A;  2XEF A;  3WAB A;  2FCK A;  1TF9 A;  1CP6 A;  4JXQ A;  4P4B A;  2Z11 A;  2XEJ A;  1ZG9 A;  4JD6 A;  4LQ6 A;  4YRH A;  2AFW A;  1FT7 A;  1UFH A;  1VGY A;  2PJA A;  4CPA A;  2OZH A;  4KUB A;  5G20 A;  3HLP A;  3D7G A;  1QMU A;  5G21 A;  3KHX A;  4M6G A;  3W6S A;  2PQ8 A;  2WZN A;  3TTH A;  2ABZ A;  4EFD A;  1IY7 A;  2Z0Z A;  4R8F A;  5EC4 A;  2EK9 A;  3V38 A;  4DJL A;  4F6A A;  1Y7E A;  5LRG A;  3TC8 A;  2QML A;  4A37 A;  1PYT B;  2QJ8 A;  4A33 A;  4A30 A;  1BAV A;  1NSL A;  3ISZ A;  2PJ0 A;  3S6F A;  2PJC A;  1LAM A;  1PUA A;  1Q2Y A;  4ZBG A;  1MK4 A;  3CXQ A;  3H8E A;  1XMB A;  3PFO A;  4UCM A;  4UEF A;  4UFV A;  2BUE A;  3P2F A;  4CAV A;  2PJ3 A;  4FWU A;  2Z3M A;  4B5O A;  3NH4 A;  4UCP A;  1QSO A;  4Z65 A;  5JH9 A;  1TXR A;  1P4N A;  1LOK A;  4L89 A;  2EUI A;  2WSA A;  2AFS A;  4NGS A;  4GM5 A;  5THW A;  2PE3 A;  3FEE A;  3I9S A;  3PFE A;  1Y0Y A;  2HB6 A;  4NFR A;  5C82 A;  5KTA A;  3S6G A;  4YFJ A;  4IUS A;  1HEE A;  4MHN A;  3B35 A;  4Q36 A;  5D29 A;  1ZLI A;  2REE A;  5HVH A;  5AG5 A;  3GKR A;  2P6G A;  4MRI A;  5IB0 A;  1ZLH A;  1VHE A;  2P6F A;  1QQ9 A;  2Q51 A;  4KOY A;  4IK2 A;  4KOW A;  4UF4 A;  2GIV A;  2ZW4 A;  3FJU A;  3MRU A;  1CX8 A;  3IU1 A;  3PEI A;  4KUA A;  4MJ8 A;  4TWE A;  5CNP A;  5HH1 A;  4MFJ A;  4AXV A;  2RB7 A;  4CAW A;  5JQ4 A;  5JM6 A;  3S9M A;  3R9F A;  2VL1 A;  4FD6 A;  5DWN A;  3WC5 A;  5I4M A;  2O28 A;  4HNY B;  4MHY A;  1BPM A;  5KTD A;  3TFY A;  2Q04 A;  4OID A;  5CBM A;  1BO4 A;  2P0W A;  5LYI A;  4P4F A;  2FIA A;  2JEV A;  3RZA A;  1IOI A;  1CG2 A;  2Q44 A;  4OME A;  3DNS A;  2J8M A;  2IQ6 A;  3JVN A;  5K8N A;  2EVN A;  4KLW A;  4MBU A;  1A2Z A;  3CPX A;  3R95 A;  3BJ7 A;  5DS0 A;  3H8G A;  3R1K A;  4AG7 A;  2PSW A;  4MFQ A;  4PSW A;  3QNV A;  3G8W A;  2PCU A;  2Z10 A;  4H89 A;  5CPA A;  2Q7S A;  2YNE A;  2OB0 A;  4OIW A;  1YVO A;  4OAE A;  5IX3 A;  1XE4 A;  3CXS A;  4XNH B;  2H5M A;  3BLN A;  3FED A;  4PK3 A;  1S7F A;  2A4N A;  3LWU A;  4YGO A;  4EME A;  4PV6 A;  3QAY A;  1XF8 A;  2F5I A;  2PIZ A;  2Q4Z A;  4W9Y A;  1Q2C A;  4CYP A;  4UWJ A;  4CYQ A;  4FD5 A;  1IGB A;  3PP9 A;  4CGN A;  4DUK A;  1EE3 P;  2AFM A;  5A28 A;  1QSR A;  3B3W A;  3KZW A;  1PU9 A;  1ELL P;  4B6Z A;  2ZEN A;  1XFO A;  1OZP A;  3CZX A;  4ZY0 A;  3DR8 A;  2QVP A;  2I79 A;  3D3S A;  1RO5 A;  2IMO A;  3SJX A;  3A9L A;  2RC4 A;  3B2Y A;  4R7M A;  3KKW A;  4K30 A;  4HNW B;  2B3U A;  2CNM A;  3IWE A;  1P0H A;  3CT9 A;  4FBE A;  1AYE A;  3NFZ A;  2BSW A;  4R87 A;  2CXA A;  4II9 A;  3IEH A;  3PB8 X;  4CS0 B;  1S60 A;  2D4O A;  3B8G A;  1XIX A;  3IWG A;  1YLO A;  2PJB A;  4FAI A;  1QSN A;  4U9Y A;  1BLL E;  2GFQ A;  2J9A A;  3LAC A;  2J8R A;  3CXP A;  3JTK A;  1Z4E A;  2GLF A;  1KWM A;  4A39 A;  2C6G A;  4P4J A;  4UA3 A;  4X3R A;  4CRZ B;  2ZXV A;  3PB4 X;  1YW6 A;  2ANP A;  3FVL A;  3VH9 A;  4F9U A;  4XNH C;  3PB9 X;  4KVX A;  2JEW A;  2PIY A;  2DXQ A;  3B7I A;  4MCQ A;  4R9M A;  3IJ3 A;  4BD9 A;  1TKH A;  5IV0 A;  1M44 A;  2PJ5 A;  2PR8 A;  4NSQ A;  1MJA A;  3OWC A;  1KUV A;  3WC7 A;  4OC3 A;  2AFX A;  4B13 A;  1F2P A;  4F0X A;  4C2Z A;  4NGP A;  2F7V A;  2OH1 A;  5AG7 A;  1UWY A;  4AVC A;  5K8M A;  3KHZ A;  1IYK A;  2ZEL A;  1MJB A;  1YGH A;  2YNC A;  5G22 A;  3T90 A;  3FYN A;  5GCN A;  3KQZ A;  3SJE A;  5HMN A;  1IIC A;  1TIQ A;  3KI9 A;  1YME A;  4E0A A;  1DTD A;  2Q4Y A;  2Y0M A;  2FIW A;  3NA6 A;  4OAD A;  5LYL A;  1B6B A;  1YW4 A;  5K8O A;  3FNC A;  3EO4 A;  4F8Z A;  2IL4 A;  3VWD A;  2POK A;  5G1Z A;  3D2P A;  3FXT A;  2PJ6 A;  1BPN A;  2PRB A;  4A31 A;  1U6M A;  2ZEO A;  1Z2L A;  5A27 A;  2CF4 A;  2Q4V A;  4WJB A;  4U5Y A;  4KOT A;  2O4H A;  2OZU A;  2PJ2 A;  4KOV A;  1LFW A;  4OC5 A;  5H86 A;  4R76 A;  1TKF A;  4P10 A;  1H8L A;  2ZEH A;  2B5G A;  3IO1 A;  4AB7 A;  5KTC A;  5JPH A;  4LQG A;  5F47 A;  1LCP A;  2VEZ A;  3DR6 A;  1XBU A;  1Y7R A;  4MCR A;  3SJG A;  1ZO0 A;  2CNT A;  1YSJ A;  4OC0 A;  8CPA A;  5H84 A;  1SQH A;  2ZEP A;  3EFA A;  4CGL A;  2I3C A;  4MFP A;  1VKC A;  2WUU A;  2B4D A;  3GB0 A;  1X10 A;  5E96 A;  1YR0 A;  3RAM A;  4C7H A;  4UEE A;  2EWB A;  3H4Q A;  1IYL A;  1JQG A;  3F5B A;  4UFX A;  3S9L A;  2CTB A;  3DSB A;  4P4D A;  2REF A;  3SI2 A;  3KAS A;  4B10 A;  2CNS A;  4QVT A;  3F0A A;  4MFZ A;  5LRK A;  4CGO A;  3WC6 A;  2ZPA A;  2VI7 A;  2JDC A;  4B11 A;  3FBU A;  4R3L A;  4XPL A;  3LD2 A;  5J8C A;  2RFH A;  3B3S A;  2CY2 A;  2DEA A;  4KOS A;  3TOB A;  1CP7 A;  3FH4 A;  3TX8 A;  4AVA A;  5HVG A;  4ORF A;  1Y9K A;  3GUX A;  2CIJ A;  4QUS A;  4HNX B;  4HKF A;  1GHE A;  3D7H A;  4NGQ A;  5HVF A;  1NE9 A;  2B58 A;  3R9E A;  2V8D A;  4RS2 A;  5AG4 A;  1RTQ A;  4X5K A;  4A2Z A;  3GLJ A;  4WWV A;  1R43 A;  4A38 A;  2X7B A;  2QEC A;  4A95 A;  4NGT A;  3TE4 A;  2BO9 A;  4JYW A;  4H6U A;  1VIX A;  1M1D A;  1ZG7 A;  2AE6 A;  4IF5 A;  3KL9 A;  2AFO A;  4A94 A;  3CPA A;  3FMC A;  5DWM A;  4CAE A;  1DE4 C;  3DLJ A;  5D8N A;  4MHP A;  1L0C A;  2OR4 A;  2DPT A;  4QBJ A;  2DF5 A;  3D7D A;  4MMO A;  4RI1 A;  4ZX9 A;  3R96 A;  2Z3L A;  3NH8 A;  4ONU A;  3NE7 A;  3R9G A;  3N5F A;  1LAN A;  3SXO A;  4JXR A;  2GE3 A;  2PVW A;  4M85 A;  4NEX A;  4PPZ A;  3VAR A;  2EBJ A;  3JRU A;  2P6E A;  2YNC C;  4ZGY B;  2JBJ A;  4XPD B;  3K9T A;  2V8G A;  4UWI A;  3TO7 A;  3ISX A;  3FEC A;  2AJ6 A;  3DGV A;  3VAT A;  2FXF A;  2HC9 A;  2ZEE A;  2PR1 A;  4RUH A;  4NJR A;  5ELY A;  1CPX A;  4PXD A;  1KZF A;  5EMI A;  3B3V A;  5FVJ A;  1I21 A;  2G3A A;  2WPW A;  3KGQ A;  3H5Z A;  4JWP A;  4PK2 A;  4P4E A;  4MXU A;  2B4B A;  2GRE A;  1WK4 A;  4J3G A;  3IWW A;  4O23 A;  2HV2 A;  3RYO A;  2FSR A;  2WYR A;  4KOR A;  4OKO A;  4FD4 A;  4M6I A;  4E2A A;  4F9V A;  4JJX A;  1Z8W A;  2ZW6 A;  3PBB A;  4Y49 B;  3LOD A;  1HDQ A;  2R8V A;  2OU2 A;  2PC1 A;  1N71 A;  4NGR A;  4MFK A;  4CGM A;  3MN8 A;  2Q0Y A;  4CYO A;  4PSX A;  3V7Z A;  4R57 A;  1QSM A;  3ZZI A;  3BJ8 A;  3PZJ A;  4PXC A;  4KVO E;  2XEI A;  3TT2 A;  4BIN A;  1ELM P;  4MCS A;  1Y0R A;  4TNU A;  2V77 A;  4YU9 A;  3PRT A;  7CPA A;  5J1Q A;  4P45 A;  3D66 A;  3NE8 A;  4C2X A;  2GAN A;  3LMS A;  4XPK A;  2PJ1 A;  4OC2 A;  5BWA B;  4FUU A;  2BCO A;  1XMT A;  2VBQ A;  4XPD C;  4UEZ A;  3C26 A;  4U9Z A;  4ZY1 A;  4DYO A;  4OC4 A;  3T8W A;  1AUG A;  2XEG A;  3RBU A;  4DNC A;  3SXN A;  1KUX A;  2ZEM A;  2O53 A;  3KR5 A;  2FS5 A;  2G9D A;  3EY5 A;  4BBH A;  4JLY A;  4IHM A;  1BOB A;  2ZED A;  3TO6 A;  1Z4R A;  2PRQ A;  2WPX A;  4NGM A;  1TKJ A;  4Q7A A;  4AG9 A;  1ZG8 A;  1M4D A;  2FL4 A;  4R3K A;  4NGN A;  2ATR A;  3MGD A;  4Q38 A;  1ARL A;  3GY9 A;  3SHP A;  3UY5 A;  2J8N A;  4X8I A;  4C2Y A;  5F09 A;  3VWE A;  1YX0 A;  3D4U A;  4CRY B;  4Y49 C;  4ZYQ A;  2PDO A;  3IFE A;  4B14 A;  1LRZ A;  3BI0 A;  3NH5 A;  2DPS A;  4KS9 A;  4QB9 A;  4YWY A;  3KQX A;  3RNZ A;  1VHS A;  2JDD A;  4IAV A;  3I3G A;  4MY3 A;  1S7N A;  4CAX A;  2ARH A;  2OOT A;  4CAF A;  2D4P A;  3E0K A;  4F0Y A;  1JWQ A;  1K4J A;  2B3V A;  2Z3K A;  4MCP A;  1CBX A;  4CGP A;  4QC6 A;  4UFW A;  2EK8 A;  3IC1 A;  5LYF A;  3FF3 A;  1GYT A;  4MHZ A;  1M4I A;  3P2H A;  1M4G A;  3PB7 X;  6CPA A;  2ZOG A;  3QAH A;  4UCN A;  3D8P A;  3F8K A;  1F2O A;  1R57 A;  3GYA A;  4MHD A;  4P6Y A;  1QST A;  4MFL A;  1ON0 A;  1AMP A;  3S6H A;  4LX9 A;  2G0B A;  3K9U A;  2C1C A;  4H6Z A;  2EO8 A;  2ZEG A;  3ZJ0 A;  4ZX8 A;  2PVV A;  4KVM E;  3S6K A;  4MI4 A;  2ZOF A;  1B87 A;  2R1I A;  2ZEF A;  4KSA A;  4X2T A;  2Q7B A;  5HXD A;  1Z8X A;  2GU2 A;  1Z8T A;  2B5G B;  3JUW A;  3WT4 A;  4NF1 A;  4ZI6 A;  2GLJ A;  1XJO A;  1Y9W A;  3T9Y A;  3BHX A;  1FNO A;  3L2N A;  2BL1 A;  3V8I A;  2YGW A;  1S7L A;  4G1P A;  2C27 A;  2BEI A;  2AFZ A;  4UIA A;  2FT0 A;  3PBE A;  4NJQ A;  3DDD A;  1CJW A;  2PJ8 A;  1WWZ A;  3IIB A;  2B4D B;  4EVY A;  3TCV A;  1M4L A;  1NMT A;  2AFU A;  4PXE A;  3WR7 A;  3D68 A;  1Q7L A;  2FVG A;  2F8H A;  2HUZ A;  4PQA A;  5EBV A;  2C6P A;  2FE7 A;  3D67 A;  2IJZ A;  4K3N A;  4FD7 A;  4JZ0 A;  4HPS A;  3TOA A;  1IID A;  4C7I A;  2R7H A;  1IU8 A;  1RXT A;  1R3N A;  4RN7 A;  4UBR A;  3IU2 A;  4NCZ A;  4KLV A;  4B5P A;  4MY0 A;  2HQY A;  3N7Z A;  3PGP A;  4GXH A;  5C88 A;  4A32 A;  1ARM A;  4KZT A; 
#chains in the Genus database with same CATH homology
 2VZY A;  1J4J A;  2KCW A;  4NXY A;  3IGR A;  1S3Z A;  3QB8 A;  3FB3 A;  3EXN A;  4OLL A;  4B12 A;  2ZW7 A;  5F49 A;  2G3T A;  2R98 A;  5F46 A;  4AVB A;  4KOX A;  5J8F A;  2OZG A;  3EC4 A;  1I1D A;  2VXK A;  2K5T A;  4CYN A;  1I12 A;  4KOU A;  1XEB A;  4L8A A;  2YND A;  1YRE A;  3D2M A;  2JLM A;  2ZW5 A;  1V0C A;  1KUY A;  4I49 A;  2I00 A;  3FIX A;  1YLE A;  5AG6 A;  4C68 A;  5I0C A;  4E8O A;  1YK3 A;  1FY7 A;  1S7K A;  4B5P B;  5AGE A;  1S5K A;  5F48 A;  4GS4 A;  1YVK A;  5ISV A;  1Z9U A;  2QIR A;  2VZZ A;  4BMH A;  3FRM A;  3TO9 A;  1Q2D A;  3G3S A;  2Z3N A;  1MJ9 A;  4M3S A;  3W91 A;  4LUA A;  4KSF A;  3W6X A;  1IB1 E;  2Z3P A;  2Z3O A;  2NMT A;  1CM0 A;  2VQY A;  2FCK A;  4JXQ A;  2Z11 A;  4JD6 A;  4YRH A;  1UFH A;  2OZH A;  4KUB A;  5G20 A;  3W6S A;  5G21 A;  2PQ8 A;  3TTH A;  2Z0Z A;  5EC4 A;  4F6A A;  2QML A;  4A33 A;  4A30 A;  1NSL A;  3S6F A;  1PUA A;  1Q2Y A;  4ZBG A;  1MK4 A;  3CXQ A;  4UCM A;  4UFV A;  2BUE A;  3P2F A;  4CAV A;  2Z3M A;  4B5O A;  4UCP A;  1QSO A;  1P4N A;  4L89 A;  2EUI A;  2WSA A;  3I9S A;  5C82 A;  5KTA A;  3S6G A;  4YFJ A;  4IUS A;  4Q36 A;  2REE A;  5AG5 A;  3GKR A;  2P6G A;  5IB0 A;  2P6F A;  4KOY A;  4KOW A;  2GIV A;  2ZW4 A;  4KUA A;  3IU1 A;  5HH1 A;  4MJ8 A;  5CNP A;  4MFJ A;  4CAW A;  5JQ4 A;  3R9F A;  5DWN A;  4FD6 A;  2O28 A;  4HNY B;  5KTD A;  3TFY A;  2Q04 A;  1BO4 A;  2P0W A;  2FIA A;  2JEV A;  2Q44 A;  3DNS A;  2J8M A;  3JVN A;  2EVN A;  4KLW A;  4MBU A;  3R95 A;  3BJ7 A;  3R1K A;  4AG7 A;  2PSW A;  4MFQ A;  4PSW A;  3G8W A;  2Z10 A;  4H89 A;  2YNE A;  2OB0 A;  1YVO A;  4OAE A;  5IX3 A;  1XE4 A;  3CXS A;  4XNH B;  2H5M A;  3BLN A;  4PK3 A;  1S7F A;  2A4N A;  4YGO A;  4PV6 A;  1XF8 A;  2F5I A;  1Q2C A;  4CYP A;  4UWJ A;  4CYQ A;  4FD5 A;  3PP9 A;  4CGN A;  5A28 A;  1QSR A;  1PU9 A;  1OZP A;  3DR8 A;  2I79 A;  3D3S A;  1RO5 A;  3A9L A;  2RC4 A;  3KKW A;  4K30 A;  4HNW B;  2B3U A;  2CNM A;  3IWE A;  1P0H A;  2BSW A;  4R87 A;  2CXA A;  4II9 A;  4CS0 B;  1S60 A;  2D4O A;  3B8G A;  1XIX A;  3IWG A;  1QSN A;  4U9Y A;  2J8R A;  3CXP A;  3JTK A;  1Z4E A;  4UA3 A;  4CRZ B;  2ZXV A;  4XNH C;  4KVX A;  2DXQ A;  5IV0 A;  4R9M A;  1M44 A;  2PR8 A;  4NSQ A;  1MJA A;  3OWC A;  1KUV A;  4B13 A;  4F0X A;  4C2Z A;  2OH1 A;  5AG7 A;  4AVC A;  1IYK A;  1MJB A;  1YGH A;  2YNC A;  5G22 A;  3T90 A;  3FYN A;  5GCN A;  5HMN A;  1IIC A;  1TIQ A;  4E0A A;  2Q4Y A;  2Y0M A;  2FIW A;  4OAD A;  1B6B A;  3FNC A;  3EO4 A;  2IL4 A;  3VWD A;  5G1Z A;  3D2P A;  3FXT A;  4A31 A;  5A27 A;  2PRB A;  1U6M A;  2Q4V A;  4U5Y A;  4KOT A;  2OZU A;  4KOV A;  5H86 A;  2B5G A;  4AB7 A;  5KTC A;  5JPH A;  5F47 A;  2VEZ A;  3DR6 A;  1Y7R A;  1ZO0 A;  2CNT A;  5H84 A;  1SQH A;  3EFA A;  4CGL A;  4MFP A;  1VKC A;  2WUU A;  2B4D A;  5E96 A;  1YR0 A;  4C7H A;  3H4Q A;  1IYL A;  3F5B A;  4UFX A;  3DSB A;  2REF A;  4B10 A;  2CNS A;  4QVT A;  3F0A A;  4MFZ A;  4CGO A;  2ZPA A;  2VI7 A;  2JDC A;  4B11 A;  3FBU A;  4R3L A;  4XPL A;  3LD2 A;  5J8C A;  2CY2 A;  4KOS A;  3TOB A;  4AVA A;  4ORF A;  1Y9K A;  4QUS A;  4HNX B;  4HKF A;  1GHE A;  1NE9 A;  2B58 A;  3R9E A;  5AG4 A;  4RS2 A;  4X5K A;  4A2Z A;  2X7B A;  2QEC A;  4A95 A;  3TE4 A;  4H6U A;  2AE6 A;  1M1D A;  4IF5 A;  5DWM A;  4CAE A;  1L0C A;  2DPT A;  4QBJ A;  3R96 A;  4RI1 A;  2Z3L A;  4ONU A;  3NE7 A;  3R9G A;  3SXO A;  4JXR A;  2GE3 A;  4M85 A;  4NEX A;  2P6E A;  2YNC C;  4ZGY B;  4XPD B;  4UWI A;  3TO7 A;  2AJ6 A;  2FXF A;  2PR1 A;  1KZF A;  5FVJ A;  1I21 A;  2G3A A;  2WPW A;  3H5Z A;  4JWP A;  4PK2 A;  2B4B A;  1WK4 A;  4J3G A;  2HV2 A;  3RYO A;  2FSR A;  4KOR A;  4FD4 A;  4E2A A;  4JJX A;  2ZW6 A;  4Y49 B;  3LOD A;  2R8V A;  2OU2 A;  2PC1 A;  1N71 A;  4CGM A;  4MFK A;  2Q0Y A;  4CYO A;  4PSX A;  4R57 A;  1QSM A;  3ZZI A;  3BJ8 A;  3PZJ A;  4KVO E;  3TT2 A;  4C2X A;  2GAN A;  4XPK A;  5BWA B;  1XMT A;  2VBQ A;  4XPD C;  3C26 A;  4U9Z A;  4DNC A;  3SXN A;  1KUX A;  2FS5 A;  3EY5 A;  4BBH A;  4JLY A;  1BOB A;  3TO6 A;  1Z4R A;  2WPX A;  4AG9 A;  1M4D A;  2FL4 A;  4R3K A;  2ATR A;  3MGD A;  4Q38 A;  3SHP A;  3GY9 A;  3UY5 A;  2J8N A;  4C2Y A;  3VWE A;  1YX0 A;  4CRY B;  4Y49 C;  2PDO A;  4B14 A;  1LRZ A;  2DPS A;  4KS9 A;  4QB9 A;  1VHS A;  2JDD A;  4CAX A;  3I3G A;  4MY3 A;  1S7N A;  2ARH A;  4CAF A;  2D4P A;  3E0K A;  4F0Y A;  1K4J A;  2B3V A;  2Z3K A;  4CGP A;  4QC6 A;  4UFW A;  1M4I A;  3P2H A;  1M4G A;  3QAH A;  4UCN A;  3D8P A;  3F8K A;  1R57 A;  3GYA A;  4MHD A;  1QST A;  4MFL A;  1ON0 A;  3S6H A;  4LX9 A;  2G0B A;  3K9U A;  4H6Z A;  3ZJ0 A;  3S6K A;  4KVM E;  4MI4 A;  1B87 A;  2R1I A;  4KSA A;  2Q7B A;  3JUW A;  2B5G B;  4NF1 A;  1Y9W A;  3T9Y A;  3V8I A;  2BL1 A;  2YGW A;  1S7L A;  2C27 A;  2BEI A;  2FT0 A;  3DDD A;  1CJW A;  1WWZ A;  2B4D B;  4EVY A;  3TCV A;  1NMT A;  3WR7 A;  2HUZ A;  5EBV A;  2FE7 A;  4FD7 A;  3TOA A;  1IID A;  4C7I A;  2R7H A;  1RXT A;  4UBR A;  4B5P A;  3IU2 A;  4NCZ A;  4KLV A;  4MY0 A;  2HQY A;  3N7Z A;  3PGP A;  5C88 A;  4A32 A;  4KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...