4XPTH

X-ray structure of drosophila dopamine transporter with subsiteb mutations d121g/s426m and el2 deletion of 162-201 in complex with substrate analogue 3,4 dichlorophen ethylamine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
b'EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport/inhibitor
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptH01
1CZ8L 1QLRA 5C09A 4ZO6A 1I8IB 4RGOH 1EJOL 3ARFD 3D39D 2LFGA 1HHJB 5L2KA 5K9KB 2WMPA 4YX2L 3P73B 5LXGL 4PGCA 3MFFB 3VXTB 3VMOA 5DJXA 1SYSB 4NQDB 2WBKA 3K4AA 4PV8A 4U1KB 4S1QL 3FKUS 4M62L 4RWYL 1FL3B 1HXYA 2AJYH 3HC4H 1U3HA 2CIIA 4PP2B 3V6FA 5CINL 2D7TL 4HMEA 3X17A 4AL8L 2BZDA 1GH7A 1FAIH 1TZGH 3GB7A 2I5YL 3BP7B 5EUOF 1KTRL 4ZSOA 3GSNA 4NYLB 2ICWI 4ZUTA 3M8OH 3T08A 4LMQI 4OUUB 4NN5C 1PKQE 2P8MB 4KZEL 1ITCA 3DBXA 2YHGA 5EU6B 4XC1H 1J5OH 3VGHA 3OPZH 4MS8D 4Q9CA 1LMKA 2A83A 3WN5C 4FQIL 4IMKA 4N1HB 5FYKD 3P9LB 5ANME 4NOFA 3V6OE 1TETL 3C60A 2JB6A 5B38B 4XNUH 2R4SL 1CFQB 3QDAA 2AK1H 4LCWD 5IB3B 3PQYA 2EDBA 3LQZB 4IOFC 3T3MF 4UNVA 5T3ZE 1YYML 3W82A 3P30L 1MCPH 1H3GA 3QUYD 3L5XL 2EYTB 5HHOD 5IM7A 4X9IA 1UH4A 1M71B 4P99A 1A47A 4XPFL 3WFHB 1S5IH 3DV4B 5SX5K 1D7FA 2PYEA 4AMKH 3HN3A 4JO3H 4BZ2H 1CZ8H 2D9CA 5IKCA 1EJOH 3HE6B 3LHPL 1D6EA 3O4LA 3KPNA 4YX2H 5LXGH 4HH9A 4ZOCA 4PIRF 1YDPB 5DS8A 2X9XA 2IF7A 4F3FA 1YNTB 5GRWA 3LPFA 4QXTB 1NJ9B 4S1QH 4M62H 4RWYH 3RZWA 5E4EC 2NXYB 1P7HL 2JCCF 3BN9D 2P42B 1EEZA 4XWOD 2HJKA 4Y16D 4RQQB 5CINH 2D7TH 4AL8H 5TDPB 3FQRA 2ICWA 3GZKA 2I5YH 3DGGA 4JZOA 4KAQL 1FCCA 4I4WA 2Q8BL 3S88L 2PW2A 4KZEH 3JV6B 1H3PL 2NY6C 3O3BB 4BA8A 4HBQA 3O6FA 3QA3A 5I1AB 2O5YL 5F21B 3VXUB 5BQ7A 3O9WD 4FQIH 1HI6A 5FGCE 4LHJB 3NPZB 3ARFA 1TETH 2APXA 3E2HB 3D39A 4C55A 3BHBA 4IRSC 1HEZB 2R4SH 3G6JE 3GSQB 1PKQA 3PWPD 4MCZA 1YYMH 1U2HA 4GRMA 4GRLC 2BSTA 3DETC 1N7ML 1CXHA 4GJTB 3GUTA 2CDEA 2P45B 3L5XH 5EC1A 2D7QA 2YBRA 2OZ4A 1FZOA 4XPFH 3V6OA 3K4ZA 1H15B 4JFED 3SCMD 1D9KD 4PG9A 3VH8G 4KI5C 1UVQB 3NGBC 4EDWL 2FHFA 3RY5A 3UTSE 1DEEA 4XH2B 3P4OB 4XNMA 5IHZB 3BDYL 4HFUL 3MJ6A 3DYPA 3TWCH 1GRWA 3LHPH 1OL0A 3H7BB 1XZ0A 1DQML 1U6AL 4CVWA 3N1GC 5D1ZD 4H5SB 2GSIB 4YXHL 3C5JB 1CVRA 3OAZH 4JDTL 5ESVA 4KY1L 3ARBD 3DPBA 1PYWB 3O6ML 3KYNA 1OP9A 5D7IE 1BIIA 5H2BB 4QHUA 3HCVA 3KLAB 3ULVC 1AO7B 1GCFA 5GRXG 5JA9A 3SN6N 2XXCB 5D7LD 4LCYB 5DRNB 1CD9B 5D71L 2XWBB 2EH7L 4LCWA 2NY3D 3CFCL 4HQQH 3KJ6L 1AP2A 4KAQH 1L6ZA 5TGBA 2HG5B 3QUYA 2Q8BH 3S88H 5HHOA 4DFIA 1H3PH 5F6HI 3BOVA 3MNZB 4QHLA 5ITFA 2RJMA 5DMGC 3AREB 4Z7VE 3SQBA 3B3IB 4WEMB 3ORJA 1B6DA 2ADIA 3FFDA 1OM3L 4P9HC 3IJSA 5J57B 4Q7DA 5GSVA 2HFGL 5JIPA 4HKXB 2QTEA 1N7MH 3E6HA 3DIFB 5IFAL 1A64A 1BOGB 3HAEH 5HYSG 3B6SB 4FTVB 5D6CA 2VXQL 1CLCA 4PJFA 1J0JA 3W5MA 3NN8B 3G6JA 4EDWH 1PX4A 3IJHA 4Y16A 3CDGA 4HFUH 3RI5F 3VXNA 1JGDB 2KPNA 1RK0B 2FECL 4MA1B 4EQ2A 1EBAA 1DQMH 1U6AH 3RNKA 5B39A 3RKDD 2GITA 4KRPB 3VFNB 4YXHH 1F6LL 4WI6A 4JDTH 4HKBA 4KJYA 1MJJB 4KY1H 3UTSA 1EHXA 1WCQA 4KUCD 3IAPA 3O6MH 5IV2B 4XHQA 4K07A 4L4VD 3B2VL 3FQWA 2R1WB 1XGPB 2ZCHH 4S0SD 1DLFH 5IR1B 3GRWA 3O9WA 4Z7WB 4HGWA 3MV8D 4G8IA 1IL1B 3MNWB 2YUVA 4POZC 3RX8A 1MPAL 1AKJD 5CSZB 5D71H 5JPNA 2EH7H 4JQVA 5GRVL 1KB5A 3CFCH 3PWPA 1S9XB 4D0BB 3KJ6H 1U3YA 4MDJB 3HZMB 3HNTH 1JGUL 2Y7QB 1U3HC 5DMIH 5IJVB 4GG6B 3H42L 4ZNEA 4CW1B 3VFWB 1S7TB 2DQTL 2FWOB 4XMPL 4M7LT 3MCG1 3ULUD 4JFEA 1DQJB 3SCMA 4OZHA 2NLJB 1D9KA 1LO3L 4CVXA 1W0VA 4P2OB 3DVIA 1NKOA 1MFDL 1NCBL 1B2WL 3MA7A 5CZXD 1P6AB 4WW2A 5DHXB 3CPLA 1OM3H 1H8OA 3I84A 3F65A 3IFPB 3BPCA 5DJAB 4Y2OA 1IGIL 5D1ZA 4XNXL 5IFAH 4MAYB 3G6AB 4Z7VA 3ARBA 5LKNA 4O9HL 3PWNB 3CX2A 1GL4B 1BEYL 2VXQH 5IF0B 1K85A 1CD8A 3L95A 3CUPA 4LNRB 5D7LA 3ZKXB 3NBNA 2VJXA 1H0DB 2FEDD 2QSCL 3IKCB 1MLBA 1XMWA 5SWZE 4NN6B 5LGKA 1G0YR 3MTRA 4LP5A 5I8EA 1FSKB 5DR5H 1NKRA 1P6FA 4HS8L 4LPVA 4PY7A 2EXYD 3QQ9C 2NYYD 2IPKA 4UDTB 1ZA6B 4ZPTA 3B2VH 3EYSL 1KPUB 1WF5A 4KVCL 1IE5A 2W60A 3C2AL 3CCHA 2C3WA 4MNQD 2NTFA 5IHBA 3GBLA 1MPAH 2V5RA 4BSJA 4NWTL 4M61B 1IEHA 1UWXH 3K3QA 1T0NB 3IVKB 1JGUH 4IMLB 1NBVL 3JWOC 5JNYA 4RMRA 3H42H 5DTFB 4JB9L 5HDLA 4XMPH 4M1CC 3OG4B 3T2OA 4CN4A 1P9MC 1LO3H 5T3XE 1AD0A 3UTQA 1MCFA 1MFDH 2IQ9L 4FFWD 2ARWA 1NCBH 1B2WH 1KNOB 2CKBB 1Y6NR 2GUOA 3LN5B 5CCKL 3ARGB 2XA8L 2DTML 4A6YL 1II4E 2FIKA 3HI1B 3O6FC 1T04A 4MNQE 3MRBB 5DXWA 3D5OF 5HI5D 1IGIH 3K1KC 4XNXH 4KKLD 3ARFC 4HFWA 1OHQA 4O9HH 5C9JB 4UOJA 2FJHA 1BEYH 4L4VA 2ZPKH 3UYRL 5JZ7C 5I1DB 1PZUB 4G6FD 1K8DA 4JR9L 3CDCA 2DI8A 4WVRA 3MV8A 2KDGA 1IGFL 1A7NL 3FO1A 3IDYB 3MOQA 1RJCA 2QSCH 1AKJA 2JIXD 3V6OC 1OW0A 1MCWW 4K71C 5C0IA 4MQ7B 4LAQH 5DA4A 5D2NB 5FO8A 4X7SL 3FN0L 4Z76B 5BVJA 2WBJA 4OCYL 4GT7A 5HHMB 4PR5A 3EYSH 1WC7A 1QRNE 4KVCH 3C2AH 1L9MA 2X6MA 4L4TB 5SWZA 1KG0A 1NGWA 3RBSA 2E27L 2DM3A 3AUVA 2W9LA 2AK4E 3OKKB 4P4KD 5C0CD 1TNNA 5DVMA 1RUAL 4NWTH 5CGTA 1B88A 1Q94B 1NBVH 1T0MB 3QO0A 1XT5A 5D5MB 5T33L 4JDZB 4GW5A 4YHZL 4GO6B 4M8QA 4JB9H 1LE9B 3UJIL 3LKPA 4PRID 3N9GL 1MI5E 4XPBL 1JWMB 1MCCA 5CILL 5IW3A 4MCYB 4RIRB 3UROR 2IQ9H 5JLZB 3MRHB 4WV1A 5DMKB 3QUYC 3SPVA 1JMZA 2CLVB 1G9NL 4JLRA 4WNQA 5CCKH 4GBXB 5DK0B 1VDGA 2XA8H 2DTMH 4A6YH 3S8WA 3GNML 1JRHI 1D6VL 2IH1B 4H1LG 3MROB 4UU9A 2NY1C 4H0GA 3ARRA 4Y5YB 3X14A 5KOMC 4N0UA 5FYLD 2X4RA 1A4JA 4RGNB 5BRZD 4F7MA 3GMPB 5F1IA 2CK0L 2G9HB 4KROB 3ZKMD 3IXTB 3ZO0A 5L8KB 4JR9H 4MNQA 2YA2A 2FH8A 5JW4R 1IGFH 4LSSL 4G8GB 4ZDHB 1A7NH 3WL9B 4R97C 4GKZB 3O3DA 3OXRA 1G7JB 3BN9C 3SO5A 2A6DB 4X7SH 4XWOC 3FN0H 3E3QC 4Y16C 3RL1A 5C6PB 5A16A 3SGKA 3M1BA 1J7VR 1I8LA 3MJ9L 4OCYH 4F37F 2HAZA 4OLUL 3DGCR 2XV6B 4JM2F 1T1ZA 1J11A 4HGKC 1WTGT 3ARDB 3ROLB 1JHTA 1I7TA 4ONFL 5HDQL 4UIMB 1MY7A 2Q76A 1RUAH 4LCCA 3O9WC 5T33H 4YHZH 1C12A 4PRNB 5EBWA 3UJIH 5K9OA 4XPBH 3N9GH 3WFZA 4UDUB 32C2A 5CILH 2AK4A 2CUMA 1ONQA 3VXMD 3VH8A 3T8XB 1ZLVK 2AXGB 5ALCL 5EUOB 3QH3A 4LKCA 1G9NH 2BXYA 2P44B 4MXVE 4OV5B 4F7EA 3D6GA 2QL1A 2JIXA 3MUGA 4WFHD 4X6FA 3SCMC 4KKAD 2EDWA 5H37G 3GNMH 1D9KC 1MI5A 4YXKL 2FHCA 1ES0B 5HYJB 1D6VH 3ZZ1A 5F6HJ 4Q6IA 5J89A 4OCMC 5EBLA 5E6ID 4WW2C 5GQBA 5T5NF 1NDMB 3J7HA 4QRRD 1QA9B 5JTWA 2CK0H 4JN1L 4Y5VA 5D1ZC 5IHUL 1U58B 1N5YL 4LSSH 1XF5B 4ZS6D 3KS0J 3M07A 1T80A 1LVEA 3ARBC 12E8L 4OZHF 3BISA 2EDYA 4P4KA 2HJFA 3F6LA 3GMMB 5C0CA 1T22A 2XPGA 4LLYB 1CDYA 4FMFA 1J8KA 2EIZA 4OZIB 1C7TA 3MJ9H 4XCNB 2R2BA 3QG6A 5LGJB 4OLUH 4PRIA 5I18L 1QO3B 4OKVB 4JKPL 3RAJH 5LCVL 4XXCC 3VFRA 2VDNH 4RCAA 4ONFH 3RL2A 4DGVL 2K1MA 3CK0L 1TZIB 3FO0L 4MJ6B 4H0IA 1MELA 1VFUA 3QJHA 1TPXB 2VLLA 2UUDK 1ZWIA 3U48A 1Q9LA 4LGPB 4Z7NF 1HHKA 2QSVA 3DUSB 5HYSA 2JCCB 3QUKB 2DBLL 3QWRD 5HI4C 5BRZA 1T1WB 2BSED 1F3DH 5ALCH 2DJ4A 5ALBL 2VSCA 1FZJB 5FK9A 5J3HD 4PLOB 2HFEB 3VI4E 1NCDL 4PRBB 4IIQC 5DJZB 2OSLB 4HGMA 1KBGL 1T6VN 4YXKH 1WZLA 5JORB 5HHQB 5KVFL 4X4ME 2XYCA 3BEVB 4P3DA 2CIKA 1RZGA 2E7MA 1JYWA 3AY4A 1EMTL 3I02A 4JN1H 2Y06L 3P9WB 3RKDC 5IHUH 1F58L 1XF3A 1N5YH 1LQSR 1EFXA 12E8H 5E7BA 2P24A 3V95A 4HWNA 3NIGF 1CICD 4YO0A 3CXHK 3ZDZE 3VCLA 3BT2L 4QTIL 5FKAB 1NGXB 1YMMD 1NMCB 1IILE 4D0CA 5I18H 3RJQB 3O2VL 4JKPH 3QHFL 1U3ZA 3HB3C 1FHGA 1U91B 3KG5A 2WBJC 1MWAA 5M7QA 4DGVH 3CK0H 2NR6D 2Q7YA 3FO0H 3MPCA 4I3SL 1EAPB 3ULUC 4J4PD 3TBTB 2LVCA 4WWID 1L7IL 4PTTB 3BZ4A 4OF0A 3KWWB 4DQOL 1LK2A 3HZVA 2YD6A 5F9WB 2D31A 2YD7A 5E6IA 4I0PB 1FG2A 2DBLH 2L7UA 4QRRA 1Q9WA 1QEWB 4X7DC 2NY4C 3T1FA 5ALBH 5FF6A 2EDOA 5IW1B 4F57L 3SDYL 3TYGL 4X7CC 4YDJB 4CGTA 3ULUF 3IF1A 5H8DA 4R7DB 4LCUA 4CVZA 1KBGH 4POYA 4KV5F 1NGQL 4OD2B 1CD1B 4P49A 3JZ7A 2GYSA 5ESQB 4PS4L 4WV1C 5KVFH 1OLZA 2ITCB 3LRSA 4WWKB 1MJUL 4NKQB 2NY2D 2FEDC 2YXMA 4QWWD 2B4CC 2OK0L 4PLKD 1QOKA 1EMTH 3BAEL 3SDAB 4X6DE 3K2UH 2Y06H 1F58H 3I2CL 2R1YA 5ID0B 4M7LL 3TBYB 5DQJA 1Z9MA 4MMZC 4ELKA 2HVJA 5DEGB 3SGEI 5CEYA 4B50A 3RWJB 4X4MA 2QSQA 1IAIL 4XBGB 3JV0A 1JTOA 3KPPB 5SX5H 1T7WA 3BT2H 4QTIH 5L2JB 3QWRA 3CFJA 2VSDA 2ID5A 3AAZB 3G5XA 2DF3A 2LAGB 2W65B 3K4DA 4GKSB 3QHFH 3JTTB 1PX3A 4ODXB 3TVMD 5KBNC 1CDBA 4JDVB 1CL7I 5DRXB 4WEUD 4I3SH 4G6AD 3P4MA 5MERB 2E5EA 4LLUA 1L7IH 5GGSA 1EPFA 3BIBX 4J3OC 4DK6A 4DQOH 4FFWC 5IG7B 3KPSD 3KPRD 5I71B 3V5KB 4LVHB 3RZCA 4F2MA 1EJ6A 4YDKL 4LCCC 5HI5C 4PREA 4F7PA 4M43L 1YYLL 4F57H 3SDYH 3TYGH 5C92A 2DD8L 1G6RB 4IRJB 5DQDL 5IROA 1CICA 5L2KB 2ATPA 3UBXB 3MODL 3WHXB 2ITDA 4I3RL 3QIBA 4PS4H 4PGCB 1MJUH 2Z92A 5GHWL 1YMMA 1T7YA 1CYGA 2OK0H 3MLUL 1BVLA 2EXWD 3GEWB 3S4SG 5E9DD 3SDDB 3ZE0F 3BAEH 4IJ3B 3IT8D 4HUMB 4NQVA 4TSBL 2BOBB 3I2CH 4Q6IC 3KPRE 4ODSL 4M7LH 1VENA 4NUGL 3WEXB 3F6IA 2F8XC 2NZ9C 5JO5A 5FHAL 2J8OA 4P23B 2RAMA 3KPLB 1RJYA 4GKNA 3GB7B 4J4PA 2HLFC 3QDME 3LD8B 4Y5VC 2XTJE 4HLZH 1IAIH 1XF4A 3U4BL 1N26A 4X6DA 2I9TA 4NO2B 5IMLA 2VZSA 1MIEL 1EEQA 5IK3A 3DOSA 1UKTA 3PL6D 3MR9A 4ZUTB 1FNFA 2OI9C 4P4KC 3WCYA 1YEFL 1OAZL 4NO5A 5BV7L 1FGNL 1TJHL 3TO4D 2EDJA 4JCMA 2A2QT 3CX5K 1VA9A 3SGDH 4PJ7E 2AV1A 1OLLA 5BS0D 1A9EB 2P48B 5E9DE 3C60B 3E1F1 2OMBA 3SDXF 4APQA 4RAVB 4KQ4L 4ZFFB 2NMSA 4AEIL 4N90E 2Z31B 3PABA 1CS6A 3MBEB 3NIFE 1WISA 2OTPA 3QIWD 4YDKH 2PYEB 3CFEB 3SKOB 4M43H 1YYLH 3S35X 2GEEA 2KUTA 1GVIA 5ADOL 4JHWL 3WNLA 5IKCB 5DUPL 2DD8H 1DANU 1ZTXL 5DK2A 4F15C 1DTUA 4PJHB 1JPFB 5DQDH 3BDBA 4NNPL 3O4LB 4HKJA 1IRAY 2X4SA 3GSRA 3JWDL 3ZKMC 3MODH 4MJIB 1UENA 4HH9B 4I3RH 1OTSC 1A02N 4CADB 1JV5B 2CKBL 5GHWH 3W0WD 4GQ9L 5JPMB 3MLUH 3S97C 5I1HL 43C9A 1X5ZA 1KELL 1RZFL 2CH8A 1KC5L 4ZD3L 1M4KA 5ISZD 4ZPVA 5JW4M 3B9EA 3VG9B 2VZOA 1HE7A 4ODSH 1EEZB 4O51B 4NUGH 3TVMA 4R4BB 4PBWD 4ODWB 4X4YA 2ICWB 4WW1A 1T4KB 3U4BH 1GAFL 3FQXB 3LN4A 4H88L 1RZ8A 2ED9A 5EOTB 1MIEH 3KPSA 3KPRA 4I4WB 1K2DA 2PW2B 1YEFH 1YN7B 1OAZH 1ZGLB 5BV7H 4M4PA 4YHIA 4LPXA 1I9IL 1FGNH 1TJHH 5ERWA 4HG4J 1CFNA 2C4XA 1FJ1A 1MREL 2J12B 3QDMA 3QIUB 5F88A 5BQ7B 3PWUB 3VG0L 3W0WE 1EHLL 2XY2A 1VSCA 2W91A 3ARFB 4YBQD 1T89A 3D39B 4F37K 5IVXF 3K8MA 1UXWA 1G84A 5HHXL 4MCZB 4KQ4H 4AEIH 3C5SA 3BP6A 1NAMB 4ODTL 4H25A 3DYMA 4N0CC 2CDEB 2Y9RT 5EO0A 3X12A 1AC0A 4Q6YA 3WUZA 4JM4L 1UJTA 5I6XB 5E9DA 1FH5L 1S9YA 5GS0L 1MCNA 3GJFA 4Y4FC 5E6IC 5ADOH 4JHWH 5DUPH 1BF2A 1ZTXH 4U7SA 1VFBB 1XZ0B 4NNPH 4DZBB 5EN2B 4C4KT 3JWDH 1CFSB 4X6CE 3QWQB 4YIQB 3HHRB 4NC0B 3NAAL 2CJUL 4ZS6C 1TZHA 1RFDL 2CKBH 5J13C 3PL6A 1INQA 3WYRA 4GQ9H 3CVHA 2H41A 3KPOB 1FG9C 5I1HH 2R2EB 3SE4A 3KYNB 1KELH 5I76A 1RZFH 2R29L 3RA7H 4ZD3H 3Q3GA 5AAWA 3TO4A 2HKFL 1QPPA 4HCRL 5IUSA 3RVTD 5BS0A 1T03L 3IDJA 1U8QA 4YHNB 1TMCB 2QV2A 3VD9A 4LCWB 1GAFH 3FT4B 4U0QB 2AXFB 1NC2D 3IGAA 3CZJA 2VB5A 5ACLA 4YPGA 3WKNA 5CJ8A 5HHOB 1S7WA 2Z0BA 4OCXL 1TQCC 1I9IH 3QIWA 5TF1L 5ITFB 4R96A 1MREH 1K4DA 4I3GA 4ISVB 2OXHA 4S1SL 2VH5L 3VG0H 8FABA 3GMQA 1EHLH 5B4MD 1RUPL 1JGLL 1LWRA 1W2KT 3REWA 5CZVL 1TQBC 1E28B 4JZJA 5HHXH 4CJ0A 3Q5YA 1DVFD 3ZT5A 5F9JB 4ODTH 4U05A 3E6HB 3PXHA 4JM2B 3WBDA 3W0WA 5J3HC 3CSGA 1BZ7A 3DSNA 4JM4H 5ACMA 1S7UA 1N3NB 3DXAE 3QEUA 1JE6A 1FH5H 5GGTL 5GS0H 4D0DA 3U7WL 5CP7A 1P7KB 1GIGL 4WFGE 4YR6B 3KDMB 2L0DA 5FO7A 4X8JB 4JANB 3QSKB 3H0TB 3OV6A 4OLEA 4PJDA 3VXNB 3RZCC 3ARVA 4WI7A 5JQ6H 3RNKB 2BSRB 2MKLC 4D8PA 3NAAH 2WAHA 2CJUH 3BP4A 3HZYA 4IRZL 1RFDH 4KJYB 4MB4A 4NHUA 3WD5L 4WI2A 1FC2D 3UZEA 2R29H 3C8KB 4YQXL 5JW4Q 3VW3L 1CICC 2B5IC 4YHPB 2HKFH 1VACB 2GK0A 3I9GL 4HCRH 3QIBC 1INEL 1TLKA 4U7MA 2JJSA 4HGWB 1JUFA 1IAMA 3HFML 1T03H 2VXTH 5JPNB 2VXUL 2VAAB 3PNWA 3F7YB 3GM0A 1A1MB 5FFLA 3LKNA 1VEOA 2UZYB 3V7AG 5IP4A 1MFCL 4HUNB 5ICXB 2V2TA 5IB5A 3LS4L 1CF8L 2GJZA 5F7DB 4J4PC 5FYJL 4JFEB 2OQJA 5TF1H 1VPOL 3QNXA 1JPGA 4OZHB 2Y6SD 4S1SH 2VH5H 3C6LC 3BD4A 4X0KB 3VA6A 4XVSL 2FEEL 1K5NB 2APFA 1HCVA 4P2QB 2E8YA 1JGLH 4KZDL 5CZVH 1XGUB 2PXYD 5HTSA 1XEDA 5I16B 5KN5B 1GGYA 5E03A 4YLQT 4WFFD 4M93B 2J8UF 1UB5B 5FECA 2JJWA 3P3YA 2EDTA 5T1LB 1YUHA 3TA3D 4R4ND 2PUQT 3DLQR 3V6BR 5GGTH 4Y1AB 2ARJQ 3WLWD 3U7WH 4APQC 4AJ0A 4QXUL 2DM2A 1BJ1H 4KK5C 1GIGH 2IEPA 4OLZL 3F12A 4YC2C 1NEUA 5D7LB 4QWWC 5EZIL 3H9SB 4PLKC 4BQ8A 4FQCL 1F6AA 1MNUL 2BP3A 2NY3B 3ALWA 4HUWB 4IRZH 1AD9A 5GGRA 3WD5H 2CO7B 5IBLC 4PY7B 3O8XA 3CJJA 4MA3B 3VW3H 4YQXH 4ZPTB 3ZL4L 1SBSL 2KH2B 2W60B 4A2LA 3I9GH 2C3VA 4Z9KB 1INEH 2ICES 2IH3A 3HFMH 3C6SB 2NTFB 2D0HA 4AZ8A 1Y0LB 4YGVA 4X99A 2VXUH 3TPKA 4HJGA 4OGXL 1DVFA 1MFCH 1S7VB 3RQ3A 4XNQA 3LS4H 3TVMC 4G6AC 5FYJH 4PJAF 2X89D 4QCIB 5E08L 1NFIA 3BPNB 1VPOH 4O2CA 3MUHL 5IGXL 3FCTA 4XVSH 1HN1A 4P5TD 3SDCA 3BJLA 5ID1A 4RWHA 4YDLC 1KLGA 5J8OA 4KZDH 1OGAB 3UTZA 5JHDB 2P5WE 3PHOA 4XMKL 4ACPA 5I1JL 1HHIA 2PR4L 1CCZA 1MHHB 2V5TA 1K3ZA 2HFFB 1T89C 5AYQA 4HFWB 3S4SA 4TVPD 2FJHB 4NC2B 4L4VB 1M7IB 3FFCD 4QRPD 1HHGA 4QXUH 2P8LB 1K8DB 4OLZH 3MV8B 3ILPA 1T20A 3FO1B 4Z0BL 2EXWC 5EZIH 4FQCH 5DVKA 3MYJA 3F62A 2IPUG 1MNUH 3CGTA 5C0IB 3QXWA 5IMOB 2QJDA 4EI5D 2ZOKB 3F8UB 1A9BA 1I9JL 4JY5L 4RNRA 5BVJB 4Y4KD 1OGTB 3ZL4H 1AIFA 1SBSH 1WC7B 1VCAA 1LO5A 3DVGA 1IQDA 2ZP0T 4LASL 1JZ3A 1KG0B 5D1QB 3PL6C 4U1MB 2QEJA 3SE4C 3IB4A 4QRPE 2PXYA 3TO4C 4OGXH 3EOBA 4ZFZB 1DZBA 2VR4A 1FO0B 3QO0B 4MD5B 4EUPH 1B3JA 4W6XB 3WUWA 4GW5B 4XMLL 3TA3A 3UJTL 5E08H 1JNHA 4D9RE 5IGXH 3MMEA 5F7FA 4QRSB 4YK4B 4WU7B 1JI2A 1XF1A 3ZSSA 4WNQB 3FQNA 2E6QA 4DVBB 4XMKH 5I1JH 4RMQA 4P9HL 4UZGA 2PR4H 3KXFE 4ORZC 5GIRB 4R3SA 4L5FL 4U49A 1QRKA 1DE4A 4MDIB 3T09A 4TTGA 4JZJC 4QLRA 4N0UB 2X4RB 3KYKL 5F1IB 3OL2A 1SVZA 4M6OL 1X5XA 5EU7E 4K2UL 2DMCA 3STZA 4M02A 4XPTL 4OFVA 2QQKL 4Z0BH 4F33A 4YNYB 3B9DA 2JJTC 1LD9A 3IDNA 3OXRB 4Y8AA 4MQXD 3MBXL 4KK9D 3BKYL 4OCSL 3RL1B 2VL5B 5EPMA 2YK1L 1I9JH 4JY5H 4NWUL 4OI9A 4O5LL 1AGCA 1XH3A 1LILA 2X89A 4JFYB 3QDJB 1LP9B 4XWGL 1E0OB 4U6XA 1H3WM 4LASH 4R0LA 1WZ1L 2I26N 3RWIA 1CWVA 1GGIL 3IRZA 4RFNC 1CE1L 1FV1A 4P5TA 4L8CA 3TYFA 2FZ3A 1CTOA 1PVHA 3D69B 3S5LA 4DN3L 3MJ8B 1JHTB 1I7TB 5FGSA 3QWOA 2DIAA 2ORBL 2Q86B 1OSZA 5MEOA 2JJSC 3TFKD 2GTZA 1KCSL 4YBQC 3ULSA 3UJTH 1P84K 4BZ1L 1CDHA 4W68A 4WHDA 5K9OB 32C2B 3QQ3A 4X6EB 4OSUL 3FFCA 4QRPA 1ONQB 4NZUL 5B8CB 1TXKA 2J88L 3RY4A 1IVLA 2EEAA 3C8HA 1EEUA 3HRZA 2YOCA 3RWHB 4P9HH 2QR0A 1BLNB 5HVHB 2LE9A 4EI5A 4Q6IB 4L5FH 3SKMB 3V7AE 2GT9A 1CE6B 4PJCE 3KYKH 4M6OH 4K2UH 3SDXB 4F9LA 4XPTH 1HILA 4IOIA 2QQKH 4MJ4A 1BFOB 5TDNA 3PWLA 5C0CB 5JXED 4K7PX 5TQ0L 3BKYH 1AC6A 4OCSH 1A0QL 1P5UA 4NQCB 4WRLA 1HSAA 2HH0L 3O6LL 2EIZB 2YK1H 1DDHA 4NWUH 1AR2A 4O5LH 4HLJA 2CUIA 4PRIB 1PSKL 4XWGH 2W9DL 3DHMA 1WZ1H 3EYVB 1HNFA 1GGIH 1TCRB 4I2XA 1CE1H 4PGEA 5JDSA 1U41A 3VFRB 5DVLA 5D8JL 4DN3H 3O8XC 2ORBH 2EKSA 1K3IA 5DZLA 3K74B 4I48B 3RWGA 4LLWA 1KCSH 1ZWIB 5B4MC 3JWOL 1HHKB 4BZ1H 4PGBA 1XCTB 1NBYA 4K7FB 1KJ3L 3Q5OA 3FOLA 3GSUB 1OB1A 4ZYKB 5GS1A 4OSUH 3EO1A 2EDNA 4LDEB 5BRZB 5J1AB 4NZUH 1IAOA 4LL9A 3KLHD 2J88H 2MTPA 4OBSA 2D3VA 4E9LA 5FK9B 2EZ0C 2FD6H 3U0TA 3VXOA 4P59L 2QHRL 2K9UA 3LPWA 1EGJA 4BQ6A 4Z6AT 1NUGA 3MRRA 4J3VA 2ERJC 3BJ91 4K23L 5J6HB 4N8VG 2X1WL 4LRIA 4U1HA 3SDCC 1GOGA 2IALB 3Q6FA 4P3DB 4FQXC 1QBLL 3I02B 3QCUL 5HGDA 1M7DB 3V8CA 5IVXB 1F4AA 1NAML 5E0QA 4I0CC 4EZMA 2A38A 4X5XA 2OZ4L 4YBLB 2CXKA 5TQ0H 4QF1A 1MCEA 1A0QH 2P46B 3GHEL 3O6LH 2HH0H 4PJCA 2A6JB 3PV6A 4PLNC 4GW4B 4JHZA 2YD3A 4D0CB 1PSKH 2B1AH 4UT7L 1OAXL 3H8NA 3VXMB 5JOEA 2W9DH 1TVBA 4OIBA 5LGHL 4PGJA 5KAQF 4HAGA 1QNZL 5D8JH 1UJ3A 1AGFA 4NCC2 3VD4A 4MWFA 4L9DA 2Y6SC 4UB0L 2ZSVB 2D0GA 4YZFF 3QAZB 3GI8L 3OAUH 3V0VA 5EWIL 4JFHE 3JWOH 4OV6F 1CLYL 2DWDA 1N6VA 5FYKL 5C08D 1HH6B 4P2RE 1KJ3H 4YFLI 2PXYC 3GSOB 4QRRB 5EO1A 4JRXE 4TQEH 1OSPL 5J12C 4G43B 3T1FB 5DJDB 4YWGH 4HKZB 3OXSA 4N1EA 2AJZA 4RAHA 1B90A 4O2FA 3A6CH 4OB5L 4R4NC 2QHRH 3BWAB 3ZTJH 1LDSA 1NMAL 4LCUB 1KN4L 1J88A 3WLWC 3DX9B 1RIVL 4K23H 2E8ZA 4LU5L 2CR3A 1NFDE 4YEEA 2BVPB 3WMSA 3HE7D 3L7EA 3HZKB 4JHAL 4ZS7L 5HBBA 3MGTA 3IAQA 2VLJD 4M48L 5F93C 1QBLH 1MRDL 2NNAB 2W92A 3QCUH 3T0ED 1R5IA 4D9QD 3TIDA 3T3PF 1T21B 2EDLA 4FXGB 2FATL 2R1YB 4NQTA 1MOEA 5I2IA 5HHPA 4E41E 4ELKB 1K4CA 2YKLL 2HVJB 4HUVB 1IAKA 4U33A 2OZ4H 4PJ8D 3LKQA 5B38G 2M8XA 2H2PD 3GHEH 5DD6A 3FB8A 2EICA 2F53E 2JELL 1B6UA 4G80B 1I3GL 4DGYL 4YXLL 1EVTC 2V2XA 3CFJB 4UT7H 1TITA 1OAXH 3AS3A 3VGEA 3G5XB 1G7LA 3P0YL 1D5ZB 4PBXA 1QNZH 5A2LH 2VISA 2R0WL 3ZKND 3IXAA 4D9QE 4UB0H 1WFUA 5GGSB 3GI8H 4R0LC 3CSYB 5EWIH 3GRWL 1CLYH 3PF2A 5FYKH 3QJFA 3NIDE 2X2YA 4G3YL 1N59A 4F2MB 5DJYA 5F3HB 1OSPH 5F1NB 1WAAF 1KB5L 1I1FA 4U1JB 4JFDD 2X4OA 3EO0B 5LG1A 1IZJA 2BJML 1NMAH 2ZJSL 1KN4H 1RIVH 4PPTA 1QQDB 1M05A 3BGFB 4WDIA 2BOCB 3ZT6A 3SO3C 4LU5H 3U2SB 3TO2A 2Z92B 4MVBD 4JHAH 4ZS7H 1TDQA 5EBMA 4M48H 2BNRE 3QDHA 4V2CB 5C3TA 1MRDH 4QHKI 4NQVB 5JA8B 5DJ8A 4NM4L 4EI5C 2FATH 4PJIE 3DVFA 4HD9A 1G0XA 2GCYB 1U8LA 2YKLH 3BPLC 1ZT1A 1B0RB 2CR6A 3LQMA 1NFDA 1RJYB 4GKNB 2J8UB 4IS6A 3DX7A 1CD0A 4PRPD 4NQED 1L0QA 4LPCA 3MLYL 1XF4B 1KTKE 1Z5LA 1TCMA 4F9LC 5HY9A 4NJAL 2JELH 1I3GH 1JPTL 1YEEL 5IK3B 5C08A 3RVXC 3MR9B 4DGYH 4ZUSA 2YPKA 4YXLH 3UTPD 3STBA 4D2NA 3VJ6A 4NO5B 3P0YH 4HBCL 4N0YL 4NZTL 3L3IA 3V9FA 4PJ9D 3BKML 2AV1B 2YWZA 2A9NL 5EU7C 3T04D 2R0WH 3X13B 4TSAL 4ORGA 5DK3A 3QQNA 4ZTOL 4EXKA 3GRWH 5E8NA 3C5ZD 1RD6A 3PABB 3HE7A 3PHQB 2NY2B 3V4UL 1KJ2B 2VLJA 4G3YH 4PJBF 4PYGA 5TE7L 1A3RL 3T0WA 3T0EA 1KB5H 1MCBA 2OCFD 5ICYA 3D3VE 35C8L 4M00A 4OJFL 5IB2A 2BJMH 2VO5A 2ZJSH 4PJ8A 4RMWA 1ZANL 1U8PA 4HKJB 4RMTA 4U0RB 2RGSA 1ZHNB 2AQ1A 4PJAB 4BKLA 5EA0L 5GGVL 2APVA 5CMAB 2YUXA 4IDLA 3AMLA 5KVDL 1JF1B 3UDWA 1H3UA 4WI5A 4NM4H 4ZPVB 2HN7B 2F54D 1BMGA 4LRIC 5HYEA 2XI9A 2LTQC 4BUGA 1R5VA 3VWKD 1MHCA 4WW1B 3U0PA 4JFFD 3MLYH 3MCKB 1BVKA 1KXTB 1X7QA 3LN4B 2ZUYA 4NJAH 1MJ7L 1JPTH 1YEEH 3KPSB 3R1GH 1K2DB 1CXEA 2HVKA 1CQYA 4JFQA 5AD0B 2FX9H 3QNZB 4HBCH 1P2CA 4N0YH 4M1DL 1CFNB 4NZTH 3VFTA 1OAUL 3P9MA 3BKMH 2A0LC 3BWUC 3B5GA 4HLZG 1AR1D 2EYSA 2A9NH 4TSAH 4Y5XA 3RU8L 3RDTD 4ONGL 5D9SA 5AG9A 2JK5B 1A22B 4HZLA 1UXWB 1QP1A 4ZTOH 2BMKB 3ULUL 3OJMB 4I77H 3SQOL 1QYGL 1SEBB 3C5SB 4LEXL 2Z4QA 1UJ3C 3K0WA 3U36B 5J56B 4O2EA 3V4UH 5J9PB 3GJEA 4L3ED 3T0XA 4QHNB 1KT2B 5DRWB 5TE7H 1A3RH 1T3FA 4S1DD 5DUML 1QPXA 2ZCLL 1XR9B 3VFGL 2X1OA 4RGMB 3VRIA 4HW6A 1V7NL 4U1LA 4OJFH 4QOKE 4NUJA 4HDIA 2X1QA 1DQDL 2EIDA 4XI5D 4JPKL 4P57A 4PRPA 5BVPL 3EDFA 4NQEA 4JJ5A 2L4OA 4B7IA 5F1SA 4L29A 5EA0H 1TZHB 1YEHL 5GGVH 43CAA 4Z7OE 3PL6B 1INQB 4XCEB 3QDGE 1UACL 3LEXB 1W72A 4KKCC 5KVDH 3QFDA 3Q3GB 1BX2B 4PJ9A 4NQDE 1F13A 3RX5A 3L6FA 2PCPA 4DCQB 2H8PB 5A2JH 1IGCL 3IGAB 1JHKL 1MJ7H 1TTFA 3OR7A 3C5ZA 3DURA 3RWFB 2CO6B 4UAOB 1NCAL 1CLOL 5MEND 4AQOA 4NRZB 5D7JB 1UEMA 3MRLA 3QIWB 1NGYA 4M1DH 1OAUH 2VLRB 8FABB 4BSVB 5B3NA 3RU8H 2DL9A 1UM4L 4ONGH 2BRQA 2EE2A 4FQQA 2EC8A 5EU6E 3AU1A 4C56B 1F11A 2FJGA 2A73B 3ULUH 4HIHB 3W39A 4P5MA 3KLHC 4N8VA 1QYGH 4LEXH 1EO7A 5JOFA 4WTXA 3TIEA 1IC7L 3NZHL 2XXMB 5DUMH 2ZCLH 5FUZL 1RMFL 3VFGH 5ISZB 2NXYD 5CP7B 2F54A 1V7NH 4DVRL 4ODVL 4NT6B 1Q72L 3MRKB 4RBPH 5EZJA 2BX5A 4LSRL 3MGAA 5T5FH 1G9ML 2HTLC 3MLTB 4XHJD 4JPKH 5BVPH 15C8L 5FKPB 5C0FB 4JFFA 4XNYL 5HPOA 2FYYB 4MAUL 1Y6MR 4D8PB 5C0NC 1YEHH 4H20L 3P4LA 2D03H 1JRHL 3DO7B 2VZUA 5BZDA 1UACH 5E2UL 5GSRA 1SM3L 1JNNL 5HGAA 4KK8D 4OT1H 2GK0B 4L8SA 1JUFB 5C2BL 5L0QB 1S9WB 1I8IA 4PJXE 3RDTA 3MJ9A 3AXLA 5EU4A 1ZHKA 1OF2B 4J1UA 4CKVX 1IGCH 3I3BA 4OM0H 1I9EA 1G7MA 5E99L 3P73A 1JHKH 2V2TB 3MFFA 3VXTA 4WI4A 4NQDA 1NCAH 1CLOH 2AJXL 5IWLA 1G7IB 4LCIL 1I7ZB 2OQJB 2VLME 4U1KA 5AYUL 5I1EL 3MRDA 3BYTA 1AXSB 4C4KO 2YRLA 1UM4H 3FJTA 2V5MA 1RHHA 3AS2A 5F44A 3VXUE 3MRQA 1F4YL 4NYLA 4JGUA 3INUL 2HT4D 4PB0L 3GIZH 4L3AA 4KFZC 1FZMB 3NZHH 4OUUA 2P8MA 3ARPA 4YHKL 3GSXB 4YUEL 1RMFH 5FUZH 4E0RA 3JVGC 4Y4HD 4DVRH 3ZHDA 4ODVH 1QVOB 1Q72H 4K8RD 3EJZD 3QCTL 2YWYA 2C4FT 1G9MH 4LHUB 2P5ED 15C8H 1FFPB 1CFQA 2RR3A 3T0EC 4XNYH 5FYLL 4YFEA 4GW1A 5IB3A 4MAUH 2BVQB 4WI3A 1AD9B 1NC2B 4H20H 4UV7L 1JRHH 5GGRB 1SM3H 5JW4N 1M71A 3CFDB 4ONHB 4OF6A 1JNNH 1IEBB 3WFHA 5B22A 2H2PC 2X40A 1WCBB 3PP3K 5C0BD 3DVNA 3VFPB 2J3SA 5C2BH 4GXUM 4UOW1 5D96C 5FA3A 2JE8A 3HPJB 4YGVB 2BNUB 1X5JA 3UDWC 5DRZA 4X99B 5HYQB 3HE6A 5C0AB 3L5WB 3H7LA 2DMKA 1J1OL 2UWEA 1AO7E 5E99H 2WWMD 3L3DB 5JMRA 1DVFB 2VDML 3MUZ1 5DYOA 2LU4A 1AJ7L 4LSPL 4ZXBB 2AJXH 1YNTA 2LU3A 4LCIH 4QXTA 4WEBL 3AB0C 4KTEL 1JFQL 5AYUH 5I1EH 3Q6GL 1MVUB 2PETA 5I17B 2DQUL 4KTDL 3PGDA 5TDPA 3O4OC 3UTZB 5GJSH 1OVZA 3IDIB 1NUNB 1HHIB 2OX5A 5INCB 1F4YH 4Y5XC 2Y5EA 3INUH 3HC0B 4PB0H 2YD1A 1MWAL 3RGVB 3JV6A 3LKOA 4OZFA 4WO4B 3O3BA 4YHKH 5IBTL 4YUEH 1R5WB 2DL2A 5I1AA 4NN7C 1AY1L 5E6YA 1UKSA 3QCTH 4MVBC 4NFDA 1KACB 5KS9A 4FTVE 2PO6D 3B5TA 4J3UA 4OZGA 3NPSB 2J4WL 4QEGA 5FYLH 3EGSB 4FA8A 1KXQE 4UV7H 4UQ3B 2X4UB 4X7EC 2NY5L 2WUBL 4RNRB 4NFBA 3GI9L 1AIFB 3L5JA 1H15A 4HV8B 4Z7QF 2H32A 1IQDB 1UVQA 4PGZA 3N0PB 4EDXA 1DJSA 4XH2A 3P4OA 3MGOB 5IHZA 5FM4A 2PW1B 2CD0A 4FZEL 1IAII 1J1OH 4DEPC 4CJ1A 5J11C 1ITBB 4Z7WE 4PJ9C 1CI5A 1ZT4B 2VDMH 4H5SA 2GSIA 1AJ7H 3C5JA 4LSPH 3WUWB 4YAQA 3TA3B 3LB6C 3VGAC 4LSTH 4CMHB 3M17B 4WEBH 4KTEH 3SGDI 1JFQH 1SJXA 2XIDA 4KJWD 3Q6GH 4MYWB 4Y4HA 2J8HA 3TF7C 3BZEB 2WSKA 1AO7A 4GG6E 1YC8A 3C5ZC 2DQUH 2F5BL 3JBG7 1IC4H 3L3KB 5TFSL 4LCYA 3IS1X 4R6UA 2P5EA 5IMMB 1QFWL 2JJVA 2XWBA 1U3JA 3REVA 4LQ1A 1GSMA 5FGBA 2PKDA 5IMKA 4EOWL 2HG5A 4R3SB 1NC4B 4B7LA 1MWAH 4TUKL 1DE4B 5IBTH 1I3VA 3MNZA 5J1TC 1AY1H 4V1DD 1AGBA 5C0BA 1G9NC 3BE1L 3B3IA 5E94B 4E5XA 4F33B 5CJXA 1QKZL 3IDNB 2J4WH 3GFUA 4FXLA 1Q1JL 3WIIL 1T2JA 4HKXA 1T1XB 5T1DL 4M5ZH 1A3LL 3DIFA 2NY5H 2WUBH 3HI5H 3WO4C 1BOGA 1KCVL 4CVUA 3B6SA 3GI9H 2W59A 3FO9B 3KLSA 5M95B 4Y89A 4R0LB 5DJ0B 1FV1B 4P5TB 4BYHA 3TYFB 2FZ3B 3S5LB 4YHYB 4WFED 1JGDA 1ZAGA 3ARGD 4FZEH 4M7ZC 3QWOB 1RK0A 1OSZB 1AR1C 4L8SC 3VFNA 3MOBL 4CBPA 2A6KA 1YY9D 2VABB 3K80A 5H35B 4HX1B 4D94A 3QQ3B 1QFUL 2R1WA 1XGPA 3DI2B 3MRJB 3HUJE 5IR1A 5MHSE 2F5BH 5F6IB 4S10A 3MNWA 2MPAL 3HRZB 5IWLC 1QFWH 5CSZA 2WWKT 4EIGB 1EO5A 4S1DC 4J3XA 3WFEL 1S9XA 4G42B 4D0BA 4MDJA 4EOWH 3T65B 5IJVA 4KMLB 1GGTA 2XG4A 4GG6A 2I25N 4HUXB 4TUKH 4Y4KB 3VGGA 5GGVY 3VFWA 2FWOA 4WCYL 2W0FB 2XT1B 4UV4L 1I8MA 1EEYB 2NLJA 4PY8I 2R9HD 2ADJA 4P2OA 1A7BA 3BE1H 1V5JA 4IOIB 4LSQL 1QKZH 5E5MA 2IFFL 4XRCB 1YPZF 1UCTA 4WIQA 1JJUA 3IFPA 5GGUB 1Q1JH 3WIIH 5DJAA 2XZCL 1HSAB 4PJBB 5T1DH 4A2MA 1FFNB 1A3LH 1F3DJ 1DDHB 1RZJC 3G6AA 1KCVH 2VDPL 1A6TA 1VGEL 1VFAA 3PWNA 5IF0A 1SBBA 2IAMB 4I2XB 2CRMA 5HHME 2JJUA 1H0DA 5A2IH 1V3MA 5GZOC 4R2GB 3IKCA 4L4TE 5MEPA 5CKAA 2W9EL 1T66C 4NBXB 3RWGB 3AS1A 2D7OA 3MOBH 3TJHD 4UDTA 1A1OB 3HE6C 4M03A 3S35L 1ZA6A 1G7PA 5GS1B 1QFUH 3EO1B 4FFVD 1WIOA 3QBTB 2D4FA 4XBPA 4KROD 5D5ME 4V1DA 1F42A 2DI9A 2MPAH 3QHTC 1AQDA 2VE6A 1DANT 3ESUF 2EEDA 5DZOA 1NGPL 4M61A 1U42A 2NXYC 3WFEH 1OCWL 1T0NA 2OP4L 3TBWB 4W6WB 4FXKA 4L3CB 2UWEF 5JIIA 4XHJC 1UWEL 5DTFA 5J7CC 3QEQD 3NCYS 4WCYH 4ELMA 4UV4H 5BZWA 3PWJA 5KSAB 3TN0D 2J5LB 2GQHA 1Q9OA 4RX4A 3STLA 1IKFL 5J06A 4LSQH 1KNOA 5D1XD 2FX8L 3ARGA 2IFFH 4RGNE 1MFBL 4K3EL 2DJUA 2V5SA 3E0GA 5DFVC 3HI1A 5C0GA 3DUHA 1IGJB 4NNYA 2XZCH 4KKBD 4G8GE 3PV6B 2CGRL 2VDPH 3E2HC 5DQ9A 5C9JA 1VGEH 3VXRB 5BJTA 4FQ2L 3MSPA 5I1DA 1F2XK 1TVBB 1I75A 1OARL 4EXPX 2ZZUT 3I6GA 4NSKA 4G8EB 1SY6A 4PJ7F 3CVHL 3MC0A 5D6DA 1IM3A 2YPLD 5KS9F 4MQ7A 2W9EH 1HQ4A 5D2NA 1PZ5A 1J1XL 2EO1A 1V3KA 3LS5L 4R8WL 3UBXG 3V0VB 5HYJD 4OZGF 1DL7L 4UBDC 4Z76A 2IAND 4OLVL 3S35H 1WV7T 1JNJA 5CS7A 3OBAA 1DBBH 1MAML 4LLAA 4L4TA 5GS2D 2XKNB 4O2FB 2QQQA 2HT4C 2C9AA 3CH8A 3VFMB 3BRGC 1CQKA 2FCBA 4LFHG 2FRGP 1NGPH 4RRPG 3S3PA 1OCWH 4Y4HC 2OP4H 5KSBF 4L8DB 5EUOE 3QR2A 1Q94A 1T0MA 3RWDB 5D5MA 4JDZA 4Z78B 2DKUA 1UWEH 1LE9A 3MGTB 2WZPD 1JWMA 5HYJE 3MUJA 3QB7C 5FGBC 5FDWA 1IKFH 4S0TD 4ZTPH 3MRHA 5DMKA 4JKWA 2CLVA 2FX8H 3W11C 1K4CB 5DK0A 1IAKB 4K3EH 1ZLSL 3SBWA 3LKQB 4EKXA 3SGJC 5FEBA 3SY0B 3GJFH 3FB8B 3ZE1E 2IH1A 3AREC 3T3ME 3MROA 2DLTA 5A40E 2CGRH 1F97A 1X44A 5CJXC 5FYJE 5ILTL 4Y5YA 3IFNL 2V2XB 2OM5A 4FQ2H 2R4RL 5C2UB 3GMPA 3IXTA 1IC5L 1OARH 4X7FC 3GMLB 5J4MA 1S7XB 1LE5B 4ZDHA 1BECA 3WL9A 1A4KB 3CVHH 4GKZA 3IXAB 3O0RL 3KLDA 3P40A 5FYKU 3G5VA 1G7JA 1I1CA 4JPIB 4NQSB 4XTRC 2A6DA 3OQ3B 3QISA 4R8WH 3LS5H 4BH7B 1DL7H 4I0KA 4MD0B 3LEVL 1QRNB 4Z77B 1HOCB 5H94B 1AHWB 4KRLB 3OHXB 4OLVH 4Z7UF 4ENED 1BBJB 3QEQA 3RRQA 3ET9F 4MA1C 3UEZA 5IFHH 1X4ZA 3BQUD 4NQXB 1MAMH 4OF3A 3TN0A 2A74B 1KB9K 2R23A 3D25B 4KRPC 1I8KA 2JCCE 1NUDA 5D1XA 4U6TA 3ARDA 1RHFA 4U2YA 4UOW0 3ROLA 3V2AR 2IADB 3MLWL 2DQGL 3QXVA 1TVHA 5GZNC 3D85B 1I1AD 2Y36L 3QUZB 5IVOA 4WDIB 4X6CF 4FQHB 5C0DA 4JVWA 2SEBA 4PRNA 4HF5L 4Y2DD 1WTLA 5EBMB 4U1NB 3ZTJG 4UDUA 4C83A 3EDEA 4MJ5B 3VE0B 5EUOA 3H9ZA 1Q8MA 2Q3AA 1BIHA 5CGYD 4X4ZA 4OF8A 1ZLSH 1RPQA 2QSTA 4IS6B 3DX7B 1WWAX 2IBZX 1ES0A 1QR1B 5HYJA 1Z5LB 1QD0A 4P2OC 3AC0A 3MRGA 2X10A 4DUXA 5ILTH 3UXFA 7FABL 2HYMA 3JV4B 2IANA 3V5DB 3IFNH 1NDMA 5SWSD 3U0WL 1QA9A 2R4RH 4YJZL 5CD3B 1IC5H 1BAFL 3BPOB 1F2QA 5HD8D 3QG7L 4MAYC 3JXAA 4YGAB 2D7PA 5DHYB 3KYAA 1HYSC 2UV3A 3O0RH 1PG7X 3C8DA 4WWKD 1DUYB 3LEVH 4OZIA 3ZKXC 1PY9A 1JIBA 3HE7B 4XCNA 4YHOL 1QSFD 2VLJB 3EBAA 5DFTA 3BVNB 4NN6C 1QO3A 2BHYA 2XFXA 4W70A 3EJYD 5IB2B 1RZKL 5SX4H 3MLWH 2MNUA 4PJ8B 2DQGH 4MJ6A 2DM4A 4POUB 2XZZA 2Y36H 3V7MA 3ZDYF 4R4FL 5I0DA 4OBRA 5FIEA 3DUSA 4HF5H 4MB5A 3CDYA 5LJYH 2VITA 1S7QB 5IQ9A 3I50H 1FZJA 1M6OB 4KJQD 4IHOA 3QXUA 1PEWA 4PRBA 4AIOA 1NEZB 1X7QB 2BVOA 4ZQKB 5JORA 4M7JL 7FABH 3ARGC 4PY8J 4JFQB 3BEVA 3BQUA 1BAFH 3P9MB 5CP3H 3QG7H 2EYSB 4JFDB 3U9UA 4BK4A 4ELMF 5D9SB 2ICEA 5FV1L 5F70A 1W8NA 5CAYB 1JVKA 4G7VL 4IRJD 4P46D 1I1AA 5CZKA 4G6ML 3IDYC 2WBWB 4YHOH 4Y2DA 5FKAA 1NGXA 3DV6B 2BY1A 4NJ9L 3MO1A 3DROB 3SDDD 4TUOB 1BD2D 2FNBA 4HHAB 5D2NC 1E4WL 1V05A 2OL3B 4KKNA 3QUXB 4U1LB 2W0LA 4QXGL 5GGSY 1RZKH 3V52L 3DWTA 3BESR 1U8HA 2F5AL 1EAPA 4LNVA 3R4DA 4NQEB 2OR8A 1QFOA 2X41A 4LLDB 5DJ2A 5C09E 5T5NG 2AERT 4GAJH 4R4FH 3KJ4B 5HI3D 3VXQB 43CAB 1W72B 5L2KE 3FAWA 5SWSA 3QFDB 3ZKSD 1UT9A 1QEWA 1MCLA 5GS0C 3TH4T 1DBJL 4FRWA 2I07B 4X6BB 3FN3A 5IW1A 5HXMA 1J12A 5E2JA 1X5AA 1IFHL 1U93B 2PCPB 3MCLL 5DZNA 1FC1A 3HTLX 4HS6B 3HC3L 1DQLL 2NXZD 4WWKA 4M7JH 3O3EA 4GBXC 4K94L 3MBED 3SBWC 4W81A 3GSVB 2P7TA 3LKSB 3MRLB 4I18B 3UBXI 3T2NL 4LF3B 2DQCL 3QCVL 3RWCB 4Y5YC 3PDOB 1IKNA 3CFBB 1IT9L 3QI9D 5DEGA 2EIBA 3RWJA 2FJGB 3EHBD 4Y0GA 2ZWLT 4G7VH 4NDMB 4RGNC 3SE3A 4KROC 3W39B 4P5MB 1FL6A 1GHFL 1KIUA 1WIUA 2UY6A 4G6MH 1Q0XL 1W0YT 1JGEA 2GI7A 5JOFB 1R24B 1BWWA 2ZUXA 5L2JA 3TIEB 4NJ9H 3PP3H 3PQYE 3U46B 1LO2L 3AAZA 4F7TA 1QACA 4MNGB 2MKWA 2W65A 1E4WH 1SYVB 5A3IC 4JHBA 2MQ0A 2F54B 1EDQA 2X4TB 4ODXA 4XVJL 4QXGH 5C9KA 2Y5TB 2VDLL 4JDVA 4PV9A 5DRXA 4R7NB 3V52H 2F5AH 3VWKB 2PYEE 3BKCL 4TVPL 2R39A 5I1CL 1N2RB 4HJJL 3U82B 2VKXA 1P53A 2WLYA 2YD5A 4NC1E 5D1XC 3TNMA 5IG7A 3ARDC 5GSRB 3O4LE 4MJIE 5DC9B 5HGAB 1DBJH 4KKBC 5C7XL 1CTNA 4P3CL 4GKOA 2B1HL 3RDTB 5KSUA 1IAIM 3AXLB 5EU4B 1ZHKB 4J1UB 1IFHH 1A1NB 1G6RA 3MCLH 3MLVL 1FIEA 4IRJA 4P46A 1OP3K 3P4NB 1J0ZA 1G7MB 2DRUA 3UBXA 2IJ0C 3HC3H 3WHXA 1A6UH 4XPGL 3RPIB 1BJ1J 5JDJA 3RVUC 4K94H 4LMQE 4L3EB 1ZS8A 5EIIB 3SDDA 1RUML 2A1WL 3T2NH 2D4DA 1BOYA 5C8JA 2BOBA 3MRDB 1YPZB 2DQCH 4WTZG 3QCVH 3WEXA 3VMNA 2I9LB 1IT9H 4UINL 1RHHB 4P23A 1H8NA 3KPLA 1WVZA 4RRPA 4U1IA 2BERA 1KIPB 3H6JA 3MRQB 3R8QA 2Q3ZA 4DKEL 3VI3F 1BGXL 1EHAA 1ZGLP 3SKNB 3BDXA 1GHFH 4NO2A 1Q0XH 3AROA 3D39E 4P3WA 1Q9KB 5DHVA 1LO2H 1INDL 2MOVA 3MRFB 4E0RB 3EZ8A 4MJ2A 4XVJH 2VDLH 1A9EA 1FL5B 4K7PL 4FP8L 3BKCH 3NA9L 4TVPH 4AEHH 4WJ5B 2XY1A 5I1CH 4GW1B 4HJJH 1MCKA 4RAVA 4ZFFA 2ZG1A 5HDBF 2LU7A 3UTTD 2R2HA 2Z31A 3ECBB 5MENB 1WLHA 4MNHB 3MBEA 3P77A 4KK6D 1JGVL 1EGJL 3TJEL 2HMID 3PJSB 3VWJD 3EAKA 3CFEA 4N5ED 3SKOA 1TPXC 5C7XH 5MEQA 4OZIF 4P3CH 4EN3B 5F7UA 3GMRB 3DVNB 5FA3B 2B1HH 2HRLA 1BJ8A 3QI9A 4Y8DC 2GTWA 3MZGB 5DRZB 1OP5H 1MCWM 4PJHA 1JPFA 3MLVH 5CJQL 2ILLA 2UWEB 3FQUB 1FYHB 4MJIA 4OQTL 5FYKE 4XPGH 4TNVF 3MRCA 5DYOB 4CADA 1JV5A 1VESA 4MA7L 3UAJD 1GOFA 4JM2D 5JPMA 5BW7A 4LCWE 1RUMH 2A1WH 1PDKA 3FB5A 1UGNA 5JOPD 2DI7A 1FNLA 1HCFX 3ELAT 5E2WL 3CFKB 3ROOB 2WIMA 2X42A 3CH1B 4UTBL 1AGEA 5HHOE 4O51A 3KHOA 4R4BA 4L1DA 4UINH 3PGDB 4ODWA 1U92A 2XTJB 3OB0H 4DKEH 3L5IA 4U31A 4X98A 1BGXH 1T4KA 4OCWL 4LOUC 3FQXA 5I73B 5IT2L 4PRHD 2DQEL 5EOTA 3BH8B 5EO9A 2XN9B 1YN7A 1ZGLA 3LKOB 1INDH 4OZFB 4PJ7B 2GJ6D 3QIUA 3HNSL 3PWUA 4K7PH 4BJLA 5KS9B 3TGXA 1GC1C 4FP8H 2NY0B 1NMCC 3NA9H 4PJFE 1SJHA 4OZGB 1QBML 5TDOB 3VFVA 3E3QE 4TTDC 1T5WB 3ZYOA 3P30H 4OFDA 1NAMA 4WUKL 1YEIL 1P4LA 1ZLUH 4TNWF 1JGVH 1EGJH 3TJEH 1QFHA 2P4AB 2H32B 4MMXC 2AEIT 5F9WC 4JGJA 4P2QD 1SQ2N 4EDXB 4I0PC 5KSBB 1VFBA 4GMTL 5CJQH 1F8TL 5EN2A 4DZBA 1CFSA 1MH5B 4MXQD 3F7QA 3N1PC 4OQTH 5TPWL 4YIQA 4RFEB 1B0GB 1CDCA 4MA7H 1NFKA 4YAQB 5T1LD 3KPOA 1CFBA 4B53A 2QADD 2R2EA 3T4YA 3PWPE 1H3TA 2G75B 4H8WC 5ESAB 4Y1AD 1MRFL 1K8IA 5E2WH 4Y4HB 4WWKC 4ZNEE 3QUMA 1G7HB 1DQTA 1MCOL 4YHNA 4JFEE 4TSCL 3H9SD 3OZ9L 4PJEF 2P5EB 2VDRL 5MP6L 4OZHE 3SDAC 3REVB 2C26A 4LSDA 3MFGB 4OCWH 4P2QE 3FT4A 3WNNA 4JFPB 2AXFA 3TCLB 2DQEH 1H3XA 4B0MM 5IMKB 4JVPA 2PYFA 1FQ9C 1IKNC 1QFPA 5HGGS 4HPOL 1GGCL 4ODBD 3SE3C 3VWJA 3T2QA 2GFBA 1OTTD 2O5YH 4UMGA 4ISVA 3HNSH 4MXWL 1AGBB 2G5BA 4LBEB 5C0BB 5A43C 4HIIB 1NCCL 2VXSL 3BH9B 4E5XB 3UZQA 3DECA 5C86A 1E28A 1QBMH 3QFJD 2O5ZL 1SJEB 4Z7UB 1FCGA 1IC1A 5F9JA 1ZLWH 5D7LE 4WUKH 4KJQC 3H9SE 1YEIH 4JM2A 1A6PA 3MRPB 4B5EA 1N3NA 1MAKA 5IOPB 1ZT7B 4IM8A 3LMJL 4PGDB 1P7KA 4YR6A 3JV5A 3KDMA 5I71C 4X8JA 4JANA 3H0TA 3BDYH 4LVHC 4X6CB 4GMTH 1OGAD 2BSSB 1F8TH 5GGRY 5JHDD 3IU3B 5TPWH 3LQAC 2BSRA 2KZWA 4PRHA 1BFSA 1JTPA 4J23A 2A6KB 3JUZA 1CDJA 2VTFA 3C8KA 4IRJC 3FONB 1A14L 1C08B 1U8KA 5GGQL 1MRFH 4YHPA 3UPCA 4X7TA 1VACA 1LDPL 2FO4B 5BXFA 1ORQB 2X4QA 3RUGF 2X1XR 1MCOH 2PO6B 3TM6A 3NCBB 5CWSA 2DMBA 4TSCH 3OZ9H 5MP6H 3SDDC 4LGSB 2VAAA 4IJ3C 3RIAF 1J8HD 3F7YA 4TYUA 1A1MA 1RQ5A 1C16B 3TV3L 5ICXA 1W0WB 3RTQB 1OGAE 2A6IA 4P23C 3E8UL 5F7DA 4HPOH 1GGCH 1IQWL 3LD8C 1I8MB 1QR4A 5EU5A 1BP3B 5FUCC 4X0KA 2YZ1A 4MXWH 2R2CA 2ADJB 1K5NA 5D1QD 5FOBA 4P2QA 2VXSH 2D7NA 2BC4A 4L4VE 5E5MB 2V7HA 3AM8A 4FG6D 1XGUA 2XKUA 1H5BB 3WFBL 5I16A 2O5ZH 2WK2A 5KN5A 3WS3B 4JE4B 5B21A 3MV8E 2HFGH 5FHBL 1JMXA 4IMKC 1UB5A 4QO1A 3DXAB 5T1LA 2HT3C 2DQFA 3C60C 1VHPA 1A6TB 1VFAB 3N85L 4GXUN 1E4JA 4Y1AA 4G5ZL 3RVVD 1KN2L 1X5LA 1UQSB 1PQZA 2Z31C 3SE8L 3MBEC 3ULUE 3H9SA 1EZVX 4EVNB 5MEPB 1LEGB 4KV5E 4HUWA 1BQHA 4RDQF 1HSBB 4HMDA 4NC1C 2B39A 3NFNA 3BUYB 4MA3A 3GDBA 5C07D 1A14H 1G7PB 1RIHL 5GGQH 1FN4B 3A6BL 1HDMB 4D9LL 4XBPB 1LDPH 4V1DB 3EYOB 3IS0X 3C6SA 1Y0LA 1AQDB 1N6UA 1R3IL 5F1KC 1TJIL 2VE6B 5BW7C 4QXWA 5EB9A 3LOWA 2GSGA 2BHZA 4KHTL 2QQNL 3VG9C 2FX7L 1S7VA 3TV3H 2XZQL 4PJHF 4PRAB 4FXKB 4DOHB 5C0JB 3E8UH 2NPLX 2ZUUA 2DQTH 1IQWH 4QCIA 3QDJD 4ELMB 5BZWB 3PWJB 1Q9OB 2ATKA 4I5BA 4JFOB 4P2CG 5SWQA 3STLB 3PG2A 3HI6L 2FLBT 4N0UE 1OGAA 1FVCB 3WFBH 5JHDA 3P11L 2ICWJ 4PJ5D 5C0GB 4NNYB 2DLGA 3QIUC 3U9PL 1I3UA 4X4XB 2OL3L 5FHBH 2ZOLB 4HUKB 1I85A 1WIPA 3BGAA 1MHHA 5DLML 2HFFA 3UJJL 5DQ9B 2R56L 1V7ML 3MNVA 3N85H 5BJTB 4LVOB 1M7IA 3BKJL 4H0HB 4G5ZH 1KN2H 2P8LA 4JFXA 4WTZA 3MXVL 3HG1D 3I6GB 1LGVA 2WWKO 2Z93B 4NSKB 3SE8H 4NKIL 4J8RA 3QNYA 1C8PA 3FOMB 5I6XC 3EJJX 1W72L 1J8HA 1IM3B 4L4JA 5IMOA 3O11A 1HQ4B 1PZ5B 2YN3A 3LV3B 4CU8A 3EO9L 2ZOKA 2ESVD 3KYMB 2EDQA 4HS8H 5HYFA 1OGTA 1QLFB 1RIHH 3A6BH 1VKXB 1QZ1A 4HJ0D 4NGHL 1NSNL 4D9LH 2FGZA 3OSKA 2YD9A 3VD3A 5D1QA 4JFZL 4U1MA 3BO8B 1R3IH 1L7TL 1TJIH 3PHSA 4KXZI 4KHTH 1J9CT 4X5WB 3MRMB 2QQNH 2FL5B 1FDLL 4MS8C 2FX7H 4NQCD 3OKOB 4ZFZA 4EI6B 1OAQL 3FB6B 2XZQH 4R26L 1FO0A 4MD5A 4QRTA 2NX5D 1T83A 4HEME 4XP9L 4AIZA 5CUSL 5D7KD 3L3HB 1HKFA 4QRSA 5FDWB 4ZNCD 3GBNL 2D2OA 4WU7A 2OXGA 3HI6H 5BOPA 2P5WB 4KK6C 4DVBA 3P11H 4J3WA 3SDXE 3U9PH 2OL3H 2H3NB 5MI0B 5KSVB 5GIRA 1YY8B 3MLRL 4MZ3A 3UJJH 2R56H 3G9AB 5C0CE 1V7MH 3IKKA 4MDIA 3T4AA 3UYRH 3BKJH 1NBZB 4ZODA 4HEPG 3SJVD 1OTUD 3MXVH 4WUUD 4Q2ZB 4NKIH 3GMOB 4JM2C 1CN4A 4PRIE 2J6EA 3MV9D 4YNYA 1GZQB 2DQHL 1W72H 3SEPA 3DX6A 1RVFL 5F7EL 3G5VB 1OOAA 3UP1A 4NZDA 3G08B 3LRHA 2ZG2A 3EO9H 2VL5A 3JSSA 5DD0L 5AAMA 3H2WA 1R6VA 1VB9A 1F4XL 2AJVL 3QEQB 4JFYA 3QDJA 1O5DT 1LP9A 2XWJB 4NGHH 1NSNH 3TN0B 1QTYT 2R23B 5L8JB 2GW5A 3U1SL 1I8KB 4TNVK 4JFZH 2FIRT 5D1XB 3D69A 1L7TH 2E27H 3MJ8A 5FYLE 4K7PY 5BRZE 2R0KL 2Q86A 4JQIL 1FDLH 3F5WA 4PJ5A 1TVHB 4Z5RA 1AFVL 1E4KA 3WE6A 1KENL 1OAQH 4R26H 4TN9A 2C1OA 5C0DB 2YD2A 1VEPA 2SEBB 1T0PB 1EAJA 1EIBA 1YZZA 3HMWL 4XP9H 3V6ZA 5CUSH 1ERNA 4X6EA 4JQVC 1QSED 5INDA 4C83B 4J7RA 1S9VA 3E6FB 5DD1L 5B8CA 3HG1A 1MHPL 3CLFL 3GBNH 1X6LA 5EU3B 2EDEA 1CGSL 3OAZK 3ZDXF 5K59F 5ADPL 5I74B 2JTDA 2XNAB 4G6JL 3KXFB 4GSDL 3RWHA 5IVXE 4RMUA 5DVNA 2YPLB 5E2TL 1NMBL 1BLNA 4CN1A 3ARYA 3WFDL 4CL7A 2N56A 3MRGB 1YNLL 3MLRH 4GRWF 5DF0A 1BWMA 4NOBA 3DX8B 2IANB 1RZJL 1BBDL 1GGBL 3AM8C 3SKMA 4WGVB 3ZKQD 1MHEA 1CE6A 3QULA 2N7BA 1FVDB 3D0VA 1U95B 3QPXL 2UZXB 4OCLC 4M93C 5D2LF 3SDXA 2C4FU 1BFOA 2DQHH 1KCUL 4U3CA 1JZ5A 5CHNB 3VXME 4TNWK 3VDBA 1RVFH 5F7EH 3TNNB 4NRXB 4LVNB 4NQCA 3T1WA 2Z8RA 4RSVA 5DD0H 25C8L 2NX5A 4WFHE 3H9YA 1F4XH 3DUUA 1CGWA 5F8QC 2AW2A 2NY3C 2ZUQB 3D9AL 3U1SH 2XFXB 3EYVA 1TCRA 1FVEB 4PJGF 4LARL 1U8OB 2AAVA 5HSFA 4QRRE 4JREB 1UH3A 5HDQH 1WFNA 1GJIA 4JPVL 1XAUA 2R0KH 4C58B 2YXFA 4JQIH 2DLEA 1OTTC 1AFVH 1NCUA 1FRGL 4QYOA 1KENH 4L9LB 4WU5A 4I48A 1P69B 3OKLB 5D70L 1XCTA 4OFIA 3HMWH 2MHAA 4K7FA 4MHHG 3GSUA 2VITB 4ZYKA 4P0DA 4O58L 4BSWA 2ZUSA 5J1AA 5DD1H 2H45A 3SJVA 1MHPH 3CLFH 5CGMA 2MSPA 3I75B 5IQ9B 1CGSH 3OMZA 4XVTL 5CKGA 1MLCA 4IHOB 2C1PB 3MV9A 5ADPH 4G6JH 4PJXF 4JRYD 4OD1L 4GSDH 3BPNC 4HWBA 3X11A 2F74A 3MV7D 5E2TH 1NMBH 2DBJA 3G04B 1UZ6F 3WFDH 3FZUD 5J6HA 2BVOB 4U2ZA 1YNLH 3W9EB 2YR3A 2HFTA 3O81A 5IFJB 1RZJH 1BBDH 1GGBH 2IALA 3BQUB 2CK2A 2JB5L 2E6PA 1I85C 1M7DA 3QPXH 5IVXA 2K3TA 5ETUB 3U9UB 2WUCL 1CXLA 1KCUH 2ICEB 4BK5A 2WNGA 1NH6A 4E42B 1I1AB 5FO9B 3HR5B 2A6JA 3LVEA 1FFRA 2C3HA 3P0GB 4GW4A 4Y2DB 3OKMA 1KEGL 4P5KA 1RJZB 3MO1B 4JPWL 3RBGA 1OW0C 4AT6A 1QSEA 3VXMA 3HPLA 3D9AH 3EFDL 1ZGLM 5LCVH 1OP3H 4LARH 1QFWI 1X5GA 1U8HB 1ZXQA 4JPVH 2OTWB 1RJLB 1FRGH 2XTLA 3HAEB 2ZSVA 5DJ2B 1Z3GL 3NA4A 5D1QC 4K8RL 5D70H 5CZXC 2RFXA 1HH6A 5EUKA 3C09B 1UEYA 3R0NA 5SWSB 3GSOA 2FJFA 1PG7W 3KVQA 3B9KB 2CXGA 1R3LA 4O58H 3RIAK 4G43A 3Q1SL 4PJEB 5DJDA 3OTTA 4HKZA 4HC1A 2X70A 1YMME 4XVTH 3AGVA 1ED3A 4IOFD 3LSOA 1NCDH 3BWAA 2PNDA 5F7MC 1G7QB 4OD1H 4OZFH 5HGBB 2IMNA 1UXSB 1TJGL 3RVVC 3S36X 2ZUWA 3DX9A 4YK4C 3VD5A 5DO2D 2BVPA 3O3EB 1YMHA 5FM8A 3HZKA 1QSFB 5IB1A 1S7SB 2P7TB 4GXVL 2NNAA 2JB5H 1UWXK 5F7KC 4G9DB 1T21A 4FXGA 2BNQD 2VR5A 2WUCH 3BD5A 2EXYC 4UUJB 2NYYC 3C9NA 4HUVA 1J1PL 2PN5A 4LEOB 4LHUG 3GMNB 5ICZB 1FL6B 2H32H 1N5AB 5E8EB 3OB8A 4G80A 1JGEB 1NCWL 2O61B 2BCKA 3RFZC 1BM3L 2FB4L 1KEGH 2AABL 4JPWH 3O2VH 4F7TB 1Y18A 3OKDB 3EFDH 1D5ZA 5E8OB 1PEZA 1S5HB 3SGKC 4PV9B 4MZ2A 1I8LC 1I1YB 1DR9A 1KIQA 1E27B 3MV7A 3O6KL 4U3HA 4HS3A 2HRPL 1Z3GH 2B8OT 3CSYA 7CGTA 4P2RB 2NY6D 1X4XA 4K8RH 1WFOA 5SV3A 3TNMB 1E6OL 4JRXB 4LRNL 4D3CL 5GISL 4XP5L 1H3VA 3N06B 3RUGB 2VDQL 3BXNA 4YFDB 1YECL 5F3HA 5F1NA 2R15A 5T1MB 3Q1SH 3ZE2F 1KPVB 4KKLC 4U1JA 5IJKA 1LP9F 1G9MC 5KSUB 3EO0A 3DRTA 3DETD 1P4IL 5JW3L 2ZG3A 3QZWB 4P46B 1TJGH 5C71A 5A2KH 1NGQH 5B8CC 3WLBB 1QQDA 2BOCA 2BVYA 4ZFOA 3U2SA 2N4IA 2XQYK 3R06B 1VADA 1CGVA 4KI5D 4YBHA 1ZS8B 4HK0B 1JNLL 2IFGA 5KAQG 4GXVH 1UZ8A 5E70A 1BD2B 3LCYA 5HVHC 3MX0A 3WDHA 5C8JB 2H1PL 2H9GB 1P7QD 3KPSE 2GCYA 2NQCA 3D2UD 3N1QC 5D93B 3PDDA 1B0RA 1WSST 1J1PH 2CRIA 2J8UA 2WIIB 3OX8B 5DDHB 1IGYB 4U1IB 4FQLL 3NVQA 1AE6L 4BQ9A 3CZFA 1NCWH 1BM3H 2FB4H 4ZUUB 5DHVB 2AABH 3ULVD 3D48R 4AEEA 5F3BB 5LBSL 1XGQB 4HAFA 3X13A 3OWEA 3EFFA 5KOVC 2EDDA 1VERA 2HRPH 3IDMA 3EIFA 2Y72A 1I4FB 4HK3N 1MCSA 2NXZB 1E6OH 2R2HB 3WUWG 3UYPA 3PHQA 3D18A 3NCYP 5DGQA 5GISH 4D3CH 5DMGD 5D7JD 3P77B 4XP5H 1KJ2A 2VDQH 3VXSD 1OT2A 3QHZL 1YECH 3CAFA 5MEQB 1BZQK 4UILL 2VLRD 5CEZD 2BNQA 3B2UD 5CJ5A 1KXVC 3QI9B 4JO4L 2GTWB 1P4IH 5JW3H 4C56D 4RZCA 3O2DL 5DGRA 2DKMA 1OTUC 1QG3A 1ZHNA 5BS0E 2LABA 4PJAA 3MRCB 3MREB 2ADGB 1WBXA 3GIVB 4NO3B 5CMAA 2X4NA 3Q5TA 1JNLH 1JF1A 1PW3A 3IFOA 3FB5B 2X05A 1FPTL 3GK8L 2H1PH 4TSBH 1EBPA 2HN7A 4YHML 1AGEB 4FABL 2FBJL 5FHAH 1PGRB 3LEYL 1C7SA 1GXEA 3C87A 1U92B 4FNLL 3AY4C 4FQLH 5I75B 4HWEL 3IRPX 3ZYJA 1A6ZA 4X98B 3MCKA 3UPRB 4ZO9A 1AE6H 1I9RL 3CVIL 1SY6L 5EO9B 2JLLA 3EYUL 4JAMA 4YBLC 5AD0A 1EVUA 3FO2B 3QNZA 4AM0A 5LBSH 4J2XA 4A6YB 1GZPB 2DLHA 4KH2A 4MHHI 4OZ4B 4X80L 3S5LG 2JK5A 3OAYK 4XCYB 3BIAX 1SJHB 5ISZE 3QQ4A 2BMKA 2E7BA 1RSFA 3VFVB 2UYLB 1ZHLA 1RIUL 1SEBA 4PJDE 3U36A 2DYPD 1P4LB 4PB9L 5IEHB 5J9PA 4QHNA 1KT2A 4GLRH 5DRWA 2V9QA 4KKAC 3QHZH 3D3VB 2KQNA 3QAZC 4UILH 1XR9A 1MF2L 1P7QA 4C57C 3DTXB 4JY4B 5D72L 5ACZB 1MSPA 1NANH 4JO4H 5EC2A 2AJSL 3O2DH 4RGOL 5CFHA 2YRPA 3KPTA 3NFPA 2XACC 2NY5C 1T2QL 4XCEA 5IIEA 2VUYA 3LEXA 4AH2A 3T4YB 2B20A 1JYVA 1KC5H 1FPTH 1OWRM 4JY6A 1K8IB 2OS7A 1BX2A 4YHMH 5KANG 4QNPF 4HXBL 4FABH 2FBJH 1ULVA 3QUMB 3LEYH 3MRNB 4LKXA 3T77A 4LHUD 4FNLH 4DCQA 2H8PA 4HWEH 4G9FD 3B9AA 2WINB 3PXJA 1KSRA 4H88H 3UTTB 1I9RH 2PYFB 1SY6H 3CVIH 3RWFA 1LNUB 5L7XL 3EYUH 2CLRA 4NRZA 5D7JA 3MV11 3VXSA 1MVFA 3VWJB 2GFBB 2J2ZA 2VLRA 5SX4I 4G8FA 4XVUD 2G5BB 4BSVA 1D5XB 4X80H 4KTYA 3LKRB 2DB8A 3NACL 1O7VA 4C56A 4XP4L 5AWNL 5C0AD 2A73A 1HIML 1T1YB 4HIHA 4CAGA 1QBBA 1RIUH 2H26A 1R3KB 3H9HA 1YQVL 4TRPL 4ZXBD 1BHGA 4PB9H 4OCRL 4QOKB 5ISZA 3FZUC 1NGZB 5I9QB 4GS7B 4NT6A 3QPQD 3MRKA 4U1GB 3O6FD 5D72H 1HH9B 3MLTA 2AJSH 3ARUA 5CBEB 5FKPA 4CRPA 5C0FA 1AXTL 4XNZB 2FYYA 3QDGB 1N8ZB 4PRHB 5IJKC 1T2QH 3F7RA 5ENWA 5JZ7D 4BQBA 3DO7A 5C0AE 4UI2A 2M2DA 3RGVD 1KPRA 3EYQD 4WO4D 1CK0L 5IROC 1U8KB 2GJ6B 4X7TB 3BGFC 4ZUWB 4FFZL 2L7JA 3S3JA 5BXFB 2X4QB 4HXBH 3D0LA 5FA4B 2CDFB 1P1ZB 1S9WA 1A8JH 5CWSB 4BFIB 1OF2A 5T3ZD 4NO0D 1JN6B 4GRWB 4M7KL 3HMXA 1CIDA 3DMMB 3HLAA 1J86A 4WY7L 1F00I 2A6IB 5L7XH 2DYPA 2NR6C 5D2LB 1G7IA 4OCXH 3EDDA 3L3GB 3S96A 1I7ZA 2EDFA 1LEKB 5EU5B 4QY8A 1AXSA 5FOBB 2BC4B 1RUPH 4DN4L 1U0QA 3NACH 3WXVL 2EH8L 4XP4H 5AWNH 2V7HB 2R0ZL 3N50A 1HIMH 5J6GB 2E7LA 1I3RA 4YZFE 1YQVH 2X5PA 5DC4B 4TRPH 5SV4A 1X3DA 3ZE1F 5EBGA 5IVNA 3VXPA 2Z8VC 4OCRH 1CFTB 2DQFB 1FZMA 1MQKL 2IBBA 4PJGB 2QADB 1X5KA 3GSXA 5KVGL 1PG7L 1QVOA 5DO2C 1BJMA 2APWA 1PQZB 2NY2C 3TH3T 3NCJL 3RPKA 3K2MC 2RCSL 4LHUA 1FFPA 1AXTH 2NY1D 4G9FA 4XC3L 1JP5A 2BVQA 3TWCL 5CP3A 1NC2A 4FQJL 1BQHB 4KRMB 3JTSA 1WWWX 3FL7A 4BUHA 1NC4D 3NFNB 3CFDA 2JKXA 2VUOA 4ONHA 3G5YA 1CK0H 1IEBA 1FGVL 2V2WA 4U0RC 4Y19B 4WFFE 4FFZH 1WCBA 4PJXB 4WHTB 2G5RA 1KJMA 2WLZA 3T3PE 3VFPA 3X3FL 3HPJA 2BNUA 5HYQA 1KJVB 4QRQB 4M7KH 5C0AA 2GSGB 3L5WA 3QFJB 5TH2A 3T2PA 3L3DA 4WY7H 3BRFA 3IDUA 5GS2H 3U4AA 1CF8H 4ZXBA 4HQQL 1P9MA 4C54A 4NPYB 1CGUA 3UTSD 2W0PA 3PV7A 2ATKB 1DQQB 1MVUA 4I5BB 1DN0B 5I17A 3WXWL 5SWQB 1J18A 3OF6D 4DAGL 4DN4H 3BW9A 3BRDA 3WXVH 1NDGB 2EH8H 1GC1L 2R0ZH 3FQTB 1WZMA 1X5FA 3IDIA 2VNCA 4JEGB 3ALXA 5BMFL 5INCA 3S98A 1XCQB 1P4BL 3ABZA 5F71A 3HC0A 1MQKH 3RGVA 1HHHB 3MNVB 1EFQA 4WO4A 5L9DL 5KVGH 3C08L 1R5WA 2Z35B 4OAWA 1PG7H 4JFXB 5ANMA 4ZUVB 1WAAE 3PWVA 4J8RB 3UTOA 3KPMA 3QNYB 3NCJH 1DN2A 2RCSH 4NO0A 4F7CA 1J8HB 1KTDB 1Z0NA 3EGSA 4XC3H 4RGMC 3O11B 1S9KC 4FQJH 4OTXL 3FRUB 2HTKD 4UQ3A 2X4UA 5KVEL 4Q9RL 1QUNA 4QRUB 3RHWF 3A6OA 1ZLVH 5HJ3A 3ARWA 3BP5B 1IMHC 1FGVH 3QYCA 1URLA 4HV8A 4H8WL 2VKWA 4KI5F 2VZVA 4HIEB 4WTWA 3X3FH 2ZCHL 3LPGA 1GOHA 4TVPE 3UYOD 1J0IA 3MGOA 1DLFL 3VFUB 2PW1A 2ED7A 3FFCE 1YQ2A 5GS3A 3TZVB 1BF8A 3BEWB 1ZT4A 1KUMA 2APTA 4QRTB 3VRLF 1F4WL 3HNTL 2G60L 1XIWB 3M17A 5DMIL 4AIZB 3ARQA 2IAMD 2GY7B 4ZAKB 3BZEA 3WXWH 3ULVF 4UAOC 4DAGH 1YN6A 3L3KA 3QXDB 5FAAA 2GJJA 5D7JC 1GC1H 5E5UB 4UNUA 3UCRA 5IMMA 4R2GD 3NCFB 3QIWC 2F8VA 5BMFH 3EOAB 3PDGA 1PBYA 2YRZA 5TJWK 4BZYA 5HI4D 1P4BH 3B2UC 4FMKA 2V9TA 3EKCA 3NMEA 1NC4A 2MQCA 3VGBA 1D5IL 4JVUA 2BDNL 4XZUB 1V8HA 5C07B 3PIQA 5L9DH 3T4AB 3UZVB 3C08H 4PJBE 4P9ML 1VFMA 4IDJL 1R3JB 1UB6B 4YDVB 2FR4A 5E94A 2UUDH 5K9JL 4KDVA 3DX6B 5KANI 3R0MA 2HJLA 3TP4A 3VMPA 4I2XE 3QXAB 4Z8FL 2BVTA 1X4YA 4OTXH 3LQAL 4TUJB 1T1XA 4Q9RH 5KVEH 3LAFA 5B3JF 1WAAA 4RMSA 1G6RL 2EE3A 5DR5L 3FO9A 5KSAD 4H8WH 5EOCL 5EFIB 1QFWM 2BY3A 5DJ0A 3OF6A 3I85A 4CDGC 3AVEA 2VOTA 1G1CA 2Y4SA 3F5WB 4LDLB 4PJ5B 4Z5RB 3WE6B 4JKMA 4UIKL 1NEZG 2AJUL 2C1OB 5L0QC 5DJCA 1T2XA 4XMLH 1F4WH 5D7IA 4NNXA 2G60H 2VABA 3V6ZB 5H35A 3O3AA 4MB3A 3VXRD 4HX1A 1UCBL 1XGYL 1E4XL 3HB3D 5FB8B 5INDB 2ZSWB 4N0FB 3MRJA 1G1YA 2WBJD 4OF7A 4ZOAA 1S9VB 4P4RA 3HG1B 1BPVA 3DRQB 3LH2L 1A6AA 4H26B 5SWZD 4AENB 1J0KA 3Q2CA 4UNTA 3FB7A 3QEHA 1AGDB 4G42A 3T65A 4XT1C 2ESVB 3OR6B 1ZSDA 1D5IH 2NY4D 4HUXA 2BDNH 4Y4KA 1MHEB 3OJVC 2W0FA 3QULB 4P9MH 1EEYA 4DGIL 3D0VB 2E7LC 3G5ZB 4IDJH 2ZPKL 3F7VB 4CMMB 1EERB 3VXRE 5K9JH 4LLVB 4XRCA 3MBXH 5GGUA 1ZVHA 4Z8FH 4MD4B 4DW2L 3LQAH 3RVTC 5BV7B 1N64L 4PJBA 3EW3B 3FRPA 1FFNA 1G9EA 1JF6A 1PD6A 4LAQL 2NX5B 3W9DA 3DUUB 2H2SD 1EXUB 1G6RH 5T3XD 4U1SA 4XXCA 5I30L 2IAMA 4OD3L 5EOCH 4WI9A 5IW6A 3ZTNL 1O7SA 3VDCA 2EDKA 3CC5B 4P48A 3U30B 4KJPD 4QYOB 4WU5B 1EA9C 1JK8B 4XVUC 4UIKH 1A7OL 2AJUH 4RISL 1PY4A 2F58L 2P1YA 3UPAA 2MHAB 4PD4K 4AK1A 1A1OA 4RAUB 1UCBH 1XGYH 2G2RB 1E4XH 3HUJB 4S1RL 4BSWB 1DVFC 1CBVL 1CDUA 3SJVB 2OJEA 1YEKL 4WUUB 3NZ8B 1RZKC 1IGTB 1M1SA 4IIQA 3UMTA 4ZXBC 3LH2H 4JKKA 1MLCB 3L3OB