4XPXA

Crystal structure of hemerythrin:wild-type
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
b'ALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWLVNHIPKVDKLYGPCLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
molecule tags Oxygen binding protein
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
total genus 58
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpxA00
1HMDA 3AGUA 2HMQA 2HMZA 4XPYA 4XQ1A 1A7DA 1I4YA 2MHRA 3AGTA 3WHNA 1I4ZA 1HMOA 2AWYA 2AVKA 4XPWA 1A7EA 3WAQA 2AWCA 4XPXA
chains in the Genus database with same CATH superfamily
2ZD9A 3CQZA 3NG1A 4MQ9F 2Y3DA 4LDQA 4G7ZF 4OIPF 3L1MA 1H7IA 2GAQA 4BJ1A 2HZ8A 2HS5A 3R7CA 1RXQA 1GS9A 1Q0DA 4MVSA 3KL4A 4E0IA 3WHNA 1SF8A 3W2WA 4EWCA 2EIJC 2LIGA 5COMA 4YT8A 5K0IA 4J32B 5KYXA 2TMVP 2BE5F 3LNMB 4CJGA 3HLZA 3DZAA 2NG1A 2G62A 2QNLA 2ZXPA 3GODA 4FESA 3EHMA 1ORSC 5L0CA 1WN0A 3IHUA 2ICWG 1Z3IX 2CNWA 2VCBA 3C18A 2YKZA 4JC7A 4XQ1A 1MNDA 2ZXOA 4F4BA 1A7VA 1BZ4A 4DVYP 4DJ9A 4U5HA 4OIRF 3U0CA 3TK0A 3DAGA 1ZHWA 1VYIA 2A0BA 2EPLX 3ASOC 4MTOA 3FDQA 4EBKA 4CJOA 3G50A 3H2UA 3N2ZB 1A0BA 3GWNA 4FAPB 2LCHA 1PV3A 1U89A 3IPMO 2DYRC 3NMKA 4Z9IA 4Z9JA 2XLMA 5DS6A 1UG7A 3SXZA 4CIPA 2NPUA 3CSKA 4EKWA 1YLMA 3RQGA 3M4CA 5JLIA 5KYYB 4Q5SF 3LNRA 1VYKA 2WB7A 3SXYA 2XL8A 5COFA 2A6EF 4KC9A 1LE2A 2J9BA 4CBEA 1Q0KA 3L34A 3U2MA 3ABKC 2A68F 3ZTZA 3WG7C 4P9FA 5E33A 1BR4A 4XEFA 2WZLA 2HMZA 3ZC4A 1YYJA 1YZAA 1KU2A 2CYDA 3CZ6A 3JCUQ 3V5XA 1D1BA 2I15A 1OXBA 2AU5A 3KYJA 1RJ9B 1YJGA 3AG1C 1VMAA 3TOLA 2MYSA 4U5EE 2XXAA 2H7BA 4MW3A 2NUTA 3IQTA 2XLOA 3TJ5A 3RVZA 2UUHA 4D4NA 1E85A 4UDVA 3POVA 1HE1A 3GWLA 3I5QA 3SXKA 2QTVA 5A6KA 2L81A 4C7OA 1OW8A 2EINC 2HSQA 3MLGA 1ZW2A 5AGFA 1EI7A 2E87A 2LD6A 4JKVA 4N6CA 1I4ZA 2J7PD 3WODF 2YRFA 2ZXWC 2IXNA 4YT2A 4JJFA 4BJ6A 1XWJA 5F5FA 5FCLA 2NUPB 4L6RA 2PFDA 1RCPA 3H2VA 4AE4A 3BEHA 1TWHA 1GQAA 3NMIA 2ETSA 2AP3A 2KC3A 4XWJA 3U2LA 5JS5A 1H9GA 2V26A 1TR2A 1T6QA 2A6HF 2HJMA 3U9MA 4EBBA 1BDJB 2HFIA 4OINF 1Y6DA 3T6JA 3B0PA 1YA9A 5FZTA 4AK9A 1T5OA 2X51A 3V7OA 4X0RA 1OQCA 5L0JA 5L3VA 4U5DE 2IXOA 3UGOA 2Q9AA 1ST6A 3V5ZA 5JP7A 5B3SC 4K7BA 2GA0A 4CS8C 3TQOA 2MWQA 2X0CA 3F46A 5KYYA 4EHPA 2XRHA 1JR8A 2OOCA 4I44A 4Q7CA 4BJ5A 3EJNA 1L3PA 2YLDA 3RIPA 3U5SA 3NYLA 4BJ6C 1C02A 3PDMP 4G7HF 3A9CA 3R2PA 2VCCA 3VAYA 1LIHA 4IAQA 3B0UX 1OCOC 1SZIA 3DWWA 1ZZPA 4XTKA 5TJ5E 1S7ZA 2JD3A 4XLNF 1YAUO 2J8WA 1HY5A 4R32A 2XL4A 3UGPA 1SYQA 3ZTMA 5F5HA 2R7SA 1H9TA 3ASNC 2Y3BA 3GEEA 3K6BA 2AWYA 2NSGA 4DVZA 2NSFA 4BG0A 3T6GB 2PX0A 3VRCA 1HE9A 4M63A 1OCRC 1YDIA 1PD0A 2VCAA 2IM8A 2FAPB 2J9UA 2CCYA 3AGUA 3KMIA 3M15A 3NMJA 2YLGA 4JTCB 4MW8A 4XPYA 2H8AA 5BUOA 2R02A 3NKDA 2JX0A 1JOGA 3L0IA 1O5HA 4GYTA 3JSZA 3US6A 3W4YA 2BC5A 2IOQA 2YVKA 3RQFA 2MHRA 3W8HA 2QLAA 4DRIB 5JUAA 1CPRA 2G3VA 3ZSUA 4OIOF 3SEOA 3C63A 2R7RA 4KNVA 1ORJA 1G4US 3KPHA 2J45A 3FOOA 5A6BA 2XXAB 3GM2A 3U3BA 4A2NB 3OEOA 3EG9A 2PF4E 3K1IA 1M57C 2KK1A 3ATPA 3ZDLA 3JYYA 1SMYF 2R05A 1NU9C 4QI0A 4LERA 4ZLCA 3B9QA 1APCA 3JRTA 2Q7RA 4H4KC 4J7TA 2ZXRA 3K1IC 3EPVA 1EKYA 1OR3A 2H7VC 2KNHA 1I4YA 3GEIA 3ZVRA 2Q00A 2WVOA 5HV9A 2XLDA 4HFFB 5AC5A 5EGYA 2WZGA 4JW1A 4XPXA 4E7SA 2R03A 4I1OB 1V55C 3HNJA 2Y3HA 3LUTB 1WTYA 3EGDB 3N24A 2HV6A 1LE4A 1ORYA 4IARA 1FFHA 4LLEA 4IB4A 2XLHA 5CI9A 4MNDA 5DVWA 3F47A 3HNLA 1LVKA 1NZEA 2EPMX 4O7GA 4U5FE 5E3CA 1M6TA 3DJUB 2H7OA 4O6YA 1B68A 1VLSA 3K1HA 3JRMO 4GEHA 4J7YA 3N0TA 2W45A 3FXHA 4ANJA 2L9JA 1VB5A 1NFNA 1WATA 1HW1A 3DKAA 1Z63A 2KQ9A 2OCCC 3U9JA 2L6FA 1WOLA 1GM5A 4YK5A 3GM1A 3FOPA 4KI2A 3FMSA 1G5ZA 2J9WA 3MYFA 1AVOB 4PJLA 4CX9A 2F22A 2EPKX 3EGXA 2D4UA 2P1AA 1ZYRF 3GANA 3LEOA 1EA8A 4H54A 4JTAB 5DQZA 2R7OA 4HFKB 5JVEA 2A1DD 2P61A 2JPUA 3OWTA 1OXKA 2QE9A 2YQYA 3RYLA 3UMKA 4EBJA 1U0BB 2O9XA 1SR2A 2YL3A 3DM9B 1LM3B 3C62A 3NKEA 4PJNA 3LESA 3EQLF 1QLEC 2ASRA 3RKOF 4YT4A 4RDAA 4NTFA 1Q0MA 1E86A 5DQTA 3Q6NA 3VYWA 3CAXA 2YL7A 3QTHA 2DYSC 4XEKA 5A6JA 1D1AA 2VC9A 3EGXB 2Z15A 1FR0A 3BRJA 5L0IA 3NRHA 1R5ID 1WGWA 2Q9BA 4WGZA 3LEVA 1G4WR 1ZVZA 1D1CA 4IJJA 5GPGB 1CGME 3S29A 2OU6A 4LLCA 1QQ3A 3PCVA 3TOMA 4YL3A 2L6GA 5L0HA 3C8GD 5D91A 1AEPA 1TQGA 1OW6A 4G7OF 1Y4CA 4JVSA 3M79A 3H65A 4XPWA 3O6XA 4YN0B 1ZHXA 2EIKC 2OEVA 4QDLA 2LFDA 5D92A 2C03A 1MMDA 2PNOA 1HMOA 1K04A 4OD5A 4PJMA 3T9OA 3HNIA 2UUIA 4YJWA 3KYIA 3TJ6A 1M2VA 4YL1A 3U3FA 4O6MA 2EIMC 5AC4A 1JMWA 5T1DB 4CS9A 2W4BA 4G78A 2Q4FA 4ONSA 4JE9A 5B3IA 5T3TA 1FTSA 2WZFA 1NG1A 3L8IA 4D4XA 1OCCC 5E3AA 3L8JA 3HNKA 3RH3A 3W2VA 1NLXA 1Z23A 3K7DA 4U5BE 5E2QA 1Z5ZA 2QUPA 2XLVA 5KYXB 3AGTA 1OCZC 2OKUA 3EH1A 4LDRA 2WVQA 3AQBA 4JRZA 3C8ZA 2A69F 1T6UA 4IGGA 1R4TA 3EZIA 4K0DA 3S28A 2Q3TA 3I5PA 3SNHA 4C3DA 1LS4A 4NTAA 3U8PA 4DXWA 3E70C 1RKEA 2IXPA 1E2XA 2OG2A 3DI5A 3QW1A 4IRUA 4O6NA 2R7QA 1NBBA 2AWCA 4JEAA 4MVZA 4DRJB 5A6BD 1F1MA 1C17M 5B1AC 1ZHYA 2XS1A 4U9EA 4MTFA 3C7JA 1Q0FA 3GORA 3S27A 1ZHTA 2HMQA 2NUPA 5L3QA 1IW7F 2FFHA 2KW3C 5CIVA 1AUEA 3WAQA 3X1OA 1E83A 2HV7A 4KBLA 4MVUA 3ZIBA 4AX2A 3HKKA 4IWBA 4MVRA 4CSAA 3EFOB 4DRHB 3FVYA 4E7ZA 4DBQA 4ULWA 2D5RB 4A4AA 1N1CA 1K05A 1NU7D 2HKVA 1TFOB 1ZU5A 4E17A 4W8PA 2CNWD 5EK0A 2IYLD 2W4MA 4KNWA 3DD7A 2R7TA 3LS1A 1O87A 3Q6MA 1XZPA 4YWQA 4CS9C 3W8IA 2RD9A 3O10A 4ER9A 3VF0A 5DS4A 1T9KA 3MYIA 4QI2A 2R7XA 3T4RA 2PBEA 3PMRA 3QVYA 3E9VA 3DM5A 1MQVA 4E0HA 1JPJA 1A41A 1OKKD 1QKRA 4YL0A 4PJJA 2KYHA 2OJQA 3K66A 4RD9A 5KYUB 1RMVA 1M56C 2KJGA 2XM4A 3K33A 4J30B 2GDCA 3IQCA 3AJMA 5KYWB 3G4XA 1LI7A 1KTMA 2HUJA 4PACA 4BPMA 4E18A 4I1MA 4JCHA 4AL1A 3CEXA 3AG4C 3GEHA 5T3WA 3ABMC 3B71A 3ECSA 3QW0A 5F28E 3Q7GA 3VM6A 3QMKA 2XSEA 1D0ZA 1YARO 3UNGC 5KYNA 1VOMA 3UMHA 1DOWA 2DGJA 1CGNA 2VB6A 2M4EA 3ITFA 3RQEA 2B0HA 3LAYA 4PR9A 4NQFA 2WVNA 3QZCA 4WGYA 1G8XA 3C8GA 1YA7O 4I3MA 2M64A 5JSLA 4AL0A 5JT4A 4XLPF 4JEBA 1ZU4A 2J0WA 3FAPB 3I4UA 2AVKA 4JCZA 4O79A 3B29A 5COGA 4CIHA 2LFFA 3JT1A 4U9DA 1LS1A 2FGYA 1FMWA 2IBFA 3DAFA 1Z7Qc 3SZRA 4CDVA 1E84A 3TULA 4CDAA 1MMGA 1JRAA 2XM0A 1RJ9A 3EGDA 5BQGA 1TWGA 3T6BA 5EHHA 2ZPAA 4CS8A 5L0GA 3S90A 4P9TA 4DBRA 2OQMA 1QPUA 2KSFA 3MX3A 4FWVA 4CDYA 1FNTc 1ZW3A 3X2QC 1V4AA 1OKKA 4C7OB 4JTDB 4PFOA 2PP4A 3TD7A 1V54C 4WABA 3RW0A 3C8GB 2I8BA 2BL2A 3JZ0A 4MVQA 5CI8A 5A6AA 2YL1A 1WWPA 4PFPA 5B1BC 3LJBA 3KH2A 4MTGA 3FHDA 2L6HA 1V74B 4WJ0A 4Q4ZF 1DOVA 3QVZA 4DOZA 2YWAA 1PCXA 2WL8A 4N6HA 1QZXA 2DB4A 1O3UA 1BR1A 1LKXA 1GGQA 3JSEO 1FFTC 2J9VA 1YVIA 4YT5A 2HJ3A 2XS8A 2Q9CA 1OW7A 3S0XA 4CS7A 3B0VC 4MVOA 3V5YA 256BA 5DS5A 1WASA 3NYMA 3G4ZA 4NTBA 4JIOA 4EUKB 4P6IC 2YL0A 5KYWA 2EPNA 4NC3A 4MVMA 1CPQA 2A0UA 1J8YF 2XLEA 3SYNA 5L0DA 3EHNA 4JJGA 4NY3A 2V3CC 1IZMA 1D0XA 3NDBB 3LLIA 2P6VA 3EG9B 1Q0GA 4JURI 1ZHZA 4N4WA 3EZHA 1QVXA 2PX3A 2YLIA 3DMDA 4U5GA 4JZAA 4OIQF 4LDKA 2J0XA 2GWWA 1LI5A 2LSEA 2Y3GA 1XZQA 3MFNA 5KYUA 2EPOA 1C03A 1T01A 4CSAC 4C3EA 3HJCA 3GM3A 1YZCA 3JYHA 5BQHA 1L7CA 2R7UA 4FX5A 2LP4A 2GFHA 2YZSA 2YEVA 1I5NA 1PD1A 3AOUA 1Z6AA 4U5CE 4BEMJ 1J8MF 3AG2C 3O39A 1M2OA 3HTKC 4XEVA 2L7AA 2CGEA 1A7EA 2XLWA 1TKNA 3RF3A 2CW0F 3UMIA 3UR3C 1MMAA 2R7VA 3KKBA 4C3BA 3O55A 2J7PA 5L0FA 2DI3A 3J06A 2VH3A 3DXJF 5A69A 1EQ1A 3SXMA 3ABLC 2C04A 1FMVA 3IQ5A 1RKEB 4HE8D 2RSEB 2LK4A 3RFYA 1BBHA 5JRAA 2IXMA 3RVYA 3ZQYA 3ZG1A 1T6IA 2Y69C 1U6HA 2HSBA 3DE8A 3JTLO 1TWCA 3A11A 4Z9HA 5IY5C 3LS0A 3PHF2 2P0NA 1W2WA 2R25A 1MNEA 1VK5A 4G0HA 2J46A 1MMNA 3AG3C 3EFOA 1LPEA 4IAOA 4B6IA 1JPNA 2P7VA 1RKCA 2VASA 2LQGA 4OD4A 5HSWA 1TWAA 3IEEA 1D0YA 3ZQVA 1K40A 4LACB 4MS2A 3IQ6A 2CDQA 4PK4A 1QSPA 1VLTA 2YHSA 4BEJA 2R9RB 4N06A 5DLJA 1HW2A 1BR2A 4W8KA 4BJ5C 1S05A 1CGOA 2NUTB 2B0JA 1HMDA 2R7WA 1NFOA 3S9OA 4ZLDA 1A7DA 1OR2A 5BQIA 4NCQA 4AE4B 3S84A 4EIYA 1KNYA 3Q7LA 1NSGB 3M4BA 4RBNA 1JAFA 1FAPB 3DJNB 2KGOA 1M2VB 3NYJA 3OA1A 2QY9A 4HEAJ 3DE9A 1H6GA 2Y39A 3U8VA 3FAJA 2XL6A 4K1OA 2OJED 2W9YA 2EILC 3M1CB 4BJTA 1UFBA 3MBGA 3EH2A 1YYXA 2G3KA 3SP1A 2OEXA 3ZWIA 4ULVA 1VTMP 3LLKA 3AQCA 1TFKB 4GQHA
chains in the Genus database with same CATH topology
1HMDA 3AGUA 2HMQA 2HMZA 4XPYA 4XQ1A 1A7DA 1I4YA 2MHRA 3AGTA 3WHNA 1I4ZA 1HMOA 2AWYA 2AVKA 4XPWA 1A7EA 3WAQA 2AWCA 4XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMD A;  3AGU A;  2HMQ A;  2HMZ A;  4XPY A;  4XQ1 A;  1A7D A;  1I4Y A;  2MHR A;  3AGT A;  3WHN A;  1I4Z A;  1HMO A;  2AWY A;  2AVK A;  4XPW A;  1A7E A;  3WAQ A;  2AWC A;  4XPX A; 
#chains in the Genus database with same CATH topology
 2ZD9 A;  3CQZ A;  3NG1 A;  4MQ9 F;  2Y3D A;  4LDQ A;  4G7Z F;  4OIP F;  3L1M A;  1H7I A;  2GAQ A;  4BJ1 A;  2HZ8 A;  2HS5 A;  3R7C A;  1RXQ A;  1GS9 A;  1Q0D A;  4MVS A;  3KL4 A;  4E0I A;  3WHN A;  1SF8 A;  3W2W A;  4EWC A;  2EIJ C;  2LIG A;  5COM A;  4YT8 A;  5K0I A;  4J32 B;  5KYX A;  2TMV P;  2BE5 F;  3LNM B;  4CJG A;  3HLZ A;  3DZA A;  2NG1 A;  2G62 A;  2QNL A;  2ZXP A;  3GOD A;  4FES A;  3EHM A;  1ORS C;  5L0C A;  1WN0 A;  3IHU A;  2ICW G;  1Z3I X;  2CNW A;  2VCB A;  3C18 A;  2YKZ A;  4JC7 A;  4XQ1 A;  1MND A;  2ZXO A;  4F4B A;  1A7V A;  1BZ4 A;  4DVY P;  4DJ9 A;  4U5H A;  4OIR F;  3U0C A;  3TK0 A;  3DAG A;  1ZHW A;  1VYI A;  2A0B A;  2EPL X;  3ASO C;  4MTO A;  3FDQ A;  4EBK A;  4CJO A;  3G50 A;  3H2U A;  3N2Z B;  1A0B A;  3GWN A;  4FAP B;  2LCH A;  1PV3 A;  1U89 A;  3IPM O;  2DYR C;  3NMK A;  4Z9I A;  4Z9J A;  2XLM A;  5DS6 A;  1UG7 A;  3SXZ A;  4CIP A;  2NPU A;  3CSK A;  4EKW A;  1YLM A;  3RQG A;  3M4C A;  5JLI A;  5KYY B;  4Q5S F;  3LNR A;  1VYK A;  2WB7 A;  3SXY A;  2XL8 A;  5COF A;  2A6E F;  4KC9 A;  1LE2 A;  2J9B A;  4CBE A;  1Q0K A;  3L34 A;  3U2M A;  3ABK C;  2A68 F;  3ZTZ A;  3WG7 C;  4P9F A;  5E33 A;  1BR4 A;  4XEF A;  2WZL A;  2HMZ A;  3ZC4 A;  1YYJ A;  1YZA A;  1KU2 A;  2CYD A;  3CZ6 A;  3JCU Q;  3V5X A;  1D1B A;  2I15 A;  1OXB A;  2AU5 A;  3KYJ A;  1RJ9 B;  1YJG A;  3AG1 C;  1VMA A;  3TOL A;  2MYS A;  4U5E E;  2XXA A;  2H7B A;  4MW3 A;  2NUT A;  3IQT A;  2XLO A;  3TJ5 A;  3RVZ A;  2UUH A;  4D4N A;  1E85 A;  4UDV A;  3POV A;  1HE1 A;  3GWL A;  3I5Q A;  3SXK A;  2QTV A;  5A6K A;  2L81 A;  4C7O A;  1OW8 A;  2EIN C;  2HSQ A;  3MLG A;  1ZW2 A;  5AGF A;  1EI7 A;  2E87 A;  2LD6 A;  4JKV A;  4N6C A;  1I4Z A;  2J7P D;  3WOD F;  2YRF A;  2ZXW C;  2IXN A;  4YT2 A;  4JJF A;  4BJ6 A;  1XWJ A;  5F5F A;  5FCL A;  2NUP B;  4L6R A;  2PFD A;  1RCP A;  3H2V A;  4AE4 A;  3BEH A;  1TWH A;  1GQA A;  3NMI A;  2ETS A;  2AP3 A;  2KC3 A;  4XWJ A;  3U2L A;  5JS5 A;  1H9G A;  2V26 A;  1TR2 A;  1T6Q A;  2A6H F;  2HJM A;  3U9M A;  4EBB A;  1BDJ B;  2HFI A;  4OIN F;  1Y6D A;  3T6J A;  3B0P A;  1YA9 A;  5FZT A;  4AK9 A;  1T5O A;  2X51 A;  3V7O A;  4X0R A;  1OQC A;  5L0J A;  5L3V A;  4U5D E;  2IXO A;  3UGO A;  2Q9A A;  1ST6 A;  3V5Z A;  5JP7 A;  5B3S C;  4K7B A;  2GA0 A;  4CS8 C;  3TQO A;  2MWQ A;  2X0C A;  3F46 A;  5KYY A;  4EHP A;  2XRH A;  1JR8 A;  2OOC A;  4I44 A;  4Q7C A;  4BJ5 A;  3EJN A;  1L3P A;  2YLD A;  3RIP A;  3U5S A;  3NYL A;  4BJ6 C;  1C02 A;  3PDM P;  4G7H F;  3A9C A;  3R2P A;  2VCC A;  3VAY A;  1LIH A;  4IAQ A;  3B0U X;  1OCO C;  1SZI A;  3DWW A;  1ZZP A;  4XTK A;  5TJ5 E;  1S7Z A;  2JD3 A;  4XLN F;  1YAU O;  2J8W A;  1HY5 A;  4R32 A;  2XL4 A;  3UGP A;  1SYQ A;  3ZTM A;  5F5H A;  2R7S A;  1H9T A;  3ASN C;  2Y3B A;  3GEE A;  3K6B A;  2AWY A;  2NSG A;  4DVZ A;  2NSF A;  4BG0 A;  3T6G B;  2PX0 A;  3VRC A;  1HE9 A;  4M63 A;  1OCR C;  1YDI A;  1PD0 A;  2VCA A;  2IM8 A;  2FAP B;  2J9U A;  2CCY A;  3AGU A;  3KMI A;  3M15 A;  3NMJ A;  2YLG A;  4JTC B;  4MW8 A;  4XPY A;  2H8A A;  5BUO A;  2R02 A;  3NKD A;  2JX0 A;  1JOG A;  3L0I A;  1O5H A;  4GYT A;  3JSZ A;  3US6 A;  3W4Y A;  2BC5 A;  2IOQ A;  2YVK A;  3RQF A;  2MHR A;  3W8H A;  2QLA A;  4DRI B;  5JUA A;  1CPR A;  2G3V A;  3ZSU A;  4OIO F;  3SEO A;  3C63 A;  2R7R A;  4KNV A;  1ORJ A;  1G4U S;  3KPH A;  2J45 A;  3FOO A;  5A6B A;  2XXA B;  3GM2 A;  3U3B A;  4A2N B;  3OEO A;  3EG9 A;  2PF4 E;  3K1I A;  1M57 C;  2KK1 A;  3ATP A;  3ZDL A;  3JYY A;  1SMY F;  2R05 A;  1NU9 C;  4QI0 A;  4LER A;  4ZLC A;  3B9Q A;  1APC A;  3JRT A;  2Q7R A;  4H4K C;  4J7T A;  2ZXR A;  3K1I C;  3EPV A;  1EKY A;  1OR3 A;  2H7V C;  2KNH A;  1I4Y A;  3GEI A;  3ZVR A;  2Q00 A;  2WVO A;  5HV9 A;  2XLD A;  4HFF B;  5AC5 A;  5EGY A;  2WZG A;  4JW1 A;  4XPX A;  4E7S A;  2R03 A;  4I1O B;  1V55 C;  3HNJ A;  2Y3H A;  3LUT B;  1WTY A;  3EGD B;  3N24 A;  2HV6 A;  1LE4 A;  1ORY A;  4IAR A;  1FFH A;  4LLE A;  4IB4 A;  2XLH A;  5CI9 A;  4MND A;  5DVW A;  3F47 A;  3HNL A;  1LVK A;  1NZE A;  2EPM X;  4O7G A;  4U5F E;  5E3C A;  1M6T A;  3DJU B;  2H7O A;  4O6Y A;  1B68 A;  1VLS A;  3K1H A;  3JRM O;  4GEH A;  4J7Y A;  3N0T A;  2W45 A;  3FXH A;  4ANJ A;  2L9J A;  1VB5 A;  1NFN A;  1WAT A;  1HW1 A;  3DKA A;  1Z63 A;  2KQ9 A;  2OCC C;  3U9J A;  2L6F A;  1WOL A;  1GM5 A;  4YK5 A;  3GM1 A;  3FOP A;  4KI2 A;  3FMS A;  1G5Z A;  2J9W A;  3MYF A;  1AVO B;  4PJL A;  4CX9 A;  2F22 A;  2EPK X;  3EGX A;  2D4U A;  2P1A A;  1ZYR F;  3GAN A;  3LEO A;  1EA8 A;  4H54 A;  4JTA B;  5DQZ A;  2R7O A;  4HFK B;  5JVE A;  2A1D D;  2P61 A;  2JPU A;  3OWT A;  1OXK A;  2QE9 A;  2YQY A;  3RYL A;  3UMK A;  4EBJ A;  1U0B B;  2O9X A;  1SR2 A;  2YL3 A;  3DM9 B;  1LM3 B;  3C62 A;  3NKE A;  4PJN A;  3LES A;  3EQL F;  1QLE C;  2ASR A;  3RKO F;  4YT4 A;  4RDA A;  4NTF A;  1Q0M A;  1E86 A;  5DQT A;  3Q6N A;  3VYW A;  3CAX A;  2YL7 A;  3QTH A;  2DYS C;  4XEK A;  5A6J A;  1D1A A;  2VC9 A;  3EGX B;  2Z15 A;  1FR0 A;  3BRJ A;  5L0I A;  3NRH A;  1R5I D;  1WGW A;  2Q9B A;  4WGZ A;  3LEV A;  1G4W R;  1ZVZ A;  1D1C A;  4IJJ A;  5GPG B;  1CGM E;  3S29 A;  2OU6 A;  4LLC A;  1QQ3 A;  3PCV A;  3TOM A;  4YL3 A;  2L6G A;  5L0H A;  3C8G D;  5D91 A;  1AEP A;  1TQG A;  1OW6 A;  4G7O F;  1Y4C A;  4JVS A;  3M79 A;  3H65 A;  4XPW A;  3O6X A;  4YN0 B;  1ZHX A;  2EIK C;  2OEV A;  4QDL A;  2LFD A;  5D92 A;  2C03 A;  1MMD A;  2PNO A;  1HMO A;  1K04 A;  4OD5 A;  4PJM A;  3T9O A;  3HNI A;  2UUI A;  4YJW A;  3KYI A;  3TJ6 A;  1M2V A;  4YL1 A;  3U3F A;  4O6M A;  2EIM C;  5AC4 A;  1JMW A;  5T1D B;  4CS9 A;  2W4B A;  4G78 A;  2Q4F A;  4ONS A;  4JE9 A;  5B3I A;  5T3T A;  1FTS A;  2WZF A;  1NG1 A;  3L8I A;  4D4X A;  1OCC C;  5E3A A;  3L8J A;  3HNK A;  3RH3 A;  3W2V A;  1NLX A;  1Z23 A;  3K7D A;  4U5B E;  5E2Q A;  1Z5Z A;  2QUP A;  2XLV A;  5KYX B;  3AGT A;  1OCZ C;  2OKU A;  3EH1 A;  4LDR A;  2WVQ A;  3AQB A;  4JRZ A;  3C8Z A;  2A69 F;  1T6U A;  4IGG A;  1R4T A;  3EZI A;  4K0D A;  3S28 A;  2Q3T A;  3I5P A;  3SNH A;  4C3D A;  1LS4 A;  4NTA A;  3U8P A;  4DXW A;  3E70 C;  1RKE A;  2IXP A;  1E2X A;  2OG2 A;  3DI5 A;  3QW1 A;  4IRU A;  4O6N A;  2R7Q A;  1NBB A;  2AWC A;  4JEA A;  4MVZ A;  4DRJ B;  5A6B D;  1F1M A;  1C17 M;  5B1A C;  1ZHY A;  2XS1 A;  4U9E A;  4MTF A;  3C7J A;  1Q0F A;  3GOR A;  3S27 A;  1ZHT A;  2HMQ A;  2NUP A;  5L3Q A;  1IW7 F;  2FFH A;  2KW3 C;  5CIV A;  1AUE A;  3WAQ A;  3X1O A;  1E83 A;  2HV7 A;  4KBL A;  4MVU A;  3ZIB A;  4AX2 A;  3HKK A;  4IWB A;  4MVR A;  4CSA A;  3EFO B;  4DRH B;  3FVY A;  4E7Z A;  4DBQ A;  4ULW A;  2D5R B;  4A4A A;  1N1C A;  1K05 A;  1NU7 D;  2HKV A;  1TFO B;  1ZU5 A;  4E17 A;  4W8P A;  2CNW D;  5EK0 A;  2IYL D;  2W4M A;  4KNW A;  3DD7 A;  2R7T A;  3LS1 A;  1O87 A;  3Q6M A;  1XZP A;  4YWQ A;  4CS9 C;  3W8I A;  2RD9 A;  3O10 A;  4ER9 A;  3VF0 A;  5DS4 A;  1T9K A;  3MYI A;  4QI2 A;  2R7X A;  3T4R A;  2PBE A;  3PMR A;  3QVY A;  3E9V A;  3DM5 A;  1MQV A;  4E0H A;  1JPJ A;  1A41 A;  1OKK D;  1QKR A;  4YL0 A;  4PJJ A;  2KYH A;  2OJQ A;  3K66 A;  4RD9 A;  5KYU B;  1RMV A;  1M56 C;  2KJG A;  2XM4 A;  3K33 A;  4J30 B;  2GDC A;  3IQC A;  3AJM A;  5KYW B;  3G4X A;  1LI7 A;  1KTM A;  2HUJ A;  4PAC A;  4BPM A;  4E18 A;  4I1M A;  4JCH A;  4AL1 A;  3CEX A;  3AG4 C;  3GEH A;  5T3W A;  3ABM C;  3B71 A;  3ECS A;  3QW0 A;  5F28 E;  3Q7G A;  3VM6 A;  3QMK A;  2XSE A;  1D0Z A;  1YAR O;  3UNG C;  5KYN A;  1VOM A;  3UMH A;  1DOW A;  2DGJ A;  1CGN A;  2VB6 A;  2M4E A;  3ITF A;  3RQE A;  2B0H A;  3LAY A;  4PR9 A;  4NQF A;  2WVN A;  3QZC A;  4WGY A;  1G8X A;  3C8G A;  1YA7 O;  4I3M A;  2M64 A;  5JSL A;  4AL0 A;  5JT4 A;  4XLP F;  4JEB A;  1ZU4 A;  2J0W A;  3FAP B;  3I4U A;  2AVK A;  4JCZ A;  4O79 A;  3B29 A;  5COG A;  4CIH A;  2LFF A;  3JT1 A;  4U9D A;  1LS1 A;  2FGY A;  1FMW A;  2IBF A;  3DAF A;  1Z7Q c;  3SZR A;  4CDV A;  1E84 A;  3TUL A;  4CDA A;  1MMG A;  1JRA A;  2XM0 A;  1RJ9 A;  3EGD A;  5BQG A;  1TWG A;  3T6B A;  5EHH A;  2ZPA A;  4CS8 A;  5L0G A;  3S90 A;  4P9T A;  4DBR A;  2OQM A;  1QPU A;  2KSF A;  3MX3 A;  4FWV A;  4CDY A;  1FNT c;  1ZW3 A;  3X2Q C;  1V4A A;  1OKK A;  4C7O B;  4JTD B;  4PFO A;  2PP4 A;  3TD7 A;  1V54 C;  4WAB A;  3RW0 A;  3C8G B;  2I8B A;  2BL2 A;  3JZ0 A;  4MVQ A;  5CI8 A;  5A6A A;  2YL1 A;  1WWP A;  4PFP A;  5B1B C;  3LJB A;  3KH2 A;  4MTG A;  3FHD A;  2L6H A;  1V74 B;  4WJ0 A;  4Q4Z F;  1DOV A;  3QVZ A;  4DOZ A;  2YWA A;  1PCX A;  2WL8 A;  4N6H A;  1QZX A;  2DB4 A;  1O3U A;  1BR1 A;  1LKX A;  1GGQ A;  3JSE O;  1FFT C;  2J9V A;  1YVI A;  4YT5 A;  2HJ3 A;  2XS8 A;  2Q9C A;  1OW7 A;  3S0X A;  4CS7 A;  3B0V C;  4MVO A;  3V5Y A;  256B A;  5DS5 A;  1WAS A;  3NYM A;  3G4Z A;  4NTB A;  4JIO A;  4EUK B;  4P6I C;  2YL0 A;  5KYW A;  2EPN A;  4NC3 A;  4MVM A;  1CPQ A;  2A0U A;  1J8Y F;  2XLE A;  3SYN A;  5L0D A;  3EHN A;  4JJG A;  4NY3 A;  2V3C C;  1IZM A;  1D0X A;  3NDB B;  3LLI A;  2P6V A;  3EG9 B;  1Q0G A;  4JUR I;  1ZHZ A;  4N4W A;  3EZH A;  1QVX A;  2PX3 A;  2YLI A;  3DMD A;  4U5G A;  4JZA A;  4OIQ F;  4LDK A;  2J0X A;  2GWW A;  1LI5 A;  2LSE A;  2Y3G A;  1XZQ A;  3MFN A;  5KYU A;  2EPO A;  1C03 A;  1T01 A;  4CSA C;  4C3E A;  3HJC A;  3GM3 A;  1YZC A;  3JYH A;  5BQH A;  1L7C A;  2R7U A;  4FX5 A;  2LP4 A;  2GFH A;  2YZS A;  2YEV A;  1I5N A;  1PD1 A;  3AOU A;  1Z6A A;  4U5C E;  4BEM J;  1J8M F;  3AG2 C;  3O39 A;  1M2O A;  3HTK C;  4XEV A;  2L7A A;  2CGE A;  1A7E A;  2XLW A;  1TKN A;  3RF3 A;  2CW0 F;  3UMI A;  3UR3 C;  1MMA A;  2R7V A;  3KKB A;  4C3B A;  3O55 A;  2J7P A;  5L0F A;  2DI3 A;  3J06 A;  2VH3 A;  3DXJ F;  5A69 A;  1EQ1 A;  3SXM A;  3ABL C;  2C04 A;  1FMV A;  3IQ5 A;  1RKE B;  4HE8 D;  2RSE B;  2LK4 A;  3RFY A;  1BBH A;  5JRA A;  2IXM A;  3RVY A;  3ZQY A;  3ZG1 A;  1T6I A;  2Y69 C;  1U6H A;  2HSB A;  3DE8 A;  3JTL O;  1TWC A;  3A11 A;  4Z9H A;  5IY5 C;  3LS0 A;  3PHF 2;  2P0N A;  1W2W A;  2R25 A;  1MNE A;  1VK5 A;  4G0H A;  2J46 A;  1MMN A;  3AG3 C;  3EFO A;  1LPE A;  4IAO A;  4B6I A;  1JPN A;  2P7V A;  1RKC A;  2VAS A;  2LQG A;  4OD4 A;  5HSW A;  1TWA A;  3IEE A;  1D0Y A;  3ZQV A;  1K40 A;  4LAC B;  4MS2 A;  3IQ6 A;  2CDQ A;  4PK4 A;  1QSP A;  1VLT A;  2YHS A;  4BEJ A;  2R9R B;  4N06 A;  5DLJ A;  1HW2 A;  1BR2 A;  4W8K A;  4BJ5 C;  1S05 A;  1CGO A;  2NUT B;  2B0J A;  1HMD A;  2R7W A;  1NFO A;  3S9O A;  4ZLD A;  1A7D A;  1OR2 A;  5BQI A;  4NCQ A;  4AE4 B;  3S84 A;  4EIY A;  1KNY A;  3Q7L A;  1NSG B;  3M4B A;  4RBN A;  1JAF A;  1FAP B;  3DJN B;  2KGO A;  1M2V B;  3NYJ A;  3OA1 A;  2QY9 A;  4HEA J;  3DE9 A;  1H6G A;  2Y39 A;  3U8V A;  3FAJ A;  2XL6 A;  4K1O A;  2OJE D;  2W9Y A;  2EIL C;  3M1C B;  4BJT A;  1UFB A;  3MBG A;  3EH2 A;  1YYX A;  2G3K A;  3SP1 A;  2OEX A;  3ZWI A;  4ULV A;  1VTM P;  3LLK A;  3AQC A;  1TFK B;  4GQH A; 
#chains in the Genus database with same CATH homology
 1HMD A;  3AGU A;  2HMQ A;  2HMZ A;  4XPY A;  4XQ1 A;  1A7D A;  1I4Y A;  2MHR A;  3AGT A;  3WHN A;  1I4Z A;  1HMO A;  2AWY A;  2AVK A;  4XPW A;  1A7E A;  3WAQ A;  2AWC A;  4XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...