4XPXA

Crystal structure of hemerythrin:wild-type
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
ALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWLVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpxA00
3AGUA 3AGTA 2AVKA 1A7DA 4XPYA 4XPXA 2HMZA 2HMQA 3WAQA 1HMDA 4XPWA 1A7EA 2AWYA 1I4ZA 1I4YA 1HMOA 3WHNA 2MHRA 4XQ1A 2AWCA
chains in the Genus database with same CATH superfamily
3GM3A 3CAXA 3K7DA 2CGEA 3DE8A 1N1CA 3EHMA 3UGPA 1DOWA 4WGYA 5HV9A 2UUIA 2RD9A 3GM2A 1TWCA 2HMZA 2IBFA 2VB6A 3K1IC 3M79A 1ORYA 4PR9A 1V55C 4B6IA 4CDAA 4OIQF 1OCOC 2Y3HA 4MVUA 3VM6A 1Q0FA 3BRJA 3NKEA 4IB4A 4ULVA 2DYRC 3NRHA 4EKWA 3H65A 4G7ZF 1XWJA 1LKXA 1B68A 4IARA 4Z9IA 4CS8C 1WATA 2Y3DA 2NPUA 4I44A 5HSWA 1RMVA 1OR3A 2WZGA 5EHHA 1NSGB 1YVIA 2KYHA 1VYIA 3U8VA 2HJMA 2XLMA 3LNRA 1FR0A 1J8MF 1Q0DA 3EGDA 2AP3A 3UNGC 1BBHA 3ZC4A 1WWPA 3LAYA 1H6GA 3MX3A 4EBBA 3UMKA 4JW1A 2CYDA 2CW0F 2J0WA 5FZTA 3CSKA 2OU6A 1BZ4A 5L0GA 1IW7F 3FMSA 1BR1A 1NU7D 3JRMO 1MNEA 4JKVA 5D92A 3DZAA 5DS4A 3X1OA 3ZQYA 3X2QC 1ZW3A 2VC9A 4PFOA 1TFKB 3EFOB 3NMJA 5E33A 2HSBA 2JPUA 5B3IA 1EKYA 2YL7A 5EGYA 1VK5A 3EQLF 5JP7A 1VMAA 1RXQA 4BEMJ 4EHPA 2IM8A 1VLTA 3A9CA 3HJCA 2L81A 3M4CA 3T4RA 3GEEA 5KYUA 4CIPA 2Y3GA 2P7VA 1OCRC 2A0BA 3L0IA 4MVQA 4NTAA 4WABA 3U9MA 5B3SC 3S84A 1LI7A 3M1CB 4BJ6C 1JRAA 1KTMA 1LE2A 1OCCC 2KJGA 4P9FA 2LSEA 3SNHA 3LEVA 2YZSA 3T6BA 1OW6A 3ZQVA 4JIOA 4LERA 4X0RA 3U9JA 4JE9A 2PNOA 4DBQA 5AGFA 4IJJA 1ORJA 4AE4A 4YN0B 2I15A 5JS5A 2BL2A 2ETSA 1D1BA 3TOLA 4U9DA 2Y69C 1ZVZA 2G62A 5FCLA 1E2XA 4N6HA 1D1CA 2H7VC 3C8GA 4JC7A 4F4BA 1SZIA 2A68F 3HTKC 3Q6NA 4E18A 2YL1A 2R7TA 3V7OA 1M2VB 2EIMC 4O6MA 2OEVA 4P6IC 1EI7A 4PJJA 2XL4A 1LS4A 4GEHA 3S28A 5COGA 4HFFB 4C3EA 1MMNA 1QSPA 3K6BA 3NYLA 4JEBA 3W4YA 2C04A 5KYXA 2VCBA 3F46A 5L0CA 2GDCA 1LPEA 3AG4C 2EPNA 4H54A 5DS6A 1PD0A 4CDVA 4QDLA 2J7PD 2OCCC 1YLMA 3DJUB 1FNTc 5CIVA 1D0XA 2XLEA 3O10A 3RVZA 4J32B 1S05A 4NCQA 2D5RB 5A6BD 5L3VA 1H9TA 4XTKA 3TJ6A 3C7JA 3LS1A 1G4WR 3TQOA 2FFHA 3MBGA 3OWTA 3UR3C 4BJ5C 1FTSA 1HMDA 4DRJB 3QZCA 2PX3A 4JVSA 3RFYA 3U3FA 3QW1A 2OEXA 4CJGA 1HE9A 3DWWA 4JURI 3RH3A 2ZPAA 2QLAA 1QLEC 4NTBA 1Q0KA 1RJ9A 4U5FE 2ZXRA 5E3AA 4IGGA 4BPMA 3MYFA 1SMYF 3AG2C 4DVZA 4EBKA 5BUOA 2J46A 3KYJA 3EGDB 2NG1A 4MTOA 2R25A 3RF3A 3ZWIA 2HUJA 4YT2A 1CPQA 1TKNA 3K1IA 1A7DA 3LUTB 1PCXA 3I4UA 2LIGA 1NFOA 1YZAA 4MVSA 3SEOA 4LACB 4HEAJ 5JT4A 4XWJA 3RQEA 4K1OA 3TD7A 4U5EE 1ZYRF 1BR4A 1JAFA 4NY3A 1MQVA 4CJOA 4CS8A 4E17A 5KYWA 2YKZA 1HW1A 1SR2A 2H7OA 1T9KA 2XL6A 2YLIA 3DE9A 3IPMO 3L34A 4WJ0A 4YJWA 3O6XA 1VYKA 4I1OB 2QY9A 3DM5A 1T6IA 3HNLA 5F28E 3S27A 4Q4ZF 2CNWA 3W8IA 4AX2A 4E7SA 3KL4A 5KYUB 2WZLA 5B1AC 3ITFA 1UG7A 2QE9A 3AG1C 2GAQA 2IOQA 2MHRA 2KK1A 3NYMA 2Q7RA 3E9VA 2LFFA 1LM3B 1O5HA 4EWCA 1PD1A 3JTLO 1NG1A 3DXJF 3PMRA 2G3VA 2YHSA 3K66A 3N24A 4DRHB 3M15A 4FWVA 2J9VA 2P61A 3EZIA 3GORA 3OA1A 3S29A 3C62A 4JTCB 1CGNA 2WVQA 5TJ5E 1OR2A 3B0PA 4XEFA 2NUTB 3N2ZB 1Z23A 2E87A 3NG1A 2Z15A 2HFIA 4MTFA 4CS9C 2XLHA 3GM1A 4JJGA 1L7CA 2KNHA 1U0BB 4MQ9F 3FVYA 4XLNF 3EHNA 2KGOA 5KYXB 3ABLC 4JTAB 2L7AA 4YT5A 1H9GA 1WTYA 2R03A 4BJ6A 4DXWA 2ASRA 3KPHA 2J9WA 2J9UA 1K05A 3W2VA 2R7SA 2R05A 2MYSA 2YL3A 3RW0A 1XZQA 3FHDA 4JCZA 1ZHTA 4MNDA 4U5HA 3FOOA 3ECSA 2HKVA 2EINC 4RD9A 1MMGA 4Q7CA 4UDVA 2YWAA 4JZAA 5DLJA 4KNVA 3HNJA 4A2NB 5A6JA 1ORSC 5KYYB 3LS0A 1FMVA 3FAJA 3A11A 2GWWA 3L1MA 4U5GA 3FOPA 3WODF 1A7EA 5JRAA 2CDQA 2A6HF 4YL0A 1J8YF 1VOMA 1ZHYA 2R7WA 3PCVA 1Z63A 1U89A 4H4KC 1LIHA 1RJ9B 2H8AA 1R5ID 1GQAA 4MW8A 4LLEA 5DQZA 1VTMP 2OG2A 2Q9CA 3WG7C 4CS7A 3SZRA 4JEAA 2NUPA 5EK0A 3NMKA 4MVRA 2LD6A 3AQBA 5IY5C 3T6JA 3LNMB 2IXOA 3L8JA 1RKEA 4U5CE 3C63A 4J30B 1R4TA 4I1MA 4OINF 3AGUA 2ZD9A 1UFBA 4NC3A 5GPGB 2VCCA 1MMDA 3VYWA 2IXMA 4A4AA 2OJQA 1OXBA 4Z9HA 1NZEA 3JYHA 3KH2A 1O3UA 4P9TA 4XPYA 1YDIA 2KQ9A 1D0YA 3ATPA 3Q6MA 4BJ5A 2PX0A 3IQCA 2XXAA 3G4ZA 1M56C 5JUAA 3GANA 2Q9AA 2WVNA 2L6FA 4FAPB 2RSEB 4IAQA 2M64A 5KYWB 4PFPA 2PF4E 4BJ1A 1LE4A 3LEOA 2EIKC 4QI2A 2BC5A 2WVOA 3FAPB 2R7VA 3V5XA 4OIRF 3R7CA 3ZVRA 4FX5A 2R7OA 4C3BA 2HS5A 2XLOA 2EILC 3KYIA 3R2PA 2PFDA 2WZFA 3ZTZA 4LDKA 2TMVP 1YA7O 5CI9A 3T6GB 3VRCA 1A41A 1D1AA 1L3PA 4XQ1A 2V3CC 2XLWA 2J9BA 1M2OA 2HSQA 2A6EF 4LLCA 3IQ5A 5AC5A 1IZMA 1JR8A 1TWAA 2XM0A 3EGXA 4ZLDA 2WB7A 3JYYA 4E0HA 4MW3A 1MMAA 1Y6DA 3SP1A 4QI0A 3BEHA 4PK4A 3V5ZA 3H2VA 1OKKA 3CZ6A 2PP4A 3SXZA 2HV7A 1ZHXA 2XM4A 1I4ZA 2QNLA 2OQMA 1RKCA 2J8WA 3O39A 3OEOA 1JMWA 1JPNA 3ASOC 4LDRA 4EIYA 3EH2A 3HLZA 3EG9A 1T6UA 5JVEA 4OD5A 3E70C 3S90A 3B71A 4CBEA 1VLSA 3V5YA 3DMDA 3LLIA 2CNWD 1NU9C 1TWGA 2Q9BA 4O6YA 5COMA 1WASA 3I5PA 4ER9A 1E83A 1QZXA 3ASNC 2J0XA 2BE5F 5BQHA 3HNIA 1NLXA 2EPOA 5COFA 3NKDA 4KNWA 4MTGA 3L8IA 3C18A 1WOLA 1F1MA 2W4BA 2LCHA 2XLVA 4C7OA 4CS9A 1AEPA 1O87A 2R02A 3HNKA 3C8ZA 4XPWA 1Y4CA 3EFOA 3ZIBA 2EPKX 2OOCA 2G3KA 3ZTMA 5KYNA 5A6BA 3U3BA 3UMHA 3I5QA 1T5OA 1SF8A 2L6HA 2M4EA 4JTDB 2XL8A 3FXHA 2FAPB 1KU2A 3GEIA 1M6TA 3GWLA 4KBLA 5L0DA 3GODA 2Q00A 4OD4A 5BQIA 3CEXA 4W8PA 4HFKB 2DB4A 1FFTC 2HJ3A 5D91A 1Z6AA 3K1HA 3RIPA 3GWNA 2XXAB 4AE4B 1E86A 1ZW2A 1QVXA 2P6VA 2ZXPA 2L6GA 1ZZPA 1NBBA 2Y39A 3JSZA 3C8GB 4CSAC 1VB5A 1RCPA 2VASA 2YLGA 2GFHA 1CGME 1LVKA 4JCHA 4I3MA 1GGQA 3DAGA 4YWQA 4O7GA 4DJ9A 1I5NA 3EPVA 4N06A 3N0TA 2W9YA 4DRIB 3T9OA 2NSFA 3TOMA 2IYLD 1BDJB 3S0XA 1EA8A 1K04A 2B0JA 3AQCA 4MVOA 1FAPB 3DM9B 3RVYA 5T3TA 3SXKA 4ZLCA 2VH3A 4JRZA 3AG3C 5BQGA 3IHUA 3DI5A 2YVKA 3S9OA 1T6QA 1WGWA 3EGXB 1AUEA 1ZHWA 3RQFA 1FMWA 3GEHA 5A6KA 3B0UX 1ZHZA 4J7TA 2LQGA 3ZDLA 2XRHA 2B0HA 2JX0A 3AOUA 3U0CA 1YAUO 4DVYP 2F22A 3Q7LA 2C03A 4RBNA 5DS5A 4OIPF 3G50A 3W8HA 1YZCA 2UUHA 4XEKA 4D4XA 3DKAA 3EG9B 3QTHA 5L0HA 3C8GD 2R7QA 4AL1A 2X51A 3LLKA 3EZHA 1JOGA 3B9QA 3QW0A 3PDMP 1LS1A 1Q0MA 4J7YA 4R32A 1YJGA 3ABKC 3MYIA 2DYSC 2AWCA 4IRUA 3RQGA 4K0DA 2IXNA 2AVKA 2KW3C 5CI8A 5DVWA 3SXYA 3JT1A 4CIHA 5A69A 2Y3BA 2R9RB 2YQYA 2ZXWC 1T01A 4XEVA 3W2WA 1U6HA 2YLDA 2HMQA 4BG0A 2DI3A 4C7OB 3AJMA 2L9JA 4ANJA 3K33A 4MVMA 4PJMA 1H7IA 4O79A 2YL0A 1V74B 2YEVA 4N4WA 4E0IA 5L0IA 2HV6A 2IXPA 2NSGA 3RYLA 3EH1A 1SYQA 3ZSUA 1HMOA 4K7BA 1Q0GA 4RDAA 1OKKD 4MS2A 2LP4A 4NQFA 1OW7A 3U2MA 1W2WA 3M4BA 3POVA 3EJNA 1ZU4A 1EQ1A 2CCYA 4U5BE 3G4XA 2P0NA 3IQTA 5DQTA 4G78A 3JCUQ 3LJBA 4KC9A 5B1BC 4YT4A 3B0VC 1TQGA 2Q3TA 3DJNB 1YA9A 3SYNA 4DOZA 3U8PA 2D4UA 1MNDA 3KMIA 1YARO 2P1AA 3QMKA 4PJNA 4XPXA 3DD7A 4YL1A 1C17M 1E84A 4NTFA 1GS9A 1CPRA 4YK5A 1HY5A 1D0ZA 2FGYA 1ST6A 3SXMA 4OIOF 1G5ZA 2R7UA 2R7XA 2V26A 4Q5SF 2O9XA 3JSEO 4ONSA 2NUTA 4FESA 5L0FA 4N6CA 3MFNA 4DBRA 1TWHA 2W4MA 1QQ3A 2YRFA 4GQHA 5JSLA 4EBJA 5K0IA 1OQCA 3VAYA 2EPMX 2MWQA 2AU5A 3HKKA 4W8KA 5T1DB 1DOVA 1K40A 4IAOA 2R7RA 1V54C 5E2QA 1NFNA 2A69F 4YT8A 2DGJA 1Z5ZA 2J45A 4PACA 3U2LA 2PBEA 3AGTA 1TFOB 1JPJA 2ICWG 1M57C 4CX9A 3IEEA 3NYJA 1AVOB 1G8XA 2Q4FA 4U9EA 2VCAA 1FFHA 3JRTA 4CSAA 2JD3A 2XSEA 3O55A 1OCZC 4XLPF 2HZ8A 5KYYA 2OKUA 2EPLX 2H7BA 1G4US 5L3QA 4O6NA 5L0JA 2X0CA 1OW8A 5F5HA 3FDQA 1HE1A 4MVZA 2XLDA 4BEJA 2AWYA 4L6RA 4E7ZA 1YYXA 1WN0A 1TR2A 1S7ZA 1I4YA 3NMIA 5F5FA 4YL3A 4HE8D 2J7PA 4CDYA 3TJ5A 4WGZA 2NUPB 1BR2A 5A6AA 1A7VA 1Z7Qc 3ZG1A 1QKRA 2WL8A 2QUPA 1PV3A 2XS1A 3ABMC 3H2UA 5E3CA 4AK9A 4BJTA 3PHF2 1GM5A 1HW2A 1RKEB 1QPUA 2EIJC 1APCA 2LK4A 3Q7GA 4U5DE 3U5SA 3IQ6A 4D4NA 256BA 4IWBA 1CGOA 1LI5A 2QTVA 5AC4A 3QVYA 1C02A 1E85A 1A0BA 1OXKA 1V4AA 1ZU5A 4AL0A 4GYTA 4KI2A 4LDQA 4G0HA 5JLIA 2KC3A 2A1DD 3CQZA 3UMIA 4PJLA 2A0UA 2XS8A 1C03A 3VF0A 3LESA 3WAQA 3J06A 4JJFA 3TULA 2I8BA 2W45A 2GA0A 5T3WA 1M2VA 4G7HF 3TK0A 1YYJA 4EUKB 3RKOF 1Z3IX 2KSFA 4ULWA 3F47A 4Z9JA 3UGOA 2OJED 3NDBB 2LFDA 3WHNA 3KKBA 2ZXOA 3MLGA 3QVZA 3B29A 4C3DA 1KNYA 1XZPA 3DAFA 3JZ0A 4M63A 3US6A 4G7OF
chains in the Genus database with same CATH topology
3AGUA 3AGTA 2AVKA 1A7DA 4XPYA 4XPXA 2HMZA 2HMQA 3WAQA 1HMDA 4XPWA 1A7EA 2AWYA 1I4ZA 1I4YA 1HMOA 3WHNA 2MHRA 4XQ1A 2AWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGU A;  3AGT A;  2AVK A;  1A7D A;  4XPY A;  4XPX A;  2HMZ A;  2HMQ A;  3WAQ A;  1HMD A;  4XPW A;  1A7E A;  2AWY A;  1I4Z A;  1I4Y A;  1HMO A;  3WHN A;  2MHR A;  4XQ1 A;  2AWC A; 
#chains in the Genus database with same CATH topology
 3GM3 A;  3CAX A;  3K7D A;  2CGE A;  3DE8 A;  1N1C A;  3EHM A;  3UGP A;  1DOW A;  4WGY A;  5HV9 A;  2UUI A;  2RD9 A;  3GM2 A;  1TWC A;  2HMZ A;  2IBF A;  2VB6 A;  3K1I C;  3M79 A;  1ORY A;  4PR9 A;  1V55 C;  4B6I A;  4CDA A;  4OIQ F;  1OCO C;  2Y3H A;  4MVU A;  3VM6 A;  1Q0F A;  3BRJ A;  3NKE A;  4IB4 A;  4ULV A;  2DYR C;  3NRH A;  4EKW A;  3H65 A;  4G7Z F;  1XWJ A;  1LKX A;  1B68 A;  4IAR A;  4Z9I A;  4CS8 C;  1WAT A;  2Y3D A;  2NPU A;  4I44 A;  5HSW A;  1RMV A;  1OR3 A;  2WZG A;  5EHH A;  1NSG B;  1YVI A;  2KYH A;  1VYI A;  3U8V A;  2HJM A;  2XLM A;  3LNR A;  1FR0 A;  1J8M F;  1Q0D A;  3EGD A;  2AP3 A;  3UNG C;  1BBH A;  3ZC4 A;  1WWP A;  3LAY A;  1H6G A;  3MX3 A;  4EBB A;  3UMK A;  4JW1 A;  2CYD A;  2CW0 F;  2J0W A;  5FZT A;  3CSK A;  2OU6 A;  1BZ4 A;  5L0G A;  1IW7 F;  3FMS A;  1BR1 A;  1NU7 D;  3JRM O;  1MNE A;  4JKV A;  5D92 A;  3DZA A;  5DS4 A;  3X1O A;  3ZQY A;  3X2Q C;  1ZW3 A;  2VC9 A;  4PFO A;  1TFK B;  3EFO B;  3NMJ A;  5E33 A;  2HSB A;  2JPU A;  5B3I A;  1EKY A;  2YL7 A;  5EGY A;  1VK5 A;  3EQL F;  5JP7 A;  1VMA A;  1RXQ A;  4BEM J;  4EHP A;  2IM8 A;  1VLT A;  3A9C A;  3HJC A;  2L81 A;  3M4C A;  3T4R A;  3GEE A;  5KYU A;  4CIP A;  2Y3G A;  2P7V A;  1OCR C;  2A0B A;  3L0I A;  4MVQ A;  4NTA A;  4WAB A;  3U9M A;  5B3S C;  3S84 A;  1LI7 A;  3M1C B;  4BJ6 C;  1JRA A;  1KTM A;  1LE2 A;  1OCC C;  2KJG A;  4P9F A;  2LSE A;  3SNH A;  3LEV A;  2YZS A;  3T6B A;  1OW6 A;  3ZQV A;  4JIO A;  4LER A;  4X0R A;  3U9J A;  4JE9 A;  2PNO A;  4DBQ A;  5AGF A;  4IJJ A;  1ORJ A;  4AE4 A;  4YN0 B;  2I15 A;  5JS5 A;  2BL2 A;  2ETS A;  1D1B A;  3TOL A;  4U9D A;  2Y69 C;  1ZVZ A;  2G62 A;  5FCL A;  1E2X A;  4N6H A;  1D1C A;  2H7V C;  3C8G A;  4JC7 A;  4F4B A;  1SZI A;  2A68 F;  3HTK C;  3Q6N A;  4E18 A;  2YL1 A;  2R7T A;  3V7O A;  1M2V B;  2EIM C;  4O6M A;  2OEV A;  4P6I C;  1EI7 A;  4PJJ A;  2XL4 A;  1LS4 A;  4GEH A;  3S28 A;  5COG A;  4HFF B;  4C3E A;  1MMN A;  1QSP A;  3K6B A;  3NYL A;  4JEB A;  3W4Y A;  2C04 A;  5KYX A;  2VCB A;  3F46 A;  5L0C A;  2GDC A;  1LPE A;  3AG4 C;  2EPN A;  4H54 A;  5DS6 A;  1PD0 A;  4CDV A;  4QDL A;  2J7P D;  2OCC C;  1YLM A;  3DJU B;  1FNT c;  5CIV A;  1D0X A;  2XLE A;  3O10 A;  3RVZ A;  4J32 B;  1S05 A;  4NCQ A;  2D5R B;  5A6B D;  5L3V A;  1H9T A;  4XTK A;  3TJ6 A;  3C7J A;  3LS1 A;  1G4W R;  3TQO A;  2FFH A;  3MBG A;  3OWT A;  3UR3 C;  4BJ5 C;  1FTS A;  1HMD A;  4DRJ B;  3QZC A;  2PX3 A;  4JVS A;  3RFY A;  3U3F A;  3QW1 A;  2OEX A;  4CJG A;  1HE9 A;  3DWW A;  4JUR I;  3RH3 A;  2ZPA A;  2QLA A;  1QLE C;  4NTB A;  1Q0K A;  1RJ9 A;  4U5F E;  2ZXR A;  5E3A A;  4IGG A;  4BPM A;  3MYF A;  1SMY F;  3AG2 C;  4DVZ A;  4EBK A;  5BUO A;  2J46 A;  3KYJ A;  3EGD B;  2NG1 A;  4MTO A;  2R25 A;  3RF3 A;  3ZWI A;  2HUJ A;  4YT2 A;  1CPQ A;  1TKN A;  3K1I A;  1A7D A;  3LUT B;  1PCX A;  3I4U A;  2LIG A;  1NFO A;  1YZA A;  4MVS A;  3SEO A;  4LAC B;  4HEA J;  5JT4 A;  4XWJ A;  3RQE A;  4K1O A;  3TD7 A;  4U5E E;  1ZYR F;  1BR4 A;  1JAF A;  4NY3 A;  1MQV A;  4CJO A;  4CS8 A;  4E17 A;  5KYW A;  2YKZ A;  1HW1 A;  1SR2 A;  2H7O A;  1T9K A;  2XL6 A;  2YLI A;  3DE9 A;  3IPM O;  3L34 A;  4WJ0 A;  4YJW A;  3O6X A;  1VYK A;  4I1O B;  2QY9 A;  3DM5 A;  1T6I A;  3HNL A;  5F28 E;  3S27 A;  4Q4Z F;  2CNW A;  3W8I A;  4AX2 A;  4E7S A;  3KL4 A;  5KYU B;  2WZL A;  5B1A C;  3ITF A;  1UG7 A;  2QE9 A;  3AG1 C;  2GAQ A;  2IOQ A;  2MHR A;  2KK1 A;  3NYM A;  2Q7R A;  3E9V A;  2LFF A;  1LM3 B;  1O5H A;  4EWC A;  1PD1 A;  3JTL O;  1NG1 A;  3DXJ F;  3PMR A;  2G3V A;  2YHS A;  3K66 A;  3N24 A;  4DRH B;  3M15 A;  4FWV A;  2J9V A;  2P61 A;  3EZI A;  3GOR A;  3OA1 A;  3S29 A;  3C62 A;  4JTC B;  1CGN A;  2WVQ A;  5TJ5 E;  1OR2 A;  3B0P A;  4XEF A;  2NUT B;  3N2Z B;  1Z23 A;  2E87 A;  3NG1 A;  2Z15 A;  2HFI A;  4MTF A;  4CS9 C;  2XLH A;  3GM1 A;  4JJG A;  1L7C A;  2KNH A;  1U0B B;  4MQ9 F;  3FVY A;  4XLN F;  3EHN A;  2KGO A;  5KYX B;  3ABL C;  4JTA B;  2L7A A;  4YT5 A;  1H9G A;  1WTY A;  2R03 A;  4BJ6 A;  4DXW A;  2ASR A;  3KPH A;  2J9W A;  2J9U A;  1K05 A;  3W2V A;  2R7S A;  2R05 A;  2MYS A;  2YL3 A;  3RW0 A;  1XZQ A;  3FHD A;  4JCZ A;  1ZHT A;  4MND A;  4U5H A;  3FOO A;  3ECS A;  2HKV A;  2EIN C;  4RD9 A;  1MMG A;  4Q7C A;  4UDV A;  2YWA A;  4JZA A;  5DLJ A;  4KNV A;  3HNJ A;  4A2N B;  5A6J A;  1ORS C;  5KYY B;  3LS0 A;  1FMV A;  3FAJ A;  3A11 A;  2GWW A;  3L1M A;  4U5G A;  3FOP A;  3WOD F;  1A7E A;  5JRA A;  2CDQ A;  2A6H F;  4YL0 A;  1J8Y F;  1VOM A;  1ZHY A;  2R7W A;  3PCV A;  1Z63 A;  1U89 A;  4H4K C;  1LIH A;  1RJ9 B;  2H8A A;  1R5I D;  1GQA A;  4MW8 A;  4LLE A;  5DQZ A;  1VTM P;  2OG2 A;  2Q9C A;  3WG7 C;  4CS7 A;  3SZR A;  4JEA A;  2NUP A;  5EK0 A;  3NMK A;  4MVR A;  2LD6 A;  3AQB A;  5IY5 C;  3T6J A;  3LNM B;  2IXO A;  3L8J A;  1RKE A;  4U5C E;  3C63 A;  4J30 B;  1R4T A;  4I1M A;  4OIN F;  3AGU A;  2ZD9 A;  1UFB A;  4NC3 A;  5GPG B;  2VCC A;  1MMD A;  3VYW A;  2IXM A;  4A4A A;  2OJQ A;  1OXB A;  4Z9H A;  1NZE A;  3JYH A;  3KH2 A;  1O3U A;  4P9T A;  4XPY A;  1YDI A;  2KQ9 A;  1D0Y A;  3ATP A;  3Q6M A;  4BJ5 A;  2PX0 A;  3IQC A;  2XXA A;  3G4Z A;  1M56 C;  5JUA A;  3GAN A;  2Q9A A;  2WVN A;  2L6F A;  4FAP B;  2RSE B;  4IAQ A;  2M64 A;  5KYW B;  4PFP A;  2PF4 E;  4BJ1 A;  1LE4 A;  3LEO A;  2EIK C;  4QI2 A;  2BC5 A;  2WVO A;  3FAP B;  2R7V A;  3V5X A;  4OIR F;  3R7C A;  3ZVR A;  4FX5 A;  2R7O A;  4C3B A;  2HS5 A;  2XLO A;  2EIL C;  3KYI A;  3R2P A;  2PFD A;  2WZF A;  3ZTZ A;  4LDK A;  2TMV P;  1YA7 O;  5CI9 A;  3T6G B;  3VRC A;  1A41 A;  1D1A A;  1L3P A;  4XQ1 A;  2V3C C;  2XLW A;  2J9B A;  1M2O A;  2HSQ A;  2A6E F;  4LLC A;  3IQ5 A;  5AC5 A;  1IZM A;  1JR8 A;  1TWA A;  2XM0 A;  3EGX A;  4ZLD A;  2WB7 A;  3JYY A;  4E0H A;  4MW3 A;  1MMA A;  1Y6D A;  3SP1 A;  4QI0 A;  3BEH A;  4PK4 A;  3V5Z A;  3H2V A;  1OKK A;  3CZ6 A;  2PP4 A;  3SXZ A;  2HV7 A;  1ZHX A;  2XM4 A;  1I4Z A;  2QNL A;  2OQM A;  1RKC A;  2J8W A;  3O39 A;  3OEO A;  1JMW A;  1JPN A;  3ASO C;  4LDR A;  4EIY A;  3EH2 A;  3HLZ A;  3EG9 A;  1T6U A;  5JVE A;  4OD5 A;  3E70 C;  3S90 A;  3B71 A;  4CBE A;  1VLS A;  3V5Y A;  3DMD A;  3LLI A;  2CNW D;  1NU9 C;  1TWG A;  2Q9B A;  4O6Y A;  5COM A;  1WAS A;  3I5P A;  4ER9 A;  1E83 A;  1QZX A;  3ASN C;  2J0X A;  2BE5 F;  5BQH A;  3HNI A;  1NLX A;  2EPO A;  5COF A;  3NKD A;  4KNW A;  4MTG A;  3L8I A;  3C18 A;  1WOL A;  1F1M A;  2W4B A;  2LCH A;  2XLV A;  4C7O A;  4CS9 A;  1AEP A;  1O87 A;  2R02 A;  3HNK A;  3C8Z A;  4XPW A;  1Y4C A;  3EFO A;  3ZIB A;  2EPK X;  2OOC A;  2G3K A;  3ZTM A;  5KYN A;  5A6B A;  3U3B A;  3UMH A;  3I5Q A;  1T5O A;  1SF8 A;  2L6H A;  2M4E A;  4JTD B;  2XL8 A;  3FXH A;  2FAP B;  1KU2 A;  3GEI A;  1M6T A;  3GWL A;  4KBL A;  5L0D A;  3GOD A;  2Q00 A;  4OD4 A;  5BQI A;  3CEX A;  4W8P A;  4HFK B;  2DB4 A;  1FFT C;  2HJ3 A;  5D91 A;  1Z6A A;  3K1H A;  3RIP A;  3GWN A;  2XXA B;  4AE4 B;  1E86 A;  1ZW2 A;  1QVX A;  2P6V A;  2ZXP A;  2L6G A;  1ZZP A;  1NBB A;  2Y39 A;  3JSZ A;  3C8G B;  4CSA C;  1VB5 A;  1RCP A;  2VAS A;  2YLG A;  2GFH A;  1CGM E;  1LVK A;  4JCH A;  4I3M A;  1GGQ A;  3DAG A;  4YWQ A;  4O7G A;  4DJ9 A;  1I5N A;  3EPV A;  4N06 A;  3N0T A;  2W9Y A;  4DRI B;  3T9O A;  2NSF A;  3TOM A;  2IYL D;  1BDJ B;  3S0X A;  1EA8 A;  1K04 A;  2B0J A;  3AQC A;  4MVO A;  1FAP B;  3DM9 B;  3RVY A;  5T3T A;  3SXK A;  4ZLC A;  2VH3 A;  4JRZ A;  3AG3 C;  5BQG A;  3IHU A;  3DI5 A;  2YVK A;  3S9O A;  1T6Q A;  1WGW A;  3EGX B;  1AUE A;  1ZHW A;  3RQF A;  1FMW A;  3GEH A;  5A6K A;  3B0U X;  1ZHZ A;  4J7T A;  2LQG A;  3ZDL A;  2XRH A;  2B0H A;  2JX0 A;  3AOU A;  3U0C A;  1YAU O;  4DVY P;  2F22 A;  3Q7L A;  2C03 A;  4RBN A;  5DS5 A;  4OIP F;  3G50 A;  3W8H A;  1YZC A;  2UUH A;  4XEK A;  4D4X A;  3DKA A;  3EG9 B;  3QTH A;  5L0H A;  3C8G D;  2R7Q A;  4AL1 A;  2X51 A;  3LLK A;  3EZH A;  1JOG A;  3B9Q A;  3QW0 A;  3PDM P;  1LS1 A;  1Q0M A;  4J7Y A;  4R32 A;  1YJG A;  3ABK C;  3MYI A;  2DYS C;  2AWC A;  4IRU A;  3RQG A;  4K0D A;  2IXN A;  2AVK A;  2KW3 C;  5CI8 A;  5DVW A;  3SXY A;  3JT1 A;  4CIH A;  5A69 A;  2Y3B A;  2R9R B;  2YQY A;  2ZXW C;  1T01 A;  4XEV A;  3W2W A;  1U6H A;  2YLD A;  2HMQ A;  4BG0 A;  2DI3 A;  4C7O B;  3AJM A;  2L9J A;  4ANJ A;  3K33 A;  4MVM A;  4PJM A;  1H7I A;  4O79 A;  2YL0 A;  1V74 B;  2YEV A;  4N4W A;  4E0I A;  5L0I A;  2HV6 A;  2IXP A;  2NSG A;  3RYL A;  3EH1 A;  1SYQ A;  3ZSU A;  1HMO A;  4K7B A;  1Q0G A;  4RDA A;  1OKK D;  4MS2 A;  2LP4 A;  4NQF A;  1OW7 A;  3U2M A;  1W2W A;  3M4B A;  3POV A;  3EJN A;  1ZU4 A;  1EQ1 A;  2CCY A;  4U5B E;  3G4X A;  2P0N A;  3IQT A;  5DQT A;  4G78 A;  3JCU Q;  3LJB A;  4KC9 A;  5B1B C;  4YT4 A;  3B0V C;  1TQG A;  2Q3T A;  3DJN B;  1YA9 A;  3SYN A;  4DOZ A;  3U8P A;  2D4U A;  1MND A;  3KMI A;  1YAR O;  2P1A A;  3QMK A;  4PJN A;  4XPX A;  3DD7 A;  4YL1 A;  1C17 M;  1E84 A;  4NTF A;  1GS9 A;  1CPR A;  4YK5 A;  1HY5 A;  1D0Z A;  2FGY A;  1ST6 A;  3SXM A;  4OIO F;  1G5Z A;  2R7U A;  2R7X A;  2V26 A;  4Q5S F;  2O9X A;  3JSE O;  4ONS A;  2NUT A;  4FES A;  5L0F A;  4N6C A;  3MFN A;  4DBR A;  1TWH A;  2W4M A;  1QQ3 A;  2YRF A;  4GQH A;  5JSL A;  4EBJ A;  5K0I A;  1OQC A;  3VAY A;  2EPM X;  2MWQ A;  2AU5 A;  3HKK A;  4W8K A;  5T1D B;  1DOV A;  1K40 A;  4IAO A;  2R7R A;  1V54 C;  5E2Q A;  1NFN A;  2A69 F;  4YT8 A;  2DGJ A;  1Z5Z A;  2J45 A;  4PAC A;  3U2L A;  2PBE A;  3AGT A;  1TFO B;  1JPJ A;  2ICW G;  1M57 C;  4CX9 A;  3IEE A;  3NYJ A;  1AVO B;  1G8X A;  2Q4F A;  4U9E A;  2VCA A;  1FFH A;  3JRT A;  4CSA A;  2JD3 A;  2XSE A;  3O55 A;  1OCZ C;  4XLP F;  2HZ8 A;  5KYY A;  2OKU A;  2EPL X;  2H7B A;  1G4U S;  5L3Q A;  4O6N A;  5L0J A;  2X0C A;  1OW8 A;  5F5H A;  3FDQ A;  1HE1 A;  4MVZ A;  2XLD A;  4BEJ A;  2AWY A;  4L6R A;  4E7Z A;  1YYX A;  1WN0 A;  1TR2 A;  1S7Z A;  1I4Y A;  3NMI A;  5F5F A;  4YL3 A;  4HE8 D;  2J7P A;  4CDY A;  3TJ5 A;  4WGZ A;  2NUP B;  1BR2 A;  5A6A A;  1A7V A;  1Z7Q c;  3ZG1 A;  1QKR A;  2WL8 A;  2QUP A;  1PV3 A;  2XS1 A;  3ABM C;  3H2U A;  5E3C A;  4AK9 A;  4BJT A;  3PHF 2;  1GM5 A;  1HW2 A;  1RKE B;  1QPU A;  2EIJ C;  1APC A;  2LK4 A;  3Q7G A;  4U5D E;  3U5S A;  3IQ6 A;  4D4N A;  256B A;  4IWB A;  1CGO A;  1LI5 A;  2QTV A;  5AC4 A;  3QVY A;  1C02 A;  1E85 A;  1A0B A;  1OXK A;  1V4A A;  1ZU5 A;  4AL0 A;  4GYT A;  4KI2 A;  4LDQ A;  4G0H A;  5JLI A;  2KC3 A;  2A1D D;  3CQZ A;  3UMI A;  4PJL A;  2A0U A;  2XS8 A;  1C03 A;  3VF0 A;  3LES A;  3WAQ A;  3J06 A;  4JJF A;  3TUL A;  2I8B A;  2W45 A;  2GA0 A;  5T3W A;  1M2V A;  4G7H F;  3TK0 A;  1YYJ A;  4EUK B;  3RKO F;  1Z3I X;  2KSF A;  4ULW A;  3F47 A;  4Z9J A;  3UGO A;  2OJE D;  3NDB B;  2LFD A;  3WHN A;  3KKB A;  2ZXO A;  3MLG A;  3QVZ A;  3B29 A;  4C3D A;  1KNY A;  1XZP A;  3DAF A;  3JZ0 A;  4M63 A;  3US6 A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3AGU A;  3AGT A;  2AVK A;  1A7D A;  4XPY A;  4XPX A;  2HMZ A;  2HMQ A;  3WAQ A;  1HMD A;  4XPW A;  1A7E A;  2AWY A;  1I4Z A;  1I4Y A;  1HMO A;  3WHN A;  2MHR A;  4XQ1 A;  2AWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...