4XPXA

Crystal structure of hemerythrin:wild-type
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
ALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWLVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
molecule keywords Bacteriohemerythrin
total genus 58
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpxA00
1I4YA 2AWCA 2AWYA 4XQ1A 1HMDA 1HMOA 3WAQA 3AGTA 4XPWA 2HMZA 2HMQA 3WHNA 1A7DA 4XPYA 3AGUA 1A7EA 2AVKA 1I4ZA 4XPXA 2MHRA
chains in the Genus database with same CATH superfamily
2Y39A 1ZU4A 2KGOA 2VB6A 3CZ6A 1W2WA 3DZAA 3MBGA 4AE4A 3EGDA 3SXKA 5DQTA 4DXWA 4AX2A 1OW6A 4KI2A 4LDKA 2EPMX 5BQHA 1OKKA 1BR1A 2ZXOA 1E85A 1AVOB 1FMVA 1PV3A 1VOMA 1D0XA 3EG9B 4KNVA 1FAPB 2XM4A 1YA9A 1K04A 5KYUB 1LPEA 1HW2A 3EFOB 4OIQF 3K1HA 5CI9A 5E33A 2J46A 3Q6NA 3NKEA 1C03A 1YA7O 2WZGA 5B3SC 3U2LA 1T01A 1KNYA 1E84A 2P1AA 1TFOB 1ORYA 2OQMA 3LESA 4IB4A 1R5ID 4Q7CA 1YZCA 3SYNA 3ZSUA 3UMKA 3PHF2 3E70C 2NUTB 2Q4FA 4CS9C 4EHPA 3EZIA 4EUKB 4JIOA 1VYKA 2YKZA 2OG2A 2EINC 4O7GA 3B0UX 1IW7F 5AGFA 4YL1A 3WHNA 1FNTc 1XZQA 3ABKC 3IPMO 1BR2A 4YT2A 4UDVA 1A0BA 1KTMA 3AQBA 3LS1A 1KU2A 1QZXA 4XWJA 1RJ9A 4JTAB 3VAYA 1TKNA 1TWCA 4F4BA 5L0DA 2EPOA 2GWWA 2YLDA 4I1MA 2EPNA 4XPXA 5HV9A 1VYIA 3AG4C 3IEEA 1Q0KA 4FWVA 4CX9A 1G4US 3H2VA 4C3EA 3UR3C 1UFBA 2XLHA 1ZYRF 1ZW3A 4U5FE 1BBHA 4XEKA 4CIHA 1LS4A 2HSQA 1CGOA 1WATA 1YYJA 2YLGA 1Q0FA 1OCCC 2ASRA 3C8ZA 2NUTA 4LDRA 1D0ZA 2EIMC 2YRFA 1ZU5A 1RKEB 5HSWA 5T3WA 4CSAA 3G4ZA 4EKWA 3MLGA 3KH2A 2R03A 3US6A 3DXJF 4K0DA 3QMKA 4IJJA 2R7WA 1AEPA 2H7OA 3NRHA 4ULVA 1LIHA 3TOLA 2VH3A 3W4YA 1O3UA 5COFA 2C03A 1H7IA 3ZC4A 4CDYA 3QW1A 4BJ6C 4MW3A 3H65A 3ZIBA 1CGNA 5COGA 1PD0A 2Q00A 2QE9A 4G7HF 4JRZA 1NBBA 2XRHA 4P9TA 5A69A 5JS5A 5L3QA 3ITFA 3VRCA 1MNDA 1Q0DA 4FESA 4GQHA 4YL3A 3FAJA 2R7TA 2CNWA 2GAQA 4IAOA 2XXAA 1ZVZA 4J32B 3I5QA 1HMDA 4Q4ZF 3ABMC 3ECSA 4QI0A 4OIPF 1NLXA 2X51A 2XLMA 5DVWA 1NU7D 1E86A 3JTLO 3LNMB 2DYRC 3MYFA 4OINF 3ZQYA 4CJOA 1XWJA 4D4NA 2R7RA 2YQYA 2EPLX 3VF0A 1OCOC 3V7OA 4CDVA 2WB7A 2R7OA 3GANA 2Q9AA 4JJGA 3EGXA 4Z9HA 3HNJA 1D1CA 3U2MA 4CBEA 2WL8A 1JAFA 1VK5A 2HUJA 4LLCA 1T6UA 5AC5A 1VLSA 1OKKD 4LLEA 1A7EA 4MVUA 1LE2A 4MW8A 1TWAA 5A6BD 2R7QA 2A1DD 1OXBA 2L6FA 4U5GA 3KMIA 5A6AA 5KYYB 2YEVA 3RQEA 3FXHA 3UGOA 2VASA 3M1CB 1MMDA 1LKXA 3UGPA 3FMSA 3DWWA 2I8BA 3SZRA 3NKDA 2W45A 2CNWD 2A68F 3M15A 1QKRA 2Q9BA 3KPHA 2XL4A 3RVZA 2QY9A 4IARA 4N6CA 4E0HA 1YVIA 2ETSA 4EBJA 2XLDA 2KYHA 3TULA 4KC9A 4JTCB 4XQ1A 4WJ0A 3WAQA 1MMGA 2J0WA 1CPRA 2XLEA 4FAPB 2AU5A 3CEXA 4J7YA 4W8PA 3SP1A 4MVSA 4EBBA 3I5PA 2DI3A 4NTBA 4PACA 4J30B 4XTKA 1G4WR 5E3AA 2VCCA 1TR2A 1TWGA 3S0XA 2XM0A 1RMVA 1LE4A 1YDIA 2OOCA 4PK4A 2FGYA 5DLJA 3TD7A 3FVYA 3HLZA 3DJUB 5BQGA 3NYLA 5FZTA 1E83A 3NYJA 4JKVA 5KYWB 2P61A 2EPKX 2KW3C 3L0IA 2HV7A 4NTFA 4AE4B 1QSPA 3AG1C 3DKAA 3QVYA 3GM2A 1MMNA 3G50A 4MQ9F 2RSEB 3U8PA 3GORA 1C02A 1Y4CA 2R25A 4E7SA 2Q9CA 3POVA 1RCPA 5B1BC 1EKYA 2OEXA 4MNDA 1CPQA 1S7ZA 3S90A 2R02A 2BE5F 4K1OA 1LI5A 1WTYA 1ZHXA 1JRAA 3S9OA 4MTFA 5B3IA 2H8AA 3HNKA 5GPGB 1L7CA 3R2PA 2P0NA 4IGGA 4MVQA 3ZTMA 2QUPA 2ZXPA 3NMKA 2HJMA 1Q0MA 2A69F 3L34A 4M63A 4O6YA 3RH3A 5CIVA 2HV6A 3B0PA 3IQ5A 2IXOA 2NSGA 4HE8D 3S84A 2AWYA 1A41A 1WASA 3AQCA 3IQTA 2LSEA 3LEVA 1HE9A 3FDQA 3DAFA 4H54A 3GODA 4XPYA 1WN0A 3OEOA 1NZEA 1D0YA 4PJMA 2PF4E 5KYUA 4U5CE 3RYLA 2XS1A 1XZPA 2LIGA 5B1AC 3RFYA 4CS8A 2Q7RA 5L3VA 1SYQA 4W8KA 3B0VC 5FCLA 1I4ZA 3CAXA 3KYIA 3Q7GA 4KNWA 4BG0A 2NSFA 2HSBA 2XLWA 1ZHWA 5BUOA 1LM3B 1ORJA 1H6GA 3VM6A 2HFIA 4EBKA 2IXNA 4DRHB 4CS9A 1H9GA 2LK4A 2ICWG 4YL0A 1OXKA 2YWAA 2GA0A 2ZD9A 2A0BA 5CI8A 3C8GB 3L8IA 4HFFB 3PCVA 3HKKA 1F1MA 1FFTC 3U3FA 2TMVP 4XLNF 3LLIA 4MVZA 4YT8A 1SF8A 4JTDB 2DGJA 4JCHA 1HY5A 1S05A 2CCYA 2YL7A 2R7XA 2IM8A 2LFFA 3DJNB 2Y3BA 1Z3IX 3GM3A 4WGYA 3S29A 2L6HA 1I5NA 1JR8A 1ZHTA 3RKOF 3PDMP 2LCHA 1ZHZA 3OWTA 3ZQVA 1J8MF 1DOWA 4ZLDA 5A6JA 3SXZA 4YWQA 4JEAA 5D91A 1M56C 3ZTZA 4XPWA 2J0XA 3U3BA 2XXAB 4MTGA 4C7OA 1EQ1A 3EZHA 2IOQA 4O6NA 3RF3A 1OCRC 4CS8C 2M4EA 2R9RB 1RKCA 3U5SA 1OW8A 3L1MA 3W8IA 2DB4A 4AL1A 1LS1A 3Q7LA 1ORSC 5EK0A 3F47A 2KQ9A 3U9MA 4XEFA 4XLPF 3EGXB 2PP4A 1AUEA 3WODF 1RJ9B 5DS4A 3N2ZB 2L9JA 3K6BA 3LJBA 5E3CA 4KBLA 2UUIA 4DRIB 1K05A 2YLIA 2NPUA 4NCQA 1RXQA 2LP4A 3C8GA 1SZIA 2XLOA 2MWQA 3EH1A 3IQ6A 1L3PA 3QW0A 3T6BA 2IYLD 5F5HA 4HFKB 5KYYA 5DS6A 5DS5A 3NDBB 1O87A 2IXPA 3EG9A 4HEAJ 4JURI 4MVRA 2RD9A 2ZPAA 4JZAA 3RW0A 3UMHA 4IRUA 4MVOA 2H7VC 4BJ5A 1GGQA 1O5HA 1K40A 4JCZA 4A2NB 3E9VA 1M2VA 1FFHA 2W4MA 1TQGA 1GM5A 3GEIA 3JZ0A 5T3TA 5COMA 4XEVA 3R7CA 3LLKA 5IY5C 3GEHA 3TJ5A 4OD5A 5E2QA 2QNLA 1PCXA 3ZG1A 3OA1A 3DMDA 3ABLC 2X0CA 5BQIA 1Z5ZA 2Q3TA 3MX3A 1GQAA 5TJ5E 5T1DB 4BJ6A 5KYXB 1N1CA 2J9UA 2ZXWC 2NG1A 3DM9B 3FAPB 3GEEA 1Z6AA 2I15A 3EH2A 4GYTA 3QZCA 1R4TA 4P9FA 4CSAC 1EA8A 4E0IA 3AGUA 2IBFA 2Z15A 2W4BA 3GWNA 2J7PD 4JJFA 2D5RB 4FX5A 4I1OB 3W2VA 3ASOC 4JW1A 2J7PA 1OQCA 3U8VA 4Z9JA 4E7ZA 4NQFA 4OIOF 3C63A 2CDQA 3O6XA 3U9JA 4Q5SF 1YZAA 3O10A 1ZZPA 3QTHA 4U9EA 2QLAA 3PMRA 4YT4A 2VCBA 1U0BB 4JEBA 1D1BA 4JVSA 1NFNA 1G8XA 3C18A 3L8JA 4RBNA 4NC3A 4WABA 4ANJA 3RIPA 2WZFA 1QQ3A 2FAPB 3B71A 2YL3A 3C7JA 4CS7A 4DOZA 3W8HA 5JUAA 2E87A 3ATPA 1TFKB 1GS9A 2J9WA 5JVEA 1V4AA 5JSLA 4LERA 2CGEA 2Y3GA 4E18A 4ZLCA 4B6IA 2EIKC 2LFDA 1YAUO 2WVQA 3BEHA 4O79A 5KYNA 4AK9A 3KL4A 2H7BA 1YJGA 3TK0A 3V5YA 4MS2A 2PFDA 2OCCC 1MMAA 1QVXA 2PNOA 1WGWA 2YVKA 2V26A 1Z7Qc 4EIYA 3JCUQ 3LNRA 4I3MA 3CSKA 3RQGA 1U89A 2HKVA 3S27A 1LVKA 3VYWA 5KYXA 4QI2A 4ER9A 5JT4A 3C8GD 3FOOA 2JX0A 4U5EE 4CDAA 1T6IA 2OU6A 4DJ9A 1IZMA 2J8WA 2UUHA 5AC4A 4BJ1A 1I4YA 1V74B 3GWLA 2KJGA 3DD7A 1YYXA 3MFNA 2LD6A 4U5HA 4YN0B 3S28A 1WOLA 1Z63A 2R7VA 3CQZA 3UMIA 2V3CC 1OR3A 2AVKA 4DBRA 1OCZC 4JE9A 1J8YF 2R05A 2XL8A 5JP7A 1FTSA 2P7VA 2XS8A 5EHHA 4CIPA 1Q0GA 4BPMA 2HMQA 1C17M 3V5XA 4U9DA 1T9KA 2WZLA 2KSFA 3F46A 2XLVA 3RVYA 3LAYA 3AG3C 3X2QC 3O55A 3DE9A 2GDCA 3M79A 4R32A 4PJNA 4YT5A 3NMJA 4AL0A 4PFOA 3KYJA 2C04A 4G78A 2J45A 2PX3A 3EHNA 4PJJA 3JYYA 2OJQA 2BL2A 3EGDB 2WVOA 3JRMO 4LACB 4C7OB 3AJMA 2P6VA 1M57C 2WVNA 4YK5A 1NFOA 4ONSA 3FOPA 3HJCA 2Y3DA 4DRJB 2A0UA 5EGYA 4G7ZF 1V54C 4K7BA 3W2WA 3ZVRA 2MHRA 1SMYF 1BZ4A 3WG7C 3SNHA 2L81A 3LUTB 4U5BE 4L6RA 3T6GB 1MNEA 3B9QA 2AWCA 1HW1A 4RD9A 2GFHA 3SXMA 4PR9A 5F5FA 1M2OA 3GM1A 1A7DA 3G4XA 2JD3A 3N0TA 1MQVA 2O9XA 2JPUA 3V5ZA 4BEJA 3IHUA 4NTAA 1Y6DA 3JSEO 5L0FA 4EWCA 3AGTA 2YZSA 3X1OA 2KC3A 3O39A 4PFPA 3M4BA 1WWPA 2XSEA 3C62A 4OD4A 5F28E 1OR2A 3HNLA 3A9CA 1FMWA 3ZWIA 2KNHA 2D4UA 3JT1A 4X0RA 1ST6A 3H2UA 4G7OF 2HMZA 2VCAA 1BR4A 4N4WA 2NUPB 2LQGA 2OKUA 3DAGA 3A11A 4N6HA 2B0HA 4WGZA 2G3KA 4JC7A 3RQFA 3T6JA 2R7SA 4MTOA 2F22A 1YARO 4GEHA 3TJ6A 2G3VA 5DQZA 4DVZA 1JMWA 1ZW2A 4BJ5C 5K0IA 3DM5A 1FR0A 2L6GA 1M2VB 3K33A 5KYWA 3SXYA 2A6EF 3K1IA 3NG1A 4H4KC 4Z9IA 4E17A 1EI7A 2KK1A 4DBQA 1T6QA 2PX0A 5L0GA 2Y69C 3AOUA 3LS0A 3T4RA 2J9BA 2YL1A 3FHDA 2FFHA 5L0JA 2HJ3A 1G5ZA 1B68A 1QLEC 1VLTA 2YL0A 3M4CA 2IXMA 4N06A 4ULWA 1VMAA 5L0CA 4PJLA 3BRJA 3SEOA 2QTVA 1NG1A 3EFOA 2ZXRA 5A6BA 3JSZA 3EJNA 1VTMP 4CJGA 1NSGB 2A6HF 3JYHA 3N24A 3Q6MA 3AG2C 2EIJC 3EPVA 4YJWA 1HE1A 3J06A 2EILC 4MVMA 3B29A 5D92A 1NU9C 1H9TA 3NYMA 1VB5A 2CW0F 1T5OA 3HTKC 3KKBA 2AP3A 5L0HA 1ZHYA 3HNIA 4C3DA 1JPJA 4U5DE 3ZDLA 1CGME 1JPNA 1UG7A 2NUPA 4OIRF 3K66A 3K1IC 1OW7A 2OEVA 1BDJB 4G0HA 3DE8A 1D1AA 2R7UA 2HS5A 2J9VA 2PBEA 4LDQA 2B0JA 2Y3HA 3IQCA 3TQOA 2L7AA 3NMIA 1A7VA 4QDLA 3QVZA 5JLIA 1SR2A 3K7DA 1PD1A 1E2XA 2YHSA 3EQLF 4J7TA 2M64A 2BC5A 1APCA 4RDAA 3TOMA 4O6MA 4P6IC 4DVYP 5A6KA 2G62A 4BEMJ 3UNGC 4C3BA 1YLMA 2DYSC 3T9OA 1M6TA 2MYSA 2XL6A 1DOVA 4I44A 1LI7A 1TWHA 1HMOA 3I4UA 1U6HA 3JRTA 4IAQA 2HZ8A 3ASNC 2VC9A 3LEOA 2W9YA 5JRAA 1QPUA 1V55C 4NY3A 5L0IA 4D4XA 1Z23A 2CYDA 3U0CA 4A4AA 1JOGA 256BA 3MYIA 3DI5A 1RKEA 4BJTA 3EHMA 4IWBA 2OJED
chains in the Genus database with same CATH topology
1I4YA 2AWCA 2AWYA 4XQ1A 1HMDA 1HMOA 3WAQA 3AGTA 4XPWA 2HMZA 2HMQA 3WHNA 1A7DA 4XPYA 3AGUA 1A7EA 2AVKA 1I4ZA 4XPXA 2MHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Y A;  2AWC A;  2AWY A;  4XQ1 A;  1HMD A;  1HMO A;  3WAQ A;  3AGT A;  4XPW A;  2HMZ A;  2HMQ A;  3WHN A;  1A7D A;  4XPY A;  3AGU A;  1A7E A;  2AVK A;  1I4Z A;  4XPX A;  2MHR A; 
#chains in the Genus database with same CATH topology
 2Y39 A;  1ZU4 A;  2KGO A;  2VB6 A;  3CZ6 A;  1W2W A;  3DZA A;  3MBG A;  4AE4 A;  3EGD A;  3SXK A;  5DQT A;  4DXW A;  4AX2 A;  1OW6 A;  4KI2 A;  4LDK A;  2EPM X;  5BQH A;  1OKK A;  1BR1 A;  2ZXO A;  1E85 A;  1AVO B;  1FMV A;  1PV3 A;  1VOM A;  1D0X A;  3EG9 B;  4KNV A;  1FAP B;  2XM4 A;  1YA9 A;  1K04 A;  5KYU B;  1LPE A;  1HW2 A;  3EFO B;  4OIQ F;  3K1H A;  5CI9 A;  5E33 A;  2J46 A;  3Q6N A;  3NKE A;  1C03 A;  1YA7 O;  2WZG A;  5B3S C;  3U2L A;  1T01 A;  1KNY A;  1E84 A;  2P1A A;  1TFO B;  1ORY A;  2OQM A;  3LES A;  4IB4 A;  1R5I D;  4Q7C A;  1YZC A;  3SYN A;  3ZSU A;  3UMK A;  3PHF 2;  3E70 C;  2NUT B;  2Q4F A;  4CS9 C;  4EHP A;  3EZI A;  4EUK B;  4JIO A;  1VYK A;  2YKZ A;  2OG2 A;  2EIN C;  4O7G A;  3B0U X;  1IW7 F;  5AGF A;  4YL1 A;  3WHN A;  1FNT c;  1XZQ A;  3ABK C;  3IPM O;  1BR2 A;  4YT2 A;  4UDV A;  1A0B A;  1KTM A;  3AQB A;  3LS1 A;  1KU2 A;  1QZX A;  4XWJ A;  1RJ9 A;  4JTA B;  3VAY A;  1TKN A;  1TWC A;  4F4B A;  5L0D A;  2EPO A;  2GWW A;  2YLD A;  4I1M A;  2EPN A;  4XPX A;  5HV9 A;  1VYI A;  3AG4 C;  3IEE A;  1Q0K A;  4FWV A;  4CX9 A;  1G4U S;  3H2V A;  4C3E A;  3UR3 C;  1UFB A;  2XLH A;  1ZYR F;  1ZW3 A;  4U5F E;  1BBH A;  4XEK A;  4CIH A;  1LS4 A;  2HSQ A;  1CGO A;  1WAT A;  1YYJ A;  2YLG A;  1Q0F A;  1OCC C;  2ASR A;  3C8Z A;  2NUT A;  4LDR A;  1D0Z A;  2EIM C;  2YRF A;  1ZU5 A;  1RKE B;  5HSW A;  5T3W A;  4CSA A;  3G4Z A;  4EKW A;  3MLG A;  3KH2 A;  2R03 A;  3US6 A;  3DXJ F;  4K0D A;  3QMK A;  4IJJ A;  2R7W A;  1AEP A;  2H7O A;  3NRH A;  4ULV A;  1LIH A;  3TOL A;  2VH3 A;  3W4Y A;  1O3U A;  5COF A;  2C03 A;  1H7I A;  3ZC4 A;  4CDY A;  3QW1 A;  4BJ6 C;  4MW3 A;  3H65 A;  3ZIB A;  1CGN A;  5COG A;  1PD0 A;  2Q00 A;  2QE9 A;  4G7H F;  4JRZ A;  1NBB A;  2XRH A;  4P9T A;  5A69 A;  5JS5 A;  5L3Q A;  3ITF A;  3VRC A;  1MND A;  1Q0D A;  4FES A;  4GQH A;  4YL3 A;  3FAJ A;  2R7T A;  2CNW A;  2GAQ A;  4IAO A;  2XXA A;  1ZVZ A;  4J32 B;  3I5Q A;  1HMD A;  4Q4Z F;  3ABM C;  3ECS A;  4QI0 A;  4OIP F;  1NLX A;  2X51 A;  2XLM A;  5DVW A;  1NU7 D;  1E86 A;  3JTL O;  3LNM B;  2DYR C;  3MYF A;  4OIN F;  3ZQY A;  4CJO A;  1XWJ A;  4D4N A;  2R7R A;  2YQY A;  2EPL X;  3VF0 A;  1OCO C;  3V7O A;  4CDV A;  2WB7 A;  2R7O A;  3GAN A;  2Q9A A;  4JJG A;  3EGX A;  4Z9H A;  3HNJ A;  1D1C A;  3U2M A;  4CBE A;  2WL8 A;  1JAF A;  1VK5 A;  2HUJ A;  4LLC A;  1T6U A;  5AC5 A;  1VLS A;  1OKK D;  4LLE A;  1A7E A;  4MVU A;  1LE2 A;  4MW8 A;  1TWA A;  5A6B D;  2R7Q A;  2A1D D;  1OXB A;  2L6F A;  4U5G A;  3KMI A;  5A6A A;  5KYY B;  2YEV A;  3RQE A;  3FXH A;  3UGO A;  2VAS A;  3M1C B;  1MMD A;  1LKX A;  3UGP A;  3FMS A;  3DWW A;  2I8B A;  3SZR A;  3NKD A;  2W45 A;  2CNW D;  2A68 F;  3M15 A;  1QKR A;  2Q9B A;  3KPH A;  2XL4 A;  3RVZ A;  2QY9 A;  4IAR A;  4N6C A;  4E0H A;  1YVI A;  2ETS A;  4EBJ A;  2XLD A;  2KYH A;  3TUL A;  4KC9 A;  4JTC B;  4XQ1 A;  4WJ0 A;  3WAQ A;  1MMG A;  2J0W A;  1CPR A;  2XLE A;  4FAP B;  2AU5 A;  3CEX A;  4J7Y A;  4W8P A;  3SP1 A;  4MVS A;  4EBB A;  3I5P A;  2DI3 A;  4NTB A;  4PAC A;  4J30 B;  4XTK A;  1G4W R;  5E3A A;  2VCC A;  1TR2 A;  1TWG A;  3S0X A;  2XM0 A;  1RMV A;  1LE4 A;  1YDI A;  2OOC A;  4PK4 A;  2FGY A;  5DLJ A;  3TD7 A;  3FVY A;  3HLZ A;  3DJU B;  5BQG A;  3NYL A;  5FZT A;  1E83 A;  3NYJ A;  4JKV A;  5KYW B;  2P61 A;  2EPK X;  2KW3 C;  3L0I A;  2HV7 A;  4NTF A;  4AE4 B;  1QSP A;  3AG1 C;  3DKA A;  3QVY A;  3GM2 A;  1MMN A;  3G50 A;  4MQ9 F;  2RSE B;  3U8P A;  3GOR A;  1C02 A;  1Y4C A;  2R25 A;  4E7S A;  2Q9C A;  3POV A;  1RCP A;  5B1B C;  1EKY A;  2OEX A;  4MND A;  1CPQ A;  1S7Z A;  3S90 A;  2R02 A;  2BE5 F;  4K1O A;  1LI5 A;  1WTY A;  1ZHX A;  1JRA A;  3S9O A;  4MTF A;  5B3I A;  2H8A A;  3HNK A;  5GPG B;  1L7C A;  3R2P A;  2P0N A;  4IGG A;  4MVQ A;  3ZTM A;  2QUP A;  2ZXP A;  3NMK A;  2HJM A;  1Q0M A;  2A69 F;  3L34 A;  4M63 A;  4O6Y A;  3RH3 A;  5CIV A;  2HV6 A;  3B0P A;  3IQ5 A;  2IXO A;  2NSG A;  4HE8 D;  3S84 A;  2AWY A;  1A41 A;  1WAS A;  3AQC A;  3IQT A;  2LSE A;  3LEV A;  1HE9 A;  3FDQ A;  3DAF A;  4H54 A;  3GOD A;  4XPY A;  1WN0 A;  3OEO A;  1NZE A;  1D0Y A;  4PJM A;  2PF4 E;  5KYU A;  4U5C E;  3RYL A;  2XS1 A;  1XZP A;  2LIG A;  5B1A C;  3RFY A;  4CS8 A;  2Q7R A;  5L3V A;  1SYQ A;  4W8K A;  3B0V C;  5FCL A;  1I4Z A;  3CAX A;  3KYI A;  3Q7G A;  4KNW A;  4BG0 A;  2NSF A;  2HSB A;  2XLW A;  1ZHW A;  5BUO A;  1LM3 B;  1ORJ A;  1H6G A;  3VM6 A;  2HFI A;  4EBK A;  2IXN A;  4DRH B;  4CS9 A;  1H9G A;  2LK4 A;  2ICW G;  4YL0 A;  1OXK A;  2YWA A;  2GA0 A;  2ZD9 A;  2A0B A;  5CI8 A;  3C8G B;  3L8I A;  4HFF B;  3PCV A;  3HKK A;  1F1M A;  1FFT C;  3U3F A;  2TMV P;  4XLN F;  3LLI A;  4MVZ A;  4YT8 A;  1SF8 A;  4JTD B;  2DGJ A;  4JCH A;  1HY5 A;  1S05 A;  2CCY A;  2YL7 A;  2R7X A;  2IM8 A;  2LFF A;  3DJN B;  2Y3B A;  1Z3I X;  3GM3 A;  4WGY A;  3S29 A;  2L6H A;  1I5N A;  1JR8 A;  1ZHT A;  3RKO F;  3PDM P;  2LCH A;  1ZHZ A;  3OWT A;  3ZQV A;  1J8M F;  1DOW A;  4ZLD A;  5A6J A;  3SXZ A;  4YWQ A;  4JEA A;  5D91 A;  1M56 C;  3ZTZ A;  4XPW A;  2J0X A;  3U3B A;  2XXA B;  4MTG A;  4C7O A;  1EQ1 A;  3EZH A;  2IOQ A;  4O6N A;  3RF3 A;  1OCR C;  4CS8 C;  2M4E A;  2R9R B;  1RKC A;  3U5S A;  1OW8 A;  3L1M A;  3W8I A;  2DB4 A;  4AL1 A;  1LS1 A;  3Q7L A;  1ORS C;  5EK0 A;  3F47 A;  2KQ9 A;  3U9M A;  4XEF A;  4XLP F;  3EGX B;  2PP4 A;  1AUE A;  3WOD F;  1RJ9 B;  5DS4 A;  3N2Z B;  2L9J A;  3K6B A;  3LJB A;  5E3C A;  4KBL A;  2UUI A;  4DRI B;  1K05 A;  2YLI A;  2NPU A;  4NCQ A;  1RXQ A;  2LP4 A;  3C8G A;  1SZI A;  2XLO A;  2MWQ A;  3EH1 A;  3IQ6 A;  1L3P A;  3QW0 A;  3T6B A;  2IYL D;  5F5H A;  4HFK B;  5KYY A;  5DS6 A;  5DS5 A;  3NDB B;  1O87 A;  2IXP A;  3EG9 A;  4HEA J;  4JUR I;  4MVR A;  2RD9 A;  2ZPA A;  4JZA A;  3RW0 A;  3UMH A;  4IRU A;  4MVO A;  2H7V C;  4BJ5 A;  1GGQ A;  1O5H A;  1K40 A;  4JCZ A;  4A2N B;  3E9V A;  1M2V A;  1FFH A;  2W4M A;  1TQG A;  1GM5 A;  3GEI A;  3JZ0 A;  5T3T A;  5COM A;  4XEV A;  3R7C A;  3LLK A;  5IY5 C;  3GEH A;  3TJ5 A;  4OD5 A;  5E2Q A;  2QNL A;  1PCX A;  3ZG1 A;  3OA1 A;  3DMD A;  3ABL C;  2X0C A;  5BQI A;  1Z5Z A;  2Q3T A;  3MX3 A;  1GQA A;  5TJ5 E;  5T1D B;  4BJ6 A;  5KYX B;  1N1C A;  2J9U A;  2ZXW C;  2NG1 A;  3DM9 B;  3FAP B;  3GEE A;  1Z6A A;  2I15 A;  3EH2 A;  4GYT A;  3QZC A;  1R4T A;  4P9F A;  4CSA C;  1EA8 A;  4E0I A;  3AGU A;  2IBF A;  2Z15 A;  2W4B A;  3GWN A;  2J7P D;  4JJF A;  2D5R B;  4FX5 A;  4I1O B;  3W2V A;  3ASO C;  4JW1 A;  2J7P A;  1OQC A;  3U8V A;  4Z9J A;  4E7Z A;  4NQF A;  4OIO F;  3C63 A;  2CDQ A;  3O6X A;  3U9J A;  4Q5S F;  1YZA A;  3O10 A;  1ZZP A;  3QTH A;  4U9E A;  2QLA A;  3PMR A;  4YT4 A;  2VCB A;  1U0B B;  4JEB A;  1D1B A;  4JVS A;  1NFN A;  1G8X A;  3C18 A;  3L8J A;  4RBN A;  4NC3 A;  4WAB A;  4ANJ A;  3RIP A;  2WZF A;  1QQ3 A;  2FAP B;  3B71 A;  2YL3 A;  3C7J A;  4CS7 A;  4DOZ A;  3W8H A;  5JUA A;  2E87 A;  3ATP A;  1TFK B;  1GS9 A;  2J9W A;  5JVE A;  1V4A A;  5JSL A;  4LER A;  2CGE A;  2Y3G A;  4E18 A;  4ZLC A;  4B6I A;  2EIK C;  2LFD A;  1YAU O;  2WVQ A;  3BEH A;  4O79 A;  5KYN A;  4AK9 A;  3KL4 A;  2H7B A;  1YJG A;  3TK0 A;  3V5Y A;  4MS2 A;  2PFD A;  2OCC C;  1MMA A;  1QVX A;  2PNO A;  1WGW A;  2YVK A;  2V26 A;  1Z7Q c;  4EIY A;  3JCU Q;  3LNR A;  4I3M A;  3CSK A;  3RQG A;  1U89 A;  2HKV A;  3S27 A;  1LVK A;  3VYW A;  5KYX A;  4QI2 A;  4ER9 A;  5JT4 A;  3C8G D;  3FOO A;  2JX0 A;  4U5E E;  4CDA A;  1T6I A;  2OU6 A;  4DJ9 A;  1IZM A;  2J8W A;  2UUH A;  5AC4 A;  4BJ1 A;  1I4Y A;  1V74 B;  3GWL A;  2KJG A;  3DD7 A;  1YYX A;  3MFN A;  2LD6 A;  4U5H A;  4YN0 B;  3S28 A;  1WOL A;  1Z63 A;  2R7V A;  3CQZ A;  3UMI A;  2V3C C;  1OR3 A;  2AVK A;  4DBR A;  1OCZ C;  4JE9 A;  1J8Y F;  2R05 A;  2XL8 A;  5JP7 A;  1FTS A;  2P7V A;  2XS8 A;  5EHH A;  4CIP A;  1Q0G A;  4BPM A;  2HMQ A;  1C17 M;  3V5X A;  4U9D A;  1T9K A;  2WZL A;  2KSF A;  3F46 A;  2XLV A;  3RVY A;  3LAY A;  3AG3 C;  3X2Q C;  3O55 A;  3DE9 A;  2GDC A;  3M79 A;  4R32 A;  4PJN A;  4YT5 A;  3NMJ A;  4AL0 A;  4PFO A;  3KYJ A;  2C04 A;  4G78 A;  2J45 A;  2PX3 A;  3EHN A;  4PJJ A;  3JYY A;  2OJQ A;  2BL2 A;  3EGD B;  2WVO A;  3JRM O;  4LAC B;  4C7O B;  3AJM A;  2P6V A;  1M57 C;  2WVN A;  4YK5 A;  1NFO A;  4ONS A;  3FOP A;  3HJC A;  2Y3D A;  4DRJ B;  2A0U A;  5EGY A;  4G7Z F;  1V54 C;  4K7B A;  3W2W A;  3ZVR A;  2MHR A;  1SMY F;  1BZ4 A;  3WG7 C;  3SNH A;  2L81 A;  3LUT B;  4U5B E;  4L6R A;  3T6G B;  1MNE A;  3B9Q A;  2AWC A;  1HW1 A;  4RD9 A;  2GFH A;  3SXM A;  4PR9 A;  5F5F A;  1M2O A;  3GM1 A;  1A7D A;  3G4X A;  2JD3 A;  3N0T A;  1MQV A;  2O9X A;  2JPU A;  3V5Z A;  4BEJ A;  3IHU A;  4NTA A;  1Y6D A;  3JSE O;  5L0F A;  4EWC A;  3AGT A;  2YZS A;  3X1O A;  2KC3 A;  3O39 A;  4PFP A;  3M4B A;  1WWP A;  2XSE A;  3C62 A;  4OD4 A;  5F28 E;  1OR2 A;  3HNL A;  3A9C A;  1FMW A;  3ZWI A;  2KNH A;  2D4U A;  3JT1 A;  4X0R A;  1ST6 A;  3H2U A;  4G7O F;  2HMZ A;  2VCA A;  1BR4 A;  4N4W A;  2NUP B;  2LQG A;  2OKU A;  3DAG A;  3A11 A;  4N6H A;  2B0H A;  4WGZ A;  2G3K A;  4JC7 A;  3RQF A;  3T6J A;  2R7S A;  4MTO A;  2F22 A;  1YAR O;  4GEH A;  3TJ6 A;  2G3V A;  5DQZ A;  4DVZ A;  1JMW A;  1ZW2 A;  4BJ5 C;  5K0I A;  3DM5 A;  1FR0 A;  2L6G A;  1M2V B;  3K33 A;  5KYW A;  3SXY A;  2A6E F;  3K1I A;  3NG1 A;  4H4K C;  4Z9I A;  4E17 A;  1EI7 A;  2KK1 A;  4DBQ A;  1T6Q A;  2PX0 A;  5L0G A;  2Y69 C;  3AOU A;  3LS0 A;  3T4R A;  2J9B A;  2YL1 A;  3FHD A;  2FFH A;  5L0J A;  2HJ3 A;  1G5Z A;  1B68 A;  1QLE C;  1VLT A;  2YL0 A;  3M4C A;  2IXM A;  4N06 A;  4ULW A;  1VMA A;  5L0C A;  4PJL A;  3BRJ A;  3SEO A;  2QTV A;  1NG1 A;  3EFO A;  2ZXR A;  5A6B A;  3JSZ A;  3EJN A;  1VTM P;  4CJG A;  1NSG B;  2A6H F;  3JYH A;  3N24 A;  3Q6M A;  3AG2 C;  2EIJ C;  3EPV A;  4YJW A;  1HE1 A;  3J06 A;  2EIL C;  4MVM A;  3B29 A;  5D92 A;  1NU9 C;  1H9T A;  3NYM A;  1VB5 A;  2CW0 F;  1T5O A;  3HTK C;  3KKB A;  2AP3 A;  5L0H A;  1ZHY A;  3HNI A;  4C3D A;  1JPJ A;  4U5D E;  3ZDL A;  1CGM E;  1JPN A;  1UG7 A;  2NUP A;  4OIR F;  3K66 A;  3K1I C;  1OW7 A;  2OEV A;  1BDJ B;  4G0H A;  3DE8 A;  1D1A A;  2R7U A;  2HS5 A;  2J9V A;  2PBE A;  4LDQ A;  2B0J A;  2Y3H A;  3IQC A;  3TQO A;  2L7A A;  3NMI A;  1A7V A;  4QDL A;  3QVZ A;  5JLI A;  1SR2 A;  3K7D A;  1PD1 A;  1E2X A;  2YHS A;  3EQL F;  4J7T A;  2M64 A;  2BC5 A;  1APC A;  4RDA A;  3TOM A;  4O6M A;  4P6I C;  4DVY P;  5A6K A;  2G62 A;  4BEM J;  3UNG C;  4C3B A;  1YLM A;  2DYS C;  3T9O A;  1M6T A;  2MYS A;  2XL6 A;  1DOV A;  4I44 A;  1LI7 A;  1TWH A;  1HMO A;  3I4U A;  1U6H A;  3JRT A;  4IAQ A;  2HZ8 A;  3ASN C;  2VC9 A;  3LEO A;  2W9Y A;  5JRA A;  1QPU A;  1V55 C;  4NY3 A;  5L0I A;  4D4X A;  1Z23 A;  2CYD A;  3U0C A;  4A4A A;  1JOG A;  256B A;  3MYI A;  3DI5 A;  1RKE A;  4BJT A;  3EHM A;  4IWB A;  2OJE D; 
#chains in the Genus database with same CATH homology
 1I4Y A;  2AWC A;  2AWY A;  4XQ1 A;  1HMD A;  1HMO A;  3WAQ A;  3AGT A;  4XPW A;  2HMZ A;  2HMQ A;  3WHN A;  1A7D A;  4XPY A;  3AGU A;  1A7E A;  2AVK A;  1I4Z A;  4XPX A;  2MHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...