4XPXA

Crystal structure of hemerythrin:wild-type
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
ALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWLVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xpxA00
1A7DA 4XPYA 1I4ZA 4XPWA 4XPXA 3WAQA 2AWCA 3AGUA 2HMZA 3WHNA 1A7EA 2AVKA 2HMQA 1HMOA 1HMDA 3AGTA 2AWYA 4XQ1A 2MHRA 1I4YA
chains in the Genus database with same CATH superfamily
2EPMX 2A1DD 3R7CA 1GQAA 5EGYA 1U0BB 1PCXA 2KK1A 2J9WA 3ABMC 2OJQA 4RDAA 1YA7O 1LS4A 1ZVZA 5CI8A 4MTFA 3DZAA 2KJGA 5BUOA 1HY5A 1SZIA 4L6RA 3SZRA 5A6JA 4XEKA 2YL7A 1MMGA 3K1IC 4U9EA 3ZG1A 2YQYA 1XZQA 1MMAA 2ZXWC 2BL2A 3ZTMA 5A6BD 1PD1A 1WGWA 1OXBA 2IYLD 2YLIA 2X51A 3K6BA 5DLJA 4XWJA 4F4BA 3L0IA 1U89A 2IM8A 4NTBA 1AVOB 4MW3A 1ZW2A 2YZSA 4KC9A 2NUTA 1DOWA 1E85A 4GQHA 2FFHA 2W45A 2EIMC 1FR0A 3T6GB 3MYFA 3GWLA 1TFOB 1AEPA 3DJUB 4P9TA 1I4YA 3C62A 1N1CA 1O87A 4EKWA 4YT2A 1CGME 3DMDA 1ZHWA 3RFYA 3G4ZA 1RKCA 2ETSA 2NUPA 2WB7A 4LERA 3RVZA 4I44A 4N6CA 2ZD9A 4WGYA 2XM0A 3CEXA 4QI0A 1GM5A 4NQFA 3F47A 2R9RB 4MVZA 3LEVA 1NU7D 2IXOA 3RQEA 3LUTB 3RQGA 5COMA 2Y3GA 1YA9A 1FFHA 2XL4A 4O6MA 3EH1A 3CQZA 3GM3A 4CJOA 2R7TA 1VLTA 2DI3A 2Q9BA 4CSAA 4I1OB 3B29A 1W2WA 4QDLA 3S84A 2NSFA 3U0CA 2GFHA 4XQ1A 2R7XA 1UFBA 1D1CA 3OA1A 4OINF 4E7ZA 2HFIA 3IHUA 1YARO 3EGDB 3RIPA 4C7OA 2W9YA 4EWCA 4U5HA 4C3DA 5IY5C 3ZIBA 3F46A 5GPGB 4CDYA 1D1BA 1ZW3A 1VB5A 1WATA 3PCVA 3HJCA 1J8YF 2CDQA 2VC9A 1LM3B 2KNHA 2ZPAA 2QY9A 4I1MA 2MWQA 4Q7CA 4CS9A 3QTHA 2HMZA 3MBGA 3LLIA 4RD9A 5AGFA 4NTAA 5DQTA 3UGOA 2EPOA 3FDQA 1BR1A 1C17M 2W4MA 4PJJA 2P6VA 4BJ6A 1AUEA 3WG7C 4U5EE 1D0ZA 5T1DB 2HSBA 4WGZA 2QNLA 4CBEA 5A6KA 5JSLA 4OIQF 3Q7LA 1PV3A 4IAOA 3G50A 1ORJA 2LCHA 2CNWA 4J30B 4P9FA 1ZHYA 1OKKD 3IQ5A 2J9UA 3NRHA 5AC4A 3DE9A 4HEAJ 1VMAA 4PJLA 256BA 1LVKA 3W2WA 2L6HA 3HTKC 1FMWA 4BJ5C 1TQGA 3QW0A 1BBHA 4CS8C 5TJ5E 4XPWA 4BJTA 2ASRA 3EQLF 4EIYA 1GS9A 1JAFA 1LE4A 2Q9CA 2P61A 1MMDA 2QUPA 3OWTA 4CIPA 1C03A 3NYLA 1ZZPA 1K04A 1QSPA 2KC3A 1OCOC 3AJMA 5T3WA 1JMWA 1NG1A 3AG1C 3ASOC 4DBRA 3EGXB 5D92A 1CGNA 3W8IA 2NSGA 1HMOA 1RJ9A 4RBNA 3ZQVA 4BEMJ 3WODF 1TWHA 4K0DA 1FAPB 2W4BA 2Y3BA 2XL6A 3ECSA 2XLEA 3E9VA 4E7SA 2TMVP 3SYNA 4EUKB 3EJNA 2XXAB 4LDKA 1M2VA 2C03A 2PX3A 3SNHA 2M64A 3L1MA 1QPUA 2YL1A 4OD5A 3U9MA 3POVA 3C8GB 4YK5A 1T6UA 3UNGC 2IOQA 2UUHA 1LIHA 4YWQA 1ZYRF 5FZTA 3X1OA 4JZAA 3JSEO 4R32A 5L0FA 3JSZA 4J7TA 4U5FE 3U3BA 1E83A 2BE5F 1HE1A 1QZXA 1ZU5A 2JX0A 4U9DA 2LP4A 3T9OA 1ZHXA 1FTSA 3HNLA 1NFOA 3U8VA 1ZU4A 4YL3A 2Q3TA 2VB6A 5BQIA 2L6GA 5DVWA 3LEOA 2AVKA 1OCZC 2J45A 3ATPA 5KYXA 1NU9C 4Z9HA 4KI2A 3MFNA 1CPQA 4KBLA 2A0UA 3QZCA 2E87A 2B0HA 2HJ3A 2AWYA 3LS1A 4HFFB 4DVYP 1Q0DA 2XLOA 1UG7A 3K1HA 3K7DA 3ZDLA 4H54A 1LS1A 1Z6AA 4JTCB 4Z9IA 1O3UA 1ORYA 1A7VA 1YZCA 4KNWA 1LI7A 3G4XA 4DXWA 3EPVA 5JVEA 2FAPB 2LFFA 5F5FA 1YYXA 2AU5A 2EIJC 3SXKA 3BRJA 2FGYA 5EHHA 2D5RB 1WWPA 3ZSUA 2WL8A 3U5SA 2LSEA 2J46A 2PF4E 1YAUO 3C8GD 3H65A 3U2MA 3ABKC 2JPUA 3I5QA 4MVUA 4AL1A 2R7RA 3VYWA 4CDAA 1VOMA 1G4US 1TKNA 5DQZA 3L34A 4BJ1A 1M2OA 2J0WA 3H2VA 3LLKA 3OEOA 4PJNA 5KYNA 1NZEA 2XLMA 4NY3A 1RKEA 3QVYA 3GEEA 3VAYA 2WZFA 1LI5A 5L3VA 3U8PA 1OW8A 2MYSA 2H7OA 1C02A 5BQGA 3SXZA 5L0IA 5KYYB 5DS6A 3ASNC 3EGXA 1E86A 3AG3C 3DM9B 3NMKA 2XLVA 2CW0F 2GA0A 4HE8D 2D4UA 4AK9A 2OU6A 5K0IA 1OW6A 2L9JA 5L0DA 4G7OF 1K05A 3TD7A 4B6IA 4E0IA 2XXAA 1EQ1A 1WN0A 4NTFA 1LE2A 4JEBA 4AE4A 3WAQA 2EIKC 4MW8A 3T6BA 4JJFA 3C63A 5EK0A 2EINC 1SYQA 2XLWA 3DD7A 4LDRA 4PACA 1T6QA 5T3TA 2VCCA 1O5HA 5COGA 4ZLCA 4DRHB 4DJ9A 4D4NA 5A6BA 4CSAC 4E17A 2XS1A 1RXQA 1VLSA 1T9KA 5JS5A 2A68F 4EBKA 4IGGA 3RH3A 3V7OA 3GANA 4EBJA 3SXYA 3Q6MA 5F28E 1ZHZA 4G0HA 2DYSC 3AQBA 4MVRA 2V3CC 2KGOA 1T5OA 5A69A 4QI2A 4O6YA 2XSEA 5KYWB 3GORA 1MNDA 1G8XA 4HFKB 4PFPA 4IAQA 1TFKB 4XPXA 3V5XA 3ZVRA 2NG1A 1YVIA 2OKUA 2Q4FA 3FOPA 2YVKA 3AQCA 5L0CA 4CS9C 4NCQA 2ICWG 2IXMA 2LQGA 4FX5A 4JJGA 1HW2A 4BG0A 1BDJB 1H7IA 1G4WR 2YRFA 2YLDA 3LS0A 4BJ6C 1T01A 1JRAA 1A41A 1K40A 4PR9A 5B1AC 4N4WA 1S05A 3UMIA 4EHPA 3NDBB 4IRUA 4YN0B 4Q5SF 3ZC4A 3ZQYA 2H7VC 1OR3A 1B68A 3H2UA 3M4CA 2IBFA 4U5GA 3JCUQ 4DRIB 2XL8A 3AG4C 4ANJA 2Q00A 3O6XA 1G5ZA 1MMNA 1NLXA 2PP4A 3Q7GA 4CJGA 5KYUB 3FMSA 2IXPA 1SR2A 2PBEA 2PFDA 2A0BA 1Z23A 3EFOB 3GEIA 4G78A 1HE9A 4M63A 3T4RA 3TOLA 3ZWIA 4AL0A 1JPJA 2A6EF 5AC5A 3B0VC 2J7PD 3S28A 3M4BA 4XTKA 2R03A 3A11A 4DRJB 3DKAA 1OCCC 5E3AA 2L81A 2GDCA 3I5PA 3VM6A 3NYJA 2ZXPA 1OXKA 3FAJA 4CDVA 3CAXA 4ULWA 2KYHA 2HUJA 2OEVA 2XLDA 3NMIA 4K1OA 1KTMA 4JW1A 4O6NA 2GAQA 2WVQA 1PD0A 2I8BA 3C8ZA 2OG2A 4MVQA 4WABA 2J9BA 2H7BA 2J0XA 3MX3A 4JCHA 4OIPF 2VASA 1JOGA 1H6GA 4JRZA 1Z5ZA 1WASA 4JTDB 5DS4A 1JPNA 1MQVA 3CSKA 4D4XA 2WVNA 1OKKA 3U9JA 3EZIA 3L8JA 2X0CA 4CS8A 4KNVA 1NFNA 1ORSC 1VYKA 3C18A 4U5CE 2YL3A 1SMYF 2XS8A 1S7ZA 3EH2A 4W8KA 3FXHA 2P0NA 2YWAA 4DBQA 2R02A 1ST6A 1OCRC 3DM5A 1XWJA 1R5ID 1E84A 5CIVA 3EGDA 1FMVA 2XLHA 1Y4CA 2G3KA 2I15A 4LACB 2NUPB 2IXNA 3NKEA 1CPRA 2AP3A 4MTGA 2Y69C 1TWGA 1M6TA 2LK4A 1SF8A 4YL0A 2ZXOA 2XM4A 2LIGA 4IARA 3ZTZA 3S90A 3KH2A 4LLEA 3GEHA 1A7DA 5E2QA 1J8MF 1QQ3A 3AG2C 4OD4A 1HW1A 1TWCA 4JTAB 3PDMP 4N6HA 2Q7RA 2HJMA 1OW7A 2PX0A 3A9CA 1LKXA 3AGUA 3AOUA 4FESA 4ONSA 4C7OB 4FAPB 2R25A 1D1AA 3LAYA 1VYIA 4YT8A 1KNYA 2L6FA 2NPUA 2HMQA 2P1AA 2Y39A 2DYRC 2WVOA 3EFOA 3HNJA 5KYUA 3RW0A 2RSEB 1KU2A 3JYHA 1VK5A 3KMIA 3CZ6A 2RD9A 1Q0KA 1F1MA 2OJED 2OOCA 3C7JA 3I4UA 3O55A 4JVSA 3S0XA 4MVMA 4PFOA 2GWWA 1ZHTA 3LJBA 3M79A 3NYMA 3RVYA 2VH3A 4CIHA 2R7OA 3B71A 4XPYA 3IPMO 1M56C 4GYTA 3MYIA 2R7QA 1OR2A 1NBBA 2WZGA 4P6IC 4UDVA 3TOMA 2Q9AA 4XEVA 3X2QC 4Q4ZF 3K33A 5HV9A 3LESA 3K1IA 3N24A 2A6HF 3W4YA 2AWCA 3PHF2 1Q0FA 2EILC 3C8GA 4IB4A 1VTMP 3TK0A 2QE9A 5F5HA 5B3IA 3DE8A 5JT4A 1A0BA 4E18A 2YL0A 1HMDA 3AGTA 3SP1A 4N06A 1YZAA 3RKOF 4ER9A 4JURI 3VRCA 5D91A 2DGJA 3B9QA 1WOLA 4LDQA 4J7YA 2MHRA 3FAPB 3UMHA 4C3EA 4E0HA 1Z63A 3EG9B 3UGPA 3K66A 3M1CB 1EA8A 2EPKX 3EHNA 3O10A 1RJ9B 3TQOA 4CX9A 1MNEA 1LPEA 3PMRA 1U6HA 2HS5A 2G3VA 2LD6A 2DB4A 3NMJA 2P7VA 5B1BC 3S27A 2HKVA 4EBBA 1L3PA 4G7ZF 5E33A 1JR8A 1M2VB 2R7WA 3RQFA 1YYJA 3DAGA 3GM1A 3V5ZA 3N0TA 4PJMA 3HKKA 3NG1A 2KSFA 4JC7A 1TR2A 1QKRA 2KW3C 1L7CA 2BC5A 3EHMA 4BEJA 3FOOA 4A2NB 1V74B 5JLIA 5JUAA 1GGQA 2J8WA 1T6IA 3KPHA 3BEHA 1Q0MA 2CNWD 4W8PA 2B0JA 1QLEC 2EPNA 3GM2A 2CCYA 1M57C 1V54C 3QVZA 2PNOA 5JRAA 3R2PA 4A4AA 3KKBA 5KYXB 2HSQA 5HSWA 3HNKA 2QTVA 5CI9A 2VCAA 1Z3IX 2EPLX 4WJ0A 3TJ6A 1CGOA 4H4KC 1I5NA 3DXJF 2OCCC 4JKVA 4MS2A 3TJ5A 3U3FA 1OQCA 3UR3C 2R05A 1APCA 2VCBA 1YLMA 3RYLA 5KYYA 3IQTA 4J32B 4YT5A 3M15A 5FCLA 4YT4A 2HV7A 2YLGA 3LNRA 3KYJA 3QMKA 3S29A 3U2LA 2HV6A 4BPMA 5DS5A 3JYYA 5BQHA 2H8AA 3N2ZB 3V5YA 2WZLA 3EZHA 3S9OA 2M4EA 2UUIA 3IQCA 2Z15A 3W8HA 4U5DE 1XZPA 3LNMB 3O39A 4C3BA 5L0JA 1Z7Qc 5B3SC 2R7VA 3HNIA 4JCZA 1EKYA 3ABLC 3J06A 4MVSA 4G7HF 2R7SA 1QVXA 1V4AA 1I4ZA 3FHDA 3HLZA 3JRMO 4MNDA 4Z9JA 5JP7A 1H9TA 4BJ5A 4OIOF 2F22A 2J9VA 3TULA 1TWAA 1IZMA 1EI7A 4LLCA 2LFDA 1RKEB 2NUTB 4I3MA 1IW7F 3B0PA 4JE9A 4XLPF 2CYDA 3QW1A 2J7PA 4PK4A 3EG9A 3SEOA 3VF0A 2L7AA 3JTLO 2YHSA 3KL4A 4MTOA 4O7GA 1A7EA 1WTYA 1RCPA 1D0YA 4YL1A 3T6JA 2C04A 3RF3A 5KYWA 4IJJA 3W2VA 4AX2A 2G62A 1R4TA 3DWWA 3DI5A 1DOVA 3KYIA 4AE4B 4MQ9F 2XRHA 3ITFA 3SXMA 2YEVA 2O9XA 4XLNF 5L0HA 3E70C 3JRTA 1YJGA 2V26A 3DJNB 1FFTC 4YJWA 5E3CA 2ZXRA 2JD3A 2KQ9A 3Q6NA 3IQ6A 2Y3DA 1Q0GA 1BR4A 3MLGA 3GWNA 5L3QA 4X0RA 4ZLDA 1D0XA 1E2XA 1RMVA 2A69F 2YKZA 5COFA 4IWBA 3IEEA 4MVOA 4DOZA 3FVYA 4NC3A 3JT1A 3JZ0A 4DVZA 3US6A 3DAFA 3WHNA 4CS7A 5L0GA 4ULVA 1FNTc 2OQMA 1V55C 2R7UA 3L8IA 4O79A 4JEAA 1BR2A 1Y6DA 1YDIA 4OIRF 4FWVA 1H9GA 4GEHA 4K7BA 4U5BE 2Y3HA 5A6AA 1BZ4A 2OEXA 2CGEA 2HZ8A 2QLAA 3GODA 3NKDA 4JIOA 4XEFA 3UMKA 1NSGB 3B0UX
chains in the Genus database with same CATH topology
1A7DA 4XPYA 1I4ZA 4XPWA 4XPXA 3WAQA 2AWCA 3AGUA 2HMZA 3WHNA 1A7EA 2AVKA 2HMQA 1HMOA 1HMDA 3AGTA 2AWYA 4XQ1A 2MHRA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7D A;  4XPY A;  1I4Z A;  4XPW A;  4XPX A;  3WAQ A;  2AWC A;  3AGU A;  2HMZ A;  3WHN A;  1A7E A;  2AVK A;  2HMQ A;  1HMO A;  1HMD A;  3AGT A;  2AWY A;  4XQ1 A;  2MHR A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 2EPM X;  2A1D D;  3R7C A;  1GQA A;  5EGY A;  1U0B B;  1PCX A;  2KK1 A;  2J9W A;  3ABM C;  2OJQ A;  4RDA A;  1YA7 O;  1LS4 A;  1ZVZ A;  5CI8 A;  4MTF A;  3DZA A;  2KJG A;  5BUO A;  1HY5 A;  1SZI A;  4L6R A;  3SZR A;  5A6J A;  4XEK A;  2YL7 A;  1MMG A;  3K1I C;  4U9E A;  3ZG1 A;  2YQY A;  1XZQ A;  1MMA A;  2ZXW C;  2BL2 A;  3ZTM A;  5A6B D;  1PD1 A;  1WGW A;  1OXB A;  2IYL D;  2YLI A;  2X51 A;  3K6B A;  5DLJ A;  4XWJ A;  4F4B A;  3L0I A;  1U89 A;  2IM8 A;  4NTB A;  1AVO B;  4MW3 A;  1ZW2 A;  2YZS A;  4KC9 A;  2NUT A;  1DOW A;  1E85 A;  4GQH A;  2FFH A;  2W45 A;  2EIM C;  1FR0 A;  3T6G B;  3MYF A;  3GWL A;  1TFO B;  1AEP A;  3DJU B;  4P9T A;  1I4Y A;  3C62 A;  1N1C A;  1O87 A;  4EKW A;  4YT2 A;  1CGM E;  3DMD A;  1ZHW A;  3RFY A;  3G4Z A;  1RKC A;  2ETS A;  2NUP A;  2WB7 A;  4LER A;  3RVZ A;  4I44 A;  4N6C A;  2ZD9 A;  4WGY A;  2XM0 A;  3CEX A;  4QI0 A;  1GM5 A;  4NQF A;  3F47 A;  2R9R B;  4MVZ A;  3LEV A;  1NU7 D;  2IXO A;  3RQE A;  3LUT B;  3RQG A;  5COM A;  2Y3G A;  1YA9 A;  1FFH A;  2XL4 A;  4O6M A;  3EH1 A;  3CQZ A;  3GM3 A;  4CJO A;  2R7T A;  1VLT A;  2DI3 A;  2Q9B A;  4CSA A;  4I1O B;  3B29 A;  1W2W A;  4QDL A;  3S84 A;  2NSF A;  3U0C A;  2GFH A;  4XQ1 A;  2R7X A;  1UFB A;  1D1C A;  3OA1 A;  4OIN F;  4E7Z A;  2HFI A;  3IHU A;  1YAR O;  3EGD B;  3RIP A;  4C7O A;  2W9Y A;  4EWC A;  4U5H A;  4C3D A;  5IY5 C;  3ZIB A;  3F46 A;  5GPG B;  4CDY A;  1D1B A;  1ZW3 A;  1VB5 A;  1WAT A;  3PCV A;  3HJC A;  1J8Y F;  2CDQ A;  2VC9 A;  1LM3 B;  2KNH A;  2ZPA A;  2QY9 A;  4I1M A;  2MWQ A;  4Q7C A;  4CS9 A;  3QTH A;  2HMZ A;  3MBG A;  3LLI A;  4RD9 A;  5AGF A;  4NTA A;  5DQT A;  3UGO A;  2EPO A;  3FDQ A;  1BR1 A;  1C17 M;  2W4M A;  4PJJ A;  2P6V A;  4BJ6 A;  1AUE A;  3WG7 C;  4U5E E;  1D0Z A;  5T1D B;  2HSB A;  4WGZ A;  2QNL A;  4CBE A;  5A6K A;  5JSL A;  4OIQ F;  3Q7L A;  1PV3 A;  4IAO A;  3G50 A;  1ORJ A;  2LCH A;  2CNW A;  4J30 B;  4P9F A;  1ZHY A;  1OKK D;  3IQ5 A;  2J9U A;  3NRH A;  5AC4 A;  3DE9 A;  4HEA J;  1VMA A;  4PJL A;  256B A;  1LVK A;  3W2W A;  2L6H A;  3HTK C;  1FMW A;  4BJ5 C;  1TQG A;  3QW0 A;  1BBH A;  4CS8 C;  5TJ5 E;  4XPW A;  4BJT A;  2ASR A;  3EQL F;  4EIY A;  1GS9 A;  1JAF A;  1LE4 A;  2Q9C A;  2P61 A;  1MMD A;  2QUP A;  3OWT A;  4CIP A;  1C03 A;  3NYL A;  1ZZP A;  1K04 A;  1QSP A;  2KC3 A;  1OCO C;  3AJM A;  5T3W A;  1JMW A;  1NG1 A;  3AG1 C;  3ASO C;  4DBR A;  3EGX B;  5D92 A;  1CGN A;  3W8I A;  2NSG A;  1HMO A;  1RJ9 A;  4RBN A;  3ZQV A;  4BEM J;  3WOD F;  1TWH A;  4K0D A;  1FAP B;  2W4B A;  2Y3B A;  2XL6 A;  3ECS A;  2XLE A;  3E9V A;  4E7S A;  2TMV P;  3SYN A;  4EUK B;  3EJN A;  2XXA B;  4LDK A;  1M2V A;  2C03 A;  2PX3 A;  3SNH A;  2M64 A;  3L1M A;  1QPU A;  2YL1 A;  4OD5 A;  3U9M A;  3POV A;  3C8G B;  4YK5 A;  1T6U A;  3UNG C;  2IOQ A;  2UUH A;  1LIH A;  4YWQ A;  1ZYR F;  5FZT A;  3X1O A;  4JZA A;  3JSE O;  4R32 A;  5L0F A;  3JSZ A;  4J7T A;  4U5F E;  3U3B A;  1E83 A;  2BE5 F;  1HE1 A;  1QZX A;  1ZU5 A;  2JX0 A;  4U9D A;  2LP4 A;  3T9O A;  1ZHX A;  1FTS A;  3HNL A;  1NFO A;  3U8V A;  1ZU4 A;  4YL3 A;  2Q3T A;  2VB6 A;  5BQI A;  2L6G A;  5DVW A;  3LEO A;  2AVK A;  1OCZ C;  2J45 A;  3ATP A;  5KYX A;  1NU9 C;  4Z9H A;  4KI2 A;  3MFN A;  1CPQ A;  4KBL A;  2A0U A;  3QZC A;  2E87 A;  2B0H A;  2HJ3 A;  2AWY A;  3LS1 A;  4HFF B;  4DVY P;  1Q0D A;  2XLO A;  1UG7 A;  3K1H A;  3K7D A;  3ZDL A;  4H54 A;  1LS1 A;  1Z6A A;  4JTC B;  4Z9I A;  1O3U A;  1ORY A;  1A7V A;  1YZC A;  4KNW A;  1LI7 A;  3G4X A;  4DXW A;  3EPV A;  5JVE A;  2FAP B;  2LFF A;  5F5F A;  1YYX A;  2AU5 A;  2EIJ C;  3SXK A;  3BRJ A;  2FGY A;  5EHH A;  2D5R B;  1WWP A;  3ZSU A;  2WL8 A;  3U5S A;  2LSE A;  2J46 A;  2PF4 E;  1YAU O;  3C8G D;  3H65 A;  3U2M A;  3ABK C;  2JPU A;  3I5Q A;  4MVU A;  4AL1 A;  2R7R A;  3VYW A;  4CDA A;  1VOM A;  1G4U S;  1TKN A;  5DQZ A;  3L34 A;  4BJ1 A;  1M2O A;  2J0W A;  3H2V A;  3LLK A;  3OEO A;  4PJN A;  5KYN A;  1NZE A;  2XLM A;  4NY3 A;  1RKE A;  3QVY A;  3GEE A;  3VAY A;  2WZF A;  1LI5 A;  5L3V A;  3U8P A;  1OW8 A;  2MYS A;  2H7O A;  1C02 A;  5BQG A;  3SXZ A;  5L0I A;  5KYY B;  5DS6 A;  3ASN C;  3EGX A;  1E86 A;  3AG3 C;  3DM9 B;  3NMK A;  2XLV A;  2CW0 F;  2GA0 A;  4HE8 D;  2D4U A;  4AK9 A;  2OU6 A;  5K0I A;  1OW6 A;  2L9J A;  5L0D A;  4G7O F;  1K05 A;  3TD7 A;  4B6I A;  4E0I A;  2XXA A;  1EQ1 A;  1WN0 A;  4NTF A;  1LE2 A;  4JEB A;  4AE4 A;  3WAQ A;  2EIK C;  4MW8 A;  3T6B A;  4JJF A;  3C63 A;  5EK0 A;  2EIN C;  1SYQ A;  2XLW A;  3DD7 A;  4LDR A;  4PAC A;  1T6Q A;  5T3T A;  2VCC A;  1O5H A;  5COG A;  4ZLC A;  4DRH B;  4DJ9 A;  4D4N A;  5A6B A;  4CSA C;  4E17 A;  2XS1 A;  1RXQ A;  1VLS A;  1T9K A;  5JS5 A;  2A68 F;  4EBK A;  4IGG A;  3RH3 A;  3V7O A;  3GAN A;  4EBJ A;  3SXY A;  3Q6M A;  5F28 E;  1ZHZ A;  4G0H A;  2DYS C;  3AQB A;  4MVR A;  2V3C C;  2KGO A;  1T5O A;  5A69 A;  4QI2 A;  4O6Y A;  2XSE A;  5KYW B;  3GOR A;  1MND A;  1G8X A;  4HFK B;  4PFP A;  4IAQ A;  1TFK B;  4XPX A;  3V5X A;  3ZVR A;  2NG1 A;  1YVI A;  2OKU A;  2Q4F A;  3FOP A;  2YVK A;  3AQC A;  5L0C A;  4CS9 C;  4NCQ A;  2ICW G;  2IXM A;  2LQG A;  4FX5 A;  4JJG A;  1HW2 A;  4BG0 A;  1BDJ B;  1H7I A;  1G4W R;  2YRF A;  2YLD A;  3LS0 A;  4BJ6 C;  1T01 A;  1JRA A;  1A41 A;  1K40 A;  4PR9 A;  5B1A C;  4N4W A;  1S05 A;  3UMI A;  4EHP A;  3NDB B;  4IRU A;  4YN0 B;  4Q5S F;  3ZC4 A;  3ZQY A;  2H7V C;  1OR3 A;  1B68 A;  3H2U A;  3M4C A;  2IBF A;  4U5G A;  3JCU Q;  4DRI B;  2XL8 A;  3AG4 C;  4ANJ A;  2Q00 A;  3O6X A;  1G5Z A;  1MMN A;  1NLX A;  2PP4 A;  3Q7G A;  4CJG A;  5KYU B;  3FMS A;  2IXP A;  1SR2 A;  2PBE A;  2PFD A;  2A0B A;  1Z23 A;  3EFO B;  3GEI A;  4G78 A;  1HE9 A;  4M63 A;  3T4R A;  3TOL A;  3ZWI A;  4AL0 A;  1JPJ A;  2A6E F;  5AC5 A;  3B0V C;  2J7P D;  3S28 A;  3M4B A;  4XTK A;  2R03 A;  3A11 A;  4DRJ B;  3DKA A;  1OCC C;  5E3A A;  2L81 A;  2GDC A;  3I5P A;  3VM6 A;  3NYJ A;  2ZXP A;  1OXK A;  3FAJ A;  4CDV A;  3CAX A;  4ULW A;  2KYH A;  2HUJ A;  2OEV A;  2XLD A;  3NMI A;  4K1O A;  1KTM A;  4JW1 A;  4O6N A;  2GAQ A;  2WVQ A;  1PD0 A;  2I8B A;  3C8Z A;  2OG2 A;  4MVQ A;  4WAB A;  2J9B A;  2H7B A;  2J0X A;  3MX3 A;  4JCH A;  4OIP F;  2VAS A;  1JOG A;  1H6G A;  4JRZ A;  1Z5Z A;  1WAS A;  4JTD B;  5DS4 A;  1JPN A;  1MQV A;  3CSK A;  4D4X A;  2WVN A;  1OKK A;  3U9J A;  3EZI A;  3L8J A;  2X0C A;  4CS8 A;  4KNV A;  1NFN A;  1ORS C;  1VYK A;  3C18 A;  4U5C E;  2YL3 A;  1SMY F;  2XS8 A;  1S7Z A;  3EH2 A;  4W8K A;  3FXH A;  2P0N A;  2YWA A;  4DBQ A;  2R02 A;  1ST6 A;  1OCR C;  3DM5 A;  1XWJ A;  1R5I D;  1E84 A;  5CIV A;  3EGD A;  1FMV A;  2XLH A;  1Y4C A;  2G3K A;  2I15 A;  4LAC B;  2NUP B;  2IXN A;  3NKE A;  1CPR A;  2AP3 A;  4MTG A;  2Y69 C;  1TWG A;  1M6T A;  2LK4 A;  1SF8 A;  4YL0 A;  2ZXO A;  2XM4 A;  2LIG A;  4IAR A;  3ZTZ A;  3S90 A;  3KH2 A;  4LLE A;  3GEH A;  1A7D A;  5E2Q A;  1J8M F;  1QQ3 A;  3AG2 C;  4OD4 A;  1HW1 A;  1TWC A;  4JTA B;  3PDM P;  4N6H A;  2Q7R A;  2HJM A;  1OW7 A;  2PX0 A;  3A9C A;  1LKX A;  3AGU A;  3AOU A;  4FES A;  4ONS A;  4C7O B;  4FAP B;  2R25 A;  1D1A A;  3LAY A;  1VYI A;  4YT8 A;  1KNY A;  2L6F A;  2NPU A;  2HMQ A;  2P1A A;  2Y39 A;  2DYR C;  2WVO A;  3EFO A;  3HNJ A;  5KYU A;  3RW0 A;  2RSE B;  1KU2 A;  3JYH A;  1VK5 A;  3KMI A;  3CZ6 A;  2RD9 A;  1Q0K A;  1F1M A;  2OJE D;  2OOC A;  3C7J A;  3I4U A;  3O55 A;  4JVS A;  3S0X A;  4MVM A;  4PFO A;  2GWW A;  1ZHT A;  3LJB A;  3M79 A;  3NYM A;  3RVY A;  2VH3 A;  4CIH A;  2R7O A;  3B71 A;  4XPY A;  3IPM O;  1M56 C;  4GYT A;  3MYI A;  2R7Q A;  1OR2 A;  1NBB A;  2WZG A;  4P6I C;  4UDV A;  3TOM A;  2Q9A A;  4XEV A;  3X2Q C;  4Q4Z F;  3K33 A;  5HV9 A;  3LES A;  3K1I A;  3N24 A;  2A6H F;  3W4Y A;  2AWC A;  3PHF 2;  1Q0F A;  2EIL C;  3C8G A;  4IB4 A;  1VTM P;  3TK0 A;  2QE9 A;  5F5H A;  5B3I A;  3DE8 A;  5JT4 A;  1A0B A;  4E18 A;  2YL0 A;  1HMD A;  3AGT A;  3SP1 A;  4N06 A;  1YZA A;  3RKO F;  4ER9 A;  4JUR I;  3VRC A;  5D91 A;  2DGJ A;  3B9Q A;  1WOL A;  4LDQ A;  4J7Y A;  2MHR A;  3FAP B;  3UMH A;  4C3E A;  4E0H A;  1Z63 A;  3EG9 B;  3UGP A;  3K66 A;  3M1C B;  1EA8 A;  2EPK X;  3EHN A;  3O10 A;  1RJ9 B;  3TQO A;  4CX9 A;  1MNE A;  1LPE A;  3PMR A;  1U6H A;  2HS5 A;  2G3V A;  2LD6 A;  2DB4 A;  3NMJ A;  2P7V A;  5B1B C;  3S27 A;  2HKV A;  4EBB A;  1L3P A;  4G7Z F;  5E33 A;  1JR8 A;  1M2V B;  2R7W A;  3RQF A;  1YYJ A;  3DAG A;  3GM1 A;  3V5Z A;  3N0T A;  4PJM A;  3HKK A;  3NG1 A;  2KSF A;  4JC7 A;  1TR2 A;  1QKR A;  2KW3 C;  1L7C A;  2BC5 A;  3EHM A;  4BEJ A;  3FOO A;  4A2N B;  1V74 B;  5JLI A;  5JUA A;  1GGQ A;  2J8W A;  1T6I A;  3KPH A;  3BEH A;  1Q0M A;  2CNW D;  4W8P A;  2B0J A;  1QLE C;  2EPN A;  3GM2 A;  2CCY A;  1M57 C;  1V54 C;  3QVZ A;  2PNO A;  5JRA A;  3R2P A;  4A4A A;  3KKB A;  5KYX B;  2HSQ A;  5HSW A;  3HNK A;  2QTV A;  5CI9 A;  2VCA A;  1Z3I X;  2EPL X;  4WJ0 A;  3TJ6 A;  1CGO A;  4H4K C;  1I5N A;  3DXJ F;  2OCC C;  4JKV A;  4MS2 A;  3TJ5 A;  3U3F A;  1OQC A;  3UR3 C;  2R05 A;  1APC A;  2VCB A;  1YLM A;  3RYL A;  5KYY A;  3IQT A;  4J32 B;  4YT5 A;  3M15 A;  5FCL A;  4YT4 A;  2HV7 A;  2YLG A;  3LNR A;  3KYJ A;  3QMK A;  3S29 A;  3U2L A;  2HV6 A;  4BPM A;  5DS5 A;  3JYY A;  5BQH A;  2H8A A;  3N2Z B;  3V5Y A;  2WZL A;  3EZH A;  3S9O A;  2M4E A;  2UUI A;  3IQC A;  2Z15 A;  3W8H A;  4U5D E;  1XZP A;  3LNM B;  3O39 A;  4C3B A;  5L0J A;  1Z7Q c;  5B3S C;  2R7V A;  3HNI A;  4JCZ A;  1EKY A;  3ABL C;  3J06 A;  4MVS A;  4G7H F;  2R7S A;  1QVX A;  1V4A A;  1I4Z A;  3FHD A;  3HLZ A;  3JRM O;  4MND A;  4Z9J A;  5JP7 A;  1H9T A;  4BJ5 A;  4OIO F;  2F22 A;  2J9V A;  3TUL A;  1TWA A;  1IZM A;  1EI7 A;  4LLC A;  2LFD A;  1RKE B;  2NUT B;  4I3M A;  1IW7 F;  3B0P A;  4JE9 A;  4XLP F;  2CYD A;  3QW1 A;  2J7P A;  4PK4 A;  3EG9 A;  3SEO A;  3VF0 A;  2L7A A;  3JTL O;  2YHS A;  3KL4 A;  4MTO A;  4O7G A;  1A7E A;  1WTY A;  1RCP A;  1D0Y A;  4YL1 A;  3T6J A;  2C04 A;  3RF3 A;  5KYW A;  4IJJ A;  3W2V A;  4AX2 A;  2G62 A;  1R4T A;  3DWW A;  3DI5 A;  1DOV A;  3KYI A;  4AE4 B;  4MQ9 F;  2XRH A;  3ITF A;  3SXM A;  2YEV A;  2O9X A;  4XLN F;  5L0H A;  3E70 C;  3JRT A;  1YJG A;  2V26 A;  3DJN B;  1FFT C;  4YJW A;  5E3C A;  2ZXR A;  2JD3 A;  2KQ9 A;  3Q6N A;  3IQ6 A;  2Y3D A;  1Q0G A;  1BR4 A;  3MLG A;  3GWN A;  5L3Q A;  4X0R A;  4ZLD A;  1D0X A;  1E2X A;  1RMV A;  2A69 F;  2YKZ A;  5COF A;  4IWB A;  3IEE A;  4MVO A;  4DOZ A;  3FVY A;  4NC3 A;  3JT1 A;  3JZ0 A;  4DVZ A;  3US6 A;  3DAF A;  3WHN A;  4CS7 A;  5L0G A;  4ULV A;  1FNT c;  2OQM A;  1V55 C;  2R7U A;  3L8I A;  4O79 A;  4JEA A;  1BR2 A;  1Y6D A;  1YDI A;  4OIR F;  4FWV A;  1H9G A;  4GEH A;  4K7B A;  4U5B E;  2Y3H A;  5A6A A;  1BZ4 A;  2OEX A;  2CGE A;  2HZ8 A;  2QLA A;  3GOD A;  3NKD A;  4JIO A;  4XEF A;  3UMK A;  1NSG B;  3B0U X; 
#chains in the Genus database with same CATH homology
 1A7D A;  4XPY A;  1I4Z A;  4XPW A;  4XPX A;  3WAQ A;  2AWC A;  3AGU A;  2HMZ A;  3WHN A;  1A7E A;  2AVK A;  2HMQ A;  1HMO A;  1HMD A;  3AGT A;  2AWY A;  4XQ1 A;  2MHR A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...