4XQ1A

Crystal structure of hemerythrin: l114a mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWAVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xq1A00
2HMQA 1I4ZA 1I4YA 2AWYA 4XPYA 2HMZA 3AGTA 3WHNA 1HMDA 2MHRA 4XPWA 4XQ1A 1A7EA 1A7DA 4XPXA 2AWCA 1HMOA 2AVKA 3AGUA 3WAQA
chains in the Genus database with same CATH superfamily
3G50A 1DOVA 3GORA 2ZXOA 4K7BA 2JX0A 4BJ1A 1Z7Qc 5JT4A 4KNWA 3VM6A 3JCUQ 2F22A 2XM4A 1YVIA 4DRHB 3KH2A 4BG0A 5DS6A 1LS1A 5IY5C 2EIMC 4AE4B 1ORJA 2CGEA 2R05A 3RVZA 4D4NA 1JOGA 4HFKB 2XXAA 1PD0A 4ONSA 4BJ6C 2HV6A 3U2LA 4W8KA 3ZVRA 1GGQA 4E17A 2R7SA 5KYYB 1E2XA 1ZVZA 2CNWA 4MTOA 3MYIA 2ZD9A 1APCA 1ORSC 3PHF2 4ANJA 5DS4A 2XLWA 1Q0MA 1LS4A 1NBBA 4P6IC 1TWGA 3UMKA 1C02A 3NRHA 1A41A 5B3IA 3RYLA 2AU5A 3F47A 1V54C 2GWWA 4QI0A 3J06A 1TFKB 4YK5A 2YLIA 1LI7A 3F46A 3JT1A 4WABA 1Z63A 3K6BA 4BJ5A 2YZSA 4OINF 4JTCB 3HKKA 3HNIA 2G3KA 2FAPB 4XEFA 3SXKA 2A69F 3EG9B 4WGYA 2NUPB 2PF4E 5KYWA 4GEHA 4NC3A 4KI2A 1YJGA 4C7OA 3E70C 2ZXRA 1WOLA 1VB5A 5T1DB 1ZZPA 4XPWA 3DE8A 1HE1A 4MVZA 5DQZA 4CS8C 4G7OF 5T3WA 4MVQA 2X0CA 2EPMX 2I8BA 3Q7GA 3I5PA 3U3BA 1VTMP 2J45A 2YVKA 3I5QA 1A7EA 1PV3A 4XLPF 2HKVA 4JRZA 4G7HF 1MQVA 3DZAA 4RBNA 1BDJB 3BEHA 3R7CA 1RCPA 2KGOA 2YEVA 1T6IA 4MTGA 2VCAA 4NTBA 3DWWA 4CIPA 2XLDA 4O6MA 3PMRA 2L7AA 1C17M 5HV9A 4LLCA 3B0UX 1W2WA 2PNOA 2VASA 4BEMJ 3B0VC 1CGNA 3KKBA 2XXAB 1IZMA 3K7DA 1GQAA 1RKEB 1TQGA 4GQHA 3MLGA 3SXYA 3RW0A 4EBJA 1XWJA 3AGTA 2WVOA 2KYHA 2NSFA 1NSGB 3KYJA 2MHRA 2P7VA 4G7ZF 1R4TA 3NMJA 3NMIA 5KYNA 5A6BA 2BL2A 4PJMA 2A6HF 5A6AA 2KC3A 4Q4ZF 2DB4A 4BJTA 4J30B 3L1MA 1G8XA 2OKUA 3HNLA 3RIPA 5A69A 2VCBA 5AGFA 3K66A 2W4BA 3US6A 5L0DA 3DE9A 4CSAA 5KYWB 1OCCC 2LFDA 5F28E 4QI2A 4C7OB 1BR4A 3V7OA 4JURI 5JS5A 2ASRA 4IGGA 1C03A 1D1AA 4N06A 3ZQYA 5JSLA 4NQFA 2LK4A 1L3PA 5AC4A 2O9XA 3EHNA 2IXNA 2HFIA 1H7IA 1HY5A 3N2ZB 1RKCA 2QTVA 3QZCA 3C7JA 4NY3A 2BC5A 2YL3A 4P9FA 4LACB 2XS8A 3LAYA 2PX0A 4JIOA 1FR0A 4AE4A 1WGWA 1A7DA 1RXQA 2WL8A 3T6JA 1T5OA 4I1MA 4EHPA 4ER9A 2J9BA 1FFHA 3GM1A 5JRAA 2V26A 3EJNA 1E83A 3DM9B 3NYLA 1MMNA 1ZHTA 2AVKA 2YWAA 2VH3A 4XEKA 2D5RB 1QKRA 3WG7C 5KYYA 1MNEA 3NMKA 2XLVA 1MMDA 3IQ6A 3LLIA 4X0RA 1YZAA 1E86A 2R7UA 3ASNC 1NFOA 3IEEA 2C03A 4XLNF 3W8HA 2OCCC 3IPMO 4IAOA 3JSEO 3ZG1A 2Q00A 2Y3HA 3L8IA 1OKKD 1H9TA 1M2VA 3LESA 2W9YA 1N1CA 2PX3A 2RD9A 3C63A 1HMDA 3AG4C 3EH2A 4MVSA 1WTYA 2VCCA 3E9VA 1BZ4A 3S9OA 3T4RA 4FWVA 4IARA 4E0IA 4CS9C 2J0XA 5A6KA 3U8PA 1U0BB 2R7TA 3A11A 2YL7A 4PK4A 1D1BA 1QSPA 3RQGA 1LVKA 2EPNA 3EG9A 1UFBA 1U89A 3HLZA 4MVUA 1V55C 3LEOA 1JAFA 2OJED 3EZIA 2IXOA 3ABKC 4CJGA 4AL0A 2KJGA 4BJ6A 1YYXA 1F1MA 3SYNA 5JUAA 3A9CA 1LPEA 1CPRA 4E0HA 4A4AA 3B9QA 3O39A 2Q9CA 3L8JA 4I3MA 5BQGA 2L81A 2B0JA 1FFTC 2LIGA 1Z3IX 2Y69C 1QQ3A 2L6GA 3ECSA 2L9JA 3EFOA 2OG2A 2AWYA 3AG1C 3GEIA 3LNRA 4XTKA 4NCQA 5AC5A 2QNLA 3JYHA 4EWCA 5EGYA 2IBFA 3EH1A 2CNWD 1O3UA 3KPHA 1EKYA 3RH3A 4PFPA 3ZTZA 2NPUA 1V74B 1M2OA 2J46A 1NU9C 3RFYA 1T6QA 3EGDA 1U6HA 1RKEA 3SEOA 2C04A 2EIKC 2YL1A 1EI7A 2DI3A 2J9WA 4U5CE 5A6JA 2A68F 5E3AA 2CDQA 3KMIA 4Z9IA 3QTHA 1OXKA 1VLTA 1Y4CA 1CGOA 2J0WA 3M4BA 4XWJA 3MX3A 4CS8A 3HTKC 1NLXA 1ZHYA 3ZDLA 3GWNA 1IW7F 1M2VB 5E2QA 4LDRA 4MVMA 1M57C 2WVQA 1FTSA 5L0FA 3ZIBA 1SMYF 3RKOF 2LQGA 2Y3BA 2XS1A 1LM3B 3VF0A 1E84A 3U0CA 5L0GA 2EPKX 2J8WA 1D0XA 1I5NA 4IJJA 3TOLA 2YRFA 3G4XA 4JJGA 1TWCA 2FFHA 2A6EF 2WVNA 3POVA 2IYLD 3DMDA 3C62A 1NFNA 1Z6AA 3DAGA 3ASOC 4JW1A 4J7YA 3S28A 1FMVA 1K05A 3CQZA 2A0BA 4IB4A 4FAPB 1RJ9B 1VOMA 3SZRA 3AG3C 3Q6NA 4U5BE 4I1OB 1JRAA 1LI5A 3EFOB 3ZQVA 2G3VA 3ZWIA 5L3VA 2IOQA 4N4WA 1JR8A 1OW6A 3AQCA 4OD5A 3CSKA 4FESA 1EA8A 3W2VA 3U9MA 3AOUA 3WODF 2GDCA 2XM0A 4P9TA 3U8VA 4A2NB 3EGDB 5A6BD 1J8YF 3M4CA 4JC7A 4LERA 3GODA 1Q0DA 3AQBA 4YWQA 1O5HA 2NG1A 2I15A 1G5ZA 1HW2A 2A1DD 3FMSA 4G78A 3G4ZA 4O6YA 3RF3A 3O6XA 1GS9A 1VK5A 5B1AC 4JKVA 4LDKA 1YA7O 4I44A 3V5ZA 4QDLA 5KYUA 3V5YA 4DOZA 3AGUA 3K1IC 4G0HA 1LE2A 1QPUA 1S7ZA 2H7OA 1MMGA 1QZXA 4JJFA 1TR2A 3ATPA 4AX2A 1Z23A 4CJOA 2EPLX 2Q7RA 2QUPA 1K04A 3LS0A 5E33A 4EIYA 2HZ8A 3U2MA 4DRJB 1OW7A 1NG1A 4H54A 4EKWA 5FCLA 5L3QA 2CCYA 1FAPB 5B3SC 2W4MA 2XSEA 5CI9A 3TK0A 3DXJF 3SNHA 1YZCA 2KSFA 1ZHWA 2KW3C 3GEEA 1VLSA 4OIPF 4YL0A 1MMAA 2R7VA 4MS2A 2M64A 2OJQA 3IQCA 4MVRA 4U5EE 4E7ZA 5HSWA 5DVWA 3S90A 3EQLF 2P61A 1WN0A 1WWPA 2R02A 2XL6A 3TULA 4EUKB 1KTMA 2Y3DA 3CEXA 3FVYA 1AEPA 4JCHA 1TKNA 1PD1A 3C8GA 3C8ZA 3DI5A 4XPXA 4CS9A 4E18A 3EHMA 4FX5A 5BQIA 2H7BA 2Q9BA 2H8AA 3FHDA 3PCVA 2XLEA 4U5FE 2QY9A 2YLDA 2R7OA 4K0DA 4HFFB 1Q0GA 2WZGA 2OEVA 1RMVA 3R2PA 3O10A 3QMKA 5FZTA 1ZYRF 3EPVA 4MQ9F 4EBBA 4YL1A 5KYUB 2Q9AA 1VYKA 2D4UA 2HSQA 4MNDA 5L0HA 2MYSA 1YLMA 3ABLC 3AJMA 2W45A 4OIOF 2KNHA 1Y6DA 4ZLDA 3TJ6A 3JRTA 1SZIA 1YAUO 3FOOA 1A7VA 5L0CA 1ZHZA 2R7QA 2YKZA 4XQ1A 4N6CA 3AG2C 5D92A 1OCRC 3K1HA 5COFA 4HEAJ 2NSGA 2NUTA 2ETSA 1XZQA 5DQTA 1HMOA 3MYFA 4Z9JA 3EGXA 4U9EA 1ZW3A 3VAYA 2LD6A 3JSZA 1RJ9A 1WASA 4RDAA 3I4UA 3OA1A 3JYYA 3LNMB 3Q7LA 2UUHA 1HE9A 1G4WR 1S05A 3RQFA 1OXBA 3KL4A 1OCZC 3HNJA 3TJ5A 2Z15A 3CAXA 3FAJA 3X2QC 5TJ5E 3TOMA 3L0IA 3C8GB 2Q3TA 3U3FA 3ITFA 1D0ZA 2MWQA 3SXMA 4JZAA 1ZU5A 2P1AA 4D4XA 2LSEA 2LCHA 4YT5A 3CZ6A 3N0TA 5COGA 4B6IA 3GM2A 1T01A 2R25A 4IWBA 1B68A 2XLOA 4PJJA 4WGZA 2AP3A 3SP1A 3VRCA 2XRHA 5EK0A 4E7SA 3S27A 1KNYA 3W8IA 2OOCA 5D91A 2PBEA 4DBQA 2ICWG 2OEXA 2JD3A 2YHSA 1JPJA 1J8MF 3LUTB 4IRUA 4N6HA 2DYRC 1ZW2A 3NYJA 3NYMA 3U9JA 4YT4A 2HMQA 4DVYP 5KYXB 3GANA 2KQ9A 2QLAA 4DRIB 1Z5ZA 1H6GA 2VC9A 2YQYA 4C3EA 2J9VA 3B29A 4KNVA 3FOPA 1ST6A 4KBLA 2EINC 3DD7A 2NUTB 5DLJA 3RQEA 2DYSC 1FNTc 4WJ0A 1YARO 4U9DA 3L34A 3EGXB 4W8PA 3NKEA 256BA 3GEHA 3TD7A 1K40A 4ULWA 3H65A 2GFHA 3B0PA 4H4KC 4MTFA 2G62A 1OR3A 2PP4A 3UGPA 3S29A 3RVYA 2V3CC 4Z9HA 1FMWA 1JPNA 5BQHA 1I4ZA 5CIVA 2L6HA 5JLIA 4JE9A 2R7RA 3GM3A 1TWHA 4DJ9A 3K1IA 1SF8A 1SYQA 4LLEA 2WB7A 2HS5A 5L0IA 3KYIA 1LE4A 2EPOA 3C18A 3MFNA 3IQTA 3WHNA 4DBRA 2FGYA 1YYJA 3IHUA 4PACA 4U5HA 2J7PD 2LFFA 4JCZA 4PJNA 5COMA 5EHHA 4BPMA 4JTAB 1Q0KA 5GPGB 1Q0FA 2HJMA 2Y3GA 1A0BA 1M6TA 2R03A 3HNKA 3DM5A 3T6BA 4YT8A 4IAQA 1T9KA 4J32B 2ZXWC 4LDQA 2HUJA 3O55A 2J7PA 4O7GA 1ORYA 2VB6A 1KU2A 1BR1A 4BJ5C 3MBGA 4UDVA 1V4AA 2B0HA 3NG1A 5JVEA 1YA9A 4U5DE 1UG7A 2RSEB 1D0YA 1NU7D 3LLKA 3QVZA 4O6NA 5B1BC 5L0JA 3U5SA 3NDBB 1DOWA 4JEAA 2R7XA 5K0IA 1QLEC 2DGJA 3DKAA 3LJBA 1OCOC 4CX9A 2XLMA 1O87A 1QVXA 4K1OA 5F5HA 4JVSA 3PDMP 1OQCA 4GYTA 4XPYA 3UMIA 3JTLO 1XZPA 2Y39A 3S0XA 4YN0B 3OEOA 1VMAA 4DVZA 3C8GD 2YLGA 4Q7CA 1L7CA 1OR2A 1SR2A 3M15A 1ZU4A 4AL1A 3QVYA 2YL0A 4PR9A 4R32A 3JZ0A 1CGME 2H7VC 4PFOA 4CBEA 4OIQF 1PCXA 3ZSUA 1CPQA 2CYDA 2ZPAA 4BEJA 3WAQA 4YT2A 4ULVA 4AK9A 3GWLA 3H2UA 1G4US 2HJ3A 3ZTMA 4CIHA 4EBKA 5BUOA 4YL3A 1LIHA 3DAFA 4NTFA 3UNGC 1I4YA 3LEVA 1E85A 3DJUB 5CI8A 4PJLA 2GAQA 3T9OA 3UR3C 3SXZA 1VYIA 2P6VA 3M1CB 3ZC4A 2HMZA 2WZLA 3HJCA 4C3BA 1D1CA 2GA0A 2A0UA 3ABMC 4MW8A 5F5FA 2P0NA 3BRJA 4OD4A 2HSBA 3TQOA 4F4BA 1R5ID 2UUIA 3Q6MA 4ZLCA 2PFDA 5KYXA 3V5XA 3UGOA 2L6FA 2X51A 1JMWA 3NKDA 4CDVA 2XL8A 1AUEA 3X1OA 3LS1A 3T6GB 4CSAC 4MVOA 3N24A 2R7WA 4O79A 2CW0F 4Q5SF 2EILC 2IXMA 2Q4FA 3QW0A 4CS7A 2AWCA 3W4YA 1YDIA 1WATA 4J7TA 4OIRF 3IQ5A 1ZHXA 5E3CA 2ZXPA 1GM5A 2TMVP 4JEBA 4U5GA 3UMHA 1T6UA 3QW1A 4NTAA 2QE9A 5DS5A 4MW3A 2LP4A 4CDYA 1M56C 3VYWA 3K33A 4CDAA 2E87A 2IXPA 3B71A 1TFOB 2EIJC 1NZEA 4C3DA 4XEVA 3OWTA 4KC9A 3EZHA 5T3TA 3JRMO 2HV7A 3FAPB 4JTDB 4YJWA 4DXWA 1EQ1A 2XL4A 2M4EA 2R9RB 3H2VA 4RD9A 1AVOB 1TWAA 1OKKA 1BBHA 1OW8A 1H9GA 2BE5F 2NUPA 2OU6A 4HE8D 1LKXA 3S84A 2WZFA 4L6RA 2J9UA 5JP7A 3M79A 2KK1A 3FDQA 3DJNB 1HW1A 3FXHA 2OQMA 2XLHA 3W2WA 2IM8A 1BR2A 1MNDA 2JPUA 4M63A
chains in the Genus database with same CATH topology
2HMQA 1I4ZA 1I4YA 2AWYA 4XPYA 2HMZA 3AGTA 3WHNA 1HMDA 2MHRA 4XPWA 4XQ1A 1A7EA 1A7DA 4XPXA 2AWCA 1HMOA 2AVKA 3AGUA 3WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMQ A;  1I4Z A;  1I4Y A;  2AWY A;  4XPY A;  2HMZ A;  3AGT A;  3WHN A;  1HMD A;  2MHR A;  4XPW A;  4XQ1 A;  1A7E A;  1A7D A;  4XPX A;  2AWC A;  1HMO A;  2AVK A;  3AGU A;  3WAQ A; 
#chains in the Genus database with same CATH topology
 3G50 A;  1DOV A;  3GOR A;  2ZXO A;  4K7B A;  2JX0 A;  4BJ1 A;  1Z7Q c;  5JT4 A;  4KNW A;  3VM6 A;  3JCU Q;  2F22 A;  2XM4 A;  1YVI A;  4DRH B;  3KH2 A;  4BG0 A;  5DS6 A;  1LS1 A;  5IY5 C;  2EIM C;  4AE4 B;  1ORJ A;  2CGE A;  2R05 A;  3RVZ A;  4D4N A;  1JOG A;  4HFK B;  2XXA A;  1PD0 A;  4ONS A;  4BJ6 C;  2HV6 A;  3U2L A;  4W8K A;  3ZVR A;  1GGQ A;  4E17 A;  2R7S A;  5KYY B;  1E2X A;  1ZVZ A;  2CNW A;  4MTO A;  3MYI A;  2ZD9 A;  1APC A;  1ORS C;  3PHF 2;  4ANJ A;  5DS4 A;  2XLW A;  1Q0M A;  1LS4 A;  1NBB A;  4P6I C;  1TWG A;  3UMK A;  1C02 A;  3NRH A;  1A41 A;  5B3I A;  3RYL A;  2AU5 A;  3F47 A;  1V54 C;  2GWW A;  4QI0 A;  3J06 A;  1TFK B;  4YK5 A;  2YLI A;  1LI7 A;  3F46 A;  3JT1 A;  4WAB A;  1Z63 A;  3K6B A;  4BJ5 A;  2YZS A;  4OIN F;  4JTC B;  3HKK A;  3HNI A;  2G3K A;  2FAP B;  4XEF A;  3SXK A;  2A69 F;  3EG9 B;  4WGY A;  2NUP B;  2PF4 E;  5KYW A;  4GEH A;  4NC3 A;  4KI2 A;  1YJG A;  4C7O A;  3E70 C;  2ZXR A;  1WOL A;  1VB5 A;  5T1D B;  1ZZP A;  4XPW A;  3DE8 A;  1HE1 A;  4MVZ A;  5DQZ A;  4CS8 C;  4G7O F;  5T3W A;  4MVQ A;  2X0C A;  2EPM X;  2I8B A;  3Q7G A;  3I5P A;  3U3B A;  1VTM P;  2J45 A;  2YVK A;  3I5Q A;  1A7E A;  1PV3 A;  4XLP F;  2HKV A;  4JRZ A;  4G7H F;  1MQV A;  3DZA A;  4RBN A;  1BDJ B;  3BEH A;  3R7C A;  1RCP A;  2KGO A;  2YEV A;  1T6I A;  4MTG A;  2VCA A;  4NTB A;  3DWW A;  4CIP A;  2XLD A;  4O6M A;  3PMR A;  2L7A A;  1C17 M;  5HV9 A;  4LLC A;  3B0U X;  1W2W A;  2PNO A;  2VAS A;  4BEM J;  3B0V C;  1CGN A;  3KKB A;  2XXA B;  1IZM A;  3K7D A;  1GQA A;  1RKE B;  1TQG A;  4GQH A;  3MLG A;  3SXY A;  3RW0 A;  4EBJ A;  1XWJ A;  3AGT A;  2WVO A;  2KYH A;  2NSF A;  1NSG B;  3KYJ A;  2MHR A;  2P7V A;  4G7Z F;  1R4T A;  3NMJ A;  3NMI A;  5KYN A;  5A6B A;  2BL2 A;  4PJM A;  2A6H F;  5A6A A;  2KC3 A;  4Q4Z F;  2DB4 A;  4BJT A;  4J30 B;  3L1M A;  1G8X A;  2OKU A;  3HNL A;  3RIP A;  5A69 A;  2VCB A;  5AGF A;  3K66 A;  2W4B A;  3US6 A;  5L0D A;  3DE9 A;  4CSA A;  5KYW B;  1OCC C;  2LFD A;  5F28 E;  4QI2 A;  4C7O B;  1BR4 A;  3V7O A;  4JUR I;  5JS5 A;  2ASR A;  4IGG A;  1C03 A;  1D1A A;  4N06 A;  3ZQY A;  5JSL A;  4NQF A;  2LK4 A;  1L3P A;  5AC4 A;  2O9X A;  3EHN A;  2IXN A;  2HFI A;  1H7I A;  1HY5 A;  3N2Z B;  1RKC A;  2QTV A;  3QZC A;  3C7J A;  4NY3 A;  2BC5 A;  2YL3 A;  4P9F A;  4LAC B;  2XS8 A;  3LAY A;  2PX0 A;  4JIO A;  1FR0 A;  4AE4 A;  1WGW A;  1A7D A;  1RXQ A;  2WL8 A;  3T6J A;  1T5O A;  4I1M A;  4EHP A;  4ER9 A;  2J9B A;  1FFH A;  3GM1 A;  5JRA A;  2V26 A;  3EJN A;  1E83 A;  3DM9 B;  3NYL A;  1MMN A;  1ZHT A;  2AVK A;  2YWA A;  2VH3 A;  4XEK A;  2D5R B;  1QKR A;  3WG7 C;  5KYY A;  1MNE A;  3NMK A;  2XLV A;  1MMD A;  3IQ6 A;  3LLI A;  4X0R A;  1YZA A;  1E86 A;  2R7U A;  3ASN C;  1NFO A;  3IEE A;  2C03 A;  4XLN F;  3W8H A;  2OCC C;  3IPM O;  4IAO A;  3JSE O;  3ZG1 A;  2Q00 A;  2Y3H A;  3L8I A;  1OKK D;  1H9T A;  1M2V A;  3LES A;  2W9Y A;  1N1C A;  2PX3 A;  2RD9 A;  3C63 A;  1HMD A;  3AG4 C;  3EH2 A;  4MVS A;  1WTY A;  2VCC A;  3E9V A;  1BZ4 A;  3S9O A;  3T4R A;  4FWV A;  4IAR A;  4E0I A;  4CS9 C;  2J0X A;  5A6K A;  3U8P A;  1U0B B;  2R7T A;  3A11 A;  2YL7 A;  4PK4 A;  1D1B A;  1QSP A;  3RQG A;  1LVK A;  2EPN A;  3EG9 A;  1UFB A;  1U89 A;  3HLZ A;  4MVU A;  1V55 C;  3LEO A;  1JAF A;  2OJE D;  3EZI A;  2IXO A;  3ABK C;  4CJG A;  4AL0 A;  2KJG A;  4BJ6 A;  1YYX A;  1F1M A;  3SYN A;  5JUA A;  3A9C A;  1LPE A;  1CPR A;  4E0H A;  4A4A A;  3B9Q A;  3O39 A;  2Q9C A;  3L8J A;  4I3M A;  5BQG A;  2L81 A;  2B0J A;  1FFT C;  2LIG A;  1Z3I X;  2Y69 C;  1QQ3 A;  2L6G A;  3ECS A;  2L9J A;  3EFO A;  2OG2 A;  2AWY A;  3AG1 C;  3GEI A;  3LNR A;  4XTK A;  4NCQ A;  5AC5 A;  2QNL A;  3JYH A;  4EWC A;  5EGY A;  2IBF A;  3EH1 A;  2CNW D;  1O3U A;  3KPH A;  1EKY A;  3RH3 A;  4PFP A;  3ZTZ A;  2NPU A;  1V74 B;  1M2O A;  2J46 A;  1NU9 C;  3RFY A;  1T6Q A;  3EGD A;  1U6H A;  1RKE A;  3SEO A;  2C04 A;  2EIK C;  2YL1 A;  1EI7 A;  2DI3 A;  2J9W A;  4U5C E;  5A6J A;  2A68 F;  5E3A A;  2CDQ A;  3KMI A;  4Z9I A;  3QTH A;  1OXK A;  1VLT A;  1Y4C A;  1CGO A;  2J0W A;  3M4B A;  4XWJ A;  3MX3 A;  4CS8 A;  3HTK C;  1NLX A;  1ZHY A;  3ZDL A;  3GWN A;  1IW7 F;  1M2V B;  5E2Q A;  4LDR A;  4MVM A;  1M57 C;  2WVQ A;  1FTS A;  5L0F A;  3ZIB A;  1SMY F;  3RKO F;  2LQG A;  2Y3B A;  2XS1 A;  1LM3 B;  3VF0 A;  1E84 A;  3U0C A;  5L0G A;  2EPK X;  2J8W A;  1D0X A;  1I5N A;  4IJJ A;  3TOL A;  2YRF A;  3G4X A;  4JJG A;  1TWC A;  2FFH A;  2A6E F;  2WVN A;  3POV A;  2IYL D;  3DMD A;  3C62 A;  1NFN A;  1Z6A A;  3DAG A;  3ASO C;  4JW1 A;  4J7Y A;  3S28 A;  1FMV A;  1K05 A;  3CQZ A;  2A0B A;  4IB4 A;  4FAP B;  1RJ9 B;  1VOM A;  3SZR A;  3AG3 C;  3Q6N A;  4U5B E;  4I1O B;  1JRA A;  1LI5 A;  3EFO B;  3ZQV A;  2G3V A;  3ZWI A;  5L3V A;  2IOQ A;  4N4W A;  1JR8 A;  1OW6 A;  3AQC A;  4OD5 A;  3CSK A;  4FES A;  1EA8 A;  3W2V A;  3U9M A;  3AOU A;  3WOD F;  2GDC A;  2XM0 A;  4P9T A;  3U8V A;  4A2N B;  3EGD B;  5A6B D;  1J8Y F;  3M4C A;  4JC7 A;  4LER A;  3GOD A;  1Q0D A;  3AQB A;  4YWQ A;  1O5H A;  2NG1 A;  2I15 A;  1G5Z A;  1HW2 A;  2A1D D;  3FMS A;  4G78 A;  3G4Z A;  4O6Y A;  3RF3 A;  3O6X A;  1GS9 A;  1VK5 A;  5B1A C;  4JKV A;  4LDK A;  1YA7 O;  4I44 A;  3V5Z A;  4QDL A;  5KYU A;  3V5Y A;  4DOZ A;  3AGU A;  3K1I C;  4G0H A;  1LE2 A;  1QPU A;  1S7Z A;  2H7O A;  1MMG A;  1QZX A;  4JJF A;  1TR2 A;  3ATP A;  4AX2 A;  1Z23 A;  4CJO A;  2EPL X;  2Q7R A;  2QUP A;  1K04 A;  3LS0 A;  5E33 A;  4EIY A;  2HZ8 A;  3U2M A;  4DRJ B;  1OW7 A;  1NG1 A;  4H54 A;  4EKW A;  5FCL A;  5L3Q A;  2CCY A;  1FAP B;  5B3S C;  2W4M A;  2XSE A;  5CI9 A;  3TK0 A;  3DXJ F;  3SNH A;  1YZC A;  2KSF A;  1ZHW A;  2KW3 C;  3GEE A;  1VLS A;  4OIP F;  4YL0 A;  1MMA A;  2R7V A;  4MS2 A;  2M64 A;  2OJQ A;  3IQC A;  4MVR A;  4U5E E;  4E7Z A;  5HSW A;  5DVW A;  3S90 A;  3EQL F;  2P61 A;  1WN0 A;  1WWP A;  2R02 A;  2XL6 A;  3TUL A;  4EUK B;  1KTM A;  2Y3D A;  3CEX A;  3FVY A;  1AEP A;  4JCH A;  1TKN A;  1PD1 A;  3C8G A;  3C8Z A;  3DI5 A;  4XPX A;  4CS9 A;  4E18 A;  3EHM A;  4FX5 A;  5BQI A;  2H7B A;  2Q9B A;  2H8A A;  3FHD A;  3PCV A;  2XLE A;  4U5F E;  2QY9 A;  2YLD A;  2R7O A;  4K0D A;  4HFF B;  1Q0G A;  2WZG A;  2OEV A;  1RMV A;  3R2P A;  3O10 A;  3QMK A;  5FZT A;  1ZYR F;  3EPV A;  4MQ9 F;  4EBB A;  4YL1 A;  5KYU B;  2Q9A A;  1VYK A;  2D4U A;  2HSQ A;  4MND A;  5L0H A;  2MYS A;  1YLM A;  3ABL C;  3AJM A;  2W45 A;  4OIO F;  2KNH A;  1Y6D A;  4ZLD A;  3TJ6 A;  3JRT A;  1SZI A;  1YAU O;  3FOO A;  1A7V A;  5L0C A;  1ZHZ A;  2R7Q A;  2YKZ A;  4XQ1 A;  4N6C A;  3AG2 C;  5D92 A;  1OCR C;  3K1H A;  5COF A;  4HEA J;  2NSG A;  2NUT A;  2ETS A;  1XZQ A;  5DQT A;  1HMO A;  3MYF A;  4Z9J A;  3EGX A;  4U9E A;  1ZW3 A;  3VAY A;  2LD6 A;  3JSZ A;  1RJ9 A;  1WAS A;  4RDA A;  3I4U A;  3OA1 A;  3JYY A;  3LNM B;  3Q7L A;  2UUH A;  1HE9 A;  1G4W R;  1S05 A;  3RQF A;  1OXB A;  3KL4 A;  1OCZ C;  3HNJ A;  3TJ5 A;  2Z15 A;  3CAX A;  3FAJ A;  3X2Q C;  5TJ5 E;  3TOM A;  3L0I A;  3C8G B;  2Q3T A;  3U3F A;  3ITF A;  1D0Z A;  2MWQ A;  3SXM A;  4JZA A;  1ZU5 A;  2P1A A;  4D4X A;  2LSE A;  2LCH A;  4YT5 A;  3CZ6 A;  3N0T A;  5COG A;  4B6I A;  3GM2 A;  1T01 A;  2R25 A;  4IWB A;  1B68 A;  2XLO A;  4PJJ A;  4WGZ A;  2AP3 A;  3SP1 A;  3VRC A;  2XRH A;  5EK0 A;  4E7S A;  3S27 A;  1KNY A;  3W8I A;  2OOC A;  5D91 A;  2PBE A;  4DBQ A;  2ICW G;  2OEX A;  2JD3 A;  2YHS A;  1JPJ A;  1J8M F;  3LUT B;  4IRU A;  4N6H A;  2DYR C;  1ZW2 A;  3NYJ A;  3NYM A;  3U9J A;  4YT4 A;  2HMQ A;  4DVY P;  5KYX B;  3GAN A;  2KQ9 A;  2QLA A;  4DRI B;  1Z5Z A;  1H6G A;  2VC9 A;  2YQY A;  4C3E A;  2J9V A;  3B29 A;  4KNV A;  3FOP A;  1ST6 A;  4KBL A;  2EIN C;  3DD7 A;  2NUT B;  5DLJ A;  3RQE A;  2DYS C;  1FNT c;  4WJ0 A;  1YAR O;  4U9D A;  3L34 A;  3EGX B;  4W8P A;  3NKE A;  256B A;  3GEH A;  3TD7 A;  1K40 A;  4ULW A;  3H65 A;  2GFH A;  3B0P A;  4H4K C;  4MTF A;  2G62 A;  1OR3 A;  2PP4 A;  3UGP A;  3S29 A;  3RVY A;  2V3C C;  4Z9H A;  1FMW A;  1JPN A;  5BQH A;  1I4Z A;  5CIV A;  2L6H A;  5JLI A;  4JE9 A;  2R7R A;  3GM3 A;  1TWH A;  4DJ9 A;  3K1I A;  1SF8 A;  1SYQ A;  4LLE A;  2WB7 A;  2HS5 A;  5L0I A;  3KYI A;  1LE4 A;  2EPO A;  3C18 A;  3MFN A;  3IQT A;  3WHN A;  4DBR A;  2FGY A;  1YYJ A;  3IHU A;  4PAC A;  4U5H A;  2J7P D;  2LFF A;  4JCZ A;  4PJN A;  5COM A;  5EHH A;  4BPM A;  4JTA B;  1Q0K A;  5GPG B;  1Q0F A;  2HJM A;  2Y3G A;  1A0B A;  1M6T A;  2R03 A;  3HNK A;  3DM5 A;  3T6B A;  4YT8 A;  4IAQ A;  1T9K A;  4J32 B;  2ZXW C;  4LDQ A;  2HUJ A;  3O55 A;  2J7P A;  4O7G A;  1ORY A;  2VB6 A;  1KU2 A;  1BR1 A;  4BJ5 C;  3MBG A;  4UDV A;  1V4A A;  2B0H A;  3NG1 A;  5JVE A;  1YA9 A;  4U5D E;  1UG7 A;  2RSE B;  1D0Y A;  1NU7 D;  3LLK A;  3QVZ A;  4O6N A;  5B1B C;  5L0J A;  3U5S A;  3NDB B;  1DOW A;  4JEA A;  2R7X A;  5K0I A;  1QLE C;  2DGJ A;  3DKA A;  3LJB A;  1OCO C;  4CX9 A;  2XLM A;  1O87 A;  1QVX A;  4K1O A;  5F5H A;  4JVS A;  3PDM P;  1OQC A;  4GYT A;  4XPY A;  3UMI A;  3JTL O;  1XZP A;  2Y39 A;  3S0X A;  4YN0 B;  3OEO A;  1VMA A;  4DVZ A;  3C8G D;  2YLG A;  4Q7C A;  1L7C A;  1OR2 A;  1SR2 A;  3M15 A;  1ZU4 A;  4AL1 A;  3QVY A;  2YL0 A;  4PR9 A;  4R32 A;  3JZ0 A;  1CGM E;  2H7V C;  4PFO A;  4CBE A;  4OIQ F;  1PCX A;  3ZSU A;  1CPQ A;  2CYD A;  2ZPA A;  4BEJ A;  3WAQ A;  4YT2 A;  4ULV A;  4AK9 A;  3GWL A;  3H2U A;  1G4U S;  2HJ3 A;  3ZTM A;  4CIH A;  4EBK A;  5BUO A;  4YL3 A;  1LIH A;  3DAF A;  4NTF A;  3UNG C;  1I4Y A;  3LEV A;  1E85 A;  3DJU B;  5CI8 A;  4PJL A;  2GAQ A;  3T9O A;  3UR3 C;  3SXZ A;  1VYI A;  2P6V A;  3M1C B;  3ZC4 A;  2HMZ A;  2WZL A;  3HJC A;  4C3B A;  1D1C A;  2GA0 A;  2A0U A;  3ABM C;  4MW8 A;  5F5F A;  2P0N A;  3BRJ A;  4OD4 A;  2HSB A;  3TQO A;  4F4B A;  1R5I D;  2UUI A;  3Q6M A;  4ZLC A;  2PFD A;  5KYX A;  3V5X A;  3UGO A;  2L6F A;  2X51 A;  1JMW A;  3NKD A;  4CDV A;  2XL8 A;  1AUE A;  3X1O A;  3LS1 A;  3T6G B;  4CSA C;  4MVO A;  3N24 A;  2R7W A;  4O79 A;  2CW0 F;  4Q5S F;  2EIL C;  2IXM A;  2Q4F A;  3QW0 A;  4CS7 A;  2AWC A;  3W4Y A;  1YDI A;  1WAT A;  4J7T A;  4OIR F;  3IQ5 A;  1ZHX A;  5E3C A;  2ZXP A;  1GM5 A;  2TMV P;  4JEB A;  4U5G A;  3UMH A;  1T6U A;  3QW1 A;  4NTA A;  2QE9 A;  5DS5 A;  4MW3 A;  2LP4 A;  4CDY A;  1M56 C;  3VYW A;  3K33 A;  4CDA A;  2E87 A;  2IXP A;  3B71 A;  1TFO B;  2EIJ C;  1NZE A;  4C3D A;  4XEV A;  3OWT A;  4KC9 A;  3EZH A;  5T3T A;  3JRM O;  2HV7 A;  3FAP B;  4JTD B;  4YJW A;  4DXW A;  1EQ1 A;  2XL4 A;  2M4E A;  2R9R B;  3H2V A;  4RD9 A;  1AVO B;  1TWA A;  1OKK A;  1BBH A;  1OW8 A;  1H9G A;  2BE5 F;  2NUP A;  2OU6 A;  4HE8 D;  1LKX A;  3S84 A;  2WZF A;  4L6R A;  2J9U A;  5JP7 A;  3M79 A;  2KK1 A;  3FDQ A;  3DJN B;  1HW1 A;  3FXH A;  2OQM A;  2XLH A;  3W2W A;  2IM8 A;  1BR2 A;  1MND A;  2JPU A;  4M63 A; 
#chains in the Genus database with same CATH homology
 2HMQ A;  1I4Z A;  1I4Y A;  2AWY A;  4XPY A;  2HMZ A;  3AGT A;  3WHN A;  1HMD A;  2MHR A;  4XPW A;  4XQ1 A;  1A7E A;  1A7D A;  4XPX A;  2AWC A;  1HMO A;  2AVK A;  3AGU A;  3WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...