4XQ1A

Crystal structure of hemerythrin: l114a mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWAVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
molecule keywords Bacteriohemerythrin
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xq1A00
3WHNA 1HMOA 1A7EA 2AWYA 2AWCA 2HMZA 2HMQA 4XQ1A 1A7DA 1I4YA 4XPXA 3AGTA 2MHRA 2AVKA 1I4ZA 3WAQA 1HMDA 3AGUA 4XPWA 4XPYA
chains in the Genus database with same CATH superfamily
1YZAA 4MVMA 4EBBA 3DD7A 5L0JA 4I1OB 1LS4A 4JCHA 2IOQA 3K1IA 3T6BA 4CDYA 2XLVA 2GWWA 3IEEA 2R25A 2EINC 4MTGA 3RVZA 2XLDA 5KYUA 1BBHA 4YN0B 1RJ9B 1MMAA 1K04A 5JLIA 5A6KA 2OOCA 4C3BA 3UR3C 3MYFA 3K7DA 3AG2C 1B68A 2EIKC 2BE5F 3U0CA 4MNDA 2BL2A 1E85A 2R7UA 3EG9A 3ASOC 1SMYF 1C17M 1OXBA 4JC7A 1ZW2A 3POVA 3UNGC 3U9MA 4JVSA 3NKEA 3AJMA 1MNDA 4KNVA 1HE1A 2ZXOA 3QMKA 3V7OA 3SXMA 2GA0A 1SR2A 4GEHA 2Z15A 3I5QA 5E2QA 3ZVRA 4DBQA 4BJ6A 1D1BA 3EGXA 1A7EA 2L81A 1LM3B 3EZIA 3NMJA 3W2VA 4BPMA 2D5RB 3RYLA 2LK4A 4BG0A 3RF3A 3WAQA 4GQHA 3DKAA 4JJGA 5A6BD 1YAUO 1VMAA 4XPYA 4EUKB 5HV9A 2PNOA 1SF8A 2PP4A 4ONSA 2DGJA 1O3UA 3H2VA 4NTFA 3EH2A 1YVIA 3DWWA 4K0DA 1M57C 2A6EF 4U5CE 2R9RB 1A7DA 4Z9JA 4C7OB 1GM5A 1ZHWA 2WB7A 3K1IC 4IARA 2IXMA 2WZLA 3B71A 4Q5SF 1Q0MA 3MYIA 1WWPA 1H7IA 2B0JA 1VYKA 2L9JA 3N0TA 4OIOF 3TOMA 2XLMA 1Z23A 2H7BA 1PD1A 3M4CA 3US6A 1YLMA 3R2PA 4W8PA 1YA9A 1FTSA 2WZFA 4H54A 2XLWA 3FAPB 4H4KC 5T3WA 2P7VA 2MHRA 3AG4C 3EHMA 3Q7LA 3UGOA 2JPUA 1ORJA 2J9BA 2XL8A 4CJGA 3KH2A 1NLXA 3EGDB 1IZMA 4JJFA 3N24A 4N06A 2FAPB 1BR4A 2ZD9A 4N4WA 2NSGA 1HW1A 5KYUB 2XLOA 3EZHA 1H6GA 2QTVA 2J9UA 2XRHA 4O6MA 3RW0A 1QLEC 3C7JA 3QZCA 3RH3A 1R5ID 2V26A 5L0IA 1C03A 4MVZA 1V54C 2JD3A 4QI0A 1NFOA 3RKOF 3JZ0A 3E70C 4BJTA 1MMDA 4IAOA 4IWBA 2UUIA 2PF4E 3TULA 4U5FE 4N6HA 4P9FA 5JT4A 1VLTA 2GFHA 3LNRA 4XLPF 4IB4A 2LQGA 3GODA 1WGWA 1ZU4A 5L3QA 4BJ5A 1GGQA 2A0BA 4I1MA 1YZCA 1TWCA 4KNWA 3T9OA 4NC3A 1IW7F 3IHUA 2W4BA 4O6NA 3W2WA 3QVYA 3IPMO 3KL4A 4HFFB 2HMQA 4XQ1A 4CIPA 1UG7A 2EPOA 1PCXA 2HV7A 3R7CA 3EGXB 3LLIA 3GM1A 2HKVA 2J46A 3C63A 1L3PA 3DE8A 3S90A 1KTMA 5FCLA 4JEAA 5K0IA 2YLIA 4PK4A 3KKBA 2IYLD 1OR2A 3VM6A 1E86A 2D4UA 3TK0A 1FAPB 2HJ3A 3TJ5A 2OKUA 1FFHA 4EKWA 4WGYA 2KW3C 3M1CB 4CIHA 1CPRA 5DS6A 4BJ1A 3DZAA 4BEMJ 2PX0A 3GM3A 2KQ9A 1KNYA 2MYSA 4PJNA 5AGFA 1QVXA 2LFDA 4HEAJ 5T1DB 5L0DA 4EWCA 4G0HA 4E0IA 2YHSA 4C3EA 1OXKA 4YL0A 4YK5A 3PCVA 3U8VA 4CS9C 4DOZA 3AG3C 2OQMA 2VCAA 2QLAA 2P0NA 3C8GD 3TQOA 3T4RA 1YYJA 2ZXPA 2A6HF 2Q3TA 4B6IA 1HW2A 1D0ZA 1OW7A 3C8GB 1FR0A 3HNKA 4MVOA 4JZAA 1CGME 2Y3BA 3SP1A 3RIPA 2Q9AA 5EK0A 5JP7A 2C03A 1AVOB 3F47A 3HNIA 2OCCC 2R03A 1D0XA 3EHNA 1F1MA 3ITFA 3IQTA 1VLSA 3S27A 2MWQA 3LEOA 5L0FA 4DRIB 2J0XA 4CDVA 1AUEA 3K66A 3LNMB 3B0PA 1ORSC 3QW0A 1PD0A 3ABMC 3C18A 4PJMA 3W4YA 3HJCA 1HE9A 1EQ1A 2P61A 4CS8C 2I8BA 1R4TA 3AGUA 4ER9A 1VK5A 3UMHA 4XPWA 4AX2A 3OEOA 3ZC4A 4FAPB 3ZG1A 4Q4ZF 1Q0DA 3NYLA 4O79A 3RQGA 3T6GB 1OCZC 3U8PA 5DS5A 3EFOA 1U0BB 1E84A 2WVQA 3JSZA 2J8WA 3RFYA 3S28A 2H8AA 2VASA 1ZU5A 1QKRA 1H9TA 4OIQF 3M79A 5AC5A 5L0CA 3NDBB 2CW0F 3E9VA 3IQ5A 4AE4A 3CQZA 1V55C 3LJBA 4C3DA 1EKYA 1RJ9A 5A6AA 3B0VC 2R7RA 4JKVA 2J7PA 1SYQA 3HKKA 4EBJA 1W2WA 1I4YA 2W45A 1BDJB 2G3VA 4JURI 4XEVA 2AVKA 3C8ZA 2W9YA 5E3CA 3TOLA 2M64A 2W4MA 4P6IC 4X0RA 3HNJA 5BUOA 1MQVA 4CS9A 2NUTB 3AOUA 1U89A 2HFIA 5JRAA 4LLEA 4G7HF 2KSFA 2ZPAA 3RVYA 3MBGA 3LUTB 2O9XA 1OCRC 3KPHA 3J06A 5JUAA 3TJ6A 4AK9A 3FVYA 3W8HA 3AGTA 4AL1A 4Z9HA 2VH3A 1HMDA 1OQCA 1ZZPA 2RSEB 1JMWA 3PMRA 1ZW3A 3NMKA 4LACB 4DVYP 2C04A 3L34A 4OD4A 2KGOA 5A6BA 1G4WR 1JRAA 1CGNA 1S7ZA 4G78A 4O6YA 2YL7A 2LIGA 4MTOA 5F5HA 1FNTc 5IY5C 3U5SA 4FESA 2PFDA 3JTLO 4DRHB 2A69F 3AQCA 3NYMA 3ZQYA 2M4EA 4YL1A 2WZGA 5AC4A 3GORA 1BR1A 1M56C 2YRFA 3PHF2 2AP3A 2IM8A 1XZPA 3DI5A 1EI7A 3MFNA 5COGA 4CS8A 4JRZA 2EPLX 4J7TA 2YEVA 1TWGA 1G8XA 1YYXA 2A1DD 4IAQA 2CNWA 2PBEA 2FFHA 2XM4A 3M15A 2L6FA 2KJGA 3NRHA 1Q0FA 2YLDA 2XXAB 4P9TA 1YA7O 3I5PA 2VB6A 4N6CA 3SNHA 4U9EA 2Q4FA 2QE9A 2J0WA 2Y3DA 4JTDB 3WODF 5DS4A 1LE2A 3V5YA 1A7VA 1RCPA 3UMIA 1M2OA 3JYYA 1I4ZA 1LS1A 2XL4A 3L8IA 1Z6AA 2EPMX 2VCBA 3ASNC 3EFOB 1WASA 2RD9A 3CZ6A 4IJJA 4RBNA 1APCA 4XWJA 3SXKA 2Q9CA 5A69A 5JSLA 5A6JA 3V5ZA 1OW8A 2P1AA 1E83A 5HSWA 4XEKA 2HJMA 2YKZA 1O5HA 1Q0GA 2OJED 1ZHXA 3SXYA 3U2LA 1T6IA 5COFA 3NYJA 1LKXA 4PFPA 1TFOB 2Y3HA 5TJ5E 3ZQVA 2YLGA 3S0XA 5T3TA 1RKCA 4YT2A 2KC3A 2YVKA 4FWVA 4ULVA 2XSEA 1JPJA 4YT4A 4LLCA 4EIYA 4JIOA 256BA 2R7WA 4K7BA 3L0IA 1RKEA 1LI5A 1WN0A 5DQZA 2H7VC 3QTHA 3O55A 2ETSA 3SZRA 2ICWG 2HZ8A 4I3MA 3C62A 4JTAB 1E2XA 5DQTA 2E87A 1OR3A 3O10A 1M2VB 4WJ0A 4W8KA 1K40A 2XM0A 2YZSA 3EQLF 4HFKB 1XZQA 3RQFA 4MW8A 3U3BA 1H9GA 2OJQA 3CAXA 3LEVA 3NMIA 1WATA 1ZHZA 3WG7C 4CDAA 3UGPA 1TWAA 1TFKB 3DMDA 4NY3A 4IGGA 3JT1A 4YJWA 3V5XA 2HMZA 1D1CA 3LS0A 2YWAA 2XLHA 1WTYA 2QNLA 3U3FA 5CIVA 1DOWA 2EPKX 3VAYA 1NFNA 2R05A 3U2MA 2VC9A 3K1HA 2Q7RA 1O87A 1CGOA 1I5NA 1KU2A 2Y39A 3O6XA 3LESA 3FXHA 4E7SA 5KYYA 3KMIA 2QUPA 4WABA 2CDQA 2QY9A 2CGEA 2G3KA 3OA1A 3GWNA 1PV3A 5KYWA 2PX3A 2J9VA 3EH1A 1LVKA 2LSEA 1AEPA 1QSPA 2Q00A 3DJNB 4Z9IA 2KYHA 4K1OA 4OIRF 3WHNA 3MX3A 5BQIA 3ABKC 2GDCA 2XS8A 4PJLA 4XEFA 4JEBA 1L7CA 1NBBA 1OW6A 3LAYA 1Y4CA 3DAFA 2Y3GA 4PACA 4LERA 5GPGB 1RKEB 3Q7GA 1LIHA 1HMOA 3RQEA 3T6JA 3AQBA 4D4XA 1ZYRF 3C8GA 2DYSC 1TQGA 3EG9B 4OIPF 1MNEA 2ASRA 3A11A 2Q9BA 5F28E 1XWJA 3G4ZA 2YL0A 4E0HA 1T5OA 3GEIA 1Q0KA 2YL1A 1T6QA 1NZEA 1D0YA 1GS9A 3B29A 3NKDA 3Q6NA 3A9CA 1Z7Qc 3CEXA 3X2QC 4G7ZF 5D91A 3HTKC 2JX0A 3B9QA 3KYIA 4KBLA 3W8IA 5DLJA 4NTBA 5E3AA 5JS5A 3FAJA 1NSGB 2G62A 4MVSA 3ZIBA 4E17A 3L1MA 2HS5A 4LDKA 3DM9B 2V3CC 5DVWA 2XS1A 3O39A 5KYXA 4MQ9F 2A0UA 1LI7A 3SXZA 1G5ZA 1M2VA 3EJNA 2J45A 1Z3IX 2IXNA 4A2NB 1G4US 2LCHA 2NG1A 2LP4A 3G4XA 3JRTA 2HSBA 1YARO 3AG1C 3S29A 1JR8A 3GANA 4AE4B 2WVOA 3M4BA 1ZHTA 2XLEA 2OG2A 3FOOA 2WL8A 4KC9A 5L0GA 2XXAA 3ZTZA 3DAGA 3FHDA 4LDRA 3ECSA 1LPEA 4A4AA 3GEHA 3HNLA 4U5DE 3U9JA 1OKKA 3F46A 5JVEA 5KYNA 4NCQA 2R02A 2EPNA 4CSAA 3X1OA 3FMSA 4QI2A 3G50A 4DBRA 2LD6A 5KYYB 3ZDLA 4CBEA 4JTCB 5BQGA 4MW3A 4U9DA 3OWTA 3EGDA 4XTKA 4Q7CA 2J7PD 4RDAA 5E33A 1T6UA 2LFFA 2R7OA 3H65A 4JW1A 5EHHA 4C7OA 1SZIA 2AWYA 2L6HA 5KYWB 4M63A 2X0CA 2KK1A 3KYJA 1D1AA 3K6BA 1QPUA 5D92A 1BZ4A 1ORYA 1VYIA 2HV6A 2IXOA 3ABLC 4E7ZA 3VF0A 4U5EE 1RMVA 2DI3A 3FOPA 4IRUA 2NUTA 4FX5A 4DXWA 1J8YF 1Z63A 2R7SA 2FGYA 1C02A 3SYNA 5KYXB 1BR2A 1OCCC 1Y6DA 2A68F 4YT5A 4ZLDA 1JAFA 2OU6A 2R7QA 3GWLA 2DB4A 2HUJA 3Q6MA 3S84A 4J30B 4WGZA 1GQAA 1WOLA 5BQHA 1T9KA 1OKKD 4OD5A 4R32A 5L0HA 1UFBA 4PR9A 1RXQA 4RD9A 2I15A 2YQYA 2CNWD 2AU5A 5F5FA 2L6GA 2NUPA 5COMA 2TMVP 3GEEA 3LS1A 1K05A 4MTFA 3ZTMA 1U6HA 3GM2A 5B3SC 3TD7A 4BEJA 1VB5A 2NPUA 3DM5A 1MMNA 3VRCA 1M6TA 3DJUB 4MVQA 1TWHA 3FDQA 1YDIA 2Y69C 4MS2A 3JYHA 2OEXA 2P6VA 1NU7D 2VCCA 4DVZA 4BJ5C 1V4AA 4F4BA 1VTMP 1CPQA 2DYRC 4DRJB 3NG1A 1DOVA 2CYDA 2YL3A 4JCZA 3EPVA 2IXPA 4J7YA 4JE9A 2R7TA 4PJJA 1A41A 1TKNA 4U5HA 5B1AC 3HLZA 4I44A 1OCOC 3S9OA 2KNHA 1FFTC 1LE4A 2ZXWC 1HY5A 1FMWA 1TR2A 2F22A 3UMKA 4D4NA 3IQ6A 3SEOA 2WVNA 3JSEO 4YWQA 3ATPA 1ZHYA 1JOGA 2CCYA 4EHPA 2XL6A 3ZSUA 4GYTA 3JRMO 2BC5A 2J9WA 2HSQA 1NU9C 4J32B 4XPXA 4YL3A 4YT8A 4ANJA 4CJOA 4ZLCA 1MMGA 3JCUQ 5B1BC 4AL0A 3ZWIA 2R7VA 1S05A 2NSFA 3DXJF 5L3VA 3I4UA 3L8JA 2NUPB 1V74B 2R7XA 4PFOA 4HE8D 3DE9A 2EILC 2X51A 4L6RA 3IQCA 4MVRA 4XLNF 2L7AA 4LDQA 1EA8A 1QZXA 3BEHA 4ULWA 3H2UA 2EIJC 4E18A 3MLGA 3LLKA 5EGYA 1JPNA 1FMVA 2ZXRA 2AWCA 3BRJA 3K33A 5CI8A 4CSAC 1T01A 2GAQA 1ZVZA 3N2ZB 4U5BE 4CX9A 4EBKA 4OINF 3PDMP 1YJGA 2IBFA 4G7OF 4BJ6C 4KI2A 3B0UX 3CSKA 4MVUA 4NTAA 1NG1A 2UUHA 1J8MF 4O7GA 4UDVA 1N1CA 1ST6A 2H7OA 3QW1A 1VOMA 4U5GA 5FZTA 1QQ3A 5CI9A 1A0BA 2B0HA 3VYWA 4DJ9A 2EIMC 5B3IA 3QVZA 4QDLA 1Z5ZA 2OEVA 4CS7A 4NQFA
chains in the Genus database with same CATH topology
3WHNA 1HMOA 1A7EA 2AWYA 2AWCA 2HMZA 2HMQA 4XQ1A 1A7DA 1I4YA 4XPXA 3AGTA 2MHRA 2AVKA 1I4ZA 3WAQA 1HMDA 3AGUA 4XPWA 4XPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHN A;  1HMO A;  1A7E A;  2AWY A;  2AWC A;  2HMZ A;  2HMQ A;  4XQ1 A;  1A7D A;  1I4Y A;  4XPX A;  3AGT A;  2MHR A;  2AVK A;  1I4Z A;  3WAQ A;  1HMD A;  3AGU A;  4XPW A;  4XPY A; 
#chains in the Genus database with same CATH topology
 1YZA A;  4MVM A;  4EBB A;  3DD7 A;  5L0J A;  4I1O B;  1LS4 A;  4JCH A;  2IOQ A;  3K1I A;  3T6B A;  4CDY A;  2XLV A;  2GWW A;  3IEE A;  2R25 A;  2EIN C;  4MTG A;  3RVZ A;  2XLD A;  5KYU A;  1BBH A;  4YN0 B;  1RJ9 B;  1MMA A;  1K04 A;  5JLI A;  5A6K A;  2OOC A;  4C3B A;  3UR3 C;  3MYF A;  3K7D A;  3AG2 C;  1B68 A;  2EIK C;  2BE5 F;  3U0C A;  4MND A;  2BL2 A;  1E85 A;  2R7U A;  3EG9 A;  3ASO C;  1SMY F;  1C17 M;  1OXB A;  4JC7 A;  1ZW2 A;  3POV A;  3UNG C;  3U9M A;  4JVS A;  3NKE A;  3AJM A;  1MND A;  4KNV A;  1HE1 A;  2ZXO A;  3QMK A;  3V7O A;  3SXM A;  2GA0 A;  1SR2 A;  4GEH A;  2Z15 A;  3I5Q A;  5E2Q A;  3ZVR A;  4DBQ A;  4BJ6 A;  1D1B A;  3EGX A;  1A7E A;  2L81 A;  1LM3 B;  3EZI A;  3NMJ A;  3W2V A;  4BPM A;  2D5R B;  3RYL A;  2LK4 A;  4BG0 A;  3RF3 A;  3WAQ A;  4GQH A;  3DKA A;  4JJG A;  5A6B D;  1YAU O;  1VMA A;  4XPY A;  4EUK B;  5HV9 A;  2PNO A;  1SF8 A;  2PP4 A;  4ONS A;  2DGJ A;  1O3U A;  3H2V A;  4NTF A;  3EH2 A;  1YVI A;  3DWW A;  4K0D A;  1M57 C;  2A6E F;  4U5C E;  2R9R B;  1A7D A;  4Z9J A;  4C7O B;  1GM5 A;  1ZHW A;  2WB7 A;  3K1I C;  4IAR A;  2IXM A;  2WZL A;  3B71 A;  4Q5S F;  1Q0M A;  3MYI A;  1WWP A;  1H7I A;  2B0J A;  1VYK A;  2L9J A;  3N0T A;  4OIO F;  3TOM A;  2XLM A;  1Z23 A;  2H7B A;  1PD1 A;  3M4C A;  3US6 A;  1YLM A;  3R2P A;  4W8P A;  1YA9 A;  1FTS A;  2WZF A;  4H54 A;  2XLW A;  3FAP B;  4H4K C;  5T3W A;  2P7V A;  2MHR A;  3AG4 C;  3EHM A;  3Q7L A;  3UGO A;  2JPU A;  1ORJ A;  2J9B A;  2XL8 A;  4CJG A;  3KH2 A;  1NLX A;  3EGD B;  1IZM A;  4JJF A;  3N24 A;  4N06 A;  2FAP B;  1BR4 A;  2ZD9 A;  4N4W A;  2NSG A;  1HW1 A;  5KYU B;  2XLO A;  3EZH A;  1H6G A;  2QTV A;  2J9U A;  2XRH A;  4O6M A;  3RW0 A;  1QLE C;  3C7J A;  3QZC A;  3RH3 A;  1R5I D;  2V26 A;  5L0I A;  1C03 A;  4MVZ A;  1V54 C;  2JD3 A;  4QI0 A;  1NFO A;  3RKO F;  3JZ0 A;  3E70 C;  4BJT A;  1MMD A;  4IAO A;  4IWB A;  2UUI A;  2PF4 E;  3TUL A;  4U5F E;  4N6H A;  4P9F A;  5JT4 A;  1VLT A;  2GFH A;  3LNR A;  4XLP F;  4IB4 A;  2LQG A;  3GOD A;  1WGW A;  1ZU4 A;  5L3Q A;  4BJ5 A;  1GGQ A;  2A0B A;  4I1M A;  1YZC A;  1TWC A;  4KNW A;  3T9O A;  4NC3 A;  1IW7 F;  3IHU A;  2W4B A;  4O6N A;  3W2W A;  3QVY A;  3IPM O;  3KL4 A;  4HFF B;  2HMQ A;  4XQ1 A;  4CIP A;  1UG7 A;  2EPO A;  1PCX A;  2HV7 A;  3R7C A;  3EGX B;  3LLI A;  3GM1 A;  2HKV A;  2J46 A;  3C63 A;  1L3P A;  3DE8 A;  3S90 A;  1KTM A;  5FCL A;  4JEA A;  5K0I A;  2YLI A;  4PK4 A;  3KKB A;  2IYL D;  1OR2 A;  3VM6 A;  1E86 A;  2D4U A;  3TK0 A;  1FAP B;  2HJ3 A;  3TJ5 A;  2OKU A;  1FFH A;  4EKW A;  4WGY A;  2KW3 C;  3M1C B;  4CIH A;  1CPR A;  5DS6 A;  4BJ1 A;  3DZA A;  4BEM J;  2PX0 A;  3GM3 A;  2KQ9 A;  1KNY A;  2MYS A;  4PJN A;  5AGF A;  1QVX A;  2LFD A;  4HEA J;  5T1D B;  5L0D A;  4EWC A;  4G0H A;  4E0I A;  2YHS A;  4C3E A;  1OXK A;  4YL0 A;  4YK5 A;  3PCV A;  3U8V A;  4CS9 C;  4DOZ A;  3AG3 C;  2OQM A;  2VCA A;  2QLA A;  2P0N A;  3C8G D;  3TQO A;  3T4R A;  1YYJ A;  2ZXP A;  2A6H F;  2Q3T A;  4B6I A;  1HW2 A;  1D0Z A;  1OW7 A;  3C8G B;  1FR0 A;  3HNK A;  4MVO A;  4JZA A;  1CGM E;  2Y3B A;  3SP1 A;  3RIP A;  2Q9A A;  5EK0 A;  5JP7 A;  2C03 A;  1AVO B;  3F47 A;  3HNI A;  2OCC C;  2R03 A;  1D0X A;  3EHN A;  1F1M A;  3ITF A;  3IQT A;  1VLS A;  3S27 A;  2MWQ A;  3LEO A;  5L0F A;  4DRI B;  2J0X A;  4CDV A;  1AUE A;  3K66 A;  3LNM B;  3B0P A;  1ORS C;  3QW0 A;  1PD0 A;  3ABM C;  3C18 A;  4PJM A;  3W4Y A;  3HJC A;  1HE9 A;  1EQ1 A;  2P61 A;  4CS8 C;  2I8B A;  1R4T A;  3AGU A;  4ER9 A;  1VK5 A;  3UMH A;  4XPW A;  4AX2 A;  3OEO A;  3ZC4 A;  4FAP B;  3ZG1 A;  4Q4Z F;  1Q0D A;  3NYL A;  4O79 A;  3RQG A;  3T6G B;  1OCZ C;  3U8P A;  5DS5 A;  3EFO A;  1U0B B;  1E84 A;  2WVQ A;  3JSZ A;  2J8W A;  3RFY A;  3S28 A;  2H8A A;  2VAS A;  1ZU5 A;  1QKR A;  1H9T A;  4OIQ F;  3M79 A;  5AC5 A;  5L0C A;  3NDB B;  2CW0 F;  3E9V A;  3IQ5 A;  4AE4 A;  3CQZ A;  1V55 C;  3LJB A;  4C3D A;  1EKY A;  1RJ9 A;  5A6A A;  3B0V C;  2R7R A;  4JKV A;  2J7P A;  1SYQ A;  3HKK A;  4EBJ A;  1W2W A;  1I4Y A;  2W45 A;  1BDJ B;  2G3V A;  4JUR I;  4XEV A;  2AVK A;  3C8Z A;  2W9Y A;  5E3C A;  3TOL A;  2M64 A;  2W4M A;  4P6I C;  4X0R A;  3HNJ A;  5BUO A;  1MQV A;  4CS9 A;  2NUT B;  3AOU A;  1U89 A;  2HFI A;  5JRA A;  4LLE A;  4G7H F;  2KSF A;  2ZPA A;  3RVY A;  3MBG A;  3LUT B;  2O9X A;  1OCR C;  3KPH A;  3J06 A;  5JUA A;  3TJ6 A;  4AK9 A;  3FVY A;  3W8H A;  3AGT A;  4AL1 A;  4Z9H A;  2VH3 A;  1HMD A;  1OQC A;  1ZZP A;  2RSE B;  1JMW A;  3PMR A;  1ZW3 A;  3NMK A;  4LAC B;  4DVY P;  2C04 A;  3L34 A;  4OD4 A;  2KGO A;  5A6B A;  1G4W R;  1JRA A;  1CGN A;  1S7Z A;  4G78 A;  4O6Y A;  2YL7 A;  2LIG A;  4MTO A;  5F5H A;  1FNT c;  5IY5 C;  3U5S A;  4FES A;  2PFD A;  3JTL O;  4DRH B;  2A69 F;  3AQC A;  3NYM A;  3ZQY A;  2M4E A;  4YL1 A;  2WZG A;  5AC4 A;  3GOR A;  1BR1 A;  1M56 C;  2YRF A;  3PHF 2;  2AP3 A;  2IM8 A;  1XZP A;  3DI5 A;  1EI7 A;  3MFN A;  5COG A;  4CS8 A;  4JRZ A;  2EPL X;  4J7T A;  2YEV A;  1TWG A;  1G8X A;  1YYX A;  2A1D D;  4IAQ A;  2CNW A;  2PBE A;  2FFH A;  2XM4 A;  3M15 A;  2L6F A;  2KJG A;  3NRH A;  1Q0F A;  2YLD A;  2XXA B;  4P9T A;  1YA7 O;  3I5P A;  2VB6 A;  4N6C A;  3SNH A;  4U9E A;  2Q4F A;  2QE9 A;  2J0W A;  2Y3D A;  4JTD B;  3WOD F;  5DS4 A;  1LE2 A;  3V5Y A;  1A7V A;  1RCP A;  3UMI A;  1M2O A;  3JYY A;  1I4Z A;  1LS1 A;  2XL4 A;  3L8I A;  1Z6A A;  2EPM X;  2VCB A;  3ASN C;  3EFO B;  1WAS A;  2RD9 A;  3CZ6 A;  4IJJ A;  4RBN A;  1APC A;  4XWJ A;  3SXK A;  2Q9C A;  5A69 A;  5JSL A;  5A6J A;  3V5Z A;  1OW8 A;  2P1A A;  1E83 A;  5HSW A;  4XEK A;  2HJM A;  2YKZ A;  1O5H A;  1Q0G A;  2OJE D;  1ZHX A;  3SXY A;  3U2L A;  1T6I A;  5COF A;  3NYJ A;  1LKX A;  4PFP A;  1TFO B;  2Y3H A;  5TJ5 E;  3ZQV A;  2YLG A;  3S0X A;  5T3T A;  1RKC A;  4YT2 A;  2KC3 A;  2YVK A;  4FWV A;  4ULV A;  2XSE A;  1JPJ A;  4YT4 A;  4LLC A;  4EIY A;  4JIO A;  256B A;  2R7W A;  4K7B A;  3L0I A;  1RKE A;  1LI5 A;  1WN0 A;  5DQZ A;  2H7V C;  3QTH A;  3O55 A;  2ETS A;  3SZR A;  2ICW G;  2HZ8 A;  4I3M A;  3C62 A;  4JTA B;  1E2X A;  5DQT A;  2E87 A;  1OR3 A;  3O10 A;  1M2V B;  4WJ0 A;  4W8K A;  1K40 A;  2XM0 A;  2YZS A;  3EQL F;  4HFK B;  1XZQ A;  3RQF A;  4MW8 A;  3U3B A;  1H9G A;  2OJQ A;  3CAX A;  3LEV A;  3NMI A;  1WAT A;  1ZHZ A;  3WG7 C;  4CDA A;  3UGP A;  1TWA A;  1TFK B;  3DMD A;  4NY3 A;  4IGG A;  3JT1 A;  4YJW A;  3V5X A;  2HMZ A;  1D1C A;  3LS0 A;  2YWA A;  2XLH A;  1WTY A;  2QNL A;  3U3F A;  5CIV A;  1DOW A;  2EPK X;  3VAY A;  1NFN A;  2R05 A;  3U2M A;  2VC9 A;  3K1H A;  2Q7R A;  1O87 A;  1CGO A;  1I5N A;  1KU2 A;  2Y39 A;  3O6X A;  3LES A;  3FXH A;  4E7S A;  5KYY A;  3KMI A;  2QUP A;  4WAB A;  2CDQ A;  2QY9 A;  2CGE A;  2G3K A;  3OA1 A;  3GWN A;  1PV3 A;  5KYW A;  2PX3 A;  2J9V A;  3EH1 A;  1LVK A;  2LSE A;  1AEP A;  1QSP A;  2Q00 A;  3DJN B;  4Z9I A;  2KYH A;  4K1O A;  4OIR F;  3WHN A;  3MX3 A;  5BQI A;  3ABK C;  2GDC A;  2XS8 A;  4PJL A;  4XEF A;  4JEB A;  1L7C A;  1NBB A;  1OW6 A;  3LAY A;  1Y4C A;  3DAF A;  2Y3G A;  4PAC A;  4LER A;  5GPG B;  1RKE B;  3Q7G A;  1LIH A;  1HMO A;  3RQE A;  3T6J A;  3AQB A;  4D4X A;  1ZYR F;  3C8G A;  2DYS C;  1TQG A;  3EG9 B;  4OIP F;  1MNE A;  2ASR A;  3A11 A;  2Q9B A;  5F28 E;  1XWJ A;  3G4Z A;  2YL0 A;  4E0H A;  1T5O A;  3GEI A;  1Q0K A;  2YL1 A;  1T6Q A;  1NZE A;  1D0Y A;  1GS9 A;  3B29 A;  3NKD A;  3Q6N A;  3A9C A;  1Z7Q c;  3CEX A;  3X2Q C;  4G7Z F;  5D91 A;  3HTK C;  2JX0 A;  3B9Q A;  3KYI A;  4KBL A;  3W8I A;  5DLJ A;  4NTB A;  5E3A A;  5JS5 A;  3FAJ A;  1NSG B;  2G62 A;  4MVS A;  3ZIB A;  4E17 A;  3L1M A;  2HS5 A;  4LDK A;  3DM9 B;  2V3C C;  5DVW A;  2XS1 A;  3O39 A;  5KYX A;  4MQ9 F;  2A0U A;  1LI7 A;  3SXZ A;  1G5Z A;  1M2V A;  3EJN A;  2J45 A;  1Z3I X;  2IXN A;  4A2N B;  1G4U S;  2LCH A;  2NG1 A;  2LP4 A;  3G4X A;  3JRT A;  2HSB A;  1YAR O;  3AG1 C;  3S29 A;  1JR8 A;  3GAN A;  4AE4 B;  2WVO A;  3M4B A;  1ZHT A;  2XLE A;  2OG2 A;  3FOO A;  2WL8 A;  4KC9 A;  5L0G A;  2XXA A;  3ZTZ A;  3DAG A;  3FHD A;  4LDR A;  3ECS A;  1LPE A;  4A4A A;  3GEH A;  3HNL A;  4U5D E;  3U9J A;  1OKK A;  3F46 A;  5JVE A;  5KYN A;  4NCQ A;  2R02 A;  2EPN A;  4CSA A;  3X1O A;  3FMS A;  4QI2 A;  3G50 A;  4DBR A;  2LD6 A;  5KYY B;  3ZDL A;  4CBE A;  4JTC B;  5BQG A;  4MW3 A;  4U9D A;  3OWT A;  3EGD A;  4XTK A;  4Q7C A;  2J7P D;  4RDA A;  5E33 A;  1T6U A;  2LFF A;  2R7O A;  3H65 A;  4JW1 A;  5EHH A;  4C7O A;  1SZI A;  2AWY A;  2L6H A;  5KYW B;  4M63 A;  2X0C A;  2KK1 A;  3KYJ A;  1D1A A;  3K6B A;  1QPU A;  5D92 A;  1BZ4 A;  1ORY A;  1VYI A;  2HV6 A;  2IXO A;  3ABL C;  4E7Z A;  3VF0 A;  4U5E E;  1RMV A;  2DI3 A;  3FOP A;  4IRU A;  2NUT A;  4FX5 A;  4DXW A;  1J8Y F;  1Z63 A;  2R7S A;  2FGY A;  1C02 A;  3SYN A;  5KYX B;  1BR2 A;  1OCC C;  1Y6D A;  2A68 F;  4YT5 A;  4ZLD A;  1JAF A;  2OU6 A;  2R7Q A;  3GWL A;  2DB4 A;  2HUJ A;  3Q6M A;  3S84 A;  4J30 B;  4WGZ A;  1GQA A;  1WOL A;  5BQH A;  1T9K A;  1OKK D;  4OD5 A;  4R32 A;  5L0H A;  1UFB A;  4PR9 A;  1RXQ A;  4RD9 A;  2I15 A;  2YQY A;  2CNW D;  2AU5 A;  5F5F A;  2L6G A;  2NUP A;  5COM A;  2TMV P;  3GEE A;  3LS1 A;  1K05 A;  4MTF A;  3ZTM A;  1U6H A;  3GM2 A;  5B3S C;  3TD7 A;  4BEJ A;  1VB5 A;  2NPU A;  3DM5 A;  1MMN A;  3VRC A;  1M6T A;  3DJU B;  4MVQ A;  1TWH A;  3FDQ A;  1YDI A;  2Y69 C;  4MS2 A;  3JYH A;  2OEX A;  2P6V A;  1NU7 D;  2VCC A;  4DVZ A;  4BJ5 C;  1V4A A;  4F4B A;  1VTM P;  1CPQ A;  2DYR C;  4DRJ B;  3NG1 A;  1DOV A;  2CYD A;  2YL3 A;  4JCZ A;  3EPV A;  2IXP A;  4J7Y A;  4JE9 A;  2R7T A;  4PJJ A;  1A41 A;  1TKN A;  4U5H A;  5B1A C;  3HLZ A;  4I44 A;  1OCO C;  3S9O A;  2KNH A;  1FFT C;  1LE4 A;  2ZXW C;  1HY5 A;  1FMW A;  1TR2 A;  2F22 A;  3UMK A;  4D4N A;  3IQ6 A;  3SEO A;  2WVN A;  3JSE O;  4YWQ A;  3ATP A;  1ZHY A;  1JOG A;  2CCY A;  4EHP A;  2XL6 A;  3ZSU A;  4GYT A;  3JRM O;  2BC5 A;  2J9W A;  2HSQ A;  1NU9 C;  4J32 B;  4XPX A;  4YL3 A;  4YT8 A;  4ANJ A;  4CJO A;  4ZLC A;  1MMG A;  3JCU Q;  5B1B C;  4AL0 A;  3ZWI A;  2R7V A;  1S05 A;  2NSF A;  3DXJ F;  5L3V A;  3I4U A;  3L8J A;  2NUP B;  1V74 B;  2R7X A;  4PFO A;  4HE8 D;  3DE9 A;  2EIL C;  2X51 A;  4L6R A;  3IQC A;  4MVR A;  4XLN F;  2L7A A;  4LDQ A;  1EA8 A;  1QZX A;  3BEH A;  4ULW A;  3H2U A;  2EIJ C;  4E18 A;  3MLG A;  3LLK A;  5EGY A;  1JPN A;  1FMV A;  2ZXR A;  2AWC A;  3BRJ A;  3K33 A;  5CI8 A;  4CSA C;  1T01 A;  2GAQ A;  1ZVZ A;  3N2Z B;  4U5B E;  4CX9 A;  4EBK A;  4OIN F;  3PDM P;  1YJG A;  2IBF A;  4G7O F;  4BJ6 C;  4KI2 A;  3B0U X;  3CSK A;  4MVU A;  4NTA A;  1NG1 A;  2UUH A;  1J8M F;  4O7G A;  4UDV A;  1N1C A;  1ST6 A;  2H7O A;  3QW1 A;  1VOM A;  4U5G A;  5FZT A;  1QQ3 A;  5CI9 A;  1A0B A;  2B0H A;  3VYW A;  4DJ9 A;  2EIM C;  5B3I A;  3QVZ A;  4QDL A;  1Z5Z A;  2OEV A;  4CS7 A;  4NQF A; 
#chains in the Genus database with same CATH homology
 3WHN A;  1HMO A;  1A7E A;  2AWY A;  2AWC A;  2HMZ A;  2HMQ A;  4XQ1 A;  1A7D A;  1I4Y A;  4XPX A;  3AGT A;  2MHR A;  2AVK A;  1I4Z A;  3WAQ A;  1HMD A;  3AGU A;  4XPW A;  4XPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...