4XQ1A

Crystal structure of hemerythrin: l114a mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWAVNHIPKVDKLYGPCLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xq1A00
2AWYA 1HMOA 2HMQA 4XPXA 4XPYA 1A7EA 2AVKA 2AWCA 1HMDA 1I4YA 1I4ZA 3WAQA 3AGTA 3AGUA 2MHRA 4XPWA 1A7DA 4XQ1A 3WHNA 2HMZA
chains in the Genus database with same CATH superfamily
4OINF 2OJED 4JW1A 1G8XA 2WVQA 4CDYA 5JUAA 3H2VA 3ZTZA 1F1MA 3MYFA 2WB7A 4N6HA 4PK4A 2GA0A 1CGOA 1OW8A 2IM8A 1R5ID 2M64A 1ZHXA 1MMNA 2VCBA 3G4XA 4FWVA 4DJ9A 3FOPA 3ASNC 4I3MA 2YQYA 1E86A 1NU7D 1YVIA 1MMGA 1MNEA 3DJUB 4NY3A 4MVZA 3VAYA 4BJ1A 1FAPB 3ZVRA 3DKAA 4U5EE 2NUPB 1VOMA 4A2NB 1VLTA 4KNVA 3N24A 4QI0A 1FR0A 3LS0A 5EGYA 2VC9A 3U2MA 1OR2A 2CW0F 2MHRA 1BR2A 2Q00A 2CDQA 2Q3TA 3QW0A 2XSEA 2HV7A 2V26A 1W2WA 3K1HA 3HKKA 5EK0A 3EGDB 2J9VA 2P61A 3PCVA 1GGQA 1EA8A 2HUJA 3JYHA 2R7SA 1TR2A 2BL2A 1KU2A 3FOOA 2OCCC 5GPGB 5JS5A 2OEXA 2A6HF 3HLZA 1H9GA 1LM3B 4YL0A 3M4CA 1A7EA 2AVKA 1GS9A 2GAQA 3LJBA 2AWCA 2XM4A 4PJLA 4OIRF 3Q7LA 5L0GA 1E84A 1WASA 3RKOF 2R02A 4JE9A 1JMWA 1G4US 1E85A 1NFOA 2J7PD 1OW7A 3ABKC 5DLJA 4PR9A 3EZIA 2HS5A 1APCA 1D0XA 1ZW2A 5JP7A 4U5GA 1G4WR 3CQZA 5DQTA 3WHNA 3RF3A 2J7PA 3DMDA 5CIVA 3W8IA 3GORA 4I1OB 2AWYA 4CBEA 4C7OA 4LLEA 4UDVA 3JTLO 1YYXA 4ER9A 2YHSA 3U0CA 3I4UA 3SNHA 3FDQA 2L7AA 5DS5A 1XZQA 4WGYA 2LFFA 2RD9A 2HSBA 2QUPA 4Q7CA 3GM2A 2XLHA 3NYLA 3TJ6A 2J9UA 3IQCA 2C04A 5T3WA 4CDVA 2IBFA 3KPHA 2CYDA 2JPUA 1HMDA 3S28A 1I5NA 4C3BA 4L6RA 4J30B 5D91A 3NMKA 4X0RA 1T9KA 2LP4A 3R7CA 3SXZA 3X1OA 3PHF2 3GODA 4JCZA 4XEVA 1VYKA 3A9CA 2XLVA 2FFHA 3ATPA 3JRTA 3U9MA 4U5CE 4CIHA 1MQVA 1V74B 2KC3A 3MFNA 4N6CA 1MMDA 4IJJA 2G62A 4MS2A 4XPWA 1IW7F 2EIKC 1AEPA 2NUTA 3RW0A 3SXMA 2Q9BA 2KJGA 5BQIA 4AL0A 2A68F 3G50A 2W4MA 5KYYA 3UMKA 5COMA 3DI5A 3WG7C 4CS8A 5F5FA 1T6UA 2R25A 3AG1C 3QMKA 4R32A 5A69A 2W4BA 4KC9A 2XLOA 3UNGC 3FMSA 3F47A 1NLXA 3WODF 3JZ0A 4MVUA 1OCRC 4WABA 2H7VC 3LEOA 4Z9IA 1Q0FA 4OD4A 3U2LA 4E18A 4O6NA 2YWAA 4ULVA 1Z7Qc 4ZLDA 4M63A 4N06A 1RJ9A 3HNKA 1E83A 3DM9B 4BJ6C 4XTKA 3FXHA 4YL3A 3ASOC 3EFOB 5KYWA 3TK0A 1FFTC 2YL7A 4CS7A 4BJ5A 3DE9A 4LLCA 5L3QA 2EIMC 1A0BA 2HMZA 1DOVA 3C62A 5CI9A 2TMVP 3B0VC 1LPEA 3AG2C 2PBEA 1EKYA 4EIYA 2NUTB 1HMOA 3QW1A 3VF0A 1T6QA 5L0CA 1FNTc 3AG4C 4EKWA 1H9TA 2A69F 1D1AA 2RSEB 3AJMA 4MVMA 1JR8A 3MBGA 5KYYB 4U5BE 3S84A 1QQ3A 1BDJB 1YLMA 2D4UA 2KQ9A 2X51A 3TD7A 2XS1A 2NUPA 1CGME 2KK1A 3U8PA 3V5YA 3O6XA 4DVZA 2GDCA 2XLEA 1BR1A 1K04A 3KYIA 1OXKA 4O7GA 1ZHTA 2CGEA 4HFKB 2YLDA 4RD9A 3NDBB 2LQGA 4K7BA 4BJTA 5KYNA 3EGDA 3TOLA 2EPOA 3VM6A 1ZU5A 3A11A 2HJMA 3CEXA 3EHMA 3NKDA 3RFYA 3O55A 4YWQA 1J8YF 3GWNA 3K1IA 3KMIA 3M1CB 2BC5A 4JVSA 3ZQVA 3NG1A 4EHPA 2XL4A 1KTMA 2FGYA 5T1DB 1TKNA 3NKEA 1T6IA 2R7WA 1VTMP 1LS1A 3RVZA 5B1BC 4XPYA 1E2XA 5L0DA 2KYHA 3H2UA 1SR2A 3LLIA 3M15A 4ZLCA 4U9DA 4P6IC 2IOQA 2Y69C 2Y3GA 3UGOA 2EINC 3N2ZB 4ANJA 2DB4A 1TWHA 1RKEB 1I4ZA 2OEVA 1M2OA 2XLDA 1T01A 3AOUA 3JSEO 4XEFA 3T4RA 3GWLA 3LS1A 3MX3A 4JJGA 2HSQA 2KW3C 1H6GA 1LI7A 4JRZA 2J0WA 3ECSA 3O10A 4RBNA 3KL4A 3Q7GA 5E2QA 2KNHA 5DS6A 3BEHA 1TWAA 2DI3A 2J46A 3JYYA 3EQLF 3AQCA 4J7TA 4D4XA 2GWWA 3U3BA 4AL1A 4I1MA 2QTVA 3KH2A 1FFHA 1ST6A 2EPMX 4DRIB 4F4BA 3ZIBA 5DS4A 2ICWG 4JURI 5JRAA 2VB6A 4FAPB 1O5HA 4W8KA 2OU6A 4MTOA 5COFA 5KYUB 1SMYF 4DRJB 2XXAB 2V3CC 2HFIA 3HJCA 1HE1A 4HE8D 1IZMA 4EBBA 1CPQA 4PFOA 2VCCA 4JZAA 3WAQA 3DE8A 1LE2A 3X2QC 2FAPB 1UG7A 1HW2A 4CJGA 2Q4FA 3EGXB 3GM1A 3IPMO 1C17M 2IXPA 5BQHA 3IQ5A 2PNOA 2AU5A 4D4NA 5B3SC 2VASA 3POVA 3RQFA 2OJQA 2NSGA 2OOCA 3ZSUA 5L0HA 3SP1A 1XZPA 1JRAA 4XPXA 1GQAA 2NPUA 2XLWA 3GM3A 3K33A 3OEOA 4XWJA 3CAXA 5JSLA 1LIHA 5E3AA 1ZHYA 1U6HA 2A0BA 3ITFA 4LDKA 1VK5A 1XWJA 4U5HA 3KKBA 4BPMA 2W45A 3S90A 1JPJA 4WJ0A 3EFOA 4YT4A 4RDAA 2CCYA 4CS8C 2R7VA 4MQ9F 2LSEA 4JC7A 4BG0A 2J9BA 4JJFA 4C3DA 2R7RA 3GEHA 3L0IA 2IXNA 1OCOC 2ZXPA 3BRJA 2YEVA 3W2VA 4AK9A 2OQMA 1A7DA 4FESA 3EHNA 3FAJA 4NQFA 5IY5C 4DOZA 2Y3BA 1PV3A 2H8AA 2H7OA 1JOGA 3EG9B 3GEIA 4NTFA 1OW6A 3QVYA 3W8HA 2L6FA 2Y3HA 1QLEC 1H7IA 1O3UA 3HNJA 1NU9C 2A6EF 5TJ5E 1Z23A 4U5FE 4BJ5C 3U8VA 4CS9A 5F5HA 1OR3A 1RKCA 2Z15A 3R2PA 1Y6DA 2EPLX 4DBRA 4IAQA 3LNRA 2QY9A 5B1AC 4DVYP 1VLSA 2EPNA 1JPNA 2IXMA 3LESA 4G7ZF 1NBBA 1TFOB 4P9TA 2NSFA 3ZG1A 1QKRA 4C3EA 1YA9A 4NCQA 3N0TA 3S27A 1M2VB 4YN0B 5DVWA 3SEOA 4YJWA 3UR3C 2Q9CA 2YL0A 2D5RB 4JTCB 4AE4B 4A4AA 4EBKA 4E7SA 1OCZC 1FMVA 1QVXA 4NTAA 3HNIA 4WGZA 5JVEA 5K0IA 2XRHA 4KBLA 4ULWA 1L7CA 3TQOA 1MMAA 4IB4A 1GM5A 2UUHA 1VYIA 2IYLD 4EBJA 4JEAA 4O6MA 4YT2A 3J06A 2F22A 1D0YA 3B9QA 2ZPAA 3EH2A 3K1IC 1RKEA 1MNDA 1ORSC 1S05A 2EILC 1YJGA 1A41A 2W9YA 3IQ6A 3LAYA 1LVKA 4O79A 1ZHWA 2XS8A 1TFKB 4K1OA 4PFPA 1EQ1A 4LDQA 5KYXB 3CZ6A 1CGNA 5T3TA 2ETSA 1T5OA 1C03A 4G0HA 4E17A 2BE5F 2HKVA 4JEBA 4H54A 2R7XA 1WGWA 3T6JA 4GQHA 1VB5A 2HJ3A 4YT5A 3W4YA 1V54C 1N1CA 1U89A 1HW1A 2A0UA 5CI8A 1OKKD 5A6AA 2Y3DA 3B71A 3JSZA 2CNWD 1Q0MA 2LFDA 2E87A 3UGPA 2WVOA 5KYUA 1BZ4A 3LEVA 1NZEA 4U9EA 3W2WA 2XXAA 2HZ8A 3U5SA 3QTHA 2WVNA 3NYJA 2OG2A 2QNLA 5AGFA 1Q0KA 5E33A 3JCUQ 1NSGB 3B0UX 1S7ZA 1J8MF 3DZAA 1ZYRF 4IWBA 1Z63A 1CPRA 2CNWA 3C8ZA 3S9OA 4FX5A 2YZSA 1V4AA 2R05A 2X0CA 3S0XA 1VMAA 3Q6NA 3EGXA 3SXYA 3DWWA 1B68A 1HY5A 3UMIA 1SZIA 2R7QA 3LUTB 3PMRA 4MVRA 1PD0A 1Z3IX 1A7VA 2Y39A 4IARA 4CSAA 2EPKX 4CJOA 2YL1A 4CIPA 2J8WA 1YAUO 4K0DA 3JRMO 4IRUA 2YLIA 3ZDLA 4DXWA 1Q0DA 1ZW3A 1QSPA 3C8GB 3SYNA 3DJNB 3K6BA 3Q6MA 3T6GB 3TJ5A 5L3VA 4OIOF 1TWGA 2YVKA 1O87A 3EZHA 1EI7A 1D1CA 1ZU4A 3IEEA 4I44A 5A6BD 1JAFA 1ZHZA 4MVOA 3JT1A 4XLPF 3RYLA 2J0XA 3ABLC 4Z9HA 3TOMA 4PACA 1BBHA 3U9JA 2JX0A 1WN0A 1AVOB 3DXJF 3AQBA 3LNMB 1YZAA 3I5QA 5A6BA 1OXBA 2KSFA 1ZZPA 3FHDA 4EWCA 2C03A 3VYWA 4Q4ZF 3E70C 2XL8A 1AUEA 3DM5A 4CX9A 1YARO 3AG3C 3I5PA 4ONSA 2JD3A 2PFDA 1OCCC 1SF8A 3B29A 3DAGA 3EG9A 3C7JA 2IXOA 3L34A 3L8IA 1FMWA 4MW8A 3NRHA 2YRFA 5L0FA 5AC4A 2HMQA 3RH3A 4LDRA 1M56C 4PJJA 3M4BA 2LIGA 5L0JA 4GEHA 1QPUA 4XEKA 2P6VA 3IQTA 3QVZA 1L3PA 4YT8A 3EH1A 3B0PA 1V55C 2YLGA 1YZCA 3IHUA 1ORJA 2UUIA 3ZQYA 4LACB 3S29A 1M2VA 4PJNA 4LERA 3FAPB 4AE4A 1RXQA 2ZD9A 4PJMA 2NG1A 2P1AA 4CS9C 1YDIA 4J7YA 3MLGA 5JT4A 5FZTA 1LKXA 2QLAA 5B3IA 3MYIA 2ZXRA 1PD1A 2WZGA 1U0BB 2QE9A 2R03A 2L6HA 4E0IA 3ABMC 4MVSA 4P9FA 4U5DE 2HV6A 3HTKC 3OWTA 3V7OA 1BR4A 2WZLA 3QZCA 1D0ZA 4J32B 4KI2A 1K05A 4MTGA 4W8PA 4Z9JA 3SXKA 3V5ZA 4G7HF 4QI2A 4EUKB 5COGA 2I8BA 2LCHA 2J9WA 2MYSA 1YYJA 5A6KA 5KYXA 4E0HA 5HSWA 1R4TA 4KNWA 3GANA 3RIPA 4MNDA 3VRCA 4HFFB 1TWCA 4JKVA 2LD6A 5E3CA 3M79A 3ZWIA 3EJNA 4BEMJ 2VCAA 2Q9AA 2R7UA 4E7ZA 3SZRA 2LK4A 4HEAJ 2OKUA 3CSKA 2R7OA 5D92A 2O9XA 2R7TA 4YL1A 2XM0A 2PX3A 2WL8A 3U3FA 2M4EA 3PDMP 1ZVZA 3RVYA 4DRHB 1G5ZA 1Q0GA 4C7OB 5F28E 1LE4A 3NYMA 4JIOA 4QDLA 3O39A 5A6JA 1Y4CA 1RCPA 1ORYA 2I15A 1M57C 2G3KA 3GEEA 1WOLA 1DOWA 4MTFA 2ZXWC 2B0HA 3EPVA 4MW3A 3K7DA 4OD5A 3RQGA 2L9JA 2DYRC 2XL6A 1Z6AA 4GYTA 5HV9A 5DQZA 1YA7O 3LLKA 2P0NA 3C8GD 3KYJA 3T9OA 1WATA 2ASRA 1WTYA 3NMJA 4OIQF 3L8JA 4OIPF 3NMIA 2GFHA 2P7VA 3C63A 4XLNF 2L6GA 2G3VA 1OQCA 2PX0A 4MVQA 1HE9A 3DD7A 2KGOA 3OA1A 3ZTMA 5L0IA 3C8GA 4JTDB 1KNYA 3E9VA 4G7OF 3C18A 4IGGA 2WZFA 1TQGA 1PCXA 1LS4A 2DYSC 3TULA 2EIJC 1Z5ZA 5FCLA 4DBQA 1D1BA 4BJ6A 2ZXOA 5BQGA 1K40A 2PP4A 3US6A 3ZC4A 4O6YA 4CDAA 3V5XA 1UFBA 5BUOA 4Q5SF 2MWQA 1LI5A 2YL3A 3T6BA 3RQEA 2R9RB 4CSAC 256BA 3F46A 1QZXA 3L1MA 3UMHA 1RMVA 2Q7RA 1I4YA 2AP3A 1OKKA 2PF4E 2VH3A 4BEJA 1SYQA 1FTSA 4NC3A 5JLIA 4B6IA 1WWPA 4AX2A 3AGTA 3HNLA 3H65A 1C02A 3G4ZA 1NG1A 2B0JA 2DGJA 4H4KC 2A1DD 1RJ9B 1NFNA 4JCHA 3AGUA 4JTAB 2XLMA 4YK5A 4N4WA 2H7BA 4G78A 3K66A 5AC5A 3FVYA 2L81A 4IAOA 5KYWB 4XQ1A 2J45A 3DAFA 5EHHA 2YKZA 4NTBA 1M6TA
chains in the Genus database with same CATH topology
2AWYA 1HMOA 2HMQA 4XPXA 4XPYA 1A7EA 2AVKA 2AWCA 1HMDA 1I4YA 1I4ZA 3WAQA 3AGTA 3AGUA 2MHRA 4XPWA 1A7DA 4XQ1A 3WHNA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWY A;  1HMO A;  2HMQ A;  4XPX A;  4XPY A;  1A7E A;  2AVK A;  2AWC A;  1HMD A;  1I4Y A;  1I4Z A;  3WAQ A;  3AGT A;  3AGU A;  2MHR A;  4XPW A;  1A7D A;  4XQ1 A;  3WHN A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 4OIN F;  2OJE D;  4JW1 A;  1G8X A;  2WVQ A;  4CDY A;  5JUA A;  3H2V A;  3ZTZ A;  1F1M A;  3MYF A;  2WB7 A;  4N6H A;  4PK4 A;  2GA0 A;  1CGO A;  1OW8 A;  2IM8 A;  1R5I D;  2M64 A;  1ZHX A;  1MMN A;  2VCB A;  3G4X A;  4FWV A;  4DJ9 A;  3FOP A;  3ASN C;  4I3M A;  2YQY A;  1E86 A;  1NU7 D;  1YVI A;  1MMG A;  1MNE A;  3DJU B;  4NY3 A;  4MVZ A;  3VAY A;  4BJ1 A;  1FAP B;  3ZVR A;  3DKA A;  4U5E E;  2NUP B;  1VOM A;  4A2N B;  1VLT A;  4KNV A;  3N24 A;  4QI0 A;  1FR0 A;  3LS0 A;  5EGY A;  2VC9 A;  3U2M A;  1OR2 A;  2CW0 F;  2MHR A;  1BR2 A;  2Q00 A;  2CDQ A;  2Q3T A;  3QW0 A;  2XSE A;  2HV7 A;  2V26 A;  1W2W A;  3K1H A;  3HKK A;  5EK0 A;  3EGD B;  2J9V A;  2P61 A;  3PCV A;  1GGQ A;  1EA8 A;  2HUJ A;  3JYH A;  2R7S A;  1TR2 A;  2BL2 A;  1KU2 A;  3FOO A;  2OCC C;  5GPG B;  5JS5 A;  2OEX A;  2A6H F;  3HLZ A;  1H9G A;  1LM3 B;  4YL0 A;  3M4C A;  1A7E A;  2AVK A;  1GS9 A;  2GAQ A;  3LJB A;  2AWC A;  2XM4 A;  4PJL A;  4OIR F;  3Q7L A;  5L0G A;  1E84 A;  1WAS A;  3RKO F;  2R02 A;  4JE9 A;  1JMW A;  1G4U S;  1E85 A;  1NFO A;  2J7P D;  1OW7 A;  3ABK C;  5DLJ A;  4PR9 A;  3EZI A;  2HS5 A;  1APC A;  1D0X A;  1ZW2 A;  5JP7 A;  4U5G A;  1G4W R;  3CQZ A;  5DQT A;  3WHN A;  3RF3 A;  2J7P A;  3DMD A;  5CIV A;  3W8I A;  3GOR A;  4I1O B;  2AWY A;  4CBE A;  4C7O A;  4LLE A;  4UDV A;  3JTL O;  1YYX A;  4ER9 A;  2YHS A;  3U0C A;  3I4U A;  3SNH A;  3FDQ A;  2L7A A;  5DS5 A;  1XZQ A;  4WGY A;  2LFF A;  2RD9 A;  2HSB A;  2QUP A;  4Q7C A;  3GM2 A;  2XLH A;  3NYL A;  3TJ6 A;  2J9U A;  3IQC A;  2C04 A;  5T3W A;  4CDV A;  2IBF A;  3KPH A;  2CYD A;  2JPU A;  1HMD A;  3S28 A;  1I5N A;  4C3B A;  4L6R A;  4J30 B;  5D91 A;  3NMK A;  4X0R A;  1T9K A;  2LP4 A;  3R7C A;  3SXZ A;  3X1O A;  3PHF 2;  3GOD A;  4JCZ A;  4XEV A;  1VYK A;  3A9C A;  2XLV A;  2FFH A;  3ATP A;  3JRT A;  3U9M A;  4U5C E;  4CIH A;  1MQV A;  1V74 B;  2KC3 A;  3MFN A;  4N6C A;  1MMD A;  4IJJ A;  2G62 A;  4MS2 A;  4XPW A;  1IW7 F;  2EIK C;  1AEP A;  2NUT A;  3RW0 A;  3SXM A;  2Q9B A;  2KJG A;  5BQI A;  4AL0 A;  2A68 F;  3G50 A;  2W4M A;  5KYY A;  3UMK A;  5COM A;  3DI5 A;  3WG7 C;  4CS8 A;  5F5F A;  1T6U A;  2R25 A;  3AG1 C;  3QMK A;  4R32 A;  5A69 A;  2W4B A;  4KC9 A;  2XLO A;  3UNG C;  3FMS A;  3F47 A;  1NLX A;  3WOD F;  3JZ0 A;  4MVU A;  1OCR C;  4WAB A;  2H7V C;  3LEO A;  4Z9I A;  1Q0F A;  4OD4 A;  3U2L A;  4E18 A;  4O6N A;  2YWA A;  4ULV A;  1Z7Q c;  4ZLD A;  4M63 A;  4N06 A;  1RJ9 A;  3HNK A;  1E83 A;  3DM9 B;  4BJ6 C;  4XTK A;  3FXH A;  4YL3 A;  3ASO C;  3EFO B;  5KYW A;  3TK0 A;  1FFT C;  2YL7 A;  4CS7 A;  4BJ5 A;  3DE9 A;  4LLC A;  5L3Q A;  2EIM C;  1A0B A;  2HMZ A;  1DOV A;  3C62 A;  5CI9 A;  2TMV P;  3B0V C;  1LPE A;  3AG2 C;  2PBE A;  1EKY A;  4EIY A;  2NUT B;  1HMO A;  3QW1 A;  3VF0 A;  1T6Q A;  5L0C A;  1FNT c;  3AG4 C;  4EKW A;  1H9T A;  2A69 F;  1D1A A;  2RSE B;  3AJM A;  4MVM A;  1JR8 A;  3MBG A;  5KYY B;  4U5B E;  3S84 A;  1QQ3 A;  1BDJ B;  1YLM A;  2D4U A;  2KQ9 A;  2X51 A;  3TD7 A;  2XS1 A;  2NUP A;  1CGM E;  2KK1 A;  3U8P A;  3V5Y A;  3O6X A;  4DVZ A;  2GDC A;  2XLE A;  1BR1 A;  1K04 A;  3KYI A;  1OXK A;  4O7G A;  1ZHT A;  2CGE A;  4HFK B;  2YLD A;  4RD9 A;  3NDB B;  2LQG A;  4K7B A;  4BJT A;  5KYN A;  3EGD A;  3TOL A;  2EPO A;  3VM6 A;  1ZU5 A;  3A11 A;  2HJM A;  3CEX A;  3EHM A;  3NKD A;  3RFY A;  3O55 A;  4YWQ A;  1J8Y F;  3GWN A;  3K1I A;  3KMI A;  3M1C B;  2BC5 A;  4JVS A;  3ZQV A;  3NG1 A;  4EHP A;  2XL4 A;  1KTM A;  2FGY A;  5T1D B;  1TKN A;  3NKE A;  1T6I A;  2R7W A;  1VTM P;  1LS1 A;  3RVZ A;  5B1B C;  4XPY A;  1E2X A;  5L0D A;  2KYH A;  3H2U A;  1SR2 A;  3LLI A;  3M15 A;  4ZLC A;  4U9D A;  4P6I C;  2IOQ A;  2Y69 C;  2Y3G A;  3UGO A;  2EIN C;  3N2Z B;  4ANJ A;  2DB4 A;  1TWH A;  1RKE B;  1I4Z A;  2OEV A;  1M2O A;  2XLD A;  1T01 A;  3AOU A;  3JSE O;  4XEF A;  3T4R A;  3GWL A;  3LS1 A;  3MX3 A;  4JJG A;  2HSQ A;  2KW3 C;  1H6G A;  1LI7 A;  4JRZ A;  2J0W A;  3ECS A;  3O10 A;  4RBN A;  3KL4 A;  3Q7G A;  5E2Q A;  2KNH A;  5DS6 A;  3BEH A;  1TWA A;  2DI3 A;  2J46 A;  3JYY A;  3EQL F;  3AQC A;  4J7T A;  4D4X A;  2GWW A;  3U3B A;  4AL1 A;  4I1M A;  2QTV A;  3KH2 A;  1FFH A;  1ST6 A;  2EPM X;  4DRI B;  4F4B A;  3ZIB A;  5DS4 A;  2ICW G;  4JUR I;  5JRA A;  2VB6 A;  4FAP B;  1O5H A;  4W8K A;  2OU6 A;  4MTO A;  5COF A;  5KYU B;  1SMY F;  4DRJ B;  2XXA B;  2V3C C;  2HFI A;  3HJC A;  1HE1 A;  4HE8 D;  1IZM A;  4EBB A;  1CPQ A;  4PFO A;  2VCC A;  4JZA A;  3WAQ A;  3DE8 A;  1LE2 A;  3X2Q C;  2FAP B;  1UG7 A;  1HW2 A;  4CJG A;  2Q4F A;  3EGX B;  3GM1 A;  3IPM O;  1C17 M;  2IXP A;  5BQH A;  3IQ5 A;  2PNO A;  2AU5 A;  4D4N A;  5B3S C;  2VAS A;  3POV A;  3RQF A;  2OJQ A;  2NSG A;  2OOC A;  3ZSU A;  5L0H A;  3SP1 A;  1XZP A;  1JRA A;  4XPX A;  1GQA A;  2NPU A;  2XLW A;  3GM3 A;  3K33 A;  3OEO A;  4XWJ A;  3CAX A;  5JSL A;  1LIH A;  5E3A A;  1ZHY A;  1U6H A;  2A0B A;  3ITF A;  4LDK A;  1VK5 A;  1XWJ A;  4U5H A;  3KKB A;  4BPM A;  2W45 A;  3S90 A;  1JPJ A;  4WJ0 A;  3EFO A;  4YT4 A;  4RDA A;  2CCY A;  4CS8 C;  2R7V A;  4MQ9 F;  2LSE A;  4JC7 A;  4BG0 A;  2J9B A;  4JJF A;  4C3D A;  2R7R A;  3GEH A;  3L0I A;  2IXN A;  1OCO C;  2ZXP A;  3BRJ A;  2YEV A;  3W2V A;  4AK9 A;  2OQM A;  1A7D A;  4FES A;  3EHN A;  3FAJ A;  4NQF A;  5IY5 C;  4DOZ A;  2Y3B A;  1PV3 A;  2H8A A;  2H7O A;  1JOG A;  3EG9 B;  3GEI A;  4NTF A;  1OW6 A;  3QVY A;  3W8H A;  2L6F A;  2Y3H A;  1QLE C;  1H7I A;  1O3U A;  3HNJ A;  1NU9 C;  2A6E F;  5TJ5 E;  1Z23 A;  4U5F E;  4BJ5 C;  3U8V A;  4CS9 A;  5F5H A;  1OR3 A;  1RKC A;  2Z15 A;  3R2P A;  1Y6D A;  2EPL X;  4DBR A;  4IAQ A;  3LNR A;  2QY9 A;  5B1A C;  4DVY P;  1VLS A;  2EPN A;  1JPN A;  2IXM A;  3LES A;  4G7Z F;  1NBB A;  1TFO B;  4P9T A;  2NSF A;  3ZG1 A;  1QKR A;  4C3E A;  1YA9 A;  4NCQ A;  3N0T A;  3S27 A;  1M2V B;  4YN0 B;  5DVW A;  3SEO A;  4YJW A;  3UR3 C;  2Q9C A;  2YL0 A;  2D5R B;  4JTC B;  4AE4 B;  4A4A A;  4EBK A;  4E7S A;  1OCZ C;  1FMV A;  1QVX A;  4NTA A;  3HNI A;  4WGZ A;  5JVE A;  5K0I A;  2XRH A;  4KBL A;  4ULW A;  1L7C A;  3TQO A;  1MMA A;  4IB4 A;  1GM5 A;  2UUH A;  1VYI A;  2IYL D;  4EBJ A;  4JEA A;  4O6M A;  4YT2 A;  3J06 A;  2F22 A;  1D0Y A;  3B9Q A;  2ZPA A;  3EH2 A;  3K1I C;  1RKE A;  1MND A;  1ORS C;  1S05 A;  2EIL C;  1YJG A;  1A41 A;  2W9Y A;  3IQ6 A;  3LAY A;  1LVK A;  4O79 A;  1ZHW A;  2XS8 A;  1TFK B;  4K1O A;  4PFP A;  1EQ1 A;  4LDQ A;  5KYX B;  3CZ6 A;  1CGN A;  5T3T A;  2ETS A;  1T5O A;  1C03 A;  4G0H A;  4E17 A;  2BE5 F;  2HKV A;  4JEB A;  4H54 A;  2R7X A;  1WGW A;  3T6J A;  4GQH A;  1VB5 A;  2HJ3 A;  4YT5 A;  3W4Y A;  1V54 C;  1N1C A;  1U89 A;  1HW1 A;  2A0U A;  5CI8 A;  1OKK D;  5A6A A;  2Y3D A;  3B71 A;  3JSZ A;  2CNW D;  1Q0M A;  2LFD A;  2E87 A;  3UGP A;  2WVO A;  5KYU A;  1BZ4 A;  3LEV A;  1NZE A;  4U9E A;  3W2W A;  2XXA A;  2HZ8 A;  3U5S A;  3QTH A;  2WVN A;  3NYJ A;  2OG2 A;  2QNL A;  5AGF A;  1Q0K A;  5E33 A;  3JCU Q;  1NSG B;  3B0U X;  1S7Z A;  1J8M F;  3DZA A;  1ZYR F;  4IWB A;  1Z63 A;  1CPR A;  2CNW A;  3C8Z A;  3S9O A;  4FX5 A;  2YZS A;  1V4A A;  2R05 A;  2X0C A;  3S0X A;  1VMA A;  3Q6N A;  3EGX A;  3SXY A;  3DWW A;  1B68 A;  1HY5 A;  3UMI A;  1SZI A;  2R7Q A;  3LUT B;  3PMR A;  4MVR A;  1PD0 A;  1Z3I X;  1A7V A;  2Y39 A;  4IAR A;  4CSA A;  2EPK X;  4CJO A;  2YL1 A;  4CIP A;  2J8W A;  1YAU O;  4K0D A;  3JRM O;  4IRU A;  2YLI A;  3ZDL A;  4DXW A;  1Q0D A;  1ZW3 A;  1QSP A;  3C8G B;  3SYN A;  3DJN B;  3K6B A;  3Q6M A;  3T6G B;  3TJ5 A;  5L3V A;  4OIO F;  1TWG A;  2YVK A;  1O87 A;  3EZH A;  1EI7 A;  1D1C A;  1ZU4 A;  3IEE A;  4I44 A;  5A6B D;  1JAF A;  1ZHZ A;  4MVO A;  3JT1 A;  4XLP F;  3RYL A;  2J0X A;  3ABL C;  4Z9H A;  3TOM A;  4PAC A;  1BBH A;  3U9J A;  2JX0 A;  1WN0 A;  1AVO B;  3DXJ F;  3AQB A;  3LNM B;  1YZA A;  3I5Q A;  5A6B A;  1OXB A;  2KSF A;  1ZZP A;  3FHD A;  4EWC A;  2C03 A;  3VYW A;  4Q4Z F;  3E70 C;  2XL8 A;  1AUE A;  3DM5 A;  4CX9 A;  1YAR O;  3AG3 C;  3I5P A;  4ONS A;  2JD3 A;  2PFD A;  1OCC C;  1SF8 A;  3B29 A;  3DAG A;  3EG9 A;  3C7J A;  2IXO A;  3L34 A;  3L8I A;  1FMW A;  4MW8 A;  3NRH A;  2YRF A;  5L0F A;  5AC4 A;  2HMQ A;  3RH3 A;  4LDR A;  1M56 C;  4PJJ A;  3M4B A;  2LIG A;  5L0J A;  4GEH A;  1QPU A;  4XEK A;  2P6V A;  3IQT A;  3QVZ A;  1L3P A;  4YT8 A;  3EH1 A;  3B0P A;  1V55 C;  2YLG A;  1YZC A;  3IHU A;  1ORJ A;  2UUI A;  3ZQY A;  4LAC B;  3S29 A;  1M2V A;  4PJN A;  4LER A;  3FAP B;  4AE4 A;  1RXQ A;  2ZD9 A;  4PJM A;  2NG1 A;  2P1A A;  4CS9 C;  1YDI A;  4J7Y A;  3MLG A;  5JT4 A;  5FZT A;  1LKX A;  2QLA A;  5B3I A;  3MYI A;  2ZXR A;  1PD1 A;  2WZG A;  1U0B B;  2QE9 A;  2R03 A;  2L6H A;  4E0I A;  3ABM C;  4MVS A;  4P9F A;  4U5D E;  2HV6 A;  3HTK C;  3OWT A;  3V7O A;  1BR4 A;  2WZL A;  3QZC A;  1D0Z A;  4J32 B;  4KI2 A;  1K05 A;  4MTG A;  4W8P A;  4Z9J A;  3SXK A;  3V5Z A;  4G7H F;  4QI2 A;  4EUK B;  5COG A;  2I8B A;  2LCH A;  2J9W A;  2MYS A;  1YYJ A;  5A6K A;  5KYX A;  4E0H A;  5HSW A;  1R4T A;  4KNW A;  3GAN A;  3RIP A;  4MND A;  3VRC A;  4HFF B;  1TWC A;  4JKV A;  2LD6 A;  5E3C A;  3M79 A;  3ZWI A;  3EJN A;  4BEM J;  2VCA A;  2Q9A A;  2R7U A;  4E7Z A;  3SZR A;  2LK4 A;  4HEA J;  2OKU A;  3CSK A;  2R7O A;  5D92 A;  2O9X A;  2R7T A;  4YL1 A;  2XM0 A;  2PX3 A;  2WL8 A;  3U3F A;  2M4E A;  3PDM P;  1ZVZ A;  3RVY A;  4DRH B;  1G5Z A;  1Q0G A;  4C7O B;  5F28 E;  1LE4 A;  3NYM A;  4JIO A;  4QDL A;  3O39 A;  5A6J A;  1Y4C A;  1RCP A;  1ORY A;  2I15 A;  1M57 C;  2G3K A;  3GEE A;  1WOL A;  1DOW A;  4MTF A;  2ZXW C;  2B0H A;  3EPV A;  4MW3 A;  3K7D A;  4OD5 A;  3RQG A;  2L9J A;  2DYR C;  2XL6 A;  1Z6A A;  4GYT A;  5HV9 A;  5DQZ A;  1YA7 O;  3LLK A;  2P0N A;  3C8G D;  3KYJ A;  3T9O A;  1WAT A;  2ASR A;  1WTY A;  3NMJ A;  4OIQ F;  3L8J A;  4OIP F;  3NMI A;  2GFH A;  2P7V A;  3C63 A;  4XLN F;  2L6G A;  2G3V A;  1OQC A;  2PX0 A;  4MVQ A;  1HE9 A;  3DD7 A;  2KGO A;  3OA1 A;  3ZTM A;  5L0I A;  3C8G A;  4JTD B;  1KNY A;  3E9V A;  4G7O F;  3C18 A;  4IGG A;  2WZF A;  1TQG A;  1PCX A;  1LS4 A;  2DYS C;  3TUL A;  2EIJ C;  1Z5Z A;  5FCL A;  4DBQ A;  1D1B A;  4BJ6 A;  2ZXO A;  5BQG A;  1K40 A;  2PP4 A;  3US6 A;  3ZC4 A;  4O6Y A;  4CDA A;  3V5X A;  1UFB A;  5BUO A;  4Q5S F;  2MWQ A;  1LI5 A;  2YL3 A;  3T6B A;  3RQE A;  2R9R B;  4CSA C;  256B A;  3F46 A;  1QZX A;  3L1M A;  3UMH A;  1RMV A;  2Q7R A;  1I4Y A;  2AP3 A;  1OKK A;  2PF4 E;  2VH3 A;  4BEJ A;  1SYQ A;  1FTS A;  4NC3 A;  5JLI A;  4B6I A;  1WWP A;  4AX2 A;  3AGT A;  3HNL A;  3H65 A;  1C02 A;  3G4Z A;  1NG1 A;  2B0J A;  2DGJ A;  4H4K C;  2A1D D;  1RJ9 B;  1NFN A;  4JCH A;  3AGU A;  4JTA B;  2XLM A;  4YK5 A;  4N4W A;  2H7B A;  4G78 A;  3K66 A;  5AC5 A;  3FVY A;  2L81 A;  4IAO A;  5KYW B;  4XQ1 A;  2J45 A;  3DAF A;  5EHH A;  2YKZ A;  4NTB A;  1M6T A; 
#chains in the Genus database with same CATH homology
 2AWY A;  1HMO A;  2HMQ A;  4XPX A;  4XPY A;  1A7E A;  2AVK A;  2AWC A;  1HMD A;  1I4Y A;  1I4Z A;  3WAQ A;  3AGT A;  3AGU A;  2MHR A;  4XPW A;  1A7D A;  4XQ1 A;  3WHN A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...