4XQ1A

Crystal structure of hemerythrin: l114a mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
131
structure length
131
Chain Sequence
b'MALMTWTAAEFGTNVGFADDQHKTIFDMVNKLHDTAATGNRSEIGKQLDALIDYVVMHFKSEETEMQKKGYADFAAHKAEHDKLVGVCADLQKKFHAGEAEVNQDTTRFVRDWAVNHIPKVDKLYGPCLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriohemerythrin
publication title The bacteriohemerythrin from Methylococcus capsulatus (Bath): Crystal structures reveal that Leu114 regulates a water tunnel.
pubmed doi rcsb
molecule tags Oxygen binding protein
total genus 58
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 4xq1A00
1I4YA 2MHRA 4XQ1A 1A7EA 1HMDA 1I4ZA 2HMZA 1HMOA 4XPYA 1A7DA 3WHNA 4XPWA 2HMQA 2AVKA 3AGUA 3AGTA 3WAQA 2AWCA 2AWYA 4XPXA
chains in the Genus database with same CATH superfamily
1YARO 4DRIB 5HV9A 4NC3A 2V3CC 2I15A 3DAGA 2R7TA 1MNDA 1LI5A 1NU7D 1V55C 3ZVRA 5BQIA 3GEHA 5GPGB 1O5HA 2I8BA 2IXPA 1C02A 1D1AA 2QUPA 5DQTA 1OXBA 3CQZA 1D0ZA 3T9OA 2P0NA 2HUJA 3LJBA 3NMIA 2J45A 4N06A 3GM2A 3AG2C 1F1MA 2L6HA 2YRFA 4K1OA 1FFTC 4CDVA 3KKBA 4YT8A 3B0VC 4LLEA 1OW6A 2EIMC 3JRTA 4CS7A 5CI9A 1FAPB 3UMKA 5E3AA 1QPUA 2YEVA 2LSEA 2J8WA 4A4AA 4DRJB 5KYUA 1O87A 2HSBA 3O6XA 1WASA 1C03A 2OKUA 1JAFA 4ZLCA 1MMNA 3LS0A 3LLKA 1I4YA 1A41A 4E7ZA 2BE5F 3SXYA 2R25A 1SF8A 1RXQA 3NMKA 3ZWIA 3DKAA 3S0XA 1U0BB 2EPKX 4H4KC 3SZRA 4JIOA 3ZTMA 2EIJC 3DM5A 4YT5A 4BEMJ 4Z9JA 3MBGA 3EG9A 1OR3A 2KW3C 4MS2A 1E2XA 4XTKA 1Z6AA 2QNLA 3T6GB 3Q7LA 3TQOA 2EPMX 5A6JA 3N0TA 3C8GB 4U5BE 2W4BA 1SMYF 1EA8A 2KGOA 3VYWA 4AE4A 4BJ6A 3JRMO 1YA7O 1RCPA 3JT1A 4GYTA 5E33A 5HSWA 1J8MF 4IB4A 1H9GA 2Q4FA 1SYQA 2XLWA 1ZHXA 3NYJA 2AWCA 1LS4A 1ORSC 1ZW2A 2EPLX 2XL8A 4JEBA 2Y69C 4EWCA 3LS1A 3IPMO 3ASOC 4QDLA 4OD5A 2J46A 3H65A 3GEIA 3PCVA 3TJ5A 4BJ1A 5JVEA 5KYNA 1JOGA 1RKCA 1ZHZA 2R7RA 3G4XA 1RKEB 3DJUB 2IM8A 4GEHA 5JT4A 3I5PA 1TFOB 2CCYA 4RDAA 3U5SA 1A7EA 4I1MA 4MVUA 3EZIA 4E0IA 1R5ID 5B3IA 1Q0FA 3TK0A 1OCCC 4G0HA 1QKRA 3RW0A 2XS1A 2RSEB 3DMDA 3JYHA 2OEXA 1BR2A 2GAQA 1Z63A 1LIHA 1V54C 3X2QC 2Y3DA 4DXWA 2NSGA 5E3CA 2IYLD 3T6BA 2Y39A 1OCOC 3EGDA 3RQFA 4MVZA 3UGPA 2O9XA 2HS5A 3CSKA 2LD6A 1M56C 2PBEA 4AL1A 2ZPAA 2H7BA 2Y3GA 2MHRA 3QW1A 1NU9C 3VM6A 3GWLA 3VF0A 3Q6NA 4E7SA 4P9TA 2GWWA 5DS6A 4YN0B 1MNEA 2H7OA 2DYSC 4JCHA 3GWNA 5E2QA 2VCCA 2X0CA 2J7PD 2XS8A 2E87A 3DAFA 2EINC 3Q6MA 5D91A 4KI2A 1RMVA 1E86A 3FDQA 1RJ9B 3NMJA 3FAJA 2A0UA 5AGFA 3S29A 2FGYA 4JVSA 3U3FA 1E83A 1NBBA 1CGOA 3LAYA 3RFYA 1GS9A 5JRAA 3SXZA 2HV7A 2WZLA 3V7OA 4U9DA 3EFOB 4G7ZF 3SP1A 1DOWA 1WATA 4YL1A 1QVXA 3EH1A 2AU5A 3L34A 3FHDA 1K04A 1LPEA 2Q9AA 4W8PA 2R7UA 4MTFA 4G7HF 4CSAC 1ZZPA 4IRUA 2P61A 2IXOA 2OJED 1JMWA 5DVWA 3PMRA 5JS5A 1PCXA 1MMAA 4LERA 4ULWA 2KNHA 2V26A 2ZXOA 3ASNC 1QLEC 5A6BA 2HSQA 5KYWB 2TMVP 4O6YA 1L3PA 5BQHA 4B6IA 1LS1A 4NCQA 3TULA 4PJJA 3MYFA 1CPQA 2R7OA 4K7BA 4R32A 3V5XA 3PHF2 3SYNA 1CGME 4FESA 5JLIA 1FFHA 5EK0A 4I44A 1BR1A 3OWTA 4XLNF 3B0PA 3E70C 1PV3A 1HE1A 3C62A 4YWQA 4NTBA 4FWVA 4OD4A 4MVRA 3ITFA 1A0BA 3DI5A 4XEKA 5F5HA 3LNRA 1YZCA 1Z5ZA 2LCHA 4DRHB 3RVYA 3JSEO 4EIYA 2OQMA 2VC9A 1MQVA 3B71A 2HZ8A 4CIHA 4E0HA 1R4TA 4C3EA 4PJNA 2XL6A 3LEOA 3HLZA 2PNOA 2L6FA 3A9CA 4ZLDA 3EGXB 1TWHA 1T9KA 3A11A 2R7XA 5TJ5E 1YAUO 4LDQA 3X1OA 2F22A 3RQGA 1J8YF 3B0UX 5EHHA 2EIKC 2KJGA 1C17M 1M2VB 5BQGA 1NLXA 2YZSA 2XSEA 1AUEA 3EPVA 4YJWA 1NFOA 2J0XA 2Q00A 2VH3A 4Q7CA 3FOPA 1YJGA 1YA9A 5K0IA 5DS5A 1EKYA 2OJQA 2EILC 3GORA 4A2NB 2XXAA 1HMOA 2NUPB 4HE8D 4YK5A 2OEVA 2A69F 1BR4A 3V5ZA 1VLSA 4IARA 3M15A 5KYXB 4Z9IA 4HEAJ 4J7TA 3PDMP 2CNWD 1SR2A 3NG1A 1UFBA 4RD9A 1BBHA 3U3BA 2EPNA 4YT4A 2PP4A 4CSAA 2M64A 3CEXA 3QZCA 3RH3A 3UR3C 3W8IA 4OIPF 3LUTB 2DB4A 4PR9A 2H8AA 2CW0F 2XLOA 2YLIA 2Z15A 3EHMA 2EPOA 2Q9BA 3H2VA 3K1HA 3KMIA 4KBLA 3GM1A 3WODF 1CPRA 1E84A 1KTMA 3KYIA 5KYYB 2HKVA 2QE9A 3GM3A 3B9QA 1Q0KA 4WJ0A 4WGZA 2D4UA 2Q7RA 3ECSA 2C03A 1YLMA 1ZU4A 4DBRA 1A7DA 2QLAA 3NRHA 2CNWA 1ZVZA 2A68F 3EZHA 1YZAA 5IY5C 5L0GA 5T1DB 4Q5SF 4W8KA 2W9YA 4EBKA 3M79A 4BJ5A 1K40A 4U9EA 3M4BA 1T6QA 3UNGC 1I5NA 3L8IA 3W2WA 3HNKA 1CGNA 1XWJA 1TWGA 4P9FA 3ZQYA 1PD1A 3TJ6A 3JSZA 3ZQVA 2YHSA 4CBEA 1TFKB 3WG7C 2DGJA 2KK1A 5CI8A 3U8VA 4O7GA 1QSPA 4JKVA 4JW1A 1GGQA 4MNDA 3SXKA 1JRAA 1FNTc 1M2VA 5JP7A 4XEVA 2R7WA 3MLGA 1LKXA 3MX3A 2LFDA 1IW7F 4F4BA 1GM5A 4XPYA 2A6HF 2OU6A 4L6RA 5B3SC 3S84A 1S05A 3AG3C 3W2VA 1JPNA 1OW7A 1BZ4A 4CX9A 1V4AA 1OKKD 4Z9HA 1ORJA 3C8GD 1PD0A 3KYJA 4IGGA 2H7VC 1DOVA 1EI7A 1H9TA 1GQAA 1T01A 4JJFA 2PX0A 4LACB 4WABA 1M6TA 4CJOA 2OCCC 1M57C 2YL1A 3Q7GA 4IAQA 2VB6A 2A0BA 2QTVA 4KNWA 1Q0MA 4DVYP 1TR2A 2NUTB 2XM4A 1YYJA 4JEAA 1MMDA 1H6GA 4J30B 5COMA 3HNJA 5F5FA 5DQZA 2BC5A 2J9BA 3ATPA 3ABLC 4PJLA 1LI7A 3IQ5A 1QQ3A 2IXNA 4U5FE 1OKKA 1H7IA 2HV6A 3DE9A 3C8GA 3RIPA 5FCLA 4CS8A 4PFPA 2YL3A 4X0RA 1L7CA 3FXHA 3RF3A 4KNVA 4EBBA 3DWWA 1WTYA 4FX5A 1YDIA 2P1AA 2YWAA 2R03A 2D5RB 1Q0GA 1Z23A 3NYMA 1D1BA 4JTCB 3W8HA 4C7OB 3VAYA 3DJNB 1Q0DA 1FMVA 3S28A 3NKDA 4N6CA 3OEOA 3NKEA 2DI3A 2HJMA 3VRCA 5L3VA 2J7PA 3GANA 1D0YA 2GFHA 1T6IA 1AVOB 1WWPA 4P6IC 3K7DA 1RKEA 1XZPA 4MVMA 4U5CE 2WVOA 4OINF 2L7AA 1Z7Qc 4PJMA 3RQEA 1N1CA 1TQGA 4AK9A 1KNYA 4YL3A 2WVNA 4IWBA 2KYHA 3HKKA 5FZTA 2R7SA 2QY9A 4WGYA 1OCRC 2A6EF 4CIPA 3AG1C 1VLTA 2ASRA 3RVZA 3DE8A 1LE4A 1OQCA 1LE2A 2L6GA 1UG7A 2B0JA 2NSFA 4LDRA 5T3TA 1G4WR 2XL4A 3QTHA 4XWJA 1FMWA 2P6VA 5D92A 3W4YA 1V74B 3ZC4A 5L0CA 3UMHA 2OG2A 3T4RA 1WN0A 2AWYA 2YLGA 4PACA 4BJTA 4E18A 3HNLA 2Q9CA 2KC3A 3QVZA 4ONSA 4BJ5C 2ZXWC 2YL0A 2R05A 4HFFB 2XRHA 3UMIA 2UUIA 1G5ZA 2A1DD 3FMSA 3RKOF 3EG9B 4O6NA 4CS9A 1D1CA 1ZHYA 4MW8A 3QVYA 2VCBA 5A6AA 1S7ZA 4H54A 5CIVA 3U2MA 4I1OB 1EQ1A 4ER9A 2LFFA 3C7JA 5L0IA 4AE4B 3O10A 2XLDA 4HFKB 2C04A 3KL4A 4BEJA 4U5GA 3UGOA 3G4ZA 5T3WA 5L0DA 3QMKA 4OIQF 1RJ9A 4O6MA 3NDBB 2JX0A 1JPJA 5BUOA 5AC4A 5F28E 1FTSA 1LVKA 4ANJA 5EGYA 2MWQA 4C3BA 4KC9A 2XLMA 3EH2A 4JTDB 2GA0A 3EFOA 1B68A 3POVA 4FAPB 3IHUA 4OIRF 3ZG1A 3EJNA 1ORYA 4O79A 3SNHA 2CGEA 2IBFA 2PX3A 4C7OA 2UUHA 5DLJA 3S9OA 5A69A 3GODA 4MQ9F 4K0DA 3BRJA 3I4UA 2BL2A 1G8XA 1VOMA 4DBQA 4XEFA 2WL8A 3ZSUA 1WGWA 3BEHA 1I4ZA 3L1MA 3I5QA 5KYWA 3KPHA 4CDYA 5L0JA 3K6BA 1ZU5A 3ABKC 2FFHA 2YVKA 5JSLA 1W2WA 4JZAA 2LQGA 256BA 3CZ6A 2J0WA 3EGDB 3HJCA 2X51A 5B1AC 2OOCA 4U5EE 1OR2A 3WAQA 4CS8C 3U9MA 3U2LA 3TOLA 3K33A 1T6UA 2XLEA 4NQFA 4BPMA 2WZFA 3K66A 3MFNA 4PFOA 2MYSA 3T6JA 1OXKA 2LP4A 4DJ9A 1Y4CA 3EGXA 4MVSA 3B29A 4GQHA 4N6HA 4IAOA 3S27A 3O55A 4LDKA 3SEOA 4C3DA 1A7VA 2JD3A 5KYUB 1VYIA 1K05A 2WVQA 4JURI 4AL0A 5DS4A 3S90A 4JCZA 5AC5A 1BDJB 3ZDLA 1Z3IX 3DZAA 5L0HA 3K1IA 1G4US 1O3UA 1SZIA 3IQCA 3WHNA 1AEPA 1FR0A 5L0FA 2L9JA 2NUPA 3FOOA 2VCAA 4JJGA 2NPUA 4JRZA 5COFA 4NY3A 3DM9B 2R9RB 2LK4A 3AGTA 3LNMB 1U89A 3RYLA 3AQBA 5KYXA 3AOUA 3LLIA 1NZEA 2G3VA 3EHNA 4G78A 3E9VA 3JTLO 2KQ9A 5A6KA 1ZYRF 4YT2A 1D0XA 1U6HA 3U0CA 4MVQA 2CDQA 2G62A 3U8PA 1KU2A 3R2PA 3TOMA 2ETSA 4CDAA 4LLCA 4CS9C 1HE9A 3EQLF 4MTOA 1QZXA 3CAXA 2XLHA 4JC7A 5KYYA 1OCZC 2HFIA 2CYDA 3US6A 2J9WA 1HW2A 1VYKA 2Q3TA 2PF4E 2Y3HA 1VK5A 1ZHWA 1WOLA 3F46A 4EBJA 4J32B 1Y6DA 2HMQA 4Q4ZF 2YKZA 1TWCA 1VB5A 1HW1A 2HJ3A 4RBNA 4ULVA 1M2OA 1VMAA 3LEVA 4DVZA 3M4CA 1NSGB 2G3KA 4D4NA 3DXJF 1IZMA 3R7CA 1E85A 3AJMA 3DD7A 3JZ0A 4BG0A 3SXMA 2IOQA 3FAPB 4UDVA 2YQYA 1YVIA 2AP3A 2KSFA 2NG1A 4M63A 4U5HA 1LM3B 2XLVA 3IQ6A 4XQ1A 4E17A 5A6BD 1MMGA 5L3QA 2XXAB 3HNIA 2DYRC 3QW0A 3JYYA 3ZIBA 5B1BC 3U9JA 2HMZA 4G7OF 2L81A 3HTKC 4PK4A 3KH2A 3TD7A 3V5YA 4QI0A 2R7QA 3ABMC 3AG4C 3C8ZA 4OIOF 1YYXA 4J7YA 2ZXPA 4MVOA 2FAPB 4YL0A 1JR8A 4QI2A 1TWAA 3O39A 3G50A 4IJJA 2VASA 4MTGA 2YL7A 4D4XA 4CJGA 4EHPA 2XM0A 3L8JA 2ICWG 3F47A 1OW8A 3IEEA 4EUKB 4AX2A 1HY5A 2W4MA 1ZW3A 4I3MA 3OA1A 1NG1A 1NFNA 3MYIA 1ST6A 3N2ZB 4XLPF 2Y3BA 3N24A 2LIGA 2R7VA 3J06A 2JPUA 4N4WA 2YLDA 3H2UA 1HMDA 2WB7A 3IQTA 3M1CB 3NYLA 3FVYA 2PFDA 2GDCA 3C63A 2NUTA 2R02A 2WZGA 3AQCA 3C18A 5COGA 4U5DE 1ZHTA 4DOZA 2W45A 1T5OA 2M4EA 2ZD9A 3GEEA 2ZXRA 4EKWA 1VTMP 4XPWA 2RD9A 2IXMA 4BJ6C 2J9UA 3K1IC 2B0HA 3L0IA 3JCUQ 2AVKA 3AGUA 4NTFA 1APCA 1XZQA 4JTAB 2P7VA 4NTAA 3LESA 2J9VA 4MW3A 4JE9A 3ZTZA 1TKNA 5JUAA 4XPXA
chains in the Genus database with same CATH topology
1I4YA 2MHRA 4XQ1A 1A7EA 1HMDA 1I4ZA 2HMZA 1HMOA 4XPYA 1A7DA 3WHNA 4XPWA 2HMQA 2AVKA 3AGUA 3AGTA 3WAQA 2AWCA 2AWYA 4XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Y A;  2MHR A;  4XQ1 A;  1A7E A;  1HMD A;  1I4Z A;  2HMZ A;  1HMO A;  4XPY A;  1A7D A;  3WHN A;  4XPW A;  2HMQ A;  2AVK A;  3AGU A;  3AGT A;  3WAQ A;  2AWC A;  2AWY A;  4XPX A; 
#chains in the Genus database with same CATH topology
 1YAR O;  4DRI B;  5HV9 A;  4NC3 A;  2V3C C;  2I15 A;  3DAG A;  2R7T A;  1MND A;  1LI5 A;  1NU7 D;  1V55 C;  3ZVR A;  5BQI A;  3GEH A;  5GPG B;  1O5H A;  2I8B A;  2IXP A;  1C02 A;  1D1A A;  2QUP A;  5DQT A;  1OXB A;  3CQZ A;  1D0Z A;  3T9O A;  2P0N A;  2HUJ A;  3LJB A;  3NMI A;  2J45 A;  4N06 A;  3GM2 A;  3AG2 C;  1F1M A;  2L6H A;  2YRF A;  4K1O A;  1FFT C;  4CDV A;  3KKB A;  4YT8 A;  3B0V C;  4LLE A;  1OW6 A;  2EIM C;  3JRT A;  4CS7 A;  5CI9 A;  1FAP B;  3UMK A;  5E3A A;  1QPU A;  2YEV A;  2LSE A;  2J8W A;  4A4A A;  4DRJ B;  5KYU A;  1O87 A;  2HSB A;  3O6X A;  1WAS A;  1C03 A;  2OKU A;  1JAF A;  4ZLC A;  1MMN A;  3LS0 A;  3LLK A;  1I4Y A;  1A41 A;  4E7Z A;  2BE5 F;  3SXY A;  2R25 A;  1SF8 A;  1RXQ A;  3NMK A;  3ZWI A;  3DKA A;  3S0X A;  1U0B B;  2EPK X;  4H4K C;  3SZR A;  4JIO A;  3ZTM A;  2EIJ C;  3DM5 A;  4YT5 A;  4BEM J;  4Z9J A;  3MBG A;  3EG9 A;  1OR3 A;  2KW3 C;  4MS2 A;  1E2X A;  4XTK A;  1Z6A A;  2QNL A;  3T6G B;  3Q7L A;  3TQO A;  2EPM X;  5A6J A;  3N0T A;  3C8G B;  4U5B E;  2W4B A;  1SMY F;  1EA8 A;  2KGO A;  3VYW A;  4AE4 A;  4BJ6 A;  3JRM O;  1YA7 O;  1RCP A;  3JT1 A;  4GYT A;  5E33 A;  5HSW A;  1J8M F;  4IB4 A;  1H9G A;  2Q4F A;  1SYQ A;  2XLW A;  1ZHX A;  3NYJ A;  2AWC A;  1LS4 A;  1ORS C;  1ZW2 A;  2EPL X;  2XL8 A;  4JEB A;  2Y69 C;  4EWC A;  3LS1 A;  3IPM O;  3ASO C;  4QDL A;  4OD5 A;  2J46 A;  3H65 A;  3GEI A;  3PCV A;  3TJ5 A;  4BJ1 A;  5JVE A;  5KYN A;  1JOG A;  1RKC A;  1ZHZ A;  2R7R A;  3G4X A;  1RKE B;  3DJU B;  2IM8 A;  4GEH A;  5JT4 A;  3I5P A;  1TFO B;  2CCY A;  4RDA A;  3U5S A;  1A7E A;  4I1M A;  4MVU A;  3EZI A;  4E0I A;  1R5I D;  5B3I A;  1Q0F A;  3TK0 A;  1OCC C;  4G0H A;  1QKR A;  3RW0 A;  2XS1 A;  2RSE B;  3DMD A;  3JYH A;  2OEX A;  1BR2 A;  2GAQ A;  1Z63 A;  1LIH A;  1V54 C;  3X2Q C;  2Y3D A;  4DXW A;  2NSG A;  5E3C A;  2IYL D;  3T6B A;  2Y39 A;  1OCO C;  3EGD A;  3RQF A;  4MVZ A;  3UGP A;  2O9X A;  2HS5 A;  3CSK A;  2LD6 A;  1M56 C;  2PBE A;  4AL1 A;  2ZPA A;  2H7B A;  2Y3G A;  2MHR A;  3QW1 A;  1NU9 C;  3VM6 A;  3GWL A;  3VF0 A;  3Q6N A;  4E7S A;  4P9T A;  2GWW A;  5DS6 A;  4YN0 B;  1MNE A;  2H7O A;  2DYS C;  4JCH A;  3GWN A;  5E2Q A;  2VCC A;  2X0C A;  2J7P D;  2XS8 A;  2E87 A;  3DAF A;  2EIN C;  3Q6M A;  5D91 A;  4KI2 A;  1RMV A;  1E86 A;  3FDQ A;  1RJ9 B;  3NMJ A;  3FAJ A;  2A0U A;  5AGF A;  3S29 A;  2FGY A;  4JVS A;  3U3F A;  1E83 A;  1NBB A;  1CGO A;  3LAY A;  3RFY A;  1GS9 A;  5JRA A;  3SXZ A;  2HV7 A;  2WZL A;  3V7O A;  4U9D A;  3EFO B;  4G7Z F;  3SP1 A;  1DOW A;  1WAT A;  4YL1 A;  1QVX A;  3EH1 A;  2AU5 A;  3L34 A;  3FHD A;  1K04 A;  1LPE A;  2Q9A A;  4W8P A;  2R7U A;  4MTF A;  4G7H F;  4CSA C;  1ZZP A;  4IRU A;  2P61 A;  2IXO A;  2OJE D;  1JMW A;  5DVW A;  3PMR A;  5JS5 A;  1PCX A;  1MMA A;  4LER A;  4ULW A;  2KNH A;  2V26 A;  2ZXO A;  3ASN C;  1QLE C;  5A6B A;  2HSQ A;  5KYW B;  2TMV P;  4O6Y A;  1L3P A;  5BQH A;  4B6I A;  1LS1 A;  4NCQ A;  3TUL A;  4PJJ A;  3MYF A;  1CPQ A;  2R7O A;  4K7B A;  4R32 A;  3V5X A;  3PHF 2;  3SYN A;  1CGM E;  4FES A;  5JLI A;  1FFH A;  5EK0 A;  4I44 A;  1BR1 A;  3OWT A;  4XLN F;  3B0P A;  3E70 C;  1PV3 A;  1HE1 A;  3C62 A;  4YWQ A;  4NTB A;  4FWV A;  4OD4 A;  4MVR A;  3ITF A;  1A0B A;  3DI5 A;  4XEK A;  5F5H A;  3LNR A;  1YZC A;  1Z5Z A;  2LCH A;  4DRH B;  3RVY A;  3JSE O;  4EIY A;  2OQM A;  2VC9 A;  1MQV A;  3B71 A;  2HZ8 A;  4CIH A;  4E0H A;  1R4T A;  4C3E A;  4PJN A;  2XL6 A;  3LEO A;  3HLZ A;  2PNO A;  2L6F A;  3A9C A;  4ZLD A;  3EGX B;  1TWH A;  1T9K A;  3A11 A;  2R7X A;  5TJ5 E;  1YAU O;  4LDQ A;  3X1O A;  2F22 A;  3RQG A;  1J8Y F;  3B0U X;  5EHH A;  2EIK C;  2KJG A;  1C17 M;  1M2V B;  5BQG A;  1NLX A;  2YZS A;  2XSE A;  1AUE A;  3EPV A;  4YJW A;  1NFO A;  2J0X A;  2Q00 A;  2VH3 A;  4Q7C A;  3FOP A;  1YJG A;  1YA9 A;  5K0I A;  5DS5 A;  1EKY A;  2OJQ A;  2EIL C;  3GOR A;  4A2N B;  2XXA A;  1HMO A;  2NUP B;  4HE8 D;  4YK5 A;  2OEV A;  2A69 F;  1BR4 A;  3V5Z A;  1VLS A;  4IAR A;  3M15 A;  5KYX B;  4Z9I A;  4HEA J;  4J7T A;  3PDM P;  2CNW D;  1SR2 A;  3NG1 A;  1UFB A;  4RD9 A;  1BBH A;  3U3B A;  2EPN A;  4YT4 A;  2PP4 A;  4CSA A;  2M64 A;  3CEX A;  3QZC A;  3RH3 A;  3UR3 C;  3W8I A;  4OIP F;  3LUT B;  2DB4 A;  4PR9 A;  2H8A A;  2CW0 F;  2XLO A;  2YLI A;  2Z15 A;  3EHM A;  2EPO A;  2Q9B A;  3H2V A;  3K1H A;  3KMI A;  4KBL A;  3GM1 A;  3WOD F;  1CPR A;  1E84 A;  1KTM A;  3KYI A;  5KYY B;  2HKV A;  2QE9 A;  3GM3 A;  3B9Q A;  1Q0K A;  4WJ0 A;  4WGZ A;  2D4U A;  2Q7R A;  3ECS A;  2C03 A;  1YLM A;  1ZU4 A;  4DBR A;  1A7D A;  2QLA A;  3NRH A;  2CNW A;  1ZVZ A;  2A68 F;  3EZH A;  1YZA A;  5IY5 C;  5L0G A;  5T1D B;  4Q5S F;  4W8K A;  2W9Y A;  4EBK A;  3M79 A;  4BJ5 A;  1K40 A;  4U9E A;  3M4B A;  1T6Q A;  3UNG C;  1I5N A;  3L8I A;  3W2W A;  3HNK A;  1CGN A;  1XWJ A;  1TWG A;  4P9F A;  3ZQY A;  1PD1 A;  3TJ6 A;  3JSZ A;  3ZQV A;  2YHS A;  4CBE A;  1TFK B;  3WG7 C;  2DGJ A;  2KK1 A;  5CI8 A;  3U8V A;  4O7G A;  1QSP A;  4JKV A;  4JW1 A;  1GGQ A;  4MND A;  3SXK A;  1JRA A;  1FNT c;  1M2V A;  5JP7 A;  4XEV A;  2R7W A;  3MLG A;  1LKX A;  3MX3 A;  2LFD A;  1IW7 F;  4F4B A;  1GM5 A;  4XPY A;  2A6H F;  2OU6 A;  4L6R A;  5B3S C;  3S84 A;  1S05 A;  3AG3 C;  3W2V A;  1JPN A;  1OW7 A;  1BZ4 A;  4CX9 A;  1V4A A;  1OKK D;  4Z9H A;  1ORJ A;  3C8G D;  1PD0 A;  3KYJ A;  4IGG A;  2H7V C;  1DOV A;  1EI7 A;  1H9T A;  1GQA A;  1T01 A;  4JJF A;  2PX0 A;  4LAC B;  4WAB A;  1M6T A;  4CJO A;  2OCC C;  1M57 C;  2YL1 A;  3Q7G A;  4IAQ A;  2VB6 A;  2A0B A;  2QTV A;  4KNW A;  1Q0M A;  4DVY P;  1TR2 A;  2NUT B;  2XM4 A;  1YYJ A;  4JEA A;  1MMD A;  1H6G A;  4J30 B;  5COM A;  3HNJ A;  5F5F A;  5DQZ A;  2BC5 A;  2J9B A;  3ATP A;  3ABL C;  4PJL A;  1LI7 A;  3IQ5 A;  1QQ3 A;  2IXN A;  4U5F E;  1OKK A;  1H7I A;  2HV6 A;  3DE9 A;  3C8G A;  3RIP A;  5FCL A;  4CS8 A;  4PFP A;  2YL3 A;  4X0R A;  1L7C A;  3FXH A;  3RF3 A;  4KNV A;  4EBB A;  3DWW A;  1WTY A;  4FX5 A;  1YDI A;  2P1A A;  2YWA A;  2R03 A;  2D5R B;  1Q0G A;  1Z23 A;  3NYM A;  1D1B A;  4JTC B;  3W8H A;  4C7O B;  3VAY A;  3DJN B;  1Q0D A;  1FMV A;  3S28 A;  3NKD A;  4N6C A;  3OEO A;  3NKE A;  2DI3 A;  2HJM A;  3VRC A;  5L3V A;  2J7P A;  3GAN A;  1D0Y A;  2GFH A;  1T6I A;  1AVO B;  1WWP A;  4P6I C;  3K7D A;  1RKE A;  1XZP A;  4MVM A;  4U5C E;  2WVO A;  4OIN F;  2L7A A;  1Z7Q c;  4PJM A;  3RQE A;  1N1C A;  1TQG A;  4AK9 A;  1KNY A;  4YL3 A;  2WVN A;  4IWB A;  2KYH A;  3HKK A;  5FZT A;  2R7S A;  2QY9 A;  4WGY A;  1OCR C;  2A6E F;  4CIP A;  3AG1 C;  1VLT A;  2ASR A;  3RVZ A;  3DE8 A;  1LE4 A;  1OQC A;  1LE2 A;  2L6G A;  1UG7 A;  2B0J A;  2NSF A;  4LDR A;  5T3T A;  1G4W R;  2XL4 A;  3QTH A;  4XWJ A;  1FMW A;  2P6V A;  5D92 A;  3W4Y A;  1V74 B;  3ZC4 A;  5L0C A;  3UMH A;  2OG2 A;  3T4R A;  1WN0 A;  2AWY A;  2YLG A;  4PAC A;  4BJT A;  4E18 A;  3HNL A;  2Q9C A;  2KC3 A;  3QVZ A;  4ONS A;  4BJ5 C;  2ZXW C;  2YL0 A;  2R05 A;  4HFF B;  2XRH A;  3UMI A;  2UUI A;  1G5Z A;  2A1D D;  3FMS A;  3RKO F;  3EG9 B;  4O6N A;  4CS9 A;  1D1C A;  1ZHY A;  4MW8 A;  3QVY A;  2VCB A;  5A6A A;  1S7Z A;  4H54 A;  5CIV A;  3U2M A;  4I1O B;  1EQ1 A;  4ER9 A;  2LFF A;  3C7J A;  5L0I A;  4AE4 B;  3O10 A;  2XLD A;  4HFK B;  2C04 A;  3KL4 A;  4BEJ A;  4U5G A;  3UGO A;  3G4Z A;  5T3W A;  5L0D A;  3QMK A;  4OIQ F;  1RJ9 A;  4O6M A;  3NDB B;  2JX0 A;  1JPJ A;  5BUO A;  5AC4 A;  5F28 E;  1FTS A;  1LVK A;  4ANJ A;  5EGY A;  2MWQ A;  4C3B A;  4KC9 A;  2XLM A;  3EH2 A;  4JTD B;  2GA0 A;  3EFO A;  1B68 A;  3POV A;  4FAP B;  3IHU A;  4OIR F;  3ZG1 A;  3EJN A;  1ORY A;  4O79 A;  3SNH A;  2CGE A;  2IBF A;  2PX3 A;  4C7O A;  2UUH A;  5DLJ A;  3S9O A;  5A69 A;  3GOD A;  4MQ9 F;  4K0D A;  3BRJ A;  3I4U A;  2BL2 A;  1G8X A;  1VOM A;  4DBQ A;  4XEF A;  2WL8 A;  3ZSU A;  1WGW A;  3BEH A;  1I4Z A;  3L1M A;  3I5Q A;  5KYW A;  3KPH A;  4CDY A;  5L0J A;  3K6B A;  1ZU5 A;  3ABK C;  2FFH A;  2YVK A;  5JSL A;  1W2W A;  4JZA A;  2LQG A;  256B A;  3CZ6 A;  2J0W A;  3EGD B;  3HJC A;  2X51 A;  5B1A C;  2OOC A;  4U5E E;  1OR2 A;  3WAQ A;  4CS8 C;  3U9M A;  3U2L A;  3TOL A;  3K33 A;  1T6U A;  2XLE A;  4NQF A;  4BPM A;  2WZF A;  3K66 A;  3MFN A;  4PFO A;  2MYS A;  3T6J A;  1OXK A;  2LP4 A;  4DJ9 A;  1Y4C A;  3EGX A;  4MVS A;  3B29 A;  4GQH A;  4N6H A;  4IAO A;  3S27 A;  3O55 A;  4LDK A;  3SEO A;  4C3D A;  1A7V A;  2JD3 A;  5KYU B;  1VYI A;  1K05 A;  2WVQ A;  4JUR I;  4AL0 A;  5DS4 A;  3S90 A;  4JCZ A;  5AC5 A;  1BDJ B;  3ZDL A;  1Z3I X;  3DZA A;  5L0H A;  3K1I A;  1G4U S;  1O3U A;  1SZI A;  3IQC A;  3WHN A;  1AEP A;  1FR0 A;  5L0F A;  2L9J A;  2NUP A;  3FOO A;  2VCA A;  4JJG A;  2NPU A;  4JRZ A;  5COF A;  4NY3 A;  3DM9 B;  2R9R B;  2LK4 A;  3AGT A;  3LNM B;  1U89 A;  3RYL A;  3AQB A;  5KYX A;  3AOU A;  3LLI A;  1NZE A;  2G3V A;  3EHN A;  4G78 A;  3E9V A;  3JTL O;  2KQ9 A;  5A6K A;  1ZYR F;  4YT2 A;  1D0X A;  1U6H A;  3U0C A;  4MVQ A;  2CDQ A;  2G62 A;  3U8P A;  1KU2 A;  3R2P A;  3TOM A;  2ETS A;  4CDA A;  4LLC A;  4CS9 C;  1HE9 A;  3EQL F;  4MTO A;  1QZX A;  3CAX A;  2XLH A;  4JC7 A;  5KYY A;  1OCZ C;  2HFI A;  2CYD A;  3US6 A;  2J9W A;  1HW2 A;  1VYK A;  2Q3T A;  2PF4 E;  2Y3H A;  1VK5 A;  1ZHW A;  1WOL A;  3F46 A;  4EBJ A;  4J32 B;  1Y6D A;  2HMQ A;  4Q4Z F;  2YKZ A;  1TWC A;  1VB5 A;  1HW1 A;  2HJ3 A;  4RBN A;  4ULV A;  1M2O A;  1VMA A;  3LEV A;  4DVZ A;  3M4C A;  1NSG B;  2G3K A;  4D4N A;  3DXJ F;  1IZM A;  3R7C A;  1E85 A;  3AJM A;  3DD7 A;  3JZ0 A;  4BG0 A;  3SXM A;  2IOQ A;  3FAP B;  4UDV A;  2YQY A;  1YVI A;  2AP3 A;  2KSF A;  2NG1 A;  4M63 A;  4U5H A;  1LM3 B;  2XLV A;  3IQ6 A;  4XQ1 A;  4E17 A;  5A6B D;  1MMG A;  5L3Q A;  2XXA B;  3HNI A;  2DYR C;  3QW0 A;  3JYY A;  3ZIB A;  5B1B C;  3U9J A;  2HMZ A;  4G7O F;  2L81 A;  3HTK C;  4PK4 A;  3KH2 A;  3TD7 A;  3V5Y A;  4QI0 A;  2R7Q A;  3ABM C;  3AG4 C;  3C8Z A;  4OIO F;  1YYX A;  4J7Y A;  2ZXP A;  4MVO A;  2FAP B;  4YL0 A;  1JR8 A;  4QI2 A;  1TWA A;  3O39 A;  3G50 A;  4IJJ A;  2VAS A;  4MTG A;  2YL7 A;  4D4X A;  4CJG A;  4EHP A;  2XM0 A;  3L8J A;  2ICW G;  3F47 A;  1OW8 A;  3IEE A;  4EUK B;  4AX2 A;  1HY5 A;  2W4M A;  1ZW3 A;  4I3M A;  3OA1 A;  1NG1 A;  1NFN A;  3MYI A;  1ST6 A;  3N2Z B;  4XLP F;  2Y3B A;  3N24 A;  2LIG A;  2R7V A;  3J06 A;  2JPU A;  4N4W A;  2YLD A;  3H2U A;  1HMD A;  2WB7 A;  3IQT A;  3M1C B;  3NYL A;  3FVY A;  2PFD A;  2GDC A;  3C63 A;  2NUT A;  2R02 A;  2WZG A;  3AQC A;  3C18 A;  5COG A;  4U5D E;  1ZHT A;  4DOZ A;  2W45 A;  1T5O A;  2M4E A;  2ZD9 A;  3GEE A;  2ZXR A;  4EKW A;  1VTM P;  4XPW A;  2RD9 A;  2IXM A;  4BJ6 C;  2J9U A;  3K1I C;  2B0H A;  3L0I A;  3JCU Q;  2AVK A;  3AGU A;  4NTF A;  1APC A;  1XZQ A;  4JTA B;  2P7V A;  4NTA A;  3LES A;  2J9V A;  4MW3 A;  4JE9 A;  3ZTZ A;  1TKN A;  5JUA A;  4XPX A; 
#chains in the Genus database with same CATH homology
 1I4Y A;  2MHR A;  4XQ1 A;  1A7E A;  1HMD A;  1I4Z A;  2HMZ A;  1HMO A;  4XPY A;  1A7D A;  3WHN A;  4XPW A;  2HMQ A;  2AVK A;  3AGU A;  3AGT A;  3WAQ A;  2AWC A;  2AWY A;  4XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...