4XQ3A

Crystal structure of sso-smap2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
NPLKSLRTAINRIVLVKLKDGSEYIGKLEQTDGTMNLVLRDCTEIREGTSEPVAKYGRVLIRGSNILFISVDYETVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Heptameric SmAP1 and SmAP2 Proteins of the Crenarchaeon Sulfolobus Solfataricus Bind to Common and Distinct RNA Targets.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
molecule tags Rna binding protein
molecule keywords Like-Sm ribonucleoprotein core
total genus 15
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xq3A00
4M77B 4C92D 1M8VA 5LJ5e 3JCMc 2EJGA 4RCCA 1MGQA 4M78D 4NOYA 4J6WA 4C8QC 4C8QD 5LJ5f 2DKGA 3QO3A 4V2SA 4M78F 5GAMj 1HXDA 2HNIA 3BW1A 4NL2A 4M77A 3SB2A 5GAN6 5GMKe 5GAMh 5LJ3h 3EFRA 4C92C 5I21A 2E65A 5GAOl 3GIBA 1H641 1BIAA 3INZA 5GAOr 4M7AC 1LJOA 3SWNC 3FIFA 4A53A 2ZGWA 5GANj 4JRKA 3JB9J 1LOJA 2RM4A 3M4GA 1WQWA 4M78G 4N0AC 4XU3A 4F7UB 5GAMf 5GMKl 5GAMd 5GANd 4NL3A 4M7AD 3EFSA 5LJ3d 4X9CA 4F7UA 5GMKm 3QSUA 4M7DB 1BIBA 4M7DE 2YHTA 4M7AF 4PJOD 3JB9F 4MMLA 3BY7A 1I5LA 4C92F 4M78E 4C92A 4M78C 1N9SA 5GANh 2DXTA 3JCMJ 4M78A 5GAOq 4XTYA 1I4K1 4XTXA 5LJ3j 3RIRA 5GANg 5GAOp 4M75E 5GAN5 2EAYA 4M78B 1HK9A 4JUVA 4M75B 4F7UG 3JCMQ 5GAN2 3JB9G 1JRIA 1LNXA 4C8QG 3AHUA 5GAN7 2E1HA 2E10A 4MMKA 3RKXA 3RERA 1I8FA 4JRIA 2DTHA 5GAMg 4QVCA 1B34B 2E41A 4M7DC 3JCMd 4PJOA 1TH7A 4XTVA 1B34A 1WQ7A 3FB9A 4QVDA 5LJ3e 1N9RA 4M77G 2VXFA 5GANf 3JB9D 2DVEA 2EWNA 3V8KA 3HFOA 4PJOG 4C92B 4HT9A 3QHSA 4M75C 5DY9A 3JCMh 4M77E 4M7DG 2CGHA 4PNOA 2VC8A 4XTUA 3V8JA 3V8LA 4C8QA 3JCMX 5LJ5j 3JCMV 3JCMg 4M77D 5LJ5d 1KQ1A 3JCMP 4M77C 4A54A 5GAN4 4J6XA 3JCMf 5GMKj 4M75A 3L1AA 5GMKh 4M75F 2RD1A 4EMKC 3JCMW 5LJ5h 2VXEA 5GANe 4M7AA 4F7UF 4F7UE 2DJZA 4PJOB 1U1TA 2EJ9A 4XU2A 1M5Q1 2DZCA 3PGGA 4C8QE 4N0AA 5LJ3g 1I81A 2DTOA 3BFMA 2DXUA 2EJFA 4XQ3A 5CAIA 3SWNB 5GAOn 1JBMA 4EMKA 4M7AB 5GMKi 4M7DD 4PJOE 4XTWA 4XU0A 3SWNA 3HSBA 4M7AE 4X9DA 4Y91A 3HFNA 2E64A 4HA8A 4RCBA 3V7SA 2Y90A 2FYKA 1D3BA 1WPYA 2RB6A 3RUXA 4C8QB 4EMHA 4XTZA 4EMGA 2DEQA 1KQ2A 2I2LA 3JCMe 1D3BB 4M7AG 4M75D 2FB7A 4C8QF 4C92G 5GAMe 4DQ2A 3JCMb 1YCYA 2YLBA 3QUIA 4HT8A 3RKYA 5GAN8 4C92E 1U1SA 5GAOm 4JLIA 3FJPA 3JB9I 1X01A 5LJ5g 3L2ZA 4M7DF 4PJOC 4M7DA 4OP0A 2RA2A 2DTIA 3RKWA 2QTXA 4PJOF 3V7CA 2DZ9A 3BDUA 3RESA 3JB9H 1WNLA 4EMKB 3V7RA 4WF2A 1Y96A 2YLCA 2K57A 4XU1A 4M77F 4J6YA 3VU3C 4J5YA 2JN0A 1Y96B 5LJ3f 4M75G 5GAN3
chains in the Genus database with same CATH superfamily
2KI7A 4KUDK 4R55A 2L5QA 3I55T 1VQ6A 2IIMA 4IUUA 1I07A 1ZBXA 1W6XA 2GBQA 2ED1A 5GANd 2O31A 4NL3A 5LJ3d 4EIKA 5KCHA 2YXYA 4C0DC 2X4YA 5I22A 3LH5A 4PFPA 3ZEHA 1Q82U 3M0TA 3CMEA 1JB0E 1LNXA 4C8QG 5GAN7 1B34B 2RO0A 3NTIA 2KRSA 2D0NA 5LJ3e 1ZSZC 4M77G 1BK2A 2WSFE 5KE2A 1ZA2B 3JCMh 2QYZA 4ELZC 4C0ZA 3KUFA 1VQ7T 2VC8A 2LZ6B 4XTUA 4F16A 2Y4XA 2PUKB 3JCMP 3EGUA 3RR6A 2DYBA 3GOXA 1I0CA 4J9CA 1R0BG 3C95A 4JJDA 2W10A 2KROA 3VRYA 1U3OA 1NYFA 1E6GA 3M55A 2XDBA 1JQQA 4PFOA 2L2PA 3PE0A 1VQ6T 1YCYA 3CMET 4OVAA 2X3XD 1U8RA 4BD3A 2EGAA 4E7SA 1N27A 1X01A 5EC7A 2KYBA 2JVVA 2MWPA 3CXCS 2XK0A 2FEIA 2KE9A 4OB0B 1WYXA 1VQNQ 1Y96B 2DA9A 1NM7A 1UJYA 1BCMA 2GNCA 3R6OA 4PL6A 4LDYA 1K0SA 4O6JA 2E65A 3BDLA 1LJOA 4J9HA 1AOJA 1U5SA 3SWNC 2D8JA 2RJDA 5GANj 1WHJA 4F04B 3CQTA 4DEYA 2CT3A 2MI6A 4PJNA 1M9SA 1ZX6A 5GAOq 1WIEA 4XTXA 2LNVA 1RACB 3FJ5A 4M75E 3OMGA 2NLUA 2OTJA 2IG0A 2CH4A 3NPFA 2J6KA 1I8FA 2RHYA 4IIOA 2G6FX 2QGFB 3CCMA 4RMOA 1UECA 2F1LA 1KQSS 1N6AA 2DFUA 1Y71A 2QXFA 1QVGS 5LJ5j 4FT4A 1G2BA 4NS5A 4A54A 3VS0A 1VQ4A 3T9NA 4M7AA 2LJ1A 3PGGA 1RL2A 1VQMA 5CAIA 2FZGB 1UG1A 3EGDA 4XTWA 3HFNA 2FRWA 1UFFA 4J7FA 3I56T 1OPLA 2DE0X 4II1A 1S1NA 2K3XA 4C8QF 4C92G 3A8GB 3PMIA 3FLGA 4JS5A 4ELYC 4QT7A 2JS0A 4HXJA 2W0ZA 2O4XA 3DKMA 5ECAA 4ANJA 2ABLA 2PVOB 1W2BS 2PZ1A 1WXBA 3BDUA 1WNLA 1SRLA 5FU6C 4WF2A 1V29B 2XDPA 1GCQC 2SRCA 3CCEA 2R5MA 2JXBA 5IT9E 1YIJT 2F5TX 2CKKA 1M8VA 1NPRA 1WZOA 2DF6A 1VQLQ 3CCJT 1VQ8Q 4JS4A 4C92C 1UGPB 3INZA 2JMAA 2GTOA 3TU4K 1ACMB 4PLLA 4YTLA 4LDUA 4X9CA 1M1KU 1MV3A 2DXBA 2A28A 3JB9F 8AT1B 4PKCC 2DBKA 3RMSA 2HQEA 1KD1R 3GLXA 1X6BA 1X69A 3CCSA 5AYFA 1KC8U 2RQVA 2C06A 3RKXA 5GAMg 2DTHA 4DA4A 2CREA 2OTJQ 1B34A 1WQ7A 2JTMA 4ORZA 3KXTA 3G71T 1N9RA 3DB4A 1QVFP 3JB9D 2EYZA 1RLQC 3GF5A 3V8KA 4K11A 2K79A 4J9DA 2CGHA 3O8VA 2MPXC 2QQ9A 2GTJA 2CZ1B 1D1BA 1E6HA 2QG9B 3EFOA 4KH1B 1M8MA 4M75A 1OI1A 3E9GA 2HZYA 2VYTA 1OOTA 3M56A 2HKQB 4ESRA 1RI0A 5DLQE 4LE9A 1VQLT 4GLKA 3M53A 2HL3A 4J7IA 1H3ZA 3FEOA 1UHFA 2FVUA 2V8JA 3G4SQ 2F5KA 1YIJQ 1P92A 4XU0A 4Y91A 1I1JA 3C94A 1QVFA 1TOVA 1WFWA 3RUXA 4C8QB 4MDWA 4OMPA 4DQ2A 1HD3A 3CBOA 3QUIA 1TTHB 4HT8A 2PVGB 3U23A 1AHJB 1U1SA 3FJPA 3JB9I 4PJOC 3OYAA 2KNBB 2YSQA 3RKWA 2GFAA 2YRDA 3M57A 2DD4A 1ZBJA 3SDZA 3CCRQ 4VUBA 2L0AA 4C92D 1ZUKA 1VYUA 2VUBA 1KG1A 3LGFA 1CKAA 1K76A 2DRMA 3QJYA 2RHXA 4A4KA 5I21A 1BCOA 2RHUA 2YWWA 1K73U 1YJWT 2QASA 3G7ZA 3HP9A 5DLOA 3L2UA 2DK3A 3CEYA 3OBYA 1K73C 1QP3A 2H3JA 4C92A 2QTVA 4L5GA 3H0HA 3UDCA 2AHJB 2DYIA 3OW2A 2NUTA 3X20B 1R77A 4M75B 1VQMQ 2E1HA 3JSCA 3OYHA 1PC0A 2BKDN 9ATCB 3EAEA 4QVDA 3EG9B 3CCUT 1QVFS 1NYGA 4BDYA 1IREB 3VRZA 1ABQA 2KSSA 3CD6Q 4PJOG 4ZN3A 4M7DG 5IH2A 2KAFA 3V8LA 2RHZA 1BI1A 1K0XA 5GAN4 1AZEA 2ZPEB 3GNFB 2F69A 4M75F 4JRPA 4RTUA 1FWZA 2MOXA 2VXEA 4F7UE 2XIDA 4E7ZA 2CP2A 5HCKA 1WXUA 4X1VA 3E2UA 5KYUB 4DBRA 8ATCB 2RJEA 2E64A 3CC7T 2EFIA 3CC2A 1Q82C 2DD5A 4OF1A 2EKOA 4ME7A 2LCLA 2COWA 4IUQA 2OX7A 3CPWA 2X35A 1BU1A 5FU7C 2QA4T 5FWCA 2CP3A 2YUNA 2X4JA 5LL6S 4HCKA 1T3SA 4TVRA 3S3MA 1G3YA 2XI9A 1GL5A 4OGEA 2WACA 5FROA 1W2BP 3PIOA 2ECZA 4XU1A 3VS2A 4AMCA 3ZL7C 5KYNA 1QKWA 3CCSQ 2COZA 4GBQA 4BB7A 5LJ5f 4NOYA 4BI4A 3NTKA 4C8QD 3QO3A 3CCLQ 1M3BA 4B9WA 1EFNA 2V26A 2DLPA 4OMLA 4CC7A 4F7UB 5HKCA 2J06A 5GAMf 1S72Q 2ZPHB 3E19A 4Z89A 5GMKm 3QSUA 1UGQB 2PUOB 2DXTA 2DEUA 3A98A 4C5EA 3CCEQ 5LJ3j 2PNIA 5I2SA 4E7KA 1XNIA 1VQLA 3QKJA 2H3EB 1M90R 1GXIE 5CKDA 2V1RA 2RQWA 1NG2A 2JS2A 1PSEA 4HCZA 1YNZA 4HT9A 4Z8AA 2HBPA 4J9EA 4AG2C 3I56A 3EFOB 2XDDA 1JU5C 5C6SA 3OS2A 1UHCA 3P8BB 3L1AA 1FMKA 4FU6A 1WHKA 1JO8A 5L23A 4ZGJB 5IXFA 2BIVA 3I55Q 2GQVA 2VWFA 2BZYA 2LTOA 1KQSA 4M7DD 1VIEA 3VS4A 1W4SA 3KFVA 2CP7A 3HPWA 3F70A 5KYWA 1JEGA 1OX9A 2JJ9A 5KCOA 4JZ4A 3PT9A 5GJVB 3QZ5B 1PWTA 1WDXA 1NLPC 1OPKA 4Q5WA 2FPDA 2MAMA 1QCOA 3L2ZA 2Z0WA 2DTIA 4PJOF 4OMQA 1S72A 2RI2A 1TUDA 1H8KA 2CP0A 2KYMA 1NZ9A 2QDYB 2DXCA 4RCCA 2DETA 2A7YA 3SFMA 1YHQA 2HNIA 2DJQA 1V76A 5LJ3h 2LJ0A 3QPHA 1KK7A 3GIBA 2QQAA 1H641 4KGXB 3VS3A 4N0AC 4M78G 5GAOm 2NUPA 3EFSA 1W1FA 2EBPA 2FO0A 2JW4A 4HCCA 3E9FA 2RF0A 4BI8B 2K9GA 4M78C 1WLPB 3JCMJ 4UC4A 4XTYA 3JAME 1OULA 4EPCA 4BI3A 4QQGA 3CCJA 1VA7A 5GAOp 3MEAA 1DJ7B 4JRQA 2E10A 1VQNA 3JCMd 4BE2A 3NHNA 1SHGA 2CZ0B 2D1XA 3OYEA 4BE1A 2FG0A 1S72T 1GRIA 5HY6A 3I5RA 2RNAA 1GBQA 4QKUA 4KGZB 3Q1JA 3H8ZA 2QQRA 3CCLT 2PQWA 3CD6A 4KUIA 3QBYA 5LJ5h 3EGXA 2OI3A 1WJRA 1AZGB 2OTLA 2DIQA 2BE7D 1R0CB 1KSWA 2O4XB 5IHIA 4GY5A 2FYKA 3QWYA 3WVDB 2EQIA 2MMPA 1D0XA 4RTZA 4JZ3A 1K9MU 4CC3A 5FLXE 1CKBA 3CCVT 1M90C 4CC2A 4JLIA 3MP6A 3URGA 4E2FB 2KK4A 4M7DF 1Q81R 2CUDA 2DZ9A 3H0FA 3VU3C 1JJ2P 4LN2A 2O88A 2V8KA 2RI3A 1YI2T 4IURA 2VASA 4C8QC 3PVQA 3BW1A 5DM7R 3EFRA 2L3PA 3QXEB 2YRCA 2OJ2A 1X27A 3G4SA 1VQ4Q 1WQWA 1Q95G 2KMTA 4M7AD 1UE9A 1C6VX 3NTHA 2EQUA 3META 4M78A 1N8RR 3I9QA 2QI2A 3X26B 1K8AU 2EQMA 2DERA 2EAYA 1NPPA 1VOMA 3CCRT 2QGGA 3AHUA 4E7JA 4Y92A 1RAIB 1RUWA 2PVDB 3UWNA 4IUPA 1QWEA 2EWNA 4MZMA 3M54A 4BUGA 1YJWQ 1YITT 4OB2B 2AZVA 1ZLMA 2NUTB 1QMCA 3A5ZB 1H92A 3THKA 2GF7A 3MEWA 2EJFA 5CVIA 3BFMA 5GAOn 1ZUYA 2GQIA 5KYWB 3S3NA 2QA4A 1PRMC 2LQ8A 2E5QA 2YLBA 4OGCA 3QG1A 1M1GA 2ZPFB 5J3BA 5FWBA 5AT1B 3D7SB 1I5OB 2AKLA 4EMKB 2RHIA 2AZSA 3OYGA 5GMKl 1VQ7A 3J7AF 2D9TA 2EIFA 1VQ5A 1RLPC 3JCMc 3ME9A 1MGQA 1Q82R 1HXDA 5GMKe 3SB2A 3M0QA 3QIIA 2K2VA 1GFDA 4JDSA 1RABB 3CMAT 1M2VB 1B3QA 2HQXA 4PJOD 2YHTA 1K1ZA 3VS6A 2FHDA 2BE9B 5CIUA 4E6RA 1YITA 1LCKA 2KXDA 2O9VA 3P8DA 2HL5C 2OAWA 1KHCA 3TVTA 2YT6A 1MMGA 1GCPA 3A8LB 4FYVB 4JRIA 2EQKA 2E41A 4J9IA 5J26A 1QP2A 3PIPA 3I35A 3M58A 4XTVA 1KHIA 2K5LA 1SHFA 1X75C 2EPDA 2MWOA 3LGLA 2J6OA 5C0MA 2MK5A 3CCET 2P4TA 2X4XA 3V8JA 3AT1B 1MV0B 4KBMB 4JJNK 4M77D 1VQ8T 2JNGA 1GCQA 2OAUA 1KC8R 2K5FA 7AT1B 1XJWB 2KVQG 3I5SA 3OYJA 2EJ9A 2V8IA 2DTOA 2RK1A 5KE3A 3EG2A 3L2QA 1JBMA 4EMKA 1PCXA 5IAYA 3GPLA 4AT1B 1AWOA 1WPYA 2Y90A 3CPWP 2LRQA 3CPWS 1Q81U 1KFZA 3LX7A 2I2LA 1AWJA 4ZNXA 1AT1B 1D1CA 3JCMb 2ENMA 5IXBA 2M0YA 3I56Q 1A0NB 5KYUA 4OMOA 1G3WA 4OMMA 4ZGDB 3FDRA 1VQ9T 2QTXA 2RK2A 1QW1A 3VS7A 2KDSA 2JN0A 3NGPA 5GAN3 3JV3A 1N5ZA 2EJGA 4FYXB 3CCST 3VKIA 1Q81C 3FC3A 4M77A 4ZGEB 1MHNA 3GBQA 3JRZA 1UGVA 4C5GA 1JXOA 4JRKA 3A8OB 2L3SA 1KD1U 1E7OA 1YI2Q 4PK4A 4MMLA 2HSEB 1I5LA 4J83A 3MPUB 4JJCA 1JXMA 2CYZB 1UB4A 3QYGB 4FW2A 2KBTA 1AVZC 3HTRA 4D8KA 5GANg 3CCQQ 4LD9K 3CD6T 3CC7Q 3ULRB 1IHWA 3E1SA 3DLMA 3CCQT 1M3AA 4QVCA 1SSFA 1KQSP 1ZSZB 4M7DC 3UT1A 3OS1A 3GP8A 2C0TA 1VQMT 2ZPIB 3CCLA 2P0KA 1OQKA 2VV5A 4BDZA 4FIBA 1OEBA 1SG5A 2NUZA 4JJBA 1TUGB 5GMKh 2P0PA 1IB8A 2DO3A 1OX8A 1HYOA 2YDLA 1YJ9A 1VQNT 4KRTA 2ZCFB 3EH1A 2E6ZA 3MEVA 3HL8A 5CQXA 3M5AA 4DOWA 5FU7B 2KT1A 1M2OA 4KT0E 1YIJA 2RB6A 1VQ9Q 3DLLA 4EMGA 3JCMe 3CMEQ 2CUBA 5I11A 1Q86R 3RNJA 1U06A 5FW9A 4N4IA 1D1AA 1TWBA 4ZTJA 2X3WD 1YWPA 3RBBB 4OP0A 2KRMA 1IHVA 2M0OA 3IQLA 4X34A 2K57A 1K73R 4M77F 4Y28E 1YI2A 2K5IA 2JZ2A 2FPEA 2KR3A 2JT4A 4AG1C 1FMWA 5IHKA 1RADB 5LJ5e 2M02A 2MCNA 4V2SA 1NEGA 1MMDA 3G4ST 4RTYA 2YRVA 1R8OB 3RMQA 3PNWC 2QK0A 3MCAB 3OMCA 2ZGWA 1LOJA 5GAMd 3MP8A 2XMFA 2QQSA 3QWXX 2K3YA 5CQYA 1NEBA 4FM4B 1BBZA 4E7LA 2O2OA 1T0HA 1JRIA 1WX6A 2LT4A 4HKEA 5M9OA 3EG9A 2J05A 3C12A 3OSSC 2QQBA 3MJXA 2O9SA 1VQKQ 3CBMA 2HCKA 1PD0A 4MZTA 2RI5A 1QLYA 5CO7A 1IRXA 3HRUA 5D6YA 3CMAQ 1JJ2S 2CS7A 4P5NA 3S3OA 3QZ9B 5GMKj 3MKDA 4RG2A 2R5AA 2M1HA 1QCFA 4DBQA 3QDFA 2VGMA 2E12A 2L3QA 1M4ZA 5J39A 2CH4W 4QQDA 3FRNA 2Y4YA 5GMKi 3CCJQ 1K9MC 4J9GA 1D3BA 4EMHA 3EG0A 3HRSA 2FB7A 3OW2P 2YUOA 5EG2A 4RKUE 2KRNA 1NJIR 1G3SA 5FU6B 2LNHB 2ROLA 1XQHA 3EGDB 1TG0A 2RQRA 2SEMA 2MYSA 3TSZA 1D0ZA 1M3CA 4JLGA 5A0LA 5D6XA 2ZAEA 2M16A 3PVLA 4FYYB 1M27C 3OY9A 2HMAA 1PM3A 1VQ5T 2RH2A 3VV0A 3VS5A 4N4GA 3M0UA 1QVPA 1X43A 3UPUA 5GAOr 4A53A 2L3RA 3M4GA 1ZQ1A 2LCCA 4BY6B 2X51A 1PHTA 4F7UA 2I0NA 1QQJA 2CP5A 1VUBA 3HRTA 4R0KA 3CC2T 1K4US 1X2QA 4E7IA 4MDXA 3RIRA 1HSQA 2K2MA 3ER0A 5GAN5 2R57A 4E47A 4HVUA 2RJCA 2QA4Q 1WXTA 3ASKA 1LVKA 4RG8A 2RJFA 1ZHIA 1ZUUA 3QYHB 4C92B 3CPFA 2A08A 2GCXA 1AEYA 3JCMV 1VQ4T 3OS5A 3PFSA 5LJ5d 1UGSB 1QKXA 4M77C 1IGUA 3OYLA 3JCMf 4FCYA 1WHLA 2ATCB 4EMKC 3NMZC 1VQ5Q 1IGQA 1FMVA 5GANe 1KD1C 4A4EA 4XU2A 1M5Q1 4FSXA 5HK3A 5KYYB 4N0AA 4RTVA 3OYNA 4J8OA 3SWNB 2P4RA 4A63B 4R56A 3HSBA 4LDVA 3C4SA 4FW1A 4BE0A 4XTZA 4M7AG 4M75D 4HVVA 1Y0MA 2K4YA 2WSCE 1FX7A 1YBYA 1M30A 2YUQA 4XAXB 5I2MA 3A8HB 4D8DA 2J7IA 1FXXA 3RKYA 3TEEA 5FRNA 6AT1B 2BZ8A 5IHNA 1WA7A 2E5KA 1VQ6Q 3V7RA 1Y96A 2E4HA 5LJ3f 3UATA 2RQUA 1VYTA 1YCSB 3HKSA 5L8RE 3OYCA 2EQJA 3SD4A 1WGSA 1NLOC 1BI0A 1ZSGA 3M0PA 4FL6A 1K9AA 3LLRA 4XK8E 2LQKA 3NFCA 4M78E 2L8DA 1N9SA 2IPOB 5GANh 1VQKT 3TREA 4BACA 3VUZA 2A3LA 1D0YA 3OA6A 2L89A 1J3TA 1ZSZA 4IUVA 4AFZC 3UA7A 3EG3A 2FZCB 3G71A 3CXCP 1OU8A 1Y57A 2RPNA 4PJOA 1VYVA 3P8HA 2RN8A 4WCIA 3L2RA 1PKTA 3HFOA 1TSFA 1PG5B 2B86A 2BZXA 5DY9A 5IN1A 1UJ0A 1N8RU 1TS9A 1G5VA 4ZTFA 3CCVA 1YHQT 1QVGP 1VQ7Q 2DL8A 1ABOA 3OYKA 3DB3A 2ROTA 3CCQA 1OYXA 1PSFA 5FRMA 4LXCA 3CMAA 2DJZA 1UDLA 5LJ3g 3EGXB 3OYYA 4XQ3A 4OB3B 1QCNA 1BB9A 4X9DA 2GGRA 1SF9A 2EGCA 3V7SA 2DEQA 1D3BB 2R58A 2DPPB 4F14A 3G71Q 1BKBA 3ZBDA 1VQPA 3TQ7P 1PKSA 1UTIA 1RAFB 1YJ9T 1GBRA 1SKUB 5LJ5g 1M2VA 2HSPA 2EGEA 4J9BA 5KH6A 2DVJA 3LYIA 2YLCA 1AWXA 1K9MR 1X6GA 1UGRB 2DL4A 1XOVA 4M75G 4CI0C 3CCRA 2JUFA 3OB9A 1VIFA 5GAN6 4NL2A 5A0GA 2DRKA 2LX9A 4WTOB 4MZPA 2XICA 1QWFA 4GLMA 4M7DB 5HK0A 1MMAA 2DX1A 2G3RA 3M0RA 1VQ9A 4C92F 1TU0B 2HBWA 1RAHB 1W2BA 1I4K1 3WVEB 3G6EQ 3BE3A 2RMOA 4OMNA 1T0JA 2CT4A 4Z02A 2CSQA 4B6MA 4C0DB 3MP1A 1RAGB 1W70A 4OB1B 2LP5A 2KY9A 3CC4Q 2OTLT 5GANf 1PD1A 3EHRA 1G83A 4C5HA 1B7TA 3QHSA 1YJNT 4CRIA 3OYMA 1F1BB 2AKKA 4LD6A 4L59A 2CZ6B 4F17A 4RTWA 1GFCA 3M9QA 1EZZB 1WJSA 1VQOT 3CC4A 2RD1A 3A1PA 2QEXT 1QVGA 3EHQA 1Q7YR 4L6V5 2J6FA 2CP6A 3OQ5A 4M7AE 3SWNA 3G6EA 4AFUC 4RCBA 2WSEE 1Q86C 4QQ6A 1RI9A 2KXCA 2X4WA 3QDRB 1WJQA 2K6DA 3CC4T 1VQOA 2MIOA 1HJDA 1SSHA 2HEQA 4HVWA 2BUDA 4M7DA 4C5IA 3SHWA 1SEMA 1WHMA 3V7CA 1M1KR 2M51A 4J6YA 4E7HA 3H41A 3MHXA 2B8AA 1SRMA 2LMJA 2HAXA 2PTKA 1MNEA 2DAQA 2LC4A 2AT1B 2QAZA 1K8AR 3HHTB 1D09B 1MMNA 2M9UA 4OMFB 5GAOl 2CSIA 1BIAA 4M7AC 3S6WA 3X28B 1OZ2A 1NJIC 2EKHA 1FYNA 2RM4A 3SEMA 1EX4A 4IIMA 3M4YA 2K7AA 2F2XA 1BIBA 2C0IA 5D6WA 4FYWB 4M7AF 4LUDA 1Z9QA 3CXCA 2RQTA 2FZKB 1VQ8A 3CCUQ 1TUCA 4ATOA 4PLIA 3J80E 4C0GA 3UF4A 3OBWA 2KGTA 4DEXA 4JUVA 1X2KA 3MEUA 3VUBA 4MMKA 1M1KC 2JTEA 4LDXA 2A36A 3CBPA 1BI2A 1YJ9Q 1Y07A 1KC8C 4M75C 4LNPA 3G1JA 3VJPA 1VQPQ 3X24B 1H3HA 4J9FA 1MUZA 3RDVA 3JCMg 4ZN1A 1O9SA 2KQWA 2X9HA 4J6XA 3A8MB 1MNDA 2BTTA 2LQWA 4F7UF 2C0OA 3PTAA 1U1TA 2JOYA 4C8QE 1I81A 2DXUA 2LDMA 2ZPGB 1JJ2A 1KIKA 4CC4B 3CCUA 2K3BA 3WXMB 1PNJA 1SPKA 2DMOA 1O75A 2EYWA 1RAAB 1YHQQ 5CKEA 1LPLA 3KBGA 1N8RC 3GNGA 2A37A 4KH0B 3CCMQ 1OZ3A 2V1QA 2JMCA 1Q7YU 4FSSA 2NUPB 2HD0A 3VYGA 5A0DA 4PJLA 2XU8A 2LQNA 5CK9A 1YWOA 1G3TA 1VQKA 2VGNA 3H0IA 1IXDA 3MO8A 4M78D 3CC7A 4J6WA 1Q86U 4LDWA 4DBHA 5GAMh 1KQ2A 4O5VA 3OYBA 4D6WA 4LUEA 1RAEB 3JB9J 3UA6A 4PJOE 4IUTA 4M7DE 1YITQ 1PRLC 3BY7A 3CCMT 1M90U 2FRYA 3OYDA 2HQHA 4PJMA 5GJWB 1X6OA 4Z88A 4PJJA 1YFNA 4QVZA 1M1FA 2OTJT 2IVWA 3L42A 4PFZA 4F7UG 1WHGA 4FT2A 4RTXA 3JCMQ 5KYXA 3RERA 2DL7A 3FB9A 4AFSC 1NBEB 2DIGA 1YP5A 2NWMA 2DVEA 2NYSA 3LH0A 5CKFA 1IO6A 2DNUA 4M77E 3OW2S 4PNOA 3X25B 2LJ3A 5KYYA 2QDLA 2H8HA 2LVMA 1K8AC 1G8XA 2FL7A 2VVKA 1VQPT 3VYHB 1B07A 1C1AA 1BI3A 1XTDA 2VKNA 2DILA 1ARKA 4PJOB 1CSKA 2E70A 2DZCA 2D0QB 3TCJA 2LX7A 3O5ZA 4C0FA 2EYQA 1YN8A 4M7AB 1IZ6A 3OS0A 3OYFA 4A4FA 1KJWA 3LWIA 3TSWA 3L2WA 4QW2A 2FPFA 3REBB 4DOVA 3CCVQ 2KEAA 2HKNA 2ZPBB 1OV3A 1Q7YC 1C0MA 2RA2A 2XHCA 5D7UA 5CCAA 2COYA 5CR2A 4A4GA 2DBMA 2E3HA 2HDAA 2XKOC 4M77B 3REAB 4JPBW 4DBFA 1OU9A 1T3LA 2O01E 2D8HA 1Y7XA 2DKGA 4M78F 5GAMj 3CC2Q 1AD5A 2YUPA 5KYXB 1AWWA 3VS1A 3FIFA 5CKBA 2QEXQ 2EYXA 4XU3A 4KULA 2AIRB 4RTTA 1VQOQ 2PU9B 1BYMA 3C0CA 2D6FA 4A4HA 1YJNQ 3LWHA 3ZFJA 4EDUA 4M78B 1HK9A 2F2VA 5GAN2 3JB9G 2ESWA 2OTLQ 1EIFA 2MF2A 4BY6C 1TH7A 2DL5A 4RUGA 2VXFA 1UEBA 3M59A 4B9XA 2XG8D 2ZZDA 3J81E 3G6ET 3LW5E 1V1CA 2JM8A 4C8QA 3JCMX 2E6NA 3EG1A 4HCBA 3M0SA 1KQ1A 3H9NA 3I55A 2DL3A 3JCMW 2P0QA 3QJ6A 3OYIA 3L2VA 1Z9ZA 2F2WA 1NJIU 4IKFA 2A0FB 2VB6A 3PMTA 4KGVB 3N5BB 2ED0A 1YJNA 2XD0A 4HA8A 5CKHA 2AK5A 3EH2A 2DM1A 2EW3A 4M4ZA 1ZA1B 2CDTA 5GAMe 2EYYA 2E3IA 2JM9A 2LCSA 3R6NA 1TXQA 2GFUA 1WI7A 3H6ZA 1NE8A 2QEXA 5GAN8 4N4HA 4C92E 1YJWA 2JTFA 2KT8A 1WHHA 5A2QE 2P84A 3RESA 2CZ7B 3JB9H 3OSVA 4J5YA 4AFQC 2EVRA 2LT1A 1UUEA
chains in the Genus database with same CATH topology
4CI0C 4KUDK 2EJGA 3CCRA 4R55A 2JUFA 2L5QA 4BB7A 4NOYA 5LJ5f 4BI4A 3NTKA 3VKIA 4C8QD 3I55T 3OB9A 1VIFA 3QO3A 4IUUA 5GAN6 4NL2A 5A0GA 3FC3A 4M77A 4ZGEB 1ZBXA 2LX9A 1MHNA 3JRZA 5HK3A 4B9WA 4MZPA 4C5GA 2XICA 4JRKA 4F7UB 5HKCA 5GANd 3A8OB 1QVGS 4NL3A 5GAMf 2ZPHB 5HK0A 5LJ3d 3E19A 5GMKm 1KD1U 3QSUA 4M7DB 1UGQB 5KCHA 2G3RA 4MMLA 1I5LA 4J83A 1VQ9A 2PUOB 4C0DC 4C92F 2X4YA 2DXTA 2CYZB 1W2BA 1UB4A 3QYGB 4C5EA 1I4K1 3WVEB 5LJ3j 3ZEHA 5I2SA 5GANg 1Q82U 4LD9K 4E7KA 3CD6T 1XNIA 4Z02A 3CMEA 1JB0E 1VQLA 3QKJA 1LNXA 4C0DB 4C8QG 5GAN7 1GXIE 3E1SA 3DLMA 3CCQT 3MP1A 1B34B 2RO0A 1SSFA 4QVCA 5CKDA 3NTIA 4M7DC 4OB1B 3UT1A 5LJ3e 2KY9A 3OS1A 3GP8A 1VQMT 2OTLT 4M77G 5GANf 2WSFE 2ZPIB 4C5HA 1PSEA 4HCZA 5KE2A 3CCLA 2P0KA 1Q81C 3QHSA 3JCMh 2VV5A 1YJNT 4CRIA 4ELZC 4C0ZA 3OYMA 4BDZA 3KUFA 2HBPA 4LD6A 2VC8A 4XTUA 4FIBA 3I56A 1VQ7T 4L59A 2Y4XA 2XDDA 2PUKB 5C6SA 2CZ6B 3OS2A 3JCMP 3P8BB 3M9QA 3L1AA 5GMKh 2P0PA 1WJSA 2DO3A 3GOXA 1VQOT 2RD1A 3CC4A 4FU6A 2QEXT 1YJ9A 3C95A 1QVGA 1VQNT 2ZCFB 2E6ZA 3MEVA 4ZGJB 2BIVA 2GQVA 3HL8A 5CQXA 4L6V5 2LTOA 1KQSA 4M7DD 3OQ5A 1VIEA 4M7AE 3SWNA 3M5AA 4DOWA 5FU7B 3G6EA 3M55A 4RCBA 1W4SA 2WSEE 2XDBA 4KT0E 1YIJA 2RB6A 1Q86C 3DLLA 4EMGA 3HPWA 3F70A 3JCMe 5KCOA 4QQ6A 1VQ6T 1YCYA 2X4WA 4OVAA 3CMET 3QDRB 1WJQA 4N4IA 3PT9A 3QZ5B 4ZTJA 1U8RA 4BD3A 4Q5WA 2MAMA 3CC4T 1VQOA 1N27A 1X01A 3L2ZA 2BUDA 4OP0A 4M7DA 4C5IA 2DTIA 2JVVA 2MWPA 4PJOF 2M0OA 3V7CA 3CXCS 1S72A 2RI2A 2XK0A 4X34A 2K57A 4OB0B 4M77F 4Y28E 4J6YA 1YI2A 2K5IA 2JZ2A 1Y96B 4E7HA 1NZ9A 2QDYB 2B8AA 3MHXA 2DXCA 2HAXA 5LJ5e 4RCCA 2DAQA 2LC4A 2A7YA 3SFMA 1YHQA 3HHTB 4V2SA 2HNIA 3R6OA 4PL6A 4LDYA 2M9UA 4O6JA 4OMFB 5LJ3h 3QPHA 2E65A 5GAOl 3BDLA 2YRVA 2QQAA 1H641 1BIAA 1R8OB 3GIBA 4M7AC 3RMQA 3S6WA 1LJOA 3PNWC 3SWNC 3X28B 3MCAB 3OMCA 2RJDA 1OZ2A 2ZGWA 5GANj 1NJIC 1LOJA 2RM4A 4M78G 4N0AC 5GAOm 3M4YA 5GAMd 3EFSA 4PJOB 3MP8A 1BIBA 5D6WA 4M7AF 4HCCA 2QQSA 2MI6A 3E9FA 3CXCA 4BI8B 4M78C 2K3YA 5CQYA 1VQ8A 3JCMJ 4UC4A 1M9SA 4XTYA 5GAOq 4XTXA 3JAME 4ATOA 4EPCA 4FM4B 4PLIA 4BI3A 3J80E 2LNVA 4QQGA 4C0GA 3OBWA 5GAOp 3CCJA 4E7LA 4M75E 3OMGA 4JUVA 3MEAA 2NLUA 1DJ7B 2OTJA 1JRIA 2IG0A 3MEUA 3VUBA 4JRQA 2LT4A 2E10A 4HKEA 4MMKA 1M1KC 1I8FA 5M9OA 1VQNA 2RHYA 3JCMd 4LDXA 4BE2A 3C12A 3OSSC 3CBPA 2CZ0B 1BI2A 2QQBA 3OYEA 4BE1A 1S72T 5HY6A 3CCMA 4RMOA 1Y07A 3CBMA 1KQSS 1KC8C 1N6AA 4M75C 3VJPA 4MZTA 3X24B 2RI5A 1Y71A 5CO7A 2QXFA 3H8ZA 2QQRA 3Q1JA 5LJ5j 3HRUA 4FT4A 5D6YA 3JCMg 4ZN1A 3CCLT 2PQWA 4NS5A 1JJ2S 2CS7A 4P5NA 3S3OA 1O9SA 3QZ9B 3CD6A 4A54A 2KQWA 4J6XA 4RG2A 4KUIA 2R5AA 3A8MB 5GMKj 2M1HA 1VQ4A 3QBYA 3T9NA 2VGMA 5LJ5h 2E12A 4F7UF 4M7AA 3PTAA 1M4ZA 1WJRA 1U1TA 2JOYA 5J39A 3PGGA 1RL2A 4C8QE 1VQMA 2OTLA 1I81A 2DXUA 2LDMA 5CAIA 2DIQA 2ZPGB 1JJ2A 4QQDA 3FRNA 2Y4YA 5GMKi 4XTWA 2O4XB 3CCUA 1K9MC 3HFNA 4GY5A 3WXMB 1O75A 2FYKA 1D3BA 4J7FA 3I56T 4EMHA 3HRSA 4II1A 5CKEA 3WVDB 2MMPA 2FB7A 2K3XA 4C8QF 3KBGA 4C92G 3A8GB 3PMIA 3FLGA 1K9MU 5EG2A 4RKUE 1N8RC 3GNGA 5FLXE 4JS5A 1G3SA 3CCVT 1M90C 4ELYC 5FU6B 1OZ3A 1XQHA 2O4XA 3DKMA 4JLIA 3MP6A 2PVOB 3URGA 1W2BS 2KK4A 1Q7YU 4M7DF 3CCST 2HD0A 2DZ9A 3BDUA 3VYGA 1WNLA 5A0DA 5FU6C 4JLGA 2XU8A 4WF2A 5CK9A 1V29B 2XDPA 3VU3C 5A0LA 5D6XA 2M16A 3CCEA 2R5MA 5IT9E 1YIJT 2F5TX 2CKKA 1G3TA 1VQKA 1M8VA 2V8KA 1NPRA 2RI3A 2VGNA 1YI2T 3MO8A 4IURA 3OY9A 4M78D 4C8QC 4J6WA 3CC7A 1Q86U 4LDWA 3CCJT 3BW1A 5GAMh 1KQ2A 4O5VA 5DM7R 4C92C 3EFRA 4JS4A 1VQ5T 2RH2A 3OYBA 3VV0A 4D6WA 1UGPB 3INZA 1QVPA 3QXEB 4N4GA 3UPUA 5GAOr 3TU4K 3G4SA 4A53A 4PLLA 2L3RA 3JB9J 3M4GA 1WQWA 4YTLA 1ZQ1A 4IUTA 2LCCA 4PJOE 4LDUA 2KMTA 4BY6B 4M7AD 4X9CA 4F7UA 1M1KU 4M7DE 2DXBA 3JB9F 1VUBA 3BY7A 3CCMT 1M90U 3OYDA 3HRTA 3NTHA 4PKCC 3CC2T 2EQUA 3META 4M78A 1X6OA 4E7IA 4MDXA 4QVZA 1M1FA 2QI2A 3RIRA 2IVWA 3X26B 1K8AU 2OTJT 3L42A 3RMSA 3ER0A 2HQEA 2EQMA 5GAN5 2EAYA 4F7UG 1NPPA 2R57A 4FT2A 3GLXA 3JCMQ 3CCRT 3CCSA 3AHUA 4E47A 5AYFA 1KC8U 4E7JA 2C06A 3RKXA 3RERA 5GAMg 2DTHA 2RJCA 4DA4A 1B34A 1WQ7A 2JTMA 3FB9A 3KXTA 3G71T 1H3ZA 1N9RA 3ASKA 4RG8A 3DB4A 2PVDB 2RJFA 2DIGA 3JB9D 3UWNA 1ZHIA 2DVEA 3LH0A 2EWNA 4IUPA 3GF5A 5CKFA 3V8KA 4MZMA 3QYHB 3M54A 4BUGA 4C92B 3CPFA 2GCXA 4M77E 3OW2S 1YITT 2CGHA 3O8VA 4PNOA 3X25B 4OB2B 2QQ9A 2CZ1B 3JCMV 1VQ4T 2LVMA 3OS5A 3PFSA 5LJ5d 1UGSB 1K8AC 4M77C 2FL7A 3OYLA 1VQPT 3JCMf 3VYHB 3A5ZB 4M75A 1OI1A 3E9GA 1BI3A 1XTDA 3M56A 2VYTA 4EMKC 1RI0A 5DLQE 5GANe 1VQLT 1KD1C 2GF7A 4GLKA 2E70A 3M53A 4XU2A 4A4EA 1M5Q1 2DZCA 2D0QB 4FSXA 4J7IA 4N0AA 3MEWA 2EJFA 5CVIA 3BFMA 3FEOA 3TCJA 4C0FA 3OYNA 2FVUA 2EYQA 2V8JA 4J8OA 3SWNB 5GAOn 4R56A 2F5KA 4M7AB 1P92A 4XU0A 3HSBA 1IZ6A 3OS0A 4LDVA 3C4SA 4Y91A 3C94A 1QVFA 3OYFA 4A4FA 3S3NA 4BE0A 3LWIA 3RUXA 4C8QB 4XTZA 4M7AG 2QA4A 3L2WA 4M75D 4MDWA 4QW2A 2K4YA 4DQ2A 2WSCE 1FX7A 1YBYA 2LQ8A 3CBOA 4DOVA 2E5QA 4XAXB 2YLBA 5I2MA 3A8HB 3QUIA 4HT8A 4OGCA 2PVGB 3QG1A 1FXXA 1AHJB 1M1GA 3RKYA 2ZPFB 3TEEA 5FRNA 1U1SA 5J3BA 3FJPA 3JB9I 2ZPBB 1Q7YC 4PJOC 3OYAA 2RA2A 2XHCA 3RKWA 5CCAA 2GFAA 5CR2A 4A4GA 3M57A 2DD4A 4EMKB 3V7RA 1Y96A 3SDZA 2RHIA 4VUBA 3OYGA 5LJ3f 5GMKl 2XKOC 1VQ7A 4M77B 4C92D 3J7AF 2D9TA 2EIFA 1VQ5A 3JCMc 2VUBA 1MGQA 3ME9A 1KG1A 2O01E 2DKGA 1Y7XA 3LGFA 3QJYA 4M78F 5GAMj 1HXDA 2RHXA 3SB2A 5GMKe 3QIIA 4A4KA 5I21A 3HKSA 5L8RE 2RHUA 3OYCA 2EQJA 2K2VA 1K73U 4JDSA 3SD4A 1YJWT 3FIFA 5CKBA 3CMAT 3G7ZA 1WGSA 4XU3A 3HP9A 5DLOA 1BI0A 4KULA 4FL6A 2HQXA 3L2UA 4PJOD 2PU9B 2DK3A 2YHTA 3CEYA 3LLRA 1BYMA 4XK8E 3G4ST 3OBYA 1K73C 2LQKA 1QP3A 3NFCA 4M78E 2H3JA 2FHDA 4C92A 2L8DA 4L5GA 1N9SA 5CIUA 5GANh 1VQKT 3TREA 1YITA 2D6FA 4A4HA 4BACA 3P8DA 3UDCA 2AHJB 3OW2A 3VUZA 3X20B 3LWHA 1KHCA 2A3LA 3ZFJA 3OA6A 4EDUA 2L89A 4M78B 1HK9A 4M75B 5GAN2 3JB9G 4IUVA 3A8LB 2E1HA 3G71A 3JSCA 3OYHA 2BKDN 2EQKA 4JRIA 2E41A 1EIFA 2MF2A 1QP2A 5J26A 3EAEA 4BY6C 3PIPA 4PJOA 1TH7A 3M58A 3P8HA 4XTVA 4QVDA 3CCUT 1KHIA 1QVFS 2K5LA 4BDYA 1IREB 2VXFA 1UEBA 3M59A 4B9XA 1X75C 2KSSA 2XG8D 3L2RA 2MWOA 2ZZDA 3HFOA 3J81E 4PJOG 3LGLA 5C0MA 5IN1A 4ZN3A 5DY9A 3G6ET 3LW5E 1N8RU 3CCET 4M7DG 2P4TA 2X4XA 2KAFA 3V8JA 3V8LA 4C8QA 3JCMX 4HT9A 2E6NA 1G5VA 4HCBA 4KBMB 2RHZA 4M77D 3CCVA 4JJNK 4ZTFA 1YHQT 1BI1A 1KQ1A 1VQ8T 3I55A 5GAN4 2JNGA 3OYKA 2OAUA 2ZPEB 2F69A 3GNFB 4M75F 4JRPA 2K5FA 3JCMW 3DB3A 3CCQA 1OYXA 1FWZA 1PSFA 2P0QA 2KVQG 3CMAA 2VXEA 3OYJA 5FRMA 4F7UE 2DJZA 2XIDA 2EJ9A 5LJ3g 3QJ6A 3OYYA 2V8IA 3OYIA 2DTOA 2RK1A 3L2VA 4XQ3A 5KE3A 3L2QA 1NJIU 4IKFA 1JBMA 4OB3B 3PMTA 4EMKA 3N5BB 5IAYA 3GPLA 4X9DA 1YJNA 2XD0A 2RJEA 2E64A 4HA8A 5CKHA 3CC7T 1VQ6A 3V7SA 2EFIA 3CC2A 1Q82C 1WPYA 2Y90A 2DD5A 2LRQA 3CPWS 4OF1A 1Q81U 2DEQA 3LX7A 2EKOA 2I2LA 1D3BB 4ME7A 2LCLA 2R58A 2DPPB 5GAMe 3JCMb 1BKBA 3ZBDA 1VQPA 4IUQA 3CPWA 2X35A 2GFUA 3H6ZA 5FU7C 2QA4T 2X4JA 1NE8A 5LL6S 2QEXA 5GAN8 1YJ9T 4N4HA 4C92E 4TVRA 1YJWA 2JTFA 1G3WA 3S3MA 4ZGDB 1G3YA 3FDRA 5LJ5g 1VQ9T 5A2QE 2XI9A 4OGEA 2WACA 2QTXA 5KH6A 2RK2A 1QW1A 3RESA 5FROA 2CZ7B 3JB9H 3OSVA 3PIOA 3LYIA 2YLCA 4XU1A 4J5YA 2KDSA 1UGRB 2JN0A 2LT1A 1XOVA 4M75G 5GAN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 B;  4C92 D;  1M8V A;  5LJ5 e;  3JCM c;  2EJG A;  4RCC A;  1MGQ A;  4M78 D;  4NOY A;  4J6W A;  4C8Q C;  4C8Q D;  5LJ5 f;  2DKG A;  3QO3 A;  4V2S A;  4M78 F;  5GAM j;  1HXD A;  2HNI A;  3BW1 A;  4NL2 A;  4M77 A;  3SB2 A;  5GAN 6;  5GMK e;  5GAM h;  5LJ3 h;  3EFR A;  4C92 C;  5I21 A;  2E65 A;  5GAO l;  3GIB A;  1H64 1;  1BIA A;  3INZ A;  5GAO r;  4M7A C;  1LJO A;  3SWN C;  3FIF A;  4A53 A;  2ZGW A;  5GAN j;  4JRK A;  3JB9 J;  1LOJ A;  2RM4 A;  3M4G A;  1WQW A;  4M78 G;  4N0A C;  4XU3 A;  4F7U B;  5GAM f;  5GMK l;  5GAM d;  5GAN d;  4NL3 A;  4M7A D;  3EFS A;  5LJ3 d;  4X9C A;  4F7U A;  5GMK m;  3QSU A;  4M7D B;  1BIB A;  4M7D E;  2YHT A;  4M7A F;  4PJO D;  3JB9 F;  4MML A;  3BY7 A;  1I5L A;  4C92 F;  4M78 E;  4C92 A;  4M78 C;  1N9S A;  5GAN h;  2DXT A;  3JCM J;  4M78 A;  5GAO q;  4XTY A;  1I4K 1;  4XTX A;  5LJ3 j;  3RIR A;  5GAN g;  5GAO p;  4M75 E;  5GAN 5;  2EAY A;  4M78 B;  1HK9 A;  4JUV A;  4M75 B;  4F7U G;  3JCM Q;  5GAN 2;  3JB9 G;  1JRI A;  1LNX A;  4C8Q G;  3AHU A;  5GAN 7;  2E1H A;  2E10 A;  4MMK A;  3RKX A;  3RER A;  1I8F A;  4JRI A;  2DTH A;  5GAM g;  4QVC A;  1B34 B;  2E41 A;  4M7D C;  3JCM d;  4PJO A;  1TH7 A;  4XTV A;  1B34 A;  1WQ7 A;  3FB9 A;  4QVD A;  5LJ3 e;  1N9R A;  4M77 G;  2VXF A;  5GAN f;  3JB9 D;  2DVE A;  2EWN A;  3V8K A;  3HFO A;  4PJO G;  4C92 B;  4HT9 A;  3QHS A;  4M75 C;  5DY9 A;  3JCM h;  4M77 E;  4M7D G;  2CGH A;  4PNO A;  2VC8 A;  4XTU A;  3V8J A;  3V8L A;  4C8Q A;  3JCM X;  5LJ5 j;  3JCM V;  3JCM g;  4M77 D;  5LJ5 d;  1KQ1 A;  3JCM P;  4M77 C;  4A54 A;  5GAN 4;  4J6X A;  3JCM f;  5GMK j;  4M75 A;  3L1A A;  5GMK h;  4M75 F;  2RD1 A;  4EMK C;  3JCM W;  5LJ5 h;  2VXE A;  5GAN e;  4M7A A;  4F7U F;  4F7U E;  2DJZ A;  4PJO B;  1U1T A;  2EJ9 A;  4XU2 A;  1M5Q 1;  2DZC A;  3PGG A;  4C8Q E;  4N0A A;  5LJ3 g;  1I81 A;  2DTO A;  3BFM A;  2DXU A;  2EJF A;  4XQ3 A;  5CAI A;  3SWN B;  5GAO n;  1JBM A;  4EMK A;  4M7A B;  5GMK i;  4M7D D;  4PJO E;  4XTW A;  4XU0 A;  3SWN A;  3HSB A;  4M7A E;  4X9D A;  4Y91 A;  3HFN A;  2E64 A;  4HA8 A;  4RCB A;  3V7S A;  2Y90 A;  2FYK A;  1D3B A;  1WPY A;  2RB6 A;  3RUX A;  4C8Q B;  4EMH A;  4XTZ A;  4EMG A;  2DEQ A;  1KQ2 A;  2I2L A;  3JCM e;  1D3B B;  4M7A G;  4M75 D;  2FB7 A;  4C8Q F;  4C92 G;  5GAM e;  4DQ2 A;  3JCM b;  1YCY A;  2YLB A;  3QUI A;  4HT8 A;  3RKY A;  5GAN 8;  4C92 E;  1U1S A;  5GAO m;  4JLI A;  3FJP A;  3JB9 I;  1X01 A;  5LJ5 g;  3L2Z A;  4M7D F;  4PJO C;  4M7D A;  4OP0 A;  2RA2 A;  2DTI A;  3RKW A;  2QTX A;  4PJO F;  3V7C A;  2DZ9 A;  3BDU A;  3RES A;  3JB9 H;  1WNL A;  4EMK B;  3V7R A;  4WF2 A;  1Y96 A;  2YLC A;  2K57 A;  4XU1 A;  4M77 F;  4J6Y A;  3VU3 C;  4J5Y A;  2JN0 A;  1Y96 B;  5LJ3 f;  4M75 G;  5GAN 3; 
#chains in the Genus database with same CATH topology
 2KI7 A;  4KUD K;  4R55 A;  2L5Q A;  3I55 T;  1VQ6 A;  2IIM A;  4IUU A;  1I07 A;  1ZBX A;  1W6X A;  2GBQ A;  2ED1 A;  5GAN d;  2O31 A;  4NL3 A;  5LJ3 d;  4EIK A;  5KCH A;  2YXY A;  4C0D C;  2X4Y A;  5I22 A;  3LH5 A;  4PFP A;  3ZEH A;  1Q82 U;  3M0T A;  3CME A;  1JB0 E;  1LNX A;  4C8Q G;  5GAN 7;  1B34 B;  2RO0 A;  3NTI A;  2KRS A;  2D0N A;  5LJ3 e;  1ZSZ C;  4M77 G;  1BK2 A;  2WSF E;  5KE2 A;  1ZA2 B;  3JCM h;  2QYZ A;  4ELZ C;  4C0Z A;  3KUF A;  1VQ7 T;  2VC8 A;  2LZ6 B;  4XTU A;  4F16 A;  2Y4X A;  2PUK B;  3JCM P;  3EGU A;  3RR6 A;  2DYB A;  3GOX A;  1I0C A;  4J9C A;  1R0B G;  3C95 A;  4JJD A;  2W10 A;  2KRO A;  3VRY A;  1U3O A;  1NYF A;  1E6G A;  3M55 A;  2XDB A;  1JQQ A;  4PFO A;  2L2P A;  3PE0 A;  1VQ6 T;  1YCY A;  3CME T;  4OVA A;  2X3X D;  1U8R A;  4BD3 A;  2EGA A;  4E7S A;  1N27 A;  1X01 A;  5EC7 A;  2KYB A;  2JVV A;  2MWP A;  3CXC S;  2XK0 A;  2FEI A;  2KE9 A;  4OB0 B;  1WYX A;  1VQN Q;  1Y96 B;  2DA9 A;  1NM7 A;  1UJY A;  1BCM A;  2GNC A;  3R6O A;  4PL6 A;  4LDY A;  1K0S A;  4O6J A;  2E65 A;  3BDL A;  1LJO A;  4J9H A;  1AOJ A;  1U5S A;  3SWN C;  2D8J A;  2RJD A;  5GAN j;  1WHJ A;  4F04 B;  3CQT A;  4DEY A;  2CT3 A;  2MI6 A;  4PJN A;  1M9S A;  1ZX6 A;  5GAO q;  1WIE A;  4XTX A;  2LNV A;  1RAC B;  3FJ5 A;  4M75 E;  3OMG A;  2NLU A;  2OTJ A;  2IG0 A;  2CH4 A;  3NPF A;  2J6K A;  1I8F A;  2RHY A;  4IIO A;  2G6F X;  2QGF B;  3CCM A;  4RMO A;  1UEC A;  2F1L A;  1KQS S;  1N6A A;  2DFU A;  1Y71 A;  2QXF A;  1QVG S;  5LJ5 j;  4FT4 A;  1G2B A;  4NS5 A;  4A54 A;  3VS0 A;  1VQ4 A;  3T9N A;  4M7A A;  2LJ1 A;  3PGG A;  1RL2 A;  1VQM A;  5CAI A;  2FZG B;  1UG1 A;  3EGD A;  4XTW A;  3HFN A;  2FRW A;  1UFF A;  4J7F A;  3I56 T;  1OPL A;  2DE0 X;  4II1 A;  1S1N A;  2K3X A;  4C8Q F;  4C92 G;  3A8G B;  3PMI A;  3FLG A;  4JS5 A;  4ELY C;  4QT7 A;  2JS0 A;  4HXJ A;  2W0Z A;  2O4X A;  3DKM A;  5ECA A;  4ANJ A;  2ABL A;  2PVO B;  1W2B S;  2PZ1 A;  1WXB A;  3BDU A;  1WNL A;  1SRL A;  5FU6 C;  4WF2 A;  1V29 B;  2XDP A;  1GCQ C;  2SRC A;  3CCE A;  2R5M A;  2JXB A;  5IT9 E;  1YIJ T;  2F5T X;  2CKK A;  1M8V A;  1NPR A;  1WZO A;  2DF6 A;  1VQL Q;  3CCJ T;  1VQ8 Q;  4JS4 A;  4C92 C;  1UGP B;  3INZ A;  2JMA A;  2GTO A;  3TU4 K;  1ACM B;  4PLL A;  4YTL A;  4LDU A;  4X9C A;  1M1K U;  1MV3 A;  2DXB A;  2A28 A;  3JB9 F;  8AT1 B;  4PKC C;  2DBK A;  3RMS A;  2HQE A;  1KD1 R;  3GLX A;  1X6B A;  1X69 A;  3CCS A;  5AYF A;  1KC8 U;  2RQV A;  2C06 A;  3RKX A;  5GAM g;  2DTH A;  4DA4 A;  2CRE A;  2OTJ Q;  1B34 A;  1WQ7 A;  2JTM A;  4ORZ A;  3KXT A;  3G71 T;  1N9R A;  3DB4 A;  1QVF P;  3JB9 D;  2EYZ A;  1RLQ C;  3GF5 A;  3V8K A;  4K11 A;  2K79 A;  4J9D A;  2CGH A;  3O8V A;  2MPX C;  2QQ9 A;  2GTJ A;  2CZ1 B;  1D1B A;  1E6H A;  2QG9 B;  3EFO A;  4KH1 B;  1M8M A;  4M75 A;  1OI1 A;  3E9G A;  2HZY A;  2VYT A;  1OOT A;  3M56 A;  2HKQ B;  4ESR A;  1RI0 A;  5DLQ E;  4LE9 A;  1VQL T;  4GLK A;  3M53 A;  2HL3 A;  4J7I A;  1H3Z A;  3FEO A;  1UHF A;  2FVU A;  2V8J A;  3G4S Q;  2F5K A;  1YIJ Q;  1P92 A;  4XU0 A;  4Y91 A;  1I1J A;  3C94 A;  1QVF A;  1TOV A;  1WFW A;  3RUX A;  4C8Q B;  4MDW A;  4OMP A;  4DQ2 A;  1HD3 A;  3CBO A;  3QUI A;  1TTH B;  4HT8 A;  2PVG B;  3U23 A;  1AHJ B;  1U1S A;  3FJP A;  3JB9 I;  4PJO C;  3OYA A;  2KNB B;  2YSQ A;  3RKW A;  2GFA A;  2YRD A;  3M57 A;  2DD4 A;  1ZBJ A;  3SDZ A;  3CCR Q;  4VUB A;  2L0A A;  4C92 D;  1ZUK A;  1VYU A;  2VUB A;  1KG1 A;  3LGF A;  1CKA A;  1K76 A;  2DRM A;  3QJY A;  2RHX A;  4A4K A;  5I21 A;  1BCO A;  2RHU A;  2YWW A;  1K73 U;  1YJW T;  2QAS A;  3G7Z A;  3HP9 A;  5DLO A;  3L2U A;  2DK3 A;  3CEY A;  3OBY A;  1K73 C;  1QP3 A;  2H3J A;  4C92 A;  2QTV A;  4L5G A;  3H0H A;  3UDC A;  2AHJ B;  2DYI A;  3OW2 A;  2NUT A;  3X20 B;  1R77 A;  4M75 B;  1VQM Q;  2E1H A;  3JSC A;  3OYH A;  1PC0 A;  2BKD N;  9ATC B;  3EAE A;  4QVD A;  3EG9 B;  3CCU T;  1QVF S;  1NYG A;  4BDY A;  1IRE B;  3VRZ A;  1ABQ A;  2KSS A;  3CD6 Q;  4PJO G;  4ZN3 A;  4M7D G;  5IH2 A;  2KAF A;  3V8L A;  2RHZ A;  1BI1 A;  1K0X A;  5GAN 4;  1AZE A;  2ZPE B;  3GNF B;  2F69 A;  4M75 F;  4JRP A;  4RTU A;  1FWZ A;  2MOX A;  2VXE A;  4F7U E;  2XID A;  4E7Z A;  2CP2 A;  5HCK A;  1WXU A;  4X1V A;  3E2U A;  5KYU B;  4DBR A;  8ATC B;  2RJE A;  2E64 A;  3CC7 T;  2EFI A;  3CC2 A;  1Q82 C;  2DD5 A;  4OF1 A;  2EKO A;  4ME7 A;  2LCL A;  2COW A;  4IUQ A;  2OX7 A;  3CPW A;  2X35 A;  1BU1 A;  5FU7 C;  2QA4 T;  5FWC A;  2CP3 A;  2YUN A;  2X4J A;  5LL6 S;  4HCK A;  1T3S A;  4TVR A;  3S3M A;  1G3Y A;  2XI9 A;  1GL5 A;  4OGE A;  2WAC A;  5FRO A;  1W2B P;  3PIO A;  2ECZ A;  4XU1 A;  3VS2 A;  4AMC A;  3ZL7 C;  5KYN A;  1QKW A;  3CCS Q;  2COZ A;  4GBQ A;  4BB7 A;  5LJ5 f;  4NOY A;  4BI4 A;  3NTK A;  4C8Q D;  3QO3 A;  3CCL Q;  1M3B A;  4B9W A;  1EFN A;  2V26 A;  2DLP A;  4OML A;  4CC7 A;  4F7U B;  5HKC A;  2J06 A;  5GAM f;  1S72 Q;  2ZPH B;  3E19 A;  4Z89 A;  5GMK m;  3QSU A;  1UGQ B;  2PUO B;  2DXT A;  2DEU A;  3A98 A;  4C5E A;  3CCE Q;  5LJ3 j;  2PNI A;  5I2S A;  4E7K A;  1XNI A;  1VQL A;  3QKJ A;  2H3E B;  1M90 R;  1GXI E;  5CKD A;  2V1R A;  2RQW A;  1NG2 A;  2JS2 A;  1PSE A;  4HCZ A;  1YNZ A;  4HT9 A;  4Z8A A;  2HBP A;  4J9E A;  4AG2 C;  3I56 A;  3EFO B;  2XDD A;  1JU5 C;  5C6S A;  3OS2 A;  1UHC A;  3P8B B;  3L1A A;  1FMK A;  4FU6 A;  1WHK A;  1JO8 A;  5L23 A;  4ZGJ B;  5IXF A;  2BIV A;  3I55 Q;  2GQV A;  2VWF A;  2BZY A;  2LTO A;  1KQS A;  4M7D D;  1VIE A;  3VS4 A;  1W4S A;  3KFV A;  2CP7 A;  3HPW A;  3F70 A;  5KYW A;  1JEG A;  1OX9 A;  2JJ9 A;  5KCO A;  4JZ4 A;  3PT9 A;  5GJV B;  3QZ5 B;  1PWT A;  1WDX A;  1NLP C;  1OPK A;  4Q5W A;  2FPD A;  2MAM A;  1QCO A;  3L2Z A;  2Z0W A;  2DTI A;  4PJO F;  4OMQ A;  1S72 A;  2RI2 A;  1TUD A;  1H8K A;  2CP0 A;  2KYM A;  1NZ9 A;  2QDY B;  2DXC A;  4RCC A;  2DET A;  2A7Y A;  3SFM A;  1YHQ A;  2HNI A;  2DJQ A;  1V76 A;  5LJ3 h;  2LJ0 A;  3QPH A;  1KK7 A;  3GIB A;  2QQA A;  1H64 1;  4KGX B;  3VS3 A;  4N0A C;  4M78 G;  5GAO m;  2NUP A;  3EFS A;  1W1F A;  2EBP A;  2FO0 A;  2JW4 A;  4HCC A;  3E9F A;  2RF0 A;  4BI8 B;  2K9G A;  4M78 C;  1WLP B;  3JCM J;  4UC4 A;  4XTY A;  3JAM E;  1OUL A;  4EPC A;  4BI3 A;  4QQG A;  3CCJ A;  1VA7 A;  5GAO p;  3MEA A;  1DJ7 B;  4JRQ A;  2E10 A;  1VQN A;  3JCM d;  4BE2 A;  3NHN A;  1SHG A;  2CZ0 B;  2D1X A;  3OYE A;  4BE1 A;  2FG0 A;  1S72 T;  1GRI A;  5HY6 A;  3I5R A;  2RNA A;  1GBQ A;  4QKU A;  4KGZ B;  3Q1J A;  3H8Z A;  2QQR A;  3CCL T;  2PQW A;  3CD6 A;  4KUI A;  3QBY A;  5LJ5 h;  3EGX A;  2OI3 A;  1WJR A;  1AZG B;  2OTL A;  2DIQ A;  2BE7 D;  1R0C B;  1KSW A;  2O4X B;  5IHI A;  4GY5 A;  2FYK A;  3QWY A;  3WVD B;  2EQI A;  2MMP A;  1D0X A;  4RTZ A;  4JZ3 A;  1K9M U;  4CC3 A;  5FLX E;  1CKB A;  3CCV T;  1M90 C;  4CC2 A;  4JLI A;  3MP6 A;  3URG A;  4E2F B;  2KK4 A;  4M7D F;  1Q81 R;  2CUD A;  2DZ9 A;  3H0F A;  3VU3 C;  1JJ2 P;  4LN2 A;  2O88 A;  2V8K A;  2RI3 A;  1YI2 T;  4IUR A;  2VAS A;  4C8Q C;  3PVQ A;  3BW1 A;  5DM7 R;  3EFR A;  2L3P A;  3QXE B;  2YRC A;  2OJ2 A;  1X27 A;  3G4S A;  1VQ4 Q;  1WQW A;  1Q95 G;  2KMT A;  4M7A D;  1UE9 A;  1C6V X;  3NTH A;  2EQU A;  3MET A;  4M78 A;  1N8R R;  3I9Q A;  2QI2 A;  3X26 B;  1K8A U;  2EQM A;  2DER A;  2EAY A;  1NPP A;  1VOM A;  3CCR T;  2QGG A;  3AHU A;  4E7J A;  4Y92 A;  1RAI B;  1RUW A;  2PVD B;  3UWN A;  4IUP A;  1QWE A;  2EWN A;  4MZM A;  3M54 A;  4BUG A;  1YJW Q;  1YIT T;  4OB2 B;  2AZV A;  1ZLM A;  2NUT B;  1QMC A;  3A5Z B;  1H92 A;  3THK A;  2GF7 A;  3MEW A;  2EJF A;  5CVI A;  3BFM A;  5GAO n;  1ZUY A;  2GQI A;  5KYW B;  3S3N A;  2QA4 A;  1PRM C;  2LQ8 A;  2E5Q A;  2YLB A;  4OGC A;  3QG1 A;  1M1G A;  2ZPF B;  5J3B A;  5FWB A;  5AT1 B;  3D7S B;  1I5O B;  2AKL A;  4EMK B;  2RHI A;  2AZS A;  3OYG A;  5GMK l;  1VQ7 A;  3J7A F;  2D9T A;  2EIF A;  1VQ5 A;  1RLP C;  3JCM c;  3ME9 A;  1MGQ A;  1Q82 R;  1HXD A;  5GMK e;  3SB2 A;  3M0Q A;  3QII A;  2K2V A;  1GFD A;  4JDS A;  1RAB B;  3CMA T;  1M2V B;  1B3Q A;  2HQX A;  4PJO D;  2YHT A;  1K1Z A;  3VS6 A;  2FHD A;  2BE9 B;  5CIU A;  4E6R A;  1YIT A;  1LCK A;  2KXD A;  2O9V A;  3P8D A;  2HL5 C;  2OAW A;  1KHC A;  3TVT A;  2YT6 A;  1MMG A;  1GCP A;  3A8L B;  4FYV B;  4JRI A;  2EQK A;  2E41 A;  4J9I A;  5J26 A;  1QP2 A;  3PIP A;  3I35 A;  3M58 A;  4XTV A;  1KHI A;  2K5L A;  1SHF A;  1X75 C;  2EPD A;  2MWO A;  3LGL A;  2J6O A;  5C0M A;  2MK5 A;  3CCE T;  2P4T A;  2X4X A;  3V8J A;  3AT1 B;  1MV0 B;  4KBM B;  4JJN K;  4M77 D;  1VQ8 T;  2JNG A;  1GCQ A;  2OAU A;  1KC8 R;  2K5F A;  7AT1 B;  1XJW B;  2KVQ G;  3I5S A;  3OYJ A;  2EJ9 A;  2V8I A;  2DTO A;  2RK1 A;  5KE3 A;  3EG2 A;  3L2Q A;  1JBM A;  4EMK A;  1PCX A;  5IAY A;  3GPL A;  4AT1 B;  1AWO A;  1WPY A;  2Y90 A;  3CPW P;  2LRQ A;  3CPW S;  1Q81 U;  1KFZ A;  3LX7 A;  2I2L A;  1AWJ A;  4ZNX A;  1AT1 B;  1D1C A;  3JCM b;  2ENM A;  5IXB A;  2M0Y A;  3I56 Q;  1A0N B;  5KYU A;  4OMO A;  1G3W A;  4OMM A;  4ZGD B;  3FDR A;  1VQ9 T;  2QTX A;  2RK2 A;  1QW1 A;  3VS7 A;  2KDS A;  2JN0 A;  3NGP A;  5GAN 3;  3JV3 A;  1N5Z A;  2EJG A;  4FYX B;  3CCS T;  3VKI A;  1Q81 C;  3FC3 A;  4M77 A;  4ZGE B;  1MHN A;  3GBQ A;  3JRZ A;  1UGV A;  4C5G A;  1JXO A;  4JRK A;  3A8O B;  2L3S A;  1KD1 U;  1E7O A;  1YI2 Q;  4PK4 A;  4MML A;  2HSE B;  1I5L A;  4J83 A;  3MPU B;  4JJC A;  1JXM A;  2CYZ B;  1UB4 A;  3QYG B;  4FW2 A;  2KBT A;  1AVZ C;  3HTR A;  4D8K A;  5GAN g;  3CCQ Q;  4LD9 K;  3CD6 T;  3CC7 Q;  3ULR B;  1IHW A;  3E1S A;  3DLM A;  3CCQ T;  1M3A A;  4QVC A;  1SSF A;  1KQS P;  1ZSZ B;  4M7D C;  3UT1 A;  3OS1 A;  3GP8 A;  2C0T A;  1VQM T;  2ZPI B;  3CCL A;  2P0K A;  1OQK A;  2VV5 A;  4BDZ A;  4FIB A;  1OEB A;  1SG5 A;  2NUZ A;  4JJB A;  1TUG B;  5GMK h;  2P0P A;  1IB8 A;  2DO3 A;  1OX8 A;  1HYO A;  2YDL A;  1YJ9 A;  1VQN T;  4KRT A;  2ZCF B;  3EH1 A;  2E6Z A;  3MEV A;  3HL8 A;  5CQX A;  3M5A A;  4DOW A;  5FU7 B;  2KT1 A;  1M2O A;  4KT0 E;  1YIJ A;  2RB6 A;  1VQ9 Q;  3DLL A;  4EMG A;  3JCM e;  3CME Q;  2CUB A;  5I11 A;  1Q86 R;  3RNJ A;  1U06 A;  5FW9 A;  4N4I A;  1D1A A;  1TWB A;  4ZTJ A;  2X3W D;  1YWP A;  3RBB B;  4OP0 A;  2KRM A;  1IHV A;  2M0O A;  3IQL A;  4X34 A;  2K57 A;  1K73 R;  4M77 F;  4Y28 E;  1YI2 A;  2K5I A;  2JZ2 A;  2FPE A;  2KR3 A;  2JT4 A;  4AG1 C;  1FMW A;  5IHK A;  1RAD B;  5LJ5 e;  2M02 A;  2MCN A;  4V2S A;  1NEG A;  1MMD A;  3G4S T;  4RTY A;  2YRV A;  1R8O B;  3RMQ A;  3PNW C;  2QK0 A;  3MCA B;  3OMC A;  2ZGW A;  1LOJ A;  5GAM d;  3MP8 A;  2XMF A;  2QQS A;  3QWX X;  2K3Y A;  5CQY A;  1NEB A;  4FM4 B;  1BBZ A;  4E7L A;  2O2O A;  1T0H A;  1JRI A;  1WX6 A;  2LT4 A;  4HKE A;  5M9O A;  3EG9 A;  2J05 A;  3C12 A;  3OSS C;  2QQB A;  3MJX A;  2O9S A;  1VQK Q;  3CBM A;  2HCK A;  1PD0 A;  4MZT A;  2RI5 A;  1QLY A;  5CO7 A;  1IRX A;  3HRU A;  5D6Y A;  3CMA Q;  1JJ2 S;  2CS7 A;  4P5N A;  3S3O A;  3QZ9 B;  5GMK j;  3MKD A;  4RG2 A;  2R5A A;  2M1H A;  1QCF A;  4DBQ A;  3QDF A;  2VGM A;  2E12 A;  2L3Q A;  1M4Z A;  5J39 A;  2CH4 W;  4QQD A;  3FRN A;  2Y4Y A;  5GMK i;  3CCJ Q;  1K9M C;  4J9G A;  1D3B A;  4EMH A;  3EG0 A;  3HRS A;  2FB7 A;  3OW2 P;  2YUO A;  5EG2 A;  4RKU E;  2KRN A;  1NJI R;  1G3S A;  5FU6 B;  2LNH B;  2ROL A;  1XQH A;  3EGD B;  1TG0 A;  2RQR A;  2SEM A;  2MYS A;  3TSZ A;  1D0Z A;  1M3C A;  4JLG A;  5A0L A;  5D6X A;  2ZAE A;  2M16 A;  3PVL A;  4FYY B;  1M27 C;  3OY9 A;  2HMA A;  1PM3 A;  1VQ5 T;  2RH2 A;  3VV0 A;  3VS5 A;  4N4G A;  3M0U A;  1QVP A;  1X43 A;  3UPU A;  5GAO r;  4A53 A;  2L3R A;  3M4G A;  1ZQ1 A;  2LCC A;  4BY6 B;  2X51 A;  1PHT A;  4F7U A;  2I0N A;  1QQJ A;  2CP5 A;  1VUB A;  3HRT A;  4R0K A;  3CC2 T;  1K4U S;  1X2Q A;  4E7I A;  4MDX A;  3RIR A;  1HSQ A;  2K2M A;  3ER0 A;  5GAN 5;  2R57 A;  4E47 A;  4HVU A;  2RJC A;  2QA4 Q;  1WXT A;  3ASK A;  1LVK A;  4RG8 A;  2RJF A;  1ZHI A;  1ZUU A;  3QYH B;  4C92 B;  3CPF A;  2A08 A;  2GCX A;  1AEY A;  3JCM V;  1VQ4 T;  3OS5 A;  3PFS A;  5LJ5 d;  1UGS B;  1QKX A;  4M77 C;  1IGU A;  3OYL A;  3JCM f;  4FCY A;  1WHL A;  2ATC B;  4EMK C;  3NMZ C;  1VQ5 Q;  1IGQ A;  1FMV A;  5GAN e;  1KD1 C;  4A4E A;  4XU2 A;  1M5Q 1;  4FSX A;  5HK3 A;  5KYY B;  4N0A A;  4RTV A;  3OYN A;  4J8O A;  3SWN B;  2P4R A;  4A63 B;  4R56 A;  3HSB A;  4LDV A;  3C4S A;  4FW1 A;  4BE0 A;  4XTZ A;  4M7A G;  4M75 D;  4HVV A;  1Y0M A;  2K4Y A;  2WSC E;  1FX7 A;  1YBY A;  1M30 A;  2YUQ A;  4XAX B;  5I2M A;  3A8H B;  4D8D A;  2J7I A;  1FXX A;  3RKY A;  3TEE A;  5FRN A;  6AT1 B;  2BZ8 A;  5IHN A;  1WA7 A;  2E5K A;  1VQ6 Q;  3V7R A;  1Y96 A;  2E4H A;  5LJ3 f;  3UAT A;  2RQU A;  1VYT A;  1YCS B;  3HKS A;  5L8R E;  3OYC A;  2EQJ A;  3SD4 A;  1WGS A;  1NLO C;  1BI0 A;  1ZSG A;  3M0P A;  4FL6 A;  1K9A A;  3LLR A;  4XK8 E;  2LQK A;  3NFC A;  4M78 E;  2L8D A;  1N9S A;  2IPO B;  5GAN h;  1VQK T;  3TRE A;  4BAC A;  3VUZ A;  2A3L A;  1D0Y A;  3OA6 A;  2L89 A;  1J3T A;  1ZSZ A;  4IUV A;  4AFZ C;  3UA7 A;  3EG3 A;  2FZC B;  3G71 A;  3CXC P;  1OU8 A;  1Y57 A;  2RPN A;  4PJO A;  1VYV A;  3P8H A;  2RN8 A;  4WCI A;  3L2R A;  1PKT A;  3HFO A;  1TSF A;  1PG5 B;  2B86 A;  2BZX A;  5DY9 A;  5IN1 A;  1UJ0 A;  1N8R U;  1TS9 A;  1G5V A;  4ZTF A;  3CCV A;  1YHQ T;  1QVG P;  1VQ7 Q;  2DL8 A;  1ABO A;  3OYK A;  3DB3 A;  2ROT A;  3CCQ A;  1OYX A;  1PSF A;  5FRM A;  4LXC A;  3CMA A;  2DJZ A;  1UDL A;  5LJ3 g;  3EGX B;  3OYY A;  4XQ3 A;  4OB3 B;  1QCN A;  1BB9 A;  4X9D A;  2GGR A;  1SF9 A;  2EGC A;  3V7S A;  2DEQ A;  1D3B B;  2R58 A;  2DPP B;  4F14 A;  3G71 Q;  1BKB A;  3ZBD A;  1VQP A;  3TQ7 P;  1PKS A;  1UTI A;  1RAF B;  1YJ9 T;  1GBR A;  1SKU B;  5LJ5 g;  1M2V A;  2HSP A;  2EGE A;  4J9B A;  5KH6 A;  2DVJ A;  3LYI A;  2YLC A;  1AWX A;  1K9M R;  1X6G A;  1UGR B;  2DL4 A;  1XOV A;  4M75 G;  4CI0 C;  3CCR A;  2JUF A;  3OB9 A;  1VIF A;  5GAN 6;  4NL2 A;  5A0G A;  2DRK A;  2LX9 A;  4WTO B;  4MZP A;  2XIC A;  1QWF A;  4GLM A;  4M7D B;  5HK0 A;  1MMA A;  2DX1 A;  2G3R A;  3M0R A;  1VQ9 A;  4C92 F;  1TU0 B;  2HBW A;  1RAH B;  1W2B A;  1I4K 1;  3WVE B;  3G6E Q;  3BE3 A;  2RMO A;  4OMN A;  1T0J A;  2CT4 A;  4Z02 A;  2CSQ A;  4B6M A;  4C0D B;  3MP1 A;  1RAG B;  1W70 A;  4OB1 B;  2LP5 A;  2KY9 A;  3CC4 Q;  2OTL T;  5GAN f;  1PD1 A;  3EHR A;  1G83 A;  4C5H A;  1B7T A;  3QHS A;  1YJN T;  4CRI A;  3OYM A;  1F1B B;  2AKK A;  4LD6 A;  4L59 A;  2CZ6 B;  4F17 A;  4RTW A;  1GFC A;  3M9Q A;  1EZZ B;  1WJS A;  1VQO T;  3CC4 A;  2RD1 A;  3A1P A;  2QEX T;  1QVG A;  3EHQ A;  1Q7Y R;  4L6V 5;  2J6F A;  2CP6 A;  3OQ5 A;  4M7A E;  3SWN A;  3G6E A;  4AFU C;  4RCB A;  2WSE E;  1Q86 C;  4QQ6 A;  1RI9 A;  2KXC A;  2X4W A;  3QDR B;  1WJQ A;  2K6D A;  3CC4 T;  1VQO A;  2MIO A;  1HJD A;  1SSH A;  2HEQ A;  4HVW A;  2BUD A;  4M7D A;  4C5I A;  3SHW A;  1SEM A;  1WHM A;  3V7C A;  1M1K R;  2M51 A;  4J6Y A;  4E7H A;  3H41 A;  3MHX A;  2B8A A;  1SRM A;  2LMJ A;  2HAX A;  2PTK A;  1MNE A;  2DAQ A;  2LC4 A;  2AT1 B;  2QAZ A;  1K8A R;  3HHT B;  1D09 B;  1MMN A;  2M9U A;  4OMF B;  5GAO l;  2CSI A;  1BIA A;  4M7A C;  3S6W A;  3X28 B;  1OZ2 A;  1NJI C;  2EKH A;  1FYN A;  2RM4 A;  3SEM A;  1EX4 A;  4IIM A;  3M4Y A;  2K7A A;  2F2X A;  1BIB A;  2C0I A;  5D6W A;  4FYW B;  4M7A F;  4LUD A;  1Z9Q A;  3CXC A;  2RQT A;  2FZK B;  1VQ8 A;  3CCU Q;  1TUC A;  4ATO A;  4PLI A;  3J80 E;  4C0G A;  3UF4 A;  3OBW A;  2KGT A;  4DEX A;  4JUV A;  1X2K A;  3MEU A;  3VUB A;  4MMK A;  1M1K C;  2JTE A;  4LDX A;  2A36 A;  3CBP A;  1BI2 A;  1YJ9 Q;  1Y07 A;  1KC8 C;  4M75 C;  4LNP A;  3G1J A;  3VJP A;  1VQP Q;  3X24 B;  1H3H A;  4J9F A;  1MUZ A;  3RDV A;  3JCM g;  4ZN1 A;  1O9S A;  2KQW A;  2X9H A;  4J6X A;  3A8M B;  1MND A;  2BTT A;  2LQW A;  4F7U F;  2C0O A;  3PTA A;  1U1T A;  2JOY A;  4C8Q E;  1I81 A;  2DXU A;  2LDM A;  2ZPG B;  1JJ2 A;  1KIK A;  4CC4 B;  3CCU A;  2K3B A;  3WXM B;  1PNJ A;  1SPK A;  2DMO A;  1O75 A;  2EYW A;  1RAA B;  1YHQ Q;  5CKE A;  1LPL A;  3KBG A;  1N8R C;  3GNG A;  2A37 A;  4KH0 B;  3CCM Q;  1OZ3 A;  2V1Q A;  2JMC A;  1Q7Y U;  4FSS A;  2NUP B;  2HD0 A;  3VYG A;  5A0D A;  4PJL A;  2XU8 A;  2LQN A;  5CK9 A;  1YWO A;  1G3T A;  1VQK A;  2VGN A;  3H0I A;  1IXD A;  3MO8 A;  4M78 D;  3CC7 A;  4J6W A;  1Q86 U;  4LDW A;  4DBH A;  5GAM h;  1KQ2 A;  4O5V A;  3OYB A;  4D6W A;  4LUE A;  1RAE B;  3JB9 J;  3UA6 A;  4PJO E;  4IUT A;  4M7D E;  1YIT Q;  1PRL C;  3BY7 A;  3CCM T;  1M90 U;  2FRY A;  3OYD A;  2HQH A;  4PJM A;  5GJW B;  1X6O A;  4Z88 A;  4PJJ A;  1YFN A;  4QVZ A;  1M1F A;  2OTJ T;  2IVW A;  3L42 A;  4PFZ A;  4F7U G;  1WHG A;  4FT2 A;  4RTX A;  3JCM Q;  5KYX A;  3RER A;  2DL7 A;  3FB9 A;  4AFS C;  1NBE B;  2DIG A;  1YP5 A;  2NWM A;  2DVE A;  2NYS A;  3LH0 A;  5CKF A;  1IO6 A;  2DNU A;  4M77 E;  3OW2 S;  4PNO A;  3X25 B;  2LJ3 A;  5KYY A;  2QDL A;  2H8H A;  2LVM A;  1K8A C;  1G8X A;  2FL7 A;  2VVK A;  1VQP T;  3VYH B;  1B07 A;  1C1A A;  1BI3 A;  1XTD A;  2VKN A;  2DIL A;  1ARK A;  4PJO B;  1CSK A;  2E70 A;  2DZC A;  2D0Q B;  3TCJ A;  2LX7 A;  3O5Z A;  4C0F A;  2EYQ A;  1YN8 A;  4M7A B;  1IZ6 A;  3OS0 A;  3OYF A;  4A4F A;  1KJW A;  3LWI A;  3TSW A;  3L2W A;  4QW2 A;  2FPF A;  3REB B;  4DOV A;  3CCV Q;  2KEA A;  2HKN A;  2ZPB B;  1OV3 A;  1Q7Y C;  1C0M A;  2RA2 A;  2XHC A;  5D7U A;  5CCA A;  2COY A;  5CR2 A;  4A4G A;  2DBM A;  2E3H A;  2HDA A;  2XKO C;  4M77 B;  3REA B;  4JPB W;  4DBF A;  1OU9 A;  1T3L A;  2O01 E;  2D8H A;  1Y7X A;  2DKG A;  4M78 F;  5GAM j;  3CC2 Q;  1AD5 A;  2YUP A;  5KYX B;  1AWW A;  3VS1 A;  3FIF A;  5CKB A;  2QEX Q;  2EYX A;  4XU3 A;  4KUL A;  2AIR B;  4RTT A;  1VQO Q;  2PU9 B;  1BYM A;  3C0C A;  2D6F A;  4A4H A;  1YJN Q;  3LWH A;  3ZFJ A;  4EDU A;  4M78 B;  1HK9 A;  2F2V A;  5GAN 2;  3JB9 G;  2ESW A;  2OTL Q;  1EIF A;  2MF2 A;  4BY6 C;  1TH7 A;  2DL5 A;  4RUG A;  2VXF A;  1UEB A;  3M59 A;  4B9X A;  2XG8 D;  2ZZD A;  3J81 E;  3G6E T;  3LW5 E;  1V1C A;  2JM8 A;  4C8Q A;  3JCM X;  2E6N A;  3EG1 A;  4HCB A;  3M0S A;  1KQ1 A;  3H9N A;  3I55 A;  2DL3 A;  3JCM W;  2P0Q A;  3QJ6 A;  3OYI A;  3L2V A;  1Z9Z A;  2F2W A;  1NJI U;  4IKF A;  2A0F B;  2VB6 A;  3PMT A;  4KGV B;  3N5B B;  2ED0 A;  1YJN A;  2XD0 A;  4HA8 A;  5CKH A;  2AK5 A;  3EH2 A;  2DM1 A;  2EW3 A;  4M4Z A;  1ZA1 B;  2CDT A;  5GAM e;  2EYY A;  2E3I A;  2JM9 A;  2LCS A;  3R6N A;  1TXQ A;  2GFU A;  1WI7 A;  3H6Z A;  1NE8 A;  2QEX A;  5GAN 8;  4N4H A;  4C92 E;  1YJW A;  2JTF A;  2KT8 A;  1WHH A;  5A2Q E;  2P84 A;  3RES A;  2CZ7 B;  3JB9 H;  3OSV A;  4J5Y A;  4AFQ C;  2EVR A;  2LT1 A;  1UUE A; 
#chains in the Genus database with same CATH homology
 4CI0 C;  4KUD K;  2EJG A;  3CCR A;  4R55 A;  2JUF A;  2L5Q A;  4BB7 A;  4NOY A;  5LJ5 f;  4BI4 A;  3NTK A;  3VKI A;  4C8Q D;  3I55 T;  3OB9 A;  1VIF A;  3QO3 A;  4IUU A;  5GAN 6;  4NL2 A;  5A0G A;  3FC3 A;  4M77 A;  4ZGE B;  1ZBX A;  2LX9 A;  1MHN A;  3JRZ A;  5HK3 A;  4B9W A;  4MZP A;  4C5G A;  2XIC A;  4JRK A;  4F7U B;  5HKC A;  5GAN d;  3A8O B;  1QVG S;  4NL3 A;  5GAM f;  2ZPH B;  5HK0 A;  5LJ3 d;  3E19 A;  5GMK m;  1KD1 U;  3QSU A;  4M7D B;  1UGQ B;  5KCH A;  2G3R A;  4MML A;  1I5L A;  4J83 A;  1VQ9 A;  2PUO B;  4C0D C;  4C92 F;  2X4Y A;  2DXT A;  2CYZ B;  1W2B A;  1UB4 A;  3QYG B;  4C5E A;  1I4K 1;  3WVE B;  5LJ3 j;  3ZEH A;  5I2S A;  5GAN g;  1Q82 U;  4LD9 K;  4E7K A;  3CD6 T;  1XNI A;  4Z02 A;  3CME A;  1JB0 E;  1VQL A;  3QKJ A;  1LNX A;  4C0D B;  4C8Q G;  5GAN 7;  1GXI E;  3E1S A;  3DLM A;  3CCQ T;  3MP1 A;  1B34 B;  2RO0 A;  1SSF A;  4QVC A;  5CKD A;  3NTI A;  4M7D C;  4OB1 B;  3UT1 A;  5LJ3 e;  2KY9 A;  3OS1 A;  3GP8 A;  1VQM T;  2OTL T;  4M77 G;  5GAN f;  2WSF E;  2ZPI B;  4C5H A;  1PSE A;  4HCZ A;  5KE2 A;  3CCL A;  2P0K A;  1Q81 C;  3QHS A;  3JCM h;  2VV5 A;  1YJN T;  4CRI A;  4ELZ C;  4C0Z A;  3OYM A;  4BDZ A;  3KUF A;  2HBP A;  4LD6 A;  2VC8 A;  4XTU A;  4FIB A;  3I56 A;  1VQ7 T;  4L59 A;  2Y4X A;  2XDD A;  2PUK B;  5C6S A;  2CZ6 B;  3OS2 A;  3JCM P;  3P8B B;  3M9Q A;  3L1A A;  5GMK h;  2P0P A;  1WJS A;  2DO3 A;  3GOX A;  1VQO T;  2RD1 A;  3CC4 A;  4FU6 A;  2QEX T;  1YJ9 A;  3C95 A;  1QVG A;  1VQN T;  2ZCF B;  2E6Z A;  3MEV A;  4ZGJ B;  2BIV A;  2GQV A;  3HL8 A;  5CQX A;  4L6V 5;  2LTO A;  1KQS A;  4M7D D;  3OQ5 A;  1VIE A;  4M7A E;  3SWN A;  3M5A A;  4DOW A;  5FU7 B;  3G6E A;  3M55 A;  4RCB A;  1W4S A;  2WSE E;  2XDB A;  4KT0 E;  1YIJ A;  2RB6 A;  1Q86 C;  3DLL A;  4EMG A;  3HPW A;  3F70 A;  3JCM e;  5KCO A;  4QQ6 A;  1VQ6 T;  1YCY A;  2X4W A;  4OVA A;  3CME T;  3QDR B;  1WJQ A;  4N4I A;  3PT9 A;  3QZ5 B;  4ZTJ A;  1U8R A;  4BD3 A;  4Q5W A;  2MAM A;  3CC4 T;  1VQO A;  1N27 A;  1X01 A;  3L2Z A;  2BUD A;  4OP0 A;  4M7D A;  4C5I A;  2DTI A;  2JVV A;  2MWP A;  4PJO F;  2M0O A;  3V7C A;  3CXC S;  1S72 A;  2RI2 A;  2XK0 A;  4X34 A;  2K57 A;  4OB0 B;  4M77 F;  4Y28 E;  4J6Y A;  1YI2 A;  2K5I A;  2JZ2 A;  1Y96 B;  4E7H A;  1NZ9 A;  2QDY B;  2B8A A;  3MHX A;  2DXC A;  2HAX A;  5LJ5 e;  4RCC A;  2DAQ A;  2LC4 A;  2A7Y A;  3SFM A;  1YHQ A;  3HHT B;  4V2S A;  2HNI A;  3R6O A;  4PL6 A;  4LDY A;  2M9U A;  4O6J A;  4OMF B;  5LJ3 h;  3QPH A;  2E65 A;  5GAO l;  3BDL A;  2YRV A;  2QQA A;  1H64 1;  1BIA A;  1R8O B;  3GIB A;  4M7A C;  3RMQ A;  3S6W A;  1LJO A;  3PNW C;  3SWN C;  3X28 B;  3MCA B;  3OMC A;  2RJD A;  1OZ2 A;  2ZGW A;  5GAN j;  1NJI C;  1LOJ A;  2RM4 A;  4M78 G;  4N0A C;  5GAO m;  3M4Y A;  5GAM d;  3EFS A;  4PJO B;  3MP8 A;  1BIB A;  5D6W A;  4M7A F;  4HCC A;  2QQS A;  2MI6 A;  3E9F A;  3CXC A;  4BI8 B;  4M78 C;  2K3Y A;  5CQY A;  1VQ8 A;  3JCM J;  4UC4 A;  1M9S A;  4XTY A;  5GAO q;  4XTX A;  3JAM E;  4ATO A;  4EPC A;  4FM4 B;  4PLI A;  4BI3 A;  3J80 E;  2LNV A;  4QQG A;  4C0G A;  3OBW A;  5GAO p;  3CCJ A;  4E7L A;  4M75 E;  3OMG A;  4JUV A;  3MEA A;  2NLU A;  1DJ7 B;  2OTJ A;  1JRI A;  2IG0 A;  3MEU A;  3VUB A;  4JRQ A;  2LT4 A;  2E10 A;  4HKE A;  4MMK A;  1M1K C;  1I8F A;  5M9O A;  1VQN A;  2RHY A;  3JCM d;  4LDX A;  4BE2 A;  3C12 A;  3OSS C;  3CBP A;  2CZ0 B;  1BI2 A;  2QQB A;  3OYE A;  4BE1 A;  1S72 T;  5HY6 A;  3CCM A;  4RMO A;  1Y07 A;  3CBM A;  1KQS S;  1KC8 C;  1N6A A;  4M75 C;  3VJP A;  4MZT A;  3X24 B;  2RI5 A;  1Y71 A;  5CO7 A;  2QXF A;  3H8Z A;  2QQR A;  3Q1J A;  5LJ5 j;  3HRU A;  4FT4 A;  5D6Y A;  3JCM g;  4ZN1 A;  3CCL T;  2PQW A;  4NS5 A;  1JJ2 S;  2CS7 A;  4P5N A;  3S3O A;  1O9S A;  3QZ9 B;  3CD6 A;  4A54 A;  2KQW A;  4J6X A;  4RG2 A;  4KUI A;  2R5A A;  3A8M B;  5GMK j;  2M1H A;  1VQ4 A;  3QBY A;  3T9N A;  2VGM A;  5LJ5 h;  2E12 A;  4F7U F;  4M7A A;  3PTA A;  1M4Z A;  1WJR A;  1U1T A;  2JOY A;  5J39 A;  3PGG A;  1RL2 A;  4C8Q E;  1VQM A;  2OTL A;  1I81 A;  2DXU A;  2LDM A;  5CAI A;  2DIQ A;  2ZPG B;  1JJ2 A;  4QQD A;  3FRN A;  2Y4Y A;  5GMK i;  4XTW A;  2O4X B;  3CCU A;  1K9M C;  3HFN A;  4GY5 A;  3WXM B;  1O75 A;  2FYK A;  1D3B A;  4J7F A;  3I56 T;  4EMH A;  3HRS A;  4II1 A;  5CKE A;  3WVD B;  2MMP A;  2FB7 A;  2K3X A;  4C8Q F;  3KBG A;  4C92 G;  3A8G B;  3PMI A;  3FLG A;  1K9M U;  5EG2 A;  4RKU E;  1N8R C;  3GNG A;  5FLX E;  4JS5 A;  1G3S A;  3CCV T;  1M90 C;  4ELY C;  5FU6 B;  1OZ3 A;  1XQH A;  2O4X A;  3DKM A;  4JLI A;  3MP6 A;  2PVO B;  3URG A;  1W2B S;  2KK4 A;  1Q7Y U;  4M7D F;  3CCS T;  2HD0 A;  2DZ9 A;  3BDU A;  3VYG A;  1WNL A;  5A0D A;  5FU6 C;  4JLG A;  2XU8 A;  4WF2 A;  5CK9 A;  1V29 B;  2XDP A;  3VU3 C;  5A0L A;  5D6X A;  2M16 A;  3CCE A;  2R5M A;  5IT9 E;  1YIJ T;  2F5T X;  2CKK A;  1G3T A;  1VQK A;  1M8V A;  2V8K A;  1NPR A;  2RI3 A;  2VGN A;  1YI2 T;  3MO8 A;  4IUR A;  3OY9 A;  4M78 D;  4C8Q C;  4J6W A;  3CC7 A;  1Q86 U;  4LDW A;  3CCJ T;  3BW1 A;  5GAM h;  1KQ2 A;  4O5V A;  5DM7 R;  4C92 C;  3EFR A;  4JS4 A;  1VQ5 T;  2RH2 A;  3OYB A;  3VV0 A;  4D6W A;  1UGP B;  3INZ A;  1QVP A;  3QXE B;  4N4G A;  3UPU A;  5GAO r;  3TU4 K;  3G4S A;  4A53 A;  4PLL A;  2L3R A;  3JB9 J;  3M4G A;  1WQW A;  4YTL A;  1ZQ1 A;  4IUT A;  2LCC A;  4PJO E;  4LDU A;  2KMT A;  4BY6 B;  4M7A D;  4X9C A;  4F7U A;  1M1K U;  4M7D E;  2DXB A;  3JB9 F;  1VUB A;  3BY7 A;  3CCM T;  1M90 U;  3OYD A;  3HRT A;  3NTH A;  4PKC C;  3CC2 T;  2EQU A;  3MET A;  4M78 A;  1X6O A;  4E7I A;  4MDX A;  4QVZ A;  1M1F A;  2QI2 A;  3RIR A;  2IVW A;  3X26 B;  1K8A U;  2OTJ T;  3L42 A;  3RMS A;  3ER0 A;  2HQE A;  2EQM A;  5GAN 5;  2EAY A;  4F7U G;  1NPP A;  2R57 A;  4FT2 A;  3GLX A;  3JCM Q;  3CCR T;  3CCS A;  3AHU A;  4E47 A;  5AYF A;  1KC8 U;  4E7J A;  2C06 A;  3RKX A;  3RER A;  5GAM g;  2DTH A;  2RJC A;  4DA4 A;  1B34 A;  1WQ7 A;  2JTM A;  3FB9 A;  3KXT A;  3G71 T;  1H3Z A;  1N9R A;  3ASK A;  4RG8 A;  3DB4 A;  2PVD B;  2RJF A;  2DIG A;  3JB9 D;  3UWN A;  1ZHI A;  2DVE A;  3LH0 A;  2EWN A;  4IUP A;  3GF5 A;  5CKF A;  3V8K A;  4MZM A;  3QYH B;  3M54 A;  4BUG A;  4C92 B;  3CPF A;  2GCX A;  4M77 E;  3OW2 S;  1YIT T;  2CGH A;  3O8V A;  4PNO A;  3X25 B;  4OB2 B;  2QQ9 A;  2CZ1 B;  3JCM V;  1VQ4 T;  2LVM A;  3OS5 A;  3PFS A;  5LJ5 d;  1UGS B;  1K8A C;  4M77 C;  2FL7 A;  3OYL A;  1VQP T;  3JCM f;  3VYH B;  3A5Z B;  4M75 A;  1OI1 A;  3E9G A;  1BI3 A;  1XTD A;  3M56 A;  2VYT A;  4EMK C;  1RI0 A;  5DLQ E;  5GAN e;  1VQL T;  1KD1 C;  2GF7 A;  4GLK A;  2E70 A;  3M53 A;  4XU2 A;  4A4E A;  1M5Q 1;  2DZC A;  2D0Q B;  4FSX A;  4J7I A;  4N0A A;  3MEW A;  2EJF A;  5CVI A;  3BFM A;  3FEO A;  3TCJ A;  4C0F A;  3OYN A;  2FVU A;  2EYQ A;  2V8J A;  4J8O A;  3SWN B;  5GAO n;  4R56 A;  2F5K A;  4M7A B;  1P92 A;  4XU0 A;  3HSB A;  1IZ6 A;  3OS0 A;  4LDV A;  3C4S A;  4Y91 A;  3C94 A;  1QVF A;  3OYF A;  4A4F A;  3S3N A;  4BE0 A;  3LWI A;  3RUX A;  4C8Q B;  4XTZ A;  4M7A G;  2QA4 A;  3L2W A;  4M75 D;  4MDW A;  4QW2 A;  2K4Y A;  4DQ2 A;  2WSC E;  1FX7 A;  1YBY A;  2LQ8 A;  3CBO A;  4DOV A;  2E5Q A;  4XAX B;  2YLB A;  5I2M A;  3A8H B;  3QUI A;  4HT8 A;  4OGC A;  2PVG B;  3QG1 A;  1FXX A;  1AHJ B;  1M1G A;  3RKY A;  2ZPF B;  3TEE A;  5FRN A;  1U1S A;  5J3B A;  3FJP A;  3JB9 I;  2ZPB B;  1Q7Y C;  4PJO C;  3OYA A;  2RA2 A;  2XHC A;  3RKW A;  5CCA A;  2GFA A;  5CR2 A;  4A4G A;  3M57 A;  2DD4 A;  4EMK B;  3V7R A;  1Y96 A;  3SDZ A;  2RHI A;  4VUB A;  3OYG A;  5LJ3 f;  5GMK l;  2XKO C;  1VQ7 A;  4M77 B;  4C92 D;  3J7A F;  2D9T A;  2EIF A;  1VQ5 A;  3JCM c;  2VUB A;  1MGQ A;  3ME9 A;  1KG1 A;  2O01 E;  2DKG A;  1Y7X A;  3LGF A;  3QJY A;  4M78 F;  5GAM j;  1HXD A;  2RHX A;  3SB2 A;  5GMK e;  3QII A;  4A4K A;  5I21 A;  3HKS A;  5L8R E;  2RHU A;  3OYC A;  2EQJ A;  2K2V A;  1K73 U;  4JDS A;  3SD4 A;  1YJW T;  3FIF A;  5CKB A;  3CMA T;  3G7Z A;  1WGS A;  4XU3 A;  3HP9 A;  5DLO A;  1BI0 A;  4KUL A;  4FL6 A;  2HQX A;  3L2U A;  4PJO D;  2PU9 B;  2DK3 A;  2YHT A;  3CEY A;  3LLR A;  1BYM A;  4XK8 E;  3G4S T;  3OBY A;  1K73 C;  2LQK A;  1QP3 A;  3NFC A;  4M78 E;  2H3J A;  2FHD A;  4C92 A;  2L8D A;  4L5G A;  1N9S A;  5CIU A;  5GAN h;  1VQK T;  3TRE A;  1YIT A;  2D6F A;  4A4H A;  4BAC A;  3P8D A;  3UDC A;  2AHJ B;  3OW2 A;  3VUZ A;  3X20 B;  3LWH A;  1KHC A;  2A3L A;  3ZFJ A;  3OA6 A;  4EDU A;  2L89 A;  4M78 B;  1HK9 A;  4M75 B;  5GAN 2;  3JB9 G;  4IUV A;  3A8L B;  2E1H A;  3G71 A;  3JSC A;  3OYH A;  2BKD N;  2EQK A;  4JRI A;  2E41 A;  1EIF A;  2MF2 A;  1QP2 A;  5J26 A;  3EAE A;  4BY6 C;  3PIP A;  4PJO A;  1TH7 A;  3M58 A;  3P8H A;  4XTV A;  4QVD A;  3CCU T;  1KHI A;  1QVF S;  2K5L A;  4BDY A;  1IRE B;  2VXF A;  1UEB A;  3M59 A;  4B9X A;  1X75 C;  2KSS A;  2XG8 D;  3L2R A;  2MWO A;  2ZZD A;  3HFO A;  3J81 E;  4PJO G;  3LGL A;  5C0M A;  5IN1 A;  4ZN3 A;  5DY9 A;  3G6E T;  3LW5 E;  1N8R U;  3CCE T;  4M7D G;  2P4T A;  2X4X A;  2KAF A;  3V8J A;  3V8L A;  4C8Q A;  3JCM X;  4HT9 A;  2E6N A;  1G5V A;  4HCB A;  4KBM B;  2RHZ A;  4M77 D;  3CCV A;  4JJN K;  4ZTF A;  1YHQ T;  1BI1 A;  1KQ1 A;  1VQ8 T;  3I55 A;  5GAN 4;  2JNG A;  3OYK A;  2OAU A;  2ZPE B;  2F69 A;  3GNF B;  4M75 F;  4JRP A;  2K5F A;  3JCM W;  3DB3 A;  3CCQ A;  1OYX A;  1FWZ A;  1PSF A;  2P0Q A;  2KVQ G;  3CMA A;  2VXE A;  3OYJ A;  5FRM A;  4F7U E;  2DJZ A;  2XID A;  2EJ9 A;  5LJ3 g;  3QJ6 A;  3OYY A;  2V8I A;  3OYI A;  2DTO A;  2RK1 A;  3L2V A;  4XQ3 A;  5KE3 A;  3L2Q A;  1NJI U;  4IKF A;  1JBM A;  4OB3 B;  3PMT A;  4EMK A;  3N5B B;  5IAY A;  3GPL A;  4X9D A;  1YJN A;  2XD0 A;  2RJE A;  2E64 A;  4HA8 A;  5CKH A;  3CC7 T;  1VQ6 A;  3V7S A;  2EFI A;  3CC2 A;  1Q82 C;  1WPY A;  2Y90 A;  2DD5 A;  2LRQ A;  3CPW S;  4OF1 A;  1Q81 U;  2DEQ A;  3LX7 A;  2EKO A;  2I2L A;  1D3B B;  4ME7 A;  2LCL A;  2R58 A;  2DPP B;  5GAM e;  3JCM b;  1BKB A;  3ZBD A;  1VQP A;  4IUQ A;  3CPW A;  2X35 A;  2GFU A;  3H6Z A;  5FU7 C;  2QA4 T;  2X4J A;  1NE8 A;  5LL6 S;  2QEX A;  5GAN 8;  1YJ9 T;  4N4H A;  4C92 E;  4TVR A;  1YJW A;  2JTF A;  1G3W A;  3S3M A;  4ZGD B;  1G3Y A;  3FDR A;  5LJ5 g;  1VQ9 T;  5A2Q E;  2XI9 A;  4OGE A;  2WAC A;  2QTX A;  5KH6 A;  2RK2 A;  1QW1 A;  3RES A;  5FRO A;  2CZ7 B;  3JB9 H;  3OSV A;  3PIO A;  3LYI A;  2YLC A;  4XU1 A;  4J5Y A;  2KDS A;  1UGR B;  2JN0 A;  2LT1 A;  1XOV A;  4M75 G;  5GAN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...