4XQ3A

Crystal structure of sso-smap2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
b'NPLKSLRTAINRIVLVKLKDGSEYIGKLEQTDGTMNLVLRDCTEIREGTSEPVAKYGRVLIRGSNILFISVDYETVMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Like-Sm ribonucleoprotein core
molecule tags Rna binding protein
source organism Sulfolobus solfataricus (strain 98/2)
publication title The Heptameric SmAP1 and SmAP2 Proteins of the Crenarchaeon Sulfolobus Solfataricus Bind to Common and Distinct RNA Targets.
pubmed doi rcsb
total genus 15
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2015-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xq3A00
1B34B 4C8QG 4M75G 4XTYA 5CAIA 5LJ5j 5GAN3 4M7DD 4XTZA 4A54A 1U1TA 4N0AA 3SWNA 3HSBA 1JRIA 3HFOA 4M7AG 3L2ZA 2ZGWA 4XQ3A 4M7AB 4HT9A 2E65A 1D3BB 2JN0A 2EJGA 4F7UA 3JB9I 1HXDA 3RKWA 4C8QF 2DJZA 4XU3A 1LJOA 4M78G 2I2LA 4NL2A 3EFSA 4EMKC 4J5YA 4EMKA 4M7DA 4M7AF 3JCMh 4M77D 3AHUA 2VXFA 2EWNA 4JRIA 3RUXA 4C8QE 4C8QC 2RB6A 4F7UE 5GAN4 4M7AD 3JCMf 3JCMW 2DVEA 3V7SA 4C92C 1JBMA 4C92E 4C8QB 4C92D 3V7CA 4M75D 4M78F 1TH7A 4XU2A 3BW1A 5GAOp 4M78C 4M78E 1Y96A 5GAMe 5GMKm 5GAMd 4M77C 4M77E 5GAN8 4JUVA 3VU3C 1M5Q1 1WPYA 4M7DG 4X9CA 4OP0A 4QVDA 5LJ3h 4C8QD 3QSUA 1I8FA 4RCBA 4M75E 4M75C 1LOJA 1YCYA 2YHTA 3RKXA 4EMHA 3JCMe 4PJOF 3JCMd 3M4GA 2DXUA 4M78A 3EFRA 3INZA 4F7UB 1I5LA 4M7DF 2DXTA 3JCMg 3V7RA 3JCMJ 3GIBA 3JCMV 5GAOl 2E1HA 4PJOB 4C8QA 5GAN6 4M75A 5LJ3d 3QUIA 5LJ3e 2EAYA 4M7DC 3BY7A 4M7AA 4M7DE 4PJOG 3JB9F 4X9DA 3FIFA 5LJ5e 4J6YA 3QHSA 5LJ5d 2DTIA 1BIAA 5LJ5g 4C92G 5GANg 5GAOm 3JB9H 2RM4A 3V8LA 4M77A 5GAN5 3V8KA 4F7UG 5GMKe 5LJ5h 5LJ3f 5GANf 1WQWA 2DTHA 4QVCA 1U1SA 5LJ3g 3JCMX 3SB2A 1N9RA 5GMKh 5LJ3j 3V8JA 5GAOq 3SWNB 5I21A 1I81A 1WQ7A 4C92A 4DQ2A 3JB9G 4XTVA 2HNIA 2RD1A 2DZCA 2EJ9A 2CGHA 4N0AC 3RKYA 1KQ1A 3FJPA 4J6WA 3SWNC 3PGGA 1D3BA 4C92F 4F7UF 3HFNA 5GMKj 1Y96B 4PNOA 4MMKA 3JCMQ 3JB9J 5GAN7 5LJ5f 5GAOr 5GAN2 2K57A 4M77F 2YLCA 4EMKB 3QO3A 1H641 4RCCA 4M7AE 4M7AC 5GMKl 3RERA 4PJOD 3FB9A 1MGQA 5GAOn 4XU0A 3RESA 4A53A 3JCMb 4NL3A 2DTOA 1B34A 2E41A 5GMKi 5GAMj 2Y90A 2RA2A 5GAMg 1HK9A 1WNLA 4JRKA 3RIRA 1I4K1 3BDUA 5GAMh 1LNXA 2E64A 2DZ9A 2DEQA 4V2SA 4HA8A 1M8VA 4M77G 2DKGA 3L1AA 2QTXA 2YLBA 3BFMA 5GANj 1KQ2A 4PJOC 1BIBA 2FYKA 4M77B 1X01A 4PJOE 4XU1A 4HT8A 4WF2A 4M75F 4M78D 4XTWA 5GANh 3JCMc 4JLIA 2E10A 2EJFA 4M7DB 4MMLA 1N9SA 2VXEA 3JB9D 5DY9A 4XTXA 4C92B 4M75B 5GAMf 4NOYA 2FB7A 4PJOA 5GANe 5GANd 4Y91A 2VC8A 4EMGA 4XTUA 3JCMP 4J6XA 4M78B
chains in the Genus database with same CATH superfamily
4PLLA 1YITA 3CCJQ 3PMTA 2DF6A 3A1PA 5CVIA 3G71A 4E7IA 1QKWA 3G4SQ 2I2LA 1I07A 2E3HA 1KQSA 4EMKC 1QCOA 2EQKA 3RUXA 3Q1JA 4E2FB 1VQ8Q 2EPDA 3PIPA 3EGDA 4C0FA 4M78E 3G71T 4EIKA 1H92A 4M77E 4N4IA 3VU3C 1VQ8T 1G3WA 1M1KR 3HHTB 1VQLQ 2X9HA 1VQ7A 1E6HA 3EG0A 3M4GA 1GFDA 4RMOA 4LD9K 1IRXA 1IO6A 2D1XA 3X25B 1YIJA 1OZ3A 3DLLA 5LJ3d 5AT1B 4M7DC 3TSWA 5GANg 2RM4A 5FU7C 1X2QA 4CC3A 2CP5A 1Q7YC 2ZPFB 1S1NA 4PFPA 5KYYB 4C92A 2BZ8A 1YWPA 2CGHA 2V8KA 4C92F 2L2PA 5J3BA 3CCVA 1P92A 3OYNA 4QKUA 4MDXA 1YJ9Q 2V1RA 2K57A 2ESWA 2XI9A 1ZUKA 2HDAA 2CREA 4PJOD 1VQ5A 4D8DA 1K9MC 2YUQA 1F1BB 2WSFE 1GXIE 1KQSS 1YP5A 2QG9B 3A98A 5FRNA 3PE0A 2J05A 4L5GA 4O6JA 1UE9A 4DEXA 2QI2A 3UATA 2D0NA 2MIOA 1YHQA 3OYGA 3CXCS 2DL7A 2PUKB 3EHQA 1NPRA 2E65A 5IHIA 1HXDA 2ZPHB 1C6VX 2K5LA 2PVOB 5CKBA 3S6WA 3L2UA 4C8QE 3CMET 4CI0C 2LTOA 3NMZC 1GCQA 4M78F 4IUUA 4WCIA 5GMKm 1AZEA 2R57A 1VQKT 1WHHA 2JMAA 3QJYA 4GY5A 1M2VA 5A0DA 2GCXA 1O75A 5KYXA 1U5SA 1XTDA 2LQNA 4RCBA 1PM3A 4OB3B 1WFWA 1VQOA 3RKXA 2L0AA 8AT1B 3OBYA 2VYTA 1W2BA 2CUDA 2IIMA 3GIBA 2CUBA 1AEYA 1VOMA 2QASA 4DBHA 1W4SA 4X9DA 1AWJA 2JJ9A 3OYHA 5L23A 2KYMA 3IQLA 1N8RR 1NLPC 5FU6B 1RACB 2LRQA 1UGRB 2EW3A 3CPFA 2CT4A 2DL5A 3FJPA 4E47A 2RH2A 3DB3A 2QAZA 3EFOA 2JOYA 3SHWA 2R58A 2AT1B 1VYTA 2M02A 1QP2A 3GNGA 1M90R 1OQKA 2YLBA 2DLPA 1WGSA 3CCEA 2KE9A 1QLYA 2CP3A 2J7IA 1H8KA 4M4ZA 3CPWA 1MMGA 4F17A 2YWWA 2FZGB 1Y07A 2OAUA 4M75B 2F5TX 2BKDN 4RTVA 1PC0A 1ABOA 3GPLA 3TEEA 1X75C 2HZYA 3BE3A 1MUZA 2KAFA 1BU1A 2J6OA 1R77A 2O4XA 1IB8A 4M7AB 4XU3A 5IXFA 2GTOA 4R55A 1VQ6A 1T0JA 1XNIA 1TUGB 2KQWA 3JSCA 3JCMf 1C1AA 1WX6A 4OGCA 2FPEA 3V7SA 4C92C 1RABB 5HK3A 1MMAA 1ZBJA 1KD1R 3CC4T 4ME7A 1LPLA 1WXBA 4JPBW 4C0DB 4IIMA 2RN8A 1ZSGA 5CKDA 2AHJB 3H0HA 2L3PA 1LOJA 1YCYA 1OYXA 1PRLC 2DRKA 1QKXA 2H3EB 3JCMV 5GAOl 2LT1A 2KBTA 3CCET 3QUIA 1WXUA 1HSQA 2W0ZA 4TVRA 3EG3A 3P8DA 3JB9H 4KH1B 1I0CA 4QVCA 3G4ST 4C0DC 1N9RA 1M9SA 2HMAA 3TQ7P 2CP0A 3M53A 1YJWA 1WJQA 2RI5A 3CCSA 4DBRA 1A0NB 2OI3A 2EQIA 3G1JA 3N5BB 4M7AC 3MP1A 1AD5A 4HVVA 4NL3A 3M4YA 3CMEA 1Q81C 1BCMA 5GAMh 2K3YA 3S3OA 3PNWC 3KXTA 1VQ9Q 5KE3A 2RQTA 4ZGEB 1Y0MA 5AYFA 1KHIA 3G6EA 4PJOA 1M27C 1B34B 4LDUA 1BKBA 1CSKA 1YHQT 3SWNA 1OPKA 3PFSA 4PK4A 3CC4A 4RTXA 3JAME 3CBMA 1KC8U 4C8QF 2DJZA 2LMJA 3JCMh 1VQ9T 2QYZA 1MNEA 1DJ7B 3BDLA 1EIFA 1X27A 4AFUC 4F7UE 3NGPA 5IH2A 1QQJA 4VUBA 5HY6A 2HQHA 3M0RA 1B7TA 3C94A 1PKTA 1WPYA 3QZ5B 1XJWB 4LD6A 1GL5A 2DD4A 2Y4YA 2M0YA 1S72A 2PU9B 2DL4A 4QT7A 4J7IA 1UUEA 4M7DF 1GCQC 2PVDB 3X20B 2E1HA 1FMWA 3EH1A 4J8OA 2MMPA 4OB0B 2LCSA 1UTIA 1R8OB 3V8KA 2KVQG 3QDRB 1CKBA 2RQVA 3A8LB 3CPWP 1K73U 4BDYA 1U1SA 2K9GA 2O01E 2EFIA 3HPWA 1T3SA 3URGA 3SEMA 2RF0A 1G3YA 4KULA 2F69A 3WVDB 1NYFA 4EPCA 1UJYA 2L8DA 4RG8A 2DYBA 1SSFA 2H3JA 3M57A 4J9DA 3QBYA 2CZ7B 2LC4A 1UB4A 1I5OB 2Y90A 1RI0A 2VVKA 2E64A 1NG2A 4AG1C 1W6XA 4XAXB 2BZXA 2QQAA 4UC4A 4J9CA 3HRSA 4PLIA 4M75F 1MHNA 1BI3A 2P4TA 1BCOA 2P84A 3WVEB 1YITT 2FB7A 2E5QA 3MEUA 4M75G 4Z02A 4XTYA 5LJ5j 2QEXA 1U1TA 1VQ8A 3L2ZA 1NJIC 1YNZA 2D8HA 2A36A 1QCFA 2XDDA 4LDWA 1RUWA 1VQPQ 1M4ZA 1VQNT 3O5ZA 2DVEA 3VRZA 2KRNA 4M78C 5GAMe 3LWIA 5GJWB 2HQEA 4EDUA 2EGCA 2FL7A 3NTKA 5HKCA 2YHTA 4J9HA 2DJQA 4B6MA 4CC7A 2OJ2A 4F7UB 1ZLMA 3CC7A 3JCMg 2ZPEB 1G2BA 4OMQA 4RTYA 1UGQB 1ZX6A 3E9FA 1FX7A 2X4YA 3BY7A 5LJ5e 1K8AU 3V8LA 5LJ5h 5GANf 1N8RC 1PWTA 2RI2A 2KYBA 4XTVA 2QGGA 4N0AC 1D3BA 1NLOC 2EGAA 3H0IA 3C0CA 1Y96B 3M0SA 4MMKA 3TVTA 1RI9A 4E7ZA 3JCMb 2DTOA 5FU6C 5GAMg 3GF5A 3H41A 1RLPC 2ED0A 1RAHB 3EGXA 1OU8A 1ACMB 3A8HB 2DKGA 3L1AA 1PSEA 5A0LA 3CBPA 3CCLA 4HKEA 5GANh 2FZCB 2CSIA 2CSQA 1Y57A 5IHKA 3CCSQ 1K0XA 3T9NA 4EMGA 3LH0A 4C8QG 1FWZA 2G6FX 1VQMT 5KYYA 3HSBA 3M56A 3OYDA 3CCQQ 2EQMA 4EMKA 3VS2A 3CMAA 2DERA 1BB9A 2KDSA 1SKUB 5KYWA 3V7CA 1VQOQ 3I55Q 3CCQA 1Y96A 2DO3A 2WSEE 4QVDA 1OEBA 1YJ9T 2RHZA 1ARKA 1BI1A 1KFZA 4M75E 4RUGA 3OYEA 4F16A 1W1FA 2RHXA 2DXTA 2DEUA 1D09B 3HRTA 4JRPA 1JXOA 2FRWA 1RLQC 3R6NA 2F1LA 2KSSA 2SEMA 5LJ5d 4JZ4A 3OYKA 4MZTA 2NUPA 3UA6A 2GFUA 3EG2A 1ABQA 4C5IA 1UFFA 4GBQA 3G7ZA 2MPXC 3S3NA 2GBQA 2L3SA 3SWNC 2DPPB 4E7LA 5GAOr 5IHNA 3CCST 3CCMQ 2RMOA 1YJWT 1UECA 5GAMj 1TUDA 4O5VA 1U06A 3R6OA 2HKNA 1WNLA 2A08A 2NWMA 4L59A 1Q81R 1NEGA 5FWCA 2FEIA 1Q95G 2RHYA 3MEVA 3KUFA 1M1KU 2CP6A 3GOXA 4ZN1A 1K9AA 2XG8D 2E10A 2GQVA 1QVGA 5I2SA 2DL3A 3CMAQ 2VXEA 2QQSA 2RHUA 4JRQA 1IZ6A 1KSWA 3QXEB 3G6ET 2KNBB 3C12A 1NPPA 3DLMA 1Q86R 2O9VA 2LDMA 2LNHB 2PUOB 5IAYA 2HBPA 3SFMA 7AT1B 3X26B 4J5YA 1O9SA 2QA4T 1OU9A 4IUVA 3OYYA 4ZGJB 3FC3A 1BBZA 1PHTA 4A63B 1JBMA 5KYUB 4C92D 2V26A 1YCSB 3I56A 2BIVA 3OYLA 1M1KC 2C0IA 3RDVA 4IKFA 4Z88A 2E6ZA 5GAN8 2DIGA 2GNCA 2JMCA 3CCJA 3OYBA 3VV0A 2DA9A 4ZN3A 3OYMA 3ME9A 4R56A 1TSFA 2ZCFB 2CH4A 1VQPT 4Y28E 5GAN6 1MV0B 3MCAB 3CCMA 2EQJA 3ER0A 3FJ5A 4J6YA 3M0UA 2A0FB 2CZ0B 1JU5C 5GMKe 4HVWA 2DRMA 3ZEHA 5LJ3j 4AMCA 5GMKh 3CCUA 1TWBA 4MDWA 3JV3A 1KQ1A 1YI2T 2C0OA 1QVFP 1PCXA 2FHDA 1M1FA 1IHWA 3I56T 4K11A 3RERA 1M90C 3CD6T 4ANJA 2JXBA 5GMKi 1U3OA 2IVWA 4CRIA 3OYIA 2EQUA 2P4RA 1M8VA 3UPUA 2AKKA 2JVVA 2K3XA 3BFMA 3REAB 1QWEA 2QGFB 1BIBA 2FPFA 2DAQA 3CQTA 4JDSA 1QP3A 2D0QB 3AT1B 3HP9A 1VQKQ 8ATCB 3HRUA 3I55A 3CXCA 3RNJA 4FM4B 1HYOA 1RAIB 1YJ9A 3G71Q 3HFOA 1UJ0A 4MZPA 4HCKA 1D3BB 5KCHA 1KG1A 1YBYA 1YJWQ 3CCRQ 1LJOA 1ZQ1A 2M9UA 2YSQA 4GLMA 2D9TA 1EZZB 5GAN4 1CKAA 1VQ6T 3A8OB 3SD4A 4M75D 4XU2A 3EGXB 3BW1A 1D0YA 5GAMd 2Y4XA 3CD6Q 2X51A 1ZBXA 3CC7Q 2RPNA 2RK2A 4X9CA 4OP0A 1VQ7Q 3CC2T 2RO0A 2V1QA 4J9FA 3L2RA 1GBQA 4BI4A 2JZ2A 4EMHA 4KUIA 2LJ1A 4BY6B 2A28A 3MP8A 3PVLA 1YJNQ 2VUBA 3I5RA 4C8QA 2AZVA 5GJVB 2F5KA 2JT4A 3H6ZA 4E6RA 1SHGA 2OTLA 2EBPA 1KD1U 1IREB 1WA7A 5LJ3g 1JJ2S 3SB2A 1Q82U 1UEBA 1EX4A 2EJ9A 5I2MA 2R5MA 1VQKA 3ZBDA 3EGUA 2FO0A 2LCLA 3EG1A 4FW1A 4KH0B 2YXYA 1B34A 4HCZA 4ORZA 2XDPA 1TOVA 2K2MA 1C0MA 4JJDA 5KCOA 2QTXA 5GANj 1KQ2A 1WXTA 1PSFA 1PD0A 1M3AA 4MMLA 1YIJQ 5DY9A 2FPDA 3I56Q 1KQSP 3VS5A 2NUPB 1WYXA 2O2OA 3JCMP 2SRCA 2AZSA 4DEYA 3LLRA 3FDRA 2MOXA 2VGMA 3PTAA 3KFVA 2E4HA 4M78G 4M77D 5J39A 3AHUA 2DNUA 4FIBA 4FYVB 1D1AA 3CCLQ 1M3CA 4RTWA 3U23A 4AFZC 4HCCA 4PKCC 2CZ6B 3MKDA 1T0HA 2MYSA 3L2VA 1K1ZA 1M5Q1 4M7DG 4FT2A 5LJ3h 3CCUQ 4C8QD 5D6WA 1WHKA 3H8ZA 4Q5WA 2B86A 2DMOA 3MHXA 2EYZA 3M0TA 3CC4Q 2XD0A 3EG9B 1KC8C 2QTVA 3INZA 3VS7A 2E70A 2OTLT 4PJOB 2HQXA 1M1GA 1NEBA 2XICA 3UT1A 1VYUA 3M0QA 1D0ZA 3FIFA 1Q7YR 4C92G 5A0GA 4JS5A 2D8JA 4OB2B 5GAN5 4PFOA 2M0OA 5C0MA 1WQWA 2DBMA 3VRYA 4ZTFA 3EAEA 4QW2A 1AOJA 1I81A 3JB9G 4DQ2A 2B8AA 1U8RA 4DA4A 2DIQA 2PNIA 5IN1A 4EMKB 3FB9A 5GAOn 1YJNA 1D0XA 2CT3A 3M59A 4C0GA 4KBMB 4FYWB 3VUZA 1QW1A 2DZ9A 2KXCA 3QYGB 4J7FA 3HL8A 2CDTA 3OA6A 4XU1A 1VYVA 3HTRA 1G83A 1YIJT 1K8AC 1D1BA 3CC7T 1X6GA 1M30A 1TG0A 4BDZA 1M8MA 4NS5A 5D6XA 2K3BA 5EC7A 3JCMQ 2VC8A 4M7AD 2DK3A 3CC2A 4C5EA 4M7DD 4M7AG 2JS2A 1SPKA 4E7SA 2ZGWA 4QVZA 4LDXA 4HT9A 1OX9A 3VYHB 2NYSA 5CO7A 1QVGS 5CKFA 3NHNA 2EKHA 3I35A 5IXBA 1GBRA 1BI2A 1RAFB 2ZZDA 1QVGP 2NUTB 3OSSC 2YUPA 4BUGA 3CXCP 2ZPGB 2X4WA 1UGVA 1X69A 3NTHA 3QSUA 4BY6C 1I8FA 4M75C 1VIFA 3E1SA 3I55T 1TUCA 1WHJA 2XMFA 4E7JA 2QQBA 3MJXA 4J83A 3VS4A 2HKQB 5KYUA 4M75A 4PFZA 3J81E 5CK9A 2EAYA 2KY9A 4P5NA 2A3LA 1W2BS 2O9SA 2W10A 1VQPA 4LDVA 2NLUA 4LUEA 5LJ3f 1QVFA 3QYHB 2Z0WA 2X3WD 4DOVA 3OY9A 4R0KA 2X4XA 4Z8AA 4OF1A 4KUDK 2O31A 1VQMQ 4CC2A 1TU0B 2DZCA 3ASKA 5D7UA 1KIKA 1GFCA 1YI2A 1V29B 2HSPA 5GAN7 1AVZC 5GAN2 2AIRB 1QVPA 3WXMB 4IUPA 4N4HA 4M77F 3QO3A 2MF2A 5HCKA 5CKHA 4OMLA 3RIRA 1PKSA 3QKJA 3HKSA 2LJ0A 1KC8R 5D6YA 1VQ9A 1VQNQ 1WLPB 4ESRA 3MO8A 4M78D 4JLIA 3I5SA 1N8RU 2P0PA 4C92B 2KEAA 3E9GA 5GANd 3MP6A 2ECZA 2DVJA 2DD5A 3CCRT 3CCRA 3CBOA 3CCJT 3OB9A 3M0PA 3JRZA 4PJLA 3OYFA 2LX7A 2BUDA 4E7HA 5A2QE 2EJGA 1BI0A 1G3SA 3TREA 1VQ4A 1WHGA 3OW2A 1QWFA 1G3TA 2M1HA 2R5AA 4DBFA 2KT8A 1HJDA 2FRYA 4LUDA 1K0SA 3A8GB 1ZA1B 2QA4A 3E19A 3OYCA 4B9WA 4OMMA 4YTLA 1WI7A 1TH7A 2QDYB 1KK7A 3GNFB 1I1JA 2PTKA 1GCPA 3OW2S 1NYGA 2DX1A 4ZTJA 3EFOB 3QPHA 1KJWA 1AWXA 2LT4A 3OW2P 2MK5A 5CQYA 1W70A 2RQRA 2DL8A 2EYXA 1WJSA 1FXXA 3V7RA 4QQGA 3UA7A 2YRCA 2DYIA 4JZ3A 2KR3A 3CCMT 4PJOG 2IG0A 2QQRA 5C6SA 2CP7A 3QHSA 5GAOm 4ELZC 2CYZB 1NM7A 1R0BG 2OTJT 2DTHA 1OOTA 3CD6A 4BI3A 2HEQA 1Z9QA 4RG2A 1AZGB 4A4KA 2WSCE 2YUNA 2P0QA 1IHVA 4J6WA 1J3TA 5KYXB 1YITQ 2HAXA 2HSEB 1X43A 5GMKl 2RK1A 3NPFA 1HK9A 1I4K1 2RQUA 1OPLA 3LGFA 2OTLQ 5L8RE 4XTWA 2DXBA 2QA4Q 1WHLA 4NOYA 1NJIU 5GANe 4Y91A 4J6XA 2LJ3A 2CZ1B 3ZL7C 4ATOA 5GAN3 3L2QA 2C0TA 4HXJA 1JRIA 2XIDA 3ZFJA 3PT9A 1SRLA 2M51A 3OMGA 3CCLT 4PL6A 2J6KA 1PNJA 1UGSB 2X3XD 2COWA 2K4YA 4FT4A 2FG0A 1FYNA 2BE9B 1M90U 2EYWA 2BZYA 4FSSA 2ENMA 1SHFA 1VQ5T 3OBWA 2KROA 3O8VA 3CCVT 2KMTA 3KBGA 5FU7B 2L3QA 3FEOA 1VQMA 1PD1A 1WJRA 2CS7A 1UHCA 2WACA 1AWOA 2XDBA 4LDYA 3JCMe 5I22A 1YWOA 3EFRA 3JCMJ 3UWNA 5KYWB 1ZUUA 3QJ6A 4C0ZA 5LJ3e 4JJBA 4J9BA 4M7AA 4FSXA 1BIAA 4BD3A 3P8HA 2KI7A 4F14A 3REBB 2G3RA 3CCEQ 1QCNA 2BE7D 1YN8A 5I21A 3D7SB 3J80E 2HNIA 4CC4B 2HL3A 1V76A 4A4GA 2COZA 4F7UF 5GMKj 4A4EA 2JM8A 5CKEA 3THKA 2CH4W 1MNDA 3RESA 2YRDA 4AT1B 4M77G 1LVKA 1OI1A 4PJOE 4LE9A 1MMNA 1VUBA 4WF2A 3OMCA 1SEMA 2LNVA 2JM9A 1SSHA 4LN2A 1KD1C 1VQ7T 2OX7A 2DM1A 2F2VA 1Q82C 5CAIA 2F2WA 4FU6A 4XTZA 2MCNA 4N0AA 3FRNA 1Z9ZA 2EYQA 4XK8E 4E7KA 1VQ6Q 4DBQA 2VV5A 3JB9I 3OS1A 4KGVB 2VWFA 4FCYA 4M7DA 1XOVA 1UGPB 1Q7YU 4MZMA 1ZHIA 2HBWA 3JCMW 2E6NA 4C8QB 2JUFA 1Y71A 2AK5A 3M9QA 2K6DA 5ECAA 4J9IA 4M77C 1M3BA 4JUVA 3LYIA 5KYNA 1M2OA 2JTMA 2QEXT 3QDFA 1K9MU 3CPWS 3FLGA 4B9XA 2JW4A 3QWXX 5EG2A 4M78A 2RJEA 2J6FA 2P0KA 4KGXB 3QG1A 2HCKA 1S72Q 1VQLT 4LXCA 1E6GA 4HCBA 1NJIR 4M7DE 2VB6A 4AFQC 3RR6A 2QK0A 1SRMA 2LP5A 4F7UG 4J9GA 2K2VA 4PJJA 3V8JA 3VKIA 1WQ7A 4IIOA 2BTTA 3RMQA 4BE1A 4ZNXA 3EGDB 2DFUA 2ABLA 4PNOA 3JB9J 2JS0A 1N5ZA 1X2KA 1H641 2RJDA 1Q86U 3TCJA 2QQ9A 3EH2A 5KE2A 5LL6S 1SF9A 4KGZB 1K73R 3META 1EFNA 3M5AA 2ZPIB 4D8KA 2VGNA 1ZSZC 1KHCA 2FYKA 4M77B 2K79A 4BE0A 2GFAA 3CCVQ 5GAMf 2NUTA 3VS6A 2I0NA 1JJ2A 3OS0A 2ZPBB 1PG5B 5DM7R 1TS9A 5DLOA 2RJFA 2A7YA 1SG5A 3OYAA 2HL5C 5DLQE 2XU8A 3LW5E 2CP2A 4DOWA 1Q82R 4QQ6A 1ZSZB 4JJNK 1VQNA 1OX8A 1FMVA 2EGEA 3RMSA 2EVRA 4JRIA 4C8QC 1QVFS 2YUOA 1B3QA 4OVAA 5KH6A 1BK2A 4OMOA 2F2XA 2GF7A 5CIUA 2O4XB 2ZAEA 4A4FA 3PIOA 3DKMA 3E2UA 4BE2A 4LNPA 3GBQA 4OMPA 4PJOF 2VKNA 2X35A 4OGEA 2ROTA 3OS5A 3CMEQ 1N6AA 2KRMA 5CR2A 2H8HA 1Q81U 4GLKA 2COYA 3VS3A 4X1VA 1T3LA 4OMNA 3VS0A 4IUTA 1RAAB 1OV3A 4A4HA 3CEYA 2PQWA 1QMCA 1S72T 3C4SA 4KT0E 1X6OA 2QDLA 2RHIA 6AT1B 1ZSZA 1H3ZA 2RD1A 2KK4A 1R0CB 3PGGA 4JJCA 2XKOC 3HFNA 4Y92A 2RNAA 1OZ2A 2JTEA 2QEXQ 3P8BB 2YLCA 2E5KA 4HVUA 4AFSC 3EHRA 1M2VB 4XU0A 4A53A 2XK0A 3G4SA 2E3IA 1K8AR 2DEQA 3QZ9B 1VQ5Q 2RJCA 4HT8A 2NUZA 4FYYB 3OS2A 2YRVA 3JCMc 2EJFA 2OTJQ 4QQDA 3JB9D 2DILA 2LZ6B 1E7OA 3OQ5A 3M54A 1WZOA 4ELYC 2MWPA 2KXDA 2A37A 4A54A 3MPUB 3NFCA 3I9QA 2DETA 2DE0X 4OMFB 1FMKA 3PMIA 4L6V5 4XQ3A 1JQQA 4F7UA 1JB0E 3M55A 2K5FA 4NL2A 3EFSA 2VASA 4D6WA 3S3MA 1XQHA 1YI2Q 4C92E 1VA7A 2GGRA 1NBEB 1VQ4T 1K73C 3NTIA 2EKOA 1UG1A 3GP8A 1WIEA 3PVQA 2K7AA 3VYGA 4BACA 3A8MB 3CCUT 2LVMA 3C95A 3JCMd 1YFNA 2LQ8A 3ULRB 4IURA 1NZ9A 3H9NA 2IPOB 1IGUA 3LH5A 3LGLA 5J26A 3G6EQ 1IGQA 2EYYA 1X6BA 1MMDA 2CKKA 3JB9F 1B07A 2DTIA 4F04B 5LJ5g 4M77A 1WHMA 4JS4A 2KT1A 2V8IA 2AKLA 3M58A 3MEWA 5CCAA 2QXFA 2V8JA 3JCMX 3X24B 1BYMA 1VQ4Q 3SWNB 3SDZA 2ATCB 3GLXA 1LCKA 3RKYA 3OSVA 9ATCB 1D1CA 3TU4K 1Q86C 2ED1A 5LJ5f 2EIFA 4FL6A 1TTHB 4M7AE 1MGQA 3RBBB 2D6FA 5HK0A 2E41A 2RA2A 2OTJA 3L42A 4JRKA 2PZ1A 4Z89A 2X4JA 4V2SA 4HA8A 1K76A 1X01A 2LQWA 1Y7XA 2GTJA 2KRSA 1V1CA 1RAGB 2LCCA 2LX9A 1JXMA 4J9EA 4N4GA 1I5LA 5FROA 1PRMC 2YT6A 5CQXA 2MI6A 3LWHA 2E12A 4RKUE 3EG9A 5I11A 2XHCA 2JN0A 3CCQT 2GQIA 3RKWA 1GRIA 5FLXE 5IT9E 3L2WA 1HD3A 4BI8B 3LX7A 2O88A 4M7AF 2RI3A 1AHJB 2EWNA 2VXFA 4C5HA 3CMAT 3VS1A 2RB6A 4RTUA 1IXDA 2DXCA 1YJNT 3H0FA 5GAOp 1K4US 4IUQA 2MAMA 3QIIA 2M16A 1UDLA 2MWOA 2C06A 3F70A 3VUBA 2L89A 1G5VA 2J06A 2HD0A 1AT1B 1ZUYA 2DXUA 1H3HA 4PJNA 1G8XA 4BB7A 3X28B 1K9MR 1JEGA 4JLGA 2OAWA 1TXQA 1RAEB 3MEAA 1VQLA 2YDLA 4FW2A 4RTTA 1JO8A 4II1A 2ROLA 4X34A 3DB4A 1VQOT 2JTFA 5GAOq 2LQKA 1OULA 2JNGA 5M9OA 4ZGDB 2DBKA 1YHQQ 3J7AF 1W2BP 2FZKB 4RTZA 1WDXA 1ZA2B 1NE8A 4PJMA 4RCCA 4AG2C 3QWYA 1UHFA 1RADB 2KGTA 4C5GA 4WTOB 5FW9A 3TSZA 1MV3A 3BDUA 2RQWA 1AWWA 1LNXA 2FVUA 4OB1B 5FRMA 3A5ZB 4KRTA 3OYJA 4PJOC 3UDCA 1N27A 3VJPA 1JJ2P 2L5QA 1RL2A 2L3RA 3UF4A 4M7DB 1N9SA 1VIEA 4XTXA 4FYXB 3CC2Q 2K5IA 2PVGB 5FWBA 4XTUA 4M78B
chains in the Genus database with same CATH topology
4PLLA 4M75G 4Z02A 4XTYA 5CAIA 5LJ5j 1YITA 2QEXA 4FU6A 4XTZA 1U1TA 4N0AA 3FRNA 3LLRA 1VQ8A 3PMTA 3FDRA 3L2ZA 2EYQA 4XK8E 4E7KA 5CVIA 2VV5A 3G71A 2VGMA 3PTAA 4E7IA 3JB9I 3OS1A 1NJIC 4M78G 2I2LA 1KQSA 4EMKC 4M7DA 1XOVA 4M77D 2EQKA 1UGPB 5J39A 3AHUA 3RUXA 3Q1JA 2XDDA 1Q7YU 4LDWA 4MZMA 1ZHIA 1M4ZA 4FIBA 3PIPA 3JCMW 1VQNT 2DVEA 2E6NA 4C8QB 2JUFA 1Y71A 4PJOE 4HCCA 4PKCC 3M9QA 4C0FA 2CZ6B 4M78C 4M78E 3G71T 5GAMe 3LWIA 4M77C 4M77E 3L2VA 4N4IA 4JUVA 3LYIA 1M5Q1 3VU3C 1VQ8T 4M7DG 4FT2A 2HQEA 2JTMA 5LJ3h 4C8QD 5D6WA 2QEXT 4EDUA 1G3WA 3H8ZA 4Q5WA 2FL7A 3HHTB 3MHXA 1K9MU 3NTKA 5HKCA 2YHTA 2XD0A 3CPWS 1VQ7A 3FLGA 4B9XA 3M4GA 1KC8C 5EG2A 4M78A 4RMOA 2RJEA 3INZA 4F7UB 3CC7A 4LD9K 2P0KA 3JCMg 2E70A 2ZPEB 3QG1A 3X25B 1YIJA 2OTLT 4PJOB 2HQXA 1M1GA 1OZ3A 2XICA 3UT1A 3DLLA 1VQLT 5LJ3d 4HCBA 1UGQB 3E9FA 1FX7A 2X4YA 4M7DC 3BY7A 4M7DE 3FIFA 5LJ5e 1K8AU 5GANg 4C92G 5A0GA 2RM4A 3V8LA 4OB2B 5GAN5 5FU7C 4JS5A 2M0OA 4F7UG 5LJ5h 5C0MA 2K2VA 1WQWA 5GANf 4ZTFA 1Q7YC 3EAEA 2ZPFB 3V8JA 3VKIA 1N8RC 4QW2A 1I81A 1WQ7A 2RI2A 4C92A 3RMQA 4DQ2A 4XTVA 3JB9G 2B8AA 1U8RA 4BE1A 2CGHA 2V8KA 4N0AC 4C92F 1D3BA 5J3BA 3CCVA 1P92A 1Y96B 3OYNA 4PNOA 4MMKA 4DA4A 4MDXA 3JB9J 2DIQA 5IN1A 2K57A 2XI9A 4EMKB 1H641 2RJDA 4PJOD 3FB9A 5GAOn 1YJNA 1Q86U 3TCJA 3JCMb 1VQ5A 2DTOA 1K9MC 3M59A 2QQ9A 4C0GA 4KBMB 5FU6C 5GAMg 2WSFE 3GF5A 3VUZA 1GXIE 1KQSS 1QW1A 5FRNA 5KE2A 2DZ9A 5LL6S 3A8HB 2DKGA 3META 3M5AA 3L1AA 3QYGB 4J7FA 2ZPIB 3HL8A 2VGNA 4BE0A 1KHCA 1PSEA 2FYKA 4M77B 3OA6A 4XU1A 5A0LA 4L5GA 3CBPA 3CCLA 4HKEA 5GANh 1BYMA 1YIJT 4O6JA 2GFAA 1K8AC 2QI2A 3CC7T 4BDZA 4NS5A 5GAMf 5D6XA 1YHQA 1JJ2A 3OS0A 3T9NA 2ZPBB 2VC8A 3JCMQ 4EMGA 2DK3A 5DM7R 3OYGA 3CXCS 4M7AD 3LH0A 4C8QG 5DLOA 2RJFA 3CC2A 1FWZA 4C5EA 4M7DD 2A7YA 2PUKB 1VQMT 3HSBA 3OYAA 4M7AG 1NPRA 2ZGWA 4QVZA 4LDXA 5DLQE 4HT9A 2E65A 3VYHB 2XU8A 3LW5E 5CO7A 1QVGS 5CKFA 1HXDA 4DOWA 2ZPHB 3M56A 3OYDA 2K5LA 2EQMA 4QQ6A 2PVOB 5CKBA 4JJNK 1VQNA 1BI2A 4EMKA 3S6WA 3RMSA 3L2UA 2ZZDA 3CMAA 4JRIA 4C8QE 4C8QC 3OSSC 1QVFS 2KDSA 4CI0C 3CMET 2LTOA 4OVAA 5KH6A 3V7CA 4M78F 4IUUA 3CCQA 1Y96A 4BUGA 2GF7A 5GMKm 2R57A 2ZPGB 1VQKT 5CIUA 2DO3A 2X4WA 2WSEE 2O4XB 3QJYA 4GY5A 4A4FA 4QVDA 3DKMA 3PIOA 3NTHA 4BE2A 1YJ9T 2RHZA 3QSUA 5A0DA 2GCXA 4BY6C 1O75A 1I8FA 1BI1A 1XTDA 4RCBA 4M75E 4M75C 4OB3B 1VIFA 3OYEA 1VQOA 3RKXA 3E1SA 3OBYA 4PJOF 3I55T 2VYTA 2RHXA 1W2BA 2X35A 4E7JA 2QQBA 2DXTA 4OGEA 3GIBA 3OS5A 4J83A 1N6AA 4M75A 5CR2A 3J81E 5CK9A 3HRTA 2EAYA 2KY9A 4P5NA 2A3LA 4GLKA 4JRPA 1Q81U 1W4SA 4X9DA 2KSSA 1W2BS 5LJ5d 1VQPA 4LDVA 3OYKA 2NLUA 4IUTA 4MZTA 4A4HA 3CEYA 5LJ3f 2PQWA 1QVFA 3QYHB 4DOVA 3OY9A 3C4SA 3OYHA 4KT0E 1S72T 1X6OA 2X4XA 2GFUA 4OF1A 4C5IA 4KUDK 2RHIA 3G7ZA 1H3ZA 3S3NA 2RD1A 2LRQA 2KK4A 1UGRB 2DZCA 3CPFA 3ASKA 5FU6B 3SWNC 3FJPA 3PGGA 2XKOC 3HFNA 4E47A 2RH2A 3DB3A 2DPPB 1YI2A 1V29B 1OZ2A 5GAN7 4E7LA 5GAN2 5GAOr 3CCST 1QVPA 3P8BB 4IUPA 4N4HA 4M77F 2YLCA 3WXMB 3QO3A 1YJWT 2MF2A 2JOYA 2R58A 4XU0A 4A53A 5CKHA 5GAMj 4O5VA 3R6OA 2XK0A 3G4SA 1WNLA 3RIRA 3QKJA 1QP2A 3HKSA 4L59A 5D6YA 1VQ9A 2RHYA 2DEQA 3MEVA 3QZ9B 3KUFA 3GNGA 2YLBA 1Q82C 1M1KU 1WGSA 2RJCA 3CCEA 3GOXA 3MO8A 4ZN1A 4M78D 3OS2A 4HT8A 2YRVA 2XG8D 4JLIA 3JCMc 2E10A 2GQVA 2EJFA 1QVGA 1N8RU 2P0PA 4QQDA 5I2SA 3CPWA 2VXEA 2QQSA 3JB9D 1Y07A 2RHUA 4C92B 2OAUA 3OQ5A 4M75B 2F5TX 3M54A 2BKDN 3E9GA 5GANd 3MP6A 4ELYC 4JRQA 2MWPA 2DD5A 3GPLA 1IZ6A 3CCRT 3CCRA 3QXEB 3CBOA 3CCJT 3G6ET 3TEEA 1X75C 4A54A 3C12A 1NPPA 3DLMA 3OB9A 3JRZA 3NFCA 2KAFA 2LDMA 3OYFA 2PUOB 5IAYA 2HBPA 2O4XA 4OMFB 4XQ3A 3PMIA 4L6V5 4M7AB 2BUDA 3SFMA 5A2QE 4E7HA 2EJGA 4F7UA 1BI0A 1JB0E 1G3SA 3TREA 3M55A 1VQ4A 4XU3A 3OW2A 2K5FA 4NL2A 3X26B 3EFSA 1G3TA 2M1HA 2R5AA 4R55A 1VQ6A 4J5YA 1O9SA 1XNIA 4D6WA 2KQWA 2QA4T 3S3MA 4IUVA 3OYYA 1XQHA 4ZGJB 3JSCA 3A8GB 3FC3A 2QA4A 3E19A 3OYCA 4B9WA 3JCMf 4OGCA 3V7SA 4C92C 4C92E 1JBMA 5HK3A 4YTLA 4C92D 1TH7A 1VQ4T 3I56A 2QDYB 2BIVA 3GNFB 3OYLA 3NTIA 1K73C 2EKOA 1M1KC 4IKFA 3OW2S 2E6ZA 3CC4T 4ZTJA 5GAN8 4ME7A 3GP8A 2DIGA 4C0DB 3VYGA 4BACA 3QPHA 3A8MB 3CCJA 3CCUT 2LVMA 2LT4A 5CKDA 3OYBA 2AHJB 1LOJA 3C95A 1YCYA 5CQYA 3JCMd 2LQ8A 3VV0A 1OYXA 4ZN3A 3OYMA 3ME9A 4IURA 4R56A 1NZ9A 1WJSA 1FXXA 3V7RA 4QQGA 2ZCFB 3JCMV 5GAOl 1VQPT 2LT1A 4Y28E 5GAN6 3CCET 3MCAB 3QUIA 3CCMA 3LGLA 5J26A 2EQJA 3CCMT 4TVRA 2CKKA 2IG0A 2QQRA 3ER0A 3P8DA 4PJOG 5C6SA 3JB9F 4J6YA 3QHSA 3JB9H 2DTIA 5LJ5g 5GAOm 4ELZC 2CYZB 2CZ0B 4M77A 4JS4A 2V8IA 5GMKe 3M58A 3MEWA 2DTHA 5CCAA 2QXFA 2V8JA 4QVCA 3X24B 3JCMX 3G4ST 2OTJT 3ZEHA 4C0DC 1N9RA 5GMKh 1M9SA 5LJ3j 3CD6A 3SWNB 4BI3A 3SDZA 3M53A 1YJWA 4RG2A 4A4KA 3CCUA 2WSCE 4MDWA 1WJQA 3GLXA 2RI5A 3CCSA 3RKYA 1KQ1A 2P0QA 4J6WA 1YI2T 3OSVA 3TU4K 2FHDA 1M1FA 1Q86C 3N5BB 2HAXA 5LJ5f 2EIFA 4FL6A 3MP1A 3I56T 4M7AE 4M7AC 5GMKl 3RERA 1M90C 1MGQA 4NL3A 2D6FA 5HK0A 3CD6T 5GMKi 2E41A 2RK1A 3M4YA 3CMEA 2RA2A 2OTJA 3L42A 1HK9A 4JRKA 1Q81C 1I4K1 2IVWA 4CRIA 5GAMh 2X4JA 3OYIA 2K3YA 3S3OA 2EQUA 4V2SA 4HA8A 1M8VA 3PNWC 3UPUA 3LGFA 2JVVA 2K3XA 3KXTA 3BFMA 1BIBA 1X01A 5L8RE 2DAQA 4XTWA 1Y7XA 5KE3A 4JDSA 1QP3A 2D0QB 2DXBA 4ZGEB 3HP9A 3HRUA 5AYFA 3I55A 1KHIA 3CXCA 4NOYA 3G6EA 1NJIU 4FM4B 4PJOA 5GANe 4Y91A 2LCCA 2LX9A 4N4GA 1I5LA 4J6XA 1B34B 4LDUA 1BKBA 2CZ1B 5FROA 4ATOA 1YHQT 5GAN3 5CQXA 3L2QA 2MI6A 1YJ9A 3LWHA 3SWNA 2E12A 1JRIA 3HFOA 2XIDA 3PFSA 3ZFJA 4RKUE 4MZPA 3PT9A 3CC4A 3JAME 3OMGA 3CBMA 3CCLT 1D3BB 2XHCA 4PL6A 2JN0A 1UGSB 5KCHA 3CCQT 1KG1A 1YBYA 1KC8U 3RKWA 4FT4A 2DJZA 2K4YA 1LJOA 4C8QF 1ZQ1A 5FLXE 3L2WA 5IT9E 4BI8B 1M90U 2M9UA 3LX7A 4M7AF 3JCMh 1VQ9T 2RI3A 1DJ7B 3BDLA 1AHJB 2EWNA 2D9TA 2VXFA 1EIFA 4C5HA 3CMAT 2RB6A 4F7UE 5GAN4 4VUBA 3A8OB 1VQ5T 2DXCA 5HY6A 1YJNT 1VQ6T 3SD4A 5GAOp 4M75D 3OBWA 4XU2A 3BW1A 4IUQA 5GAMd 2MAMA 2Y4XA 3C94A 3QIIA 2M16A 1ZBXA 3O8VA 3CCVT 2KMTA 3KBGA 1WPYA 2RK2A 3QZ5B 4X9CA 4OP0A 5FU7B 2MWOA 1VQMA 3FEOA 2CS7A 1WJRA 2C06A 2RO0A 2WACA 3F70A 4LD6A 3VUBA 2L89A 3CC2T 3L2RA 1G5VA 2DD4A 2XDBA 2Y4YA 4BI4A 4LDYA 2JZ2A 2HD0A 4EMHA 4KUIA 3JCMe 1S72A 2PU9B 2DXUA 3EFRA 4J7IA 4BY6B 4M7DF 2PVDB 3MP8A 3UWNA 3JCMJ 3X20B 2VUBA 2E1HA 3X28B 4BB7A 4C8QA 4C0ZA 3QJ6A 5LJ3e 4J8OA 4JLGA 2MMPA 3MEAA 2F5KA 4OB0B 4M7AA 3H6ZA 1VQLA 4FSXA 1BIAA 4BD3A 3P8HA 2OTLA 1R8OB 3V8KA 2KVQG 3QDRB 3A8LB 4II1A 2G3RA 1K73U 1KD1U 1IREB 4BDYA 5LJ3g 1U1SA 2O01E 4X34A 1JJ2S 3DB4A 3SB2A 2EFIA 2JTFA 3HPWA 5GAOq 1UEBA 3URGA 1VQOT 1Q82U 5I21A 2LQKA 3J80E 1G3YA 2HNIA 2JNGA 5M9OA 4KULA 4ZGDB 2EJ9A 4A4GA 2F69A 3WVDB 4F7UF 3J7AF 5I2MA 4EPCA 5GMKj 2R5MA 4A4EA 1VQKA 2L8DA 3ZBDA 4RG8A 1SSFA 2H3JA 1NE8A 3M57A 5CKEA 2LCLA 3QBYA 2CZ7B 4RCCA 2LC4A 1UB4A 3RESA 1B34A 4HCZA 2Y90A 1RI0A 2XDPA 4C5GA 3BDUA 1LNXA 2E64A 4XAXB 4M77G 2FVUA 4OB1B 2QQAA 5KCOA 1OI1A 5FRMA 2QTXA 3A5ZB 4UC4A 5GANj 3HRSA 1KQ2A 3OYJA 4PJOC 3UDCA 1N27A 4PLIA 3VJPA 2L5QA 1PSFA 1RL2A 1VUBA 2L3RA 4M75F 1MHNA 3OMCA 4WF2A 4M7DB 2LNVA 1BI3A 1N9SA 2P4TA 4MMLA 1VIEA 5DY9A 4XTXA 3WVEB 1KD1C 2K5IA 1VQ7T 2PVGB 2FB7A 1YITT 2E5QA 4XTUA 3JCMP 3MEUA 4M78B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B34 B;  4C8Q G;  4M75 G;  4XTY A;  5CAI A;  5LJ5 j;  5GAN 3;  4M7D D;  4XTZ A;  4A54 A;  1U1T A;  4N0A A;  3SWN A;  3HSB A;  1JRI A;  3HFO A;  4M7A G;  3L2Z A;  2ZGW A;  4XQ3 A;  4M7A B;  4HT9 A;  2E65 A;  1D3B B;  2JN0 A;  2EJG A;  4F7U A;  3JB9 I;  1HXD A;  3RKW A;  4C8Q F;  2DJZ A;  4XU3 A;  1LJO A;  4M78 G;  2I2L A;  4NL2 A;  3EFS A;  4EMK C;  4J5Y A;  4EMK A;  4M7D A;  4M7A F;  3JCM h;  4M77 D;  3AHU A;  2VXF A;  2EWN A;  4JRI A;  3RUX A;  4C8Q E;  4C8Q C;  2RB6 A;  4F7U E;  5GAN 4;  4M7A D;  3JCM f;  3JCM W;  2DVE A;  3V7S A;  4C92 C;  1JBM A;  4C92 E;  4C8Q B;  4C92 D;  3V7C A;  4M75 D;  4M78 F;  1TH7 A;  4XU2 A;  3BW1 A;  5GAO p;  4M78 C;  4M78 E;  1Y96 A;  5GAM e;  5GMK m;  5GAM d;  4M77 C;  4M77 E;  5GAN 8;  4JUV A;  3VU3 C;  1M5Q 1;  1WPY A;  4M7D G;  4X9C A;  4OP0 A;  4QVD A;  5LJ3 h;  4C8Q D;  3QSU A;  1I8F A;  4RCB A;  4M75 E;  4M75 C;  1LOJ A;  1YCY A;  2YHT A;  3RKX A;  4EMH A;  3JCM e;  4PJO F;  3JCM d;  3M4G A;  2DXU A;  4M78 A;  3EFR A;  3INZ A;  4F7U B;  1I5L A;  4M7D F;  2DXT A;  3JCM g;  3V7R A;  3JCM J;  3GIB A;  3JCM V;  5GAO l;  2E1H A;  4PJO B;  4C8Q A;  5GAN 6;  4M75 A;  5LJ3 d;  3QUI A;  5LJ3 e;  2EAY A;  4M7D C;  3BY7 A;  4M7A A;  4M7D E;  4PJO G;  3JB9 F;  4X9D A;  3FIF A;  5LJ5 e;  4J6Y A;  3QHS A;  5LJ5 d;  2DTI A;  1BIA A;  5LJ5 g;  4C92 G;  5GAN g;  5GAO m;  3JB9 H;  2RM4 A;  3V8L A;  4M77 A;  5GAN 5;  3V8K A;  4F7U G;  5GMK e;  5LJ5 h;  5LJ3 f;  5GAN f;  1WQW A;  2DTH A;  4QVC A;  1U1S A;  5LJ3 g;  3JCM X;  3SB2 A;  1N9R A;  5GMK h;  5LJ3 j;  3V8J A;  5GAO q;  3SWN B;  5I21 A;  1I81 A;  1WQ7 A;  4C92 A;  4DQ2 A;  3JB9 G;  4XTV A;  2HNI A;  2RD1 A;  2DZC A;  2EJ9 A;  2CGH A;  4N0A C;  3RKY A;  1KQ1 A;  3FJP A;  4J6W A;  3SWN C;  3PGG A;  1D3B A;  4C92 F;  4F7U F;  3HFN A;  5GMK j;  1Y96 B;  4PNO A;  4MMK A;  3JCM Q;  3JB9 J;  5GAN 7;  5LJ5 f;  5GAO r;  5GAN 2;  2K57 A;  4M77 F;  2YLC A;  4EMK B;  3QO3 A;  1H64 1;  4RCC A;  4M7A E;  4M7A C;  5GMK l;  3RER A;  4PJO D;  3FB9 A;  1MGQ A;  5GAO n;  4XU0 A;  3RES A;  4A53 A;  3JCM b;  4NL3 A;  2DTO A;  1B34 A;  2E41 A;  5GMK i;  5GAM j;  2Y90 A;  2RA2 A;  5GAM g;  1HK9 A;  1WNL A;  4JRK A;  3RIR A;  1I4K 1;  3BDU A;  5GAM h;  1LNX A;  2E64 A;  2DZ9 A;  2DEQ A;  4V2S A;  4HA8 A;  1M8V A;  4M77 G;  2DKG A;  3L1A A;  2QTX A;  2YLB A;  3BFM A;  5GAN j;  1KQ2 A;  4PJO C;  1BIB A;  2FYK A;  4M77 B;  1X01 A;  4PJO E;  4XU1 A;  4HT8 A;  4WF2 A;  4M75 F;  4M78 D;  4XTW A;  5GAN h;  3JCM c;  4JLI A;  2E10 A;  2EJF A;  4M7D B;  4MML A;  1N9S A;  2VXE A;  3JB9 D;  5DY9 A;  4XTX A;  4C92 B;  4M75 B;  5GAM f;  4NOY A;  2FB7 A;  4PJO A;  5GAN e;  5GAN d;  4Y91 A;  2VC8 A;  4EMG A;  4XTU A;  3JCM P;  4J6X A;  4M78 B; 
#chains in the Genus database with same CATH topology
 4PLL A;  1YIT A;  3CCJ Q;  3PMT A;  2DF6 A;  3A1P A;  5CVI A;  3G71 A;  4E7I A;  1QKW A;  3G4S Q;  2I2L A;  1I07 A;  2E3H A;  1KQS A;  4EMK C;  1QCO A;  2EQK A;  3RUX A;  3Q1J A;  4E2F B;  1VQ8 Q;  2EPD A;  3PIP A;  3EGD A;  4C0F A;  4M78 E;  3G71 T;  4EIK A;  1H92 A;  4M77 E;  4N4I A;  3VU3 C;  1VQ8 T;  1G3W A;  1M1K R;  3HHT B;  1VQL Q;  2X9H A;  1VQ7 A;  1E6H A;  3EG0 A;  3M4G A;  1GFD A;  4RMO A;  4LD9 K;  1IRX A;  1IO6 A;  2D1X A;  3X25 B;  1YIJ A;  1OZ3 A;  3DLL A;  5LJ3 d;  5AT1 B;  4M7D C;  3TSW A;  5GAN g;  2RM4 A;  5FU7 C;  1X2Q A;  4CC3 A;  2CP5 A;  1Q7Y C;  2ZPF B;  1S1N A;  4PFP A;  5KYY B;  4C92 A;  2BZ8 A;  1YWP A;  2CGH A;  2V8K A;  4C92 F;  2L2P A;  5J3B A;  3CCV A;  1P92 A;  3OYN A;  4QKU A;  4MDX A;  1YJ9 Q;  2V1R A;  2K57 A;  2ESW A;  2XI9 A;  1ZUK A;  2HDA A;  2CRE A;  4PJO D;  1VQ5 A;  4D8D A;  1K9M C;  2YUQ A;  1F1B B;  2WSF E;  1GXI E;  1KQS S;  1YP5 A;  2QG9 B;  3A98 A;  5FRN A;  3PE0 A;  2J05 A;  4L5G A;  4O6J A;  1UE9 A;  4DEX A;  2QI2 A;  3UAT A;  2D0N A;  2MIO A;  1YHQ A;  3OYG A;  3CXC S;  2DL7 A;  2PUK B;  3EHQ A;  1NPR A;  2E65 A;  5IHI A;  1HXD A;  2ZPH B;  1C6V X;  2K5L A;  2PVO B;  5CKB A;  3S6W A;  3L2U A;  4C8Q E;  3CME T;  4CI0 C;  2LTO A;  3NMZ C;  1GCQ A;  4M78 F;  4IUU A;  4WCI A;  5GMK m;  1AZE A;  2R57 A;  1VQK T;  1WHH A;  2JMA A;  3QJY A;  4GY5 A;  1M2V A;  5A0D A;  2GCX A;  1O75 A;  5KYX A;  1U5S A;  1XTD A;  2LQN A;  4RCB A;  1PM3 A;  4OB3 B;  1WFW A;  1VQO A;  3RKX A;  2L0A A;  8AT1 B;  3OBY A;  2VYT A;  1W2B A;  2CUD A;  2IIM A;  3GIB A;  2CUB A;  1AEY A;  1VOM A;  2QAS A;  4DBH A;  1W4S A;  4X9D A;  1AWJ A;  2JJ9 A;  3OYH A;  5L23 A;  2KYM A;  3IQL A;  1N8R R;  1NLP C;  5FU6 B;  1RAC B;  2LRQ A;  1UGR B;  2EW3 A;  3CPF A;  2CT4 A;  2DL5 A;  3FJP A;  4E47 A;  2RH2 A;  3DB3 A;  2QAZ A;  3EFO A;  2JOY A;  3SHW A;  2R58 A;  2AT1 B;  1VYT A;  2M02 A;  1QP2 A;  3GNG A;  1M90 R;  1OQK A;  2YLB A;  2DLP A;  1WGS A;  3CCE A;  2KE9 A;  1QLY A;  2CP3 A;  2J7I A;  1H8K A;  4M4Z A;  3CPW A;  1MMG A;  4F17 A;  2YWW A;  2FZG B;  1Y07 A;  2OAU A;  4M75 B;  2F5T X;  2BKD N;  4RTV A;  1PC0 A;  1ABO A;  3GPL A;  3TEE A;  1X75 C;  2HZY A;  3BE3 A;  1MUZ A;  2KAF A;  1BU1 A;  2J6O A;  1R77 A;  2O4X A;  1IB8 A;  4M7A B;  4XU3 A;  5IXF A;  2GTO A;  4R55 A;  1VQ6 A;  1T0J A;  1XNI A;  1TUG B;  2KQW A;  3JSC A;  3JCM f;  1C1A A;  1WX6 A;  4OGC A;  2FPE A;  3V7S A;  4C92 C;  1RAB B;  5HK3 A;  1MMA A;  1ZBJ A;  1KD1 R;  3CC4 T;  4ME7 A;  1LPL A;  1WXB A;  4JPB W;  4C0D B;  4IIM A;  2RN8 A;  1ZSG A;  5CKD A;  2AHJ B;  3H0H A;  2L3P A;  1LOJ A;  1YCY A;  1OYX A;  1PRL C;  2DRK A;  1QKX A;  2H3E B;  3JCM V;  5GAO l;  2LT1 A;  2KBT A;  3CCE T;  3QUI A;  1WXU A;  1HSQ A;  2W0Z A;  4TVR A;  3EG3 A;  3P8D A;  3JB9 H;  4KH1 B;  1I0C A;  4QVC A;  3G4S T;  4C0D C;  1N9R A;  1M9S A;  2HMA A;  3TQ7 P;  2CP0 A;  3M53 A;  1YJW A;  1WJQ A;  2RI5 A;  3CCS A;  4DBR A;  1A0N B;  2OI3 A;  2EQI A;  3G1J A;  3N5B B;  4M7A C;  3MP1 A;  1AD5 A;  4HVV A;  4NL3 A;  3M4Y A;  3CME A;  1Q81 C;  1BCM A;  5GAM h;  2K3Y A;  3S3O A;  3PNW C;  3KXT A;  1VQ9 Q;  5KE3 A;  2RQT A;  4ZGE B;  1Y0M A;  5AYF A;  1KHI A;  3G6E A;  4PJO A;  1M27 C;  1B34 B;  4LDU A;  1BKB A;  1CSK A;  1YHQ T;  3SWN A;  1OPK A;  3PFS A;  4PK4 A;  3CC4 A;  4RTX A;  3JAM E;  3CBM A;  1KC8 U;  4C8Q F;  2DJZ A;  2LMJ A;  3JCM h;  1VQ9 T;  2QYZ A;  1MNE A;  1DJ7 B;  3BDL A;  1EIF A;  1X27 A;  4AFU C;  4F7U E;  3NGP A;  5IH2 A;  1QQJ A;  4VUB A;  5HY6 A;  2HQH A;  3M0R A;  1B7T A;  3C94 A;  1PKT A;  1WPY A;  3QZ5 B;  1XJW B;  4LD6 A;  1GL5 A;  2DD4 A;  2Y4Y A;  2M0Y A;  1S72 A;  2PU9 B;  2DL4 A;  4QT7 A;  4J7I A;  1UUE A;  4M7D F;  1GCQ C;  2PVD B;  3X20 B;  2E1H A;  1FMW A;  3EH1 A;  4J8O A;  2MMP A;  4OB0 B;  2LCS A;  1UTI A;  1R8O B;  3V8K A;  2KVQ G;  3QDR B;  1CKB A;  2RQV A;  3A8L B;  3CPW P;  1K73 U;  4BDY A;  1U1S A;  2K9G A;  2O01 E;  2EFI A;  3HPW A;  1T3S A;  3URG A;  3SEM A;  2RF0 A;  1G3Y A;  4KUL A;  2F69 A;  3WVD B;  1NYF A;  4EPC A;  1UJY A;  2L8D A;  4RG8 A;  2DYB A;  1SSF A;  2H3J A;  3M57 A;  4J9D A;  3QBY A;  2CZ7 B;  2LC4 A;  1UB4 A;  1I5O B;  2Y90 A;  1RI0 A;  2VVK A;  2E64 A;  1NG2 A;  4AG1 C;  1W6X A;  4XAX B;  2BZX A;  2QQA A;  4UC4 A;  4J9C A;  3HRS A;  4PLI A;  4M75 F;  1MHN A;  1BI3 A;  2P4T A;  1BCO A;  2P84 A;  3WVE B;  1YIT T;  2FB7 A;  2E5Q A;  3MEU A;  4M75 G;  4Z02 A;  4XTY A;  5LJ5 j;  2QEX A;  1U1T A;  1VQ8 A;  3L2Z A;  1NJI C;  1YNZ A;  2D8H A;  2A36 A;  1QCF A;  2XDD A;  4LDW A;  1RUW A;  1VQP Q;  1M4Z A;  1VQN T;  3O5Z A;  2DVE A;  3VRZ A;  2KRN A;  4M78 C;  5GAM e;  3LWI A;  5GJW B;  2HQE A;  4EDU A;  2EGC A;  2FL7 A;  3NTK A;  5HKC A;  2YHT A;  4J9H A;  2DJQ A;  4B6M A;  4CC7 A;  2OJ2 A;  4F7U B;  1ZLM A;  3CC7 A;  3JCM g;  2ZPE B;  1G2B A;  4OMQ A;  4RTY A;  1UGQ B;  1ZX6 A;  3E9F A;  1FX7 A;  2X4Y A;  3BY7 A;  5LJ5 e;  1K8A U;  3V8L A;  5LJ5 h;  5GAN f;  1N8R C;  1PWT A;  2RI2 A;  2KYB A;  4XTV A;  2QGG A;  4N0A C;  1D3B A;  1NLO C;  2EGA A;  3H0I A;  3C0C A;  1Y96 B;  3M0S A;  4MMK A;  3TVT A;  1RI9 A;  4E7Z A;  3JCM b;  2DTO A;  5FU6 C;  5GAM g;  3GF5 A;  3H41 A;  1RLP C;  2ED0 A;  1RAH B;  3EGX A;  1OU8 A;  1ACM B;  3A8H B;  2DKG A;  3L1A A;  1PSE A;  5A0L A;  3CBP A;  3CCL A;  4HKE A;  5GAN h;  2FZC B;  2CSI A;  2CSQ A;  1Y57 A;  5IHK A;  3CCS Q;  1K0X A;  3T9N A;  4EMG A;  3LH0 A;  4C8Q G;  1FWZ A;  2G6F X;  1VQM T;  5KYY A;  3HSB A;  3M56 A;  3OYD A;  3CCQ Q;  2EQM A;  4EMK A;  3VS2 A;  3CMA A;  2DER A;  1BB9 A;  2KDS A;  1SKU B;  5KYW A;  3V7C A;  1VQO Q;  3I55 Q;  3CCQ A;  1Y96 A;  2DO3 A;  2WSE E;  4QVD A;  1OEB A;  1YJ9 T;  2RHZ A;  1ARK A;  1BI1 A;  1KFZ A;  4M75 E;  4RUG A;  3OYE A;  4F16 A;  1W1F A;  2RHX A;  2DXT A;  2DEU A;  1D09 B;  3HRT A;  4JRP A;  1JXO A;  2FRW A;  1RLQ C;  3R6N A;  2F1L A;  2KSS A;  2SEM A;  5LJ5 d;  4JZ4 A;  3OYK A;  4MZT A;  2NUP A;  3UA6 A;  2GFU A;  3EG2 A;  1ABQ A;  4C5I A;  1UFF A;  4GBQ A;  3G7Z A;  2MPX C;  3S3N A;  2GBQ A;  2L3S A;  3SWN C;  2DPP B;  4E7L A;  5GAO r;  5IHN A;  3CCS T;  3CCM Q;  2RMO A;  1YJW T;  1UEC A;  5GAM j;  1TUD A;  4O5V A;  1U06 A;  3R6O A;  2HKN A;  1WNL A;  2A08 A;  2NWM A;  4L59 A;  1Q81 R;  1NEG A;  5FWC A;  2FEI A;  1Q95 G;  2RHY A;  3MEV A;  3KUF A;  1M1K U;  2CP6 A;  3GOX A;  4ZN1 A;  1K9A A;  2XG8 D;  2E10 A;  2GQV A;  1QVG A;  5I2S A;  2DL3 A;  3CMA Q;  2VXE A;  2QQS A;  2RHU A;  4JRQ A;  1IZ6 A;  1KSW A;  3QXE B;  3G6E T;  2KNB B;  3C12 A;  1NPP A;  3DLM A;  1Q86 R;  2O9V A;  2LDM A;  2LNH B;  2PUO B;  5IAY A;  2HBP A;  3SFM A;  7AT1 B;  3X26 B;  4J5Y A;  1O9S A;  2QA4 T;  1OU9 A;  4IUV A;  3OYY A;  4ZGJ B;  3FC3 A;  1BBZ A;  1PHT A;  4A63 B;  1JBM A;  5KYU B;  4C92 D;  2V26 A;  1YCS B;  3I56 A;  2BIV A;  3OYL A;  1M1K C;  2C0I A;  3RDV A;  4IKF A;  4Z88 A;  2E6Z A;  5GAN 8;  2DIG A;  2GNC A;  2JMC A;  3CCJ A;  3OYB A;  3VV0 A;  2DA9 A;  4ZN3 A;  3OYM A;  3ME9 A;  4R56 A;  1TSF A;  2ZCF B;  2CH4 A;  1VQP T;  4Y28 E;  5GAN 6;  1MV0 B;  3MCA B;  3CCM A;  2EQJ A;  3ER0 A;  3FJ5 A;  4J6Y A;  3M0U A;  2A0F B;  2CZ0 B;  1JU5 C;  5GMK e;  4HVW A;  2DRM A;  3ZEH A;  5LJ3 j;  4AMC A;  5GMK h;  3CCU A;  1TWB A;  4MDW A;  3JV3 A;  1KQ1 A;  1YI2 T;  2C0O A;  1QVF P;  1PCX A;  2FHD A;  1M1F A;  1IHW A;  3I56 T;  4K11 A;  3RER A;  1M90 C;  3CD6 T;  4ANJ A;  2JXB A;  5GMK i;  1U3O A;  2IVW A;  4CRI A;  3OYI A;  2EQU A;  2P4R A;  1M8V A;  3UPU A;  2AKK A;  2JVV A;  2K3X A;  3BFM A;  3REA B;  1QWE A;  2QGF B;  1BIB A;  2FPF A;  2DAQ A;  3CQT A;  4JDS A;  1QP3 A;  2D0Q B;  3AT1 B;  3HP9 A;  1VQK Q;  8ATC B;  3HRU A;  3I55 A;  3CXC A;  3RNJ A;  4FM4 B;  1HYO A;  1RAI B;  1YJ9 A;  3G71 Q;  3HFO A;  1UJ0 A;  4MZP A;  4HCK A;  1D3B B;  5KCH A;  1KG1 A;  1YBY A;  1YJW Q;  3CCR Q;  1LJO A;  1ZQ1 A;  2M9U A;  2YSQ A;  4GLM A;  2D9T A;  1EZZ B;  5GAN 4;  1CKA A;  1VQ6 T;  3A8O B;  3SD4 A;  4M75 D;  4XU2 A;  3EGX B;  3BW1 A;  1D0Y A;  5GAM d;  2Y4X A;  3CD6 Q;  2X51 A;  1ZBX A;  3CC7 Q;  2RPN A;  2RK2 A;  4X9C A;  4OP0 A;  1VQ7 Q;  3CC2 T;  2RO0 A;  2V1Q A;  4J9F A;  3L2R A;  1GBQ A;  4BI4 A;  2JZ2 A;  4EMH A;  4KUI A;  2LJ1 A;  4BY6 B;  2A28 A;  3MP8 A;  3PVL A;  1YJN Q;  2VUB A;  3I5R A;  4C8Q A;  2AZV A;  5GJV B;  2F5K A;  2JT4 A;  3H6Z A;  4E6R A;  1SHG A;  2OTL A;  2EBP A;  1KD1 U;  1IRE B;  1WA7 A;  5LJ3 g;  1JJ2 S;  3SB2 A;  1Q82 U;  1UEB A;  1EX4 A;  2EJ9 A;  5I2M A;  2R5M A;  1VQK A;  3ZBD A;  3EGU A;  2FO0 A;  2LCL A;  3EG1 A;  4FW1 A;  4KH0 B;  2YXY A;  1B34 A;  4HCZ A;  4ORZ A;  2XDP A;  1TOV A;  2K2M A;  1C0M A;  4JJD A;  5KCO A;  2QTX A;  5GAN j;  1KQ2 A;  1WXT A;  1PSF A;  1PD0 A;  1M3A A;  4MML A;  1YIJ Q;  5DY9 A;  2FPD A;  3I56 Q;  1KQS P;  3VS5 A;  2NUP B;  1WYX A;  2O2O A;  3JCM P;  2SRC A;  2AZS A;  4DEY A;  3LLR A;  3FDR A;  2MOX A;  2VGM A;  3PTA A;  3KFV A;  2E4H A;  4M78 G;  4M77 D;  5J39 A;  3AHU A;  2DNU A;  4FIB A;  4FYV B;  1D1A A;  3CCL Q;  1M3C A;  4RTW A;  3U23 A;  4AFZ C;  4HCC A;  4PKC C;  2CZ6 B;  3MKD A;  1T0H A;  2MYS A;  3L2V A;  1K1Z A;  1M5Q 1;  4M7D G;  4FT2 A;  5LJ3 h;  3CCU Q;  4C8Q D;  5D6W A;  1WHK A;  3H8Z A;  4Q5W A;  2B86 A;  2DMO A;  3MHX A;  2EYZ A;  3M0T A;  3CC4 Q;  2XD0 A;  3EG9 B;  1KC8 C;  2QTV A;  3INZ A;  3VS7 A;  2E70 A;  2OTL T;  4PJO B;  2HQX A;  1M1G A;  1NEB A;  2XIC A;  3UT1 A;  1VYU A;  3M0Q A;  1D0Z A;  3FIF A;  1Q7Y R;  4C92 G;  5A0G A;  4JS5 A;  2D8J A;  4OB2 B;  5GAN 5;  4PFO A;  2M0O A;  5C0M A;  1WQW A;  2DBM A;  3VRY A;  4ZTF A;  3EAE A;  4QW2 A;  1AOJ A;  1I81 A;  3JB9 G;  4DQ2 A;  2B8A A;  1U8R A;  4DA4 A;  2DIQ A;  2PNI A;  5IN1 A;  4EMK B;  3FB9 A;  5GAO n;  1YJN A;  1D0X A;  2CT3 A;  3M59 A;  4C0G A;  4KBM B;  4FYW B;  3VUZ A;  1QW1 A;  2DZ9 A;  2KXC A;  3QYG B;  4J7F A;  3HL8 A;  2CDT A;  3OA6 A;  4XU1 A;  1VYV A;  3HTR A;  1G83 A;  1YIJ T;  1K8A C;  1D1B A;  3CC7 T;  1X6G A;  1M30 A;  1TG0 A;  4BDZ A;  1M8M A;  4NS5 A;  5D6X A;  2K3B A;  5EC7 A;  3JCM Q;  2VC8 A;  4M7A D;  2DK3 A;  3CC2 A;  4C5E A;  4M7D D;  4M7A G;  2JS2 A;  1SPK A;  4E7S A;  2ZGW A;  4QVZ A;  4LDX A;  4HT9 A;  1OX9 A;  3VYH B;  2NYS A;  5CO7 A;  1QVG S;  5CKF A;  3NHN A;  2EKH A;  3I35 A;  5IXB A;  1GBR A;  1BI2 A;  1RAF B;  2ZZD A;  1QVG P;  2NUT B;  3OSS C;  2YUP A;  4BUG A;  3CXC P;  2ZPG B;  2X4W A;  1UGV A;  1X69 A;  3NTH A;  3QSU A;  4BY6 C;  1I8F A;  4M75 C;  1VIF A;  3E1S A;  3I55 T;  1TUC A;  1WHJ A;  2XMF A;  4E7J A;  2QQB A;  3MJX A;  4J83 A;  3VS4 A;  2HKQ B;  5KYU A;  4M75 A;  4PFZ A;  3J81 E;  5CK9 A;  2EAY A;  2KY9 A;  4P5N A;  2A3L A;  1W2B S;  2O9S A;  2W10 A;  1VQP A;  4LDV A;  2NLU A;  4LUE A;  5LJ3 f;  1QVF A;  3QYH B;  2Z0W A;  2X3W D;  4DOV A;  3OY9 A;  4R0K A;  2X4X A;  4Z8A A;  4OF1 A;  4KUD K;  2O31 A;  1VQM Q;  4CC2 A;  1TU0 B;  2DZC A;  3ASK A;  5D7U A;  1KIK A;  1GFC A;  1YI2 A;  1V29 B;  2HSP A;  5GAN 7;  1AVZ C;  5GAN 2;  2AIR B;  1QVP A;  3WXM B;  4IUP A;  4N4H A;  4M77 F;  3QO3 A;  2MF2 A;  5HCK A;  5CKH A;  4OML A;  3RIR A;  1PKS A;  3QKJ A;  3HKS A;  2LJ0 A;  1KC8 R;  5D6Y A;  1VQ9 A;  1VQN Q;  1WLP B;  4ESR A;  3MO8 A;  4M78 D;  4JLI A;  3I5S A;  1N8R U;  2P0P A;  4C92 B;  2KEA A;  3E9G A;  5GAN d;  3MP6 A;  2ECZ A;  2DVJ A;  2DD5 A;  3CCR T;  3CCR A;  3CBO A;  3CCJ T;  3OB9 A;  3M0P A;  3JRZ A;  4PJL A;  3OYF A;  2LX7 A;  2BUD A;  4E7H A;  5A2Q E;  2EJG A;  1BI0 A;  1G3S A;  3TRE A;  1VQ4 A;  1WHG A;  3OW2 A;  1QWF A;  1G3T A;  2M1H A;  2R5A A;  4DBF A;  2KT8 A;  1HJD A;  2FRY A;  4LUD A;  1K0S A;  3A8G B;  1ZA1 B;  2QA4 A;  3E19 A;  3OYC A;  4B9W A;  4OMM A;  4YTL A;  1WI7 A;  1TH7 A;  2QDY B;  1KK7 A;  3GNF B;  1I1J A;  2PTK A;  1GCP A;  3OW2 S;  1NYG A;  2DX1 A;  4ZTJ A;  3EFO B;  3QPH A;  1KJW A;  1AWX A;  2LT4 A;  3OW2 P;  2MK5 A;  5CQY A;  1W70 A;  2RQR A;  2DL8 A;  2EYX A;  1WJS A;  1FXX A;  3V7R A;  4QQG A;  3UA7 A;  2YRC A;  2DYI A;  4JZ3 A;  2KR3 A;  3CCM T;  4PJO G;  2IG0 A;  2QQR A;  5C6S A;  2CP7 A;  3QHS A;  5GAO m;  4ELZ C;  2CYZ B;  1NM7 A;  1R0B G;  2OTJ T;  2DTH A;  1OOT A;  3CD6 A;  4BI3 A;  2HEQ A;  1Z9Q A;  4RG2 A;  1AZG B;  4A4K A;  2WSC E;  2YUN A;  2P0Q A;  1IHV A;  4J6W A;  1J3T A;  5KYX B;  1YIT Q;  2HAX A;  2HSE B;  1X43 A;  5GMK l;  2RK1 A;  3NPF A;  1HK9 A;  1I4K 1;  2RQU A;  1OPL A;  3LGF A;  2OTL Q;  5L8R E;  4XTW A;  2DXB A;  2QA4 Q;  1WHL A;  4NOY A;  1NJI U;  5GAN e;  4Y91 A;  4J6X A;  2LJ3 A;  2CZ1 B;  3ZL7 C;  4ATO A;  5GAN 3;  3L2Q A;  2C0T A;  4HXJ A;  1JRI A;  2XID A;  3ZFJ A;  3PT9 A;  1SRL A;  2M51 A;  3OMG A;  3CCL T;  4PL6 A;  2J6K A;  1PNJ A;  1UGS B;  2X3X D;  2COW A;  2K4Y A;  4FT4 A;  2FG0 A;  1FYN A;  2BE9 B;  1M90 U;  2EYW A;  2BZY A;  4FSS A;  2ENM A;  1SHF A;  1VQ5 T;  3OBW A;  2KRO A;  3O8V A;  3CCV T;  2KMT A;  3KBG A;  5FU7 B;  2L3Q A;  3FEO A;  1VQM A;  1PD1 A;  1WJR A;  2CS7 A;  1UHC A;  2WAC A;  1AWO A;  2XDB A;  4LDY A;  3JCM e;  5I22 A;  1YWO A;  3EFR A;  3JCM J;  3UWN A;  5KYW B;  1ZUU A;  3QJ6 A;  4C0Z A;  5LJ3 e;  4JJB A;  4J9B A;  4M7A A;  4FSX A;  1BIA A;  4BD3 A;  3P8H A;  2KI7 A;  4F14 A;  3REB B;  2G3R A;  3CCE Q;  1QCN A;  2BE7 D;  1YN8 A;  5I21 A;  3D7S B;  3J80 E;  2HNI A;  4CC4 B;  2HL3 A;  1V76 A;  4A4G A;  2COZ A;  4F7U F;  5GMK j;  4A4E A;  2JM8 A;  5CKE A;  3THK A;  2CH4 W;  1MND A;  3RES A;  2YRD A;  4AT1 B;  4M77 G;  1LVK A;  1OI1 A;  4PJO E;  4LE9 A;  1MMN A;  1VUB A;  4WF2 A;  3OMC A;  1SEM A;  2LNV A;  2JM9 A;  1SSH A;  4LN2 A;  1KD1 C;  1VQ7 T;  2OX7 A;  2DM1 A;  2F2V A;  1Q82 C;  5CAI A;  2F2W A;  4FU6 A;  4XTZ A;  2MCN A;  4N0A A;  3FRN A;  1Z9Z A;  2EYQ A;  4XK8 E;  4E7K A;  1VQ6 Q;  4DBQ A;  2VV5 A;  3JB9 I;  3OS1 A;  4KGV B;  2VWF A;  4FCY A;  4M7D A;  1XOV A;  1UGP B;  1Q7Y U;  4MZM A;  1ZHI A;  2HBW A;  3JCM W;  2E6N A;  4C8Q B;  2JUF A;  1Y71 A;  2AK5 A;  3M9Q A;  2K6D A;  5ECA A;  4J9I A;  4M77 C;  1M3B A;  4JUV A;  3LYI A;  5KYN A;  1M2O A;  2JTM A;  2QEX T;  3QDF A;  1K9M U;  3CPW S;  3FLG A;  4B9X A;  2JW4 A;  3QWX X;  5EG2 A;  4M78 A;  2RJE A;  2J6F A;  2P0K A;  4KGX B;  3QG1 A;  2HCK A;  1S72 Q;  1VQL T;  4LXC A;  1E6G A;  4HCB A;  1NJI R;  4M7D E;  2VB6 A;  4AFQ C;  3RR6 A;  2QK0 A;  1SRM A;  2LP5 A;  4F7U G;  4J9G A;  2K2V A;  4PJJ A;  3V8J A;  3VKI A;  1WQ7 A;  4IIO A;  2BTT A;  3RMQ A;  4BE1 A;  4ZNX A;  3EGD B;  2DFU A;  2ABL A;  4PNO A;  3JB9 J;  2JS0 A;  1N5Z A;  1X2K A;  1H64 1;  2RJD A;  1Q86 U;  3TCJ A;  2QQ9 A;  3EH2 A;  5KE2 A;  5LL6 S;  1SF9 A;  4KGZ B;  1K73 R;  3MET A;  1EFN A;  3M5A A;  2ZPI B;  4D8K A;  2VGN A;  1ZSZ C;  1KHC A;  2FYK A;  4M77 B;  2K79 A;  4BE0 A;  2GFA A;  3CCV Q;  5GAM f;  2NUT A;  3VS6 A;  2I0N A;  1JJ2 A;  3OS0 A;  2ZPB B;  1PG5 B;  5DM7 R;  1TS9 A;  5DLO A;  2RJF A;  2A7Y A;  1SG5 A;  3OYA A;  2HL5 C;  5DLQ E;  2XU8 A;  3LW5 E;  2CP2 A;  4DOW A;  1Q82 R;  4QQ6 A;  1ZSZ B;  4JJN K;  1VQN A;  1OX8 A;  1FMV A;  2EGE A;  3RMS A;  2EVR A;  4JRI A;  4C8Q C;  1QVF S;  2YUO A;  1B3Q A;  4OVA A;  5KH6 A;  1BK2 A;  4OMO A;  2F2X A;  2GF7 A;  5CIU A;  2O4X B;  2ZAE A;  4A4F A;  3PIO A;  3DKM A;  3E2U A;  4BE2 A;  4LNP A;  3GBQ A;  4OMP A;  4PJO F;  2VKN A;  2X35 A;  4OGE A;  2ROT A;  3OS5 A;  3CME Q;  1N6A A;  2KRM A;  5CR2 A;  2H8H A;  1Q81 U;  4GLK A;  2COY A;  3VS3 A;  4X1V A;  1T3L A;  4OMN A;  3VS0 A;  4IUT A;  1RAA B;  1OV3 A;  4A4H A;  3CEY A;  2PQW A;  1QMC A;  1S72 T;  3C4S A;  4KT0 E;  1X6O A;  2QDL A;  2RHI A;  6AT1 B;  1ZSZ A;  1H3Z A;  2RD1 A;  2KK4 A;  1R0C B;  3PGG A;  4JJC A;  2XKO C;  3HFN A;  4Y92 A;  2RNA A;  1OZ2 A;  2JTE A;  2QEX Q;  3P8B B;  2YLC A;  2E5K A;  4HVU A;  4AFS C;  3EHR A;  1M2V B;  4XU0 A;  4A53 A;  2XK0 A;  3G4S A;  2E3I A;  1K8A R;  2DEQ A;  3QZ9 B;  1VQ5 Q;  2RJC A;  4HT8 A;  2NUZ A;  4FYY B;  3OS2 A;  2YRV A;  3JCM c;  2EJF A;  2OTJ Q;  4QQD A;  3JB9 D;  2DIL A;  2LZ6 B;  1E7O A;  3OQ5 A;  3M54 A;  1WZO A;  4ELY C;  2MWP A;  2KXD A;  2A37 A;  4A54 A;  3MPU B;  3NFC A;  3I9Q A;  2DET A;  2DE0 X;  4OMF B;  1FMK A;  3PMI A;  4L6V 5;  4XQ3 A;  1JQQ A;  4F7U A;  1JB0 E;  3M55 A;  2K5F A;  4NL2 A;  3EFS A;  2VAS A;  4D6W A;  3S3M A;  1XQH A;  1YI2 Q;  4C92 E;  1VA7 A;  2GGR A;  1NBE B;  1VQ4 T;  1K73 C;  3NTI A;  2EKO A;  1UG1 A;  3GP8 A;  1WIE A;  3PVQ A;  2K7A A;  3VYG A;  4BAC A;  3A8M B;  3CCU T;  2LVM A;  3C95 A;  3JCM d;  1YFN A;  2LQ8 A;  3ULR B;  4IUR A;  1NZ9 A;  3H9N A;  2IPO B;  1IGU A;  3LH5 A;  3LGL A;  5J26 A;  3G6E Q;  1IGQ A;  2EYY A;  1X6B A;  1MMD A;  2CKK A;  3JB9 F;  1B07 A;  2DTI A;  4F04 B;  5LJ5 g;  4M77 A;  1WHM A;  4JS4 A;  2KT1 A;  2V8I A;  2AKL A;  3M58 A;  3MEW A;  5CCA A;  2QXF A;  2V8J A;  3JCM X;  3X24 B;  1BYM A;  1VQ4 Q;  3SWN B;  3SDZ A;  2ATC B;  3GLX A;  1LCK A;  3RKY A;  3OSV A;  9ATC B;  1D1C A;  3TU4 K;  1Q86 C;  2ED1 A;  5LJ5 f;  2EIF A;  4FL6 A;  1TTH B;  4M7A E;  1MGQ A;  3RBB B;  2D6F A;  5HK0 A;  2E41 A;  2RA2 A;  2OTJ A;  3L42 A;  4JRK A;  2PZ1 A;  4Z89 A;  2X4J A;  4V2S A;  4HA8 A;  1K76 A;  1X01 A;  2LQW A;  1Y7X A;  2GTJ A;  2KRS A;  1V1C A;  1RAG B;  2LCC A;  2LX9 A;  1JXM A;  4J9E A;  4N4G A;  1I5L A;  5FRO A;  1PRM C;  2YT6 A;  5CQX A;  2MI6 A;  3LWH A;  2E12 A;  4RKU E;  3EG9 A;  5I11 A;  2XHC A;  2JN0 A;  3CCQ T;  2GQI A;  3RKW A;  1GRI A;  5FLX E;  5IT9 E;  3L2W A;  1HD3 A;  4BI8 B;  3LX7 A;  2O88 A;  4M7A F;  2RI3 A;  1AHJ B;  2EWN A;  2VXF A;  4C5H A;  3CMA T;  3VS1 A;  2RB6 A;  4RTU A;  1IXD A;  2DXC A;  1YJN T;  3H0F A;  5GAO p;  1K4U S;  4IUQ A;  2MAM A;  3QII A;  2M16 A;  1UDL A;  2MWO A;  2C06 A;  3F70 A;  3VUB A;  2L89 A;  1G5V A;  2J06 A;  2HD0 A;  1AT1 B;  1ZUY A;  2DXU A;  1H3H A;  4PJN A;  1G8X A;  4BB7 A;  3X28 B;  1K9M R;  1JEG A;  4JLG A;  2OAW A;  1TXQ A;  1RAE B;  3MEA A;  1VQL A;  2YDL A;  4FW2 A;  4RTT A;  1JO8 A;  4II1 A;  2ROL A;  4X34 A;  3DB4 A;  1VQO T;  2JTF A;  5GAO q;  2LQK A;  1OUL A;  2JNG A;  5M9O A;  4ZGD B;  2DBK A;  1YHQ Q;  3J7A F;  1W2B P;  2FZK B;  4RTZ A;  1WDX A;  1ZA2 B;  1NE8 A;  4PJM A;  4RCC A;  4AG2 C;  3QWY A;  1UHF A;  1RAD B;  2KGT A;  4C5G A;  4WTO B;  5FW9 A;  3TSZ A;  1MV3 A;  3BDU A;  2RQW A;  1AWW A;  1LNX A;  2FVU A;  4OB1 B;  5FRM A;  3A5Z B;  4KRT A;  3OYJ A;  4PJO C;  3UDC A;  1N27 A;  3VJP A;  1JJ2 P;  2L5Q A;  1RL2 A;  2L3R A;  3UF4 A;  4M7D B;  1N9S A;  1VIE A;  4XTX A;  4FYX B;  3CC2 Q;  2K5I A;  2PVG B;  5FWB A;  4XTU A;  4M78 B; 
#chains in the Genus database with same CATH homology
 4PLL A;  4M75 G;  4Z02 A;  4XTY A;  5CAI A;  5LJ5 j;  1YIT A;  2QEX A;  4FU6 A;  4XTZ A;  1U1T A;  4N0A A;  3FRN A;  3LLR A;  1VQ8 A;  3PMT A;  3FDR A;  3L2Z A;  2EYQ A;  4XK8 E;  4E7K A;  5CVI A;  2VV5 A;  3G71 A;  2VGM A;  3PTA A;  4E7I A;  3JB9 I;  3OS1 A;  1NJI C;  4M78 G;  2I2L A;  1KQS A;  4EMK C;  4M7D A;  1XOV A;  4M77 D;  2EQK A;  1UGP B;  5J39 A;  3AHU A;  3RUX A;  3Q1J A;  2XDD A;  1Q7Y U;  4LDW A;  4MZM A;  1ZHI A;  1M4Z A;  4FIB A;  3PIP A;  3JCM W;  1VQN T;  2DVE A;  2E6N A;  4C8Q B;  2JUF A;  1Y71 A;  4PJO E;  4HCC A;  4PKC C;  3M9Q A;  4C0F A;  2CZ6 B;  4M78 C;  4M78 E;  3G71 T;  5GAM e;  3LWI A;  4M77 C;  4M77 E;  3L2V A;  4N4I A;  4JUV A;  3LYI A;  1M5Q 1;  3VU3 C;  1VQ8 T;  4M7D G;  4FT2 A;  2HQE A;  2JTM A;  5LJ3 h;  4C8Q D;  5D6W A;  2QEX T;  4EDU A;  1G3W A;  3H8Z A;  4Q5W A;  2FL7 A;  3HHT B;  3MHX A;  1K9M U;  3NTK A;  5HKC A;  2YHT A;  2XD0 A;  3CPW S;  1VQ7 A;  3FLG A;  4B9X A;  3M4G A;  1KC8 C;  5EG2 A;  4M78 A;  4RMO A;  2RJE A;  3INZ A;  4F7U B;  3CC7 A;  4LD9 K;  2P0K A;  3JCM g;  2E70 A;  2ZPE B;  3QG1 A;  3X25 B;  1YIJ A;  2OTL T;  4PJO B;  2HQX A;  1M1G A;  1OZ3 A;  2XIC A;  3UT1 A;  3DLL A;  1VQL T;  5LJ3 d;  4HCB A;  1UGQ B;  3E9F A;  1FX7 A;  2X4Y A;  4M7D C;  3BY7 A;  4M7D E;  3FIF A;  5LJ5 e;  1K8A U;  5GAN g;  4C92 G;  5A0G A;  2RM4 A;  3V8L A;  4OB2 B;  5GAN 5;  5FU7 C;  4JS5 A;  2M0O A;  4F7U G;  5LJ5 h;  5C0M A;  2K2V A;  1WQW A;  5GAN f;  4ZTF A;  1Q7Y C;  3EAE A;  2ZPF B;  3V8J A;  3VKI A;  1N8R C;  4QW2 A;  1I81 A;  1WQ7 A;  2RI2 A;  4C92 A;  3RMQ A;  4DQ2 A;  4XTV A;  3JB9 G;  2B8A A;  1U8R A;  4BE1 A;  2CGH A;  2V8K A;  4N0A C;  4C92 F;  1D3B A;  5J3B A;  3CCV A;  1P92 A;  1Y96 B;  3OYN A;  4PNO A;  4MMK A;  4DA4 A;  4MDX A;  3JB9 J;  2DIQ A;  5IN1 A;  2K57 A;  2XI9 A;  4EMK B;  1H64 1;  2RJD A;  4PJO D;  3FB9 A;  5GAO n;  1YJN A;  1Q86 U;  3TCJ A;  3JCM b;  1VQ5 A;  2DTO A;  1K9M C;  3M59 A;  2QQ9 A;  4C0G A;  4KBM B;  5FU6 C;  5GAM g;  2WSF E;  3GF5 A;  3VUZ A;  1GXI E;  1KQS S;  1QW1 A;  5FRN A;  5KE2 A;  2DZ9 A;  5LL6 S;  3A8H B;  2DKG A;  3MET A;  3M5A A;  3L1A A;  3QYG B;  4J7F A;  2ZPI B;  3HL8 A;  2VGN A;  4BE0 A;  1KHC A;  1PSE A;  2FYK A;  4M77 B;  3OA6 A;  4XU1 A;  5A0L A;  4L5G A;  3CBP A;  3CCL A;  4HKE A;  5GAN h;  1BYM A;  1YIJ T;  4O6J A;  2GFA A;  1K8A C;  2QI2 A;  3CC7 T;  4BDZ A;  4NS5 A;  5GAM f;  5D6X A;  1YHQ A;  1JJ2 A;  3OS0 A;  3T9N A;  2ZPB B;  2VC8 A;  3JCM Q;  4EMG A;  2DK3 A;  5DM7 R;  3OYG A;  3CXC S;  4M7A D;  3LH0 A;  4C8Q G;  5DLO A;  2RJF A;  3CC2 A;  1FWZ A;  4C5E A;  4M7D D;  2A7Y A;  2PUK B;  1VQM T;  3HSB A;  3OYA A;  4M7A G;  1NPR A;  2ZGW A;  4QVZ A;  4LDX A;  5DLQ E;  4HT9 A;  2E65 A;  3VYH B;  2XU8 A;  3LW5 E;  5CO7 A;  1QVG S;  5CKF A;  1HXD A;  4DOW A;  2ZPH B;  3M56 A;  3OYD A;  2K5L A;  2EQM A;  4QQ6 A;  2PVO B;  5CKB A;  4JJN K;  1VQN A;  1BI2 A;  4EMK A;  3S6W A;  3RMS A;  3L2U A;  2ZZD A;  3CMA A;  4JRI A;  4C8Q E;  4C8Q C;  3OSS C;  1QVF S;  2KDS A;  4CI0 C;  3CME T;  2LTO A;  4OVA A;  5KH6 A;  3V7C A;  4M78 F;  4IUU A;  3CCQ A;  1Y96 A;  4BUG A;  2GF7 A;  5GMK m;  2R57 A;  2ZPG B;  1VQK T;  5CIU A;  2DO3 A;  2X4W A;  2WSE E;  2O4X B;  3QJY A;  4GY5 A;  4A4F A;  4QVD A;  3DKM A;  3PIO A;  3NTH A;  4BE2 A;  1YJ9 T;  2RHZ A;  3QSU A;  5A0D A;  2GCX A;  4BY6 C;  1O75 A;  1I8F A;  1BI1 A;  1XTD A;  4RCB A;  4M75 E;  4M75 C;  4OB3 B;  1VIF A;  3OYE A;  1VQO A;  3RKX A;  3E1S A;  3OBY A;  4PJO F;  3I55 T;  2VYT A;  2RHX A;  1W2B A;  2X35 A;  4E7J A;  2QQB A;  2DXT A;  4OGE A;  3GIB A;  3OS5 A;  4J83 A;  1N6A A;  4M75 A;  5CR2 A;  3J81 E;  5CK9 A;  3HRT A;  2EAY A;  2KY9 A;  4P5N A;  2A3L A;  4GLK A;  4JRP A;  1Q81 U;  1W4S A;  4X9D A;  2KSS A;  1W2B S;  5LJ5 d;  1VQP A;  4LDV A;  3OYK A;  2NLU A;  4IUT A;  4MZT A;  4A4H A;  3CEY A;  5LJ3 f;  2PQW A;  1QVF A;  3QYH B;  4DOV A;  3OY9 A;  3C4S A;  3OYH A;  4KT0 E;  1S72 T;  1X6O A;  2X4X A;  2GFU A;  4OF1 A;  4C5I A;  4KUD K;  2RHI A;  3G7Z A;  1H3Z A;  3S3N A;  2RD1 A;  2LRQ A;  2KK4 A;  1UGR B;  2DZC A;  3CPF A;  3ASK A;  5FU6 B;  3SWN C;  3FJP A;  3PGG A;  2XKO C;  3HFN A;  4E47 A;  2RH2 A;  3DB3 A;  2DPP B;  1YI2 A;  1V29 B;  1OZ2 A;  5GAN 7;  4E7L A;  5GAN 2;  5GAO r;  3CCS T;  1QVP A;  3P8B B;  4IUP A;  4N4H A;  4M77 F;  2YLC A;  3WXM B;  3QO3 A;  1YJW T;  2MF2 A;  2JOY A;  2R58 A;  4XU0 A;  4A53 A;  5CKH A;  5GAM j;  4O5V A;  3R6O A;  2XK0 A;  3G4S A;  1WNL A;  3RIR A;  3QKJ A;  1QP2 A;  3HKS A;  4L59 A;  5D6Y A;  1VQ9 A;  2RHY A;  2DEQ A;  3MEV A;  3QZ9 B;  3KUF A;  3GNG A;  2YLB A;  1Q82 C;  1M1K U;  1WGS A;  2RJC A;  3CCE A;  3GOX A;  3MO8 A;  4ZN1 A;  4M78 D;  3OS2 A;  4HT8 A;  2YRV A;  2XG8 D;  4JLI A;  3JCM c;  2E10 A;  2GQV A;  2EJF A;  1QVG A;  1N8R U;  2P0P A;  4QQD A;  5I2S A;  3CPW A;  2VXE A;  2QQS A;  3JB9 D;  1Y07 A;  2RHU A;  4C92 B;  2OAU A;  3OQ5 A;  4M75 B;  2F5T X;  3M54 A;  2BKD N;  3E9G A;  5GAN d;  3MP6 A;  4ELY C;  4JRQ A;  2MWP A;  2DD5 A;  3GPL A;  1IZ6 A;  3CCR T;  3CCR A;  3QXE B;  3CBO A;  3CCJ T;  3G6E T;  3TEE A;  1X75 C;  4A54 A;  3C12 A;  1NPP A;  3DLM A;  3OB9 A;  3JRZ A;  3NFC A;  2KAF A;  2LDM A;  3OYF A;  2PUO B;  5IAY A;  2HBP A;  2O4X A;  4OMF B;  4XQ3 A;  3PMI A;  4L6V 5;  4M7A B;  2BUD A;  3SFM A;  5A2Q E;  4E7H A;  2EJG A;  4F7U A;  1BI0 A;  1JB0 E;  1G3S A;  3TRE A;  3M55 A;  1VQ4 A;  4XU3 A;  3OW2 A;  2K5F A;  4NL2 A;  3X26 B;  3EFS A;  1G3T A;  2M1H A;  2R5A A;  4R55 A;  1VQ6 A;  4J5Y A;  1O9S A;  1XNI A;  4D6W A;  2KQW A;  2QA4 T;  3S3M A;  4IUV A;  3OYY A;  1XQH A;  4ZGJ B;  3JSC A;  3A8G B;  3FC3 A;  2QA4 A;  3E19 A;  3OYC A;  4B9W A;  3JCM f;  4OGC A;  3V7S A;  4C92 C;  4C92 E;  1JBM A;  5HK3 A;  4YTL A;  4C92 D;  1TH7 A;  1VQ4 T;  3I56 A;  2QDY B;  2BIV A;  3GNF B;  3OYL A;  3NTI A;  1K73 C;  2EKO A;  1M1K C;  4IKF A;  3OW2 S;  2E6Z A;  3CC4 T;  4ZTJ A;  5GAN 8;  4ME7 A;  3GP8 A;  2DIG A;  4C0D B;  3VYG A;  4BAC A;  3QPH A;  3A8M B;  3CCJ A;  3CCU T;  2LVM A;  2LT4 A;  5CKD A;  3OYB A;  2AHJ B;  1LOJ A;  3C95 A;  1YCY A;  5CQY A;  3JCM d;  2LQ8 A;  3VV0 A;  1OYX A;  4ZN3 A;  3OYM A;  3ME9 A;  4IUR A;  4R56 A;  1NZ9 A;  1WJS A;  1FXX A;  3V7R A;  4QQG A;  2ZCF B;  3JCM V;  5GAO l;  1VQP T;  2LT1 A;  4Y28 E;  5GAN 6;  3CCE T;  3MCA B;  3QUI A;  3CCM A;  3LGL A;  5J26 A;  2EQJ A;  3CCM T;  4TVR A;  2CKK A;  2IG0 A;  2QQR A;  3ER0 A;  3P8D A;  4PJO G;  5C6S A;  3JB9 F;  4J6Y A;  3QHS A;  3JB9 H;  2DTI A;  5LJ5 g;  5GAO m;  4ELZ C;  2CYZ B;  2CZ0 B;  4M77 A;  4JS4 A;  2V8I A;  5GMK e;  3M58 A;  3MEW A;  2DTH A;  5CCA A;  2QXF A;  2V8J A;  4QVC A;  3X24 B;  3JCM X;  3G4S T;  2OTJ T;  3ZEH A;  4C0D C;  1N9R A;  5GMK h;  1M9S A;  5LJ3 j;  3CD6 A;  3SWN B;  4BI3 A;  3SDZ A;  3M53 A;  1YJW A;  4RG2 A;  4A4K A;  3CCU A;  2WSC E;  4MDW A;  1WJQ A;  3GLX A;  2RI5 A;  3CCS A;  3RKY A;  1KQ1 A;  2P0Q A;  4J6W A;  1YI2 T;  3OSV A;  3TU4 K;  2FHD A;  1M1F A;  1Q86 C;  3N5B B;  2HAX A;  5LJ5 f;  2EIF A;  4FL6 A;  3MP1 A;  3I56 T;  4M7A E;  4M7A C;  5GMK l;  3RER A;  1M90 C;  1MGQ A;  4NL3 A;  2D6F A;  5HK0 A;  3CD6 T;  5GMK i;  2E41 A;  2RK1 A;  3M4Y A;  3CME A;  2RA2 A;  2OTJ A;  3L42 A;  1HK9 A;  4JRK A;  1Q81 C;  1I4K 1;  2IVW A;  4CRI A;  5GAM h;  2X4J A;  3OYI A;  2K3Y A;  3S3O A;  2EQU A;  4V2S A;  4HA8 A;  1M8V A;  3PNW C;  3UPU A;  3LGF A;  2JVV A;  2K3X A;  3KXT A;  3BFM A;  1BIB A;  1X01 A;  5L8R E;  2DAQ A;  4XTW A;  1Y7X A;  5KE3 A;  4JDS A;  1QP3 A;  2D0Q B;  2DXB A;  4ZGE B;  3HP9 A;  3HRU A;  5AYF A;  3I55 A;  1KHI A;  3CXC A;  4NOY A;  3G6E A;  1NJI U;  4FM4 B;  4PJO A;  5GAN e;  4Y91 A;  2LCC A;  2LX9 A;  4N4G A;  1I5L A;  4J6X A;  1B34 B;  4LDU A;  1BKB A;  2CZ1 B;  5FRO A;  4ATO A;  1YHQ T;  5GAN 3;  5CQX A;  3L2Q A;  2MI6 A;  1YJ9 A;  3LWH A;  3SWN A;  2E12 A;  1JRI A;  3HFO A;  2XID A;  3PFS A;  3ZFJ A;  4RKU E;  4MZP A;  3PT9 A;  3CC4 A;  3JAM E;  3OMG A;  3CBM A;  3CCL T;  1D3B B;  2XHC A;  4PL6 A;  2JN0 A;  1UGS B;  5KCH A;  3CCQ T;  1KG1 A;  1YBY A;  1KC8 U;  3RKW A;  4FT4 A;  2DJZ A;  2K4Y A;  1LJO A;  4C8Q F;  1ZQ1 A;  5FLX E;  3L2W A;  5IT9 E;  4BI8 B;  1M90 U;  2M9U A;  3LX7 A;  4M7A F;  3JCM h;  1VQ9 T;  2RI3 A;  1DJ7 B;  3BDL A;  1AHJ B;  2EWN A;  2D9T A;  2VXF A;  1EIF A;  4C5H A;  3CMA T;  2RB6 A;  4F7U E;  5GAN 4;  4VUB A;  3A8O B;  1VQ5 T;  2DXC A;  5HY6 A;  1YJN T;  1VQ6 T;  3SD4 A;  5GAO p;  4M75 D;  3OBW A;  4XU2 A;  3BW1 A;  4IUQ A;  5GAM d;  2MAM A;  2Y4X A;  3C94 A;  3QII A;  2M16 A;  1ZBX A;  3O8V A;  3CCV T;  2KMT A;  3KBG A;  1WPY A;  2RK2 A;  3QZ5 B;  4X9C A;  4OP0 A;  5FU7 B;  2MWO A;  1VQM A;  3FEO A;  2CS7 A;  1WJR A;  2C06 A;  2RO0 A;  2WAC A;  3F70 A;  4LD6 A;  3VUB A;  2L89 A;  3CC2 T;  3L2R A;  1G5V A;  2DD4 A;  2XDB A;  2Y4Y A;  4BI4 A;  4LDY A;  2JZ2 A;  2HD0 A;  4EMH A;  4KUI A;  3JCM e;  1S72 A;  2PU9 B;  2DXU A;  3EFR A;  4J7I A;  4BY6 B;  4M7D F;  2PVD B;  3MP8 A;  3UWN A;  3JCM J;  3X20 B;  2VUB A;  2E1H A;  3X28 B;  4BB7 A;  4C8Q A;  4C0Z A;  3QJ6 A;  5LJ3 e;  4J8O A;  4JLG A;  2MMP A;  3MEA A;  2F5K A;  4OB0 B;  4M7A A;  3H6Z A;  1VQL A;  4FSX A;  1BIA A;  4BD3 A;  3P8H A;  2OTL A;  1R8O B;  3V8K A;  2KVQ G;  3QDR B;  3A8L B;  4II1 A;  2G3R A;  1K73 U;  1KD1 U;  1IRE B;  4BDY A;  5LJ3 g;  1U1S A;  2O01 E;  4X34 A;  1JJ2 S;  3DB4 A;  3SB2 A;  2EFI A;  2JTF A;  3HPW A;  5GAO q;  1UEB A;  3URG A;  1VQO T;  1Q82 U;  5I21 A;  2LQK A;  3J80 E;  1G3Y A;  2HNI A;  2JNG A;  5M9O A;  4KUL A;  4ZGD B;  2EJ9 A;  4A4G A;  2F69 A;  3WVD B;  4F7U F;  3J7A F;  5I2M A;  4EPC A;  5GMK j;  2R5M A;  4A4E A;  1VQK A;  2L8D A;  3ZBD A;  4RG8 A;  1SSF A;  2H3J A;  1NE8 A;  3M57 A;  5CKE A;  2LCL A;  3QBY A;  2CZ7 B;  4RCC A;  2LC4 A;  1UB4 A;  3RES A;  1B34 A;  4HCZ A;  2Y90 A;  1RI0 A;  2XDP A;  4C5G A;  3BDU A;  1LNX A;  2E64 A;  4XAX B;  4M77 G;  2FVU A;  4OB1 B;  2QQA A;  5KCO A;  1OI1 A;  5FRM A;  2QTX A;  3A5Z B;  4UC4 A;  5GAN j;  3HRS A;  1KQ2 A;  3OYJ A;  4PJO C;  3UDC A;  1N27 A;  4PLI A;  3VJP A;  2L5Q A;  1PSF A;  1RL2 A;  1VUB A;  2L3R A;  4M75 F;  1MHN A;  3OMC A;  4WF2 A;  4M7D B;  2LNV A;  1BI3 A;  1N9S A;  2P4T A;  4MML A;  1VIE A;  5DY9 A;  4XTX A;  3WVE B;  1KD1 C;  2K5I A;  1VQ7 T;  2PVG B;  2FB7 A;  1YIT T;  2E5Q A;  4XTU A;  3JCM P;  3MEU A;  4M78 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...