4XQ4A

X-ray structure analysis of xylanase - n44d
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGDFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 54
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xq4A00
3VL8A 3RI9A 3WT3A 4HK8A 1H4HA 2DCYA 3VLBB 1KS5A 3O7OA 1HV1A 1OA2A 3WP3A 3VZLA 1TE1B 5K9YA 1IGOA 3AKPA 3VZMA 3AMMA 2VG9A 3LGRA 2VUJA 4XQWA 1XNKA 3HD8B 4IXLA 1UU5A 3WR0A 2JENA 3VZNA 1XYPA 1F5JA 1BVVA 3VHNA 1C5IA 2BWAA 1H8VA 3VGIA 3VZJA 3MFCA 1XNBA 2VULA 4HKWA 1H4GA 3MFAA 1REFA 2BVVA 3VZOA 1REEA 1C5HA 1YNAA 5EJ3A 3WXPA 5HXVA 3WP6A 4S2GA 3WX5A 2QZ2A 3VHPA 1H0BA 1QH6A 2B45X 1REDA 2JICA 3AKTA 1T6GC 2JEMA 3AMPA 3ZSEA 4XQDA 1PVXA 2Z79A 3AKQA 4HKLA 3WQ7A 3RI8A 3WY6A 1XNDA 3MF9A 2D97A 1XYOA 1BCXA 4XPVA 1W2UA 3EXUA 2D98A 3B5LB 2DCZA 2F6BA 1BK1A 2B46X 2B42B 2VGDA 1OLRA 2QZ3A 3VZKA 3M4FA 3B7MA 2NLRA 4XQ4A 3WP5A 1XNCA 3VL9A 4S2HA 1ENXA 1KS4A 4S2DA 3VHOA 1OA4A 3MF6A 3WP4A 1QH7A 4NPRA 1HV0A 3LB9A 1UU4A 3AMQA 1UU6A 2DCKA 1OA3A 4H7MA 3WQ0A 2C1FA 3AKRA 3AMHA 1M4WA 2BW8A 1XYNA 3AMNA 5K7PA 4HKOA 2DFBA 1H1AA 3AKSA 1HIXA 1OLQA 4HK9A 2BWCA 1AXKA 3WQ1A 4S2FA 2DFCA 2NQYA 1UKRA 1NLRA 1XXNA 2DCJA
chains in the Genus database with same CATH superfamily
4YARA 4KBBA 1VBC2 1HB2A 2QTWB 4XHXA 4BQYA 5HBAA 4P00B 4RGKA 2F4LA 2GC0A 3BU7A 5AC92 4MGSA 1LULA 2XH6A 4JKLA 4E2QA 2CSGA 2VVFA 3ZR6A 3POYA 5K0UB 1ULCA 2K46A 2VUDA 1LOCA 3VD9A 2GSYA 2VOWA 1GQGA 4OHYA 3C2UA 1RYYA 5EJZB 4JGYC 2PA7A 3AC0A 4XYXA 5LY1A 4LIUA 5B4NA 1W6NA 1ALYA 4I09A 1NCRC 1HLCA 1B09A 4RN5A 4ZU4A 1NXD1 4AEJA 1U5XA 3BYWA 3H3LA 2Q4SA 1XRUA 1S2BA 2WKKA 3ON7A 1JS9A 1W6MB 1MPXA 3W58A 3DKWA 3N7LA 4FI9A 2BUKA 4FSJA 3CJIA 1ULOA 2HWC2 1JZ7A 1AYM1 1XBFA 2GP3A 2QCSB 1RMU1 4Y22A 2VW2A 3WP6A 2Y33A 3GHMA 1OD3A 5GZGA 5L9VA 4AFCA 3WCRA 1WD3A 4Q4W2 4KBZA 3UJQA 3KWVA 4FFGA 1CJPA 3NJXA 5FZCA 5J7MA 3IDAA 4Y22B 2D5HA 3HN1A 3ELNA 1RUG3 1ZX5A 2Q0AA 1NUKA 2W1SA 5JPMB 3H8RA 3NV2A 1PVXA 4EE2A 2C9KA 5JCTA 2XUMA 3TBDA 3SCHA 5GLTA 1YUDA 4MUVA 3PURA 4JCKA 2WC2A 1W0NA 1OSGA 1Q8VA 4CDWC 3I2OA 3W20A 3NNLA 2DUOA 4AEDC 1D0HA 3E5QA 5DQ0A 4YM1A 4Y1VA 1RUF1 5IUQA 4LLOA 2W3JA 3N9MA 2CDOA 1NYWA 4GWIA 2LUWA 2WQ4A 1M06G 1VE0A 2XGXA 1V0AA 4E27A 5FFOC 1CWPA 3UKVA 5FP9A 1YI7A 4IL7A 1JHJA 4YGDA 3MLLA 4ZHNA 3WF4A 2OXBA 1UOGA 1S0FA 2JB4A 1K5MB 3TNPB 3P5BA 1IQAA 1W04A 3KB5A 1HXS2 1ENQA 5FZMA 3VKLA 4AGGA 2CGOA 1UU4A 4FO9A 4WM8B 3AMQA 3ZM8A 2DCKA 3O1SA 4IGOA 5F8PA 3I3MA 5IJRA 2YGMA 4FOWA 5BXXA 3D0SA 4PLMA 1XNTA 3FBYA 1OI6A 2ZCWA 1WBFA 1FOD2 1KQRA 2WQZC 3FC0A 5FWEA 3GZUC 5K7PA 5FDBA 2YPDA 1BMV2 1GP4A 3LAGA 1WCSA 4MGKE 5EP9A 4CEWB 4C8DA 3PHMA 5IWFA 5G04L 4MHUA 2WT0A 1S55A 3IZOA 1C4RA 2BP6A 2VMCA 1NG0A 3S5AA 1AYN2 4CTEA 4EWDA 1JHNA 2BERA 2EXJA 3WNOA 2GMEA 2NQYA 5A6QA 4CCNA 4XZPA 2BDRA 3ZXFA 1XXNA 2KA3A 1DZQA 4ZY9A 2I45A 2B8MA 3RWNA 3KVAA 3VDDA 4DEQA 1WCDJ 3SISA 4Y5SA 1Z7S1 2TEPA 1WLWA 4DUXA 3DPRA 3URFA 1OA2A 4AHWA 4UW6A 5IVJA 5E6HA 2IXJA 3PUHA 1PGL1 1TE1B 3FHAA 3I2IA 5F7UA 4OUSA 3BI3A 2UURA 3TEWA 5A3MA 4Y4RA 2RS52 3BALA 1UXZA 4LPLA 1WLDA 5FQ0A 1GWLA 4IERA 4X8NA 2QQWA 2HWF2 2HWF3 4QPIA 3BVCA 2AREA 3POWA 1PIV3 3ZYIB 2JENA 2XBO2 3NNMA 2CWSA 4LULA 1KD7A 1NZIA 2BNMA 2ZABA 3I4IA 1K42A 3VBUB 2RS13 4HKWA 4IGQA 2JIJA 4A7KA 1J1LA 3MFAA 5L9RA 4NRMA 4Q5OA 5FZ4A 1AR73 4COVA 4P9WA 4B7EA 1PM7A 4UFIA 2PQSA 3RZLA 1H6XA 3GZEA 5FY4A 3AP4A 5L7OB 2HEVF 2WA3A 4RD7A 1GUIA 1OFSA 3IIIA 2RS32 1SLIA 4UAPA 4DO0A 2AYHA 4LBNA 2HEYF 4P14A 3I2HA 1KFUL 2YV8A 5FY1A 1EPWA 4CYDA 3OPZA 4Q0PA 4NIGA 1DGRA 4BHPA 4CXXA 1UNBA 3N7MA 5GLVA 1XSRA 4PBOA 5CKNA 1UYYA 4WM8C 1O3QA 5FZ0A 1C8M3 3T2QA 1ZRCA 1Z7S2 1BK1A 2J1EA 1N3OA 2QDNA 2D6NA 4JGZC 5FP3A 1N47A 2QZ3A 3UYJA 1KFXL 1K45A 1XNCA 2R071 3ZYPA 1OLMA 2H6BA 3IDBB 3S6PA 3MGUA 1I9RA 4KU8A 5FLHA 1H2KA 1RUD1 2YYOA 1ZNPA 4IEQA 3ZIXA 4AXOA 4O9GA 3FE5A 5FBZA 3NAPC 5JI9A 1NX9A 1EV11 1N3QA 2E9QA 2WA4A 3ECQA 4KNCA 1AVBA 5HXMA 5F3CA 4TZDA 1S0JA 1ZBE3 5D1IA 3LSEA 3WLUA 1QF3A 3C7GA 3KZ4C 3LB9A 3WUDA 4W65A 1UU6A 4NHYA 2I07B 4WM7A 5FPXA 2PHTA 2J1UA 2ID4A 4MSVA 1OQ1A 5DZGA 4I2OA 1LGBA 4WVMB 5FPZA 5GLWA 1R1A3 4EQVA 2RR11 5LBCA 4NJ4A 3VBSA 2Y60A 4BIFA 3MIHA 5HI0A 1NE4A 1R1A1 2VZPA 4AAXA 4Z07A 5FUPA 3AZXA 5FLJA 2WIIB 2BWCA 4GWMA 3ZFFB 5AC91 5IK5A 1JUIA 4QQHA 1BEV1 4K6BA 3IAPA 5FTTC 4AI0A 2QQLA 3RNSA 4V2WA 3RMXA 1SLBA 5HPOA 3S57A 5AFEA 1JZ6A 2ZOEB 3VBUC 4OHZA 3AP6A 1SG3A 1KS5A 5A7QA 1MVQA 4LBQB 5JLVA 3RGBA 3B69A 1RJ7A 5CKMA 4W4ZA 2E6VA 3IT8A 1AR82 2ZGQA 3QACA 4PBPA 4U2AA 2CHHA 1D4VB 4KI5M 1UAIA 1FNZA 1VAVA 4NMIA 4DMIA 2IC1A 2VUJA 3HNYM 3JQXA 4YPJA 1PVC2 3USUB 5IVCA 4COWA 4RGGA 1SFYA 2GC3A 2XHKA 1JYWA 3ZXLA 2UWAA 3LA7A 3IM0A 4JQRA 5BNPC 2ZBJA 5DAWA 1KGYA 4N53B 5B4XA 5JR7B 5C4WA 3WR0A 2WYFA 3UKTA 3VBFC 2XJQA 3FLPA 3QH6A 1HXS3 2P5BA 1O8SA 2BWAA 1SLLA 3DYMA 4RL7A 4XFBA 3VGIA 4GIQA 3ACLA 5CADA 3MI8A 1GICA 1YEWA 1DG6A 1LHNA 2W87A 3DECA 4COZA 1YNAA 5EJ3A 1AYM3 4BMEA 3IMMA 2XVGA 4S2GA 3EBRA 1AL21 3AVRA 1EUUA 3NVCA 3ZYRA 2IVJA 3LFIA 1JTZX 1W6OA 3ZN6B 1NY72 3I59A 1H8TC 5JDBA 2RS53 3C8XA 2WO3A 1TNFA 1RUNA 3LEKA 1HJGA 3M3IA 4KU7A 1QDCA 4DXTA 2H0BA 1H8TB 1RGSA 4YZ2A 1ZZ6A 3MPBA 1VB2A 1QQP2 2JDNA 2JJ6A 5A3LA 1QJU3 1W2TA 4NVPA 2VTXJ 4XIOA 1BZWA 5FYZA 3GF6A 2WNVB 3DEMA 2ZX2A 3ZXAC 5KC6A 2Y6FA 3I8TA 4YVWA 1DQ2A 1UZVA 2D43A 1H8TA 2D98A 1PO11 2DCZA 4NHMA 4QDRA 3ATGA 4PLNA 5KHJA 2R041 1Y7BA 4LBQD 3V65A 4UI9L 1F9KA 5FYTA 3M4FA 3AFKA 1WLTA 4ZZ8A 2A6XA 1U0AA 1MQTC 2E53A 2VE1A 3M8LA 4FP3A 4DIQA 2XB6C 1Q8OA 2NZ9A 3IPVB 1KJRA 2JDZA 2RS31 5FYSA 2FHRA 4CE8A 2HWD2 2PAEA 4Y5TA 3ZR5A 4CEYB 3KT7A 1HRV1 4AI3A 3VBUA 1ND2C 4CDQA 4AI8A 1OURA 3HAGA 1FNYA 5DUXA 4E9KA 4Q4X3 2EVXA 2RDRA 2O8QA 3JZVA 5A70A 3BIEA 1FATA 2XJSA 3I2GA 4LBOA 4CDUC 3CJXA 2WS93 4GA9A 2WS92 2NP0A 4YGBA 5FK7A 4QQLA 5FJHA 3W21A 1A8DA 1D4M2 4EZHA 2RR13 2E33A 5FYHA 1VAMA 5L9BA 2Q1ZB 2ZJCA 3MDPA 4HKOA 3AKSA 4ARYA 5IVFA 3J7LA 2VBDA 4BPZA 1WUVA 2VR4A 5D21A 4QD2A 2YC2A 4CUBA 4YLZA 2GN3A 2ZGSA 3LE0A 4ISRA 2PHDA 2LALA 3OG2A 2RJ2A 4KH9A 1UZWA 3ZDSA 5CAZA 1UX6A 4D6QA 1PGL2 1R091 2R043 4LE4A 4M4PA 2DCYA 3FL7A 3VLBB 2CWMA 4TXWA 1GWMA 5C3RA 3CQOA 4GALA 5JSOA 2R16A 3VBFA 4NIAA 4W6XA 5C8CC 3LDKA 4Q1PA 3PL0A 3AMMA 3WDYA 2UYBA 3SKJE 4CCOA 4XHBA 2J42A 4O7XA 3M3OA 2WNUC 1VRH3 5FZ6A 2WYSA 2ERFA 4BIOA 1QJFA 1UW8A 4LO5B 1W8ZA 2OPKA 1GZTA 4L2NA 5F3EA 4QM8A 1ULPA 1UY3A 3MUY1 1OXCA 4QPYA 5GKAC 1C5IA 4HVQA 3SXWA 1H8VA 4DY3A 1YQ8A 2E7TA 1K5MA 1RUJ1 1U12A 2BNNA 3PIJA 5IHRA 1FMD1 2J1AA 4R9BA 4N7UA 3BB6A 4AGVA 4W6YA 2D3RA 2PTMA 1X9TA 1LU2A 1CAXA 4FOVA 4GKXA 4QXKA 5IAXA 5JOYA 5HXVA 1J59A 5FPAA 3AM2A 3A0NA 1QOOA 2J7MA 4LQRA 5IVBA 3WW2A 2Y6LA 2ZA9A 4AHYA 3TEYA 2ZZQA 1E57A 1GV9A 1UIJA 3WQBA 2KR2A 1O4ZA 1TVGA 1CAXB 2A5ZA 4LBMA 1UQXA 1DYKA 4GULA 4QB1A 5EXOA 1XQNA 3DPRB 4LE3A 4U36A 2JD9A 1RTVA 4QPIB 4YG6A 5A80A 3SNMA 2D6PA 1VALA 4EN7B 2MEV3 4FPOB 3MF9A 4UOJA 3NNGA 2D97A 5BYNA 4YW7A 3P6BA 2HWE1 2Q5TA 1SFPA 3VBHB 5KHKA 1JZ2A 1OVPA 4XDQA 4PCRA 3EXUA 5J09A 2RJKA 3U11A 2A75A 2PN5A 4CEWC 4FPKA 3JCIA 2N7GA 1G9BA 1CIWA 1TNRA 2L9LA 3T0BA 1SPPA 4D8MA 2NLRA 5LA2A 3I3BA 1OD5A 3Q9OA 2VCMA 4Q0VA 4A42A 2JDYA 4C1WA 5CFCC 3O1OA 3ITQA 3VBHA 4XXAA 5BNNB 4QU2A 1S2EA 2X5IA 1BHGA 2ZAAA 2A73B 1GFF2 2YDEA 3FHIB 1AR72 1RUE1 1TME2 3ZFGA 4H7MA 1DIWA 3RYRA 2FDFA 3H1MA 3NV4A 4B8EA 2QUOA 1QOTA 3U14A 1GSLA 4IV3A 5A1AA 1S2KA 2ZXQA 5F2SA 4XUPA 1G8WA 1VLNA 4GZ9A 4IEOA 3RMYA 4I0WB 4H3WA 3O1VA 2CY6A 5IFTA 5LA9A 2R6QA 3NAPA 3MIDA 3PVNA 2RE9A 1AUYA 3R0RA 4OQ8A 4HETA 4CCKA 3RRDA 5EYXA 5IK7A 4AFMA 4URAA 1LODA 1C8M2 1WKYA 4LIVA 1XU2A 2V5YA 4BJ0A 1A34A 3IB3A 3B00A 3N9LA 2Q1FA 4JGZA 4LHNA 5FYIA 5LA0A 1VBC1 3MPPG 1A6CA 1XU1A 2XQXA 4K8RB 2GAUA 4KG8A 2JXAA 2VNRA 4OI1A 2HWB2 3SITA 3ZYBA 3OYWA 3UT0A 3EJKA 4IE4A 1Z0HA 1VBA3 1UX7A 1C8M1 1ZZ7A 3NJVA 1PO13 4CRQA 5C3PA 5F5IA 1HX6A 4FPFA 3I3QA 3OBZA 4IXLA 1JYVA 1XNAA 2RHPA 3BTAA 1W8TA 3I2DA 3OF1A 1YXWA 4HT1T 1W9SA 5ERLA 3WZ1A 4F7ZA 1MS3A 1WW5A 3H42B 3RJ2X 4XW3A 5FY5A 1UY0A 2WZR3 4N7IA 2R0HA 4CDWA 5FMOS 1MS8A 5E89A 1V6MA 2GZWA 2GNTA 3WEZA 1S0EA 4WVVA 3WOGA 5CG9A 4AGRA 1RMU3 2EIEA 4B1LA 2G9GA 1PHMA 2YC0A 3FWEA 3WXPA 4XOGA 4JGYB 2NM1A 4META 2VBPA 1VBB2 3PLQA 1HN0A 2MNGA 1QH6A 1RB8G 2B45X 3WG4A 3A23A 4RHV3 5FZFA 1AJOA 2JDKA 2WDBA 3M70A 2X05A 3FLRA 5LY2A 1RVF2 2IZWA 1DGRN 3VDCA 3KMHA 5FZOA 1SLAA 5J3UA 2W91A 3NJZA 3QBQA 3WY6A 3E1F1 4AVCA 2W52A 1VMJA 5JIUA 2WABA 2HWE2 2XOMA 1JZ4A 4XURA 1YFWA 2XQRA 2R042 3IKWA 2Q8EA 3KT1A 3AL5A 3AYDA 4MGYE 4AVBA 5FZOB 3HQRA 2HWC1 5KWRA 3E6CC 4QAWA 5GLUA 4DXSA 2WUHA 1ZREA 3LA2A 1UIKA 2VNOA 2DYCA 2FCUA 1GWKA 5CYYA 4L11A 2QNKA 5D8AC 5L36A 2XJPA 3O0VA 2O1QA 3ZN6A 1WMDA 1IQDC 5EHDA 4A41A 4AVSA 1WCUA 3JD72 1WA6X 1X50A 3C7OA 2ADDA 4K3UA 1RMU2 3HBKA 4IV3C 4QX7A 5JMCA 1VMHA 2HKXA 1SBDA 1Q3EA 2IXCA 2VVDA 2VW0A 4GJZA 3USUA 2WNUB 1E5IA 3ZYHA 4D7SA 4CVUA 4I01A 4CCJA 5SV8A 1LHWA 3AYEA 3ZXDA 2VOKA 4Q4V2 1YJLA 3RS6A 4IDZA 3WDVA 1OA3A 4NRQA 4FPYA 4JKMA 1CD3G 5FOBB 5ABJA 1E5HA 1RUE2 1TME1 3O14A 2ZEZA 1PZ9A 3HNBM 4MYEA 2OVUA 4HVOA 1JN2P 1S4CA 4DQAA 3J8F2 3I2FA 1ULGA 3WW4A 4CXWA 3B9CA 5ABJC 2QQUA 4AVAA 1W6PA 2RS12 4K8FA 1JYTA 1X8EA 3H3UA 4QB6A 3U37A 3ZKUA 4CDUA 5JXHA 2Q8DA 3VD7A 1N1YA 4QX2A 1HJFA 5JIAA 1R092 1W8OA 3CO2A 4F8AA 3ETPA 3T0AA 3SKVA 5KHGA 4Q8KA 3WDXA 2C5DA 4AEKA 1D0GA 4HZFA 1UY1A 4M01A 2RDQA 4XF9A 4HL0A 2HWB3 2JX9A 4KQ7A 4CPBA 3P3PA 1W06A 4WZFA 1BVP1 5DN2A 5L7OC 3AJYA 3FFQA 3MYXA 4HSJA 2AR6A 4PDWC 3ZYFA 1DQ5A 1SPPB 4K20A 4I02A 4QKBA 1W8UA 2V09A 4M3CE 4NRPA 4CP0A 2MHFA 3IN9A 3OY8A 4NAOA 4D94A 2HBUA 5IT6A 3MV01 3OGJA 4JAAA 4YWAA 4CCDA 2NN8A 5I0SA 4DY5A 1W6NB 3POFA 2GH2A 1VPHA 1YCIA 4DS0A 2VCCA 2XR4A 2ZGRA 1OHFA 1XYPA 4Y1YA 3I97A 4OI4A 3VHNA 1Y9GA 2Y6HA 2VULA 2V5DA 3ORJA 3QD6A 5A7WA 3DXTA 1T2XA 2ZGKA 4XTMA 2PHFA 1ZZ9A 4OUEA 3GNEA 5F32A 2VZOA 1JYNA 5CIRA 5C5TA 2QQOA 3FBMA 3HEIA 2BZDA 3VD3A 2QE3A 3VDAA 3PVOA 3ACFA 1VBA2 5DAVA 5H9QA 3ZXEA 1JH5A 1HB1A 1UL9A 2HYKA 4Q8LA 4ARXA 4ZONA 1V6NA 2GC1A 1U5IA 1S0CA 3BODA 4HMZA 1DP0A 4XAEA 1H1MA 5FMDA 2A7AA 1STMA 3LPFA 4FPLA 1OQEA 5BPXA 4FCAA 2Z79A 4JQTA 2GALA 1Q8SA 1ZBA1 1B35A 3M1HA 2WNOA 2OQ7A 1XNDA 3B3QE 3LCPA 3NV3A 5DAXA 3RZGA 1NCRA 1OH4A 1YFUA 4MGZE 4OFGA 1W2UA 2NMOA 4IV1C 1JYIA 3OJBA 3LEGA 4UF0B 2YY1A 5BNOC 4FQZA 3RJRA 5GALA 2GP5A 2HWB1 2I2SA 4EROA 1JZ3A 1H2MA 1ZM1A 4XXPA 3RZHA 3W5NA 1VBC3 1Q8QA 1HRI2 3VL9A 4YFWA 1YQ6A 2RDSA 5TSWA 1S1AA 1CZVA 5LW9A 1GKBA 4GWJA 2Y8KA 4WM7B 2WAOA 4ZS2A 2Z2SB 3MF6A 3PUSA 5C70A 5FZIA 2PLV3 3ASIA 5BNNC 1DDLA 1RJ8A 2CNAA 1CIYA 2LTNA 4G3YC 4Y1UA 4YW2A 4P02B 2W92A 1JZ5A 4TYSA 1ND2A 4LO6B 3AMHA 3VDDB 1ND3C 4Q4X1 3LF7A 4FTSA 4E2SA 5FZGA 4A6OA 1IKPA 2MEV2 5T55A 1H1AA 1TEIA 1HIXA 1UPSA 3T09A 4BDVB 3GBFA 1RITA 4LKSA 3VV1A 1LHOA 5T50A 4LXLA 1NCQC 1V9U3 4ZU5A 5I8SA 3M7AA 3D6EA 5FPVA 1UKGA 3CBNA 4XFCA 3O1MA 1MEC1 2D6LX 3LOBA 1ASJ2 3UL2A 5CFCA 2VUAA 1VBD1 2PHLA 4CU8A 1OKOA 3C7HA 4EJRA 3ZFEC 4NWWA 4IEWA 4FXGB 4BU2A 2Y6GA 5LATA 3A0KA 2PELA 4OVEA 1GNYA 1NCQA 3T1MA 4LHKA 2VPVA 5A3OA 4HXCA 3ZXGA 1SLTA 1OPMA 2B9UA 2YB7A 4LKDA 3FX3A 2BBVA 2ARBA 2RVAA 4KGQA 4PI2A 5DDJ3 5DZEA 3HQXA 4P9YA 4EN6B 4B29A 1RUC2 1RUI2 1RUI3 1RUC3 4LJHA 4FP2A 3WNKA 5C4WC 1PNFA 4K21A 1VR3A 3ZSMA 1KEXA 4MLOA 1UZZA 1DLCA 4LT5A 1PO21 2UU8A 1H2LA 1S0IA 1ZVFA 4IV3B 3I2JA 4ORFA 5BNNA 5T5PA 2E63A 3SCFA 2WWSA 4LBKA 1REEA 4YVSA 1AJKA 3WNXA 2P6HA 1OOPA 1MS5A 4IV1B 1AR61 2BOJA 1V6JA 2Y64A 1JOJA 3DV8A 3H8OA 3D8CA 3CU7A 2HBTA 4Q4V3 1VAKA 1ASJ3 1LEDA 1LGCA 1O8PA 4UFLA 5J37A 2VECA 3WG2A 1A8MA 2VMDA 4PF1A 3WNPA 2B7YA 2D6OX 2YPJA 1QIQA 2LS6A 2GNBA 5FY8A 1YQ2A 3AMPA 3RDIA 1BKZA 5F39A 1IG0A 3PUQA 4BA6A 5E8AA 5EJ1B 4CDXC 1D4M3 2A3YA 4GMP3 3OUJA 3AK0A 3VBRC 2J1VA 4N43C 2PMWB 4UWDA 4D6RA 2JDAA 1UD1A 3VBSC 2VQTA 3B5LB 1BLZA 2QQIA 4Q0QA 1YO8A 1DGLA 4PI0A 1A3KA 4H2AA 3J26N 4D0QA 1W8NA 3Q8CA 4WVWA 3VKMA 1UZ0A 2R49A 4NAMA 4JGZB 5JPNB 2R1DA 3BUCA 4S2HA 5C6CA 1AXZA 2Y34A 2WT2A 3GBWA 2VZUA 2PHXA 1PX4A 4E4DX 1BXHA 3INAA 4GQ7A 2BQPA 4R4XA 4UFKA 2HEWF 2HLEA 1W03A 2V72A 2YG0A 1F31A 3H0OA 3OUHA 1WA4A 2ZAHA 3JB4C 2RM22 3K3OA 2CYFA 1JU4A 5EWSA 5IW0A 4DRVA 4AWDA 2WRAA 5C8WA 5J48A 3IDCB 4N90A 5HV4A 2BRTA 1ZZBA 3J8F1 4AI2A 2A71A 5C9AA 2GMPA 2YXSA 2DBNA 1GOFA 5AVPA 4QX1A 2WWJA 2DVDA 2R0FA 2XJUA 2FCTA 2XJVA 1NAEA 4UT5A 4WM8A 1FI2A 4IEVA 2ZPXA 3POJA 2BYVE 4LLFA 1SCSA 2DFBA 4RFT0 2Y26A 1PK6C 1ZBE1 3DYPA 4F3JA 5FY0A 4ISQA 1OBNA 2WS91 3EQEA 3AP9A 3ZFFC 1WBLA 5FK8A 5C4WB 2EIDA 2ZS6B 4UYBA 1GYKA 4JDMA 3SH5A 1PO12 4DXRA 4Q26A 2PAMA 1RUD2 3TN93 4BOWA 2PLV2 3TOJA 5CFDB 3VBOB 4LO7A 2ZGLA 4NROA 4SBVA 4N53A 3J4UH 1ND3B 2R30A 2YU2A 3HT1A 3MV11 4QPGA 2RDNA 5LB6A 1UMIA 2C4XA 2UY8A 1F2NA 2HWC3 2XHNA 4HOOA 4RR3C 1QMJA 3C3VA 2PHWA 4YZ1A 4LMFA 1N3PA 1V6LA 2XG3A 3AP7A 3EB7A 4GMP1 4H55A 3TEXA 2P3IA 3LEMA 4AG4A 1QJU1 1F8VA 4HLTA 4XQWA 4YGCA 2JECA 4FFFA 3U75A 3HD8B 4AQ6A 3KV5A 4DXZA 4BXSV 2JE7A 2XMLA 4KWKA 4UBGA 3S7EA 1DF0A 4QPIC 4IESA 3WV6A 5A32A 3NV1A 1G86A 4HG6B 3NNFA 2ZEYA 1KRIA 2G1MA 1POV1 3K4ZA 4XBQA 5JUVA 5C3SA 1ND2B 1UYZA 3AVSA 1O91A 3LEIA 3MIGA 2WZPP 3VZOA 4PDWA 1AR83 5EZWA 3AFGA 3LSDA 2WL1A 3OPWA 5C33A 1ENRA 3O0WA 2ATFA 1C57A 1RUOA 2WO1A 2WZR1 2OT7A 1AR81 1WWYA 4L8QA 4B3NA 5LBBA 2WAAA 1AR71 1UMZA 4Q1RA 1WZXA 4BE3A 2A3XA 4XQDA 2GH8A 2J1TA 3EMRA 3GBGA 5FY9A 1CZSA 3OBAA 3WUCA 1LOEA 5T5LA 3AXEA 3H3ZA 3WQ7A 4PIYA 1HXS1 1W28A 4JRLA 5CNAA 4FQ4A 3ILRA 3ZDVA 1XYOA 2ZACA 1VIWB 4C91A 2P37A 1AL0G 1G9FA 1DQ6A 3ZSKA 3ROUA 1YFYA 1DQ0A 2OUJA 4MXWB 2OUHA 3B93A 1COV3 3VN4A 3NKGA 1AX2A 4QMAA 3C7FA 1XJAA 1EPZA 2ET7A 5LRRA 2VMFA 4BQ2A 3JU9A 2HH9A 4IEPA 5F5AA 2R062 4ITCA 4A45A 4XETA 5CA6A 2P1BA 1KS4A 2VZRA 1NKGA 3SMHA 1VP6A 3V56A 4P9XA 2V4AA 3V0AB 4BK5A 4LORA 4LOTA 2E31A 3W59A 3VHRA 3POIA 5JI7A 5CFDC 3WW3A 4IUGA 1ZRDA 4XACA 2ARAA 4GKYA 1QH7A 2IFWA 4B7KA 4XCAA 3ES1A 1X82A 2FZ1A 5FZHA 2ILMA 4D3WA 1EV12 3OBRA 2DBIA 2VQ0A 5D8AA 3MIEA 1TME3 2J1RA 4XJUA 3LWCA 3WQ0A 1ODMA 5GJ6A 1YHFA 2QQKA 1M4WA 4NHKA 1AX1A 5I93A 1MS9A 3OEBA 4YFZA 2ZX1A 3FUOA 3GJBA 4N9HA 3U0ZA 2PHUA 1XC6A 1ODNA 1HRV3 1JYCA 2B4KA 2ZTNA 4Y20A 1W8HA 1RUE3 4UXAA 2WWUA 1AYM2 2XLFA 1QNYA 3PMSA 2Y38A 1FMD2 4CEYC 5A33B 5J98B 2R1BA 1UKRA 5C3OA 3KSCA 2P3KA 2OPWA 3KF3A 1MS1A 2JG8A 2ORXA 1NLSA 3JXSA 1B35B 4QT6A 1VBE2 3RSJA 3WT3A 4TTGA 2QQJA 3L2HA 5IK8A 4YZ5A 4CCMA 1BQPA 2YUEA 4I0BA 3ILFA 3OYWB 3BPSA 1CAVB 5LBEA 1APNA 4MGIE 4YW3A 2Q8CA 3HJRA 5EYYA 3VKOA 4C1XA 3H50A 2R32A 4YM0A 4J1XA 4Q27A 4FPHA 2AEYA 4URTA 3ES4A 1DCSA 5D2AA 3K46A 1OT5A 1LNSA 1CX4A 5DUWA 1X36A 2W68A 4X6QB 4OZXA 1N1VA 1F4HA 2RG4A 3GXUA 5G05L 1FV2A 3U4XA 3I3DA 4MGQA 2JDPA 4XJZA 2E7AA 2BBAA 4Q4Y1 1RHI1 2VMHA 4PLOA 1HKDA 4Q4W1 4G4FA 2DVAA 5HCAA 3VDBA 1QXJA 4B4QA 4HPKA 1GNHA 4AAPA 1OQDA 4LNVA 4MHRA 2EXHA 1DYOA 3N3HA 4YG3A 2WN2A 3LZZA 1MVEA 1R083 1MS0A 5FYCA 4Q4V1 4XUNA 3NL1A 1ZRFA 3DUIA 1JI6A 3VUOA 3SHRA 4NE9A 3KF5A 2DTYA 4NR1A 2JICA 2J1SA 3D5OA 4A7YA 1DHKB 1DQ4A 3E6BA 3SC7X 3ZSEA 3I2KA 3J7NA 4HKLA 2ARXA 5DXDA 5FO7B 2QDRA 3ZN4A 1LKNA 1W6QA 3AZWA 3UETA 3CJIC 3UV9A 3ZSJA 1ULEA 2JDUA 1FV3A 5JZGB 1TMF2 3F95A 1NXMA 2ZX0A 3LIHA 4K40A 4XTPA 5LBFA 5C7GA 2A6YA 1DU3D 2IXKA 2VZ3A 2E7QA 5J96B 3TWIA 3KV6A 4IW3A 4XVHA 1AYN1 1RIRA 3T2PA 1W9TA 2AACA 1UY2A 2P34A 1SFNA 3KQRA 4XJ9A 5A7PA 3ZKYA 4R52A 2B42B 4AEDB 1BBT1 1R093 2G4IA 5SV5A 1G9CA 1C28A 2PXJA 4P9GA 2WNVA 5FWJA 4KWLA 2AUYA 4QPGC 3ZPOA 1BMV1 2EXIA 2VNGA 1SDDB 5F9TA 1YIPA 1ENXA 1G7YA 2HJIA 2UWCA 4XDPA 3WF3A 2FDJA 1Z7S3 1UN1A 3CKHA 4OI0A 3GCWA 1D2QA 2BGCA 3VD5A 4Q29A 3MUZ1 1NA1C 4FXKB 5ANNA 4GD4A 3UNPA 2VQUA 2WNEA 5BNPB 1NE6A 4FFIA 3APBA 1HV0A 5DG2A 1ST8A 2NMNA 1I3HA 1VBB1 1K5MC 1UF2C 3WDUA 5GZCA 1K5JA 4AEDA 4EN8B 5FV3A 4JV4A 1RVF3 2D93A 2TNFA 1GZ9A 2JDHA 4JX0A 4XDOA 1H9PA 4IEYA 1TG7A 1ZBE2 3HVDA 4NN0A 5C71A 3IIAA 4LTAA 3POEA 1VBD2 4NOTA 1FOD3 3AP5A 2JWPA 3MHZA 4XF1A 1CAUB 3R6SA 4CU7A 1DLLA 2Q8OA 1EP0A 1MZEA 1KJLA 1OUSA 2AEZA 2Y6JA 3NMBA 4XF4A 4YRDA 1ZZ8A 1X9PA 5A7NA 1Q5OA 1FPN2 3AYCA 4RQPB 4FFHA 1O3RA 3D82A 3Q8AA 2XXZA 4G9SB 4CDWB 2ZGMA 5FPLA 1UOFA 2DCJA 2VC9A 2X5IC 3DXUA 3A7QA 4D6SA 5FZ7A 1US3A 1UO9A 1VRH2 3N4MA 5HCBA 4IEXA 5KXBA 1BBT3 1EAH2 4DEVA 2CDPA 4Q0UA 4GAZA 4NHXA 2OYZA 2WO2A 4YW5A 4AVTA 4CUAA 2UYAA 4ASLA 2WSVA 3O7OA 1GP5A 2VXRA 5CB7A 2CAVA 5JSPA 2VW1A 3U78A 5IYYA 2VTXA 4FPEA 1ONAA 2TBVA 3ZFGC 5CEHA 1ZRIA 1O5UA 3MLKA 3KHCA 4ES8A 3V0AA 1GOHA 4L92A 3ZSLA 5AVAA 5T5OA 1R64A 2QBXA 2ZEWA 4BZ4A 1WLCA 4IE7A 2Q30A 5FYMA 2JG9B 3A4UA 3WDWA 4B4PA 4EZ4A 3VZNA 1Y43B 4TLGA 3ZYGA 5FZLA 5CFDA 3U10A 1IS3A 3W9AA 3KVBA 3N7KA 3VZJA 2AENA 5LCWL 1LHUA 4B1MA 2YC4A 2XLAA 3R05A 1Q56A 1R081 5KXEA 1Q43A 3OPTA 3OEAA 2VMEA 3DCQA 5C9AB 1PGW2 1W9FA 2XL7A 4FTEA 1W2AX 1XE7A 5EQUA 1ZBA2 2DVBA 3PVEA 3V64A 4XC9A 5IFPA 5LA1A 5C3QA 1T6GC 2VXJA 2WNUA 4X8PA 1GZWB 4P9IA 4AE2A 3CZJA 1G6NA 4BQ5A 5CG8A 1FMD3 3K2OA 4DPNA 2I74A 4DZGA 3TN92 1RUH2 1O59A 2UWBA 3KHBA 1PMJX 5I0UA 1CN1A 1FAYA 2W47A 1JZ8A 2RM23 2VVEA 3I49A 4BK4A 3MBWA 2G19A 1K12A 4XILA 2WN3A 2C0ZA 2NPIA 2ZHMA 3OBTA 4F83A 4JHTA 3UGGA 3PU3A 3RFRA 4JC1A 2Y6KA 2VGDA 1UMHA 4QHBA 5A32B 4QX8A 1YFXA 3CDZB 2P17A 2CL2A 4M00A 5FPBA 3MLJA 5DUVA 5K0UA 1F15A 3RZZA 3WSOA 3P1IA 4BYYA 5J1XA 3BTYA 1O3TA 1EAH1 1X8MA 4CU6A 1PZ8A 2FQPA 1IS5A 3J7HA 4CEWA 1MEC2 3ILNA 2XVKA 1QNWA 4DUWA 1O6UA 2BGPA 5FP7A 1IS4A 2RMU3 4MXVA 2IXIA 5FYBA 5CBLA 3VD4A 2QQPA 4AFAA 1PM4A 4I30A 5ACA1 4FPGA 2ARCA 2WFF2 1VBE1 3ZFEB 3LPGA 1GU3A 3Q8BA 2FDIA 3LOIA 4XMAA 5E16A 4YYOA 4FT8A 1BEV2 3H1YA 2DUQA 5FZDA 5BNQA 1GMMA 5CVRA 2RJLA 1VBE3 3OGRA 4BXFA 3ZFGB 4AQTA 2XJRA 3T4VA 3NSTA 1Q8PA 3JB8A 5T3NA 3N9PA 4UFJA 5I0TA 4AF9A 2WR9A 4CCLA 3HOBA 4FOQA 1GANA 1PNGA 4Y26A 2FD8A 4AHZA 3VBHC 2D6KA 4RHV2 5JZGA 1HQNA 5IAVA 1IZ3A 4DFSA 3OOXA 2RV9A 5FZKA 4CDXB 4HK8A 4BMBA 2O0OA 5D8AB 3SLIA 4ZZ5A 4FBFA 1VMFA 3WP3A 3FFZA 2EAAA 4GB31 1FYUA 4AQSA 4XBNA 5KXCA 4GH4C 4L9BA 5BNOA 4MGTA 3H8XA 5FYUA 4AK3A 1LEMA 2VG9A 5EV7A 5FAXA 4AYUA 1MQTA 1V6IA 3IPVA 1LOFA 1XSQA 4E8DA 1AYN3 1XNKA 2BJSA 4MXWA 5FPUA 4QQ2A 1F5JA 4MH0E 4PT6A 1S0BA 4KGGA 4PJYA 3POBA 4LA2A 3VBFB 4KG0A 3VBRA 4M0NA 2XLGA 3KV9A 1XNBA 4A3ZA 3PUAA 1H4GA 3KLSA 2DVGA 2Q1MA 1W9WA 3CNAA 3F2ZA 1XPWA 4AOCA 4N43B 2EICA 3CEWA 1RXFA 3AXDA 4MX3A 1T6BX 2PFWA 4RYDA 1G9DA 1ASJ1 2JG8B 4XF0A 2R061 3VHPA 1H0BA 1DZTA 4K9SA 3ETQA 4QGNA 1NQDA 3RYPA 5K0UC 1AR63 1K3IA 4MO3M 1PO23 5FP8A 4GH4B 4N43A 1C1LA 5FZAA 2VH9A 3HT2A 2JEMA 2ZKLA 5A6ZA 4YZ4A 2ENRA 2HWF1 3SEEA 2OIIA 2PQQA 3NJYA 4K1ZA 3ZMNA 4BQ3A 3OGSA 1VRH1 4XJ8A 3O1TA 2BVBA 1NCRB 3PVBB 3QH7A 4A2UA 2WLQA 4Z1VA 4Y1XA 3GHNA 5C9AC 5FZEA 4MOAA 2PYTA 4NPLA 5DAQA 1SEFA 1OLME 2CAUA 1HB3A 2ZKNA 4E4HA 3VZKA 2X8KA 3A22A 3ZOIA 1JOPA 1OVSA 1YJKA 1MEC3 3QLQA 4GB33 4XQ4A 5APAA 1H1IA 4NIIA 2C24A 4E4ZA 4S2DA 1XB9A 2WBKA 4D7TA 5JOZA 4QKNA 1OH3A 2BTVC 4OUMA 2YBKA 3B94A 3FMGA 3WP4A 4E8CA 2JE8A 1KXGA 4NPRA 4N9IA 1VJ2A 2V4VA 4XAAA 4Y4YA 2GNDA 4W8JA 4R9CA 1LOFC 2ZGUA 4LOSA 1PGW1 2PAKA 3ZFFA 4UW3A 5JZGC 2Y0OA 2JKXA 1MZFA 4CP9B 3OB8A 3I7DA 2OA2A 1QKQA 3N9NA 2FDKA 3AKRA 5CISA 3U4SA 5LEJA 2ZGPA 5I0RA 4Q2FA 3LFMA 2LW8A 4AW7A 2BEOA 2BFUS 2YHJA 3K4AA 2PLV1 1RXGA 3RQ0A 2X09A 2D3PA 4XABA 4CP1A 4CUCA 3B01A 1EUTA 1NCQB 4LK7A 3THCA 1CQ9A 1DFQA 1WCKA 2XDVA 4HPKB 4CDQC 2DFCA 5JMOA 3S5QA 1LOBA 2FBEA 1RUD3 4O65A 5FZBA 3U07A 4QPWA 1DGWX 2V73A 3T0DA 1UZYA 2VZ1A 2IFRA 4Z8BA 5CFCB 1FX5A 2W39A 1TMF3 1JOBA 1OOPB 1HQLA 1Y9QA 2E26A 4IV1A 1AR92 2RMU2 4JDNA 1FPN3 4LUMA 2QQVA 1QY4A 1JYXA 1HV1A 5DPNA 4N8MA 4M3CA 5I0DA 4HN0A 3VZLA 2WFF3 4HFSA 5FLIA 4FAGA 4Z2WA 3PDQA 4FVVA 2RM21 4QDSA 1CAUA 3WF2A 2W9XA 5LK7B 3V0BB 4D7YA 3X29B 5DMYA 1ZA7A 5A3TA 2D40A 4WM7C 1QOSA 1WW7A 1WMFA 4O9EA 3BOPA 4MVTA 4FTBA 3I3EA 2FZ2A 1UU5A 1RUG2 5E88A 2ET1A 2K9ZA 3M3EA 2HWE3 2VAUA 2X5IB 3OY8B 3RYKA 3V0BA 1BVVA 2XONA 4HBNA 4XE9A 4C0HA 1CX1A 1O5LA 1W9YA 3G6JB 1UOJA 3OD4A 4PQQA 2B5HA 3I54A 4QGMA 1A78A 1GBGA 1MZ5A 2LM3A 1RUG1 2P4EA 3H9AA 3J9SA 3OSDA 4RQPA 4CDUB 1LAJA 1C5HA 4HONA 3KGZA 1SZBA 1J83A 2A70A 4RS5C 1WCQA 5FZ8A 3FN9A 3ST7A 2ETEA 4JTNA 5JVVA 1POQA 4GJYA 4LK6A 3D0JA 2W1QA 2H0VA 2DWRA 1O7FA 3C7EA 4OLLA 4LO4B 1H2NA 1LGNA 2DVFA 2WSUA 3IWZA 4RGAA 3JQWA 1XOYA 3K51A 4QX3A 1PGSA 2RS11 2VOXA 1W6MA 3ME2A 3RI8A 1IG3A 2W46A 4CDQB 3ZPYA 5A7SA 2BGOA 4JGYA 1BCXA 4XPVA 5DZFA 2GDFA 3NRUA 1QDOA 1OF4A 2BFUL 1VRBA 2ZMLA 3GYDA 4GB32 1GNZA 4I3GA 2VZVA 4OHVA 4XUQA 5FOJB 5JR2A 4UW5A 3BTXA 4EN0A 2VZSA 1H30A 1JXNA 2C6SA 2F6BA 1CVNA 4OYUA 4EYUA 5FXWA 4Q0SA 4PIZA 3N35A 4CXYA 1S0GA 2CGNA 3OUIA 4BM8A 1DGWA 5DABA 4LBLA 5JWPA 3RZMA 4BWOA 3POSA 5FYYA 3T3YA 1YRZA 3HNMA 1MR5A 2D6MA 2VM9A 5IVVA 3RZKA 3Q8FA 2AC1A 3GGLA 2R072 4WBBA 1LRHA 1V6OA 1RC6A 1JU3A 1FT9A 3NW4A 2EXKA 1BEV3 5CKQA 5A3WA 2XJTA 3VBSB 2YMZA 4NIDA 3NKTA 4V1PA 5KBFA 1SMVA 2WNVC 3TRSB 4WV8A 4DRRA 1UPIA 3UJOA 4NIHA 1YC61 1Y3TA 3HN3A 1XYNA 5HCFA 4AFBA 5FKBA 2VBBA 1FOD1 1CJDA 2W0XA 1QEXA 1RHI2 3DPRC 4ZU7A 1PZ7A 4JDOA 4OHWA 5JXGA 1PMHX 1YYNA 3B9IA 2GU9A 1QJX2 3MIFA 1RVF1 2B9VA 5CU1A 3K3NA 1L7QA 4LO8A 2W08A 5FKCA 3WD5A 5C8CB 2BPA2 2VMGA 4WZCA 3J8F3 4S2FA 4UF0A 3EHKA 3FZ3A 1SDWA 1I5ZA 3E97A 4LUKA 1NLRA 3HPNA 4Y1ZA 4TLFA 4YNIA 1W6OB 5IVEA 2MPFA 3O12A 3VBOA 4XBLA 2XL9A 3PUIA 4I3PA 4X6RB 3WP5A 4A44A 1W8FA 1UOBA 3K77A 3L2YA 5DDJ2 1YI9A 4IEZA 1POV0 4PDWB 5F2WA 1UY4A 2E51A 3VBOC 3WF1A 4LHLA 1PVC1 2EAKA 3PNAA 4CP2A 1GZWA 2R073 2DV9A 5FYVA 3WW1A 1NT0A 1OKQA 3WHUA 5DG1A 3M2MA 3GJAA 3MW2A 2C9AA 3ALQA 5H9RA 1D4M1 4SLIA 3GALA 2ORZA 4K7JA 5GZDA 2IWGB 3OCPA 3O0XA 4FOYA 4COUA 4O61A 5GZEA 4GMP0 2WZEA 2B39A 1B35C 1HB4A 4RSUA 2ZGTA 1CR7A 3ACIA 2VCBA 4M0HA 1JMUB 2JKBA 3Q8EA 3AZYA 3BKZA 2XWBB 3WG3A 4KWUA 4QQOA 1LCLA 3GCXA 4NUBA 2F17A 1E5SA 4ASKA 4OMDA 3MZHA 2ZMNA 1Y4WA 5GM0A 3AZZA 3OD0A 4RS5A 4E2GA 4JVAA 1QQP3 4FPJA 1J58A 1MACA 1GZCA 1QJEA 3WDTA 3WX5A 4BLIA 4Q4W3 2WZ8A 1QQP1 2J22A 4IGPA 1IPJA 2JIGA 4OMCA 1HDKA 2VJXA 3ZN5A 3IAQA 1X33A 3LDBA 5EPAA 5A7WB 2SBAA 3LIGA 1GOGA 1I1EA 4QQPA 4PF5A 2QVSB 5LWBA 1LR5A 4FPCA 5LASA 2ZHLA 1PIV1 1C3HA 4RS5B 2WFF1 3WF0A 4R4ZA 2BU9A 1QJY3 5JOWA 1LU1A 2NYYA 3M3QA 2FCVA 3R4DB 2OW4A 1IPKA 2JG8C 1BK0A 3KD4A 5BUVA 4QX5A 2XKOA 1OLRA 2CU5A 1MZ6A 1H9WA 3JBG1 2EA7A 3KGLA 4Q4Y2 4CPBD 1ULDA 4CEYA 2C26A 1PX3A 5FP4A 1WD4A 3HWJA 5E1RA 5F37A 5F3GA 5KHHA 1WGPA 3WCSA 1J1TA 4AHXA 2PHRA 2VOTA 1J84A 3MEPA 1DYPA 1YIFA 1V9U1 3H7YA 4JKKA 3S30A 4AL9A 5HV0A 2QKDA 1HN1A 4Y20B 1OPOA 5IK4A 2DTWA 3NAPB 2WO7A 4BQWA 2ADEA 1UWWA 5BNOB 4EWEA 4W50A 4XFIA 4AVVA 1N1SA 2W5FA 2VL4A 2C1FA 3IDEA 1N1TA 4OULA 1L7LA 1LOGA 3NNJA 2WLPA 1SLCA 4QHZA 1V00A 4QDQA 4LR4A 5FO9B 3TAYA 4CCEA 5F1RA 1L3JA 3L9JT 3T2TA 5FZ1A 2Z42A 3O1RA 4QKFA 2XVLA 5HCHA 3AJZA 2F4PA 3WVJA 5AFBA 4HK9A 2YZ4A 5ACA3 4AI9A 2YU1A 2A3WA 4XMIA 4Z82A 3PJYA 5I8TA 3J7MA 3H1WA 2RMU1 5A6YA 5JXIA 1XE0A 4MZUA 5KR7A 1RINA 5H9SA 4C0BA 1W99A 4BQ1A 1EV13 4WVMA 1CGPA 4CZSA 3HIFA 3E5UA 3PIGA 1V9U2 5IVYA 4CP9A 5FXXA 1RL3A 2X29A 2YFUA 1QJY1 2A1XA 4KWJA 4YGEA 1HRI1 5F3IA 1QGLA 1ENSA 2EALA 3K48A 1H6YA 3JBG3 3JBG2 5FZ3A 1O4TA 2ZEXA 2K0GA 5H9PA 4BH9A 3MW3A 1SACA 2JG9A 3KT4A 2VCAA 4ATEA 4CA9A 3RG0A 3D4KA 4DOUA 2EF6A 4P5YA 4QXBA 3HBZA 1W90A 1UYXA 3SEPA 1AR62 5FUNA 1TQ5A 3K4DA 5EIYB 5L19A 5DAPA 4YM2A 3KCYA 3NWKA 5FQ0B 3LD8A 3FHQA 3K75B 2DDUA 2P3JA 3SH3A 4NO4A 4ZKTB 4XZUG 3THPA 4AFDA 1AL23 1URXA 2GC2A 1REFA 1Z78A 2BVVA 4RA0A 4OI2A 4ES9A 5FBJA 3GM8A 3BU0A 1UXXX 3KS7A 4C90A 1TZOA 5A3UA 3BTZA 3ZMOA 1ULFA 3O5SA 1LB2A 2UY9A 1W0OA 3W5MA 4CU9A 2TUNA 3LKJA 5A3NA 2IXHA 2G9ZA 2XWJB 4YW4A 1POV3 1V70A 3AYAA 5GZFA 3TNQA 1RUJ3 1W6PB 3N9OA 1NZCA 3ZYJB 4OCTA 4XFFA 1W3XA 2Z5WA 3AL6A 5A7OA 2DF7A 3CZUA 3EYPA 4GXLA 5DDJ1 3ACHA 3T1LA 4RQPC 1YQ5A 3UKNA 5JAXA 3KQ4B 1PK6A 4WVZA 5KHIA 3RZJA 4PQ9A 2O8OA 4MV2A 3MIBA 3DYOA 1FPN1 5DUUA 1AR91 2XBO3 4OZOA 4LITA 1PK6B 1SBFA 1HRI3 4CSWA 3DL3A 4XEZA 2AZ5A 4M3CB 2WQ8A 3JUUA 4ET7A 1OMIA 2G9FA 3CIHA 3NO8A 5FREA 3WNNA 5FR3A 3D3AA 3EO6A 1YQCA 1AZDA 2VQAA 1DZRA 5A1FA 1D7PM 3CMGA 1GR3A 1X7NA 1YLLA 4J25A 1IHMA 3R4UA 4PHZA 3ZIWA 4BQ4A 5T52A 1IOAA 2HYXA 2P6CA 2ZX3A 3S0MA 5K8SA 1IPSA 3MICA 1QJX1 2HWD3 4UBHA 2OQ6A 1NOVA 1QXPA 1R082 2BOIA 3KCXA 4RFRB 1LENA 2FDGA 5EFUA 2YGLA 2P3YA 4YVWC 4BISA 4QU1A 1UYPA 1OLQA 4V2VA 4P5HA 2KXLA 3B02A 3VKFC 1U5ZA 2ZX4A 3WHTA 1CPNA 3CJIB 3TYJA 1EAH3 2AH2A 3GDBA 4Y33A 5CZKA 2YFZA 5BV6A 2XPJA 4QGLA 5FXVA 5BY5A 1WW6A 3VL8A 3S7IA 3DF0A 1G9AA 5F5QA 4QB2A 1H4HA 2FMDA 1CONA 3N7JA 4LEJA 5A33A 5IATA 1RUF3 2ZGNA 1O3SA 2KD7A 3OGGA 5A6XA 3GZAA 4Y3OA 1OF3A 1OOPC 2EIGA 3PMEA 4EWAA 2ZZJA 1F5FA 2A6VA 3CHXA 2WFPA 3M3CA 1WW4A 3NQHA 4LA3A 1KITA 1NY71 3VZMA 4A4AA 1AR93 5C5UA 2VZTA 3LGRA 4A6SA 4BLJA 3THTA 2BV4A 1COV1 2JDMA 2QQNA 2KM2A 3RVHA 1ND3A 2ZGOA 5ACA2 4P9JA 1QJZA 4XUTA 4YG0A 2Z69A 3SCGA 1CZTA 4RHV1 2MEV1 3CL1A 4ZXKA 3BOWA 2XKPA 2W1WA 3HMYA 2XUEA 4NPMA 3ACGA 1WMXA 2JB8A 4AR2A 4QPGB 5I91A 5FIXA 1DBNA 4GWNA 1CAWA 2W2IA 1Y9MA 3WG1A 4H7LA 5F6KA 1C1FA 4IQPA 2R063 1US2A 1BJQA 2ES3A 3ZO0B 5L73A 1RHI3 2JE9A 4DINB 1NQJA 4RR3B 4PIXA 1REDA 1KDMA 2IVIB 2VMIA 3AKTA 4K1YA 1LOAA 4XF3A 5F5CA 5ABJB 4R9DA 5FJKA 4Z92B 2VO5A 3HQUA 1JUHA 3I59B 4QHOA 2YBSA 4KL1A 5LZ6A 2LRPA 5T54A 3SH4A 5FUIA 4D69A 3BN6A 1QJU2 2DCTA 4AZZA 2RR12 2A6ZA 4XFAA 2CGPA 5FMBA 1AHSA 2DUPA 3ZFEA 1BBT2 4L0PA 3T4HB 4CUGA 5JXJA 4LKFA 1C8NA 3BPZA 1F35A 4QKDA 5C8CA 3R4SA 4OHXA 5GLZA 2B46X 3PJQA 2VY0A 4TWTA 4Y24A 4RR3A 4YVWB 4XIKA 1TMF1 1HW5A 1J3PA 2W1UA 2ZHKA 3HR9A 2AGSA 3WINE 2IUWA 4J6GA 2VTFA 5JOXA 3UGFA 3VDDC 4QM9A 3ZVXA 1W2OA 3WNMA 3OGVA 1OC1A 3CLPA 4MG2A 4N53C 1W39A 2DU1A 2OZJA 3VHOA 1W8WA 4YM3A 2D44A 1GQHA 2W95A 1WMEA 2R7EB 1VBD3 1IKQA 2OKXA 2CTVA 1RUJ2 4UFMA 4LKEA 1RUH1 3H7JA 4ONUA 3SQOA 3TN91 4DB5A 5AC93 1O4YA 1PO22 2VU9A 3JD73 4INDA 4XFGA 4P08A 1F4AA 2YBPA 4R8HA 5J36A 4QXCA 1LHVA 3USSA 2IXLA 4IE0A 4I0AA 4CDXA 2BW8A 4NHLA 4XJWA 3JD71 1MQTB 2WINB 5I8YA 2DU0A 4Z2AA 1JODA 1VBB3 2X10A 3AMNA 4YSFA 5LK5A 1AF9A 1AL22 1QXRA 2QFEA 4HN1A 3ZXKA 2D3SA 1FXZA 3OTFA 4LBJA 4LHSA 1XE8A 3TEZA 3FUQA 1AXKA 3O1PA 3WQ1A 4IEUA 1ZA4A 2ZHNA 1JBCA 1NA1A 2VD7A 5FY7A 3VBRB 1P8JA 1ZYBA 4HSLA 2D5FA 2WZR2 1EYBA 2RS33 3RI9A 4P9LA 3LDRA 5T5JA 3IBMA 4IE6A 1LJ7A 4UW4A 2A6WA 3ZX7A 1QU0A 4XFHA 5FRAA 3T08A 4EV0A 3WNLA 1ZRRA 4IE5A 3O1UA 2FDHA 4QXHA 4QWNA 4COYA 5K9YA 4TN7A 1IGOA 2VUCA 3AKPA 4R9AA 1SHWB 3T2OA 5BNPA 2XBO1 3QOPA 4L97A 3DN7A 3PTYA 4Q4X2 3RPQA 3E6DA 4HANA 4UFHA 1NA1B 1S0DA 1COV2 2K2SA 3KCCA 1CPMA 1BYHA 3DKQA 4GH4A 2RS51 3LA3A 1OUXA 4M4RA 5KXDA 1YWKA 4ASMB 4BQXA 5ISLA 1ZBA3 1GP6A 1SBEA 3QCWA 4JRAA 2OX0A 2JG9C 1MS4A 3MFCA 2E32A 3MO4A 1W2NA 4ZXEA 3TB0A 3UGHA 3KM5A 3RWKX 3ENRA 4EN9B 5FMCA 1PIV2 5K4LA 2Z4FA 5FXZA 3CF6E 2DURA 5M0TA 5F6LB 2QZ2A 2VZQA 3U1XA 1QHDA 3A21A 4HVRA 4DNYA 4DUVA 3AB0A 1QWRA 4Q4Y3 4YVSC 4YZ3A 1GLHA 2SLIA 2EIBA 3BIWE 5FCCA 3ZLIA 1HQWA 1W3VA 1NLQA 3P3NA 3MW4A 4JZRA 4LBQA 2WT1A 3THDA 2QJVA 1RUC1 1RUI1 3POGA 3AKQA 2Y0IA 2ZMKA 5JSRA 1D2SA 1E5RA 1VBA1 2WJSA 1LECA 1JW6A 2X53S 3VKNA 1AX0A 2BNOA 1CESA 3IMNA 5LRSA 4BCUA 2OZ6A 1PMIA 3H8UA 4XUOA 1AXYA 3LQCA 2FMYA 4CCCA 1CAVA 3VB9A 5LEKA 4J1WA 3UESA 4E4SA 1VB4A 2GN7A 4JHZA 2D7FA 2O14A 5FMOL 3PU8A 5ANQA 4JTOA 3B7MA 3DGTA 1QJY2 1W6QB 4M3CF 4A7ZA 1PVC3 1SCRA 1LTEA 3AX4A 4AEMA 1KDKA 1LESA 2GMMA 1J3QA 5FZ9A 2GNMA 1L7RA 4H14A 3T30A 4BB3A 1OA4A 4B4RA 2YROA 3N36A 3GZTB 2W94A 4YW1A 3BCWA 2VNVA 3ZXJA 4Y5Z0 5A3PA 1UCXA 1IS6A 1ACCA 4QX0A 1CAWB 4XCBA 4FAHA 1R1ZA 1I6XA 1SQ4A 2P2KA 4NWVA 4OQ9A 2VOVA 5FO8B 4MADA 5A1LA 1ZZCA 2LROA 2QQMA 3KV4A 2OS2A 3PTRB 3E5XA 1I5PA 3FLTA 4YW6A 4KMQA 5L7OA 1RUH3 2JD4A 3UK9A 1U5YA 1HRV2 4L99A 1DQ1A 2CV6A 2HWD1 1OFNA 1QJX3 4A3XA 3ABZA 1GQPA 4XJAA 1W0PA 1RUF2 4YVSB 5B2GB 1EY2A 1J3RA 5KC5A 4ZS3A 3G7DA 4AI1A 1V6KA 4IETA 1R1A2 2H6CA 3AZVA 3BGAA 4ZPIA 3N9QA 1W05A 4AQ2A 4TSVA 3FJSA 4W6WA 4ATFA
chains in the Genus database with same CATH topology
4YARA 4KBBA 1VBC2 4XHXA 5HBAA 2GC0A 3BU7A 5AC92 1LULA 2XH6A 4E2QA 5K0UB 2VVFA 3POYA 1ULCA 1LOCA 2GSYA 2VOWA 1GQGA 4OHYA 3C2UA 4JGYC 2PA7A 4XYXA 1W6NA 1ALYA 4I09A 1NCRC 1HLCA 1B09A 4ZU4A 1NXD1 4AEJA 1U5XA 2Q4SA 1XRUA 1S2BA 2WKKA 1W6MB 3W58A 3DKWA 3N7LA 4FSJA 2BUKA 3CJIA 2HWC2 1AYM1 2QCSB 4Y22A 1RMU1 2VW2A 3WP6A 3GHMA 5GZGA 4AFCA 3WCRA 1WD3A 4Q4W2 3UJQA 1CJPA 5J7MA 4Y22B 2D5HA 3HN1A 3ELNA 1RUG3 1ZX5A 2Q0AA 5JPMB 3NV2A 1PVXA 5JCTA 2XUMA 3TBDA 3SCHA 5GLTA 1YUDA 4MUVA 4JCKA 2WC2A 1OSGA 1Q8VA 4CDWC 2DUOA 4AEDC 1D0HA 3E5QA 4YM1A 4Y1VA 1RUF1 5IUQA 4LLOA 1NYWA 1M06G 2LUWA 2WQ4A 2XGXA 4E27A 5FFOC 3UKVA 1YI7A 4IL7A 4YGDA 3MLLA 1S0FA 1K5MB 3TNPB 1IQAA 3KB5A 3VKLA 1HXS2 1ENQA 4AGGA 2CGOA 1UU4A 4FO9A 4WM8B 3AMQA 2DCKA 2YGMA 4FOWA 5BXXA 3D0SA 4PLMA 3FBYA 1OI6A 2ZCWA 1WBFA 1FOD2 1KQRA 2WQZC 3FC0A 3GZUC 5K7PA 5FDBA 1BMV2 3LAGA 1WCSA 4MGKE 4CEWB 3PHMA 2WT0A 1S55A 1C4RA 1NG0A 1AYN2 4CTEA 4EWDA 1JHNA 2EXJA 2GMEA 2NQYA 4XZPA 3ZXFA 1XXNA 2KA3A 1DZQA 2I45A 2B8MA 3RWNA 3VDDA 1WCDJ 3SISA 1Z7S1 2TEPA 1WLWA 3DPRA 3URFA 1OA2A 4AHWA 4UW6A 2IXJA 1PGL1 1TE1B 4OUSA 2UURA 5A3MA 2RS52 3BALA 1WLDA 5FQ0A 4IERA 4X8NA 2HWF2 2HWF3 4QPIA 2AREA 3POWA 1PIV3 3ZYIB 2JENA 2XBO2 2CWSA 4LULA 1KD7A 2BNMA 2ZABA 3I4IA 3VBUB 2RS13 4HKWA 4A7KA 1J1LA 3MFAA 1AR73 4COVA 4P9WA 4B7EA 1PM7A 5L7OB 3AP4A 2HEVF 2WA3A 4RD7A 1OFSA 2RS32 1SLIA 2AYHA 4LBNA 2HEYF 4P14A 1KFUL 2YV8A 1EPWA 4CYDA 3OPZA 4Q0PA 1DGRA 4BHPA 3N7MA 5GLVA 4PBOA 4WM8C 1O3QA 1C8M3 1ZRCA 1Z7S2 1BK1A 1N3OA 2QDNA 2D6NA 4JGZC 1N47A 2QZ3A 1KFXL 1XNCA 2R071 3ZYPA 2H6BA 3IDBB 3S6PA 3MGUA 1I9RA 4KU8A 5FLHA 1H2KA 1RUD1 2YYOA 1ZNPA 4IEQA 3ZIXA 4AXOA 4O9GA 3FE5A 5FBZA 3NAPC 5JI9A 1EV11 1N3QA 2E9QA 2WA4A 3ECQA 4KNCA 1AVBA 4TZDA 1S0JA 1ZBE3 5D1IA 3LSEA 3WLUA 1QF3A 3KZ4C 3LB9A 3WUDA 4W65A 1UU6A 2I07B 4WM7A 5FPXA 2PHTA 4MSVA 5DZGA 1OQ1A 4I2OA 1LGBA 4WVMB 5FPZA 5GLWA 1R1A3 2RR11 3VBSA 4BIFA 3MIHA 5HI0A 1NE4A 1R1A1 4Z07A 3AZXA 5FLJA 2WIIB 2BWCA 4GWMA 3ZFFB 5AC91 5IK5A 1JUIA 4QQHA 1BEV1 4K6BA 4AI0A 5FTTC 3RNSA 3RMXA 1SLBA 5AFEA 2ZOEB 3VBUC 4OHZA 3AP6A 1KS5A 5JLVA 1MVQA 4LBQB 3B69A 1RJ7A 2E6VA 3IT8A 1AR82 2ZGQA 3QACA 4PBPA 4U2AA 1D4VB 1UAIA 1FNZA 1VAVA 4DMIA 2IC1A 2VUJA 3USUB 3JQXA 1PVC2 4COWA 4RGGA 1SFYA 2GC3A 2XHKA 3ZXLA 2UWAA 3LA7A 3IM0A 4JQRA 5BNPC 2ZBJA 3WR0A 4N53B 5JR7B 5C4WA 3VBFC 3UKTA 2XJQA 3FLPA 3QH6A 1HXS3 4RL7A 4XFBA 2BWAA 1SLLA 3VGIA 4GIQA 3ACLA 5CADA 3MI8A 1GICA 1DG6A 1LHNA 4COZA 1YNAA 5EJ3A 1AYM3 4BMEA 2XVGA 4S2GA 3EBRA 1AL21 3NVCA 3ZYRA 1JTZX 1W6OA 3ZN6B 1NY72 3I59A 1H8TC 5JDBA 2RS53 1TNFA 1RUNA 4KU7A 3M3IA 1QDCA 2H0BA 1H8TB 1RGSA 4YZ2A 1ZZ6A 3MPBA 1VB2A 1QQP2 2JJ6A 5A3LA 1QJU3 4NVPA 4XIOA 1BZWA 5KC6A 3GF6A 2WNVB 3ZXAC 2ZX2A 3I8TA 4YVWA 1DQ2A 2D43A 1H8TA 2D98A 1PO11 2DCZA 4NHMA 3ATGA 4PLNA 5KHJA 2R041 1Y7BA 4LBQD 3V65A 1F9KA 3M4FA 3AFKA 1WLTA 2A6XA 1U0AA 1MQTC 2E53A 3M8LA 4FP3A 2XB6C 1Q8OA 2NZ9A 3IPVB 1KJRA 2JDZA 2RS31 2FHRA 2HWD2 2PAEA 4CEYB 3KT7A 1HRV1 4AI3A 3VBUA 1ND2C 4CDQA 4AI8A 3HAGA 1FNYA 5DUXA 4E9KA 4Q4X3 2EVXA 2O8QA 3JZVA 1FATA 2XJSA 4LBOA 3CJXA 2WS93 4GA9A 2WS92 2NP0A 4YGBA 4QQLA 1A8DA 1D4M2 2RR13 1VAMA 2ZJCA 2Q1ZB 3MDPA 4HKOA 3AKSA 4BPZA 1WUVA 4QD2A 4YLZA 2GN3A 2ZGSA 4ISRA 2PHDA 2LALA 4KH9A 3ZDSA 5CAZA 1UX6A 1PGL2 1R091 2R043 4LE4A 2DCYA 3VLBB 2CWMA 4GALA 5JSOA 2R16A 3VBFA 4W6XA 5C8CC 4Q1PA 3AMMA 3WDYA 2UYBA 4XHBA 3M3OA 2WNUC 1VRH3 4BIOA 2ERFA 1UW8A 4LO5B 2OPKA 4L2NA 4QM8A 4QPYA 5GKAC 1C5IA 4HVQA 3SXWA 1H8VA 4DY3A 2E7TA 1K5MA 1RUJ1 1U12A 2BNNA 1FMD1 4R9BA 4N7UA 3BB6A 4AGVA 4W6YA 2D3RA 2PTMA 1LU2A 1CAXA 4FOVA 4GKXA 4QXKA 5JOYA 5HXVA 1J59A 3AM2A 3A0NA 1QOOA 3WW2A 4AHYA 2ZA9A 2ZZQA 1E57A 1GV9A 1UIJA 1O4ZA 2A5ZA 1CAXB 4LBMA 1DYKA 4GULA 5EXOA 1XQNA 3DPRB 4LE3A 4U36A 1RTVA 4QPIB 4YG6A 3SNMA 2D6PA 1VALA 4EN7B 2MEV3 4FPOB 3MF9A 5BYNA 2D97A 2HWE1 2Q5TA 3VBHB 5KHKA 4XDQA 4PCRA 3EXUA 5J09A 2RJKA 3U11A 2A75A 2PN5A 4CEWC 4FPKA 3JCIA 2N7GA 1G9BA 1CIWA 1TNRA 2NLRA 1OD5A 3Q9OA 4Q0VA 4C1WA 5CFCC 3VBHA 4XXAA 5BNNB 4QU2A 2X5IA 2ZAAA 2A73B 1GFF2 2YDEA 3FHIB 1AR72 1RUE1 1TME2 3ZFGA 4H7MA 1DIWA 3RYRA 3H1MA 3NV4A 4B8EA 2QUOA 1QOTA 1GSLA 4IV3A 1S2KA 1G8WA 1VLNA 4IEOA 3RMYA 4I0WB 4H3WA 2CY6A 2R6QA 3NAPA 3MIDA 3PVNA 2RE9A 1AUYA 3R0RA 4HETA 3RRDA 5EYXA 5IK7A 4AFMA 1LODA 1C8M2 1XU2A 2V5YA 3B00A 4JGZA 4LHNA 1VBC1 3MPPG 1A6CA 1XU1A 4OI1A 2GAUA 4KG8A 2JXAA 2VNRA 3SITA 2HWB2 3OYWA 3EJKA 1Z0HA 1VBA3 1ZZ7A 1C8M1 4CRQA 1PO13 1HX6A 4FPFA 4IXLA 2RHPA 3BTAA 3I2DA 3OF1A 1YXWA 4HT1T 3WZ1A 4F7ZA 1MS3A 1WW5A 3RJ2X 4XW3A 2WZR3 4N7IA 2R0HA 4CDWA 5FMOS 1MS8A 5E89A 1V6MA 2GZWA 2GNTA 1S0EA 4WVVA 3WOGA 5CG9A 4AGRA 1RMU3 2G9GA 1PHMA 2YC0A 3FWEA 3WXPA 4XOGA 4JGYB 2NM1A 4META 3PLQA 1VBB2 2MNGA 1QH6A 1RB8G 2B45X 3WG4A 4RHV3 1AJOA 3M70A 3FLRA 1RVF2 2IZWA 1DGRN 3KMHA 1SLAA 5J3UA 3NJZA 3QBQA 4AVCA 3WY6A 2W52A 5JIUA 2HWE2 1YFWA 3IKWA 2R042 3KT1A 4MGYE 3AYDA 4AVBA 5KWRA 2HWC1 3E6CC 1ZREA 5GLUA 3LA2A 1UIKA 2VNOA 2DYCA 4L11A 2QNKA 5D8AC 5L36A 2XJPA 3O0VA 2O1QA 3ZN6A 1WMDA 4AVSA 3JD72 1X50A 4K3UA 1RMU2 5JMCA 4IV3C 2HKXA 1SBDA 1Q3EA 2IXCA 2VVDA 2VW0A 3USUA 3VKMA 2WNUB 4D7SA 4I01A 5SV8A 1LHWA 3AYEA 3ZXDA 2VOKA 4Q4V2 1YJLA 3RS6A 3WDVA 1OA3A 4FPYA 1CD3G 5FOBB 5ABJA 3O14A 1RUE2 1TME1 4MYEA 1PZ9A 2OVUA 4HVOA 1JN2P 4DQAA 3J8F2 1ULGA 3WW4A 3B9CA 5ABJC 4AVAA 1W6PA 2RS12 4K8FA 1X8EA 3H3UA 4CDUA 1N1YA 5JIAA 1R092 4F8AA 3CO2A 5KHGA 4Q8KA 3WDXA 2C5DA 4AEKA 1D0GA 4HZFA 4M01A 4XF9A 4HL0A 2HWB3 2JX9A 4KQ7A 3P3PA 4WZFA 1BVP1 5L7OC 3AJYA 3FFQA 3MYXA 4HSJA 2AR6A 4PDWC 1DQ5A 4K20A 4I02A 2V09A 4M3CE 4CP0A 2MHFA 3IN9A 3OY8A 4D94A 5IT6A 3OGJA 4JAAA 2NN8A 5I0SA 4DY5A 1W6NB 2GH2A 1YCIA 4DS0A 2ZGRA 4Y1YA 1OHFA 1XYPA 4OI4A 3VHNA 2VULA 3QD6A 4XTMA 2ZGKA 2PHFA 1ZZ9A 3GNEA 5CIRA 3FBMA 2QE3A 3PVOA 5H9QA 1VBA2 3ZXEA 1JH5A 1UL9A 2HYKA 4Q8LA 1V6NA 2GC1A 1U5IA 1S0CA 3BODA 4HMZA 1H1MA 2A7AA 4FPLA 5BPXA 1OQEA 4FCAA 2Z79A 2GALA 1Q8SA 1ZBA1 1B35A 3M1HA 3LCPA 1XNDA 3B3QE 3NV3A 1NCRA 1YFUA 4MGZE 4OFGA 1W2UA 2NMOA 4IV1C 1JYIA 3OJBA 2YY1A 5BNOC 4FQZA 3RJRA 5GALA 2HWB1 2I2SA 4EROA 1H2MA 1ZM1A 4XXPA 1VBC3 1Q8QA 1HRI2 3VL9A 4YFWA 5TSWA 1S1AA 1GKBA 4WM7B 2Z2SB 3MF6A 2PLV3 3ASIA 5BNNC 1DDLA 1RJ8A 2CNAA 2LTNA 4G3YC 4Y1UA 4YW2A 4TYSA 1ND2A 4LO6B 3AMHA 3VDDB 1ND3C 4Q4X1 4FTSA 4E2SA 1IKPA 2MEV2 5T55A 1H1AA 1TEIA 1HIXA 1UPSA 3GBFA 1RITA 3VV1A 1LHOA 5T50A 1NCQC 1V9U3 4ZU5A 5I8SA 3M7AA 3D6EA 1UKGA 4XFCA 1MEC1 2D6LX 3LOBA 1ASJ2 3UL2A 5CFCA 2VUAA 1VBD1 2PHLA 4EJRA 3ZFEC 4NWWA 4IEWA 4FXGB 3A0KA 2PELA 4OVEA 1NCQA 3T1MA 4LHKA 2VPVA 3ZXGA 1SLTA 1OPMA 2B9UA 2BBVA 3FX3A 2ARBA 5DDJ3 4KGQA 5DZEA 3HQXA 4P9YA 4EN6B 4B29A 1RUC2 1RUI2 1RUI3 1RUC3 4FP2A 5C4WC 1PNFA 4K21A 1VR3A 3ZSMA 4MLOA 1UZZA 4LT5A 1PO21 2UU8A 1H2LA 1S0IA 1ZVFA 4IV3B 4ORFA 5BNNA 5T5PA 2E63A 3SCFA 2WWSA 4LBKA 1REEA 4YVSA 1AJKA 3WNXA 1OOPA 1MS5A 4IV1B 1AR61 1V6JA 3DV8A 1JOJA 3D8CA 3CU7A 4Q4V3 1VAKA 1ASJ3 1LEDA 1LGCA 5J37A 2VECA 3WG2A 1A8MA 2B7YA 2D6OX 2YPJA 2GNBA 3AMPA 3RDIA 1BKZA 4BA6A 5E8AA 4CDXC 1D4M3 2A3YA 4GMP3 3AK0A 3VBRC 4N43C 3VBSC 1UD1A 3B5LB 4Q0QA 1YO8A 1DGLA 1A3KA 3J26N 4WVWA 2R49A 4JGZB 5JPNB 2R1DA 4S2HA 5C6CA 1AXZA 2WT2A 3GBWA 2PHXA 4E4DX 1BXHA 3INAA 4GQ7A 2BQPA 4R4XA 2HEWF 3H0OA 1F31A 1WA4A 2ZAHA 3JB4C 2RM22 2CYFA 5EWSA 4DRVA 4AWDA 5C8WA 5J48A 3IDCB 4N90A 1ZZBA 3J8F1 4AI2A 2A71A 5C9AA 2GMPA 2YXSA 5AVPA 2DVDA 2R0FA 2XJUA 2XJVA 4WM8A 1FI2A 4IEVA 2ZPXA 2BYVE 4LLFA 1SCSA 2DFBA 4RFT0 2Y26A 1PK6C 1ZBE1 4F3JA 4ISQA 3ZFFC 2WS91 3EQEA 3AP9A 5C4WB 1WBLA 2ZS6B 3SH5A 1GYKA 4JDMA 1PO12 4Q26A 2PAMA 1RUD2 3TN93 4BOWA 2PLV2 3TOJA 5CFDB 3VBOB 4LO7A 2ZGLA 4SBVA 4N53A 3J4UH 1ND3B 2R30A 3HT1A 4QPGA 2UY8A 1F2NA 2HWC3 4RR3C 1QMJA 3C3VA 2PHWA 4YZ1A 4CDUC 1N3PA 1V6LA 2XG3A 3AP7A 4GMP1 4H55A 4AG4A 1F8VA 2P3IA 1QJU1 4HLTA 4XQWA 4YGCA 2JECA 3HD8B 4AQ6A 4DXZA 2JE7A 4KWKA 4UBGA 3S7EA 1DF0A 4QPIC 4IESA 3WV6A 5A32A 3NV1A 1G86A 1KRIA 1POV1 4XBQA 1ND2B 2WZPP 3VZOA 1O91A 3MIGA 4PDWA 1AR83 5EZWA 3AFGA 3LSDA 2WL1A 5C33A 1ENRA 3O0WA 2ATFA 1C57A 1RUOA 2WZR1 1AR81 4L8QA 4B3NA 1AR71 1UMZA 4Q1RA 4BE3A 2A3XA 4XQDA 2GH8A 3WUCA 5CG8A 3GBGA 1LOEA 5T5LA 3AXEA 3H3ZA 3WQ7A 4PIYA 1HXS1 4JRLA 5CNAA 4FQ4A 3ILRA 1XYOA 2ZACA 1VIWB 4C91A 1AL0G 2P37A 1G9FA 1DQ6A 3ZSKA 3ROUA 1YFYA 1DQ0A 2OUJA 4MXWB 2OUHA 3B93A 1COV3 3VN4A 3NKGA 1AX2A 4QMAA 1EPZA 2ET7A 5LRRA 3JU9A 4IEPA 2R062 4ITCA 4XETA 5CA6A 1KS4A 3SMHA 1VP6A 3V56A 4P9XA 3V0AB 3W59A 3VHRA 5CFDC 5JI7A 3WW3A 1ZRDA 4GKYA 1QH7A 2IFWA 4B7KA 3ES1A 1X82A 2FZ1A 2ILMA 4D3WA 1EV12 3OBRA 5D8AA 2VQ0A 3MIEA 1TME3 4XJUA 3LWCA 3WQ0A 5GJ6A 1YHFA 4NHKA 1M4WA 1AX1A 5I93A 1MS9A 4YFZA 2ZX1A 3FUOA 4N9HA 3U0ZA 2PHUA 1HRV3 2ZTNA 1JYCA 4Y20A 4UXAA 1RUE3 1AYM2 2XLFA 1QNYA 3PMSA 2Y38A 1FMD2 4CEYC 5A33B 5J98B 2R1BA 1UKRA 3KSCA 2P3KA 1MS1A 2JG8A 1NLSA 4QT6A 1B35B 3RSJA 1VBE2 3WT3A 3L2HA 5IK8A 4YZ5A 1BQPA 2YUEA 4I0BA 3ILFA 3OYWB 1CAVB 1APNA 4MGIE 4YW3A 5EYYA 3VKOA 4C1XA 3H50A 2R32A 4YM0A 4J1XA 4Q27A 4FPHA 4URTA 3ES4A 1CX4A 5DUWA 1X36A 2W68A 4X6QB 4OZXA 1N1VA 1FV2A 3U4XA 4XJZA 2E7AA 4Q4Y1 1RHI1 2VMHA 4PLOA 1HKDA 4Q4W1 4G4FA 2DVAA 5HCAA 1QXJA 4B4QA 4HPKA 1GNHA 1OQDA 4LNVA 2EXHA 3N3HA 4YG3A 3LZZA 1MVEA 1R083 1MS0A 4Q4V1 3NL1A 1ZRFA 3DUIA 3VUOA 3SHRA 2DTYA 4NR1A 2JICA 4A7YA 3D5OA 1DHKB 1DQ4A 3E6BA 3ZSEA 4HKLA 5DXDA 2ARXA 5FO7B 2QDRA 3ZN4A 1LKNA 1W6QA 3AZWA 3CJIC 3UV9A 3ZSJA 1ULEA 5JZGB 1FV3A 1TMF2 1NXMA 2ZX0A 4K40A 4XTPA 2A6YA 1DU3D 2IXKA 2E7QA 5J96B 3TWIA 1AYN1 1RIRA 3KQRA 2P34A 4XJ9A 1SFNA 4AEDB 4R52A 2B42B 1BBT1 1R093 2G4IA 5SV5A 1G9CA 1C28A 4P9GA 2WNVA 4KWLA 2AUYA 4QPGC 1BMV1 2EXIA 2VNGA 5F9TA 1YIPA 1ENXA 1G7YA 2HJIA 2UWCA 1Z7S3 1UN1A 4OI0A 1D2QA 2BGCA 4Q29A 1NA1C 4FXKB 2WNEA 5BNPB 1NE6A 3APBA 1HV0A 5DG2A 1I3HA 1VBB1 2NMNA 1K5MC 1UF2C 3WDUA 5GZCA 4AEDA 4EN8B 4JV4A 1RVF3 2D93A 2TNFA 1GZ9A 1H9PA 4IEYA 1ZBE2 4NN0A 3IIAA 4LTAA 1VBD2 4NOTA 1FOD3 3AP5A 4XF1A 1CAUB 3R6SA 1DLLA 2Q8OA 1EP0A 1MZEA 1KJLA 4XF4A 4YRDA 1ZZ8A 1Q5OA 1FPN2 3AYCA 4RQPB 1O3RA 3D82A 4G9SB 4CDWB 2ZGMA 2DCJA 2X5IC 3N4MA 1VRH2 5HCBA 4IEXA 5KXBA 1BBT3 1EAH2 4Q0UA 2OYZA 4AVTA 4YW5A 2UYAA 4ASLA 2WSVA 3O7OA 2VXRA 5CB7A 2CAVA 5JSPA 2VW1A 4FPEA 1ONAA 2TBVA 3ZFGC 1O5UA 3MLKA 4ES8A 3V0AA 4L92A 3ZSLA 5AVAA 5T5OA 4BZ4A 1WLCA 4B4PA 2Q30A 2JG9B 3A4UA 3WDWA 3VZNA 1Y43B 3ZYGA 5CFDA 3U10A 1IS3A 3W9AA 3N7KA 3VZJA 2AENA 1LHUA 2XLAA 3R05A 1Q56A 1R081 5KXEA 1Q43A 5C9AB 1PGW2 2XL7A 4FTEA 1XE7A 1ZBA2 2DVBA 3PVEA 3V64A 1T6GC 2WNUA 4X8PA 4AE2A 1GZWB 4P9IA 1G6NA 1FMD3 4DPNA 2I74A 4DZGA 3TN92 1RUH2 2UWBA 5I0UA 1CN1A 1FAYA 2RM23 2VVEA 4XILA 2C0ZA 2NPIA 2ZHMA 3OBTA 4F83A 4JC1A 2VGDA 4QHBA 5A32B 1YFXA 2P17A 2CL2A 4M00A 3MLJA 5DUVA 5K0UA 3RZZA 4BYYA 1O3TA 1EAH1 1X8MA 1PZ8A 2FQPA 1IS5A 4CEWA 1MEC2 3ILNA 2XVKA 1QNWA 2QQPA 1IS4A 2RMU3 4MXVA 2IXIA 5CBLA 4AFAA 4I30A 5ACA1 4FPGA 2WFF2 1VBE1 3ZFEB 3LOIA 4XMAA 5E16A 4YYOA 4FT8A 1BEV2 3H1YA 2DUQA 5BNQA 5CVRA 2RJLA 1VBE3 3ZFGB 4AQTA 2XJRA 3NSTA 1Q8PA 3JB8A 5T3NA 4AF9A 5I0TA 4FOQA 1GANA 1PNGA 4Y26A 4AHZA 3VBHC 2D6KA 4RHV2 5JZGA 1HQNA 1IZ3A 4DFSA 4CDXB 4HK8A 4BMBA 2O0OA 5D8AB 3SLIA 4FBFA 3WP3A 3FFZA 2EAAA 4GB31 1FYUA 4AQSA 4XBNA 5KXCA 4GH4C 4L9BA 5BNOA 4AK3A 1LEMA 2VG9A 5EV7A 5FAXA 4AYUA 1MQTA 1V6IA 3IPVA 1LOFA 1AYN3 1XNKA 4MXWA 4QQ2A 1F5JA 4MH0E 1S0BA 4KGGA 4PJYA 4LA2A 3VBFB 4KG0A 3VBRA 4M0NA 2XLGA 1XNBA 1H4GA 3KLSA 2DVGA 2Q1MA 3CNAA 4N43B 3CEWA 3AXDA 4MX3A 2PFWA 1G9DA 1ASJ1 2JG8B 4XF0A 2R061 3VHPA 1H0BA 1DZTA 4K9SA 3ETQA 4QGNA 1NQDA 3RYPA 5K0UC 1AR63 1PO23 4GH4B 4N43A 1C1LA 2VH9A 3HT2A 2JEMA 2ZKLA 4YZ4A 2ENRA 2HWF1 2OIIA 2PQQA 4K1ZA 3ZMNA 1VRH1 4XJ8A 2BVBA 1NCRB 3PVBB 3QH7A 4A2UA 2WLQA 4Z1VA 4Y1XA 3GHNA 5C9AC 2PYTA 1SEFA 2CAUA 2ZKNA 3VZKA 2X8KA 1YJKA 4GB33 4XQ4A 1MEC3 3QLQA 3WP5A 4E4ZA 1H1IA 4S2DA 4D7TA 5JOZA 2BTVC 4OUMA 3B94A 3FMGA 3WP4A 1KXGA 4NPRA 4N9IA 1VJ2A 4Y4YA 2GNDA 4R9CA 1LOFC 2ZGUA 3ZFFA 1PGW1 2PAKA 4UW3A 5JZGC 2Y0OA 1MZFA 3I7DA 2OA2A 1QKQA 3AKRA 5LEJA 2ZGPA 5I0RA 4Q2FA 4AW7A 2BEOA 2BFUS 2YHJA 2PLV1 3RQ0A 2D3PA 4CP1A 3B01A 1NCQB 1CQ9A 1DFQA 1WCKA 4HPKB 4CDQC 2DFCA 1LOBA 2FBEA 1RUD3 3U07A 1DGWX 2V73A 1UZYA 2IFRA 4Z8BA 5CFCB 1FX5A 2W39A 1TMF3 1OOPB 1HQLA 1Y9QA 4IV1A 1AR92 2RMU2 4JDNA 1FPN3 4LUMA 1QY4A 1HV1A 4M3CA 4HN0A 3VZLA 2WFF3 4HFSA 5FLIA 4FAGA 4Z2WA 4FVVA 2RM21 1CAUA 5LK7B 3V0BB 4D7YA 3X29B 2D40A 4WM7C 1QOSA 1WW7A 1WMFA 4O9EA 3BOPA 4MVTA 4FTBA 2FZ2A 1UU5A 1RUG2 5E88A 2ET1A 2K9ZA 3M3EA 2HWE3 2X5IB 3OY8B 3RYKA 3V0BA 1BVVA 4XE9A 4HBNA 4C0HA 1O5LA 3G6JB 3OD4A 2B5HA 3I54A 4QGMA 1A78A 1GBGA 1MZ5A 2LM3A 1RUG1 3H9AA 3J9SA 4RQPA 4CDUB 1C5HA 3KGZA 2A70A 4RS5C 3ST7A 2ETEA 4JTNA 5JVVA 3D0JA 2H0VA 2DWRA 1O7FA 4OLLA 4LO4B 1H2NA 1LGNA 2DVFA 2WSUA 3IWZA 4RGAA 3JQWA 3K51A 1PGSA 2RS11 2VOXA 1W6MA 3ME2A 3RI8A 4CDQB 3ZPYA 4JGYA 1BCXA 4XPVA 5DZFA 2GDFA 1QDOA 2BFUL 2ZMLA 3GYDA 4GB32 4I3GA 5FOJB 1GNZA 4OHVA 4UW5A 4EN0A 1H30A 1JXNA 2F6BA 1CVNA 4Q0SA 4PIZA 3N35A 1S0GA 2CGNA 4BM8A 1DGWA 4LBLA 5JWPA 4BWOA 3POSA 1YRZA 1MR5A 2D6MA 2R072 4WBBA 1LRHA 1V6OA 1RC6A 1FT9A 3NW4A 2EXKA 1BEV3 2XJTA 3VBSB 2YMZA 3NKTA