4XQFA

Tailspike protein mutant e372q (delta d470/n471) of e. coli bacteriophage hk620
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
594
Chain Sequence
b'DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 594
sequence length 598
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xqfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xqfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xqfA02
1RMGA 1JRGA 4XNFA 4XL9A 4NK8A 1PLUA 4EW9A 4I84A 2QX3A 2VBKA 2BSPA 2IQ7A 4MR0A 2UVEA 2X6XA 2PECA 4XLHA 1O8DA 4YEJA 1O8HA 1OFMA 2X85A 4XOPA 1O8LA 1OGOX 4YZXA 3JURA 3VSUA 2X6WA 1BN8A 1RU4A 4YZAA 4Z06A 2VJIA 1KCDA 4OJOA 1XG2A 1O8JA 2NTBA 2O1DA 2X3HA 4YELA 2UVFA 3GQ7A 4OJPA 4YZQA 3VMWA 1O8EA 4XONA 2O04A 4XN0A 4W8QA 1NHCA 3B8YA 1QCXA 4Z03A 4OJLA 5C1CA 2NZMA 1K5CA 4XLAA 1OGMX 4XLFA 4XR6A 4XMYA 1OOCA 1KTWA 3LMWA 4XORA 2EWEA 4XKVA 1IA5A 4XOTA 2NTPA 2QXZA 4XM3A 2VBEA 3B4NA 3B90A 2NT6A 4OJ5A 5C1EA 2O0VA 4XLCA 2PYGA 2INVA 2O17A 4XLEA 3SUCA 1PE9A 2O0WA 3GQAA 3UW0A 2X6YA 1X0CA 1O8FA 4U49A 3T9GA 3ZPPA 1DBGA 1GQ8A 1O8MA 1O8KA 2NSPA 4W8RA 2QY1A 3KRGA 2NTQA 4MXNA 1QJVA 2VJJA 1EE6A 1O8IA 1VBLA 1CZFA 4AVZA 4OJ6A 1BHEA 4OZYA 4XKWA 3VMVA 4NK6A 3FY3A 1H80A 5AMVA 4XQFA 1PXZA 4HWVA 4W8TA 4XN3A 3VSVA 2NT9A 3GQ9A 3ZSCA 3WWGA 1OFLA 1O88A 2Z8GA 3VSTA 3GQ8A 1IB4A 2PYHA 4OZZA 3EQOA 4U4BA 1IDKA 1O8GA 1DBOA 3GRHA 4URRA 3EQNA 1IDJA 4Z05A 1AIRA 1JTAA 2VBMA 2ODLA 1RWRA 2INUA 4PMHA 2NSTA 4C2LA 4W8SA 1HG8A 1WMRA 4YZ0A 1KCCA
chains in the Genus database with same CATH superfamily
2C2WA 2XAHA 4OPOA 5EEAA 4NDLA 3ASNH 4Y33A 3TQNA 2DFIA 1S72I 1CNEA 3LSRA 4U7DA 5DS0A 1P4XA 2WY7Q 5DEQA 3I4NJ 1O3RA 4L9VA 4YIFA 3N90A 2DK5A 2IQ7A 1ZHFA 2CH0A 4N9HA 2Y75A 2D1HA 2PN6A 4UHTA 5IY5H 1FNNA 1QUEA 1TP4A 3QE2A 1OFMA 4LITA 2FF4A 1GV5A 4IJAA 3G71B 1LLZA 3MKYB 3KZYA 4KJZA 2E2HJ 1T56A 3FM3A 3MD2A 2F43A 3DU6A 2QDXA 4UUTA 1MBGA 4EM1A 2XROA 3IAM2 5K5OA 2HMAA 4UB6C 3CCSI 1MMNA 3GWZA 1HKQA 5D6EA 1W5SA 1HC8A 3OAAA 4LOCA 5HS8A 1J0RA 5HLIA 3A3GA 1BX1A 3BCDA 4OOSA 2DJNA 1OGMX 1VQOI 1R6RA 2W25A 2XGDA 4FK8A 2DA4A 3F0CA 1RQRA 2JTVA 2UWMA 2GJPA 3N4MA 3FDYA 2K9MA 2Y2ZA 5JLWA 2VPLA 2QBYB 3GTPJ 1H85A 2LRDA 1MBFA 3NAUA 4GGGA 3ZMTA 1BA5A 1JA0A 3E1YE 2NPFA 4ACBA 3K6GA 4OAZA 4ZV4A 3T8TA 2RREA 3ZCOA 1YITB 3GTLJ 1H9TA 2VXDA 3ZMDA 3A35A 1VQMI 2LREA 1D1BA 1MNDA 2OQGA 2ZXHA 4Q47A 1XPXA 3RTRA 2HXOA 1VQPB 4F93B 1V0EA 4M4SA 2L4AA 4U49A 1QGZA 1Q9SA 1OCOH 2GA1A 1ETWA 4B3AA 4LB6B 5BSYA 4KIGA 2QN6A 1RKTA 1KZLA 2EK5A 4AC9A 1UD8A 2O6GE 1KK1A 2EIMH 2XKOA 4UVBA 2EFGA 1UD2A 1WU8A 4WXHA 1EP1B 2KLOA 1KGSA 2QQAA 3A0BC 4E7HA 3RZOJ 4OPWA 2HQAA 1FJLA 1M1EB 1H8EA 3L9FA 3GIRA 2PLFA 2OTLI 4AIHA 3BPXA 1K9MD 3SZPA 3IH2A 2C4TA 1X3ZB 2V7VA 2ZXJA 1X2NA 3GZ6A 4W8TA 1LEBA 3CJNA 1MSFC 3HRUA 1IO2A 1MBJA 3CQZJ 3V7CA 1V5FA 3WBJA 3ZSCA 4CXFA 2GZWA 4JQFA 1L1IA 3B6CA 4AIDA 4OZZA 3SFIA 1MRZA 1R23A 4M6XA 4RS8A 4U4BA 3JQQA 3RZDJ 1J09A 3P7NA 2HDDA 5H5JA 1JJ6C 2ZTNA 3TEDA 2CO5A 5DCMB 3BTCA 3OYGA 5FLVA 4IRGA 1QNTA 2VB6A 2EFOA 2ZXWH 3ZOBA 1IJWC 4YEIA 2ODLA 4ESBA 4RLQA 4IXAA 3GVLA 4AYBA 4IF4A 3M1EA 3PSSA 4KA4A 1IN5A 1TWCJ 1WJEA 2BW3A 2DOAA 3E6CC 2QKLB 4BL0B 1BC8C 1O4XA 5DD4A 1IAWA 3HRSA 1X3UA 2RNGA 2CS3A 2ZL6A 2B0LA 4D0PA 2CRVA 3K1NA 4FT8A 1H9GA 3VDXA 1Z7LA 1ENHA 4I84A 2UXNA 1DUXC 1R5GA 3K2ZA 2YUSA 3RY8A 2F48A 3IH3A 3A4CA 3DTKA 2IAIA 3FXOA 5K1YA 2JQ7A 2PBIA 3K1MA 2NNYA 4D1QA 1BLIA 3S3OA 5CVJA 1O8HA 1MDMA 2DTZA 5JLVC 1DP7P 1O8LA 3KCCA 1WQ2A 3K70C 2RVCA 3QOPA 4YZXA 3J80K 3SZEA 2FOWA 2DA6A 4P22A 2B0RA 1K78B 2PE3A 5J3LA 1UFMA 2EIXA 1ZG5A 2QWWA 2EIJH 3KZIC 2EV6A 3PJRA 1O8JA 2UVFA 2KHMA 4KUMA 4OJPA 1O7LA 2DYSH 3P9CA 2HXIA 1LJ9A 3E5QA 3TW6A 2XPVA 4A5NA 1GXPA 1W0JA 1N0VC 2WY8Q 4G6QA 3HZJA 5ILUA 4HF1A 1VQ5B 2VQCA 3FIWA 2CQNA 3Q5FA 1D5VA 3WTUC 3E97A 3OL4A 3FXMA 2M3AA 2OYNA 3OEEA 4BE2A 4Y7NJ 1WSVA 2PQ8A 3T1BA 3OOCA 3SQVA 1OQYA 3CCMI 2CMPA 2IA2A 2W57A 2FBHA 3PQJA 1TNTA 3DU1X 2XAUA 1R5HA 2ZNYA 2IGNA 3D5LA 2DMNA 3G1LA 1VQ8I 5K7FA 4LIVA 4WX9A 1XMXA 3ISXA 1JE8A 4EJUA 2PEXA 4RPDA 2F4NA 2G0YA 3UW0A 2JN6A 1ETQA 2QZAA 4HV6A 3S1RJ 4XLNF 2O3FA 4Y52J 4Z4SA 2MW8A 3O2PE 1SVMA 2ZFUA 3KL9A 2EA4A 2K85A 3CCYA 2ZMEA 1OMIA 2L54A 1GQ8A 4A3LJ 4PDKA 2BY0A 4GDFA 1G8XA 2CW5A 3O3KA 4FWTA 3GFLA 3BWGA 3SEJA 3H94A 1EE6A 4MLOA 1Y39A 2K5CA 4CCNA 2NVTJ 2HS5A 2OBSA 4M53A 3SYTA 4AVZA 1NH3A 3RPUD 3BZCA 4WZKA 3D1NI 4Z4VA 1I18A 3AVUA 4IHXA 1IJEA 1KU2A 1WXRA 1E3XA 2M2EA 1TC3C 1EXMA 2VQHA 1SD6A 2VJ4A 1QQIA 1RIOH 4Y4RA 2P0WA 3V42A 3AGPA 1S72B 2ME0A 3P4GA 2R5YA 1TT5B 2M30A 1SD7A 2M9HA 4Z4UA 1QZZA 2EFQA 3D5SC 4DJAA 3I56I 5LFAA 3L2CA 1I6HJ 1YHQI 4A3BJ 1VF7A 4G7XA 4AD9A 3GX4X 4Q7JB 1QU3A 1YJ9B 5F0HA 3BY1A 2DA3A 1MD0A 4M3FA 1EP3B 1QVGB 4XK4A 1S7OA 1OLTA 3ZQ7A 1QPIA 1KK3A 1WKMA 4BQNA 2DA7A 2M1BA 1YJWB 2HZTA 1XGSA 2JMWA 3BR2A 4G7ZF 2CK3A 3VYUB 2P5LC 3S1MJ 5DUIA 1OHHA 5CVRA 2HU9A 1HW5A 2VOPA 4LLLA 3OYLA 4J0QA 2Y31A 3CCSB 3MWMA 2OBTA 4C30A 3GLXA 1JHHA 1VHEA 4DNCA 1B2RA 5FL7A 5HS7A 3BG6A 3I64A 2VJ5A 5JFRA 3CLOA 3JRHA 1MH3A 3C2HA 4AIJA 1VQOB 1N8RD 4ZTFA 3CB4A 4RB3C 2XGCA 4A3DJ 2E1RA 4CUGA 5DNSA 4OPVA 1Y0RA 2XRLA 5K5RA 1YJNB 1FNDA 3L2UA 2W48A 4BJTA 4BEHB 2WJVA 3K9TA 1S7AA 5LGNA 5THXA 2RDPA 2JWTA 1MH4A 2X85A 4XOPA 3V7RA 5FKLA 2FOKA 1LDJA 1RZ4A 1XCBA 4B8XA 1XS9A 1QG0A 2UXXA 2VYQA 4YAOA 1VQMB 2XZLA 3AK5A 2BN4A 3R6JA 2IXSA 3LSMA 1OB2A 4Y3OA 3DKXA 4OJOA 4L5JA 4RAGA 3FX3A 5K5QA 2M45A 2Q6LA 4CCKA 1WPCA 5TR9A 4GYGA 1IN7A 4XONA 5EEGA 1COWA 4LC0A 3WYAA 3IV5A 3ZRGA 1BI2A 1LFUP 1O3QA 3CDHA 1QCXA 4GQNA 2GJRA 3W5HA 2VC0A 1T5EA 5IP9J 1WP6A 3FKSA 5DM6F 2W6IA 1O3SA 2E5NA 2GA2A 4KISA 1T6ZA 1SMTA 1FX7A 5D6FA 3VNUA 2EWEA 3M3YJ 1JHFA 2RV8A 3ZGKA 3FPKA 2NYXA 2YUHA 2OTLB 1K73D 1UHWA 3WHCA 3CC7I 3E1SA 4KITB 3S3MA 4X06A 2OPTA 1KD1D 2HKOA 1U3EM 1UAAA 2F5CA 5AONA 1B72B 5FNZA 4ZZLA 3RPQA 2R9VA 4BBSJ 5F4OA 2GREA 4I01A 5LEKA 1TWFJ 2NV4A 2OUMA 5HDKA 3H3UA 1B1BA 3Q9SA 3HEFA 3WY9A 1YLFA 4L9JA 5LGUA 4CCJA 2CQ7A 1MMAA 4W8RA 3F21A 2DIEA 4OP7A 4H9GA 2BVLA 2BY1A 5LGTA 4IHSA 1LDKB 2V7UA 1R5BA 2L9NA 3KYDB 2VKHA 2STWA 1D8JA 1UHSA 1JA1A 2HYJA 3BQJA 1T6SA 2R5ZA 2MH9A 3W2FA 4L9TA 2XAJA 3Q0WA 2C6YA 2FX3A 1ZELA 4O5VA 3VSKA 4XRFA 2FXAA 1GUUA 3E20A 2JDIA 2M7AA 4CA0A 4U0WA 4ESJA 2Y48A 2MYSA 2VUMJ 3OV8A 2EIKH 3C1DA 1S6LA 5BMZA 1HZEA 2LFBA 2BM5A 1QA2A 1HBXG 1RRJA 2CFXA 2M4KA 2NVXJ 3E7LA 1GDTA 1K4TA 3F23A 3FBIB 1RC9A 2H6BA 5HOOA 2L3DA 3O8HA 3HJEA 4MFDA 4QLCU 1TNSA 2KZVA 3OZWA 3LSJA 3CUQA 3HTUA 4BQOA 2BV6A 2IEKA 3EQNA 3CCRI 1R4NB 2IT0A 1Z91A 3CRZA 1JTAA 2RAEA 2IJLA 4RM3A 2W84A 3W2AA 3KPHA 4PGHA 2VFQA 4DBRA 3JSPA 2RGVA 2ECBA 2QVOA 5F04A 2R7RA 4OMZA 3H36A 1DGWY 2M5WA 1SKYB 3MKLA 3HAGA 2V9PA 1N78A 3CPWB 2XDVA 4G6TB 2ZTGA 5KW9A 4RLFA 1IGNA 2JN9A 1H8HA 3HM5A 4TT3A 2KISA 3LA2A 1QHGA 2LTPA 3A8IA 2B7EA 1XFOA 3H9JA 5IYWA 5CQGA 3CCMB 3S8PA 4M0LA 1QGYA 2X3UA 1IHMA 4A2UA 2DYIA 4ACAA 1D1NA 2VNKA 2Y9ZA 1LNWA 3W5VA 1MMDA 2P6SA 2F4MB 1XMKA 3H5AA 4BJ5C 3L2WA 1YI2I 2K3PA 1K61A 1GHCA 1W7PA 4UV8A 2WWYA 3ULQB 4XRSA 1E43A 4HX4A 4RAFA 4QSHA 1MNEA 3VMFA 3WXMA 2QTZA 3U6KA 1O8EA 4Y13A 2XPWA 2O04A 2NS8A 4B4CA 3PL8A 4TN1A 1Q81D 1I5ZA 2WC2A 5M5XJ 5FLMJ 3W5UA 2EQRA 2HQNA 2COBA 2XV4S 2ZZQA 5HDNA 3IWFA 1IJFA 2JIZA 1PJRA 3LWFA 2A3SA 3QPSA 4M73A 4G7OF 4Y17A 2XAFA 3OYDA 4NNJA 4D5FA 1OFCX 3PSFA 4HQMA 1EFCA 3JREA 1IA5A 4KT6A 2A07F 3HRTA 2LZJA 1X3WB 1E1RA 1YTYA 2OBRA 3ZZUA 3GYHX 2O0VA 4JRAC 4A3JJ 5B1AH 1X4PA 2INVA 3R0JA 1ZUNB 3OL3A 1QGPA 1ZGJA 3TMOA 2JA6J 1AHDP 5DSZA 3LO8A 3G6EI 3WNBA 3I56B 2DMUA 4BHPA 1YHQB 4L5EA 2GXGA 4LIUA 3K4CA 1X1DA 5F64A 1L0OC 1DBGA 1OPCA 4BY1J 2V7WA 3MMPA 2LY9A 3WG9A 2A69F 4LLGF 3S2HJ 2VBYA 3RKWA 2FA5A 3FKJA 4NC8A 3H92A 3LAPA 4RLZA 1IXCA 2YSRA 2E1NA 1HCRA 2ID6A 2XGEA 1T6XA 3FHNA 3COAC 4M6VA 2BM4A 2D45A 1AWCA 5F6FA 1JTXA 5CVUA 1HA3A 2P8TA 3LQQA 5LBQA 5IYCJ 5E3MA 1Y1VJ 4QPQA 4RDLA 5FKMA 2K86A 5E1WA 4IKFA 3IHUA 5DV5A 4XQFA 2L9SA 3U21A 3TH0A 2WAQA 2K27A 4HNUA 3K4KA 2WPDA 1CF7B 4Y9RA 1A04A 1P4AA 2J7KA 5CPRB 2R3SA 1EFUA 1WDTA 1UD5A 1ZARA 2HYFA 3CLQA 4A6EA 1DARA 4J19A 4LBVA 3O6BB 1HQCA 1W9XA 1DBOA 4OINF 3CDLA 3EDPA 4ZTJA 3A01B 2V31A 2BY3A 3GFMA 5ERIA 3OYKA 1SFEA 5TRDA 4A3MJ 1P4MA 5C3EJ 2B9SA 3Q38A 3QYFA 2QENA 5D8KB 4XICA 1QO0D 4HNVA 1TW2A 4EATA 4OIPF 2IS4A 1E3OC 3HOVJ 2OC6A 4YZ0A 2CW7A 2GAUA 3DF8A 3F8MA 3FXKA 2Q2EA 4HG2A 4ESFA 4E7ZA 4EGZA 2E1CA 1W87A 4FQGA 1PP8F 2DT5A 3DTIA 2HOAA 4W97A 5L3FA 1XB4A 5FD5A 3R61A 3KETA 5DYMA 2HOTA 1EFTA 2X0KA 4R1HA 4X7CA 2K4JA 3KE2A 1KQ9A 1WJDA 2GOMA 4B3XA 5ILSA 4MR0A 3HPGA 2X6XA 3KYCB 4PSWA 5FKOA 1PUFB 2ISZA 2UVEA 3I54A 1IRXA 5M3MJ 5HS9A 1R1VA 1UJ8A 2XGXA 3CC7B 5LHGA 2PMZN 2IA1A 4F3QA 3DWLE 2NOJB 2DMTA 2ZBKA 4HA8A 2QCOA 3R4KA 2JPCA 3AGQA 5B6IA 4ZCLA 2X6WA 1PP7U 4CO8A 2V6CA 1NTCA 1B8IB 3AVWA 2DT6A 3J81K 2KRFA 2IA0A 1KQ0A 3LFKA 3JRFA 1I1GA 4Z4YA 1WVRA 5K7HA 3DBRB 2LC2A 4MGRA 4LG0A 3T0YA 3Q39A 1W1WE 2MFZA 5J8CA 1VFCA 1ZREA 1QRCA 2YWEA 4O3MA 2WV0A 2A5WA 2ZZEA 4UUSB 2V1DA 5JR3A 1QHHD 5IYDJ 2DPDA 1BN5A 3S32A 1N75A 2Z33A 4HW0A 4W1UA 1PVEA 3GUDA 3S17J 3RJPA 3GCMA 2VBEA 1ZG1A 2L7ZA 3S1NJ 2ZZGA 1S4MA 1DU0A 5BNGA 3GSIA 3HC7A 3EPZA 4RMNA 4IW3B 1OYWA 2ESHA 1F36A 3HL2A 2QYUA 3SUCA 1QQ1A 2HI3A 4X1EA 3I59A 4BU2A 2X53S 1T33A 4QUZA 2QYOA 1NDHA 4TKOB 1D1AA 2H6CA 3ECOA 4BH9A 1D1CA 1U9NA 1RNLA 2CQKA 4YIIA 4CYCA 2NRAC 3I1FA 4DQKA 2BOLA 2R4GA 2Y9YA 1X1BA 5KNLA 1QUFA 1ETXA 1Z67A 2VJJA 2GOXB 3I3LA 1FOXA 2CYYA 3PA2A 3F8NA 3T8RA 5FB2A 1YIJI 3LA7A 3P26A 2V9VA 4OIRF 5F08A 3SJMA 1JTYA 2Y30A 4N0BA 2ME6A 1N05A 5C4JJ 2F5VA 4J01A 2H1LA 2HDCA 1EZGA 4HWVA 1U5TA 3BR1A 3OYNA 1B72A 4U88A 3VSVA 2UUZA 3AG3H 3VOEA 1BOBA 3LNNA 4MYTA 3OYHA 1WJ5A 2BM6A 1O88A 5D5VB 1MJBA 3ERMA 3KX2A 3TDUC 2VONA 2NS7A 4YFXF 3U1KA 4E7LA 1SANA 2IS2A 1G6NA 4CICA 3GXOA 2HDNB 1Y0YA 3GRHA 2H09A 2DMQA 5KVRA 2QUFA 4F91B 1VLOA 1IN8A 4C3JJ 2EA2A 3QFCA 4KMFA 4KIFA 3MKWB 1XC5A 2COMA 3M8JA 5IYQA 1LVKA 4ZGNB 4P1VA 1E64A 5KCMA 5DS9A 4RM0A 3OR2C 1F4KA 4TSFA 1ACIA 3HBLA 3HTSB 1HSJA 4Z2YA 3DBHB 4C2TA 2Z5UA 3BJAA 4M9ZA 3P27A 2GIZA 1YFHA 1ETKA 1BIAA 2OA4A 1VZ0A 4S0HB 1DP3A 1EFRA 2C5BA 2DETA 2QX3A 5GPAA 3QOEA 1LFBA 2O8XA 4WF2A 2ZFWA 5H2FC 1JKOC 3WBKA 4XLHA 4MIMA 4YRVA 1ZLKA 2BVMA 3QQAA 1WJFA 3ONQA 3L1PA 3VSUA 3Q6QA 4YZAA 2R7FA 1YRNB 1KCDA 4RA2A 3G6EB 2Z3YA 4LFUA 1K6OA 2ICWG 2YU9J 1BOAA 1JI8A 1XDSA 2JUCA 2VT3A 3K4JA 5L3GA 4RD4A 5ICGA 4RB0A 1WFXA 1EH7A 2DTRA 5IK2A 4XLAA 3LSKA 3WQZA 3ZN1A 2C78A 3R60A 4XLFA 3SDGA 1OJLA 1QRYA 3CJQB 4BHCA 4XR6A 2AQEA 5HLHA 2GQQA 4ETSA 1R00A 2DDAA 5HKKA 1G3TA 3V7AA 2XTWA 1P4WA 3H1CA 2Y69H 3U1DA 2JK3A 2VKEA 4TMXA 2F5EA 1EH8A 3GZNB 4JX5A 4XM3A 1EF4A 2QXZA 1KYWA 2Z9OA 4HYEA 2W7ZA 3B90A 2V1XA 1VJSA 2E2IJ 2IGKA 3P5JA 4M71A 3ZR8X 4MEXF 4NQWB 3ABKH 4FHTA 3MKZA 3BCAA 3QPTA 3CD6I 3PIPF 2DBBA 4HE6A 3I55I 1VTNC 3OMYA 1ZK8A 1XE1A 3ASSA 4ZCMA 3ML3A 4BS9A 2OTJI 2WSSA 3HSFA 1ZM4A 5F27A 3OYAA 2VLAA 2DT7B 3VO1A 3BC9A 4CGZA 5HODA 2LBFA 1O8MA 1WJAA 3BOQA 2X1EA 3V8LA 4ZYGA 3NWSA 1EKEA 2D1VA 4RAYA 3FHZA 1WRJA 3JAMK 2JVHA 2RC4A 4B44A 4RB1A 3HSEA 4BAYA 2BGJA 4IRIA 1ZLJA 1FIAA 3BR6A 4DQLA 2FE3A 3FK7A 3HUGA 4V2FA 4WWVA 4PC7A 3M9AA 1IRZA 3U6BA 3TKYA 3N6ZA 5F0CA 2D3NA 3OWTA 4JX6A 4P9UA 3VR6A 3ZQLA 3K10A 4LG3A 4B43A 1FRQA 1G7CA 5FKKA 2OK7A 2FMLA 1TWAJ 3GQ8A 3TGNA 1FX0A 2FQ4A 4YG2F 1ZRDA 2YS9A 5EZGA 1A6IA 1RESA 3F72A 2X4HA 2DOFA 2OZ6A 4ZYEA 1FOWA 5L3CA 3J80Z 4M9XA 3CCQI 1KONA 3PUBA 4GRIA 2E1OA 5E1XA 3SYJA 5HLTA 4U0YA 1ZM9A 2L9VA 1V54H 1VQ9I 1NB0A 4OM9A 3LNQA 1N08A 5DUKA 5CVVA 4XSXF 4OIQF 5FLXK 3NQOA 1IN6A 2LR8A 1N07A 3A1PA 3PNVA 2AHOA 1TWHJ 5J1YA 2CV2A 4BDZA 3FPPA 1P9QC 4AYBN 1R9TJ 4KH3A 1KA8A 3NWTA 4JX4A 3V8KA 2F2EA 2A05A 2CJJA 3HOZJ 4ZDLA 5J1UA 3WTZA 2MC3A 4A12A 4DK0A 3L09A 1ETVA 1R4MB 5H20A 4WZLA 1XGOA 3E6MA 2JJ2A 2RC6A 1VQLI 5J4VA 2DN0A 5CYVA 1TW3A 2LSOA 3J7ZI 4S04A 2XT4A 1X19A 1JUPA 3FXQA 3RKXA 1OR7C 3MZHA 4RDUA 3AVTA 2B5OA 3PA1A 2DOGA 3PM1A 1ZAOA 1A35A 1QGAA 1UD6A 4XD7A 4IO9F 3ZIAA 1MBHA 1RU4A 1RQPA 3WTSC 1RKWA 4P1WA 1FZPB 1J59A 1XG2A 3I53A 1YS6A 2V7FA 3SZTA 2JA8J 4L18B 3SLDA 3HOYJ 1DABA 2LH9A 2NOGA 4DNRB 4LJZF 5C1CA 1MABA 3CMMA 3ZMZA 3DQVC 3WGGA 3PVDA 4LK0F 3ZC3A 4ROXA 5E79C 2E34A 1IDZA 1HW2A 3GFIA 1HKSA 5H59A 1F60A 4AC0A 3W2VA 2K3FA 2HTJA 3HB9A 1ZKGA 1S7EA 3ML6A 1G4DA 2HVSA 2IRFG 2Y0MA 5CJ9A 4MNUA 4PK4A 2IPQX 3FF5A 2E2JJ 3RPUA 5IT9K 1GV2A 5H6RA 1X0CA 3JTGA 3E6DA 3HOTA 3FMSA 3Q9VA 2P3MA 4M9SA 4X0GA 3HOUJ 4LB5A 3T9GA 3C2GA 2EBIA 4QVAA 1LUJB 3JR9A 1R1TA 1T6YA 3HKZN 4MQVA 3ZQGA 4DW6A 3BLYA 1RR7A 3WG7H 2NTQA 2W00A 1QJVA 1UG2A 1VBLA 2FBKA 2HWVA 2GXBA 4GYIA 3VYSB 5BPDA 4U9UA 1GAQA 3CJTB 3WHBA 4RDJA 4TMTA 1IRGA 4QIWN 1JKQC 1WGXA 2Y0SA 1SFUA 1GJRA 4E0FA 3I0TA 3HKZA 3KP4A 4C3HJ 3WNCA 1KQ5A 4D9JA 3VFZA 1X1AA 3QPLA 3O8GA 2V7QA 2WADA 2R7OA 3M8EA 4ZGQB 2RN7A 1T98A 1IDKA 2LNBA 2GK6A 4AWXB 4IX7A 1B9NA 2VL8A 3HSRA 4YAWA 1S3JA 2KJBA 5JHFA 3S15J 3PUNA 5ICCA 1A8PA 2N8GA 5B1BH 4DYCA 2HZDA 3ASOH 1WH7A 9ANTA 5E8GA 3BT9A 1YW8A 1FP1D 3PFYA 4JBAA 2H27A 1XG1A 1WH5A 3ECHA 4C43A 4OJ6A 1P7JA 4PCQA 4QTRA 2A61A 5L46A 5EF6A 3BP8A 3BC8A 2VE9A 1U78A 3FXUA 2V4DA 2J5PA 2VBKA 3BH7B 3DDYA 2VFNA 1J9IA 4ANJA 1Y56A 1KQ8A 2F1LA 1R5OA 3AG1H 1FNBA 1K28D 3BR0A 2PJRB 2V1UA 5FFZA 4YEJA 1QBJA 4KDPA 4IQJA 3PSZA 1IRFA 3EUHC 2KKOA 2EFWA 1X2MA 2CUFA 3M4OJ 2XAQA 1LE8B 3W2EA 2L2OA 2M4GA 4Z06A 2VJIA 5AIPA 1Z7UA 3CJRB 4A69C 5FRMA 2MBFA 1ZRCA 3CP8A 3RCOA 2K9QA 4A3FJ 4C3IJ 1DQUA 3DXJF 3RYPA 3OS0A 2K7LA 1H8AC 2XB5A 4FE7A 2JA7J 4Z03A 2NZMA 1X58A 2AHQA 1BPLA 1XX5A 2W24A 3BY2A 2X6OA 1BM9A 2F1MA 4QHYA 1FLIA 1TQMA 3ERED 3LMWA 1IV8A 4TMVA 3I4MJ 3A3BA 2X1DA 2BGCA 3I4PA 1OCCH 2WB1N 1ZGAA 2M34A 3MHPA 2PFBA 2NTPA 3G3ZA 4HX7A 1WOPA 2LY2A 2VI6A 3R0AA 3DTEA 4HIZA 5E1ZB 3BDDA 2TRTA 3WGHA 3WE2A 2IVMA 1I8DA 3G1OA 1V5GA 1YW7A 3H9QA 1EJ9A 4A0YA 4R79A 2HYGD 2L5QA 3Q3SA 4PFPA 1TQPA 3FXLA 5A8AA 1OCPA 2KP6A 2GM4A 1OISA 2WB1A 5J35A 3CCQB 2YWFA 4PJJA 5LHHA 3H9GA 3FM5A 3HG9A 5CLSA 3LAJA 3ROUA 1EWYA 1AMOA 3SJPA 1U6GA 4EJTA 5FO0A 2KRHA 1T2KA 2ZBVA 1VQ9B 1ZQ3P 2ESNA 2WA0A 3ASPA 3A8JA 1I7PA 1QFJA 1SMYF 5IYBJ 3WTTC 3VMVA 2I8DA 5D5WB 1QX4A 2VZLA 5AMVA 3OJWA 5EGOB 5JMCB 1KU7A 2E1BA 3LVBA 2X9DA 3NRVA 4V2GA 3C3WA 2CNDA 1R5ID 2VN2A 4B09A 1J75A 5FO1A 2XEXA 1HA8A 2IW5A 2ZO4A 2ZSHB 4F52A 3S14J 4XKBA 1FWZA 1DPRA 4ENMA 4B4DA 1FBSA 2LG4A 1IDJA 2R7ZJ 3TP3A 3BR5A 1UMQA 1V5VA 2Z1DA 2WV1A 3FKIJ 2QBYA 3T51B 1WI9A 3WE3A 1RWRA 3BCBA 3OSGA 1WJBA 4IZZA 1AKHB 1NG7A 2VE8A 2QF7A 4D7NA 2E36A 4ON0A 6PAXA 2HOSA 4P12A 2PMDA 4RCYA 4BPRA 1LDDA 2QSFX 1HG8A 3GZ5A 3ZQQA 1BIBA 1ETOA 3BG7A 4MQ9F 1J5YA 1JKPC 3ZQFA 2HEOA 4XNFA 5EG0B 3MCAA 2I10A 3ZBTA 4ITVA 4UZFA 4II2A 4UY8I 1XDUA 3R6KA 3Q0VA 1OFDA 4Z4ZA 1QA1A 2JSPA 5GTHC 4I7HA 1B9MA 1IB0A 2VBTA 4KKTA 5IYRA 1OGJA 1APLC 3JQPA 1Z3XA 2DK8A 1JKRC 1FBUA 2VFMA 2L0KA 4IHTA 3ZUGA 2LKPA 3ZMVA 1IV6A 3V4GA 3F8CA 3RIQA 3ASTA 3TOBA 2B7BA 4XIDA 4ZYHA 4F7DA 2XZOA 5D8LB 5FJ8J 3ZN0A 5LLQA 1W0UA 1XGNA 4YZQA 3GO5A 2Q0OA 3GMEA 3HOWJ 2M0CA 3VO2A 4IPAA 3EETA 4MTEA 1EA3A 5IT3A 2XSDC 4HLYA 1Q86D 1K5CA 5EZHA 3BTJA 1D5YA 1BX0A 1T8IA 4NBSA 5GAGJ 3HOXJ 1FBQA 3FK6A 3OYJA 1T0FC 3BG5A 4BXFA 1TWGJ 1VQ8B 2BHZA 5DCMA 3K7AJ 1T08B 2K9SA 5L3EA 5A89A 4DZPA 3OYCA 1PJ6A 2NT6A 3CP2A 1FYMA 4AF7A 4OJ5A 1ON2A 3BY6A 1O3TA 2BM7A 4IOCF 4R71A 5FIUA 3NE5B 4HNTA 3CMEI 4PC2A 1Q1VA 1KZHA 5GP9A 3TP0A 1VQNI 2R7UA 2FVGA 2CV0A 4X6AJ 5HVQC 4YFOA 2NVQJ 2XZPA 1EP2B 2FQ3A 3M8FA 1GLNA 3OYMA 1BW5A 3GVKA 2ELHA 3E0JB 3OYEA 5KAFC 4M74A 1TYWA 1G7RA 2NSPA 4K1XA 1I50J 4ZJZA 2I5UA 2CSOA 1HW1A 2GJKA 3DEEA 2GQFA 1O8IA 4HZFA 3QYBA 2G9WA 4AIKA 4AU7A 3GLLA 3LSHA 4GO1A 4HEA2 2XKPA 5DM7F 4IHYA 4WWCA 1TTYA 4E70A 3JSOA 1LFPA 2XIGA 1BHEA 1EV7A 4M3DA 3T53B 3HHGA 4OOVA 3IRQA 4NK6A 3H9NA 3FY3A 1E3PA 1UG0A 3L2QA 4XLPF 5H6QA 1F1ZA 1K7AA 1DPUA 5CKTA 3RDIA 2YWGA 3GTJJ 1K6YA 1K78A 5ED4A 2LK2A 4EQQA 5E8IA 1FY7A 1H0MA 3ELKA 3H0GJ 4K2EA 4RPBA 1ON1A 4G7HF 2Z8GA 4Q4ZF 1A31A 4HV5A 3MZYA 2D74A 2FMYA 3KEOA 1W4MA 2WAQN 2ZC2A 5EJCA 3CCEI 1IW7F 4BYYA 3ABMH 3LSPA 1GVDA 1XB2A 4CCLA 1GXQA 4MFEA 5E18F 5B66C 1RI7A 2H8WA 1FYLA 2PJPA 4Z05A 3TW7A 1P6RA 3K2AA 3MZ8A 3H0DA 4E7KA 5F4MA 4CQJA 3FISA 3GVAA 4NB5A 1E63A 3ZXSA 3VEPA 1PJ5A 5BSXA 4BKXA 5BOXA 3LSGA 3AVYA 3GQBA 3DP7A 3U9GA 3IKVA 4G7WA 3PETA 4I02A 4RGUA 2C4UA 2XRNA 2LD5A 2M5SA 1EH6A 4FASD 1VF9A 4IHWA 2V1NA 3OFNA 5J8FA 4ABZA 3AL0C 4C2UA 3F6VA 1HOMA 2CBXA 4FETA 1KC8D 2DQRA 2W6JA 1XSVA 1U9OA 1U2WA 2HKXA 2ECCA 1W7PD 4IEJA 4UUVA 1VI0A 4AUXA 2HQRA 2Z99A 3QU3A 1SFOJ 1S0UA 2HVQA 3CCLI 4YDTA 1USSA 1JUSA 1JJ8C 3QRFF 1UELB 4WZTA 2CUJA 1VQ6I 2EILH 3GW2A 4DIQA 1R58A 2P81A 3KP2A 3P9KA 2NTBA 4KN7X 1FIPA 4P3YA 5J47A 5AN9A 1RUOA 3G2BA 2XVCA 3K69A 1VQ4I 3DFGA 1FT9A 2EZIA 3J7YJ 2CQXA 3ES9A 3AVVA 3DKWA 5GAHJ 1VQ7I 3SXYA 1Z3YA 3BG3A 3DEWA 5DDGA 1YQAA 4XSZF 1AA7A 5IOZA 2ZNZA 4Z4RA 2ZXIA 4KICA 1OOCA 2UV1A 5JHUA 3AFHA 3OZUA 1TSPA 4Z4WA 2X0LA 1B4AA 4XKVA 3DPLC 2E35A 1PDNC 2BW3B 5JI6A 2OU2A 2D3LA 4RBOA 1V4RA 2L02A 2MA3A 1ODDA 5E3NA 3GVJA 3RSNA 1F43A 5L3DA 4A0XA 3QYEA 3FMQA 3QFSA 3U2QA 2M8GX 1A5JA 1BI0A 2ADUA 2R7QA 4QWQA 4A5MA 3W2HA 4YCQA 3KIOA 2ZITA 3TBIA 1BR1A 3OZVA 4JK1X 2QY1A 3VODA 3M7GA 2WYRA 1MDMB 2VBWA 1LVAA 2RQQA 2WAEA 4S05A 4P2NA 5KK1A 4CDGA 3RKQA 4PC3A 2WZPP 3QP6A 3S93A 1Y1WJ 4EVIA 4V19K 1M1KD 4BEHA 3MCZA 3KP6A 2QQ8A 3H3VK 4OZYA 2XT2A 5BS6A 3GTKJ 4BHBA 2E5ZA 2VASA 2FJ1A 2O0YA 3L00A 4RGRA 3GEZA 4AF6A 4XRSG 1PYVA 3L7WA 1W0KA 2XC1A 4BJ6C 4NHJA 1PJ7A 3JX8A 2BGIA 4CCOA 2MGQA 1M90D 4M1KA 3KP3A 3LSTA 5A2QK 2E7WA 2HNHA 4E4HA 3IC7A 2EZLA 3CCRB 3TO6A 2LF7A 5LD2C 4HBLA 1BMFA 2V5IA 3H09A 2Q6KA 1T95A 1AIRA 1G3WA 3NAWA 4D5CA 5J1RA 3EYIA 5JVGF 1KQSB 1KRHA 2JA5J 2B63J 1QA6A 4M3GA 3SQNA 3REOA 4FN5A 3GTQJ 3CUQC 3BNWA 4DBQA 5HLGA 2V26A 2BV3A 2KVOA 2ZMEB 2DFHA 3W6JB 4CSWA 3BZ6A 4UVCA 1RMGA 2DFEA 3ONUA 4NK8A 4G9YA 1MIJA 4B3FX 4Z1MA 2ZCWA 3ZP5A 1OCTC 4PJLA 4P5OA 4FTHA 1QH0A 2XGJA 5IOYA 2K02A 2KL4A 2FRHA 4N4OB 1KU9A 4PUSA 3DPTA 2PECA 1FTZA 4HDVA 5GADJ 2IOUG 1LEAA 1QVUA 4X7DA 1V0FA 3CW2A 3F3XA 4N9IA 1D2EA 3PUMA 1YI2B 4I09A 2XF6A 2W7NA 2DI3A 3LSIA 3FXJA 4FX0A 3HXLA 2EZKA 4L8JA 3JURA 1E17A 5L3BA 2XHKA 2DYRH 1EA0A 4Q5SF 1DG1G 4HQEA 1VQNB 3WTWC 2PLYA 1MMGA 3VSLA 2R5YB 2O1DA 2X3HA 4G6IA 3VMWA 1UZCA 3SEZA 1IXSB 2W4SA 1W34A 1ETYA 1MJAA 4W8QA 1OKRA 3B8YA 3BROA 1O57A 3K4LA 3OS1A 2HCJB 2HPIA 3N05A 4FISA 4OJLA 4HDUA 3JAMZ 1IG7A 2JSCA 3CC2I 3A8KA 3ZQHA 1TTTA 1SAXA 2HFHA 1GT0C 1OCRH 3B78A 5TISC 3AL0B 3LQ6A 3K4MA 4D7MA 4UZUA 2EZHA 3L2RA 2R7WA 2EWNA 1MSEC 1BW6A 2QMUA 4FXUA 3PSIA 2M87A 3RIRA 2A6HF 4XRMA 3C7JA 3OEHA 3DU5A 2P4WA 4CH7A 3VPRA 3OS2A 1ERDA 1UCRA 1XGMA 3PENA 3FWEA 2O6WA 4DQ2A 2KRCA 4B1RA 4MO7A 2QGGA 4G1VA 1FSEA 1N25A 3FXRA 2DPUA 3CCEB 2HGCA 2XASA 4BUPA 3IKTA 3ZPPA 3QPHA 2DA2A 5E3OA 1YS7A 4X05A 1B6AA 1LKXA 1MBKA 1Y0UA 4EH1A 1MNMC 2O7OA 3IWZA 2IS1A 4GXOA 5FLXZ 3Q3AA 1DU6A 3ASQA 5CQEA 4ENNA 4N3GA 1Z05A 2BSAA 1OGIA 2WAFA 2NVUB 2OCEA 1UD3A 1E3ZA 5JLXA 3W6VA 4BNCA 2CC2A 2NS0A 3V7SA 3LFUA 3SLNA 2GLOA 4A3CJ 5CDFA 4YIRX 4XN3A 2W85A 1HF0A 3CO6C 2QQBA 3OIQA 2ISYA 3EUHA 1JNYA 3KLOA 4EEFG 2DOEA 1NK3P 3TO7A 3MFKA 3EQOA 3JRBA 3OKXA 3JQRA 1TBXA 2Z16A 2BVNA 2V6EA 3CPXA 3CCLB 3A1YA 4BQQA 1YJ9I 1VQ6B 4A3IJ 4YC5A 1YJWI 3AG4H 1WWXA 3LQRA 4II3A 3TDZC 4P96A 1GR1A 1T38A 2O61A 2QSGX 4TMWA 5HDGA 2BEOA 4PSXA 2IGMA 4KNYA 1NK2P 2VBVA 4QV2A 3K0LA 1G59A 4RD1A 4Y7CA 1JJ2B 2E60A 4RD2A 2J8IA 4W8SA 2MLGA 1I27A 1SVLA 2P5VA 1VQ4B 3C18A 2CU7A 2EB7A 3ABLH 2XF7A 2LVSA 1S29A 1W5CC 1OYYA 1WI3A 4I99C 4M3BA 1K4SA 2X8KA 4LBZA 2ZZFA 1VQ7B 1JRGA 3W2IA 1WOSA 5EYRA 1PLUA 1JXSA 1Y8QB 5B5EC 5HNFA 1SM4A 4RDKA 2VQLA 1N77A 3ISPA 3NEUA 5E17F 1FPQA 1YJNI 1KMHA 4P3IA 2WR8A 4B47A 3B73A 3VWBA 1PKVA 3SEQA 1V3FA 1JUMA 3QP5A 5A88A 2L7FP 2R5ZB 2R7SA 2R7DA 2LMDA 3JTHA 5IT9Z 5IYNA 3SFZA 1XCVA 1L3LA 2QLZA 1FYKA 1FOKA 1UD4A 2ELJA 2YX7A 5TV2A 1HVXA 4X0CA 1QFZA 4AM3A 3QSYA 1HSTA 4HPQA 4E7JA 2OAZA 2M8EA 3CUOA 1NRKA 3GTMJ 3QFTA 1WOOA 4NCNA 1FNCA 2QKMB 2MG4A 3UKGA 1WCMJ 3CUQB 1CF7A 4HX8A 2DODA 4OOIA 4NC6A 1RETA 3BH4A 2PX9A 3F22A 1UB9A 2DW4A 3D0SA 2D9RA 3CC4I 4MYUA 2WTEA 4YAFA 3FZVA 2OD5A 2DCEA 4XOTA 4ZDPA 2VKDA 5D4RA 3A01A 2QSHX 1GO2A 2OBPA 3BTIA 1K4ZA 5BPIA 1S9HA 4H0EA 2CGPA 1JT6A 4XLCA 5LRSA 1TLLA 3E5UA 3GBGA 5FFXA 1CNFA 1XSDA 3S16J 4RD6A 2KIQA 4TV7A 1LM1A 1SEUA 2MLKA 1Z77A 5FKNA 3IAS2 1QVFB 1YX2A 2FBIA 2VT2A 5ILVA 3IH4A 2L01A 3V8JA 3WODF 1R49A 2QGUA 3VB2A 4HE5A 1KU3A 1FMVA 1K83J 3BPVA 2MSYA 4WCGA 3LJYA 4X07A 4HAMA 3KRGA 2AXLA 1D0YA 2A6EF 3ESWB 2DA5A 4L0ZB 4IVNA 2ZJQF 2XNCA 2KQRA 4HF2A 1YIJB 5GAEJ 3ZPLA 2IBDA 1PUFA 3BR3A 5TGTA 1P2FA 1W7PB 1BJZA 2BXZA 3A0HC 1OB0A 1TYXA 4HLXA 4NC7A 4MHGA 4B48A 4LBYA 3A02A 1JGSA 2BPOA 2JA2A 2GWRA 3OJXA 2DU9A 3AKZA 1QPMA 4ASNA 2LOOA 1W5TA 3IL2A 1RR8C 3KLNA 3ZQIA 2R7XA 1B8IA 4CZCA 5TJJA 4L5IA 2ZBUA 3VSTA 4N4NB 3M07A 2Y0SN 1E0EA 5LEJA 1W35A 1IXRC 1U5TC 1IC8A 4PGGA 5M5WJ 4RAZA 4UUSA 5JBQA 2DA1A 3OSFA 2DJIA 2G7HA 4RGXA 3J81k 4JP0A 5GTIC 1BI3A 2FX0A 1VQKI 2GBYA 2K9NA 1N0UA 4PMHA 4PC6A 5LHIA 1KK0A 3N97A 1ZYRF 1YIOA 2EJRA 2E7XA 1T0FA 5IP7J 4N3NA 1KCCA 1Z6RA 1Z6TA 2BZTA 1Y8RB 4WZEA 1KK2A 2ACJA 3CC2B 2XNJA 3FBNB 2E71A 3CCUI 2Z2SB 4P26A 2DO7A 3NARA 3WTXC 4I0AA 3BZKA 3A2KA 1T39A 1F20A 2R7TA 4G5GA 3F8BA 3M1CA 3BJOA 3I71A 4A0ZA 1NBMA 3MAJA 2PI0A 1K79A 1O8DA 4U0VA 4A3GJ 3HHHA 4EMSA 4OIOF 1NHAA 1FDRA 1HDDC 2FSWA 2VPRA 2A5YB 3ZPNA 3BQZA 3SY2A 2KIMA 3DCFA 3H5RA 3LMMA 4BXXJ 3OYFA 3ZMUA 1NG6A 2VFPA 4LD5A 4ZYAA 1JT0A 1NHCA 2DDBA 2LLKA 1U0JA 1G2HA 2D2WA 2CRGA 2KFDA 4E6KG 1CLWA 1DDGA 4RGSA 2C5HA 1A36A 2XPUA 4EJOA 1WPKA 4KYWA 3E3VA 2DEUA 2QZ8A 2HTSA 2P7VB 3EUKL 4ZYDA 1MMSA 4QFMA 4EGYA 3HGYA 2BE5F 2X1CA 5DD8A 5FGMA 4J00A 1G7SA 5FRNA 4CYDA 3CD6B 2BY2A 1FP2A 4MTDA 1IDYA 3H35A 3I55B 1BJAA 4PJ0C 4PJMA 2O17A 4B3GA 4V02C 2OTJB 1R7JA 2Q2EB 4Y9UA 3GQAA 2X6YA 1H42A 2JJ1A 2JUGA 2CW0F 3I5UA 4BGDA 3GTGJ 2KZGA 2M0MA 1AOYA 5ICEA 1B23P 1P92A 5FROA 5IP6A 2VQGA 4LLNA 1K8AD 1FMWA 4F7ZA 5JVTA 2XSJC 3SDBA 1P7IA 3KFWX 1DGRM 1Q7YD 4HSTA 1TL8A 4Y15A 1BR2A 3BTLA 4JMQA 1XMAA 4BACA 2H1KA 4BXUA 1TYVA 4L9NA 4LGWA 1REPC 1H80A 3CXCB 4LMYA 2LKSA 4CZZA 4A3EJ 1PXZA 2CFOA 1X1PA 2L7KA 3RKYA 4DOZA 3D26A 2NVYJ 2QTLA 1YRNA 4RJLA 4ASUA 4LG0B 4OU0A 2CF4A 2BXYA 3MEXA 2YPRA 3CMYA 2A68F 2KDOA 3CZ6A 4BQAA 1CQXA 3BH6B 1KJZA 2I1LA 3DBLB 4P9SA 2QEXI 4A3KJ 1IZ1A 1X4OA 3QU6A 3U2RA 5GV7A 1NJID 3G4SI 3OOUA 5HZAA 3CCJI 5FD6A 2LDUA 1WHUA 1QZYA 5KHDA 3MQ0A 3WNDA 1XN7A 1AIPA 3QODA 2NSTA 4IL6C 1SFXA 1J2XA 3SZGA 3I59B 2R7VA 4KFCA 1H88C 1A6QA 4NQWA 1C0WA 4I0BA 4UV9A 2LYCA 3RQ4A 1XQBA 1WMRA 4G8XA 2J5OA 4OWRB 4CYCB 1TUIA 3ZZTA 3CCVI 2XB0X 1XTAA 1Z21A 4NUBA 3SJZA 4P55A 1SD4A 1SC7A 1WTHD 3NB2A 3WTYC 1UMKA 1R22A 3CC4B 2EFPA 5J40A 1VQLB 3OR1C 3IRRA 2WZNA 1SFKA 5E20A 2JPBA 4UB8C 1LLWA 4GFBA 3W6KB 1D8TA 1OGOX 1U5TB 2CW8A 4ZC3A 1S5LC 2E1MC 1YLOA 2XNDA 4FE4A 2FEZA 4LBWA 3UNGC 1ITYA 3GQ7A 2H8RA 2Z6BD 1TT0A 4P6YA 2VNJA 2V4JC 1YOVB 3BJ6A 3WTVC 1MJ9A 5M3FJ 3J7AY 4WXCA 4C2MJ 1ZM3A 2XTXA 3F6OA 1K8FA 3WGIA 4LK1F 1QZEA 3SHFA 4UZEA 2V7XA 4XMYA 1MKMA 1D3YA 1CQTA 4BBRJ 1BR4A 2EINH 2ZJ2A 5LRRA 5C44J 2DQLA 2WBMA 2BYVE 3P9IA 4XORA 1XD7A 2LY1A 3WU0A 1ONVA 2EPFA 1E62A 1GVJA 2JRMA 2L4MA 4GCVA 2BF4A 2R93J 2K4BA 2YR2A 1ZN2A 2WJYA 1XSXA 2HLDA 3EQLF 4I98B 2BM1A 5BQTA 2W82A 3HIFA 4F55A 3HYIA 1PE9A 2O0WA 4CCMA 4KMUX 4Q48A 2OF7A 3HDDA 4OOXA 5DCFA 4OMYA 4ZH4F 3PQKA 2Q6OA 5E3LA 1ZRFA 1PUEE 2VFOA 4MEYF 4F92B 2OJED 3S1QJ 1O8KA 4PGOA 3HGGA 5EDNA 1G3SA 5D4SA 1BL0A 2JVGA 2ZKZA 4IOAF 1X1CA 4OAYA 4YFKF 1IUFA 1VQKB 5M5YJ 1R5NA 4P9FA 3TL4X 3FJOA 3JU4A 4X7FA 3OPOA 4DNTB 3PUFA 3GF2A 1ZG3A 3JRIA 2QA4I 3LL7A 4FCYA 3OE7A 2R92J 2UZKA 2JZYA 5DN6A 2G0EA 2E19A 2OQRA 2VNIA 4H4KC 3RQIA 3QFRA 1SD5A 5C4XJ 1ZR2A 3H3ZA 3LA3A 5HNHA 3ZZ0A 2K9LA 3MN2A 2NT9A 3GQ9A 2CQQA 2J8KA 1MW7A 4DYQA 3WWGA 5EMNA 3CCUB 3JRDA 2HR3A 4X7EA 2STTA 2GXAA 3R6SA 5FO5A 2KJCA 3TO9A 1WSUA 2R6HA 2LKXA 4BY7J 3ZQCA 2O5RA 3FMRA 1FEXA 1UHMA 3QAHA 2ZB9A 4IQ4A 3JRGA 4KIBA 1SKQA 3CESA 1TLHB 5B3SH 2ZMEC 3VYTB 1DDIA 1QFYA 4RCZA 4C2LA 1STZA 2MD0A 4YALA 1ZH5A 2QE7A 2F4IA 4YHBA 2VBSA 2CUZA 2L9RA 3W2WA 2F6CA 3KP5A 3RI4A 5F0FA 2CUEA 2F5FA 3F8FA 1ZGWA 2XOKA 1HF2A 1D0XA 2LBFB 5J3OA 4EM0B 2RNJA 3HRMA 1JB9A 1BQEA 2BSPA 1U8RA 2MC4A 2NNNA 4P25A 2KIUA 2GIVA 4CHUA 4BDYA 4ZDOA 3CMAI 3HUGB 3J81Z 4E7IA 1HXDA 1FSHA 1F5TA 3C2BA 4A6DA 4UAJA 5AIQA 1NB9A 3DV8A 2DLLA 2OZUA 2DFFA 2PIAA 3OYIA 4YELA 3BQYA 2VIXA 3DEUA 2VBXA 2PMHA 2BHYA 3CDIA 3K1PA 4DGWB 4ENJA 4G94A 2G7UA 4RM2A 1AU7A 2DXIA 2DCUA 1TZLA 2W1OA 2VODA 4QVJA 1E79A 1E3HA 3GTOJ 4DYRA 1WJCA 1Z0XA 3K4BA 1ORKA 2XF5A 3KZZA 3LOCA 4EV0A 3PO3J 1KTWA 4PC1A 2PG4A 2HVRA 1OYIA 2OV7A 3K4NA 1U8BA 3I9V2 2B7CA 4M3EA 2VKVA 1Q82D 4AVPA 2IP2A 1B59A 3KYLA 3G73A 4BE1A 1CGPA 1IN4A 2XTYA 4HRIA 5C1EA 1J9ZA 3G71I 1QA3A 2JRTA 3JRAA 3HOSA 4WK8F 4U7BA 1W36D 3T56B 5A2QZ 2VOOA 1QRBA 3WU2C 1GVHA 1H89C 4UXNA 1O8FA 1I3AA 3G1MA 3PNYA 4X8IA 1I3QJ 4HF0A 3AG2H 2Q1ZB 4PJNA 2O8KA 2E1MB 5GPCA 2QEXB 3EUAA 3KEQA 5F1JA 1I6XA 1VHOA 3G4SB 3H5NA 5E6TA 3CCJB 1R36A 4M72A 1JGGA 1GAWA 3V76A 2TDXA 3D5RC 5CVIA 1ZTRA 2X51A 3ABUA 1R1UA 3OOPA 3Q6RA 1QVTA 1YX3A 4KT5C 5HXBA 1KTVA 1G3YA 2PJRA 5HZBA 2EV5A 2O03A 3B02A 2Q8KA 4XKWA 2BX6A 3E6BA 2F4OB 2AXTC 2DMPA 2ETHA 1LE8A 4PFOA 1YITI 3OYBA 4G12A 4NBQA 2QM3A 1U2RA 2BM0A 3CCVB 1YYVA 3DLLF 3KP7A 2ELKA 2FNAA 1Y0NA 4RD3A 1IB4A 2ZL7A 2PYHA 4JYKA 1VQPI 2XAGA 4Z6YA 1E1QA 5F4JA 4YXWA 2ZJRF 3B82A 1IF1A 2V79A 4XBFA 3PO2J 1I1SA 1WORA 3GFJA 2C77A 1O8GA 1YG2A 3ZMSA 1VNDA 2V9KA 2VBMA 3AVXA 1J7KA 3BG9A 1YO5C 1TVCA 3LYCA 3J7AO 1POGA 3DKYA 1HLVA 3W2GA 4C9YA 2P6TA 2GK7A 1FNMA 2CWEA 3IP4B 4DZJA 2MD5A 2RC5A 3HPHA 3ASRA 1HDPA 4KKUA 1D8KA 1SVOA 3ONYA 1YW9A 1VLYA 1OR7A 4EM2A 5GV8A 4QPOA 4XL9A 2EV0A 5KAIC 2VNHA 2V7TA 2AO9A 3DLAA 4P6VF 4EW9A 3L2VA 1FTTA 1FOYA 2F5DA 4C0SA 4M6YA 4JOMA 2PMZA 1ELOA 4M2LA 3TOAA 5F1RA 4FX4A 4ENKA 1W0TA 1LQ1A 4RD0A 1OB5A 1MBEA 1LB2A 3OW7A 4EJVA 3S3NA 2HDWA 2KPMA 3E5XA 1IUYA 3VNVA 1N06A 5K7ZA 3JRCA 2CG4A 2IGOA 2JT1A 3LQEA 1BN8A 3DPUA 2HPMA 4E7SA 1Y6IA 3S2WA 2P5KA 1BC7C 2MH2A 2XC7A 5DTDA 2QQ9A 3CTAA 4A93J 3BCFA 1YE9A 5D5UB 2KDZA 3ZBUA 5KSWB 2FU4A 2M7BA 5EGOA 4PZJA 4XN0A 2HQ5A 2ZSIB 1KYZA 4RB2C 1R71A 1Q1HA 3RYRA 4R8HA 1W2BB 3Q0UA 2DY1A 2A6TA 3G05A 3B8HA 2L7MP 3UR3C 3KEYA 3MMYB 4IRHA 2P7CB 1ZM2A 3OW2B 5FA6A 1BJKA 3AAFA 1YX5A 2QA4B 2FD5A 2KT0A 2RKHA 4I76A 1E2XA 3I58A 1I39A 4L0YB 1HKTA 1FRNA 2BMWA 2Q6IA 4WQMA 2TCTA 3B4NA 4ZCIA 1O7FA 5ICFA 3KEWA 5LMZA 2VBUA 3F9KA 1SAUA 2VC1A 4HOBA 3OY9A 2IS6A 2K40A 4KKSA 3CMEB 1DDNA 2JJ7A 2PYGA 1TQIA 2LF8A 2YU3A 3A03A 4XLEA 2DERA 2OCCH 1AKHA 5IPAA 1G7TA 4OPSA 2EH3A 2EFNA 5EEHA 4I6ZA 1WSRA 1Z9CA 2XUBA 4ZZDA 1USTA 2RQPA 4G6DA 2YX4A 4G1BA 3CF2A 2FUG2 1V5EA 2VXZA 4WXDA 1F9NA 3VYRB 1WZ2A 5J4YA 2KIFA 5EG0A 2VBZA 3JW4A 4EJWA 1VQ5I 3SKBA 2R0QC 1S8NA 4MXNA 2CV1A 2OK8A 1OFEA 4BE0A 4I2OA 2ZL5A 3W3CA 3PFIA 4Z4TA 4XKCA 1CZFA 2D5VA 3PIOF 3OP1A 1MZBA 2LP0A 2H94A 4PAAA 2HOEA 3IUOA 1W36C 1RUNA 3S2DJ 2AS5F 3ABTA 1BBYA 4U87A 2YWHA 1ULYA 1LPQA 4UVAA 2ID3A 4DK1A 3CF5F 2BBYA 5D5XB 1OCZH 2KMUA 2NXNB 1FC3A 1OFLA 4YFNF 3OIOA 1V55H 5IYPA 1D0ZA 2O9LA 1Z1DA 2MABA 4KN4X 3PNTA 4URRA 3EYYA 3WU1B 3CO7C 3CMAB 2X48A 4HSRA 2FNPA 2NAZA 2GPJA 2F3LA 4PABA 3X2QH 2ZJPF 1MGTA 4IHVA 2INUA 3QWLA 3OIPA 1TYUA 4O6JA 5J6XA 5TY0A 1RPWA 3T5XA 4TMZA 3K70D 2DAOA 3JCUC 1ZR4A 1BI1A 3MVPA 4UNOA 4YAUA 2AQFA 2PMUA 3B6AA
chains in the Genus database with same CATH topology
2CW7A 4E7ZA 4HG2A 4XNFA 4Y33A 3DTIA 3FBNB 4ITVA 2WY7Q 4II2A 2Z2SB 1WJDA 2GOMA 2JSPA 4B3XA 2IQ7A 4MR0A 3A2KA 3HPGA 2X6XA 4PSWA 4KKTA 2UVEA 2R7TA 1Z3XA 1IRXA 2CH0A 3M1CA 1NBMA 1O8DA 1OFMA 4LITA 4F3QA 3DWLE 2NOJB 3MKYB 4KJZA 2F43A 3MD2A 2X6WA 2XZOA 3DU6A 2DT6A 3ZPNA 3IAM2 4YZQA 3LMMA 1MMNA 3H5RA 3OYFA 1NG6A 3OAAA 4ZYAA 1NHCA 1EA3A 2LC2A 1U0JA 3A3GA 1K5CA 3BCDA 2MFZA 4E6KG 1OGMX 1R6RA 2ZZEA 2A5WA 1QHHD 2UWMA 3S32A 1N75A 2GJPA 3FDYA 2K9MA 3OYJA 1T0FC 2VPLA 4BXFA 3EUKL 2LRDA 2X1CA 2VBEA 4J00A 3K6GA 2ZZGA 4OAZA 5FRNA 3OYCA 2RREA 3CP2A 3ZCOA 2NT6A 4OJ5A 3H35A 2VXDA 3HC7A 3EPZA 4PJMA 4RMNA 3HL2A 3A35A 2LREA 4HNTA 3NE5B 4B3GA 1D1BA 2O17A 2Q2EB 3GQAA 1MNDA 2R7UA 2ZXHA 2X6YA 4BU2A 2CV0A 2JJ1A 5HVQC 2JUGA 4BGDA 2X53S 3RTRA 2XZPA 2M0MA 4F93B 1V0EA 4TKOB 1D1AA 5FROA 1GLNA 3OYMA 2VQGA 4U49A 1D1CA 1FMWA 3GVKA 3E0JB 3OYEA 2BOLA 2XSJC 2R4GA 3SDBA 1KZLA 1X1BA 2NSPA 5KNLA 1DGRM 4ZJZA 1UD8A 2GJKA 3DEEA 2VJJA 4HSTA 1O8IA 2GOXB 3I3LA 3QYBA 1BR2A 4AU7A 4JMQA 1UD2A 4HEA2 3LSHA 4BACA 2KLOA 1LFPA 4E7HA 1BHEA 3T53B 2HQAA 1H8EA 4NK6A 3FY3A 1UG0A 1H80A 3L2QA 2F5VA 4J01A 1PXZA 5CKTA 4HWVA 2CFOA 3OYNA 2L7KA 4DOZA 1K6YA 4W8TA 3VSVA 4ASUA 2UUZA 1BOBA 1V5FA 3LNNA 3OYHA 3ZSCA 1WJ5A 2KDOA 1O88A 2Z8GA 4JQFA 3CZ6A 4OZZA 3KX2A 4U4BA 4E7LA 2IS2A 1J09A 4CCLA 2ZTNA 3GRHA 1X4OA 4Z05A 3OYGA 3OOUA 4E7KA 4F91B 2VB6A 3H0DA 5KHDA 3MKWB 2ODLA 3GVLA 4RLQA 3M8JA 3ZXSA 4AYBA 3QODA 2NSTA 1LVKA 3LSGA 2DOAA 1WJEA 2BW3A 5KCMA 3SZGA 3GQBA 3OR2C 2R7VA 2QKLB 4BL0B 4TSFA 4G7WA 3SUCA 3RQ4A 2LYCA 1WMRA 2RNGA 2CS3A 4C2TA 4FASD 2M5SA 4OWRB 2V1NA 3OFNA 1Z21A 4NUBA 3AL0C 3VDXA 1Z7LA 4C2UA 4I84A 1VZ0A 1DP3A 1EFRA 4FETA 2QX3A 1WTHD 2W6JA 3QOEA 3A4CA 3DTKA 3OR1C 4D1QA 4XLHA 3S3OA 1BLIA 5C1CA 1SFKA 4YRVA 1O8HA 2HVQA 2BVMA 1O8LA 1UELB 2CUJA 1WJFA 3ONQA 3K70C 1OGOX 1HG8A 4YZXA 3VSUA 4DIQA 2CW8A 4P22A 4ZC3A 4YZAA 2E1MC 2XNDA 1KCDA 1O8JA 2NTBA 3PJRA 3UNGC 4OJPA 2UVFA 2KHMA 2Z6BD 3GQ7A 1JI8A 3K4JA 3G2BA 1TT0A 2V4JC 3J7AY 1W0JA 2WY8Q 1WFXA 5IK2A 2VQCA 4XLAA 1Z3YA 3LSKA 3OL4A 3WQZA 1AA7A 4XLFA 2M3AA 3OEEA 3CJQB 4BE2A 4XR6A 2ZXIA 2AQEA 4XMYA 1OOCA 3OOCA 2UV1A 1BR4A 3ZIAA 5HKKA 3AFHA 2WBMA 4XORA 2CMPA 2LY1A 4XKVA 2QXZA 2XAUA 3DPLC 4XM3A 2IGNA 2BW3B 3D5LA 2D3LA 2WJYA 3B90A 1VJSA 2IGKA 4LIVA 2HLDA 3ZR8X 4NQWB 3MKZA 3GVJA 3RSNA 3BCAA 2W82A 4F55A 3UW0A 1PE9A 2O0WA 4CCMA 3OMYA 3QYEA 4BS9A 2R7QA 2WSSA 2ZFUA 3OYAA 2VLAA 2DT7B 1GQ8A 3TBIA 3BC9A 4F92B 1BR1A 2LBFA 1O8MA 1O8KA 1WJAA 1G8XA 2QY1A 2X1EA 3H94A 2JVGA 2RQQA 2WAEA 1X1CA 3NWSA 4MLOA 2K5CA 4OAYA 1EE6A 4CCNA 2WZPP 2JVHA 3S93A 3SYTA 4B44A 4AVZA 4BEHA 3TL4X 3JU4A 3OPOA 4DNTB 3RPUD 3OE7A 1I18A 3LL7A 4OZYA 5DN6A 1E3XA 2E5ZA 2VQHA 2VASA 2VJ4A 4H4KC 4Y4RA 2P0WA 3V42A 2D3NA 3OWTA 1PYVA 5HNHA 1W0KA 2K9LA 3K10A 4LG3A 4B43A 3VR6A 4BJ6C 2NT9A 1MW7A 3GQ9A 3WWGA 4CCOA 3GQ8A 3D5SC 4DJAA 1FX0A 1VF7A 5LFAA 4G7XA 2HNHA 4E4HA 1QU3A 2O5RA 1OLTA 4BQNA 5LD2C 1BMFA 1KONA 3PUBA 1T95A 4IQ4A 4GRIA 2CK3A 1AIRA 3VYUB 3CESA 5HLTA 1OHHA 2HU9A 3VYTB 3OYLA 4C2LA 2MD0A 2QE7A 4C30A 2F4IA 4DBQA 2V26A 2CUZA 3W2WA 3PNVA 2KVOA 2F6CA 2CV2A 3FPPA 4BDZA 4CSWA 1P9QC 3BG6A 2XOKA 2VJ5A 1RMGA 3NWTA 1D0XA 3C2HA 2LBFB 4NK8A 4B3FX 4Z1MA 4ZTFA 4ZDLA 4PJLA 4P5OA 4CUGA 2XGJA 4DK0A 2KL4A 3L2UA 2MC4A 4N4OB 2BSPA 4PUSA 3DPTA 4BJTA 2JJ2A 2PECA 4BEHB 2WJVA 4BDYA 1V0FA 1X19A 4ZDOA 2X85A 1OR7C 4XOPA 3HUGB 2XF6A 2W7NA 4E7IA 3LSIA 2XZLA 3HXLA 3JURA 4L8JA 1UD6A 4XD7A 1RU4A 2IXSA 3LSMA 4P1WA 4Y3OA 3DKXA 4OJOA 1MMGA 3VSLA 3OYIA 1XG2A 2O1DA 4YELA 4G6IA 2V7FA 2X3HA 3VMWA 3SEZA 2VIXA 2W4SA 4CCKA 1COWA 4XONA 1WPCA 4W8QA 3B8YA 3ZRGA 4DGWB 2LH9A 3K4LA 3OS1A 4DNRB 2HPIA 3N05A 4RM2A 2DXIA 3CMMA 1MABA 4GQNA 2GJRA 1TZLA 4OJLA 2W1OA 3DQVC 1T5EA 1WP6A 3FKSA 1E79A 1WJCA 3K4BA 2XF5A 2W6IA 2E5NA 1KTWA 4KISA 2HVRA 3AL0B 2OV7A 2EWEA 3K4NA 3K4MA 3I9V2 3ZGKA 4UZUA 3W2VA 3L2RA 2R7WA 3E1SA 4KITB 3KYLA 4BE1A 3PSIA 3S3MA 2HVSA 4FXUA 4HRIA 5C1EA 1UAAA 3OEHA 3DU5A 4CH7A 4PK4A 3HOSA 3OS2A 4U7BA 1W36D 1ERDA 2R9VA 3T56B 1QCXA 2KRCA 1O8FA 1X0CA 3PNYA 2OUMA 3HOTA 2Q1ZB 4PJNA 4X0GA 3T9GA 2E1MB 3C2GA 4BUPA 3ZPPA 4CCJA 3EUAA 1MMAA 4W8RA 3BLYA 2DIEA 1LKXA 2NTQA 2W00A 2BVLA 3H5NA 1QJVA 1VBLA 2IS1A 1LDKB 3D5RC 2L9NA 2X51A 3VYSB 5CQEA 2VKHA 1YX3A 2PJRA 2WAFA 4XKWA 1UD3A 1E3ZA 1ZELA 2Y0SA 3VSKA 3LFUA 4E0FA 4PFOA 2JDIA 5CDFA 2M7AA 4CA0A 4XN3A 3OYBA 2MYSA 3HKZA 1HZEA 3OIQA 4D9JA 1X1AA 2M4KA 2V7QA 1IB4A 2WADA 2R7OA 3FBIB 5HOOA 2PYHA 3EQOA 1E1QA 4YXWA 1IDKA 2KZVA 2GK6A 2Z16A 4IX7A 2V6EA 3A1YA 4BQOA 4BQQA 1O8GA 2VL8A 3EQNA 1JTAA 5JHFA 4RM3A 2V9KA 4II3A 2VBMA 3W2AA 2HZDA 4PSXA 2IGMA 4DBRA 1G59A 3DKYA 3PFYA 2R7RA 1SKYB 1DGWY 2E60A 4C9YA 4W8SA 2GK7A 1N78A 3HAGA 3IP4B 4KKUA 2XF7A 4OJ6A 3HPHA 2X8KA 2XDVA 4G6TB 2ZTGA 4RLFA 2ZZFA 1VLYA 1JRGA 4QPOA 4XL9A 1H8HA 3BC8A 4TT3A 1PLUA 3DLAA 4EW9A 2V4DA 5HNFA 3L2VA 1QHGA 2VQLA 2PMZA 3H9JA 4JOMA 1N77A 3DDYA 5CQGA 2VBKA 3S8PA 4ANJA 1Y56A 1KMHA 3OW7A 4B47A 1K28D 3VWBA 2PJRB 3S3NA 4YEJA 2HDWA 2KPMA 3SEQA 1PKVA 2R7SA 4IQJA 1MMDA 3EUHC 4BJ5C 3L2WA 3H5AA 1UD4A 2IGOA 2K3PA 2ELJA 1BN8A 2L2OA 2M4GA 3DPUA 2HPMA 4E7SA 1E43A 4Z06A 1Y6IA 2VJIA 1MNEA 1HVXA 2XC7A 3BCFA 3CJRB 1YE9A 4HPQA 4E7JA 5FRMA 3CP8A 3RCOA 2M7BA 1O8EA 2O04A 4XN0A 1NRKA 2ZSIB 1DQUA 3OS0A 3PL8A 2QKMB 4Z03A 2NZMA 1BPLA 2F1MA 2A6TA 2ZZQA 3BH4A 3G05A 3UR3C 1PJRA 3KEYA 3MMYB 2JIZA 3LMWA 3A3BA 3OYDA 2X1DA 4NNJA 1YX5A 3PSFA 1IA5A 2DCEA 4KT6A 4XOTA 4ZDPA 2NTPA 2VKDA 2LZJA 3B4NA 1E1RA 3KEWA 1S9HA 4KKSA 3F9KA 1SAUA 2LY2A 4XLCA 3OY9A 2IS6A 2O0VA 4HIZA 3DTEA 3GBGA 1X4PA 2INVA 2PYGA 3OL3A 4XLEA 3IAS2 3TMOA 1I8DA 5FL7A 1V5GA 3H9QA 4R79A 4LIUA 2L5QA 3K4CA 1X1DA 4PFPA 1DBGA 1FMVA 3CF2A 2FUG2 1V5EA 2KP6A 2VXZA 2WB1A 3VYRB 3FKJA 4PJJA 4NC8A 3KRGA 4MXNA 3H9GA 1D0YA 3HG9A 2CV1A 4BE0A 3W3CA 4XKCA 2KQRA 2KRHA 3FHNA 1OB0A 1CZFA 5TGTA 2WA0A 4NC7A 4B48A 3IUOA 1W36C 2JA2A 2I8DA 3VMVA 4QPQA 5AMVA 3AKZA 4IKFA 4XQFA 2LOOA 2L9SA 4U87A 3U21A 2E1BA 2WAQA 2R7XA 4HNUA 4DK1A 4CZCA 3K4KA 2KMUA 2WPDA 1OFLA 3VSTA 4N4NB 5CPRB 1E0EA 1HA8A 1UD5A 1D0ZA 2ZSHB 4F52A 4XKBA 2MABA 3PNTA 1W9XA 1DBOA 4URRA 1IDJA 2LG4A 4ZTJA 2DJIA 4HSRA 2V31A 3OYKA 2Z1DA 3T51B 1RWRA 3BCBA 3QYFA 2INUA 3OIPA 4PMHA 1WJBA 4IZZA 1NG7A 4EATA 3K70D 2IS4A 2AQFA 2OC6A 3ZQQA 4YZ0A 3BG7A 1KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMG A;  1JRG A;  4XNF A;  4XL9 A;  4NK8 A;  1PLU A;  4EW9 A;  4I84 A;  2QX3 A;  2VBK A;  2BSP A;  2IQ7 A;  4MR0 A;  2UVE A;  2X6X A;  2PEC A;  4XLH A;  1O8D A;  4YEJ A;  1O8H A;  1OFM A;  2X85 A;  4XOP A;  1O8L A;  1OGO X;  4YZX A;  3JUR A;  3VSU A;  2X6W A;  1BN8 A;  1RU4 A;  4YZA A;  4Z06 A;  2VJI A;  1KCD A;  4OJO A;  1XG2 A;  1O8J A;  2NTB A;  2O1D A;  2X3H A;  4YEL A;  2UVF A;  3GQ7 A;  4OJP A;  4YZQ A;  3VMW A;  1O8E A;  4XON A;  2O04 A;  4XN0 A;  4W8Q A;  1NHC A;  3B8Y A;  1QCX A;  4Z03 A;  4OJL A;  5C1C A;  2NZM A;  1K5C A;  4XLA A;  1OGM X;  4XLF A;  4XR6 A;  4XMY A;  1OOC A;  1KTW A;  3LMW A;  4XOR A;  2EWE A;  4XKV A;  1IA5 A;  4XOT A;  2NTP A;  2QXZ A;  4XM3 A;  2VBE A;  3B4N A;  3B90 A;  2NT6 A;  4OJ5 A;  5C1E A;  2O0V A;  4XLC A;  2PYG A;  2INV A;  2O17 A;  4XLE A;  3SUC A;  1PE9 A;  2O0W A;  3GQA A;  3UW0 A;  2X6Y A;  1X0C A;  1O8F A;  4U49 A;  3T9G A;  3ZPP A;  1DBG A;  1GQ8 A;  1O8M A;  1O8K A;  2NSP A;  4W8R A;  2QY1 A;  3KRG A;  2NTQ A;  4MXN A;  1QJV A;  2VJJ A;  1EE6 A;  1O8I A;  1VBL A;  1CZF A;  4AVZ A;  4OJ6 A;  1BHE A;  4OZY A;  4XKW A;  3VMV A;  4NK6 A;  3FY3 A;  1H80 A;  5AMV A;  4XQF A;  1PXZ A;  4HWV A;  4W8T A;  4XN3 A;  3VSV A;  2NT9 A;  3GQ9 A;  3ZSC A;  3WWG A;  1OFL A;  1O88 A;  2Z8G A;  3VST A;  3GQ8 A;  1IB4 A;  2PYH A;  4OZZ A;  3EQO A;  4U4B A;  1IDK A;  1O8G A;  1DBO A;  3GRH A;  4URR A;  3EQN A;  1IDJ A;  4Z05 A;  1AIR A;  1JTA A;  2VBM A;  2ODL A;  1RWR A;  2INU A;  4PMH A;  2NST A;  4C2L A;  4W8S A;  1HG8 A;  1WMR A;  4YZ0 A;  1KCC A; 
#chains in the Genus database with same CATH topology
 2C2W A;  2XAH A;  4OPO A;  5EEA A;  4NDL A;  3ASN H;  4Y33 A;  3TQN A;  2DFI A;  1S72 I;  1CNE A;  3LSR A;  4U7D A;  5DS0 A;  1P4X A;  2WY7 Q;  5DEQ A;  3I4N J;  1O3R A;  4L9V A;  4YIF A;  3N90 A;  2DK5 A;  2IQ7 A;  1ZHF A;  2CH0 A;  4N9H A;  2Y75 A;  2D1H A;  2PN6 A;  4UHT A;  5IY5 H;  1FNN A;  1QUE A;  1TP4 A;  3QE2 A;  1OFM A;  4LIT A;  2FF4 A;  1GV5 A;  4IJA A;  3G71 B;  1LLZ A;  3MKY B;  3KZY A;  4KJZ A;  2E2H J;  1T56 A;  3FM3 A;  3MD2 A;  2F43 A;  3DU6 A;  2QDX A;  4UUT A;  1MBG A;  4EM1 A;  2XRO A;  3IAM 2;  5K5O A;  2HMA A;  4UB6 C;  3CCS I;  1MMN A;  3GWZ A;  1HKQ A;  5D6E A;  1W5S A;  1HC8 A;  3OAA A;  4LOC A;  5HS8 A;  1J0R A;  5HLI A;  3A3G A;  1BX1 A;  3BCD A;  4OOS A;  2DJN A;  1OGM X;  1VQO I;  1R6R A;  2W25 A;  2XGD A;  4FK8 A;  2DA4 A;  3F0C A;  1RQR A;  2JTV A;  2UWM A;  2GJP A;  3N4M A;  3FDY A;  2K9M A;  2Y2Z A;  5JLW A;  2VPL A;  2QBY B;  3GTP J;  1H85 A;  2LRD A;  1MBF A;  3NAU A;  4GGG A;  3ZMT A;  1BA5 A;  1JA0 A;  3E1Y E;  2NPF A;  4ACB A;  3K6G A;  4OAZ A;  4ZV4 A;  3T8T A;  2RRE A;  3ZCO A;  1YIT B;  3GTL J;  1H9T A;  2VXD A;  3ZMD A;  3A35 A;  1VQM I;  2LRE A;  1D1B A;  1MND A;  2OQG A;  2ZXH A;  4Q47 A;  1XPX A;  3RTR A;  2HXO A;  1VQP B;  4F93 B;  1V0E A;  4M4S A;  2L4A A;  4U49 A;  1QGZ A;  1Q9S A;  1OCO H;  2GA1 A;  1ETW A;  4B3A A;  4LB6 B;  5BSY A;  4KIG A;  2QN6 A;  1RKT A;  1KZL A;  2EK5 A;  4AC9 A;  1UD8 A;  2O6G E;  1KK1 A;  2EIM H;  2XKO A;  4UVB A;  2EFG A;  1UD2 A;  1WU8 A;  4WXH A;  1EP1 B;  2KLO A;  1KGS A;  2QQA A;  3A0B C;  4E7H A;  3RZO J;  4OPW A;  2HQA A;  1FJL A;  1M1E B;  1H8E A;  3L9F A;  3GIR A;  2PLF A;  2OTL I;  4AIH A;  3BPX A;  1K9M D;  3SZP A;  3IH2 A;  2C4T A;  1X3Z B;  2V7V A;  2ZXJ A;  1X2N A;  3GZ6 A;  4W8T A;  1LEB A;  3CJN A;  1MSF C;  3HRU A;  1IO2 A;  1MBJ A;  3CQZ J;  3V7C A;  1V5F A;  3WBJ A;  3ZSC A;  4CXF A;  2GZW A;  4JQF A;  1L1I A;  3B6C A;  4AID A;  4OZZ A;  3SFI A;  1MRZ A;  1R23 A;  4M6X A;  4RS8 A;  4U4B A;  3JQQ A;  3RZD J;  1J09 A;  3P7N A;  2HDD A;  5H5J A;  1JJ6 C;  2ZTN A;  3TED A;  2CO5 A;  5DCM B;  3BTC A;  3OYG A;  5FLV A;  4IRG A;  1QNT A;  2VB6 A;  2EFO A;  2ZXW H;  3ZOB A;  1IJW C;  4YEI A;  2ODL A;  4ESB A;  4RLQ A;  4IXA A;  3GVL A;  4AYB A;  4IF4 A;  3M1E A;  3PSS A;  4KA4 A;  1IN5 A;  1TWC J;  1WJE A;  2BW3 A;  2DOA A;  3E6C C;  2QKL B;  4BL0 B;  1BC8 C;  1O4X A;  5DD4 A;  1IAW A;  3HRS A;  1X3U A;  2RNG A;  2CS3 A;  2ZL6 A;  2B0L A;  4D0P A;  2CRV A;  3K1N A;  4FT8 A;  1H9G A;  3VDX A;  1Z7L A;  1ENH A;  4I84 A;  2UXN A;  1DUX C;  1R5G A;  3K2Z A;  2YUS A;  3RY8 A;  2F48 A;  3IH3 A;  3A4C A;  3DTK A;  2IAI A;  3FXO A;  5K1Y A;  2JQ7 A;  2PBI A;  3K1M A;  2NNY A;  4D1Q A;  1BLI A;  3S3O A;  5CVJ A;  1O8H A;  1MDM A;  2DTZ A;  5JLV C;  1DP7 P;  1O8L A;  3KCC A;  1WQ2 A;  3K70 C;  2RVC A;  3QOP A;  4YZX A;  3J80 K;  3SZE A;  2FOW A;  2DA6 A;  4P22 A;  2B0R A;  1K78 B;  2PE3 A;  5J3L A;  1UFM A;  2EIX A;  1ZG5 A;  2QWW A;  2EIJ H;  3KZI C;  2EV6 A;  3PJR A;  1O8J A;  2UVF A;  2KHM A;  4KUM A;  4OJP A;  1O7L A;  2DYS H;  3P9C A;  2HXI A;  1LJ9 A;  3E5Q A;  3TW6 A;  2XPV A;  4A5N A;  1GXP A;  1W0J A;  1N0V C;  2WY8 Q;  4G6Q A;  3HZJ A;  5ILU A;  4HF1 A;  1VQ5 B;  2VQC A;  3FIW A;  2CQN A;  3Q5F A;  1D5V A;  3WTU C;  3E97 A;  3OL4 A;  3FXM A;  2M3A A;  2OYN A;  3OEE A;  4BE2 A;  4Y7N J;  1WSV A;  2PQ8 A;  3T1B A;  3OOC A;  3SQV A;  1OQY A;  3CCM I;  2CMP A;  2IA2 A;  2W57 A;  2FBH A;  3PQJ A;  1TNT A;  3DU1 X;  2XAU A;  1R5H A;  2ZNY A;  2IGN A;  3D5L A;  2DMN A;  3G1L A;  1VQ8 I;  5K7F A;  4LIV A;  4WX9 A;  1XMX A;  3ISX A;  1JE8 A;  4EJU A;  2PEX A;  4RPD A;  2F4N A;  2G0Y A;  3UW0 A;  2JN6 A;  1ETQ A;  2QZA A;  4HV6 A;  3S1R J;  4XLN F;  2O3F A;  4Y52 J;  4Z4S A;  2MW8 A;  3O2P E;  1SVM A;  2ZFU A;  3KL9 A;  2EA4 A;  2K85 A;  3CCY A;  2ZME A;  1OMI A;  2L54 A;  1GQ8 A;  4A3L J;  4PDK A;  2BY0 A;  4GDF A;  1G8X A;  2CW5 A;  3O3K A;  4FWT A;  3GFL A;  3BWG A;  3SEJ A;  3H94 A;  1EE6 A;  4MLO A;  1Y39 A;  2K5C A;  4CCN A;  2NVT J;  2HS5 A;  2OBS A;  4M53 A;  3SYT A;  4AVZ A;  1NH3 A;  3RPU D;  3BZC A;  4WZK A;  3D1N I;  4Z4V A;  1I18 A;  3AVU A;  4IHX A;  1IJE A;  1KU2 A;  1WXR A;  1E3X A;  2M2E A;  1TC3 C;  1EXM A;  2VQH A;  1SD6 A;  2VJ4 A;  1QQI A;  1RIO H;  4Y4R A;  2P0W A;  3V42 A;  3AGP A;  1S72 B;  2ME0 A;  3P4G A;  2R5Y A;  1TT5 B;  2M30 A;  1SD7 A;  2M9H A;  4Z4U A;  1QZZ A;  2EFQ A;  3D5S C;  4DJA A;  3I56 I;  5LFA A;  3L2C A;  1I6H J;  1YHQ I;  4A3B J;  1VF7 A;  4G7X A;  4AD9 A;  3GX4 X;  4Q7J B;  1QU3 A;  1YJ9 B;  5F0H A;  3BY1 A;  2DA3 A;  1MD0 A;  4M3F A;  1EP3 B;  1QVG B;  4XK4 A;  1S7O A;  1OLT A;  3ZQ7 A;  1QPI A;  1KK3 A;  1WKM A;  4BQN A;  2DA7 A;  2M1B A;  1YJW B;  2HZT A;  1XGS A;  2JMW A;  3BR2 A;  4G7Z F;  2CK3 A;  3VYU B;  2P5L C;  3S1M J;  5DUI A;  1OHH A;  5CVR A;  2HU9 A;  1HW5 A;  2VOP A;  4LLL A;  3OYL A;  4J0Q A;  2Y31 A;  3CCS B;  3MWM A;  2OBT A;  4C30 A;  3GLX A;  1JHH A;  1VHE A;  4DNC A;  1B2R A;  5FL7 A;  5HS7 A;  3BG6 A;  3I64 A;  2VJ5 A;  5JFR A;  3CLO A;  3JRH A;  1MH3 A;  3C2H A;  4AIJ A;  1VQO B;  1N8R D;  4ZTF A;  3CB4 A;  4RB3 C;  2XGC A;  4A3D J;  2E1R A;  4CUG A;  5DNS A;  4OPV A;  1Y0R A;  2XRL A;  5K5R A;  1YJN B;  1FND A;  3L2U A;  2W48 A;  4BJT A;  4BEH B;  2WJV A;  3K9T A;  1S7A A;  5LGN A;  5THX A;  2RDP A;  2JWT A;  1MH4 A;  2X85 A;  4XOP A;  3V7R A;  5FKL A;  2FOK A;  1LDJ A;  1RZ4 A;  1XCB A;  4B8X A;  1XS9 A;  1QG0 A;  2UXX A;  2VYQ A;  4YAO A;  1VQM B;  2XZL A;  3AK5 A;  2BN4 A;  3R6J A;  2IXS A;  3LSM A;  1OB2 A;  4Y3O A;  3DKX A;  4OJO A;  4L5J A;  4RAG A;  3FX3 A;  5K5Q A;  2M45 A;  2Q6L A;  4CCK A;  1WPC A;  5TR9 A;  4GYG A;  1IN7 A;  4XON A;  5EEG A;  1COW A;  4LC0 A;  3WYA A;  3IV5 A;  3ZRG A;  1BI2 A;  1LFU P;  1O3Q A;  3CDH A;  1QCX A;  4GQN A;  2GJR A;  3W5H A;  2VC0 A;  1T5E A;  5IP9 J;  1WP6 A;  3FKS A;  5DM6 F;  2W6I A;  1O3S A;  2E5N A;  2GA2 A;  4KIS A;  1T6Z A;  1SMT A;  1FX7 A;  5D6F A;  3VNU A;  2EWE A;  3M3Y J;  1JHF A;  2RV8 A;  3ZGK A;  3FPK A;  2NYX A;  2YUH A;  2OTL B;  1K73 D;  1UHW A;  3WHC A;  3CC7 I;  3E1S A;  4KIT B;  3S3M A;  4X06 A;  2OPT A;  1KD1 D;  2HKO A;  1U3E M;  1UAA A;  2F5C A;  5AON A;  1B72 B;  5FNZ A;  4ZZL A;  3RPQ A;  2R9V A;  4BBS J;  5F4O A;  2GRE A;  4I01 A;  5LEK A;  1TWF J;  2NV4 A;  2OUM A;  5HDK A;  3H3U A;  1B1B A;  3Q9S A;  3HEF A;  3WY9 A;  1YLF A;  4L9J A;  5LGU A;  4CCJ A;  2CQ7 A;  1MMA A;  4W8R A;  3F21 A;  2DIE A;  4OP7 A;  4H9G A;  2BVL A;  2BY1 A;  5LGT A;  4IHS A;  1LDK B;  2V7U A;  1R5B A;  2L9N A;  3KYD B;  2VKH A;  2STW A;  1D8J A;  1UHS A;  1JA1 A;  2HYJ A;  3BQJ A;  1T6S A;  2R5Z A;  2MH9 A;  3W2F A;  4L9T A;  2XAJ A;  3Q0W A;  2C6Y A;  2FX3 A;  1ZEL A;  4O5V A;  3VSK A;  4XRF A;  2FXA A;  1GUU A;  3E20 A;  2JDI A;  2M7A A;  4CA0 A;  4U0W A;  4ESJ A;  2Y48 A;  2MYS A;  2VUM J;  3OV8 A;  2EIK H;  3C1D A;  1S6L A;  5BMZ A;  1HZE A;  2LFB A;  2BM5 A;  1QA2 A;  1HBX G;  1RRJ A;  2CFX A;  2M4K A;  2NVX J;  3E7L A;  1GDT A;  1K4T A;  3F23 A;  3FBI B;  1RC9 A;  2H6B A;  5HOO A;  2L3D A;  3O8H A;  3HJE A;  4MFD A;  4QLC U;  1TNS A;  2KZV A;  3OZW A;  3LSJ A;  3CUQ A;  3HTU A;  4BQO A;  2BV6 A;  2IEK A;  3EQN A;  3CCR I;  1R4N B;  2IT0 A;  1Z91 A;  3CRZ A;  1JTA A;  2RAE A;  2IJL A;  4RM3 A;  2W84 A;  3W2A A;  3KPH A;  4PGH A;  2VFQ A;  4DBR A;  3JSP A;  2RGV A;  2ECB A;  2QVO A;  5F04 A;  2R7R A;  4OMZ A;  3H36 A;  1DGW Y;  2M5W A;  1SKY B;  3MKL A;  3HAG A;  2V9P A;  1N78 A;  3CPW B;  2XDV A;  4G6T B;  2ZTG A;  5KW9 A;  4RLF A;  1IGN A;  2JN9 A;  1H8H A;  3HM5 A;  4TT3 A;  2KIS A;  3LA2 A;  1QHG A;  2LTP A;  3A8I A;  2B7E A;  1XFO A;  3H9J A;  5IYW A;  5CQG A;  3CCM B;  3S8P A;  4M0L A;  1QGY A;  2X3U A;  1IHM A;  4A2U A;  2DYI A;  4ACA A;  1D1N A;  2VNK A;  2Y9Z A;  1LNW A;  3W5V A;  1MMD A;  2P6S A;  2F4M B;  1XMK A;  3H5A A;  4BJ5 C;  3L2W A;  1YI2 I;  2K3P A;  1K61 A;  1GHC A;  1W7P A;  4UV8 A;  2WWY A;  3ULQ B;  4XRS A;  1E43 A;  4HX4 A;  4RAF A;  4QSH A;  1MNE A;  3VMF A;  3WXM A;  2QTZ A;  3U6K A;  1O8E A;  4Y13 A;  2XPW A;  2O04 A;  2NS8 A;  4B4C A;  3PL8 A;  4TN1 A;  1Q81 D;  1I5Z A;  2WC2 A;  5M5X J;  5FLM J;  3W5U A;  2EQR A;  2HQN A;  2COB A;  2XV4 S;  2ZZQ A;  5HDN A;  3IWF A;  1IJF A;  2JIZ A;  1PJR A;  3LWF A;  2A3S A;  3QPS A;  4M73 A;  4G7O F;  4Y17 A;  2XAF A;  3OYD A;  4NNJ A;  4D5F A;  1OFC X;  3PSF A;  4HQM A;  1EFC A;  3JRE A;  1IA5 A;  4KT6 A;  2A07 F;  3HRT A;  2LZJ A;  1X3W B;  1E1R A;  1YTY A;  2OBR A;  3ZZU A;  3GYH X;  2O0V A;  4JRA C;  4A3J J;  5B1A H;  1X4P A;  2INV A;  3R0J A;  1ZUN B;  3OL3 A;  1QGP A;  1ZGJ A;  3TMO A;  2JA6 J;  1AHD P;  5DSZ A;  3LO8 A;  3G6E I;  3WNB A;  3I56 B;  2DMU A;  4BHP A;  1YHQ B;  4L5E A;  2GXG A;  4LIU A;  3K4C A;  1X1D A;  5F64 A;  1L0O C;  1DBG A;  1OPC A;  4BY1 J;  2V7W A;  3MMP A;  2LY9 A;  3WG9 A;  2A69 F;  4LLG F;  3S2H J;  2VBY A;  3RKW A;  2FA5 A;  3FKJ A;  4NC8 A;  3H92 A;  3LAP A;  4RLZ A;  1IXC A;  2YSR A;  2E1N A;  1HCR A;  2ID6 A;  2XGE A;  1T6X A;  3FHN A;  3COA C;  4M6V A;  2BM4 A;  2D45 A;  1AWC A;  5F6F A;  1JTX A;  5CVU A;  1HA3 A;  2P8T A;  3LQQ A;  5LBQ A;  5IYC J;  5E3M A;  1Y1V J;  4QPQ A;  4RDL A;  5FKM A;  2K86 A;  5E1W A;  4IKF A;  3IHU A;  5DV5 A;  4XQF A;  2L9S A;  3U21 A;  3TH0 A;  2WAQ A;  2K27 A;  4HNU A;  3K4K A;  2WPD A;  1CF7 B;  4Y9R A;  1A04 A;  1P4A A;  2J7K A;  5CPR B;  2R3S A;  1EFU A;  1WDT A;  1UD5 A;  1ZAR A;  2HYF A;  3CLQ A;  4A6E A;  1DAR A;  4J19 A;  4LBV A;  3O6B B;  1HQC A;  1W9X A;  1DBO A;  4OIN F;  3CDL A;  3EDP A;  4ZTJ A;  3A01 B;  2V31 A;  2BY3 A;  3GFM A;  5ERI A;  3OYK A;  1SFE A;  5TRD A;  4A3M J;  1P4M A;  5C3E J;  2B9S A;  3Q38 A;  3QYF A;  2QEN A;  5D8K B;  4XIC A;  1QO0 D;  4HNV A;  1TW2 A;  4EAT A;  4OIP F;  2IS4 A;  1E3O C;  3HOV J;  2OC6 A;  4YZ0 A;  2CW7 A;  2GAU A;  3DF8 A;  3F8M A;  3FXK A;  2Q2E A;  4HG2 A;  4ESF A;  4E7Z A;  4EGZ A;  2E1C A;  1W87 A;  4FQG A;  1PP8 F;  2DT5 A;  3DTI A;  2HOA A;  4W97 A;  5L3F A;  1XB4 A;  5FD5 A;  3R61 A;  3KET A;  5DYM A;  2HOT A;  1EFT A;  2X0K A;  4R1H A;  4X7C A;  2K4J A;  3KE2 A;  1KQ9 A;  1WJD A;  2GOM A;  4B3X A;  5ILS A;  4MR0 A;  3HPG A;  2X6X A;  3KYC B;  4PSW A;  5FKO A;  1PUF B;  2ISZ A;  2UVE A;  3I54 A;  1IRX A;  5M3M J;  5HS9 A;  1R1V A;  1UJ8 A;  2XGX A;  3CC7 B;  5LHG A;  2PMZ N;  2IA1 A;  4F3Q A;  3DWL E;  2NOJ B;  2DMT A;  2ZBK A;  4HA8 A;  2QCO A;  3R4K A;  2JPC A;  3AGQ A;  5B6I A;  4ZCL A;  2X6W A;  1PP7 U;  4CO8 A;  2V6C A;  1NTC A;  1B8I B;  3AVW A;  2DT6 A;  3J81 K;  2KRF A;  2IA0 A;  1KQ0 A;  3LFK A;  3JRF A;  1I1G A;  4Z4Y A;  1WVR A;  5K7H A;  3DBR B;  2LC2 A;  4MGR A;  4LG0 A;  3T0Y A;  3Q39 A;  1W1W E;  2MFZ A;  5J8C A;  1VFC A;  1ZRE A;  1QRC A;  2YWE A;  4O3M A;  2WV0 A;  2A5W A;  2ZZE A;  4UUS B;  2V1D A;  5JR3 A;  1QHH D;  5IYD J;  2DPD A;  1BN5 A;  3S32 A;  1N75 A;  2Z33 A;  4HW0 A;  4W1U A;  1PVE A;  3GUD A;  3S17 J;  3RJP A;  3GCM A;  2VBE A;  1ZG1 A;  2L7Z A;  3S1N J;  2ZZG A;  1S4M A;  1DU0 A;  5BNG A;  3GSI A;  3HC7 A;  3EPZ A;  4RMN A;  4IW3 B;  1OYW A;  2ESH A;  1F36 A;  3HL2 A;  2QYU A;  3SUC A;  1QQ1 A;  2HI3 A;  4X1E A;  3I59 A;  4BU2 A;  2X53 S;  1T33 A;  4QUZ A;  2QYO A;  1NDH A;  4TKO B;  1D1A A;  2H6C A;  3ECO A;  4BH9 A;  1D1C A;  1U9N A;  1RNL A;  2CQK A;  4YII A;  4CYC A;  2NRA C;  3I1F A;  4DQK A;  2BOL A;  2R4G A;  2Y9Y A;  1X1B A;  5KNL A;  1QUF A;  1ETX A;  1Z67 A;  2VJJ A;  2GOX B;  3I3L A;  1FOX A;  2CYY A;  3PA2 A;  3F8N A;  3T8R A;  5FB2 A;  1YIJ I;  3LA7 A;  3P26 A;  2V9V A;  4OIR F;  5F08 A;  3SJM A;  1JTY A;  2Y30 A;  4N0B A;  2ME6 A;  1N05 A;  5C4J J;  2F5V A;  4J01 A;  2H1L A;  2HDC A;  1EZG A;  4HWV A;  1U5T A;  3BR1 A;  3OYN A;  1B72 A;  4U88 A;  3VSV A;  2UUZ A;  3AG3 H;  3VOE A;  1BOB A;  3LNN A;  4MYT A;  3OYH A;  1WJ5 A;  2BM6 A;  1O88 A;  5D5V B;  1MJB A;  3ERM A;  3KX2 A;  3TDU C;  2VON A;  2NS7 A;  4YFX F;  3U1K A;  4E7L A;  1SAN A;  2IS2 A;  1G6N A;  4CIC A;  3GXO A;  2HDN B;  1Y0Y A;  3GRH A;  2H09 A;  2DMQ A;  5KVR A;  2QUF A;  4F91 B;  1VLO A;  1IN8 A;  4C3J J;  2EA2 A;  3QFC A;  4KMF A;  4KIF A;  3MKW B;  1XC5 A;  2COM A;  3M8J A;  5IYQ A;  1LVK A;  4ZGN B;  4P1V A;  1E64 A;  5KCM A;  5DS9 A;  4RM0 A;  3OR2 C;  1F4K A;  4TSF A;  1ACI A;  3HBL A;  3HTS B;  1HSJ A;  4Z2Y A;  3DBH B;  4C2T A;  2Z5U A;  3BJA A;  4M9Z A;  3P27 A;  2GIZ A;  1YFH A;  1ETK A;  1BIA A;  2OA4 A;  1VZ0 A;  4S0H B;  1DP3 A;  1EFR A;  2C5B A;  2DET A;  2QX3 A;  5GPA A;  3QOE A;  1LFB A;  2O8X A;  4WF2 A;  2ZFW A;  5H2F C;  1JKO C;  3WBK A;  4XLH A;  4MIM A;  4YRV A;  1ZLK A;  2BVM A;  3QQA A;  1WJF A;  3ONQ A;  3L1P A;  3VSU A;  3Q6Q A;  4YZA A;  2R7F A;  1YRN B;  1KCD A;  4RA2 A;  3G6E B;  2Z3Y A;  4LFU A;  1K6O A;  2ICW G;  2YU9 J;  1BOA A;  1JI8 A;  1XDS A;  2JUC A;  2VT3 A;  3K4J A;  5L3G A;  4RD4 A;  5ICG A;  4RB0 A;  1WFX A;  1EH7 A;  2DTR A;  5IK2 A;  4XLA A;  3LSK A;  3WQZ A;  3ZN1 A;  2C78 A;  3R60 A;  4XLF A;  3SDG A;  1OJL A;  1QRY A;  3CJQ B;  4BHC A;  4XR6 A;  2AQE A;  5HLH A;  2GQQ A;  4ETS A;  1R00 A;  2DDA A;  5HKK A;  1G3T A;  3V7A A;  2XTW A;  1P4W A;  3H1C A;  2Y69 H;  3U1D A;  2JK3 A;  2VKE A;  4TMX A;  2F5E A;  1EH8 A;  3GZN B;  4JX5 A;  4XM3 A;  1EF4 A;  2QXZ A;  1KYW A;  2Z9O A;  4HYE A;  2W7Z A;  3B90 A;  2V1X A;  1VJS A;  2E2I J;  2IGK A;  3P5J A;  4M71 A;  3ZR8 X;  4MEX F;  4NQW B;  3ABK H;  4FHT A;  3MKZ A;  3BCA A;  3QPT A;  3CD6 I;  3PIP F;  2DBB A;  4HE6 A;  3I55 I;  1VTN C;  3OMY A;  1ZK8 A;  1XE1 A;  3ASS A;  4ZCM A;  3ML3 A;  4BS9 A;  2OTJ I;  2WSS A;  3HSF A;  1ZM4 A;  5F27 A;  3OYA A;  2VLA A;  2DT7 B;  3VO1 A;  3BC9 A;  4CGZ A;  5HOD A;  2LBF A;  1O8M A;  1WJA A;  3BOQ A;  2X1E A;  3V8L A;  4ZYG A;  3NWS A;  1EKE A;  2D1V A;  4RAY A;  3FHZ A;  1WRJ A;  3JAM K;  2JVH A;  2RC4 A;  4B44 A;  4RB1 A;  3HSE A;  4BAY A;  2BGJ A;  4IRI A;  1ZLJ A;  1FIA A;  3BR6 A;  4DQL A;  2FE3 A;  3FK7 A;  3HUG A;  4V2F A;  4WWV A;  4PC7 A;  3M9A A;  1IRZ A;  3U6B A;  3TKY A;  3N6Z A;  5F0C A;  2D3N A;  3OWT A;  4JX6 A;  4P9U A;  3VR6 A;  3ZQL A;  3K10 A;  4LG3 A;  4B43 A;  1FRQ A;  1G7C A;  5FKK A;  2OK7 A;  2FML A;  1TWA J;  3GQ8 A;  3TGN A;  1FX0 A;  2FQ4 A;  4YG2 F;  1ZRD A;  2YS9 A;  5EZG A;  1A6I A;  1RES A;  3F72 A;  2X4H A;  2DOF A;  2OZ6 A;  4ZYE A;  1FOW A;  5L3C A;  3J80 Z;  4M9X A;  3CCQ I;  1KON A;  3PUB A;  4GRI A;  2E1O A;  5E1X A;  3SYJ A;  5HLT A;  4U0Y A;  1ZM9 A;  2L9V A;  1V54 H;  1VQ9 I;  1NB0 A;  4OM9 A;  3LNQ A;  1N08 A;  5DUK A;  5CVV A;  4XSX F;  4OIQ F;  5FLX K;  3NQO A;  1IN6 A;  2LR8 A;  1N07 A;  3A1P A;  3PNV A;  2AHO A;  1TWH J;  5J1Y A;  2CV2 A;  4BDZ A;  3FPP A;  1P9Q C;  4AYB N;  1R9T J;  4KH3 A;  1KA8 A;  3NWT A;  4JX4 A;  3V8K A;  2F2E A;  2A05 A;  2CJJ A;  3HOZ J;  4ZDL A;  5J1U A;  3WTZ A;  2MC3 A;  4A12 A;  4DK0 A;  3L09 A;  1ETV A;  1R4M B;  5H20 A;  4WZL A;  1XGO A;  3E6M A;  2JJ2 A;  2RC6 A;  1VQL I;  5J4V A;  2DN0 A;  5CYV A;  1TW3 A;  2LSO A;  3J7Z I;  4S04 A;  2XT4 A;  1X19 A;  1JUP A;  3FXQ A;  3RKX A;  1OR7 C;  3MZH A;  4RDU A;  3AVT A;  2B5O A;  3PA1 A;  2DOG A;  3PM1 A;  1ZAO A;  1A35 A;  1QGA A;  1UD6 A;  4XD7 A;  4IO9 F;  3ZIA A;  1MBH A;  1RU4 A;  1RQP A;  3WTS C;  1RKW A;  4P1W A;  1FZP B;  1J59 A;  1XG2 A;  3I53 A;  1YS6 A;  2V7F A;  3SZT A;  2JA8 J;  4L18 B;  3SLD A;  3HOY J;  1DAB A;  2LH9 A;  2NOG A;  4DNR B;  4LJZ F;  5C1C A;  1MAB A;  3CMM A;  3ZMZ A;  3DQV C;  3WGG A;  3PVD A;  4LK0 F;  3ZC3 A;  4ROX A;  5E79 C;  2E34 A;  1IDZ A;  1HW2 A;  3GFI A;  1HKS A;  5H59 A;  1F60 A;  4AC0 A;  3W2V A;  2K3F A;  2HTJ A;  3HB9 A;  1ZKG A;  1S7E A;  3ML6 A;  1G4D A;  2HVS A;  2IRF G;  2Y0M A;  5CJ9 A;  4MNU A;  4PK4 A;  2IPQ X;  3FF5 A;  2E2J J;  3RPU A;  5IT9 K;  1GV2 A;  5H6R A;  1X0C A;  3JTG A;  3E6D A;  3HOT A;  3FMS A;  3Q9V A;  2P3M A;  4M9S A;  4X0G A;  3HOU J;  4LB5 A;  3T9G A;  3C2G A;  2EBI A;  4QVA A;  1LUJ B;  3JR9 A;  1R1T A;  1T6Y A;  3HKZ N;  4MQV A;  3ZQG A;  4DW6 A;  3BLY A;  1RR7 A;  3WG7 H;  2NTQ A;  2W00 A;  1QJV A;  1UG2 A;  1VBL A;  2FBK A;  2HWV A;  2GXB A;  4GYI A;  3VYS B;  5BPD A;  4U9U A;  1GAQ A;  3CJT B;  3WHB A;  4RDJ A;  4TMT A;  1IRG A;  4QIW N;  1JKQ C;  1WGX A;  2Y0S A;  1SFU A;  1GJR A;  4E0F A;  3I0T A;  3HKZ A;  3KP4 A;  4C3H J;  3WNC A;  1KQ5 A;  4D9J A;  3VFZ A;  1X1A A;  3QPL A;  3O8G A;  2V7Q A;  2WAD A;  2R7O A;  3M8E A;  4ZGQ B;  2RN7 A;  1T98 A;  1IDK A;  2LNB A;  2GK6 A;  4AWX B;  4IX7 A;  1B9N A;  2VL8 A;  3HSR A;  4YAW A;  1S3J A;  2KJB A;  5JHF A;  3S15 J;  3PUN A;  5ICC A;  1A8P A;  2N8G A;  5B1B H;  4DYC A;  2HZD A;  3ASO H;  1WH7 A;  9ANT A;  5E8G A;  3BT9 A;  1YW8 A;  1FP1 D;  3PFY A;  4JBA A;  2H27 A;  1XG1 A;  1WH5 A;  3ECH A;  4C43 A;  4OJ6 A;  1P7J A;  4PCQ A;  4QTR A;  2A61 A;  5L46 A;  5EF6 A;  3BP8 A;  3BC8 A;  2VE9 A;  1U78 A;  3FXU A;  2V4D A;  2J5P A;  2VBK A;  3BH7 B;  3DDY A;  2VFN A;  1J9I A;  4ANJ A;  1Y56 A;  1KQ8 A;  2F1L A;  1R5O A;  3AG1 H;  1FNB A;  1K28 D;  3BR0 A;  2PJR B;  2V1U A;  5FFZ A;  4YEJ A;  1QBJ A;  4KDP A;  4IQJ A;  3PSZ A;  1IRF A;  3EUH C;  2KKO A;  2EFW A;  1X2M A;  2CUF A;  3M4O J;  2XAQ A;  1LE8 B;  3W2E A;  2L2O A;  2M4G A;  4Z06 A;  2VJI A;  5AIP A;  1Z7U A;  3CJR B;  4A69 C;  5FRM A;  2MBF A;  1ZRC A;  3CP8 A;  3RCO A;  2K9Q A;  4A3F J;  4C3I J;  1DQU A;  3DXJ F;  3RYP A;  3OS0 A;  2K7L A;  1H8A C;  2XB5 A;  4FE7 A;  2JA7 J;  4Z03 A;  2NZM A;  1X58 A;  2AHQ A;  1BPL A;  1XX5 A;  2W24 A;  3BY2 A;  2X6O A;  1BM9 A;  2F1M A;  4QHY A;  1FLI A;  1TQM A;  3ERE D;  3LMW A;  1IV8 A;  4TMV A;  3I4M J;  3A3B A;  2X1D A;  2BGC A;  3I4P A;  1OCC H;  2WB1 N;  1ZGA A;  2M34 A;  3MHP A;  2PFB A;  2NTP A;  3G3Z A;  4HX7 A;  1WOP A;  2LY2 A;  2VI6 A;  3R0A A;  3DTE A;  4HIZ A;  5E1Z B;  3BDD A;  2TRT A;  3WGH A;  3WE2 A;  2IVM A;  1I8D A;  3G1O A;  1V5G A;  1YW7 A;  3H9Q A;  1EJ9 A;  4A0Y A;  4R79 A;  2HYG D;  2L5Q A;  3Q3S A;  4PFP A;  1TQP A;  3FXL A;  5A8A A;  1OCP A;  2KP6 A;  2GM4 A;  1OIS A;  2WB1 A;  5J35 A;  3CCQ B;  2YWF A;  4PJJ A;  5LHH A;  3H9G A;  3FM5 A;  3HG9 A;  5CLS A;  3LAJ A;  3ROU A;  1EWY A;  1AMO A;  3SJP A;  1U6G A;  4EJT A;  5FO0 A;  2KRH A;  1T2K A;  2ZBV A;  1VQ9 B;  1ZQ3 P;  2ESN A;  2WA0 A;  3ASP A;  3A8J A;  1I7P A;  1QFJ A;  1SMY F;  5IYB J;  3WTT C;  3VMV A;  2I8D A;  5D5W B;  1QX4 A;  2VZL A;  5AMV A;  3OJW A;  5EGO B;  5JMC B;  1KU7 A;  2E1B A;  3LVB A;  2X9D A;  3NRV A;  4V2G A;  3C3W A;  2CND A;  1R5I D;  2VN2 A;  4B09 A;  1J75 A;  5FO1 A;  2XEX A;  1HA8 A;  2IW5 A;  2ZO4 A;  2ZSH B;  4F52 A;  3S14 J;  4XKB A;  1FWZ A;  1DPR A;  4ENM A;  4B4D A;  1FBS A;  2LG4 A;  1IDJ A;  2R7Z J;  3TP3 A;  3BR5 A;  1UMQ A;  1V5V A;  2Z1D A;  2WV1 A;  3FKI J;  2QBY A;  3T51 B;  1WI9 A;  3WE3 A;  1RWR A;  3BCB A;  3OSG A;  1WJB A;  4IZZ A;  1AKH B;  1NG7 A;  2VE8 A;  2QF7 A;  4D7N A;  2E36 A;  4ON0 A;  6PAX A;  2HOS A;  4P12 A;  2PMD A;  4RCY A;  4BPR A;  1LDD A;  2QSF X;  1HG8 A;  3GZ5 A;  3ZQQ A;  1BIB A;  1ETO A;  3BG7 A;  4MQ9 F;  1J5Y A;  1JKP C;  3ZQF A;  2HEO A;  4XNF A;  5EG0 B;  3MCA A;  2I10 A;  3ZBT A;  4ITV A;  4UZF A;  4II2 A;  4UY8 I;  1XDU A;  3R6K A;  3Q0V A;  1OFD A;  4Z4Z A;  1QA1 A;  2JSP A;  5GTH C;  4I7H A;  1B9M A;  1IB0 A;  2VBT A;  4KKT A;  5IYR A;  1OGJ A;  1APL C;  3JQP A;  1Z3X A;  2DK8 A;  1JKR C;  1FBU A;  2VFM A;  2L0K A;  4IHT A;  3ZUG A;  2LKP A;  3ZMV A;  1IV6 A;  3V4G A;  3F8C A;  3RIQ A;  3AST A;  3TOB A;  2B7B A;  4XID A;  4ZYH A;  4F7D A;  2XZO A;  5D8L B;  5FJ8 J;  3ZN0 A;  5LLQ A;  1W0U A;  1XGN A;  4YZQ A;  3GO5 A;  2Q0O A;  3GME A;  3HOW J;  2M0C A;  3VO2 A;  4IPA A;  3EET A;  4MTE A;  1EA3 A;  5IT3 A;  2XSD C;  4HLY A;  1Q86 D;  1K5C A;  5EZH A;  3BTJ A;  1D5Y A;  1BX0 A;  1T8I A;  4NBS A;  5GAG J;  3HOX J;  1FBQ A;  3FK6 A;  3OYJ A;  1T0F C;  3BG5 A;  4BXF A;  1TWG J;  1VQ8 B;  2BHZ A;  5DCM A;  3K7A J;  1T08 B;  2K9S A;  5L3E A;  5A89 A;  4DZP A;  3OYC A;  1PJ6 A;  2NT6 A;  3CP2 A;  1FYM A;  4AF7 A;  4OJ5 A;  1ON2 A;  3BY6 A;  1O3T A;  2BM7 A;  4IOC F;  4R71 A;  5FIU A;  3NE5 B;  4HNT A;  3CME I;  4PC2 A;  1Q1V A;  1KZH A;  5GP9 A;  3TP0 A;  1VQN I;  2R7U A;  2FVG A;  2CV0 A;  4X6A J;  5HVQ C;  4YFO A;  2NVQ J;  2XZP A;  1EP2 B;  2FQ3 A;  3M8F A;  1GLN A;  3OYM A;  1BW5 A;  3GVK A;  2ELH A;  3E0J B;  3OYE A;  5KAF C;  4M74 A;  1TYW A;  1G7R A;  2NSP A;  4K1X A;  1I50 J;  4ZJZ A;  2I5U A;  2CSO A;  1HW1 A;  2GJK A;  3DEE A;  2GQF A;  1O8I A;  4HZF A;  3QYB A;  2G9W A;  4AIK A;  4AU7 A;  3GLL A;  3LSH A;  4GO1 A;  4HEA 2;  2XKP A;  5DM7 F;  4IHY A;  4WWC A;  1TTY A;  4E70 A;  3JSO A;  1LFP A;  2XIG A;  1BHE A;  1EV7 A;  4M3D A;  3T53 B;  3HHG A;  4OOV A;  3IRQ A;  4NK6 A;  3H9N A;  3FY3 A;  1E3P A;  1UG0 A;  3L2Q A;  4XLP F;  5H6Q A;  1F1Z A;  1K7A A;  1DPU A;  5CKT A;  3RDI A;  2YWG A;  3GTJ J;  1K6Y A;  1K78 A;  5ED4 A;  2LK2 A;  4EQQ A;  5E8I A;  1FY7 A;  1H0M A;  3ELK A;  3H0G J;  4K2E A;  4RPB A;  1ON1 A;  4G7H F;  2Z8G A;  4Q4Z F;  1A31 A;  4HV5 A;  3MZY A;  2D74 A;  2FMY A;  3KEO A;  1W4M A;  2WAQ N;  2ZC2 A;  5EJC A;  3CCE I;  1IW7 F;  4BYY A;  3ABM H;  3LSP A;  1GVD A;  1XB2 A;  4CCL A;  1GXQ A;  4MFE A;  5E18 F;  5B66 C;  1RI7 A;  2H8W A;  1FYL A;  2PJP A;  4Z05 A;  3TW7 A;  1P6R A;  3K2A A;  3MZ8 A;  3H0D A;  4E7K A;  5F4M A;  4CQJ A;  3FIS A;  3GVA A;  4NB5 A;  1E63 A;  3ZXS A;  3VEP A;  1PJ5 A;  5BSX A;  4BKX A;  5BOX A;  3LSG A;  3AVY A;  3GQB A;  3DP7 A;  3U9G A;  3IKV A;  4G7W A;  3PET A;  4I02 A;  4RGU A;  2C4U A;  2XRN A;  2LD5 A;  2M5S A;  1EH6 A;  4FAS D;  1VF9 A;  4IHW A;  2V1N A;  3OFN A;  5J8F A;  4ABZ A;  3AL0 C;  4C2U A;  3F6V A;  1HOM A;  2CBX A;  4FET A;  1KC8 D;  2DQR A;  2W6J A;  1XSV A;  1U9O A;  1U2W A;  2HKX A;  2ECC A;  1W7P D;  4IEJ A;  4UUV A;  1VI0 A;  4AUX A;  2HQR A;  2Z99 A;  3QU3 A;  1SFO J;  1S0U A;  2HVQ A;  3CCL I;  4YDT A;  1USS A;  1JUS A;  1JJ8 C;  3QRF F;  1UEL B;  4WZT A;  2CUJ A;  1VQ6 I;  2EIL H;  3GW2 A;  4DIQ A;  1R58 A;  2P81 A;  3KP2 A;  3P9K A;  2NTB A;  4KN7 X;  1FIP A;  4P3Y A;  5J47 A;  5AN9 A;  1RUO A;  3G2B A;  2XVC A;  3K69 A;  1VQ4 I;  3DFG A;  1FT9 A;  2EZI A;  3J7Y J;  2CQX A;  3ES9 A;  3AVV A;  3DKW A;  5GAH J;  1VQ7 I;  3SXY A;  1Z3Y A;  3BG3 A;  3DEW A;  5DDG A;  1YQA A;  4XSZ F;  1AA7 A;  5IOZ A;  2ZNZ A;  4Z4R A;  2ZXI A;  4KIC A;  1OOC A;  2UV1 A;  5JHU A;  3AFH A;  3OZU A;  1TSP A;  4Z4W A;  2X0L A;  1B4A A;  4XKV A;  3DPL C;  2E35 A;  1PDN C;  2BW3 B;  5JI6 A;  2OU2 A;  2D3L A;  4RBO A;  1V4R A;  2L02 A;  2MA3 A;  1ODD A;  5E3N A;  3GVJ A;  3RSN A;  1F43 A;  5L3D A;  4A0X A;  3QYE A;  3FMQ A;  3QFS A;  3U2Q A;  2M8G X;  1A5J A;  1BI0 A;  2ADU A;  2R7Q A;  4QWQ A;  4A5M A;  3W2H A;  4YCQ A;  3KIO A;  2ZIT A;  3TBI A;  1BR1 A;  3OZV A;  4JK1 X;  2QY1 A;  3VOD A;  3M7G A;  2WYR A;  1MDM B;  2VBW A;  1LVA A;  2RQQ A;  2WAE A;  4S05 A;  4P2N A;  5KK1 A;  4CDG A;  3RKQ A;  4PC3 A;  2WZP P;  3QP6 A;  3S93 A;  1Y1W J;  4EVI A;  4V19 K;  1M1K D;  4BEH A;  3MCZ A;  3KP6 A;  2QQ8 A;  3H3V K;  4OZY A;  2XT2 A;  5BS6 A;  3GTK J;  4BHB A;  2E5Z A;  2VAS A;  2FJ1 A;  2O0Y A;  3L00 A;  4RGR A;  3GEZ A;  4AF6 A;  4XRS G;  1PYV A;  3L7W A;  1W0K A;  2XC1 A;  4BJ6 C;  4NHJ A;  1PJ7 A;  3JX8 A;  2BGI A;  4CCO A;  2MGQ A;  1M90 D;  4M1K A;  3KP3 A;  3LST A;  5A2Q K;  2E7W A;  2HNH A;  4E4H A;  3IC7 A;  2EZL A;  3CCR B;  3TO6 A;  2LF7 A;  5LD2 C;  4HBL A;  1BMF A;  2V5I A;  3H09 A;  2Q6K A;  1T95 A;  1AIR A;  1G3W A;  3NAW A;  4D5C A;  5J1R A;  3EYI A;  5JVG F;  1KQS B;  1KRH A;  2JA5 J;  2B63 J;  1QA6 A;  4M3G A;  3SQN A;  3REO A;  4FN5 A;  3GTQ J;  3CUQ C;  3BNW A;  4DBQ A;  5HLG A;  2V26 A;  2BV3 A;  2KVO A;  2ZME B;  2DFH A;  3W6J B;  4CSW A;  3BZ6 A;  4UVC A;  1RMG A;  2DFE A;  3ONU A;  4NK8 A;  4G9Y A;  1MIJ A;  4B3F X;  4Z1M A;  2ZCW A;  3ZP5 A;  1OCT C;  4PJL A;  4P5O A;  4FTH A;  1QH0 A;  2XGJ A;  5IOY A;  2K02 A;  2KL4 A;  2FRH A;  4N4O B;  1KU9 A;  4PUS A;  3DPT A;  2PEC A;  1FTZ A;  4HDV A;  5GAD J;  2IOU G;  1LEA A;  1QVU A;  4X7D A;  1V0F A;  3CW2 A;  3F3X A;  4N9I A;  1D2E A;  3PUM A;  1YI2 B;  4I09 A;  2XF6 A;  2W7N A;  2DI3 A;  3LSI A;  3FXJ A;  4FX0 A;  3HXL A;  2EZK A;  4L8J A;  3JUR A;  1E17 A;  5L3B A;  2XHK A;  2DYR H;  1EA0 A;  4Q5S F;  1DG1 G;  4HQE A;  1VQN B;  3WTW C;  2PLY A;  1MMG A;  3VSL A;  2R5Y B;  2O1D A;  2X3H A;  4G6I A;  3VMW A;  1UZC A;  3SEZ A;  1IXS B;  2W4S A;  1W34 A;  1ETY A;  1MJA A;  4W8Q A;  1OKR A;  3B8Y A;  3BRO A;  1O57 A;  3K4L A;  3OS1 A;  2HCJ B;  2HPI A;  3N05 A;  4FIS A;  4OJL A;  4HDU A;  3JAM Z;  1IG7 A;  2JSC A;  3CC2 I;  3A8K A;  3ZQH A;  1TTT A;  1SAX A;  2HFH A;  1GT0 C;  1OCR H;  3B78 A;  5TIS C;  3AL0 B;  3LQ6 A;  3K4M A;  4D7M A;  4UZU A;  2EZH A;  3L2R A;  2R7W A;  2EWN A;  1MSE C;  1BW6 A;  2QMU A;  4FXU A;  3PSI A;  2M87 A;  3RIR A;  2A6H F;  4XRM A;  3C7J A;  3OEH A;  3DU5 A;  2P4W A;  4CH7 A;  3VPR A;  3OS2 A;  1ERD A;  1UCR A;  1XGM A;  3PEN A;  3FWE A;  2O6W A;  4DQ2 A;  2KRC A;  4B1R A;  4MO7 A;  2QGG A;  4G1V A;  1FSE A;  1N25 A;  3FXR A;  2DPU A;  3CCE B;  2HGC A;  2XAS A;  4BUP A;  3IKT A;  3ZPP A;  3QPH A;  2DA2 A;  5E3O A;  1YS7 A;  4X05 A;  1B6A A;  1LKX A;  1MBK A;  1Y0U A;  4EH1 A;  1MNM C;  2O7O A;  3IWZ A;  2IS1 A;  4GXO A;  5FLX Z;  3Q3A A;  1DU6 A;  3ASQ A;  5CQE A;  4ENN A;  4N3G A;  1Z05 A;  2BSA A;  1OGI A;  2WAF A;  2NVU B;  2OCE A;  1UD3 A;  1E3Z A;  5JLX A;  3W6V A;  4BNC A;  2CC2 A;  2NS0 A;  3V7S A;  3LFU A;  3SLN A;  2GLO A;  4A3C J;  5CDF A;  4YIR X;  4XN3 A;  2W85 A;  1HF0 A;  3CO6 C;  2QQB A;  3OIQ A;  2ISY A;  3EUH A;  1JNY A;  3KLO A;  4EEF G;  2DOE A;  1NK3 P;  3TO7 A;  3MFK A;  3EQO A;  3JRB A;  3OKX A;  3JQR A;  1TBX A;  2Z16 A;  2BVN A;  2V6E A;  3CPX A;  3CCL B;  3A1Y A;  4BQQ A;  1YJ9 I;  1VQ6 B;  4A3I J;  4YC5 A;  1YJW I;  3AG4 H;  1WWX A;  3LQR A;  4II3 A;  3TDZ C;  4P96 A;  1GR1 A;  1T38 A;  2O61 A;  2QSG X;  4TMW A;  5HDG A;  2BEO A;  4PSX A;  2IGM A;  4KNY A;  1NK2 P;  2VBV A;  4QV2 A;  3K0L A;  1G59 A;  4RD1 A;  4Y7C A;  1JJ2 B;  2E60 A;  4RD2 A;  2J8I A;  4W8S A;  2MLG A;  1I27 A;  1SVL A;  2P5V A;  1VQ4 B;  3C18 A;  2CU7 A;  2EB7 A;  3ABL H;  2XF7 A;  2LVS A;  1S29 A;  1W5C C;  1OYY A;  1WI3 A;  4I99 C;  4M3B A;  1K4S A;  2X8K A;  4LBZ A;  2ZZF A;  1VQ7 B;  1JRG A;  3W2I A;  1WOS A;  5EYR A;  1PLU A;  1JXS A;  1Y8Q B;  5B5E C;  5HNF A;  1SM4 A;  4RDK A;  2VQL A;  1N77 A;  3ISP A;  3NEU A;  5E17 F;  1FPQ A;  1YJN I;  1KMH A;  4P3I A;  2WR8 A;  4B47 A;  3B73 A;  3VWB A;  1PKV A;  3SEQ A;  1V3F A;  1JUM A;  3QP5 A;  5A88 A;  2L7F P;  2R5Z B;  2R7S A;  2R7D A;  2LMD A;  3JTH A;  5IT9 Z;  5IYN A;  3SFZ A;  1XCV A;  1L3L A;  2QLZ A;  1FYK A;  1FOK A;  1UD4 A;  2ELJ A;  2YX7 A;  5TV2 A;  1HVX A;  4X0C A;  1QFZ A;  4AM3 A;  3QSY A;  1HST A;  4HPQ A;  4E7J A;  2OAZ A;  2M8E A;  3CUO A;  1NRK A;  3GTM J;  3QFT A;  1WOO A;  4NCN A;  1FNC A;  2QKM B;  2MG4 A;  3UKG A;  1WCM J;  3CUQ B;  1CF7 A;  4HX8 A;  2DOD A;  4OOI A;  4NC6 A;  1RET A;  3BH4 A;  2PX9 A;  3F22 A;  1UB9 A;  2DW4 A;  3D0S A;  2D9R A;  3CC4 I;  4MYU A;  2WTE A;  4YAF A;  3FZV A;  2OD5 A;  2DCE A;  4XOT A;  4ZDP A;  2VKD A;  5D4R A;  3A01 A;  2QSH X;  1GO2 A;  2OBP A;  3BTI A;  1K4Z A;  5BPI A;  1S9H A;  4H0E A;  2CGP A;  1JT6 A;  4XLC A;  5LRS A;  1TLL A;  3E5U A;  3GBG A;  5FFX A;  1CNF A;  1XSD A;  3S16 J;  4RD6 A;  2KIQ A;  4TV7 A;  1LM1 A;  1SEU A;  2MLK A;  1Z77 A;  5FKN A;  3IAS 2;  1QVF B;  1YX2 A;  2FBI A;  2VT2 A;  5ILV A;  3IH4 A;  2L01 A;  3V8J A;  3WOD F;  1R49 A;  2QGU A;  3VB2 A;  4HE5 A;  1KU3 A;  1FMV A;  1K83 J;  3BPV A;  2MSY A;  4WCG A;  3LJY A;  4X07 A;  4HAM A;  3KRG A;  2AXL A;  1D0Y A;  2A6E F;  3ESW B;  2DA5 A;  4L0Z B;  4IVN A;  2ZJQ F;  2XNC A;  2KQR A;  4HF2 A;  1YIJ B;  5GAE J;  3ZPL A;  2IBD A;  1PUF A;  3BR3 A;  5TGT A;  1P2F A;  1W7P B;  1BJZ A;  2BXZ A;  3A0H C;  1OB0 A;  1TYX A;  4HLX A;  4NC7 A;  4MHG A;  4B48 A;  4LBY A;  3A02 A;  1JGS A;  2BPO A;  2JA2 A;  2GWR A;  3OJX A;  2DU9 A;  3AKZ A;  1QPM A;  4ASN A;  2LOO A;  1W5T A;  3IL2 A;  1RR8 C;  3KLN A;  3ZQI A;  2R7X A;  1B8I A;  4CZC A;  5TJJ A;  4L5I A;  2ZBU A;  3VST A;  4N4N B;  3M07 A;  2Y0S N;  1E0E A;  5LEJ A;  1W35 A;  1IXR C;  1U5T C;  1IC8 A;  4PGG A;  5M5W J;  4RAZ A;  4UUS A;  5JBQ A;  2DA1 A;  3OSF A;  2DJI A;  2G7H A;  4RGX A;  3J81 k;  4JP0 A;  5GTI C;  1BI3 A;  2FX0 A;  1VQK I;  2GBY A;  2K9N A;  1N0U A;  4PMH A;  4PC6 A;  5LHI A;  1KK0 A;  3N97 A;  1ZYR F;  1YIO A;  2EJR A;  2E7X A;  1T0F A;  5IP7 J;  4N3N A;  1KCC A;  1Z6R A;  1Z6T A;  2BZT A;  1Y8R B;  4WZE A;  1KK2 A;  2ACJ A;  3CC2 B;  2XNJ A;  3FBN B;  2E71 A;  3CCU I;  2Z2S B;  4P26 A;  2DO7 A;  3NAR A;  3WTX C;  4I0A A;  3BZK A;  3A2K A;  1T39 A;  1F20 A;  2R7T A;  4G5G A;  3F8B A;  3M1C A;  3BJO A;  3I71 A;  4A0Z A;  1NBM A;  3MAJ A;  2PI0 A;  1K79 A;  1O8D A;  4U0V A;  4A3G J;  3HHH A;  4EMS A;  4OIO F;  1NHA A;  1FDR A;  1HDD C;  2FSW A;  2VPR A;  2A5Y B;  3ZPN A;  3BQZ A;  3SY2 A;  2KIM A;  3DCF A;  3H5R A;  3LMM A;  4BXX J;  3OYF A;  3ZMU A;  1NG6 A;  2VFP A;  4LD5 A;  4ZYA A;  1JT0 A;  1NHC A;  2DDB A;  2LLK A;  1U0J A;  1G2H A;  2D2W A;  2CRG A;  2KFD A;  4E6K G;  1CLW A;  1DDG A;  4RGS A;  2C5H A;  1A36 A;  2XPU A;  4EJO A;  1WPK A;  4KYW A;  3E3V A;  2DEU A;  2QZ8 A;  2HTS A;  2P7V B;  3EUK L;  4ZYD A;  1MMS A;  4QFM A;  4EGY A;  3HGY A;  2BE5 F;  2X1C A;  5DD8 A;  5FGM A;  4J00 A;  1G7S A;  5FRN A;  4CYD A;  3CD6 B;  2BY2 A;  1FP2 A;  4MTD A;  1IDY A;  3H35 A;  3I55 B;  1BJA A;  4PJ0 C;  4PJM A;  2O17 A;  4B3G A;  4V02 C;  2OTJ B;  1R7J A;  2Q2E B;  4Y9U A;  3GQA A;  2X6Y A;  1H42 A;  2JJ1 A;  2JUG A;  2CW0 F;  3I5U A;  4BGD A;  3GTG J;  2KZG A;  2M0M A;  1AOY A;  5ICE A;  1B23 P;  1P92 A;  5FRO A;  5IP6 A;  2VQG A;  4LLN A;  1K8A D;  1FMW A;  4F7Z A;  5JVT A;  2XSJ C;  3SDB A;  1P7I A;  3KFW X;  1DGR M;  1Q7Y D;  4HST A;  1TL8 A;  4Y15 A;  1BR2 A;  3BTL A;  4JMQ A;  1XMA A;  4BAC A;  2H1K A;  4BXU A;  1TYV A;  4L9N A;  4LGW A;  1REP C;  1H80 A;  3CXC B;  4LMY A;  2LKS A;  4CZZ A;  4A3E J;  1PXZ A;  2CFO A;  1X1P A;  2L7K A;  3RKY A;  4DOZ A;  3D26 A;  2NVY J;  2QTL A;  1YRN A;  4RJL A;  4ASU A;  4LG0 B;  4OU0 A;  2CF4 A;  2BXY A;  3MEX A;  2YPR A;  3CMY A;  2A68 F;  2KDO A;  3CZ6 A;  4BQA A;  1CQX A;  3BH6 B;  1KJZ A;  2I1L A;  3DBL B;  4P9S A;  2QEX I;  4A3K J;  1IZ1 A;  1X4O A;  3QU6 A;  3U2R A;  5GV7 A;  1NJI D;  3G4S I;  3OOU A;  5HZA A;  3CCJ I;  5FD6 A;  2LDU A;  1WHU A;  1QZY A;  5KHD A;  3MQ0 A;  3WND A;  1XN7 A;  1AIP A;  3QOD A;  2NST A;  4IL6 C;  1SFX A;  1J2X A;  3SZG A;  3I59 B;  2R7V A;  4KFC A;  1H88 C;  1A6Q A;  4NQW A;  1C0W A;  4I0B A;  4UV9 A;  2LYC A;  3RQ4 A;  1XQB A;  1WMR A;  4G8X A;  2J5O A;  4OWR B;  4CYC B;  1TUI A;  3ZZT A;  3CCV I;  2XB0 X;  1XTA A;  1Z21 A;  4NUB A;  3SJZ A;  4P55 A;  1SD4 A;  1SC7 A;  1WTH D;  3NB2 A;  3WTY C;  1UMK A;  1R22 A;  3CC4 B;  2EFP A;  5J40 A;  1VQL B;  3OR1 C;  3IRR A;  2WZN A;  1SFK A;  5E20 A;  2JPB A;  4UB8 C;  1LLW A;  4GFB A;  3W6K B;  1D8T A;  1OGO X;  1U5T B;  2CW8 A;  4ZC3 A;  1S5L C;  2E1M C;  1YLO A;  2XND A;  4FE4 A;  2FEZ A;  4LBW A;  3UNG C;  1ITY A;  3GQ7 A;  2H8R A;  2Z6B D;  1TT0 A;  4P6Y A;  2VNJ A;  2V4J C;  1YOV B;  3BJ6 A;  3WTV C;  1MJ9 A;  5M3F J;  3J7A Y;  4WXC A;  4C2M J;  1ZM3 A;  2XTX A;  3F6O A;  1K8F A;  3WGI A;  4LK1 F;  1QZE A;  3SHF A;  4UZE A;  2V7X A;  4XMY A;  1MKM A;  1D3Y A;  1CQT A;  4BBR J;  1BR4 A;  2EIN H;  2ZJ2 A;  5LRR A;  5C44 J;  2DQL A;  2WBM A;  2BYV E;  3P9I A;  4XOR A;  1XD7 A;  2LY1 A;  3WU0 A;  1ONV A;  2EPF A;  1E62 A;  1GVJ A;  2JRM A;  2L4M A;  4GCV A;  2BF4 A;  2R93 J;  2K4B A;  2YR2 A;  1ZN2 A;  2WJY A;  1XSX A;  2HLD A;  3EQL F;  4I98 B;  2BM1 A;  5BQT A;  2W82 A;  3HIF A;  4F55 A;  3HYI A;  1PE9 A;  2O0W A;  4CCM A;  4KMU X;  4Q48 A;  2OF7 A;  3HDD A;  4OOX A;  5DCF A;  4OMY A;  4ZH4 F;  3PQK A;  2Q6O A;  5E3L A;  1ZRF A;  1PUE E;  2VFO A;  4MEY F;  4F92 B;  2OJE D;  3S1Q J;  1O8K A;  4PGO A;  3HGG A;  5EDN A;  1G3S A;  5D4S A;  1BL0 A;  2JVG A;  2ZKZ A;  4IOA F;  1X1C A;  4OAY A;  4YFK F;  1IUF A;  1VQK B;  5M5Y J;  1R5N A;  4P9F A;  3TL4 X;  3FJO A;  3JU4 A;  4X7F A;  3OPO A;  4DNT B;  3PUF A;  3GF2 A;  1ZG3 A;  3JRI A;  2QA4 I;  3LL7 A;  4FCY A;  3OE7 A;  2R92 J;  2UZK A;  2JZY A;  5DN6 A;  2G0E A;  2E19 A;  2OQR A;  2VNI A;  4H4K C;  3RQI A;  3QFR A;  1SD5 A;  5C4X J;  1ZR2 A;  3H3Z A;  3LA3 A;  5HNH A;  3ZZ0 A;  2K9L A;  3MN2 A;  2NT9 A;  3GQ9 A;  2CQQ A;  2J8K A;  1MW7 A;  4DYQ A;  3WWG A;  5EMN A;  3CCU B;  3JRD A;  2HR3 A;  4X7E A;  2STT A;  2GXA A;  3R6S A;  5FO5 A;  2KJC A;  3TO9 A;  1WSU A;  2R6H A;  2LKX A;  4BY7 J;  3ZQC A;  2O5R A;  3FMR A;  1FEX A;  1UHM A;  3QAH A;  2ZB9 A;  4IQ4 A;  3JRG A;  4KIB A;  1SKQ A;  3CES A;  1TLH B;  5B3S H;  2ZME C;  3VYT B;  1DDI A;  1QFY A;  4RCZ A;  4C2L A;  1STZ A;  2MD0 A;  4YAL A;  1ZH5 A;  2QE7 A;  2F4I A;  4YHB A;  2VBS A;  2CUZ A;  2L9R A;  3W2W A;  2F6C A;  3KP5 A;  3RI4 A;  5F0F A;  2CUE A;  2F5F A;  3F8F A;  1ZGW A;  2XOK A;  1HF2 A;  1D0X A;  2LBF B;  5J3O A;  4EM0 B;  2RNJ A;  3HRM A;  1JB9 A;  1BQE A;  2BSP A;  1U8R A;  2MC4 A;  2NNN A;  4P25 A;  2KIU A;  2GIV A;  4CHU A;  4BDY A;  4ZDO A;  3CMA I;  3HUG B;  3J81 Z;  4E7I A;  1HXD A;  1FSH A;  1F5T A;  3C2B A;  4A6D A;  4UAJ A;  5AIQ A;  1NB9 A;  3DV8 A;  2DLL A;  2OZU A;  2DFF A;  2PIA A;  3OYI A;  4YEL A;  3BQY A;  2VIX A;  3DEU A;  2VBX A;  2PMH A;  2BHY A;  3CDI A;  3K1P A;  4DGW B;  4ENJ A;  4G94 A;  2G7U A;  4RM2 A;  1AU7 A;  2DXI A;  2DCU A;  1TZL A;  2W1O A;  2VOD A;  4QVJ A;  1E79 A;  1E3H A;  3GTO J;  4DYR A;  1WJC A;  1Z0X A;  3K4B A;  1ORK A;  2XF5 A;  3KZZ A;  3LOC A;  4EV0 A;  3PO3 J;  1KTW A;  4PC1 A;  2PG4 A;  2HVR A;  1OYI A;  2OV7 A;  3K4N A;  1U8B A;  3I9V 2;  2B7C A;  4M3E A;  2VKV A;  1Q82 D;  4AVP A;  2IP2 A;  1B59 A;  3KYL A;  3G73 A;  4BE1 A;  1CGP A;  1IN4 A;  2XTY A;  4HRI A;  5C1E A;  1J9Z A;  3G71 I;  1QA3 A;  2JRT A;  3JRA A;  3HOS A;  4WK8 F;  4U7B A;  1W36 D;  3T56 B;  5A2Q Z;  2VOO A;  1QRB A;  3WU2 C;  1GVH A;  1H89 C;  4UXN A;  1O8F A;  1I3A A;  3G1M A;  3PNY A;  4X8I A;  1I3Q J;  4HF0 A;  3AG2 H;  2Q1Z B;  4PJN A;  2O8K A;  2E1M B;  5GPC A;  2QEX B;  3EUA A;  3KEQ A;  5F1J A;  1I6X A;  1VHO A;  3G4S B;  3H5N A;  5E6T A;  3CCJ B;  1R36 A;  4M72 A;  1JGG A;  1GAW A;  3V76 A;  2TDX A;  3D5R C;  5CVI A;  1ZTR A;  2X51 A;  3ABU A;  1R1U A;  3OOP A;  3Q6R A;  1QVT A;  1YX3 A;  4KT5 C;  5HXB A;  1KTV A;  1G3Y A;  2PJR A;  5HZB A;  2EV5 A;  2O03 A;  3B02 A;  2Q8K A;  4XKW A;  2BX6 A;  3E6B A;  2F4O B;  2AXT C;  2DMP A;  2ETH A;  1LE8 A;  4PFO A;  1YIT I;  3OYB A;  4G12 A;  4NBQ A;  2QM3 A;  1U2R A;  2BM0 A;  3CCV B;  1YYV A;  3DLL F;  3KP7 A;  2ELK A;  2FNA A;  1Y0N A;  4RD3 A;  1IB4 A;  2ZL7 A;  2PYH A;  4JYK A;  1VQP I;  2XAG A;  4Z6Y A;  1E1Q A;  5F4J A;  4YXW A;  2ZJR F;  3B82 A;  1IF1 A;  2V79 A;  4XBF A;  3PO2 J;  1I1S A;  1WOR A;  3GFJ A;  2C77 A;  1O8G A;  1YG2 A;  3ZMS A;  1VND A;  2V9K A;  2VBM A;  3AVX A;  1J7K A;  3BG9 A;  1YO5 C;  1TVC A;  3LYC A;  3J7A O;  1POG A;  3DKY A;  1HLV A;  3W2G A;  4C9Y A;  2P6T A;  2GK7 A;  1FNM A;  2CWE A;  3IP4 B;  4DZJ A;  2MD5 A;  2RC5 A;  3HPH A;  3ASR A;  1HDP A;  4KKU A;  1D8K A;  1SVO A;  3ONY A;  1YW9 A;  1VLY A;  1OR7 A;  4EM2 A;  5GV8 A;  4QPO A;  4XL9 A;  2EV0 A;  5KAI C;  2VNH A;  2V7T A;  2AO9 A;  3DLA A;  4P6V F;  4EW9 A;  3L2V A;  1FTT A;  1FOY A;  2F5D A;  4C0S A;  4M6Y A;  4JOM A;  2PMZ A;  1ELO A;  4M2L A;  3TOA A;  5F1R A;  4FX4 A;  4ENK A;  1W0T A;  1LQ1 A;  4RD0 A;  1OB5 A;  1MBE A;  1LB2 A;  3OW7 A;  4EJV A;  3S3N A;  2HDW A;  2KPM A;  3E5X A;  1IUY A;  3VNV A;  1N06 A;  5K7Z A;  3JRC A;  2CG4 A;  2IGO A;  2JT1 A;  3LQE A;  1BN8 A;  3DPU A;  2HPM A;  4E7S A;  1Y6I A;  3S2W A;  2P5K A;  1BC7 C;  2MH2 A;  2XC7 A;  5DTD A;  2QQ9 A;  3CTA A;  4A93 J;  3BCF A;  1YE9 A;  5D5U B;  2KDZ A;  3ZBU A;  5KSW B;  2FU4 A;  2M7B A;  5EGO A;  4PZJ A;  4XN0 A;  2HQ5 A;  2ZSI B;  1KYZ A;  4RB2 C;  1R71 A;  1Q1H A;  3RYR A;  4R8H A;  1W2B B;  3Q0U A;  2DY1 A;  2A6T A;  3G05 A;  3B8H A;  2L7M P;  3UR3 C;  3KEY A;  3MMY B;  4IRH A;  2P7C B;  1ZM2 A;  3OW2 B;  5FA6 A;  1BJK A;  3AAF A;  1YX5 A;  2QA4 B;  2FD5 A;  2KT0 A;  2RKH A;  4I76 A;  1E2X A;  3I58 A;  1I39 A;  4L0Y B;  1HKT A;  1FRN A;  2BMW A;  2Q6I A;  4WQM A;  2TCT A;  3B4N A;  4ZCI A;  1O7F A;  5ICF A;  3KEW A;  5LMZ A;  2VBU A;  3F9K A;  1SAU A;  2VC1 A;  4HOB A;  3OY9 A;  2IS6 A;  2K40 A;  4KKS A;  3CME B;  1DDN A;  2JJ7 A;  2PYG A;  1TQI A;  2LF8 A;  2YU3 A;  3A03 A;  4XLE A;  2DER A;  2OCC H;  1AKH A;  5IPA A;  1G7T A;  4OPS A;  2EH3 A;  2EFN A;  5EEH A;  4I6Z A;  1WSR A;  1Z9C A;  2XUB A;  4ZZD A;  1UST A;  2RQP A;  4G6D A;  2YX4 A;  4G1B A;  3CF2 A;  2FUG 2;  1V5E A;  2VXZ A;  4WXD A;  1F9N A;  3VYR B;  1WZ2 A;  5J4Y A;  2KIF A;  5EG0 A;  2VBZ A;  3JW4 A;  4EJW A;  1VQ5 I;  3SKB A;  2R0Q C;  1S8N A;  4MXN A;  2CV1 A;  2OK8 A;  1OFE A;  4BE0 A;  4I2O A;  2ZL5 A;  3W3C A;  3PFI A;  4Z4T A;  4XKC A;  1CZF A;  2D5V A;  3PIO F;  3OP1 A;  1MZB A;  2LP0 A;  2H94 A;  4PAA A;  2HOE A;  3IUO A;  1W36 C;  1RUN A;  3S2D J;  2AS5 F;  3ABT A;  1BBY A;  4U87 A;  2YWH A;  1ULY A;  1LPQ A;  4UVA A;  2ID3 A;  4DK1 A;  3CF5 F;  2BBY A;  5D5X B;  1OCZ H;  2KMU A;  2NXN B;  1FC3 A;  1OFL A;  4YFN F;  3OIO A;  1V55 H;  5IYP A;  1D0Z A;  2O9L A;  1Z1D A;  2MAB A;  4KN4 X;  3PNT A;  4URR A;  3EYY A;  3WU1 B;  3CO7 C;  3CMA B;  2X48 A;  4HSR A;  2FNP A;  2NAZ A;  2GPJ A;  2F3L A;  4PAB A;  3X2Q H;  2ZJP F;  1MGT A;  4IHV A;  2INU A;  3QWL A;  3OIP A;  1TYU A;  4O6J A;  5J6X A;  5TY0 A;  1RPW A;  3T5X A;  4TMZ A;  3K70 D;  2DAO A;  3JCU C;  1ZR4 A;  1BI1 A;  3MVP A;  4UNO A;  4YAU A;  2AQF A;  2PMU A;  3B6A A; 
#chains in the Genus database with same CATH homology
 2CW7 A;  4E7Z A;  4HG2 A;  4XNF A;  4Y33 A;  3DTI A;  3FBN B;  4ITV A;  2WY7 Q;  4II2 A;  2Z2S B;  1WJD A;  2GOM A;  2JSP A;  4B3X A;  2IQ7 A;  4MR0 A;  3A2K A;  3HPG A;  2X6X A;  4PSW A;  4KKT A;  2UVE A;  2R7T A;  1Z3X A;  1IRX A;  2CH0 A;  3M1C A;  1NBM A;  1O8D A;  1OFM A;  4LIT A;  4F3Q A;  3DWL E;  2NOJ B;  3MKY B;  4KJZ A;  2F43 A;  3MD2 A;  2X6W A;  2XZO A;  3DU6 A;  2DT6 A;  3ZPN A;  3IAM 2;  4YZQ A;  3LMM A;  1MMN A;  3H5R A;  3OYF A;  1NG6 A;  3OAA A;  4ZYA A;  1NHC A;  1EA3 A;  2LC2 A;  1U0J A;  3A3G A;  1K5C A;  3BCD A;  2MFZ A;  4E6K G;  1OGM X;  1R6R A;  2ZZE A;  2A5W A;  1QHH D;  2UWM A;  3S32 A;  1N75 A;  2GJP A;  3FDY A;  2K9M A;  3OYJ A;  1T0F C;  2VPL A;  4BXF A;  3EUK L;  2LRD A;  2X1C A;  2VBE A;  4J00 A;  3K6G A;  2ZZG A;  4OAZ A;  5FRN A;  3OYC A;  2RRE A;  3CP2 A;  3ZCO A;  2NT6 A;  4OJ5 A;  3H35 A;  2VXD A;  3HC7 A;  3EPZ A;  4PJM A;  4RMN A;  3HL2 A;  3A35 A;  2LRE A;  4HNT A;  3NE5 B;  4B3G A;  1D1B A;  2O17 A;  2Q2E B;  3GQA A;  1MND A;  2R7U A;  2ZXH A;  2X6Y A;  4BU2 A;  2CV0 A;  2JJ1 A;  5HVQ C;  2JUG A;  4BGD A;  2X53 S;  3RTR A;  2XZP A;  2M0M A;  4F93 B;  1V0E A;  4TKO B;  1D1A A;  5FRO A;  1GLN A;  3OYM A;  2VQG A;  4U49 A;  1D1C A;  1FMW A;  3GVK A;  3E0J B;  3OYE A;  2BOL A;  2XSJ C;  2R4G A;  3SDB A;  1KZL A;  1X1B A;  2NSP A;  5KNL A;  1DGR M;  4ZJZ A;  1UD8 A;  2GJK A;  3DEE A;  2VJJ A;  4HST A;  1O8I A;  2GOX B;  3I3L A;  3QYB A;  1BR2 A;  4AU7 A;  4JMQ A;  1UD2 A;  4HEA 2;  3LSH A;  4BAC A;  2KLO A;  1LFP A;  4E7H A;  1BHE A;  3T53 B;  2HQA A;  1H8E A;  4NK6 A;  3FY3 A;  1UG0 A;  1H80 A;  3L2Q A;  2F5V A;  4J01 A;  1PXZ A;  5CKT A;  4HWV A;  2CFO A;  3OYN A;  2L7K A;  4DOZ A;  1K6Y A;  4W8T A;  3VSV A;  4ASU A;  2UUZ A;  1BOB A;  1V5F A;  3LNN A;  3OYH A;  3ZSC A;  1WJ5 A;  2KDO A;  1O88 A;  2Z8G A;  4JQF A;  3CZ6 A;  4OZZ A;  3KX2 A;  4U4B A;  4E7L A;  2IS2 A;  1J09 A;  4CCL A;  2ZTN A;  3GRH A;  1X4O A;  4Z05 A;  3OYG A;  3OOU A;  4E7K A;  4F91 B;  2VB6 A;  3H0D A;  5KHD A;  3MKW B;  2ODL A;  3GVL A;  4RLQ A;  3M8J A;  3ZXS A;  4AYB A;  3QOD A;  2NST A;  1LVK A;  3LSG A;  2DOA A;  1WJE A;  2BW3 A;  5KCM A;  3SZG A;  3GQB A;  3OR2 C;  2R7V A;  2QKL B;  4BL0 B;  4TSF A;  4G7W A;  3SUC A;  3RQ4 A;  2LYC A;  1WMR A;  2RNG A;  2CS3 A;  4C2T A;  4FAS D;  2M5S A;  4OWR B;  2V1N A;  3OFN A;  1Z21 A;  4NUB A;  3AL0 C;  3VDX A;  1Z7L A;  4C2U A;  4I84 A;  1VZ0 A;  1DP3 A;  1EFR A;  4FET A;  2QX3 A;  1WTH D;  2W6J A;  3QOE A;  3A4C A;  3DTK A;  3OR1 C;  4D1Q A;  4XLH A;  3S3O A;  1BLI A;  5C1C A;  1SFK A;  4YRV A;  1O8H A;  2HVQ A;  2BVM A;  1O8L A;  1UEL B;  2CUJ A;  1WJF A;  3ONQ A;  3K70 C;  1OGO X;  1HG8 A;  4YZX A;  3VSU A;  4DIQ A;  2CW8 A;  4P22 A;  4ZC3 A;  4YZA A;  2E1M C;  2XND A;  1KCD A;  1O8J A;  2NTB A;  3PJR A;  3UNG C;  4OJP A;  2UVF A;  2KHM A;  2Z6B D;  3GQ7 A;  1JI8 A;  3K4J A;  3G2B A;  1TT0 A;  2V4J C;  3J7A Y;  1W0J A;  2WY8 Q;  1WFX A;  5IK2 A;  2VQC A;  4XLA A;  1Z3Y A;  3LSK A;  3OL4 A;  3WQZ A;  1AA7 A;  4XLF A;  2M3A A;  3OEE A;  3CJQ B;  4BE2 A;  4XR6 A;  2ZXI A;  2AQE A;  4XMY A;  1OOC A;  3OOC A;  2UV1 A;  1BR4 A;  3ZIA A;  5HKK A;  3AFH A;  2WBM A;  4XOR A;  2CMP A;  2LY1 A;  4XKV A;  2QXZ A;  2XAU A;  3DPL C;  4XM3 A;  2IGN A;  2BW3 B;  3D5L A;  2D3L A;  2WJY A;  3B90 A;  1VJS A;  2IGK A;  4LIV A;  2HLD A;  3ZR8 X;  4NQW B;  3MKZ A;  3GVJ A;  3RSN A;  3BCA A;  2W82 A;  4F55 A;  3UW0 A;  1PE9 A;  2O0W A;  4CCM A;  3OMY A;  3QYE A;  4BS9 A;  2R7Q A;  2WSS A;  2ZFU A;  3OYA A;  2VLA A;  2DT7 B;  1GQ8 A;  3TBI A;  3BC9 A;  4F92 B;  1BR1 A;  2LBF A;  1O8M A;  1O8K A;  1WJA A;  1G8X A;  2QY1 A;  2X1E A;  3H94 A;  2JVG A;  2RQQ A;  2WAE A;  1X1C A;  3NWS A;  4MLO A;  2K5C A;  4OAY A;  1EE6 A;  4CCN A;  2WZP P;  2JVH A;  3S93 A;  3SYT A;  4B44 A;  4AVZ A;  4BEH A;  3TL4 X;  3JU4 A;  3OPO A;  4DNT B;  3RPU D;  3OE7 A;  1I18 A;  3LL7 A;  4OZY A;  5DN6 A;  1E3X A;  2E5Z A;  2VQH A;  2VAS A;  2VJ4 A;  4H4K C;  4Y4R A;  2P0W A;  3V42 A;  2D3N A;  3OWT A;  1PYV A;  5HNH A;  1W0K A;  2K9L A;  3K10 A;  4LG3 A;  4B43 A;  3VR6 A;  4BJ6 C;  2NT9 A;  1MW7 A;  3GQ9 A;  3WWG A;  4CCO A;  3GQ8 A;  3D5S C;  4DJA A;  1FX0 A;  1VF7 A;  5LFA A;  4G7X A;  2HNH A;  4E4H A;  1QU3 A;  2O5R A;  1OLT A;  4BQN A;  5LD2 C;  1BMF A;  1KON A;  3PUB A;  1T95 A;  4IQ4 A;  4GRI A;  2CK3 A;  1AIR A;  3VYU B;  3CES A;  5HLT A;  1OHH A;  2HU9 A;  3VYT B;  3OYL A;  4C2L A;  2MD0 A;  2QE7 A;  4C30 A;  2F4I A;  4DBQ A;  2V26 A;  2CUZ A;  3W2W A;  3PNV A;  2KVO A;  2F6C A;  2CV2 A;  3FPP A;  4BDZ A;  4CSW A;  1P9Q C;  3BG6 A;  2XOK A;  2VJ5 A;  1RMG A;  3NWT A;  1D0X A;  3C2H A;  2LBF B;  4NK8 A;  4B3F X;  4Z1M A;  4ZTF A;  4ZDL A;  4PJL A;  4P5O A;  4CUG A;  2XGJ A;  4DK0 A;  2KL4 A;  3L2U A;  2MC4 A;  4N4O B;  2BSP A;  4PUS A;  3DPT A;  4BJT A;  2JJ2 A;  2PEC A;  4BEH B;  2WJV A;  4BDY A;  1V0F A;  1X19 A;  4ZDO A;  2X85 A;  1OR7 C;  4XOP A;  3HUG B;  2XF6 A;  2W7N A;  4E7I A;  3LSI A;  2XZL A;  3HXL A;  3JUR A;  4L8J A;  1UD6 A;  4XD7 A;  1RU4 A;  2IXS A;  3LSM A;  4P1W A;  4Y3O A;  3DKX A;  4OJO A;  1MMG A;  3VSL A;  3OYI A;  1XG2 A;  2O1D A;  4YEL A;  4G6I A;  2V7F A;  2X3H A;  3VMW A;  3SEZ A;  2VIX A;  2W4S A;  4CCK A;  1COW A;  4XON A;  1WPC A;  4W8Q A;  3B8Y A;  3ZRG A;  4DGW B;  2LH9 A;  3K4L A;  3OS1 A;  4DNR B;  2HPI A;  3N05 A;  4RM2 A;  2DXI A;  3CMM A;  1MAB A;  4GQN A;  2GJR A;  1TZL A;  4OJL A;  2W1O A;  3DQV C;  1T5E A;  1WP6 A;  3FKS A;  1E79 A;  1WJC A;  3K4B A;  2XF5 A;  2W6I A;  2E5N A;  1KTW A;  4KIS A;  2HVR A;  3AL0 B;  2OV7 A;  2EWE A;  3K4N A;  3K4M A;  3I9V 2;  3ZGK A;  4UZU A;  3W2V A;  3L2R A;  2R7W A;  3E1S A;  4KIT B;  3KYL A;  4BE1 A;  3PSI A;  3S3M A;  2HVS A;  4FXU A;  4HRI A;  5C1E A;  1UAA A;  3OEH A;  3DU5 A;  4CH7 A;  4PK4 A;  3HOS A;  3OS2 A;  4U7B A;  1W36 D;  1ERD A;  2R9V A;  3T56 B;  1QCX A;  2KRC A;  1O8F A;  1X0C A;  3PNY A;  2OUM A;  3HOT A;  2Q1Z B;  4PJN A;  4X0G A;  3T9G A;  2E1M B;  3C2G A;  4BUP A;  3ZPP A;  4CCJ A;  3EUA A;  1MMA A;  4W8R A;  3BLY A;  2DIE A;  1LKX A;  2NTQ A;  2W00 A;  2BVL A;  3H5N A;  1QJV A;  1VBL A;  2IS1 A;  1LDK B;  3D5R C;  2L9N A;  2X51 A;  3VYS B;  5CQE A;  2VKH A;  1YX3 A;  2PJR A;  2WAF A;  4XKW A;  1UD3 A;  1E3Z A;  1ZEL A;  2Y0S A;  3VSK A;  3LFU A;  4E0F A;  4PFO A;  2JDI A;  5CDF A;  2M7A A;  4CA0 A;  4XN3 A;  3OYB A;  2MYS A;  3HKZ A;  1HZE A;  3OIQ A;  4D9J A;  1X1A A;  2M4K A;  2V7Q A;  1IB4 A;  2WAD A;  2R7O A;  3FBI B;  5HOO A;  2PYH A;  3EQO A;  1E1Q A;  4YXW A;  1IDK A;  2KZV A;  2GK6 A;  2Z16 A;  4IX7 A;  2V6E A;  3A1Y A;  4BQO A;  4BQQ A;  1O8G A;  2VL8 A;  3EQN A;  1JTA A;  5JHF A;  4RM3 A;  2V9K A;  4II3 A;  2VBM A;  3W2A A;  2HZD A;  4PSX A;  2IGM A;  4DBR A;  1G59 A;  3DKY A;  3PFY A;  2R7R A;  1SKY B;  1DGW Y;  2E60 A;  4C9Y A;  4W8S A;  2GK7 A;  1N78 A;  3HAG A;  3IP4 B;  4KKU A;  2XF7 A;  4OJ6 A;  3HPH A;  2X8K A;  2XDV A;  4G6T B;  2ZTG A;  4RLF A;  2ZZF A;  1VLY A;  1JRG A;  4QPO A;  4XL9 A;  1H8H A;  3BC8 A;  4TT3 A;  1PLU A;  3DLA A;  4EW9 A;  2V4D A;  5HNF A;  3L2V A;  1QHG A;  2VQL A;  2PMZ A;  3H9J A;  4JOM A;  1N77 A;  3DDY A;  5CQG A;  2VBK A;  3S8P A;  4ANJ A;  1Y56 A;  1KMH A;  3OW7 A;  4B47 A;  1K28 D;  3VWB A;  2PJR B;  3S3N A;  4YEJ A;  2HDW A;  2KPM A;  3SEQ A;  1PKV A;  2R7S A;  4IQJ A;  1MMD A;  3EUH C;  4BJ5 C;  3L2W A;  3H5A A;  1UD4 A;  2IGO A;  2K3P A;  2ELJ A;  1BN8 A;  2L2O A;  2M4G A;  3DPU A;  2HPM A;  4E7S A;  1E43 A;  4Z06 A;  1Y6I A;  2VJI A;  1MNE A;  1HVX A;  2XC7 A;  3BCF A;  3CJR B;  1YE9 A;  4HPQ A;  4E7J A;  5FRM A;  3CP8 A;  3RCO A;  2M7B A;  1O8E A;  2O04 A;  4XN0 A;  1NRK A;  2ZSI B;  1DQU A;  3OS0 A;  3PL8 A;  2QKM B;  4Z03 A;  2NZM A;  1BPL A;  2F1M A;  2A6T A;  2ZZQ A;  3BH4 A;  3G05 A;  3UR3 C;  1PJR A;  3KEY A;  3MMY B;  2JIZ A;  3LMW A;  3A3B A;  3OYD A;  2X1D A;  4NNJ A;  1YX5 A;  3PSF A;  1IA5 A;  2DCE A;  4KT6 A;  4XOT A;  4ZDP A;  2NTP A;  2VKD A;  2LZJ A;  3B4N A;  1E1R A;  3KEW A;  1S9H A;  4KKS A;  3F9K A;  1SAU A;  2LY2 A;  4XLC A;  3OY9 A;  2IS6 A;  2O0V A;  4HIZ A;  3DTE A;  3GBG A;  1X4P A;  2INV A;  2PYG A;  3OL3 A;  4XLE A;  3IAS 2;  3TMO A;  1I8D A;  5FL7 A;  1V5G A;  3H9Q A;  4R79 A;  4LIU A;  2L5Q A;  3K4C A;  1X1D A;  4PFP A;  1DBG A;  1FMV A;  3CF2 A;  2FUG 2;  1V5E A;  2KP6 A;  2VXZ A;  2WB1 A;  3VYR B;  3FKJ A;  4PJJ A;  4NC8 A;  3KRG A;  4MXN A;  3H9G A;  1D0Y A;  3HG9 A;  2CV1 A;  4BE0 A;  3W3C A;  4XKC A;  2KQR A;  2KRH A;  3FHN A;  1OB0 A;  1CZF A;  5TGT A;  2WA0 A;  4NC7 A;  4B48 A;  3IUO A;  1W36 C;  2JA2 A;  2I8D A;  3VMV A;  4QPQ A;  5AMV A;  3AKZ A;  4IKF A;  4XQF A;  2LOO A;  2L9S A;  4U87 A;  3U21 A;  2E1B A;  2WAQ A;  2R7X A;  4HNU A;  4DK1 A;  4CZC A;  3K4K A;  2KMU A;  2WPD A;  1OFL A;  3VST A;  4N4N B;  5CPR B;  1E0E A;  1HA8 A;  1UD5 A;  1D0Z A;  2ZSH B;  4F52 A;  4XKB A;  2MAB A;  3PNT A;  1W9X A;  1DBO A;  4URR A;  1IDJ A;  2LG4 A;  4ZTJ A;  2DJI A;  4HSR A;  2V31 A;  3OYK A;  2Z1D A;  3T51 B;  1RWR A;  3BCB A;  3QYF A;  2INU A;  3OIP A;  4PMH A;  1WJB A;  4IZZ A;  1NG7 A;  4EAT A;  3K70 D;  2IS4 A;  2AQF A;  2OC6 A;  3ZQQ A;  4YZ0 A;  3BG7 A;  1KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...