4XQFA

Tailspike protein mutant e372q (delta d470/n471) of e. coli bacteriophage hk620
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
594
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 594
sequence length 598
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xqfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xqfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xqfA02
1RWRA 2PECA 1O8HA 3UW0A 4OJLA 1O8KA 1OOCA 2EWEA 1IB4A 1CZFA 2INVA 4XNFA 1EE6A 1O8IA 1O8GA 3B8YA 1WMRA 1O8LA 3GQAA 4Z06A 4YEJA 4OJOA 4MR0A 3GQ7A 3VMWA 4C2LA 3VSTA 3T9GA 3VSVA 4W8QA 4XKVA 4XR6A 2QY1A 4OZYA 1BHEA 1JTAA 4HWVA 4YZQA 4U49A 2O04A 2NT6A 2NTPA 4YELA 4XLFA 1RU4A 2BSPA 3EQOA 2O0VA 1IA5A 1NHCA 2PYGA 2O1DA 1PE9A 1O8JA 3GQ9A 2NTQA 4XMYA 1OFMA 2X6XA 1RMGA 1OFLA 3EQNA 2X3HA 2IQ7A 5C1EA 1AIRA 2X85A 2Z8GA 4PMHA 2X6YA 1OGMX 4MXNA 1IDJA 2NZMA 4YZ0A 4Z05A 1DBOA 1O8EA 5AMVA 2VBMA 4XM3A 1H80A 1XG2A 3SUCA 2PYHA 4OJ5A 3VMVA 3ZPPA 4OZZA 4XL9A 4XLAA 1IDKA 3LMWA 4W8SA 4XORA 2NTBA 4URRA 1X0CA 2O17A 4NK6A 3GRHA 1KCDA 2VBKA 4OJ6A 2O0WA 4XQFA 1OGOX 1QJVA 4XOPA 2UVFA 3ZSCA 1PLUA 4AVZA 3VSUA 1PXZA 5C1CA 2UVEA 3B90A 4YZXA 1VBLA 4NK8A 4XKWA 3B4NA 1O88A 1KTWA 2VJJA 1O8MA 1K5CA 4EW9A 2VJIA 4I84A 4XN3A 1QCXA 4XLCA 4XOTA 2ODLA 3GQ8A 2X6WA 2NT9A 3FY3A 4YZAA 4OJPA 1DBGA 2NSPA 3WWGA 2INUA 4W8RA 4XLEA 2QXZA 1KCCA 2QX3A 4U4BA 1HG8A 1O8FA 4Z03A 1BN8A 4XN0A 3KRGA 4XONA 1GQ8A 4XLHA 1O8DA 1JRGA 2VBEA 3JURA 4W8TA 2NSTA
chains in the Genus database with same CATH superfamily
2KIUA 5H20A 2JA6J 5FLXZ 1QPIA 3U2QA 1R1UA 2DMPA 1ZLJA 2EIMH 3SFIA 2RREA 4ZC3A 1ZRCA 1OOCA 1T0FA 3K1PA 3C1DA 3M1EA 4ITVA 3M1CA 3WODF 3OS0A 1N75A 4C0SA 4H9GA 1K61A 2MD0A 4QIWN 3HAGA 1B6AA 4JX6A 2I8DA 1UG0A 4JRAC 2NS7A 5K7ZA 1D1CA 1DQUA 4C2LA 5KAIC 4PABA 2L3DA 3A8IA 3CCMI 1GAQA 2ZZEA 3GFIA 3ASPA 2QY1A 1XSVA 3V76A 4NDLA 1XGMA 4IEJA 5JLXA 3OL4A 1HVXA 4RGXA 1XN7A 1W7PB 1IN5A 2CQKA 1RU4A 2WV1A 3KZIC 2VPRA 5ICGA 3FIWA 3QP6A 2HKXA 3ROUA 3K4MA 4A3EJ 1ZG3A 1VF9A 2XB0X 2RKHA 2F2EA 4L18B 1JJ6C 3BR6A 2AO9A 3JRHA 4FE7A 1ZAOA 3HOYJ 4KITB 2EIXA 3AFHA 1FNDA 1OFMA 3TP3A 2X3HA 2P4WA 1G7TA 1UD5A 2M3AA 2ELHA 4P6VF 1LQ1A 4CZZA 1WJBA 2GJPA 1V5GA 1VQ6I 2M7AA 5IT9Z 4V02C 2HPMA 1FT9A 3PSZA 1H89C 4BUPA 4RDKA 3AG2H 4ON0A 2R5YB 2J7KA 1N0VC 1YITB 2MFZA 5GTHC 1DUXC 2O61A 3CRZA 3PFIA 2DY1A 4YFNF 5IOZA 4DZJA 4G7XA 1G6NA 2PLFA 3BJ6A 4UV9A 1NG7A 1JJ8C 1IXSB 2BMWA 3ZUGA 2GREA 2DXIA 4EMSA 3VWBA 3E6BA 2RGVA 4EQQA 3TGNA 1LE8B 3Q6RA 2WV0A 1KCDA 2XC7A 4EJOA 4BHPA 1Q9SA 3VSKA 1P7JA 2COMA 2XGEA 4PZJA 4WF2A 5HS7A 3H0GJ 2BW3B 4EM2A 3JREA 1ZLKA 4KJZA 4DNRB 1R5ID 2HXOA 1NB0A 1LDDA 4KISA 4E7LA 3VSUA 2QGGA 2ICWG 1I1SA 1N25A 2Z2SB 2A6TA 2QQBA 4IHTA 1DDIA 3WNCA 3R0JA 2BOLA 4XKWA 1MRZA 4BXXJ 4X07A 3RTRA 3HTSB 1HLVA 2XGXA 1HQCA 2W24A 2YWEA 2VKVA 5BS6A 4XLCA 3LFUA 3DFGA 1YX3A 3PUBA 2G7UA 2HQ5A 1ZM4A 3JRGA 2QUFA 2DERA 5FKMA 3DDYA 4U9UA 2WJVA 3T1BA 4G6DA 3TDUC 5B1AH 2EFGA 1X2MA 3S2DJ 5F04A 1EV7A 1KCCA 5HDNA 3CMEB 3ZCOA 1OB0A 3AVWA 1VQPB 3OYNA 2CSOA 2E71A 3WTWC 3ZXSA 3LSHA 2DT6A 1W4MA 1IRZA 4RAZA 1ULYA 5FROA 2O5RA 3FXQA 3CCUI 3IHUA 3WGGA 4UZEA 5FNZA 1J9IA 2IP2A 2CW7A 1EP1B 4QSHA 4A6DA 1QUEA 2IXSA 4HV6A 3W5HA 5GV8A 3GQ9A 2J5PA 2PN6A 2XKOA 1B23P 2LKXA 1QO0D 2DA1A 3DQVC 3W3CA 5CQGA 5JHFA 4Y13A 1WMRA 2IGMA 5HLGA 5FA6A 3DWLE 1ZM2A 3CF5F 1R5BA 2GLOA 2WZNA 1WXRA 2TRTA 3V8JA 2PJRA 1CQXA 2H6CA 3A01B 4DZPA 4Y9UA 3ZR8X 4LBYA 2HCJB 4RD0A 5EJCA 2M4GA 2CUJA 1OCOH 4MYUA 2NVQJ 4LK0F 1RI7A 4N3GA 2D2WA 5J35A 3ZRGA 2KRFA 2M5WA 2PMZA 1FPQA 2XGDA 1G7RA 4X0CA 1N07A 3LAPA 1TC3C 3HSEA 1GVJA 3K70C 2VNKA 4G7OF 1T38A 1IA5A 4F93B 3FKSA 1P7IA 2P81A 1VQ7I 4RGRA 4XMYA 5E79C 2LRDA 4XRSG 1UELB 4KIBA 1RMGA 2W57A 3ZQGA 1G7CA 5C1EA 1YJWB 3GBGA 4XBFA 1QZZA 3JAMK 3RYRA 3DBLB 4A5NA 3HC7A 4LG3A 2QEXI 5TY0A 2BHYA 1QGAA 1S5LC 3P27A 4Z4TA 4YIFA 1USSA 4YG2F 4I01A 1MMAA 1XS9A 3K69A 1VI0A 2P6TA 2G0EA 2ZNYA 2WPDA 3WNDA 4U87A 4HNVA 3GO5A 3QU3A 4FX0A 5IP6A 2ELJA 4LBVA 4YAUA 4CCOA 1BA5A 2ZNZA 3H9JA 3RKYA 1LVAA 1SANA 2V9KA 3ZMVA 2C6YA 3F23A 3V7AA 4CYDA 2UUZA 1F43A 4HV5A 4HRIA 3U6BA 4CCMA 3WBKA 1RKTA 3ZMUA 1FEXA 3S1MJ 2XEXA 1OGOX 2GM4A 1E43A 5DD8A 3L7WA 3K4JA 3OKXA 2CUEA 2HOTA 2OYNA 2QWWA 5C1CA 3S1NJ 3G71I 1UD2A 2JIZA 5J40A 2GXGA 1LFBA 3ZMZA 3K4CA 1YJ9I 2VQCA 3RQ4A 1NRKA 4EGZA 5HOOA 2VONA 3BH7B 4EATA 2ZCWA 3ERED 3ABTA 4EW9A 5LMZA 3QQAA 5E17F 4CCNA 3I3LA 1LVKA 3H5AA 1FBSA 1FNCA 4MEYF 4RJLA 2CRGA 2MA3A 3DEEA 4UUTA 1QH0A 4G1BA 1T8IA 4JX5A 1LLZA 4YZAA 1VQ8B 1X3ZB 2XDVA 4QTRA 4ZTFA 4ENKA 2FXAA 2ZMEC 3E5QA 3S17J 2OU2A 4EH1A 2ESNA 4G9YA 4HZFA 2M4KA 2LMDA 2A5WA 2ME0A 2E2IJ 1TW2A 4LLGF 3RZDJ 3M4OJ 1HW5A 3FPKA 3QFTA 1WPCA 2ECCA 3BQYA 1TTYA 1SM4A 3WQZA 2O0YA 3FXMA 4M9SA 4XICA 4A3JJ 1U8BA 2DA4A 3PETA 2IPQX 4XLHA 2RC5A 2GBYA 1X4OA 3T5XA 3OYKA 3ZBTA 2FUG2 1GDTA 2CNDA 3IH2A 4Q5SF 3OZUA 3FM3A 1GJRA 4A3CJ 1N0UA 4XLPF 5JHUA 2VQGA 2EWEA 3F8FA 4IXAA 3VDXA 2ZJQF 3OOCA 1Y0RA 2AXTC 5J1YA 2A6HF 3HOWJ 4TSFA 2BV3A 1O8LA 3BCBA 5DCMB 3CDIA 2K9NA 4HX4A 1U5TA 2BY1A 2UXNA 1AA7A 3OYDA 2DQLA 3GQ7A 3TL4X 1ZG1A 3VSTA 2OC6A 3A02A 2BX6A 1H9TA 1BL0A 4W8QA 5DS9A 1Z7LA 3T9GA 3EUKL 2FE3A 3FMSA 2E60A 3DBHB 3P9KA 5CJ9A 4B1RA 5D4RA 2JA5J 1XQBA 2HR3A 2C5BA 3BR1A 4I98B 1JTAA 1R5HA 3HDDA 3LAJA 2NT6A 3K0LA 1BR4A 3L2VA 2FOWA 4JOMA 3F0CA 4U88A 5K1YA 3S3NA 3WTXC 4DW6A 4ZGQB 2CV2A 1NDHA 2E35A 4BQNA 3IL2A 4RGSA 1YX2A 1IAWA 3IWZA 3OIOA 1PUEE 3GVLA 4O6JA 1IJEA 2M30A 1IHMA 4LLNA 1E3HA 4ZZLA 3ABKH 1ZH5A 1P9QC 1PVEA 5B5EC 2VFMA 4BPRA 2Z8GA 3F8MA 2X6YA 4I7HA 1CLWA 3ECOA 3HL2A 4E7HA 1IDJA 4PDKA 3I0TA 4QLCU 4BHCA 1FZPB 2STTA 4NNJA 1GR1A 4Y33A 2VBSA 3GCMA 4ZZDA 3OYMA 3ZQCA 3RJPA 4C2TA 2LLKA 3GTJJ 3T8RA 1DP7P 1XSDA 1R5NA 1T98A 4AC9A 1M1EB 2MGQA 2Y75A 2QBYB 2X51A 2KIMA 2XT2A 4L9TA 3M8FA 4XLAA 4UVAA 4G94A 3VPRA 1H8EA 1E1QA 2A61A 3CP8A 3KP6A 1JT0A 5AIPA 3MN2A 3OYLA 2QTLA 4W1UA 2WTEA 2OZ6A 2WY7Q 4JYKA 4KMUX 4LIUA 4BE0A 5FL7A 4RA2A 3VMVA 1KK1A 1X19A 1N08A 1JB9A 3F8NA 3KLNA 5IYCJ 2BM5A 1J75A 3ES9A 3RYPA 3W2AA 3TP0A 2M8GX 2JMWA 3MVPA 2UVEA 1B1BA 1QZEA 3NQOA 1XE1A 2DDBA 3OWTA 2DCUA 3P7NA 1IUFA 1O4XA 3LA3A 4LG0A 1VQ4I 2C4TA 3K2AA 2VXZA 4X7EA 1R5OA 1B2RA 4G8XA 4K2EA 2DLLA 4XN3A 1IXRC 3IV5A 1Z3XA 4TV7A 4WQMA 2XF5A 3JW4A 3CPXA 2LH9A 2BYVE 2ACJA 4RD4A 3WU2C 5CVIA 3GTKJ 5FKKA 4B09A 1GO2A 1T0FC 1LPQA 1BX1A 3R6JA 4OP7A 3FY3A 3NAUA 2VNHA 3WWGA 1Q1VA 3TO9A 3EYYA 4N4NB 1UJ8A 1YHQI 3ZBUA 2E1CA 2V79A 3F8BA 3KP2A 4L5EA 4IQJA 1E3ZA 2V7WA 4AF7A 5DN6A 3LNNA 2QX3A 1J59A 4IZZA 4BNCA 5IP9J 5TV2A 5FB2A 4XN0A 3RCOA 2XPVA 1EKEA 3T51B 3PIPF 2OTLI 2KISA 4B3AA 3FBNB 1GQ8A 4Q7JB 3PSFA 1USTA 3WTZA 2VB6A 4HG2A 4M1KA 1VQ6B 2VBZA 1K73D 3E7LA 1E2XA 1S4MA 2E5ZA 2RVCA 2R7OA 4YDTA 1NTCA 2XAJA 3F9KA 1E17A 2VBWA 3G73A 2O6GE 4U0YA 1EE6A 3BJOA 1SD6A 3OR1C 4BJTA 2OK7A 3ZC3A 4ACAA 2MG4A 3QYFA 2L9VA 3KP4A 3SJPA 4XSXF 1SVOA 2LG4A 1FX0A 4FT8A 3J81k 2HDDA 1SD4A 1N06A 3OW7A 1XMKA 3A1YA 1XDSA 3NEUA 2V7TA 2K27A 1BJKA 3JSOA 3VSLA 1DG1G 2BPOA 3CTAA 1IXCA 2OD5A 3W6VA 2ZXIA 1ITYA 5FRMA 5TISC 1QVGB 1YRNB 1JHHA 1Z91A 4PC3A 4ZDLA 4FISA 4XD7A 4MTEA 2GAUA 4LGWA 1WWXA 5D5UB 2L4MA 2Z6BD 2GIVA 2V1XA 3W6KB 3KEWA 3AAFA 1TYVA 1X3UA 3WE3A 3HEFA 5ILUA 4NC6A 2DPDA 2F4OB 4Z4YA 1MBKA 3BPXA 2UWMA 2IS2A 2OBSA 2WSSA 2NZMA 2L0KA 3ZMDA 4YIRX 2E1MC 3B6CA 3FK6A 4XM3A 1IF1A 3S15J 3BCAA 2DO7A 2RC4A 4QHYA 5EF6A 2MBFA 1BI0A 4BQQA 3MFKA 4RDJA 4OZZA 4C2UA 3WU0A 1J9ZA 3S3MA 4UZUA 2HDWA 3ONUA 1T33A 3V7SA 3CC7I 3CCVI 5KCMA 4YAOA 2K3PA 3TO6A 1T6ZA 1WJCA 1X1BA 1OHHA 5F4OA 1SMTA 2NRAC 3F6VA 4YFXF 1FIPA 3I59A 3QOEA 3CCUB 4M3DA 2CJJA 1JGGA 1RR7A 3JSPA 1FNMA 1QJVA 2G7HA 1H0MA 1EZGA 4DYQA 3PL8A 1BI1A 4MYTA 3PM1A 4HDVA 2A05A 2EPFA 4D5CA 4IL6C 2VFQA 2B5OA 5LHGA 2PBIA 1ELOA 5IK2A 4OAYA 4OWRB 3S2WA 3QE2A 3DTEA 2VJIA 3VNUA 3G1OA 2BE5F 3GTPJ 3FMRA 4PC6A 5J1UA 1EP2B 2D9RA 2Q6OA 2XGJA 3BTJA 4ZYHA 4CYCA 3OEEA 4KYWA 4X7CA 2VL8A 2F4MB 2QM3A 4UVBA 2JDIA 1Y39A 1CQTA 5E3OA 3FKJA 3IRRA 1OR7A 1TQPA 4R8HA 4AIJA 2UZKA 1VQ7B 3LNQA 1JTXA 1ZGAA 3HRSA 5E1XA 3H9QA 1HBXG 2DMQA 4UHTA 1BBYA 3OEHA 4XONA 3KE2A 1HXDA 3MMYB 2K9SA 5KHDA 2AHOA 3ASTA 3J7AY 2B7EA 2A69F 2QEXB 1L3LA 2DOFA 5HS9A 2NSTA 3WGIA 4Z4SA 3J7AO 1FYKA 2OK8A 4PC1A 2QDXA 1TNTA 1YW7A 2R7VA 3CPWB 2CQ7A 2LFBA 3BQZA 3LA7A 1E63A 3Q38A 4Z4UA 2VC1A 1QGZA 4ZCLA 4RD6A 5C4JJ 4D9JA 1UFMA 1W0JA 2JQ7A 1WH5A 1JE8A 1R23A 1B8IA 4B48A 3OYJA 4M9XA 1QRCA 2WJYA 2DFFA 2K5CA 3BZKA 4XR6A 4BJ6C 4EV0A 1PJ7A 2KKOA 3OAAA 1XMAA 4JP0A 2N8GA 4AIHA 1FOWA 2WAFA 4U49A 3K4NA 5CDFA 4GYGA 1TL8A 2R7DA 1W0TA 3C7JA 4TN1A 3G71B 3I9V2 5F0CA 4A3DJ 5IY5H 3ISPA 3TW7A 2W6JA 1CF7A 1HZEA 2Z5UA 2JUCA 1V0EA 1YJ9B 1OJLA 3N05A 1VTNC 2KIFA 2ZMEA 3OYCA 4ZTJA 4GXOA 1XX5A 1DGRM 1WQ2A 5A89A 2YWHA 4M6XA 1QG0A 4A0YA 2EIJH 3C2GA 4DK1A 1W9XA 2QYOA 1XG2A 5DUIA 2H09A 1WJAA 2DJNA 2DAOA 2HYFA 1JKOC 1ETVA 5H59A 3P9IA 3K9TA 2GWRA 4XL9A 3AL0B 4B44A 2K3FA 2K4JA 4II2A 4OM9A 2BXYA 4KICA 3SJMA 4KUMA 2R7TA 5GAEJ 5LBQA 2XT4A 2ZZQA 2R7QA 2D45A 2CUFA 2XPWA 1D8KA 3FBIB 3CO7C 3I1FA 1ETQA 1FNNA 3IKTA 3PENA 5JBQA 4E7IA 1I5ZA 1Z6TA 4OJ6A 4BDYA 4II3A 2ZC2A 1E3OC 2F48A 2IEKA 4MFDA 1D5VA 1W35A 2C77A 3WYAA 3HPHA 3AG3H 3O3KA 3MCZA 3R61A 4G12A 4UV8A 5BNGA 1WSUA 1JKQC 1G3SA 1VQ9I 2PMDA 3MEXA 3B73A 3TW6A 3ABMH 2R93J 4NK8A 2HS5A 3VB2A 4A6EA 3PQKA 1TYWA 1D1NA 1ON2A 2BM6A 3PSIA 4I09A 1SAUA 5JMCB 4P55A 4DIQA 2CW8A 5HNFA 3LMMA 3MKWB 1T56A 1XB2A 3BOQA 2GJRA 5DCFA 4C30A 4RDUA 3P9CA 5L3CA 1IRFA 4HEA2 1DBGA 2CW0F 3PIOF 2UXXA 1VLYA 2ZZFA 3E0JB 3BR2A 2JUGA 2Q0OA 4E7ZA 5B3SH 2IAIA 2EA4A 4N9IA 4I0AA 5FO1A 3PO2J 1KGSA 1WJEA 1XGSA 1EA3A 1U5TC 3GFMA 2Y0SN 4HPQA 3WTTC 2ISZA 1TWFJ 2VOOA 4A3GJ 3EUHA 1D0ZA 2COBA 2FNAA 2QZ8A 3JTGA 2E1MB 4PFPA 1BM9A 3I4NJ 5DM6F 3Q5FA 2EFQA 1QGYA 3ONYA 1GXPA 2QXZA 3ZQLA 4HX8A 1OGJA 1N77A 2JJ2A 5AONA 4IHXA 4DOZA 4RB1A 1KQ8A 2STWA 2PMHA 4D7MA 1WP6A 1RWRA 4M3BA 4BGDA 1Y0NA 3Q0WA 1LEBA 2IJLA 2GA2A 3O6BB 2B9SA 4A3BJ 4I6ZA 1ON1A 1CZFA 4MNUA 4XNFA 3PO3J 1F1ZA 4YC5A 4RBOA 3LQQA 5GPCA 4YEJA 3L09A 4GGGA 1ZUNB 1TLHB 5LEJA 2IQ7A 1XD7A 4Y52J 4MR0A 4B4DA 2DU9A 2BGCA 1OYIA 2OPTA 3OPOA 1REPC 4C3HJ 2L7FP 2K7LA 1TSPA 2OAZA 2FBIA 3SYJA 2EIKH 4WXHA 2HNHA 2CWEA 1AOYA 1UCRA 2F5CA 1A36A 3GTQJ 3GIRA 4U7DA 2FMLA 1IN4A 3ZPNA 1LLWA 2BY0A 2FEZA 2O0VA 3MKYB 1S7OA 3DTKA 3L2CA 3I5UA 3HZJA 3K1NA 4ROXA 1G8XA 4Z4VA 3QSYA 1PE9A 2BGIA 5D4SA 1HDPA 3ASQA 1B9MA 1YQAA 1VQ4B 3EQNA 1F9NA 2HTSA 1DDGA 4IRHA 5LGNA 5F0HA 4R1HA 4Y15A 4WZEA 3M7GA 4BY1J 2IOUG 2P0WA 4X05A 2XTYA 4OOVA 3P4GA 4AUXA 5F4JA 3H36A 2F43A 1YTYA 4J0QA 3F8CA 2VT2A 4BU2A 3GSIA 2R7XA 1YHQB 1MBFA 4RLZA 4TMWA 4NHJA 3QPHA 4F52A 4PGHA 3LSGA 2HEOA 1DABA 1HW2A 3CUQA 4XORA 4QVAA 2HQRA 1GVHA 2W00A 3KPHA 4M72A 2OA4A 1Y56A 2IVMA 2G9WA 5CLSA 1O3RA 2OTLB 3DP7A 1S0UA 3COAC 1WORA 2CU7A 3AGQA 2VBKA 4KDPA 3S8PA 5HXBA 5M5YJ 1W36C 1SKQA 3DKYA 3HUGA 1OGIA 2VNJA 1QA3A 2VASA 4OU0A 1GV5A 2KQRA 3H5NA 2E7WA 3WBJA 3B90A 1JTYA 4HW0A 4GCVA 3GLXA 4DQKA 3H09A 3OMYA 5BPIA 3CCQI 1JKPC 1OB5A 2XASA 4L5JA 1MH3A 5D6FA 3OSGA 5EGOA 4WCGA 4M73A 4P1VA 5EG0B 4UUVA 1PUFA 4X1EA 3GVAA 4WZTA 4WXDA 4IOAF 5JI6A 1DU0A 3WXMA 3GQ8A 3SJZA 5EEHA 2R6HA 1UG2A 1K83J 2R5ZB 1VQOI 1AU7A 1OYYA 5JLWA 4AD9A 1ACIA 3CCEI 1E3PA 2WAEA 4XLEA 4CCLA 3H94A 4IVNA 4J19A 3DBRB 3OW2B 2DYRH 4OOSA 3DV8A 3E6MA 3CDLA 1EFCA 1ZM9A 3I55I 4PFOA 1O8FA 3EETA 3M3YJ 1FSEA 1UD6A 1MMGA 3TOBA 1KD1D 2RNJA 1PP7U 2ETHA 3SZGA 3ZN1A 2H27A 2FSWA 2XSJC 1RQPA 3LYCA 5A8AA 4E7SA 4RPDA 4IHVA 1FDRA 4ZJZA 1E79A 3GUDA 3OE7A 1G3WA 5FIUA 3KP3A 3GVKA 2M2EA 3VR6A 4AIKA 2BV6A 2NS0A 2KZGA 4NQWA 4UXNA 3ML6A 4X06A 1YLFA 2FBHA 5LRRA 1U78A 1CNEA 2J8IA 1ETYA 3A03A 4HX7A 4WWVA 1D5YA 2ZB9A 2GOXB 3JTHA 1YJNB 1Y8RB 1QFYA 4OJOA 3CC7B 1H9GA 3CCVB 2ZBUA 2ZKZA 2LD5A 1JHFA 1B72B 2VT3A 2C78A 3I4PA 4ZGNB 2QKLB 1V3FA 4X6AJ 4E6KG 3BCDA 4N3NA 2NV4A 2BXZA 2K02A 3AVUA 2Q1ZB 2EA2A 1F5TA 1TUIA 2P7CB 2DN0A 1YO5C 2BVNA 2MSYA 5D8KB 1OB2A 2XB5A 1Y0YA 2EV6A 1MABA 5ILVA 3KLOA 4P9FA 4ZYDA 5LHHA 4XSZF 3G1MA 2LOOA 4G7WA 3BROA 5HLTA 4M3EA 2DPUA 4C43A 4I76A 1OFLA 3CCLI 2D74A 1EH8A 1ENHA 1V5VA 4N9HA 2NPFA 3RY8A 5E8GA 1MMDA 1GAWA 3GTMJ 2CV0A 2MH9A 1Z6RA 4MXNA 4OMYA 1IN6A 3G6EI 2VQLA 4AM3A 4G7ZF 3OYGA 3E5UA 2JTVA 2L02A 2HFHA 1QA6A 5FLMJ 2CBXA 1AKHA 4CZCA 3ZPLA 3OYAA 5FD5A 4BEHB 1AWCA 4MEXF 1MDMA 4WK8F 3GFJA 4H4KC 3CCSI 1Z77A 4KN7X 1OCCH 1P4AA 3MAJA 5K7HA 3RDIA 4DNCA 2A68F 5D5XB 4BH9A 2QGUA 2Q2EB 3IC7A 1V5EA 4U7BA 2H6BA 2KJCA 2CRVA 4BHBA 1HA8A 3GRHA 5GV7A 1FWZA 3HYIA 3V7RA 3VO2A 4WZLA 3MZ8A 1QVFB 5FJ8J 1UD3A 2DMUA 1VHEA 3JAMZ 1OR7C 2LC2A 3KYCB 2FMYA 3ASOH 4Z2YA 5EYRA 4B3XA 1QNTA 4E70A 3BY1A 1T5EA 2FQ4A 2V26A 2VN2A 5J3LA 2ZSHB 1J7KA 3CCYA 1PDNC 4BQAA 3SKBA 3BR3A 4UNOA 2V31A 5JFRA 1O8MA 5HLIA 1W7PA 4C9YA 1KU7A 1HA3A 5A2QK 2HDCA 1UZCA 5A2QZ 4NUBA 3S14J 4A3KJ 1FP2A 4H0EA 2Y0SA 3FF5A 1FYMA 1PJ6A 1ZQ3P 1VQKI 3M8EA 1WDTA 1BOAA 5GADJ 1NH3A 2FX0A 1QU3A 3AGPA 1Q82D 4YEIA 1S6LA 4A3IJ 4QVJA 2INUA 3BLYA 4P96A 2L4AA 2HOAA 1X58A 4RCZA 3GW2A 1ETKA 2HZDA 2NOJB 1KONA 2EBIA 3J81K 2BM1A 1IV6A 4O3MA 3KIOA 1POGA 1ZK8A 2W4SA 2W7NA 2P7VB 3ZMSA 2F5EA 4BXFA 5F1JA 3CUOA 3C2BA 2CG4A 4N0BA 3WTUC 4BBSJ 1P4MA 3VYRB 4B3FX 2XVCA 4L0YB 3GX4X 2V9PA 4DBQA 1GV2A 1YS6A 2MC3A 4IO9F 2OCCH 2DODA 2EWNA 2QQ8A 2OJED 4WWCA 1VLOA 3UW0A 4M6YA 3VOEA 3FWEA 4HF1A 2BM0A 1R58A 2M1BA 1WSRA 4P2NA 2BW3A 1LEAA 4V2FA 1BN5A 2KDZA 3B02A 4Z4WA 4BS9A 4L9VA 3PUFA 1QQ1A 2JK3A 3TMOA 4A2UA 1UB9A 2KT0A 1J0RA 4RD1A 5J1RA 1A5JA 3HOUJ 3U21A 3W2VA 1APLC 1OCPA 4L8JA 2ADUA 2BF4A 4ZCIA 2PQ8A 3REOA 3SZTA 4YZQA 1ETOA 2YUSA 5ICEA 2Z16A 5F0FA 4FASD 3A1PA 2ZL6A 1FC3A 2AS5F 3K2ZA 5TRDA 1WI3A 1BIAA 1O3TA 1IRXA 1I50J 2L9RA 1JKRC 3Q6QA 4M3GA 4AU7A 2H1KA 2ID3A 1KA8A 4GQNA 3SDBA 1VFCA 3ZMTA 2X48A 1OGMX 4JX4A 4RAFA 3DPLC 2HLDA 3A3GA 1DBOA 5ICCA 4PJLA 3HSRA 3LOCA 1LB2A 4FHTA 1E3XA 1A6IA 4ASNA 2GPJA 1NK2P 1HCRA 2W84A 2FJ1A 3M07A 1OMIA 3U1DA 3WGHA 1FTZA 1J09A 4MQVA 2OBPA 2QZAA 1MJ9A 1FOKA 3K4LA 2HU9A 1QZYA 2E19A 3FDYA 3D5RC 4BY7J 1KMHA 3LMWA 3K7AJ 2CO5A 3Q0UA 2NTBA 1QBJA 3ZZTA 1RUOA 5EDNA 2IA2A 1BPLA 3E1YE 3P26A 4XRFA 5H5JA 2Z99A 5FKNA 2P3MA 1XFOA 1MD0A 1IC8A 2UV1A 1PXZA 4UUSB 3EUHC 2KPMA 3CCJI 3CJTB 2QQ9A 1T6SA 3VYTB 2M0MA 2DA2A 2LF7A 2E2HJ 1QRYA 3DEUA 5IYBJ 2VBYA 2VJJA 2W48A 3LSTA 1RR8C 2P5LC 1W7PD 3U1KA 1SVMA 1X1CA 2QTZA 4OOIA 1KU2A 3ZZUA 1QCXA 4RS8A 4L9JA 1EWYA 1I1GA 1WKMA 4V19K 3CZ6A 4Y7CA 5EEAA 2V7VA 4QWQA 4EGYA 2QE7A 2K4BA 4EM0B 4G6TB 1VQLI 1ZYRF 6PAXA 3SLDA 1H8HA 4J01A 4Y3OA 2KVOA 1WPKA 3DLAA 4QV2A 2JVHA 4YCQA 2YU3A 3I59B 4E0FA 2P5KA 3W2FA 4LBWA 4KMFA 3I54A 1E64A 4A3LJ 2BSAA 2J8KA 3OYFA 2VFOA 4I99C 3OL3A 5GP9A 3JRBA 1J2XA 2DBBA 4RGUA 4QPOA 2VE9A 4KFCA 2QSFX 1BI2A 4NBSA 2VI6A 1ERDA 3BH4A 2X9DA 2KDOA 1JRGA 3E1SA 1WOOA 4MQ9F 1V5FA 4P3YA 3BR0A 1IN7A 1FRQA 4HBLA 1O8HA 3H9GA 3H1CA 1TLLA 1WZ2A 4CYCB 1FIAA 2DK5A 2J5OA 5DSZA 3CCMB 1R6RA 5IYPA 5H6RA 2Y31A 3F3XA 2R7FA 2K9MA 1R7JA 3L2UA 2HKOA 5HLHA 1T6YA 3CMYA 2YX7A 5DYMA 5EZHA 1RZ4A 2PE3A 3PVDA 1OCZH 2LY1A 1X1PA 3DKXA 2PLYA 4HIZA 4YFOA 3VSVA 5KW9A 3K1MA 4DNTB 1ONVA 1BHEA 4KKTA 3CJNA 1RETA 2KLOA 1I3AA 3PNYA 2LREA 4OOXA 4OPSA 2ZBVA 1H88C 5F6FA 4ZDPA 2ZFUA 1VZ0A 1TVCA 2F1MA 3CUQC 2M9HA 4J00A 1K78A 2R92J 3L2QA 2I5UA 4F3QA 3BJAA 3BTCA 3LFKA 2RV8A 3CCQB 3BT9A 2GK6A 3BPVA 2XNDA 1M1KD 2QYUA 3Q3AA 4Y17A 1W5TA 2JWTA 1QA2A 2FD5A 1BJZA 1IG7A 1RIOH 3FJOA 4ABZA 1KK2A 4D1QA 3R4KA 2VJ4A 2Z1DA 3ZQ7A 2VBXA 2O8KA 1BQEA 4BXUA 1VQOB 1Z3YA 3BY2A 3LQRA 1Y6IA 1SFOJ 3QU6A 1BW5A 2QMUA 3CCEB 3K10A 5F64A 1IGNA 1EF4A 4P9SA 3VO1A 3OY9A 1OFEA 4GDFA 3E5XA 2W7ZA 1YX5A 3CP2A 4NC8A 2QVOA 5E1ZB 4ZH4F 3D1NI 3I55B 2HQNA 2Y0MA 2V4DA 3FMQA 3FISA 2EFPA 3A2KA 4BE1A 1CF7B 2RC6A 5DCMA 4P6YA 3IUOA 2ZMEB 5DV5A 4AIDA 5BSXA 1Z7UA 2WWYA 1HF0A 2WYRA 3G4SI 3BDDA 2JRTA 4A0ZA 1PLUA 2FRHA 4U0WA 2JN9A 3BC9A 4MTDA 3V8LA 1EH7A 1XDUA 4U0VA 4B8XA 4JQFA 1O88A 4AF6A 5FFXA 2EZKA 4ASUA 3DPUA 3BNWA 3MKZA 2DEUA 1FX7A 3VNVA 2BHZA 4XOTA 2WBMA 4Q48A 1O3SA 1ZR2A 1OPCA 5DD4A 2L7KA 4QPQA 4FN5A 1I6XA 2DMNA 4OJPA 1FBQA 3WE2A 2QKMB 4P1WA 2Z33A 2P8TA 3N6ZA 1U2RA 3S2HJ 5CVJA 2JRMA 1IZ1A 2DA5A 4YIIA 3NE5B 3F6OA 4A93J 2Q6LA 5FGMA 5ICFA 5FO0A 2VFPA 4Z03A 5E3MA 1K9MD 1OFCX 1TQMA 2GZWA 5E6TA 1JXSA 1ETXA 3CCLB 1D3YA 4KH3A 2VPLA 1SFEA 2QF7A 1TQIA 3N97A 3GVJA 3G6EB 3KP5A 2PECA 4ESJA 1ODDA 3HRTA 2XAFA 3L2WA 3FXOA 3Q3SA 2XHKA 5HDGA 4F7DA 2HYGD 3CCSB 3GQAA 4Z4ZA 3QFCA 1DPRA 3FX3A 5CKTA 2VJ5A 3H92A 3B78A 2EZLA 4Z1MA 2ZZGA 3G3ZA 3LSIA 1X3WB 3SQNA 1NK3P 3CC2I 1VNDA 1N78A 1P4XA 4ZCMA 3LQEA 3ZP5A 5K5OA 3H5RA 1NG6A 1DDNA 2F6CA 1MSEC 1NB9A 4OPWA 2GIZA 3DKWA 3WY9A 3EQOA 1NHCA 4IKFA 2ZTNA 3ULQB 4PUSA 1R71A 2VOPA 1SFUA 1R36A 1FP1D 2X6XA 1OCRH 4DYRA 5CVRA 1C0WA 4PJJA 2CQNA 1LDJA 2V9VA 3OR2C 2X85A 3DLLF 3Q9SA 5ED4A 2DIEA 3KZYA 1G3YA 2R7RA 1YI2I 3M8JA 1BR2A 1VQKB 2IGNA 2EZIA 3HM5A 2VBTA 3LQ6A 1EJ9A 3QFSA 3IAM2 3K4KA 2NS8A 2HXIA 4RLQA 1BLIA 2NVTJ 3FKIJ 2HYJA 4W97A 3SEZA 3LSRA 5M3FJ 3LSPA 1VF7A 2M7BA 4WZKA 2IBDA 3DU5A 3WTYC 2PG4A 1PKVA 1PP8F 2EJRA 4PGGA 1IDKA 2XIGA 4IF4A 3B82A 1I39A 1OCTC 4EVIA 1XC5A 1EP3B 4CHUA 1Y8QB 2DYSH 2PIAA 2O17A 4KN4X 1G59A 1UAAA 4BACA 3I58A 1LJ9A 1V4RA 2ZXJA 2LYCA 4A0XA 2V7QA 2W82A 1EFRA 1KQ0A 1KU9A 4AVZA 4DGWB 3L2RA 3TKYA 3J7ZI 2VODA 1W5SA 2KFDA 4HA8A 2V7FA 1R9TJ 3JCUC 4TMTA 3W5VA 4DYCA 4KIFA 2C2WA 3OYIA 1YRNA 3OP1A 3CDHA 1RKWA 4OPOA 2Y2ZA 4I84A 1MBHA 2EB7A 4P26A 1IUYA 4ZV4A 1MBEA 2YSRA 1K6YA 3HJEA 2IT0A 3S93A 4IPAA 2ODLA 4CA0A 4ANJA 3ECHA 5C3EJ 1UMKA 3HRUA 2EZHA 2XAUA 1TYUA 2CW5A 2QENA 5CYVA 2ESHA 2ZBKA 3LL7A 2XTWA 4YAFA 2JJ1A 2YS9A 2VZLA 2JN6A 4JBAA 2V6CA 2H1LA 4M71A 1RC9A 2RQPA 3W2WA 3S1QJ 4LBZA 1U9NA 3H3VK 2LSOA 4F55A 1K79A 3BWGA 3HPGA 2P5VA 3CCRI 3X2QH 1D8TA 5F27A 1OKRA 4RD3A 4IHWA 4Y9RA 2A3SA 3A4CA 2M87A 5FO5A 2VBUA 1TT5B 4MO7A 3OYEA 3H0DA 1FJLA 5EGOB 2DCEA 5JVTA 3T56B 4HDUA 1S7EA 3HOVJ 3ZGKA 4IRGA 5M3MJ 4OJLA 2TDXA 3CQZJ 5CQEA 1WVRA 2ZJPF 3ZN0A 4OPVA 2OV7A 3B8YA 5FKLA 4G1VA 1UHWA 5TGTA 1KZHA 1B4AA 3EQLF 3S32A 3J7YJ 1JA0A 3EUAA 2GXAA 3SEQA 2ZJRF 4HLXA 3BG7A 4NC7A 5E1WA 3RIRA 1QX4A 2XAQA 2EH3A 1O57A 3S16J 1FYLA 1VQ5I 2KJBA 3FXKA 3PJRA 5LHIA 1AIPA 5E8IA 4I0BA 2X8KA 2LDUA 3FXUA 1FTTA 2W25A 3FXLA 3HB9A 2H8RA 1A6QA 1KK0A 1K4ZA 4OZYA 4RM2A 4ZYGA 4S05A 1Z9CA 4TMVA 1F36A 3OJWA 1UHMA 2MYSA 2O04A 1MKMA 2DJIA 1MGTA 3Q0VA 3CCJB 5ILSA 2PYGA 3FHZA 3ELKA 2O1DA 3BR5A 4FE4A 5J4YA 3SY2A 1IRGA 2LBFA 4RB0A 1SFXA 4NQWB 2DW4A 4L9NA 4IRIA 3BZ6A 2FVGA 2DOAA 2XNJA 2WADA 4PSXA 3V42A 2A6EF 2NVXJ 4ETSA 4M4SA 5FRNA 2EK5A 2VE8A 4EEFG 3JQQA 5AMVA 5B66C 1I18A 1VQLB 1D0YA 4NBQA 2BVLA 1GHCA 5KVRA 2O03A 1XCVA 1ZM3A 5D5VB 4K1XA 4XIDA 5BMZA 1RRJA 3KL9A 5E20A 3W2EA 3QP5A 5CVVA 4CCKA 5IPAA 1K4SA 3I56I 1IB0A 2F1LA 2IS4A 4RB3C 5HZBA 1MZBA 2CMPA 3BZCA 2LY2A 4A3FJ 3JRFA 3SLNA 3FM5A 1W0KA 2Q6IA 3ASRA 3GTGJ 2F5DA 3A35A 5AIQA 1QRBA 3SFZA 2L9NA 3ZSCA 4BDZA 3FZVA 2PJRB 2NOGA 3VEPA 3C2HA 4RLFA 4EJWA 3OJXA 3CD6I 1N05A 4PJMA 1AKHB 2DDAA 2XPUA 3T53B 2HWVA 5DUKA 1NBMA 1PYVA 4HSTA 3MHPA 5FLXK 4Q47A 3R6SA 3CJRB 5IYWA 1WJ5A 2DTRA 2IA0A 2L7ZA 5D5WB 2X6WA 2Y48A 1L1IA 1TW3A 2M34A 4JMQA 3BG9A 1IJWC 4FCYA 2B63J 1FLIA 1T08B 1GXQA 3EPZA 4NB5A 5CPRB 4ESBA 5J4VA 1S72I 1EFTA 2D3LA 2K86A 3E3VA 2DA6A 2WR8A 2WA0A 1U8RA 4BQOA 3RKXA 4HF0A 1SEUA 4GO1A 1ZG5A 3GMEA 1UMQA 4FETA 2O9LA 2ZITA 3KRGA 2D3NA 1XSXA 1O3QA 4CUGA 4DBRA 2QCOA 3AVYA 3OYBA 3A8KA 2GXBA 4X8IA 2G0YA 2QA4I 5HKKA 2L9SA 1FY7A 2CQQA 2EQRA 4ZYAA 1MMSA 1V0FA 1MW7A 5L46A 5F08A 4W8TA 3OIPA 3RPUD 2XAGA 1DGWY 3PQJA 3NWSA 4CCJA 2PI0A 1JUSA 3O2PE 1ZRFA 2ZFWA 1MJBA 2EV0A 1O8KA 1TWGJ 2DMTA 4DQ2A 4PJ0C 3SZPA 1F60A 3OOUA 1OLTA 3KP7A 2VC0A 2VKEA 3AG4H 5F4MA 2D1HA 5GAHJ 2FBKA 2XV4S 1WH7A 5IT9K 3DXJF 4ZDOA 2GA1A 5E18F 2OBTA 4M2LA 3GYHX 1Q7YD 3N90A 2XC1A 4D5FA 1U9OA 1M90D 1KYWA 4IX7A 3L9FA 2HGCA 3A0HC 3B6AA 1MH4A 3G4SB 2CS3A 2K40A 4XLFA 1VQMI 1KRHA 4UVCA 2I1LA 3K4BA 1QHGA 2VXDA 1KC8D 1D0XA 1MIJA 1O8JA 3KCCA 5K5RA 1SVLA 2ID6A 1CGPA 1T2KA 2QN6A 2X6OA 3C18A 1XMXA 1E0EA 3JU4A 4RD2A 1OISA 3AG1H 2IW5A 3QYEA 4HAMA 3NARA 4S0HB 2ZJ2A 3SUCA 1IO2A 3VFZA 1A35A 2XOKA 1JA1A 3ESWB 4MLOA 4RDLA 2ZXHA 5EMNA 1WHUA 4RMNA 1K28D 3ZPPA 2LY9A 2OQRA 2PEXA 1WCMJ 4D7NA 2TCTA 1KQ5A 2XAHA 5JR3A 2Y9ZA 4HE6A 1A04A 1ZARA 5L3DA 3I53A 2PJPA 1KQSB 1WRJA 4E7KA 1U6GA 3GFLA 1ZGWA 2VNIA 2VUMJ 1S7AA 5BSYA 3I71A 2JSPA 2UVFA 2R7WA 4TT3A 1U5TB 2FA5A 2B7CA 3ISXA 2DFIA 5M5WJ 4HYEA 4M3FA 3TEDA 2DTZA 1VBLA 3LSKA 3OYHA 4GRIA 1W5CC 4YHBA 2OF7A 5KAFC 1GT0C 3W2GA 2E5NA 1XCBA 5D6EA 3K6GA 3CW2A 1P92A 1Z67A 3DTIA 3KYLA 4HF2A 2BBYA 2GK7A 2YUHA 4IHYA 1IW7F 3CC2B 4M0LA 4Y7NJ 1QUFA 1FBUA 2NT9A 2K85A 2NSPA 4C2MJ 1W34A 4M6VA 3S3OA 3H35A 2A07F 1FNBA 2NVYJ 2HPIA 3LSJA 3AKZA 1UHSA 5L3EA 1K4TA 1MMNA 1P4WA 3ASNH 2VQHA 4P25A 3IP4B 3ZOBA 1AMOA 4XKBA 2V7XA 2F5VA 2WB1N 1R5GA 2R3SA 3QODA 2E1OA 4PK4A 2EILH 2LF8A 3GLLA 4B43A 2H8WA 1R4MB 4HLYA 1X1AA 1YI2B 5GAGJ 1FMVA 2BY3A 2ME6A 5LFAA 2JPBA 1HDDC 2EFNA 2IS1A 5IYRA 3CJQB 2IS6A 4UZFA 2BM7A 4CICA 4IW3B 3KEYA 3VODA 1CNFA 3U6KA 1O8IA 2FF4A 2B0RA 1R1VA 3C3WA 5M5XJ 1KZLA 1UD4A 2JT1A 4Z06A 2F3LA 3OFNA 2NYXA 3DCFA 5H6QA 3OZVA 4WX9A 2X3UA 1A8PA 3ABUA 2CFOA 5K7FA 2HVRA 3J81Z 2GQFA 2V1DA 4TMXA 1RNLA 1ZGJA 2EINH 4E4HA 2R5YA 2E36A 3WTSC 3CMAI 1ZR4A 4LD5A 1IDZA 4KT6A 4XKVA 1RUNA 2BGJA 5KSWB 1ZREA 3VMFA 1NJID 2WC2A 4RM3A 3R6KA 1EH6A 2E7XA 3KX2A 2XZOA 1R49A 5EG0A 1BC7C 3OS1A 2X1DA 4LG0B 1V55H 1Z1DA 2CF4A 2BSPA 4B4CA 1WOPA 1WJFA 4DJAA 5J3OA 2R0QC 5KNLA 1LE8A 2R5ZA 1B59A 1HC8A 5A88A 2KP6A 1FRNA 4YFKF 3UKGA 2AHQA 3E6DA 5IOYA 3ASSA 1YIOA 5FKOA 1VQNI 5LLQA 4RAYA 4P9UA 3JRIA 3UNGC 3NAWA 2Y9YA 2HTJA 2IGKA 4FK8A 1O8EA 3GZNB 1ZKGA 2D5VA 5LD2C 4YALA 4BE2A 2PYHA 1FMWA 1B9NA 3MZYA 2LP0A 2B7BA 2Q8KA 3WG7H 2RQQA 3WTVC 1MSFC 4FX4A 4OJ5A 2YR2A 1EFUA 1HSTA 2M0CA 4A5MA 2KRHA 4MIMA 3JR9A 4M53A 3HGYA 1JUMA 4NCNA 2XSDC 4B3GA 2FU4A 3OZWA 2IRFG 3RI4A 2L5QA 1H42A 1VQ9B 3IH3A 1AHDP 3EDPA 3CCRB 1O7LA 4XKCA 2X0LA 1K78B 3CLOA 4NK6A 3FXJA 3KFWX 1WSVA 2DFEA 5B6IA 3GZ5A 4X0GA 3MKLA 3JRDA 3D26A 2YWGA 1B72A 1HW1A 3FHNA 3F22A 3LJYA 2CUZA 4RB2C 2JA8J 4EJTA 1KK3A 4YZXA 3GEZA 3MQ0A 3BG6A 5J8CA 2KZVA 5L3BA 2VYQA 5IYNA 5LRSA 3A3BA 2KHMA 2XRLA 3CLQA 5E3LA 1F4KA 2M8EA 4LITA 4GFBA 1JNYA 1TBXA 1VQ5B 1DARA 3T0YA 4JK1X 4S04A 1GUUA 4F91B 1YW9A 2DT7B 2XZPA 1TP4A 4MGRA 3SQVA 1SAXA 2CK3A 2PFBA 1TZLA 2CQXA 3EYIA 3DU1X 2E1BA 2DOEA 4PGOA 3QPLA 2CC2A 3DPTA 4PCQA 3LSMA 1P2FA 3I4MJ 1W2BB 1Y0UA 1ZHFA 3TOAA 1BMFA 3HHHA 4A12A 3SHFA 2W85A 3A01A 1LFUP 4U4BA 2MABA 3BG5A 2CFXA 3RKWA 2NNYA 3RPQA 4BEHA 1HOMA 1IJFA 1KJZA 3PSSA 2OTJI 4BYYA 1O8DA 3JURA 1YLOA 3HRMA 1Q81D 3E6CC 3CC4I 5HDKA 1E1RA 2PMUA 1XGNA 1YYVA 2ZO4A 3CXCB 2Q2EA 1KQ9A 3BQJA 4UB8C 4UAJA 3R0AA 1EXMA 4AC0A 4X7DA 2V4JC 2X4HA 1T6XA 3G2BA 3G1LA 4CO8A 1JJ2B 2Z9OA 3LA2A 3I64A 4Z4RA 3WU1B 1YW8A 1JUPA 3I56B 2PX9A 4HNUA 3JRCA 3NRVA 1I6HJ 3QWLA 1F20A 3NB2A 3VMWA 2E1RA 2XRNA 3OIQA 4LJZF 4P5OA 3BP8A 5E3NA 1KYZA 1RPWA 4HE5A 1BOBA 1Y1VJ 4F92B 1SFKA 2JPCA 2JVGA 4OMZA 5K5QA 1W1WE 5DDGA 2NXNB 3PNTA 4HWVA 4N4OB 1TT0A 4XLNF 4YELA 5GPAA 4OIPF 3G05A 1QVUA 4YXWA 4F7ZA 4I02A 1LM1A 1I27A 2B0LA 1YIJI 2OBRA 3FPPA 3L1PA 2YX4A 2DYIA 4RCYA 1VJSA 4A69C 1XGOA 3WNBA 3CD6B 1XPXA 1TTTA 5GTIC 2AQEA 3W5UA 5IYDJ 2RN7A 2R9VA 2NTQA 3LO8A 2M45A 3PUMA 2BY2A 3ZZ0A 1KU3A 3QYBA 1AIRA 2DI3A 2HOSA 3ERMA 3FK7A 1LFPA 4BJ5C 2KMUA 5BQTA 4YZ0A 3HBLA 3ZQQA 4UY8I 4PJNA 4KKSA 3O8GA 2R7ZJ 5TR9A 1TNSA 2L2OA 1YFHA 1S72B 1I3QJ 1U0JA 2XGCA 3QFRA 4L5IA 2E2JJ 1IV8A 4OIRF 5L3FA 2C4UA 3E97A 3TO7A 4CGZA 4LB5A 2JSCA 4KIGA 3BG3A 1X0CA 4LMYA 3PUNA 3CF2A 3HG9A 4LLLA 1D2EA 2HMAA 4B47A 2QA4B 3ML3A 1WU8A 2RNGA 2O0WA 3HKZN 3SDGA 4PC2A 3HSFA 5DEQA 4BKXA 2HDNB 1B8IB 1TWAJ 5HODA 3QRFF 3Q39A 5JLVC 4RPBA 2JZYA 3ONQA 3VYUB 3GXOA 2GQQA 4RM0A 4ENNA 1HKTA 3IKVA 3PA1A 3AL0C 5HNHA 3P5JA 1K5CA 3IH4A 3LVBA 4HSRA 1O7FA 2CV1A 4LB6B 1QQIA 4XRMA 1WI9A 4G6QA 2O6WA 1LKXA 2IGOA 1ZRDA 2FX3A 1S8NA 1GVDA 2EFOA 4QFMA 2ISYA 4WXCA 2XKPA 3RIQA 1ZN2A 3RQIA 1YITI 1YOVB 2WB1A 2ZSIB 3IAS2 3IWFA 1I8DA 1MBGA 3Q9VA 4G6IA 5D8LB 2A5YB 3KYDB 1VQMB 3U9GA 1JT6A 1RESA 1WJDA 1OYWA 4PC7A 3A8JA 2P6SA 3B8HA 5B1BH 3VYSB 4LC0A 2WAQN 1BN8A 3GQBA 1Q1HA 4YRVA 2HQAA 3ZQFA 1P6RA 2C5HA 3ZQHA 2XTXA 3O8HA 5C4XJ 3HXLA 1PJ5A 3RSNA 2JA2A 2VBEA 3OSFA 4BBRJ 1JI8A 2XROA 2R7SA 1XB4A 1MJAA 4AYBN 1MBJA 4KKUA 2HOEA 2EV5A 5HVQC 2YU9J 4Q4ZF 1T39A 2X1EA 1XG1A 1YG2A 4XK4A 2YWFA 1IB4A 3QAHA 2INVA 4FXUA 1FOXA 1O8GA 4ENMA 2ELKA 4IJAA 2JA7J 4EJVA 2MC4A 4HQMA 1W0UA 3H9NA 3GTLJ 2LTPA 2CGPA 2DT5A 1TWHJ 3R60A 2LVSA 2Z3YA 4UUSA 2LKSA 2ZL7A 1STZA 4IQ4A 4IOCF 5DS0A 1G3TA 1A31A 2QBYA 3GTOJ 5CVUA 4KT5C 4XRSA 4CQJA 3PNVA 2HZTA 3HGGA 2NVUB 5EZGA 1G7SA 1Z21A 1YJNI 4O5VA 1K7AA 2CYYA 1WGXA 2VBVA 2X1CA 4KA4A 4E7JA 5DTDA 3CMEI 1R00A 4Y4RA 1SD5A 1VQPI 2K9QA 3V7CA 1DU6A 3JQPA 1TYXA 3GWZA 4LFUA 2ECBA 4GYIA 2VIXA 3A0BC 5FFZA 4C3JJ 1V54H 1G4DA 2DOGA 2Q6KA 3CESA 5LEKA 2VKDA 1COWA 3ZQIA 4G5GA 1R1TA 2VLAA 3MCAA 2H94A 2DA7A 2I10A 3MZHA 3IRQA 3HOXJ 2DFHA 2R7UA 1H80A 2QQAA 4CDGA 4ENJA 3QOPA 2RDPA 3NWTA 2HVSA 3HTUA 5IT3A 1VHOA 2XF6A 2FQ3A 2K9LA 3OV8A 4QUZA 2ZTGA 2BZTA 2V1NA 3H3UA 4MFEA 3HOSA 1IN8A 1PJRA 4C3IJ 3HOTA 1QPMA 2V6EA 4X7FA 2EFWA 5AN9A 4URRA 1IDYA 1XTAA 2LBFB 4R79A 5BOXA 4FQGA 1W36D 1U3EM 3AVVA 4XQFA 2DETA 1J5YA 2W6IA 1RQRA 1JGSA 3SZEA 4OIOF 1UD8A 1L0OC 3JQRA 2KIQA 1NHAA 4IHSA 2HI3A 5FLVA 3B4NA 4AWXB 2MW8A 2L7MP 2LNBA 3RZOJ 1YJWI 4CSWA 1BR1A 1QVTA 3W6JB 2MD5A 1Y1WJ 1R4NB 4ACBA 3CMAB 3RKQA 2FOKA 3V8KA 4FWTA 2NNNA 1DP3A 1FSHA 2IA1A 1SD7A 2O3FA 3HHGA 3V4GA 1BC8C 1QA1A 3D0SA 4W8RA 1OQYA 5FD6A 3W2IA 2LZJA 3TDZC 4KNYA 2V7UA 1ZTRA 2OCEA 3CB4A 3MD2A 5IYQA 4RAGA 3MMPA 2L54A 2XNCA 3GF2A 2M5SA 1H85A 1HG8A 5H2FC 1MNMC 1X1DA 3D5SC 2BVMA 4MHGA 1EA0A 2WY8Q 3SEJA 2AXLA 1N8RD 5LGUA 2LK2A 2BEOA 4TMZA 4EJUA 1VQNB 2XZLA 4M9ZA 1TWCJ 1X4PA 3DF8A 5KK1A 1U2WA 1BI3A 3W2HA 4DQLA 1K8FA 1H8AC 2KRCA 2MLGA 2E1NA 2W1OA 5HZAA 5F1RA 1FOYA 2DQRA 3CUQB 1HKQA 1E62A 1ZELA 2QLZA 3L00A 4CH7A 1I7PA 4PSWA 4ZYEA 3KEQA 1BX0A 3CO6C 1QFZA 3SXYA 5J6XA 2L01A 3N4MA 5BPDA 1GLNA 4L0ZB 3HUGB 4G7HF 2E34A 5L3GA 5J8FA 5DNSA 1QFJA 5EEGA 4OAZA 3BTIA 3SYTA 1S3JA 4HOBA 3WHCA 1G2HA 2OZUA 3UR3C 3JRAA 1BW6A 1VQ8I 3BY6A 1LDKB 1Q86D 4P3IA 2X53S 2NTPA 4LK1F 3AK5A 1D1AA 2VKHA 1LNWA 2AQFA 3OS2A 2YPRA 3RPUA 2QSGX 4TKOB 3TH0A 2Y30A 3QPTA 1HF2A 3FXRA 1BIBA 3BC8A 5IP7J 4UB6C 2X0KA 2VFNA 1PUFB 4ESFA 9ANTA 4M74A 1HSJA 2PMZN 1YS7A 3D5LA 3H3ZA 4R71A 2V5IA 4DK0A 1K6OA 4AVPA 4PMHA 1Z05A 2NAZA 2R4GA 4LIVA 3WHBA 3GZ6A 1KTVA 1K8AD 1OFDA 4Z05A 3T8TA 4BL0B 5LGTA 2XF7A 2VBMA 2ZL5A 1W87A 4HQEA 1R22A 1ETWA 3F72A 1WOSA 2JJ7A 4HNTA 3F21A 3HOZJ 4OIQF 2BM4A 2XUBA 3ABLH 4CXFA 1S29A 3K70D 3DEWA 4I2OA 2HVQA 3HKZA 3E20A 4W8SA 2ZXWH 5TJJA 2MLKA 1ORKA 1D1BA 2V1UA 3PA2A 2OTJB 2KL4A 1WTHD 3TQNA 3U2RA 5THXA 3ZIAA 2F4NA 1SKYB 1YE9A 3KZZA 3LWFA 1BJAA 3BCFA 3M9AA 3CC4B 2QSHX 4XOPA 5J47A 3DU6A 2FNPA 4YAWA 2RAEA 2O8XA 3KEOA 4EM1A 4BAYA 4A3MJ 4LOCA 4D0PA 1HKSA 3HIFA 3QPSA 3KETA 1X2NA 2OUMA 3JX8A 1KTWA 5DM7F 4P22A 2GJKA 3AVXA 3WG9A 2BN4A 3MWMA 4V2GA 3AVTA 3OOPA 1QHHD 3BTLA 1SMYF 1S9HA 1T95A 3J80K 3J80Z 2F4IA 2WAQA 2LKPA 2D1VA 3TBIA 1MNEA 4Z6YA 1SC7A 4PAAA 2F5FA 5HS8A 2DK8A 3PFYA 1Z0XA 1YIJB 2MH2A 2O7OA 2WZPP 5JVGF 4P12A 4AYBA 2Y69H 1MNDA 3BH6B 3S1RJ 2DA3A 5C44J 1LUJB 1WFXA 1DPUA 4OINF 1D8JA 1QGPA 2LR8A 2CH0A 2OQGA 4FTHA 3CMMA 1MDMB 2GOMA 5ERIA
chains in the Genus database with same CATH topology
5LFAA 1FMVA 2IS1A 1O8HA 3H9GA 3CJQB 2IS6A 2RREA 4ZC3A 2R7VA 1OOCA 3KEYA 1R6RA 4ITVA 3M1CA 1O8IA 3OS0A 1N75A 2K9MA 1KZLA 1UD4A 4Z06A 2MD0A 3OFNA 4D9JA 1W0JA 3L2UA 3HAGA 2I8DA 1UG0A 2CFOA 1D1CA 1DQUA 4C2LA 2HVRA 4B48A 3OYJA 4E4HA 2LY1A 4HIZA 3DKXA 3VSVA 2WJYA 2K5CA 2ZZEA 3OAAA 4KT6A 4XKVA 4XR6A 4BJ6C 2QY1A 4DNTB 1HVXA 4RM3A 3OL4A 2WAFA 4KKTA 1BHEA 3PNYA 3KX2A 2KLOA 2XZOA 4U49A 3K4NA 2LREA 2X1DA 3OS1A 5CDFA 1RU4A 2BSPA 4ZDPA 2ZFUA 1WJFA 1VZ0A 4DJAA 3I9V2 3K4MA 2F1MA 4J00A 5KNLA 3L2QA 2W6JA 4F3QA 3GQ9A 2KP6A 1HZEA 1V0EA 1OFMA 4KITB 2GK6A 3AFHA 2XNDA 3N05A 3OYCA 2X3HA 1UD5A 4ZTJA 2M3AA 1DGRM 1WJBA 2GJPA 1V5GA 4D1QA 2M7AA 3UNGC 2VJ4A 3C2GA 2IGKA 2HPMA 2Z1DA 4DK1A 1O8EA 4BUPA 1W9XA 5LD2C 1XG2A 4BE2A 1Z3YA 1WJAA 2MFZA 1FMWA 2PYHA 1Y6IA 4OJ5A 2RQQA 3K10A 2NSPA 3OY9A 2KRHA 4XL9A 3AL0B 4G7XA 1YX5A 3CP2A 4NC8A 4B44A 4B3GA 4II2A 1NG7A 2L5QA 2R7TA 2V4DA 2DXIA 3VWBA 2ZZQA 4XKCA 2R7QA 3A2KA 4BE1A 3FBIB 4NK6A 2XC7A 1KCDA 4OJ6A 3IUOA 4E7IA 3VSKA 4BDYA 4II3A 4X0GA 2BW3B 4KJZA 3FHNA 3HPHA 4DNRB 2CUZA 1PLUA 4KISA 4E7LA 3VSUA 3BC9A 2Z2SB 2A6TA 4YZXA 3BG6A 4NK8A 2BOLA 2KZVA 4JQFA 4XKWA 3A3BA 1O88A 2KHMA 4ASUA 3DPUA 3PSIA 4LITA 3RTRA 3MKZA 1SAUA 4DIQA 2CW8A 5HNFA 3LMMA 4XLCA 3LFUA 3MKWB 2XZPA 4F91B 2GJRA 2DT7B 2WBMA 4XOTA 4C30A 1YX3A 3PUBA 2L7KA 4QPQA 2CK3A 1TZLA 4OJPA 4HEA2 1DBGA 2E1BA 1VLYA 2QKMB 4P1WA 3DPTA 3E0JB 2JUGA 4E7ZA 2WJVA 2ZZFA 3LSMA 3DDYA 1BMFA 2QXZA 1WJEA 4HPQA 1EA3A 1KCCA 3NE5B 4U4BA 3ZCOA 1OB0A 2MABA 1D0ZA 3OYNA 4Z03A 2E1MB 4PFPA 4BEHA 3ZXSA 3LSHA 2VPLA 2DT6A 5FROA 1N77A 1O8DA 3JURA 2JJ2A 2O5RA 4DOZA 3GVJA 1E1RA 1WP6A 1RWRA 2PECA 4BGDA 2CW7A 2IXSA 3L2WA 1CZFA 3W3CA 3DQVC 4XNFA 5JHFA 5CQGA 2V4JC 1WMRA 2IGMA 3G2BA 3GQAA 3DWLE 4YEJA 5CKTA 2VJ5A 2PJRA 4HNUA 4MR0A 3OPOA 3VMWA 3OIQA 4P5OA 3ZR8X 4Z1MA 2M4GA 2CUJA 1BOBA 4F92B 2ZZGA 1SFKA 2JVGA 3LSIA 1N78A 2HNHA 3ZRGA 2PMZA 3H5RA 1NG6A 3PNTA 4HWVA 4N4OB 2F6CA 1TT0A 4YELA 3K70C 3G05A 4YXWA 3ZPNA 3EQOA 2O0VA 4F93B 3FKSA 3FPPA 1IA5A 1NHCA 4IKFA 3MKYB 2ZTNA 4PUSA 3DTKA 1VJSA 1PE9A 1G8XA 2AQEA 2NTQA 4XMYA 2R9VA 2X6XA 2LRDA 1RMGA 1UELB 3EQNA 4PJJA 5C1EA 3QYBA 1AIRA 3GBGA 3OR2C 2X85A 2DIEA 3HC7A 4LG3A 1LFPA 4BJ5C 2KMUA 2R7RA 4YZ0A 3M8JA 1BR2A 3ZQQA 2IGNA 2P0WA 4PJNA 4KKSA 1MMAA 3IAM2 2WPDA 3K4KA 2F43A 4RLQA 4BU2A 1BLIA 2R7XA 2L2OA 1VF7A 3SEZA 3VMVA 4U87A 1U0JA 2M7BA 3DU5A 2ELJA 4F52A 4CCOA 1PKVA 3LSGA 1IDKA 3H9JA 4XORA 2V9KA 2W00A 1Y56A 1X0CA 2UUZA 2O17A 3CF2A 3HG9A 4HRIA 1G59A 2VBKA 3S8PA 4B47A 4CCMA 1W36C 1UAAA 4BACA 2RNGA 1OGOX 3DKYA 2O0WA 2LYCA 1E43A 2V7QA 3K4JA 2VASA 2W82A 1EFRA 4DGWB 4AVZA 3L2RA 2KQRA 5C1CA 3H5NA 3B90A 2V7FA 1UD2A 2JIZA 3ONQA 3VYUB 3OMYA 3K4CA 2VQCA 3RQ4A 1NRKA 5HOOA 3OYIA 4EATA 5HNHA 3AL0C 1K5CA 4EW9A 4HSRA 2CV1A 4I84A 4CCNA 3I3LA 1LVKA 3H5AA 3DEEA 2ODLA 1K6YA 1LKXA 2IGOA 3S93A 3GQ8A 4CA0A 4ANJA 4YZAA 2XDVA 4ZTFA 2XAUA 2WB1A 2ZSIB 3IAS2 3LL7A 1I8DA 4G6IA 2JJ1A 4CCLA 2WAEA 4XLEA 2M4KA 3H94A 2A5WA 1WJDA 3W2WA 3WQZA 1WPCA 4F55A 3VYSB 3HPGA 4PFOA 1O8FA 1UD6A 1BN8A 3GQBA 4YRVA 1MMGA 2HQAA 3SZGA 3A4CA 3HXLA 2XSJC 4XLHA 2JA2A 3RSNA 1X4OA 3OYKA 2VBEA 3OYEA 2FUG2 1JI8A 3H0DA 3T56B 2R7SA 2DCEA 4E7SA 4ZJZA 1E79A 4KKUA 3OE7A 5HVQC 3GVKA 2X1EA 3ZGKA 3VR6A 4OJLA 2VQGA 5CQEA 2EWEA 1IB4A 2INVA 3VDXA 4FXUA 1O8GA 3OOCA 2OV7A 3B8YA 4TSFA 2MC4A 1O8LA 3BCBA 5TGTA 3S32A 3EUAA 2GOXB 3SEQA 1AA7A 3BG7A 4NC7A 3OYDA 4OJOA 3GQ7A 3TL4X 3VSTA 2OC6A 2QKLB 3T9GA 4IQ4A 3PJRA 4W8QA 1Z7LA 3BCDA 3EUKL 4E6KG 2X8KA 2E60A 2Q1ZB 4OZYA 4RM2A 3PNVA 1JTAA 2MYSA 1Z21A 2NT6A 2O04A 1BR4A 3L2VA 2DJIA 4JOMA 1MABA 2X1CA 3S3NA 4E7JA 2CV2A 2PYGA 2O1DA 4Y4RA 4BQNA 2LOOA 3GVLA 2LBFA 4G7WA 5HLTA 1OFLA 4NQWB 2IQ7A 1P9QC 2VIXA 2DOAA 2WADA 3CESA 2Z8GA 2X6YA 1MMDA 2VKDA 1COWA 3HL2A 4PSXA 4E7HA 3V42A 2CV0A 1IDJA 4MXNA 2VLAA 4NNJA 5FRNA 2VQLA 4Y33A 3OYGA 5AMVA 2R7UA 1H80A 3OYMA 1I18A 4C2TA 1D0YA 2BVLA 3NWTA 4CZCA 2HVSA 3OYAA 4BEHB 2XF6A 4H4KC 2K9LA 2X51A 2ZTGA 2V1NA 4CCKA 4XLAA 2IS4A 1H8EA 3HOSA 1E1QA 1PJRA 3CP8A 3HOTA 2CMPA 2V6EA 2LY2A 2Q2EB 3OYLA 1V5EA 4URRA 4U7BA 1W0KA 2LBFB 1HA8A 3GRHA 2WY7Q 4R79A 1W36D 4LIUA 4BE0A 3A35A 5FL7A 1X19A 1UD3A 4XQFA 2L9NA 2W6IA 3ZSCA 4BDZA 1OR7C 2LC2A 1UD8A 3W2AA 2PJRB 4B3XA 1T5EA 2UVEA 2V26A 3C2HA 4RLFA 3OWTA 2ZSHB 4PJMA 3B4NA 3T53B 2V31A 1O8MA 1NBMA 1PYVA 4C9YA 4HSTA 2VXZA 4CSWA 3CJRB 1BR1A 4NUBA 4XN3A 1Z3XA 2XF5A 2LH9A 1WJ5A 2Y0SA 1QU3A 2X6WA 1T0FC 3FY3A 1DP3A 3WWGA 2INUA 4N4NB 4JMQA 3BLYA 4W8RA 2D3LA 3EPZA 5CPRB 2LZJA 2HZDA 2NOJB 1KONA 3MD2A 4IQJA 1E3ZA 2QX3A 5DN6A 3LNNA 2WA0A 2M5SA 4BQOA 1HG8A 4IZZA 2W4SA 2W7NA 4BXFA 1X1DA 2BVMA 3D5SC 4FETA 4XN0A 3RCOA 2WY8Q 2D3NA 3T51B 3KRGA 4CUGA 3VYRB 4DBRA 3FBNB 4B3FX 1GQ8A 3OYBA 3PSFA 5HKKA 2L9SA 2XZLA 1V0FA 2VB6A 4HG2A 4ZYAA 1X4PA 1MW7A 4DBQA 4W8TA 3OIPA 3RPUD 2E5ZA 1DGWY 3NWSA 2KRCA 4CCJA 2R7OA 2W1OA 3F9KA 3UW0A 1O8KA 1EE6A 3OR1C 4BJTA 1ZELA 1OLTA 3OOUA 2BW3A 4CH7A 4PSWA 3QYFA 2LG4A 4BS9A 1FX0A 4ZDOA 1GLNA 3TMOA 3HUGB 4OAZA 3OW7A 3SYTA 3A1YA 3UR3C 3U21A 4IX7A 3W2VA 3VSLA 4L8JA 1LDKB 4YZQA 2ZXIA 5FRMA 2X53S 2NTPA 2CS3A 1D1AA 2VKHA 2AQFA 2Z16A 3OS2A 4TKOB 4XLFA 4FASD 4ZDLA 4XD7A 3K4BA 3BC8A 1QHGA 2VXDA 1D0XA 1O8JA 1IRXA 2Z6BD 3KEWA 3D5LA 4AU7A 4DK0A 4GQNA 3SDBA 4PMHA 2UWMA 1E0EA 2R4GA 4LIVA 2IS2A 2WSSA 3JU4A 1OGMX 3DPLC 2NZMA 4Z05A 2HLDA 4BL0B 3A3GA 1DBOA 3QYEA 2XF7A 4PJLA 2VBMA 2E1MC 4XM3A 3SUCA 1E3XA 3BCAA 2XOKA 4MLOA 2ZXHA 4HNTA 4RMNA 1K28D 3ZPPA 4BQQA 1J09A 4OZZA 4C2UA 3K70D 3K4LA 2HU9A 2HVQA 3FDYA 3S3MA 2HDWA 3D5RC 3HKZA 1KMHA 4UZUA 3LMWA 4W8SA 5KCMA 2K3PA 1D1BA 1WJCA 1X1BA 2KL4A 1OHHA 1WTHD 2NTBA 3ZIAA 1SKYB 4E7KA 1YE9A 1BPLA 3QOEA 3BCFA 1QJVA 2JSPA 4XOPA 2UVFA 3DU6A 2R7WA 4TT3A 3PL8A 2UV1A 1PXZA 3EUHC 2KPMA 3VYTB 2M0MA 1VBLA 5IK2A 3LSKA 3OYHA 2OUMA 4GRIA 1KTWA 2VJJA 4P22A 4OAYA 4OWRB 2E5NA 2GJKA 3DTEA 2VJIA 1X1CA 3K6GA 2XGJA 1QCXA 3DTIA 3KYLA 2GK7A 1QHHD 3OEEA 1S9HA 3CZ6A 1T95A 2NT9A 2VL8A 2QE7A 4G6TB 2F4IA 2WAQA 3TBIA 2JDIA 1H8HA 1MNEA 4Y3OA 4J01A 2KVOA 3DLAA 2JVHA 3S3OA 3H35A 3FKJA 3PFYA 4E0FA 2HPIA 3AKZA 2WZPP 1MMNA 2VQHA 4AYBA 3OYFA 1MNDA 3H9QA 3IP4B 3OL3A 4XKBA 2F5VA 1WFXA 4QPOA 3QODA 3OEHA 4XONA 4PK4A 1ERDA 3BH4A 3MMYB 2KDOA 2CH0A 4B43A 3E1SA 5KHDA 3J7AY 1V5FA 3CMMA 2GOMA 1JRGA 1X1AA 2NSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWR A;  2PEC A;  1O8H A;  3UW0 A;  4OJL A;  1O8K A;  1OOC A;  2EWE A;  1IB4 A;  1CZF A;  2INV A;  4XNF A;  1EE6 A;  1O8I A;  1O8G A;  3B8Y A;  1WMR A;  1O8L A;  3GQA A;  4Z06 A;  4YEJ A;  4OJO A;  4MR0 A;  3GQ7 A;  3VMW A;  4C2L A;  3VST A;  3T9G A;  3VSV A;  4W8Q A;  4XKV A;  4XR6 A;  2QY1 A;  4OZY A;  1BHE A;  1JTA A;  4HWV A;  4YZQ A;  4U49 A;  2O04 A;  2NT6 A;  2NTP A;  4YEL A;  4XLF A;  1RU4 A;  2BSP A;  3EQO A;  2O0V A;  1IA5 A;  1NHC A;  2PYG A;  2O1D A;  1PE9 A;  1O8J A;  3GQ9 A;  2NTQ A;  4XMY A;  1OFM A;  2X6X A;  1RMG A;  1OFL A;  3EQN A;  2X3H A;  2IQ7 A;  5C1E A;  1AIR A;  2X85 A;  2Z8G A;  4PMH A;  2X6Y A;  1OGM X;  4MXN A;  1IDJ A;  2NZM A;  4YZ0 A;  4Z05 A;  1DBO A;  1O8E A;  5AMV A;  2VBM A;  4XM3 A;  1H80 A;  1XG2 A;  3SUC A;  2PYH A;  4OJ5 A;  3VMV A;  3ZPP A;  4OZZ A;  4XL9 A;  4XLA A;  1IDK A;  3LMW A;  4W8S A;  4XOR A;  2NTB A;  4URR A;  1X0C A;  2O17 A;  4NK6 A;  3GRH A;  1KCD A;  2VBK A;  4OJ6 A;  2O0W A;  4XQF A;  1OGO X;  1QJV A;  4XOP A;  2UVF A;  3ZSC A;  1PLU A;  4AVZ A;  3VSU A;  1PXZ A;  5C1C A;  2UVE A;  3B90 A;  4YZX A;  1VBL A;  4NK8 A;  4XKW A;  3B4N A;  1O88 A;  1KTW A;  2VJJ A;  1O8M A;  1K5C A;  4EW9 A;  2VJI A;  4I84 A;  4XN3 A;  1QCX A;  4XLC A;  4XOT A;  2ODL A;  3GQ8 A;  2X6W A;  2NT9 A;  3FY3 A;  4YZA A;  4OJP A;  1DBG A;  2NSP A;  3WWG A;  2INU A;  4W8R A;  4XLE A;  2QXZ A;  1KCC A;  2QX3 A;  4U4B A;  1HG8 A;  1O8F A;  4Z03 A;  1BN8 A;  4XN0 A;  3KRG A;  4XON A;  1GQ8 A;  4XLH A;  1O8D A;  1JRG A;  2VBE A;  3JUR A;  4W8T A;  2NST A; 
#chains in the Genus database with same CATH topology
 2KIU A;  5H20 A;  2JA6 J;  5FLX Z;  1QPI A;  3U2Q A;  1R1U A;  2DMP A;  1ZLJ A;  2EIM H;  3SFI A;  2RRE A;  4ZC3 A;  1ZRC A;  1OOC A;  1T0F A;  3K1P A;  3C1D A;  3M1E A;  4ITV A;  3M1C A;  3WOD F;  3OS0 A;  1N75 A;  4C0S A;  4H9G A;  1K61 A;  2MD0 A;  4QIW N;  3HAG A;  1B6A A;  4JX6 A;  2I8D A;  1UG0 A;  4JRA C;  2NS7 A;  5K7Z A;  1D1C A;  1DQU A;  4C2L A;  5KAI C;  4PAB A;  2L3D A;  3A8I A;  3CCM I;  1GAQ A;  2ZZE A;  3GFI A;  3ASP A;  2QY1 A;  1XSV A;  3V76 A;  4NDL A;  1XGM A;  4IEJ A;  5JLX A;  3OL4 A;  1HVX A;  4RGX A;  1XN7 A;  1W7P B;  1IN5 A;  2CQK A;  1RU4 A;  2WV1 A;  3KZI C;  2VPR A;  5ICG A;  3FIW A;  3QP6 A;  2HKX A;  3ROU A;  3K4M A;  4A3E J;  1ZG3 A;  1VF9 A;  2XB0 X;  2RKH A;  2F2E A;  4L18 B;  1JJ6 C;  3BR6 A;  2AO9 A;  3JRH A;  4FE7 A;  1ZAO A;  3HOY J;  4KIT B;  2EIX A;  3AFH A;  1FND A;  1OFM A;  3TP3 A;  2X3H A;  2P4W A;  1G7T A;  1UD5 A;  2M3A A;  2ELH A;  4P6V F;  1LQ1 A;  4CZZ A;  1WJB A;  2GJP A;  1V5G A;  1VQ6 I;  2M7A A;  5IT9 Z;  4V02 C;  2HPM A;  1FT9 A;  3PSZ A;  1H89 C;  4BUP A;  4RDK A;  3AG2 H;  4ON0 A;  2R5Y B;  2J7K A;  1N0V C;  1YIT B;  2MFZ A;  5GTH C;  1DUX C;  2O61 A;  3CRZ A;  3PFI A;  2DY1 A;  4YFN F;  5IOZ A;  4DZJ A;  4G7X A;  1G6N A;  2PLF A;  3BJ6 A;  4UV9 A;  1NG7 A;  1JJ8 C;  1IXS B;  2BMW A;  3ZUG A;  2GRE A;  2DXI A;  4EMS A;  3VWB A;  3E6B A;  2RGV A;  4EQQ A;  3TGN A;  1LE8 B;  3Q6R A;  2WV0 A;  1KCD A;  2XC7 A;  4EJO A;  4BHP A;  1Q9S A;  3VSK A;  1P7J A;  2COM A;  2XGE A;  4PZJ A;  4WF2 A;  5HS7 A;  3H0G J;  2BW3 B;  4EM2 A;  3JRE A;  1ZLK A;  4KJZ A;  4DNR B;  1R5I D;  2HXO A;  1NB0 A;  1LDD A;  4KIS A;  4E7L A;  3VSU A;  2QGG A;  2ICW G;  1I1S A;  1N25 A;  2Z2S B;  2A6T A;  2QQB A;  4IHT A;  1DDI A;  3WNC A;  3R0J A;  2BOL A;  4XKW A;  1MRZ A;  4BXX J;  4X07 A;  3RTR A;  3HTS B;  1HLV A;  2XGX A;  1HQC A;  2W24 A;  2YWE A;  2VKV A;  5BS6 A;  4XLC A;  3LFU A;  3DFG A;  1YX3 A;  3PUB A;  2G7U A;  2HQ5 A;  1ZM4 A;  3JRG A;  2QUF A;  2DER A;  5FKM A;  3DDY A;  4U9U A;  2WJV A;  3T1B A;  4G6D A;  3TDU C;  5B1A H;  2EFG A;  1X2M A;  3S2D J;  5F04 A;  1EV7 A;  1KCC A;  5HDN A;  3CME B;  3ZCO A;  1OB0 A;  3AVW A;  1VQP B;  3OYN A;  2CSO A;  2E71 A;  3WTW C;  3ZXS A;  3LSH A;  2DT6 A;  1W4M A;  1IRZ A;  4RAZ A;  1ULY A;  5FRO A;  2O5R A;  3FXQ A;  3CCU I;  3IHU A;  3WGG A;  4UZE A;  5FNZ A;  1J9I A;  2IP2 A;  2CW7 A;  1EP1 B;  4QSH A;  4A6D A;  1QUE A;  2IXS A;  4HV6 A;  3W5H A;  5GV8 A;  3GQ9 A;  2J5P A;  2PN6 A;  2XKO A;  1B23 P;  2LKX A;  1QO0 D;  2DA1 A;  3DQV C;  3W3C A;  5CQG A;  5JHF A;  4Y13 A;  1WMR A;  2IGM A;  5HLG A;  5FA6 A;  3DWL E;  1ZM2 A;  3CF5 F;  1R5B A;  2GLO A;  2WZN A;  1WXR A;  2TRT A;  3V8J A;  2PJR A;  1CQX A;  2H6C A;  3A01 B;  4DZP A;  4Y9U A;  3ZR8 X;  4LBY A;  2HCJ B;  4RD0 A;  5EJC A;  2M4G A;  2CUJ A;  1OCO H;  4MYU A;  2NVQ J;  4LK0 F;  1RI7 A;  4N3G A;  2D2W A;  5J35 A;  3ZRG A;  2KRF A;  2M5W A;  2PMZ A;  1FPQ A;  2XGD A;  1G7R A;  4X0C A;  1N07 A;  3LAP A;  1TC3 C;  3HSE A;  1GVJ A;  3K70 C;  2VNK A;  4G7O F;  1T38 A;  1IA5 A;  4F93 B;  3FKS A;  1P7I A;  2P81 A;  1VQ7 I;  4RGR A;  4XMY A;  5E79 C;  2LRD A;  4XRS G;  1UEL B;  4KIB A;  1RMG A;  2W57 A;  3ZQG A;  1G7C A;  5C1E A;  1YJW B;  3GBG A;  4XBF A;  1QZZ A;  3JAM K;  3RYR A;  3DBL B;  4A5N A;  3HC7 A;  4LG3 A;  2QEX I;  5TY0 A;  2BHY A;  1QGA A;  1S5L C;  3P27 A;  4Z4T A;  4YIF A;  1USS A;  4YG2 F;  4I01 A;  1MMA A;  1XS9 A;  3K69 A;  1VI0 A;  2P6T A;  2G0E A;  2ZNY A;  2WPD A;  3WND A;  4U87 A;  4HNV A;  3GO5 A;  3QU3 A;  4FX0 A;  5IP6 A;  2ELJ A;  4LBV A;  4YAU A;  4CCO A;  1BA5 A;  2ZNZ A;  3H9J A;  3RKY A;  1LVA A;  1SAN A;  2V9K A;  3ZMV A;  2C6Y A;  3F23 A;  3V7A A;  4CYD A;  2UUZ A;  1F43 A;  4HV5 A;  4HRI A;  3U6B A;  4CCM A;  3WBK A;  1RKT A;  3ZMU A;  1FEX A;  3S1M J;  2XEX A;  1OGO X;  2GM4 A;  1E43 A;  5DD8 A;  3L7W A;  3K4J A;  3OKX A;  2CUE A;  2HOT A;  2OYN A;  2QWW A;  5C1C A;  3S1N J;  3G71 I;  1UD2 A;  2JIZ A;  5J40 A;  2GXG A;  1LFB A;  3ZMZ A;  3K4C A;  1YJ9 I;  2VQC A;  3RQ4 A;  1NRK A;  4EGZ A;  5HOO A;  2VON A;  3BH7 B;  4EAT A;  2ZCW A;  3ERE D;  3ABT A;  4EW9 A;  5LMZ A;  3QQA A;  5E17 F;  4CCN A;  3I3L A;  1LVK A;  3H5A A;  1FBS A;  1FNC A;  4MEY F;  4RJL A;  2CRG A;  2MA3 A;  3DEE A;  4UUT A;  1QH0 A;  4G1B A;  1T8I A;  4JX5 A;  1LLZ A;  4YZA A;  1VQ8 B;  1X3Z B;  2XDV A;  4QTR A;  4ZTF A;  4ENK A;  2FXA A;  2ZME C;  3E5Q A;  3S17 J;  2OU2 A;  4EH1 A;  2ESN A;  4G9Y A;  4HZF A;  2M4K A;  2LMD A;  2A5W A;  2ME0 A;  2E2I J;  1TW2 A;  4LLG F;  3RZD J;  3M4O J;  1HW5 A;  3FPK A;  3QFT A;  1WPC A;  2ECC A;  3BQY A;  1TTY A;  1SM4 A;  3WQZ A;  2O0Y A;  3FXM A;  4M9S A;  4XIC A;  4A3J J;  1U8B A;  2DA4 A;  3PET A;  2IPQ X;  4XLH A;  2RC5 A;  2GBY A;  1X4O A;  3T5X A;  3OYK A;  3ZBT A;  2FUG 2;  1GDT A;  2CND A;  3IH2 A;  4Q5S F;  3OZU A;  3FM3 A;  1GJR A;  4A3C J;  1N0U A;  4XLP F;  5JHU A;  2VQG A;  2EWE A;  3F8F A;  4IXA A;  3VDX A;  2ZJQ F;  3OOC A;  1Y0R A;  2AXT C;  5J1Y A;  2A6H F;  3HOW J;  4TSF A;  2BV3 A;  1O8L A;  3BCB A;  5DCM B;  3CDI A;  2K9N A;  4HX4 A;  1U5T A;  2BY1 A;  2UXN A;  1AA7 A;  3OYD A;  2DQL A;  3GQ7 A;  3TL4 X;  1ZG1 A;  3VST A;  2OC6 A;  3A02 A;  2BX6 A;  1H9T A;  1BL0 A;  4W8Q A;  5DS9 A;  1Z7L A;  3T9G A;  3EUK L;  2FE3 A;  3FMS A;  2E60 A;  3DBH B;  3P9K A;  5CJ9 A;  4B1R A;  5D4R A;  2JA5 J;  1XQB A;  2HR3 A;  2C5B A;  3BR1 A;  4I98 B;  1JTA A;  1R5H A;  3HDD A;  3LAJ A;  2NT6 A;  3K0L A;  1BR4 A;  3L2V A;  2FOW A;  4JOM A;  3F0C A;  4U88 A;  5K1Y A;  3S3N A;  3WTX C;  4DW6 A;  4ZGQ B;  2CV2 A;  1NDH A;  2E35 A;  4BQN A;  3IL2 A;  4RGS A;  1YX2 A;  1IAW A;  3IWZ A;  3OIO A;  1PUE E;  3GVL A;  4O6J A;  1IJE A;  2M30 A;  1IHM A;  4LLN A;  1E3H A;  4ZZL A;  3ABK H;  1ZH5 A;  1P9Q C;  1PVE A;  5B5E C;  2VFM A;  4BPR A;  2Z8G A;  3F8M A;  2X6Y A;  4I7H A;  1CLW A;  3ECO A;  3HL2 A;  4E7H A;  1IDJ A;  4PDK A;  3I0T A;  4QLC U;  4BHC A;  1FZP B;  2STT A;  4NNJ A;  1GR1 A;  4Y33 A;  2VBS A;  3GCM A;  4ZZD A;  3OYM A;  3ZQC A;  3RJP A;  4C2T A;  2LLK A;  3GTJ J;  3T8R A;  1DP7 P;  1XSD A;  1R5N A;  1T98 A;  4AC9 A;  1M1E B;  2MGQ A;  2Y75 A;  2QBY B;  2X51 A;  2KIM A;  2XT2 A;  4L9T A;  3M8F A;  4XLA A;  4UVA A;  4G94 A;  3VPR A;  1H8E A;  1E1Q A;  2A61 A;  3CP8 A;  3KP6 A;  1JT0 A;  5AIP A;  3MN2 A;  3OYL A;  2QTL A;  4W1U A;  2WTE A;  2OZ6 A;  2WY7 Q;  4JYK A;  4KMU X;  4LIU A;  4BE0 A;  5FL7 A;  4RA2 A;  3VMV A;  1KK1 A;  1X19 A;  1N08 A;  1JB9 A;  3F8N A;  3KLN A;  5IYC J;  2BM5 A;  1J75 A;  3ES9 A;  3RYP A;  3W2A A;  3TP0 A;  2M8G X;  2JMW A;  3MVP A;  2UVE A;  1B1B A;  1QZE A;  3NQO A;  1XE1 A;  2DDB A;  3OWT A;  2DCU A;  3P7N A;  1IUF A;  1O4X A;  3LA3 A;  4LG0 A;  1VQ4 I;  2C4T A;  3K2A A;  2VXZ A;  4X7E A;  1R5O A;  1B2R A;  4G8X A;  4K2E A;  2DLL A;  4XN3 A;  1IXR C;  3IV5 A;  1Z3X A;  4TV7 A;  4WQM A;  2XF5 A;  3JW4 A;  3CPX A;  2LH9 A;  2BYV E;  2ACJ A;  4RD4 A;  3WU2 C;  5CVI A;  3GTK J;  5FKK A;  4B09 A;  1GO2 A;  1T0F C;  1LPQ A;  1BX1 A;  3R6J A;  4OP7 A;  3FY3 A;  3NAU A;  2VNH A;  3WWG A;  1Q1V A;  3TO9 A;  3EYY A;  4N4N B;  1UJ8 A;  1YHQ I;  3ZBU A;  2E1C A;  2V79 A;  3F8B A;  3KP2 A;  4L5E A;  4IQJ A;  1E3Z A;  2V7W A;  4AF7 A;  5DN6 A;  3LNN A;  2QX3 A;  1J59 A;  4IZZ A;  4BNC A;  5IP9 J;  5TV2 A;  5FB2 A;  4XN0 A;  3RCO A;  2XPV A;  1EKE A;  3T51 B;  3PIP F;  2OTL I;  2KIS A;  4B3A A;  3FBN B;  1GQ8 A;  4Q7J B;  3PSF A;  1UST A;  3WTZ A;  2VB6 A;  4HG2 A;  4M1K A;  1VQ6 B;  2VBZ A;  1K73 D;  3E7L A;  1E2X A;  1S4M A;  2E5Z A;  2RVC A;  2R7O A;  4YDT A;  1NTC A;  2XAJ A;  3F9K A;  1E17 A;  2VBW A;  3G73 A;  2O6G E;  4U0Y A;  1EE6 A;  3BJO A;  1SD6 A;  3OR1 C;  4BJT A;  2OK7 A;  3ZC3 A;  4ACA A;  2MG4 A;  3QYF A;  2L9V A;  3KP4 A;  3SJP A;  4XSX F;  1SVO A;  2LG4 A;  1FX0 A;  4FT8 A;  3J81 k;  2HDD A;  1SD4 A;  1N06 A;  3OW7 A;  1XMK A;  3A1Y A;  1XDS A;  3NEU A;  2V7T A;  2K27 A;  1BJK A;  3JSO A;  3VSL A;  1DG1 G;  2BPO A;  3CTA A;  1IXC A;  2OD5 A;  3W6V A;  2ZXI A;  1ITY A;  5FRM A;  5TIS C;  1QVG B;  1YRN B;  1JHH A;  1Z91 A;  4PC3 A;  4ZDL A;  4FIS A;  4XD7 A;  4MTE A;  2GAU A;  4LGW A;  1WWX A;  5D5U B;  2L4M A;  2Z6B D;  2GIV A;  2V1X A;  3W6K B;  3KEW A;  3AAF A;  1TYV A;  1X3U A;  3WE3 A;  3HEF A;  5ILU A;  4NC6 A;  2DPD A;  2F4O B;  4Z4Y A;  1MBK A;  3BPX A;  2UWM A;  2IS2 A;  2OBS A;  2WSS A;  2NZM A;  2L0K A;  3ZMD A;  4YIR X;  2E1M C;  3B6C A;  3FK6 A;  4XM3 A;  1IF1 A;  3S15 J;  3BCA A;  2DO7 A;  2RC4 A;  4QHY A;  5EF6 A;  2MBF A;  1BI0 A;  4BQQ A;  3MFK A;  4RDJ A;  4OZZ A;  4C2U A;  3WU0 A;  1J9Z A;  3S3M A;  4UZU A;  2HDW A;  3ONU A;  1T33 A;  3V7S A;  3CC7 I;  3CCV I;  5KCM A;  4YAO A;  2K3P A;  3TO6 A;  1T6Z A;  1WJC A;  1X1B A;  1OHH A;  5F4O A;  1SMT A;  2NRA C;  3F6V A;  4YFX F;  1FIP A;  3I59 A;  3QOE A;  3CCU B;  4M3D A;  2CJJ A;  1JGG A;  1RR7 A;  3JSP A;  1FNM A;  1QJV A;  2G7H A;  1H0M A;  1EZG A;  4DYQ A;  3PL8 A;  1BI1 A;  4MYT A;  3PM1 A;  4HDV A;  2A05 A;  2EPF A;  4D5C A;  4IL6 C;  2VFQ A;  2B5O A;  5LHG A;  2PBI A;  1ELO A;  5IK2 A;  4OAY A;  4OWR B;  3S2W A;  3QE2 A;  3DTE A;  2VJI A;  3VNU A;  3G1O A;  2BE5 F;  3GTP J;  3FMR A;  4PC6 A;  5J1U A;  1EP2 B;  2D9R A;  2Q6O A;  2XGJ A;  3BTJ A;  4ZYH A;  4CYC A;  3OEE A;  4KYW A;  4X7C A;  2VL8 A;  2F4M B;  2QM3 A;  4UVB A;  2JDI A;  1Y39 A;  1CQT A;  5E3O A;  3FKJ A;  3IRR A;  1OR7 A;  1TQP A;  4R8H A;  4AIJ A;  2UZK A;  1VQ7 B;  3LNQ A;  1JTX A;  1ZGA A;  3HRS A;  5E1X A;  3H9Q A;  1HBX G;  2DMQ A;  4UHT A;  1BBY A;  3OEH A;  4XON A;  3KE2 A;  1HXD A;  3MMY B;  2K9S A;  5KHD A;  2AHO A;  3AST A;  3J7A Y;  2B7E A;  2A69 F;  2QEX B;  1L3L A;  2DOF A;  5HS9 A;  2NST A;  3WGI A;  4Z4S A;  3J7A O;  1FYK A;  2OK8 A;  4PC1 A;  2QDX A;  1TNT A;  1YW7 A;  2R7V A;  3CPW B;  2CQ7 A;  2LFB A;  3BQZ A;  3LA7 A;  1E63 A;  3Q38 A;  4Z4U A;  2VC1 A;  1QGZ A;  4ZCL A;  4RD6 A;  5C4J J;  4D9J A;  1UFM A;  1W0J A;  2JQ7 A;  1WH5 A;  1JE8 A;  1R23 A;  1B8I A;  4B48 A;  3OYJ A;  4M9X A;  1QRC A;  2WJY A;  2DFF A;  2K5C A;  3BZK A;  4XR6 A;  4BJ6 C;  4EV0 A;  1PJ7 A;  2KKO A;  3OAA A;  1XMA A;  4JP0 A;  2N8G A;  4AIH A;  1FOW A;  2WAF A;  4U49 A;  3K4N A;  5CDF A;  4GYG A;  1TL8 A;  2R7D A;  1W0T A;  3C7J A;  4TN1 A;  3G71 B;  3I9V 2;  5F0C A;  4A3D J;  5IY5 H;  3ISP A;  3TW7 A;  2W6J A;  1CF7 A;  1HZE A;  2Z5U A;  2JUC A;  1V0E A;  1YJ9 B;  1OJL A;  3N05 A;  1VTN C;  2KIF A;  2ZME A;  3OYC A;  4ZTJ A;  4GXO A;  1XX5 A;  1DGR M;  1WQ2 A;  5A89 A;  2YWH A;  4M6X A;  1QG0 A;  4A0Y A;  2EIJ H;  3C2G A;  4DK1 A;  1W9X A;  2QYO A;  1XG2 A;  5DUI A;  2H09 A;  1WJA A;  2DJN A;  2DAO A;  2HYF A;  1JKO C;  1ETV A;  5H59 A;  3P9I A;  3K9T A;  2GWR A;  4XL9 A;  3AL0 B;  4B44 A;  2K3F A;  2K4J A;  4II2 A;  4OM9 A;  2BXY A;  4KIC A;  3SJM A;  4KUM A;  2R7T A;  5GAE J;  5LBQ A;  2XT4 A;  2ZZQ A;  2R7Q A;  2D45 A;  2CUF A;  2XPW A;  1D8K A;  3FBI B;  3CO7 C;  3I1F A;  1ETQ A;  1FNN A;  3IKT A;  3PEN A;  5JBQ A;  4E7I A;  1I5Z A;  1Z6T A;  4OJ6 A;  4BDY A;  4II3 A;  2ZC2 A;  1E3O C;  2F48 A;  2IEK A;  4MFD A;  1D5V A;  1W35 A;  2C77 A;  3WYA A;  3HPH A;  3AG3 H;  3O3K A;  3MCZ A;  3R61 A;  4G12 A;  4UV8 A;  5BNG A;  1WSU A;  1JKQ C;  1G3S A;  1VQ9 I;  2PMD A;  3MEX A;  3B73 A;  3TW6 A;  3ABM H;  2R93 J;  4NK8 A;  2HS5 A;  3VB2 A;  4A6E A;  3PQK A;  1TYW A;  1D1N A;  1ON2 A;  2BM6 A;  3PSI A;  4I09 A;  1SAU A;  5JMC B;  4P55 A;  4DIQ A;  2CW8 A;  5HNF A;  3LMM A;  3MKW B;  1T56 A;  1XB2 A;  3BOQ A;  2GJR A;  5DCF A;  4C30 A;  4RDU A;  3P9C A;  5L3C A;  1IRF A;  4HEA 2;  1DBG A;  2CW0 F;  3PIO F;  2UXX A;  1VLY A;  2ZZF A;  3E0J B;  3BR2 A;  2JUG A;  2Q0O A;  4E7Z A;  5B3S H;  2IAI A;  2EA4 A;  4N9I A;  4I0A A;  5FO1 A;  3PO2 J;  1KGS A;  1WJE A;  1XGS A;  1EA3 A;  1U5T C;  3GFM A;  2Y0S N;  4HPQ A;  3WTT C;  2ISZ A;  1TWF J;  2VOO A;  4A3G J;  3EUH A;  1D0Z A;  2COB A;  2FNA A;  2QZ8 A;  3JTG A;  2E1M B;  4PFP A;  1BM9 A;  3I4N J;  5DM6 F;  3Q5F A;  2EFQ A;  1QGY A;  3ONY A;  1GXP A;  2QXZ A;  3ZQL A;  4HX8 A;  1OGJ A;  1N77 A;  2JJ2 A;  5AON A;  4IHX A;  4DOZ A;  4RB1 A;  1KQ8 A;  2STW A;  2PMH A;  4D7M A;  1WP6 A;  1RWR A;  4M3B A;  4BGD A;  1Y0N A;  3Q0W A;  1LEB A;  2IJL A;  2GA2 A;  3O6B B;  2B9S A;  4A3B J;  4I6Z A;  1ON1 A;  1CZF A;  4MNU A;  4XNF A;  3PO3 J;  1F1Z A;  4YC5 A;  4RBO A;  3LQQ A;  5GPC A;  4YEJ A;  3L09 A;  4GGG A;  1ZUN B;  1TLH B;  5LEJ A;  2IQ7 A;  1XD7 A;  4Y52 J;  4MR0 A;  4B4D A;  2DU9 A;  2BGC A;  1OYI A;  2OPT A;  3OPO A;  1REP C;  4C3H J;  2L7F P;  2K7L A;  1TSP A;  2OAZ A;  2FBI A;  3SYJ A;  2EIK H;  4WXH A;  2HNH A;  2CWE A;  1AOY A;  1UCR A;  2F5C A;  1A36 A;  3GTQ J;  3GIR A;  4U7D A;  2FML A;  1IN4 A;  3ZPN A;  1LLW A;  2BY0 A;  2FEZ A;  2O0V A;  3MKY B;  1S7O A;  3DTK A;  3L2C A;  3I5U A;  3HZJ A;  3K1N A;  4ROX A;  1G8X A;  4Z4V A;  3QSY A;  1PE9 A;  2BGI A;  5D4S A;  1HDP A;  3ASQ A;  1B9M A;  1YQA A;  1VQ4 B;  3EQN A;  1F9N A;  2HTS A;  1DDG A;  4IRH A;  5LGN A;  5F0H A;  4R1H A;  4Y15 A;  4WZE A;  3M7G A;  4BY1 J;  2IOU G;  2P0W A;  4X05 A;  2XTY A;  4OOV A;  3P4G A;  4AUX A;  5F4J A;  3H36 A;  2F43 A;  1YTY A;  4J0Q A;  3F8C A;  2VT2 A;  4BU2 A;  3GSI A;  2R7X A;  1YHQ B;  1MBF A;  4RLZ A;  4TMW A;  4NHJ A;  3QPH A;  4F52 A;  4PGH A;  3LSG A;  2HEO A;  1DAB A;  1HW2 A;  3CUQ A;  4XOR A;  4QVA A;  2HQR A;  1GVH A;  2W00 A;  3KPH A;  4M72 A;  2OA4 A;  1Y56 A;  2IVM A;  2G9W A;  5CLS A;  1O3R A;  2OTL B;  3DP7 A;  1S0U A;  3COA C;  1WOR A;  2CU7 A;  3AGQ A;  2VBK A;  4KDP A;  3S8P A;  5HXB A;  5M5Y J;  1W36 C;  1SKQ A;  3DKY A;  3HUG A;  1OGI A;  2VNJ A;  1QA3 A;  2VAS A;  4OU0 A;  1GV5 A;  2KQR A;  3H5N A;  2E7W A;  3WBJ A;  3B90 A;  1JTY A;  4HW0 A;  4GCV A;  3GLX A;  4DQK A;  3H09 A;  3OMY A;  5BPI A;  3CCQ I;  1JKP C;  1OB5 A;  2XAS A;  4L5J A;  1MH3 A;  5D6F A;  3OSG A;  5EGO A;  4WCG A;  4M73 A;  4P1V A;  5EG0 B;  4UUV A;  1PUF A;  4X1E A;  3GVA A;  4WZT A;  4WXD A;  4IOA F;  5JI6 A;  1DU0 A;  3WXM A;  3GQ8 A;  3SJZ A;  5EEH A;  2R6H A;  1UG2 A;  1K83 J;  2R5Z B;  1VQO I;  1AU7 A;  1OYY A;  5JLW A;  4AD9 A;  1ACI A;  3CCE I;  1E3P A;  2WAE A;  4XLE A;  4CCL A;  3H94 A;  4IVN A;  4J19 A;  3DBR B;  3OW2 B;  2DYR H;  4OOS A;  3DV8 A;  3E6M A;  3CDL A;  1EFC A;  1ZM9 A;  3I55 I;  4PFO A;  1O8F A;  3EET A;  3M3Y J;  1FSE A;  1UD6 A;  1MMG A;  3TOB A;  1KD1 D;  2RNJ A;  1PP7 U;  2ETH A;  3SZG A;  3ZN1 A;  2H27 A;  2FSW A;  2XSJ C;  1RQP A;  3LYC A;  5A8A A;  4E7S A;  4RPD A;  4IHV A;  1FDR A;  4ZJZ A;  1E79 A;  3GUD A;  3OE7 A;  1G3W A;  5FIU A;  3KP3 A;  3GVK A;  2M2E A;  3VR6 A;  4AIK A;  2BV6 A;  2NS0 A;  2KZG A;  4NQW A;  4UXN A;  3ML6 A;  4X06 A;  1YLF A;  2FBH A;  5LRR A;  1U78 A;  1CNE A;  2J8I A;  1ETY A;  3A03 A;  4HX7 A;  4WWV A;  1D5Y A;  2ZB9 A;  2GOX B;  3JTH A;  1YJN B;  1Y8R B;  1QFY A;  4OJO A;  3CC7 B;  1H9G A;  3CCV B;  2ZBU A;  2ZKZ A;  2LD5 A;  1JHF A;  1B72 B;  2VT3 A;  2C78 A;  3I4P A;  4ZGN B;  2QKL B;  1V3F A;  4X6A J;  4E6K G;  3BCD A;  4N3N A;  2NV4 A;  2BXZ A;  2K02 A;  3AVU A;  2Q1Z B;  2EA2 A;  1F5T A;  1TUI A;  2P7C B;  2DN0 A;  1YO5 C;  2BVN A;  2MSY A;  5D8K B;  1OB2 A;  2XB5 A;  1Y0Y A;  2EV6 A;  1MAB A;  5ILV A;  3KLO A;  4P9F A;  4ZYD A;  5LHH A;  4XSZ F;  3G1M A;  2LOO A;  4G7W A;  3BRO A;  5HLT A;  4M3E A;  2DPU A;  4C43 A;  4I76 A;  1OFL A;  3CCL I;  2D74 A;  1EH8 A;  1ENH A;  1V5V A;  4N9H A;  2NPF A;  3RY8 A;  5E8G A;  1MMD A;  1GAW A;  3GTM J;  2CV0 A;  2MH9 A;  1Z6R A;  4MXN A;  4OMY A;  1IN6 A;  3G6E I;  2VQL A;  4AM3 A;  4G7Z F;  3OYG A;  3E5U A;  2JTV A;  2L02 A;  2HFH A;  1QA6 A;  5FLM J;  2CBX A;  1AKH A;  4CZC A;  3ZPL A;  3OYA A;  5FD5 A;  4BEH B;  1AWC A;  4MEX F;  1MDM A;  4WK8 F;  3GFJ A;  4H4K C;  3CCS I;  1Z77 A;  4KN7 X;  1OCC H;  1P4A A;  3MAJ A;  5K7H A;  3RDI A;  4DNC A;  2A68 F;  5D5X B;  4BH9 A;  2QGU A;  2Q2E B;  3IC7 A;  1V5E A;  4U7B A;  2H6B A;  2KJC A;  2CRV A;  4BHB A;  1HA8 A;  3GRH A;  5GV7 A;  1FWZ A;  3HYI A;  3V7R A;  3VO2 A;  4WZL A;  3MZ8 A;  1QVF B;  5FJ8 J;  1UD3 A;  2DMU A;  1VHE A;  3JAM Z;  1OR7 C;  2LC2 A;  3KYC B;  2FMY A;  3ASO H;  4Z2Y A;  5EYR A;  4B3X A;  1QNT A;  4E70 A;  3BY1 A;  1T5E A;  2FQ4 A;  2V26 A;  2VN2 A;  5J3L A;  2ZSH B;  1J7K A;  3CCY A;  1PDN C;  4BQA A;  3SKB A;  3BR3 A;  4UNO A;  2V31 A;  5JFR A;  1O8M A;  5HLI A;  1W7P A;  4C9Y A;  1KU7 A;  1HA3 A;  5A2Q K;  2HDC A;  1UZC A;  5A2Q Z;  4NUB A;  3S14 J;  4A3K J;  1FP2 A;  4H0E A;  2Y0S A;  3FF5 A;  1FYM A;  1PJ6 A;  1ZQ3 P;  1VQK I;  3M8E A;  1WDT A;  1BOA A;  5GAD J;  1NH3 A;  2FX0 A;  1QU3 A;  3AGP A;  1Q82 D;  4YEI A;  1S6L A;  4A3I J;  4QVJ A;  2INU A;  3BLY A;  4P96 A;  2L4A A;  2HOA A;  1X58 A;  4RCZ A;  3GW2 A;  1ETK A;  2HZD A;  2NOJ B;  1KON A;  2EBI A;  3J81 K;  2BM1 A;  1IV6 A;  4O3M A;  3KIO A;  1POG A;  1ZK8 A;  2W4S A;  2W7N A;  2P7V B;  3ZMS A;  2F5E A;  4BXF A;  5F1J A;  3CUO A;  3C2B A;  2CG4 A;  4N0B A;  3WTU C;  4BBS J;  1P4M A;  3VYR B;  4B3F X;  2XVC A;  4L0Y B;  3GX4 X;  2V9P A;  4DBQ A;  1GV2 A;  1YS6 A;  2MC3 A;  4IO9 F;  2OCC H;  2DOD A;  2EWN A;  2QQ8 A;  2OJE D;  4WWC A;  1VLO A;  3UW0 A;  4M6Y A;  3VOE A;  3FWE A;  4HF1 A;  2BM0 A;  1R58 A;  2M1B A;  1WSR A;  4P2N A;  2BW3 A;  1LEA A;  4V2F A;  1BN5 A;  2KDZ A;  3B02 A;  4Z4W A;  4BS9 A;  4L9V A;  3PUF A;  1QQ1 A;  2JK3 A;  3TMO A;  4A2U A;  1UB9 A;  2KT0 A;  1J0R A;  4RD1 A;  5J1R A;  1A5J A;  3HOU J;  3U21 A;  3W2V A;  1APL C;  1OCP A;  4L8J A;  2ADU A;  2BF4 A;  4ZCI A;  2PQ8 A;  3REO A;  3SZT A;  4YZQ A;  1ETO A;  2YUS A;  5ICE A;  2Z16 A;  5F0F A;  4FAS D;  3A1P A;  2ZL6 A;  1FC3 A;  2AS5 F;  3K2Z A;  5TRD A;  1WI3 A;  1BIA A;  1O3T A;  1IRX A;  1I50 J;  2L9R A;  1JKR C;  3Q6Q A;  4M3G A;  4AU7 A;  2H1K A;  2ID3 A;  1KA8 A;  4GQN A;  3SDB A;  1VFC A;  3ZMT A;  2X48 A;  1OGM X;  4JX4 A;  4RAF A;  3DPL C;  2HLD A;  3A3G A;  1DBO A;  5ICC A;  4PJL A;  3HSR A;  3LOC A;  1LB2 A;  4FHT A;  1E3X A;  1A6I A;  4ASN A;  2GPJ A;  1NK2 P;  1HCR A;  2W84 A;  2FJ1 A;  3M07 A;  1OMI A;  3U1D A;  3WGH A;  1FTZ A;  1J09 A;  4MQV A;  2OBP A;  2QZA A;  1MJ9 A;  1FOK A;  3K4L A;  2HU9 A;  1QZY A;  2E19 A;  3FDY A;  3D5R C;  4BY7 J;  1KMH A;  3LMW A;  3K7A J;  2CO5 A;  3Q0U A;  2NTB A;  1QBJ A;  3ZZT A;  1RUO A;  5EDN A;  2IA2 A;  1BPL A;  3E1Y E;  3P26 A;  4XRF A;  5H5J A;  2Z99 A;  5FKN A;  2P3M A;  1XFO A;  1MD0 A;  1IC8 A;  2UV1 A;  1PXZ A;  4UUS B;  3EUH C;  2KPM A;  3CCJ I;  3CJT B;  2QQ9 A;  1T6S A;  3VYT B;  2M0M A;  2DA2 A;  2LF7 A;  2E2H J;  1QRY A;  3DEU A;  5IYB J;  2VBY A;  2VJJ A;  2W48 A;  3LST A;  1RR8 C;  2P5L C;  1W7P D;  3U1K A;  1SVM A;  1X1C A;  2QTZ A;  4OOI A;  1KU2 A;  3ZZU A;  1QCX A;  4RS8 A;  4L9J A;  1EWY A;  1I1G A;  1WKM A;  4V19 K;  3CZ6 A;  4Y7C A;  5EEA A;  2V7V A;  4QWQ A;  4EGY A;  2QE7 A;  2K4B A;  4EM0 B;  4G6T B;  1VQL I;  1ZYR F;  6PAX A;  3SLD A;  1H8H A;  4J01 A;  4Y3O A;  2KVO A;  1WPK A;  3DLA A;  4QV2 A;  2JVH A;  4YCQ A;  2YU3 A;  3I59 B;  4E0F A;  2P5K A;  3W2F A;  4LBW A;  4KMF A;  3I54 A;  1E64 A;  4A3L J;  2BSA A;  2J8K A;  3OYF A;  2VFO A;  4I99 C;  3OL3 A;  5GP9 A;  3JRB A;  1J2X A;  2DBB A;  4RGU A;  4QPO A;  2VE9 A;  4KFC A;  2QSF X;  1BI2 A;  4NBS A;  2VI6 A;  1ERD A;  3BH4 A;  2X9D A;  2KDO A;  1JRG A;  3E1S A;  1WOO A;  4MQ9 F;  1V5F A;  4P3Y A;  3BR0 A;  1IN7 A;  1FRQ A;  4HBL A;  1O8H A;  3H9G A;  3H1C A;  1TLL A;  1WZ2 A;  4CYC B;  1FIA A;  2DK5 A;  2J5O A;  5DSZ A;  3CCM B;  1R6R A;  5IYP A;  5H6R A;  2Y31 A;  3F3X A;  2R7F A;  2K9M A;  1R7J A;  3L2U A;  2HKO A;  5HLH A;  1T6Y A;  3CMY A;  2YX7 A;  5DYM A;  5EZH A;  1RZ4 A;  2PE3 A;  3PVD A;  1OCZ H;  2LY1 A;  1X1P A;  3DKX A;  2PLY A;  4HIZ A;  4YFO A;  3VSV A;  5KW9 A;  3K1M A;  4DNT B;  1ONV A;  1BHE A;  4KKT A;  3CJN A;  1RET A;  2KLO A;  1I3A A;  3PNY A;  2LRE A;  4OOX A;  4OPS A;  2ZBV A;  1H88 C;  5F6F A;  4ZDP A;  2ZFU A;  1VZ0 A;  1TVC A;  2F1M A;  3CUQ C;  2M9H A;  4J00 A;  1K78 A;  2R92 J;  3L2Q A;  2I5U A;  4F3Q A;  3BJA A;  3BTC A;  3LFK A;  2RV8 A;  3CCQ B;  3BT9 A;  2GK6 A;  3BPV A;  2XND A;  1M1K D;  2QYU A;  3Q3A A;  4Y17 A;  1W5T A;  2JWT A;  1QA2 A;  2FD5 A;  1BJZ A;  1IG7 A;  1RIO H;  3FJO A;  4ABZ A;  1KK2 A;  4D1Q A;  3R4K A;  2VJ4 A;  2Z1D A;  3ZQ7 A;  2VBX A;  2O8K A;  1BQE A;  4BXU A;  1VQO B;  1Z3Y A;  3BY2 A;  3LQR A;  1Y6I A;  1SFO J;  3QU6 A;  1BW5 A;  2QMU A;  3CCE B;  3K10 A;  5F64 A;  1IGN A;  1EF4 A;  4P9S A;  3VO1 A;  3OY9 A;  1OFE A;  4GDF A;  3E5X A;  2W7Z A;  1YX5 A;  3CP2 A;  4NC8 A;  2QVO A;  5E1Z B;  4ZH4 F;  3D1N I;  3I55 B;  2HQN A;  2Y0M A;  2V4D A;  3FMQ A;  3FIS A;  2EFP A;  3A2K A;  4BE1 A;  1CF7 B;  2RC6 A;  5DCM A;  4P6Y A;  3IUO A;  2ZME B;  5DV5 A;  4AID A;  5BSX A;  1Z7U A;  2WWY A;  1HF0 A;  2WYR A;  3G4S I;  3BDD A;  2JRT A;  4A0Z A;  1PLU A;  2FRH A;  4U0W A;  2JN9 A;  3BC9 A;  4MTD A;  3V8L A;  1EH7 A;  1XDU A;  4U0V A;  4B8X A;  4JQF A;  1O88 A;  4AF6 A;  5FFX A;  2EZK A;  4ASU A;  3DPU A;  3BNW A;  3MKZ A;  2DEU A;  1FX7 A;  3VNV A;  2BHZ A;  4XOT A;  2WBM A;  4Q48 A;  1O3S A;  1ZR2 A;  1OPC A;  5DD4 A;  2L7K A;  4QPQ A;  4FN5 A;  1I6X A;  2DMN A;  4OJP A;  1FBQ A;  3WE2 A;  2QKM B;  4P1W A;  2Z33 A;  2P8T A;  3N6Z A;  1U2R A;  3S2H J;  5CVJ A;  2JRM A;  1IZ1 A;  2DA5 A;  4YII A;  3NE5 B;  3F6O A;  4A93 J;  2Q6L A;  5FGM A;  5ICF A;  5FO0 A;  2VFP A;  4Z03 A;  5E3M A;  1K9M D;  1OFC X;  1TQM A;  2GZW A;  5E6T A;  1JXS A;  1ETX A;  3CCL B;  1D3Y A;  4KH3 A;  2VPL A;  1SFE A;  2QF7 A;  1TQI A;  3N97 A;  3GVJ A;  3G6E B;  3KP5 A;  2PEC A;  4ESJ A;  1ODD A;  3HRT A;  2XAF A;  3L2W A;  3FXO A;  3Q3S A;  2XHK A;  5HDG A;  4F7D A;  2HYG D;  3CCS B;  3GQA A;  4Z4Z A;  3QFC A;  1DPR A;  3FX3 A;  5CKT A;  2VJ5 A;  3H92 A;  3B78 A;  2EZL A;  4Z1M A;  2ZZG A;  3G3Z A;  3LSI A;  1X3W B;  3SQN A;  1NK3 P;  3CC2 I;  1VND A;  1N78 A;  1P4X A;  4ZCM A;  3LQE A;  3ZP5 A;  5K5O A;  3H5R A;  1NG6 A;  1DDN A;  2F6C A;  1MSE C;  1NB9 A;  4OPW A;  2GIZ A;  3DKW A;  3WY9 A;  3EQO A;  1NHC A;  4IKF A;  2ZTN A;  3ULQ B;  4PUS A;  1R71 A;  2VOP A;  1SFU A;  1R36 A;  1FP1 D;  2X6X A;  1OCR H;  4DYR A;  5CVR A;  1C0W A;  4PJJ A;  2CQN A;  1LDJ A;  2V9V A;  3OR2 C;  2X85 A;  3DLL F;  3Q9S A;  5ED4 A;  2DIE A;  3KZY A;  1G3Y A;  2R7R A;  1YI2 I;  3M8J A;  1BR2 A;  1VQK B;  2IGN A;  2EZI A;  3HM5 A;  2VBT A;  3LQ6 A;  1EJ9 A;  3QFS A;  3IAM 2;  3K4K A;  2NS8 A;  2HXI A;  4RLQ A;  1BLI A;  2NVT J;  3FKI J;  2HYJ A;  4W97 A;  3SEZ A;  3LSR A;  5M3F J;  3LSP A;  1VF7 A;  2M7B A;  4WZK A;  2IBD A;  3DU5 A;  3WTY C;  2PG4 A;  1PKV A;  1PP8 F;  2EJR A;  4PGG A;  1IDK A;  2XIG A;  4IF4 A;  3B82 A;  1I39 A;  1OCT C;  4EVI A;  1XC5 A;  1EP3 B;  4CHU A;  1Y8Q B;  2DYS H;  2PIA A;  2O17 A;  4KN4 X;  1G59 A;  1UAA A;  4BAC A;  3I58 A;  1LJ9 A;  1V4R A;  2ZXJ A;  2LYC A;  4A0X A;  2V7Q A;  2W82 A;  1EFR A;  1KQ0 A;  1KU9 A;  4AVZ A;  4DGW B;  3L2R A;  3TKY A;  3J7Z I;  2VOD A;  1W5S A;  2KFD A;  4HA8 A;  2V7F A;  1R9T J;  3JCU C;  4TMT A;  3W5V A;  4DYC A;  4KIF A;  2C2W A;  3OYI A;  1YRN A;  3OP1 A;  3CDH A;  1RKW A;  4OPO A;  2Y2Z A;  4I84 A;  1MBH A;  2EB7 A;  4P26 A;  1IUY A;  4ZV4 A;  1MBE A;  2YSR A;  1K6Y A;  3HJE A;  2IT0 A;  3S93 A;  4IPA A;  2ODL A;  4CA0 A;  4ANJ A;  3ECH A;  5C3E J;  1UMK A;  3HRU A;  2EZH A;  2XAU A;  1TYU A;  2CW5 A;  2QEN A;  5CYV A;  2ESH A;  2ZBK A;  3LL7 A;  2XTW A;  4YAF A;  2JJ1 A;  2YS9 A;  2VZL A;  2JN6 A;  4JBA A;  2V6C A;  2H1L A;  4M71 A;  1RC9 A;  2RQP A;  3W2W A;  3S1Q J;  4LBZ A;  1U9N A;  3H3V K;  2LSO A;  4F55 A;  1K79 A;  3BWG A;  3HPG A;  2P5V A;  3CCR I;  3X2Q H;  1D8T A;  5F27 A;  1OKR A;  4RD3 A;  4IHW A;  4Y9R A;  2A3S A;  3A4C A;  2M87 A;  5FO5 A;  2VBU A;  1TT5 B;  4MO7 A;  3OYE A;  3H0D A;  1FJL A;  5EGO B;  2DCE A;  5JVT A;  3T56 B;  4HDU A;  1S7E A;  3HOV J;  3ZGK A;  4IRG A;  5M3M J;  4OJL A;  2TDX A;  3CQZ J;  5CQE A;  1WVR A;  2ZJP F;  3ZN0 A;  4OPV A;  2OV7 A;  3B8Y A;  5FKL A;  4G1V A;  1UHW A;  5TGT A;  1KZH A;  1B4A A;  3EQL F;  3S32 A;  3J7Y J;  1JA0 A;  3EUA A;  2GXA A;  3SEQ A;  2ZJR F;  4HLX A;  3BG7 A;  4NC7 A;  5E1W A;  3RIR A;  1QX4 A;  2XAQ A;  2EH3 A;  1O57 A;  3S16 J;  1FYL A;  1VQ5 I;  2KJB A;  3FXK A;  3PJR A;  5LHI A;  1AIP A;  5E8I A;  4I0B A;  2X8K A;  2LDU A;  3FXU A;  1FTT A;  2W25 A;  3FXL A;  3HB9 A;  2H8R A;  1A6Q A;  1KK0 A;  1K4Z A;  4OZY A;  4RM2 A;  4ZYG A;  4S05 A;  1Z9C A;  4TMV A;  1F36 A;  3OJW A;  1UHM A;  2MYS A;  2O04 A;  1MKM A;  2DJI A;  1MGT A;  3Q0V A;  3CCJ B;  5ILS A;  2PYG A;  3FHZ A;  3ELK A;  2O1D A;  3BR5 A;  4FE4 A;  5J4Y A;  3SY2 A;  1IRG A;  2LBF A;  4RB0 A;  1SFX A;  4NQW B;  2DW4 A;  4L9N A;  4IRI A;  3BZ6 A;  2FVG A;  2DOA A;  2XNJ A;  2WAD A;  4PSX A;  3V42 A;  2A6E F;  2NVX J;  4ETS A;  4M4S A;  5FRN A;  2EK5 A;  2VE8 A;  4EEF G;  3JQQ A;  5AMV A;  5B66 C;  1I18 A;  1VQL B;  1D0Y A;  4NBQ A;  2BVL A;  1GHC A;  5KVR A;  2O03 A;  1XCV A;  1ZM3 A;  5D5V B;  4K1X A;  4XID A;  5BMZ A;  1RRJ A;  3KL9 A;  5E20 A;  3W2E A;  3QP5 A;  5CVV A;  4CCK A;  5IPA A;  1K4S A;  3I56 I;  1IB0 A;  2F1L A;  2IS4 A;  4RB3 C;  5HZB A;  1MZB A;  2CMP A;  3BZC A;  2LY2 A;  4A3F J;  3JRF A;  3SLN A;  3FM5 A;  1W0K A;  2Q6I A;  3ASR A;  3GTG J;  2F5D A;  3A35 A;  5AIQ A;  1QRB A;  3SFZ A;  2L9N A;  3ZSC A;  4BDZ A;  3FZV A;  2PJR B;  2NOG A;  3VEP A;  3C2H A;  4RLF A;  4EJW A;  3OJX A;  3CD6 I;  1N05 A;  4PJM A;  1AKH B;  2DDA A;  2XPU A;  3T53 B;  2HWV A;  5DUK A;  1NBM A;  1PYV A;  4HST A;  3MHP A;  5FLX K;  4Q47 A;  3R6S A;  3CJR B;  5IYW A;  1WJ5 A;  2DTR A;  2IA0 A;  2L7Z A;  5D5W B;  2X6W A;  2Y48 A;  1L1I A;  1TW3 A;  2M34 A;  4JMQ A;  3BG9 A;  1IJW C;  4FCY A;  2B63 J;  1FLI A;  1T08 B;  1GXQ A;  3EPZ A;  4NB5 A;  5CPR B;  4ESB A;  5J4V A;  1S72 I;  1EFT A;  2D3L A;  2K86 A;  3E3V A;  2DA6 A;  2WR8 A;  2WA0 A;  1U8R A;  4BQO A;  3RKX A;  4HF0 A;  1SEU A;  4GO1 A;  1ZG5 A;  3GME A;  1UMQ A;  4FET A;  2O9L A;  2ZIT A;  3KRG A;  2D3N A;  1XSX A;  1O3Q A;  4CUG A;  4DBR A;  2QCO A;  3AVY A;  3OYB A;  3A8K A;  2GXB A;  4X8I A;  2G0Y A;  2QA4 I;  5HKK A;  2L9S A;  1FY7 A;  2CQQ A;  2EQR A;  4ZYA A;  1MMS A;  1V0F A;  1MW7 A;  5L46 A;  5F08 A;  4W8T A;  3OIP A;  3RPU D;  2XAG A;  1DGW Y;  3PQJ A;  3NWS A;  4CCJ A;  2PI0 A;  1JUS A;  3O2P E;  1ZRF A;  2ZFW A;  1MJB A;  2EV0 A;  1O8K A;  1TWG J;  2DMT A;  4DQ2 A;  4PJ0 C;  3SZP A;  1F60 A;  3OOU A;  1OLT A;  3KP7 A;  2VC0 A;  2VKE A;  3AG4 H;  5F4M A;  2D1H A;  5GAH J;  2FBK A;  2XV4 S;  1WH7 A;  5IT9 K;  3DXJ F;  4ZDO A;  2GA1 A;  5E18 F;  2OBT A;  4M2L A;  3GYH X;  1Q7Y D;  3N90 A;  2XC1 A;  4D5F A;  1U9O A;  1M90 D;  1KYW A;  4IX7 A;  3L9F A;  2HGC A;  3A0H C;  3B6A A;  1MH4 A;  3G4S B;  2CS3 A;  2K40 A;  4XLF A;  1VQM I;  1KRH A;  4UVC A;  2I1L A;  3K4B A;  1QHG A;  2VXD A;  1KC8 D;  1D0X A;  1MIJ A;  1O8J A;  3KCC A;  5K5R A;  1SVL A;  2ID6 A;  1CGP A;  1T2K A;  2QN6 A;  2X6O A;  3C18 A;  1XMX A;  1E0E A;  3JU4 A;  4RD2 A;  1OIS A;  3AG1 H;  2IW5 A;  3QYE A;  4HAM A;  3NAR A;  4S0H B;  2ZJ2 A;  3SUC A;  1IO2 A;  3VFZ A;  1A35 A;  2XOK A;  1JA1 A;  3ESW B;  4MLO A;  4RDL A;  2ZXH A;  5EMN A;  1WHU A;  4RMN A;  1K28 D;  3ZPP A;  2LY9 A;  2OQR A;  2PEX A;  1WCM J;  4D7N A;  2TCT A;  1KQ5 A;  2XAH A;  5JR3 A;  2Y9Z A;  4HE6 A;  1A04 A;  1ZAR A;  5L3D A;  3I53 A;  2PJP A;  1KQS B;  1WRJ A;  4E7K A;  1U6G A;  3GFL A;  1ZGW A;  2VNI A;  2VUM J;  1S7A A;  5BSY A;  3I71 A;  2JSP A;  2UVF A;  2R7W A;  4TT3 A;  1U5T B;  2FA5 A;  2B7C A;  3ISX A;  2DFI A;  5M5W J;  4HYE A;  4M3F A;  3TED A;  2DTZ A;  1VBL A;  3LSK A;  3OYH A;  4GRI A;  1W5C C;  4YHB A;  2OF7 A;  5KAF C;  1GT0 C;  3W2G A;  2E5N A;  1XCB A;  5D6E A;  3K6G A;  3CW2 A;  1P92 A;  1Z67 A;  3DTI A;  3KYL A;  4HF2 A;  2BBY A;  2GK7 A;  2YUH A;  4IHY A;  1IW7 F;  3CC2 B;  4M0L A;  4Y7N J;  1QUF A;  1FBU A;  2NT9 A;  2K85 A;  2NSP A;  4C2M J;  1W34 A;  4M6V A;  3S3O A;  3H35 A;  2A07 F;  1FNB A;  2NVY J;  2HPI A;  3LSJ A;  3AKZ A;  1UHS A;  5L3E A;  1K4T A;  1MMN A;  1P4W A;  3ASN H;  2VQH A;  4P25 A;  3IP4 B;  3ZOB A;  1AMO A;  4XKB A;  2V7X A;  2F5V A;  2WB1 N;  1R5G A;  2R3S A;  3QOD A;  2E1O A;  4PK4 A;  2EIL H;  2LF8 A;  3GLL A;  4B43 A;  2H8W A;  1R4M B;  4HLY A;  1X1A A;  1YI2 B;  5GAG J;  1FMV A;  2BY3 A;  2ME6 A;  5LFA A;  2JPB A;  1HDD C;  2EFN A;  2IS1 A;  5IYR A;  3CJQ B;  2IS6 A;  4UZF A;  2BM7 A;  4CIC A;  4IW3 B;  3KEY A;  3VOD A;  1CNF A;  3U6K A;  1O8I A;  2FF4 A;  2B0R A;  1R1V A;  3C3W A;  5M5X J;  1KZL A;  1UD4 A;  2JT1 A;  4Z06 A;  2F3L A;  3OFN A;  2NYX A;  3DCF A;  5H6Q A;  3OZV A;  4WX9 A;  2X3U A;  1A8P A;  3ABU A;  2CFO A;  5K7F A;  2HVR A;  3J81 Z;  2GQF A;  2V1D A;  4TMX A;  1RNL A;  1ZGJ A;  2EIN H;  4E4H A;  2R5Y A;  2E36 A;  3WTS C;  3CMA I;  1ZR4 A;  4LD5 A;  1IDZ A;  4KT6 A;  4XKV A;  1RUN A;  2BGJ A;  5KSW B;  1ZRE A;  3VMF A;  1NJI D;  2WC2 A;  4RM3 A;  3R6K A;  1EH6 A;  2E7X A;  3KX2 A;  2XZO A;  1R49 A;  5EG0 A;  1BC7 C;  3OS1 A;  2X1D A;  4LG0 B;  1V55 H;  1Z1D A;  2CF4 A;  2BSP A;  4B4C A;  1WOP A;  1WJF A;  4DJA A;  5J3O A;  2R0Q C;  5KNL A;  1LE8 A;  2R5Z A;  1B59 A;  1HC8 A;  5A88 A;  2KP6 A;  1FRN A;  4YFK F;  3UKG A;  2AHQ A;  3E6D A;  5IOY A;  3ASS A;  1YIO A;  5FKO A;  1VQN I;  5LLQ A;  4RAY A;  4P9U A;  3JRI A;  3UNG C;  3NAW A;  2Y9Y A;  2HTJ A;  2IGK A;  4FK8 A;  1O8E A;  3GZN B;  1ZKG A;  2D5V A;  5LD2 C;  4YAL A;  4BE2 A;  2PYH A;  1FMW A;  1B9N A;  3MZY A;  2LP0 A;  2B7B A;  2Q8K A;  3WG7 H;  2RQQ A;  3WTV C;  1MSF C;  4FX4 A;  4OJ5 A;  2YR2 A;  1EFU A;  1HST A;  2M0C A;  4A5M A;  2KRH A;  4MIM A;  3JR9 A;  4M53 A;  3HGY A;  1JUM A;  4NCN A;  2XSD C;  4B3G A;  2FU4 A;  3OZW A;  2IRF G;  3RI4 A;  2L5Q A;  1H42 A;  1VQ9 B;  3IH3 A;  1AHD P;  3EDP A;  3CCR B;  1O7L A;  4XKC A;  2X0L A;  1K78 B;  3CLO A;  4NK6 A;  3FXJ A;  3KFW X;  1WSV A;  2DFE A;  5B6I A;  3GZ5 A;  4X0G A;  3MKL A;  3JRD A;  3D26 A;  2YWG A;  1B72 A;  1HW1 A;  3FHN A;  3F22 A;  3LJY A;  2CUZ A;  4RB2 C;  2JA8 J;  4EJT A;  1KK3 A;  4YZX A;  3GEZ A;  3MQ0 A;  3BG6 A;  5J8C A;  2KZV A;  5L3B A;  2VYQ A;  5IYN A;  5LRS A;  3A3B A;  2KHM A;  2XRL A;  3CLQ A;  5E3L A;  1F4K A;  2M8E A;  4LIT A;  4GFB A;  1JNY A;  1TBX A;  1VQ5 B;  1DAR A;  3T0Y A;  4JK1 X;  4S04 A;  1GUU A;  4F91 B;  1YW9 A;  2DT7 B;  2XZP A;  1TP4 A;  4MGR A;  3SQV A;  1SAX A;  2CK3 A;  2PFB A;  1TZL A;  2CQX A;  3EYI A;  3DU1 X;  2E1B A;  2DOE A;  4PGO A;  3QPL A;  2CC2 A;  3DPT A;  4PCQ A;  3LSM A;  1P2F A;  3I4M J;  1W2B B;  1Y0U A;  1ZHF A;  3TOA A;  1BMF A;  3HHH A;  4A12 A;  3SHF A;  2W85 A;  3A01 A;  1LFU P;  4U4B A;  2MAB A;  3BG5 A;  2CFX A;  3RKW A;  2NNY A;  3RPQ A;  4BEH A;  1HOM A;  1IJF A;  1KJZ A;  3PSS A;  2OTJ I;  4BYY A;  1O8D A;  3JUR A;  1YLO A;  3HRM A;  1Q81 D;  3E6C C;  3CC4 I;  5HDK A;  1E1R A;  2PMU A;  1XGN A;  1YYV A;  2ZO4 A;  3CXC B;  2Q2E A;  1KQ9 A;  3BQJ A;  4UB8 C;  4UAJ A;  3R0A A;  1EXM A;  4AC0 A;  4X7D A;  2V4J C;  2X4H A;  1T6X A;  3G2B A;  3G1L A;  4CO8 A;  1JJ2 B;  2Z9O A;  3LA2 A;  3I64 A;  4Z4R A;  3WU1 B;  1YW8 A;  1JUP A;  3I56 B;  2PX9 A;  4HNU A;  3JRC A;  3NRV A;  1I6H J;  3QWL A;  1F20 A;  3NB2 A;  3VMW A;  2E1R A;  2XRN A;  3OIQ A;  4LJZ F;  4P5O A;  3BP8 A;  5E3N A;  1KYZ A;  1RPW A;  4HE5 A;  1BOB A;  1Y1V J;  4F92 B;  1SFK A;  2JPC A;  2JVG A;  4OMZ A;  5K5Q A;  1W1W E;  5DDG A;  2NXN B;  3PNT A;  4HWV A;  4N4O B;  1TT0 A;  4XLN F;  4YEL A;  5GPA A;  4OIP F;  3G05 A;  1QVU A;  4YXW A;  4F7Z A;  4I02 A;  1LM1 A;  1I27 A;  2B0L A;  1YIJ I;  2OBR A;  3FPP A;  3L1P A;  2YX4 A;  2DYI A;  4RCY A;  1VJS A;  4A69 C;  1XGO A;  3WNB A;  3CD6 B;  1XPX A;  1TTT A;  5GTI C;  2AQE A;  3W5U A;  5IYD J;  2RN7 A;  2R9V A;  2NTQ A;  3LO8 A;  2M45 A;  3PUM A;  2BY2 A;  3ZZ0 A;  1KU3 A;  3QYB A;  1AIR A;  2DI3 A;  2HOS A;  3ERM A;  3FK7 A;  1LFP A;  4BJ5 C;  2KMU A;  5BQT A;  4YZ0 A;  3HBL A;  3ZQQ A;  4UY8 I;  4PJN A;  4KKS A;  3O8G A;  2R7Z J;  5TR9 A;  1TNS A;  2L2O A;  1YFH A;  1S72 B;  1I3Q J;  1U0J A;  2XGC A;  3QFR A;  4L5I A;  2E2J J;  1IV8 A;  4OIR F;  5L3F A;  2C4U A;  3E97 A;  3TO7 A;  4CGZ A;  4LB5 A;  2JSC A;  4KIG A;  3BG3 A;  1X0C A;  4LMY A;  3PUN A;  3CF2 A;  3HG9 A;  4LLL A;  1D2E A;  2HMA A;  4B47 A;  2QA4 B;  3ML3 A;  1WU8 A;  2RNG A;  2O0W A;  3HKZ N;  3SDG A;  4PC2 A;  3HSF A;  5DEQ A;  4BKX A;  2HDN B;  1B8I B;  1TWA J;  5HOD A;  3QRF F;  3Q39 A;  5JLV C;  4RPB A;  2JZY A;  3ONQ A;  3VYU B;  3GXO A;  2GQQ A;  4RM0 A;  4ENN A;  1HKT A;  3IKV A;  3PA1 A;  3AL0 C;  5HNH A;  3P5J A;  1K5C A;  3IH4 A;  3LVB A;  4HSR A;  1O7F A;  2CV1 A;  4LB6 B;  1QQI A;  4XRM A;  1WI9 A;  4G6Q A;  2O6W A;  1LKX A;  2IGO A;  1ZRD A;  2FX3 A;  1S8N A;  1GVD A;  2EFO A;  4QFM A;  2ISY A;  4WXC A;  2XKP A;  3RIQ A;  1ZN2 A;  3RQI A;  1YIT I;  1YOV B;  2WB1 A;  2ZSI B;  3IAS 2;  3IWF A;  1I8D A;  1MBG A;  3Q9V A;  4G6I A;  5D8L B;  2A5Y B;  3KYD B;  1VQM B;  3U9G A;  1JT6 A;  1RES A;  1WJD A;  1OYW A;  4PC7 A;  3A8J A;  2P6S A;  3B8H A;  5B1B H;  3VYS B;  4LC0 A;  2WAQ N;  1BN8 A;  3GQB A;  1Q1H A;  4YRV A;  2HQA A;  3ZQF A;  1P6R A;  2C5H A;  3ZQH A;  2XTX A;  3O8H A;  5C4X J;  3HXL A;  1PJ5 A;  3RSN A;  2JA2 A;  2VBE A;  3OSF A;  4BBR J;  1JI8 A;  2XRO A;  2R7S A;  1XB4 A;  1MJA A;  4AYB N;  1MBJ A;  4KKU A;  2HOE A;  2EV5 A;  5HVQ C;  2YU9 J;  4Q4Z F;  1T39 A;  2X1E A;  1XG1 A;  1YG2 A;  4XK4 A;  2YWF A;  1IB4 A;  3QAH A;  2INV A;  4FXU A;  1FOX A;  1O8G A;  4ENM A;  2ELK A;  4IJA A;  2JA7 J;  4EJV A;  2MC4 A;  4HQM A;  1W0U A;  3H9N A;  3GTL J;  2LTP A;  2CGP A;  2DT5 A;  1TWH J;  3R60 A;  2LVS A;  2Z3Y A;  4UUS A;  2LKS A;  2ZL7 A;  1STZ A;  4IQ4 A;  4IOC F;  5DS0 A;  1G3T A;  1A31 A;  2QBY A;  3GTO J;  5CVU A;  4KT5 C;  4XRS A;  4CQJ A;  3PNV A;  2HZT A;  3HGG A;  2NVU B;  5EZG A;  1G7S A;  1Z21 A;  1YJN I;  4O5V A;  1K7A A;  2CYY A;  1WGX A;  2VBV A;  2X1C A;  4KA4 A;  4E7J A;  5DTD A;  3CME I;  1R00 A;  4Y4R A;  1SD5 A;  1VQP I;  2K9Q A;  3V7C A;  1DU6 A;  3JQP A;  1TYX A;  3GWZ A;  4LFU A;  2ECB A;  4GYI A;  2VIX A;  3A0B C;  5FFZ A;  4C3J J;  1V54 H;  1G4D A;  2DOG A;  2Q6K A;  3CES A;  5LEK A;  2VKD A;  1COW A;  3ZQI A;  4G5G A;  1R1T A;  2VLA A;  3MCA A;  2H94 A;  2DA7 A;  2I10 A;  3MZH A;  3IRQ A;  3HOX J;  2DFH A;  2R7U A;  1H80 A;  2QQA A;  4CDG A;  4ENJ A;  3QOP A;  2RDP A;  3NWT A;  2HVS A;  3HTU A;  5IT3 A;  1VHO A;  2XF6 A;  2FQ3 A;  2K9L A;  3OV8 A;  4QUZ A;  2ZTG A;  2BZT A;  2V1N A;  3H3U A;  4MFE A;  3HOS A;  1IN8 A;  1PJR A;  4C3I J;  3HOT A;  1QPM A;  2V6E A;  4X7F A;  2EFW A;  5AN9 A;  4URR A;  1IDY A;  1XTA A;  2LBF B;  4R79 A;  5BOX A;  4FQG A;  1W36 D;  1U3E M;  3AVV A;  4XQF A;  2DET A;  1J5Y A;  2W6I A;  1RQR A;  1JGS A;  3SZE A;  4OIO F;  1UD8 A;  1L0O C;  3JQR A;  2KIQ A;  1NHA A;  4IHS A;  2HI3 A;  5FLV A;  3B4N A;  4AWX B;  2MW8 A;  2L7M P;  2LNB A;  3RZO J;  1YJW I;  4CSW A;  1BR1 A;  1QVT A;  3W6J B;  2MD5 A;  1Y1W J;  1R4N B;  4ACB A;  3CMA B;  3RKQ A;  2FOK A;  3V8K A;  4FWT A;  2NNN A;  1DP3 A;  1FSH A;  2IA1 A;  1SD7 A;  2O3F A;  3HHG A;  3V4G A;  1BC8 C;  1QA1 A;  3D0S A;  4W8R A;  1OQY A;  5FD6 A;  3W2I A;  2LZJ A;  3TDZ C;  4KNY A;  2V7U A;  1ZTR A;  2OCE A;  3CB4 A;  3MD2 A;  5IYQ A;  4RAG A;  3MMP A;  2L54 A;  2XNC A;  3GF2 A;  2M5S A;  1H85 A;  1HG8 A;  5H2F C;  1MNM C;  1X1D A;  3D5S C;  2BVM A;  4MHG A;  1EA0 A;  2WY8 Q;  3SEJ A;  2AXL A;  1N8R D;  5LGU A;  2LK2 A;  2BEO A;  4TMZ A;  4EJU A;  1VQN B;  2XZL A;  4M9Z A;  1TWC J;  1X4P A;  3DF8 A;  5KK1 A;  1U2W A;  1BI3 A;  3W2H A;  4DQL A;  1K8F A;  1H8A C;  2KRC A;  2MLG A;  2E1N A;  2W1O A;  5HZA A;  5F1R A;  1FOY A;  2DQR A;  3CUQ B;  1HKQ A;  1E62 A;  1ZEL A;  2QLZ A;  3L00 A;  4CH7 A;  1I7P A;  4PSW A;  4ZYE A;  3KEQ A;  1BX0 A;  3CO6 C;  1QFZ A;  3SXY A;  5J6X A;  2L01 A;  3N4M A;  5BPD A;  1GLN A;  4L0Z B;  3HUG B;  4G7H F;  2E34 A;  5L3G A;  5J8F A;  5DNS A;  1QFJ A;  5EEG A;  4OAZ A;  3BTI A;  3SYT A;  1S3J A;  4HOB A;  3WHC A;  1G2H A;  2OZU A;  3UR3 C;  3JRA A;  1BW6 A;  1VQ8 I;  3BY6 A;  1LDK B;  1Q86 D;  4P3I A;  2X53 S;  2NTP A;  4LK1 F;  3AK5 A;  1D1A A;  2VKH A;  1LNW A;  2AQF A;  3OS2 A;  2YPR A;  3RPU A;  2QSG X;  4TKO B;  3TH0 A;  2Y30 A;  3QPT A;  1HF2 A;  3FXR A;  1BIB A;  3BC8 A;  5IP7 J;  4UB6 C;  2X0K A;  2VFN A;  1PUF B;  4ESF A;  9ANT A;  4M74 A;  1HSJ A;  2PMZ N;  1YS7 A;  3D5L A;  3H3Z A;  4R71 A;  2V5I A;  4DK0 A;  1K6O A;  4AVP A;  4PMH A;  1Z05 A;  2NAZ A;  2R4G A;  4LIV A;  3WHB A;  3GZ6 A;  1KTV A;  1K8A D;  1OFD A;  4Z05 A;  3T8T A;  4BL0 B;  5LGT A;  2XF7 A;  2VBM A;  2ZL5 A;  1W87 A;  4HQE A;  1R22 A;  1ETW A;  3F72 A;  1WOS A;  2JJ7 A;  4HNT A;  3F21 A;  3HOZ J;  4OIQ F;  2BM4 A;  2XUB A;  3ABL H;  4CXF A;  1S29 A;  3K70 D;  3DEW A;  4I2O A;  2HVQ A;  3HKZ A;  3E20 A;  4W8S A;  2ZXW H;  5TJJ A;  2MLK A;  1ORK A;  1D1B A;  2V1U A;  3PA2 A;  2OTJ B;  2KL4 A;  1WTH D;  3TQN A;  3U2R A;  5THX A;  3ZIA A;  2F4N A;  1SKY B;  1YE9 A;  3KZZ A;  3LWF A;  1BJA A;  3BCF A;  3M9A A;  3CC4 B;  2QSH X;  4XOP A;  5J47 A;  3DU6 A;  2FNP A;  4YAW A;  2RAE A;  2O8X A;  3KEO A;  4EM1 A;  4BAY A;  4A3M J;  4LOC A;  4D0P A;  1HKS A;  3HIF A;  3QPS A;  3KET A;  1X2N A;  2OUM A;  3JX8 A;  1KTW A;  5DM7 F;  4P22 A;  2GJK A;  3AVX A;  3WG9 A;  2BN4 A;  3MWM A;  4V2G A;  3AVT A;  3OOP A;  1QHH D;  3BTL A;  1SMY F;  1S9H A;  1T95 A;  3J80 K;  3J80 Z;  2F4I A;  2WAQ A;  2LKP A;  2D1V A;  3TBI A;  1MNE A;  4Z6Y A;  1SC7 A;  4PAA A;  2F5F A;  5HS8 A;  2DK8 A;  3PFY A;  1Z0X A;  1YIJ B;  2MH2 A;  2O7O A;  2WZP P;  5JVG F;  4P12 A;  4AYB A;  2Y69 H;  1MND A;  3BH6 B;  3S1R J;  2DA3 A;  5C44 J;  1LUJ B;  1WFX A;  1DPU A;  4OIN F;  1D8J A;  1QGP A;  2LR8 A;  2CH0 A;  2OQG A;  4FTH A;  3CMM A;  1MDM B;  2GOM A;  5ERI A; 
#chains in the Genus database with same CATH homology
 5LFA A;  1FMV A;  2IS1 A;  1O8H A;  3H9G A;  3CJQ B;  2IS6 A;  2RRE A;  4ZC3 A;  2R7V A;  1OOC A;  3KEY A;  1R6R A;  4ITV A;  3M1C A;  1O8I A;  3OS0 A;  1N75 A;  2K9M A;  1KZL A;  1UD4 A;  4Z06 A;  2MD0 A;  3OFN A;  4D9J A;  1W0J A;  3L2U A;  3HAG A;  2I8D A;  1UG0 A;  2CFO A;  1D1C A;  1DQU A;  4C2L A;  2HVR A;  4B48 A;  3OYJ A;  4E4H A;  2LY1 A;  4HIZ A;  3DKX A;  3VSV A;  2WJY A;  2K5C A;  2ZZE A;  3OAA A;  4KT6 A;  4XKV A;  4XR6 A;  4BJ6 C;  2QY1 A;  4DNT B;  1HVX A;  4RM3 A;  3OL4 A;  2WAF A;  4KKT A;  1BHE A;  3PNY A;  3KX2 A;  2KLO A;  2XZO A;  4U49 A;  3K4N A;  2LRE A;  2X1D A;  3OS1 A;  5CDF A;  1RU4 A;  2BSP A;  4ZDP A;  2ZFU A;  1WJF A;  1VZ0 A;  4DJA A;  3I9V 2;  3K4M A;  2F1M A;  4J00 A;  5KNL A;  3L2Q A;  2W6J A;  4F3Q A;  3GQ9 A;  2KP6 A;  1HZE A;  1V0E A;  1OFM A;  4KIT B;  2GK6 A;  3AFH A;  2XND A;  3N05 A;  3OYC A;  2X3H A;  1UD5 A;  4ZTJ A;  2M3A A;  1DGR M;  1WJB A;  2GJP A;  1V5G A;  4D1Q A;  2M7A A;  3UNG C;  2VJ4 A;  3C2G A;  2IGK A;  2HPM A;  2Z1D A;  4DK1 A;  1O8E A;  4BUP A;  1W9X A;  5LD2 C;  1XG2 A;  4BE2 A;  1Z3Y A;  1WJA A;  2MFZ A;  1FMW A;  2PYH A;  1Y6I A;  4OJ5 A;  2RQQ A;  3K10 A;  2NSP A;  3OY9 A;  2KRH A;  4XL9 A;  3AL0 B;  4G7X A;  1YX5 A;  3CP2 A;  4NC8 A;  4B44 A;  4B3G A;  4II2 A;  1NG7 A;  2L5Q A;  2R7T A;  2V4D A;  2DXI A;  3VWB A;  2ZZQ A;  4XKC A;  2R7Q A;  3A2K A;  4BE1 A;  3FBI B;  4NK6 A;  2XC7 A;  1KCD A;  4OJ6 A;  3IUO A;  4E7I A;  3VSK A;  4BDY A;  4II3 A;  4X0G A;  2BW3 B;  4KJZ A;  3FHN A;  3HPH A;  4DNR B;  2CUZ A;  1PLU A;  4KIS A;  4E7L A;  3VSU A;  3BC9 A;  2Z2S B;  2A6T A;  4YZX A;  3BG6 A;  4NK8 A;  2BOL A;  2KZV A;  4JQF A;  4XKW A;  3A3B A;  1O88 A;  2KHM A;  4ASU A;  3DPU A;  3PSI A;  4LIT A;  3RTR A;  3MKZ A;  1SAU A;  4DIQ A;  2CW8 A;  5HNF A;  3LMM A;  4XLC A;  3LFU A;  3MKW B;  2XZP A;  4F91 B;  2GJR A;  2DT7 B;  2WBM A;  4XOT A;  4C30 A;  1YX3 A;  3PUB A;  2L7K A;  4QPQ A;  2CK3 A;  1TZL A;  4OJP A;  4HEA 2;  1DBG A;  2E1B A;  1VLY A;  2QKM B;  4P1W A;  3DPT A;  3E0J B;  2JUG A;  4E7Z A;  2WJV A;  2ZZF A;  3LSM A;  3DDY A;  1BMF A;  2QXZ A;  1WJE A;  4HPQ A;  1EA3 A;  1KCC A;  3NE5 B;  4U4B A;  3ZCO A;  1OB0 A;  2MAB A;  1D0Z A;  3OYN A;  4Z03 A;  2E1M B;  4PFP A;  4BEH A;  3ZXS A;  3LSH A;  2VPL A;  2DT6 A;  5FRO A;  1N77 A;  1O8D A;  3JUR A;  2JJ2 A;  2O5R A;  4DOZ A;  3GVJ A;  1E1R A;  1WP6 A;  1RWR A;  2PEC A;  4BGD A;  2CW7 A;  2IXS A;  3L2W A;  1CZF A;  3W3C A;  3DQV C;  4XNF A;  5JHF A;  5CQG A;  2V4J C;  1WMR A;  2IGM A;  3G2B A;  3GQA A;  3DWL E;  4YEJ A;  5CKT A;  2VJ5 A;  2PJR A;  4HNU A;  4MR0 A;  3OPO A;  3VMW A;  3OIQ A;  4P5O A;  3ZR8 X;  4Z1M A;  2M4G A;  2CUJ A;  1BOB A;  4F92 B;  2ZZG A;  1SFK A;  2JVG A;  3LSI A;  1N78 A;  2HNH A;  3ZRG A;  2PMZ A;  3H5R A;  1NG6 A;  3PNT A;  4HWV A;  4N4O B;  2F6C A;  1TT0 A;  4YEL A;  3K70 C;  3G05 A;  4YXW A;  3ZPN A;  3EQO A;  2O0V A;  4F93 B;  3FKS A;  3FPP A;  1IA5 A;  1NHC A;  4IKF A;  3MKY B;  2ZTN A;  4PUS A;  3DTK A;  1VJS A;  1PE9 A;  1G8X A;  2AQE A;  2NTQ A;  4XMY A;  2R9V A;  2X6X A;  2LRD A;  1RMG A;  1UEL B;  3EQN A;  4PJJ A;  5C1E A;  3QYB A;  1AIR A;  3GBG A;  3OR2 C;  2X85 A;  2DIE A;  3HC7 A;  4LG3 A;  1LFP A;  4BJ5 C;  2KMU A;  2R7R A;  4YZ0 A;  3M8J A;  1BR2 A;  3ZQQ A;  2IGN A;  2P0W A;  4PJN A;  4KKS A;  1MMA A;  3IAM 2;  2WPD A;  3K4K A;  2F43 A;  4RLQ A;  4BU2 A;  1BLI A;  2R7X A;  2L2O A;  1VF7 A;  3SEZ A;  3VMV A;  4U87 A;  1U0J A;  2M7B A;  3DU5 A;  2ELJ A;  4F52 A;  4CCO A;  1PKV A;  3LSG A;  1IDK A;  3H9J A;  4XOR A;  2V9K A;  2W00 A;  1Y56 A;  1X0C A;  2UUZ A;  2O17 A;  3CF2 A;  3HG9 A;  4HRI A;  1G59 A;  2VBK A;  3S8P A;  4B47 A;  4CCM A;  1W36 C;  1UAA A;  4BAC A;  2RNG A;  1OGO X;  3DKY A;  2O0W A;  2LYC A;  1E43 A;  2V7Q A;  3K4J A;  2VAS A;  2W82 A;  1EFR A;  4DGW B;  4AVZ A;  3L2R A;  2KQR A;  5C1C A;  3H5N A;  3B90 A;  2V7F A;  1UD2 A;  2JIZ A;  3ONQ A;  3VYU B;  3OMY A;  3K4C A;  2VQC A;  3RQ4 A;  1NRK A;  5HOO A;  3OYI A;  4EAT A;  5HNH A;  3AL0 C;  1K5C A;  4EW9 A;  4HSR A;  2CV1 A;  4I84 A;  4CCN A;  3I3L A;  1LVK A;  3H5A A;  3DEE A;  2ODL A;  1K6Y A;  1LKX A;  2IGO A;  3S93 A;  3GQ8 A;  4CA0 A;  4ANJ A;  4YZA A;  2XDV A;  4ZTF A;  2XAU A;  2WB1 A;  2ZSI B;  3IAS 2;  3LL7 A;  1I8D A;  4G6I A;  2JJ1 A;  4CCL A;  2WAE A;  4XLE A;  2M4K A;  3H94 A;  2A5W A;  1WJD A;  3W2W A;  3WQZ A;  1WPC A;  4F55 A;  3VYS B;  3HPG A;  4PFO A;  1O8F A;  1UD6 A;  1BN8 A;  3GQB A;  4YRV A;  1MMG A;  2HQA A;  3SZG A;  3A4C A;  3HXL A;  2XSJ C;  4XLH A;  2JA2 A;  3RSN A;  1X4O A;  3OYK A;  2VBE A;  3OYE A;  2FUG 2;  1JI8 A;  3H0D A;  3T56 B;  2R7S A;  2DCE A;  4E7S A;  4ZJZ A;  1E79 A;  4KKU A;  3OE7 A;  5HVQ C;  3GVK A;  2X1E A;  3ZGK A;  3VR6 A;  4OJL A;  2VQG A;  5CQE A;  2EWE A;  1IB4 A;  2INV A;  3VDX A;  4FXU A;  1O8G A;  3OOC A;  2OV7 A;  3B8Y A;  4TSF A;  2MC4 A;  1O8L A;  3BCB A;  5TGT A;  3S32 A;  3EUA A;  2GOX B;  3SEQ A;  1AA7 A;  3BG7 A;  4NC7 A;  3OYD A;  4OJO A;  3GQ7 A;  3TL4 X;  3VST A;  2OC6 A;  2QKL B;  3T9G A;  4IQ4 A;  3PJR A;  4W8Q A;  1Z7L A;  3BCD A;  3EUK L;  4E6K G;  2X8K A;  2E60 A;  2Q1Z B;  4OZY A;  4RM2 A;  3PNV A;  1JTA A;  2MYS A;  1Z21 A;  2NT6 A;  2O04 A;  1BR4 A;  3L2V A;  2DJI A;  4JOM A;  1MAB A;  2X1C A;  3S3N A;  4E7J A;  2CV2 A;  2PYG A;  2O1D A;  4Y4R A;  4BQN A;  2LOO A;  3GVL A;  2LBF A;  4G7W A;  5HLT A;  1OFL A;  4NQW B;  2IQ7 A;  1P9Q C;  2VIX A;  2DOA A;  2WAD A;  3CES A;  2Z8G A;  2X6Y A;  1MMD A;  2VKD A;  1COW A;  3HL2 A;  4PSX A;  4E7H A;  3V42 A;  2CV0 A;  1IDJ A;  4MXN A;  2VLA A;  4NNJ A;  5FRN A;  2VQL A;  4Y33 A;  3OYG A;  5AMV A;  2R7U A;  1H80 A;  3OYM A;  1I18 A;  4C2T A;  1D0Y A;  2BVL A;  3NWT A;  4CZC A;  2HVS A;  3OYA A;  4BEH B;  2XF6 A;  4H4K C;  2K9L A;  2X51 A;  2ZTG A;  2V1N A;  4CCK A;  4XLA A;  2IS4 A;  1H8E A;  3HOS A;  1E1Q A;  1PJR A;  3CP8 A;  3HOT A;  2CMP A;  2V6E A;  2LY2 A;  2Q2E B;  3OYL A;  1V5E A;  4URR A;  4U7B A;  1W0K A;  2LBF B;  1HA8 A;  3GRH A;  2WY7 Q;  4R79 A;  1W36 D;  4LIU A;  4BE0 A;  3A35 A;  5FL7 A;  1X19 A;  1UD3 A;  4XQF A;  2L9N A;  2W6I A;  3ZSC A;  4BDZ A;  1OR7 C;  2LC2 A;  1UD8 A;  3W2A A;  2PJR B;  4B3X A;  1T5E A;  2UVE A;  2V26 A;  3C2H A;  4RLF A;  3OWT A;  2ZSH B;  4PJM A;  3B4N A;  3T53 B;  2V31 A;  1O8M A;  1NBM A;  1PYV A;  4C9Y A;  4HST A;  2VXZ A;  4CSW A;  3CJR B;  1BR1 A;  4NUB A;  4XN3 A;  1Z3X A;  2XF5 A;  2LH9 A;  1WJ5 A;  2Y0S A;  1QU3 A;  2X6W A;  1T0F C;  3FY3 A;  1DP3 A;  3WWG A;  2INU A;  4N4N B;  4JMQ A;  3BLY A;  4W8R A;  2D3L A;  3EPZ A;  5CPR B;  2LZJ A;  2HZD A;  2NOJ B;  1KON A;  3MD2 A;  4IQJ A;  1E3Z A;  2QX3 A;  5DN6 A;  3LNN A;  2WA0 A;  2M5S A;  4BQO A;  1HG8 A;  4IZZ A;  2W4S A;  2W7N A;  4BXF A;  1X1D A;  2BVM A;  3D5S C;  4FET A;  4XN0 A;  3RCO A;  2WY8 Q;  2D3N A;  3T51 B;  3KRG A;  4CUG A;  3VYR B;  4DBR A;  3FBN B;  4B3F X;  1GQ8 A;  3OYB A;  3PSF A;  5HKK A;  2L9S A;  2XZL A;  1V0F A;  2VB6 A;  4HG2 A;  4ZYA A;  1X4P A;  1MW7 A;  4DBQ A;  4W8T A;  3OIP A;  3RPU D;  2E5Z A;  1DGW Y;  3NWS A;  2KRC A;  4CCJ A;  2R7O A;  2W1O A;  3F9K A;  3UW0 A;  1O8K A;  1EE6 A;  3OR1 C;  4BJT A;  1ZEL A;  1OLT A;  3OOU A;  2BW3 A;  4CH7 A;  4PSW A;  3QYF A;  2LG4 A;  4BS9 A;  1FX0 A;  4ZDO A;  1GLN A;  3TMO A;  3HUG B;  4OAZ A;  3OW7 A;  3SYT A;  3A1Y A;  3UR3 C;  3U21 A;  4IX7 A;  3W2V A;  3VSL A;  4L8J A;  1LDK B;  4YZQ A;  2ZXI A;  5FRM A;  2X53 S;  2NTP A;  2CS3 A;  1D1A A;  2VKH A;  2AQF A;  2Z16 A;  3OS2 A;  4TKO B;  4XLF A;  4FAS D;  4ZDL A;  4XD7 A;  3K4B A;  3BC8 A;  1QHG A;  2VXD A;  1D0X A;  1O8J A;  1IRX A;  2Z6B D;  3KEW A;  3D5L A;  4AU7 A;  4DK0 A;  4GQN A;  3SDB A;  4PMH A;  2UWM A;  1E0E A;  2R4G A;  4LIV A;  2IS2 A;  2WSS A;  3JU4 A;  1OGM X;  3DPL C;  2NZM A;  4Z05 A;  2HLD A;  4BL0 B;  3A3G A;  1DBO A;  3QYE A;  2XF7 A;  4PJL A;  2VBM A;  2E1M C;  4XM3 A;  3SUC A;  1E3X A;  3BCA A;  2XOK A;  4MLO A;  2ZXH A;  4HNT A;  4RMN A;  1K28 D;  3ZPP A;  4BQQ A;  1J09 A;  4OZZ A;  4C2U A;  3K70 D;  3K4L A;  2HU9 A;  2HVQ A;  3FDY A;  3S3M A;  2HDW A;  3D5R C;  3HKZ A;  1KMH A;  4UZU A;  3LMW A;  4W8S A;  5KCM A;  2K3P A;  1D1B A;  1WJC A;  1X1B A;  2KL4 A;  1OHH A;  1WTH D;  2NTB A;  3ZIA A;  1SKY B;  4E7K A;  1YE9 A;  1BPL A;  3QOE A;  3BCF A;  1QJV A;  2JSP A;  4XOP A;  2UVF A;  3DU6 A;  2R7W A;  4TT3 A;  3PL8 A;  2UV1 A;  1PXZ A;  3EUH C;  2KPM A;  3VYT B;  2M0M A;  1VBL A;  5IK2 A;  3LSK A;  3OYH A;  2OUM A;  4GRI A;  1KTW A;  2VJJ A;  4P22 A;  4OAY A;  4OWR B;  2E5N A;  2GJK A;  3DTE A;  2VJI A;  1X1C A;  3K6G A;  2XGJ A;  1QCX A;  3DTI A;  3KYL A;  2GK7 A;  1QHH D;  3OEE A;  1S9H A;  3CZ6 A;  1T95 A;  2NT9 A;  2VL8 A;  2QE7 A;  4G6T B;  2F4I A;  2WAQ A;  3TBI A;  2JDI A;  1H8H A;  1MNE A;  4Y3O A;  4J01 A;  2KVO A;  3DLA A;  2JVH A;  3S3O A;  3H35 A;  3FKJ A;  3PFY A;  4E0F A;  2HPI A;  3AKZ A;  2WZP P;  1MMN A;  2VQH A;  4AYB A;  3OYF A;  1MND A;  3H9Q A;  3IP4 B;  3OL3 A;  4XKB A;  2F5V A;  1WFX A;  4QPO A;  3QOD A;  3OEH A;  4XON A;  4PK4 A;  1ERD A;  3BH4 A;  3MMY B;  2KDO A;  2CH0 A;  4B43 A;  3E1S A;  5KHD A;  3J7A Y;  1V5F A;  3CMM A;  2GOM A;  1JRG A;  1X1A A;  2NST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...