4XR1A

Escherichia coli replication terminator protein (tus) complexed with dna- ag/at mismatch.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
307
structure length
307
Chain Sequence
RYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Replication/dna
molecule keywords DNA replication terminus site-binding protein
total genus 88
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 4xr1A02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 4xr1A01
4XR3A 2I06A 4XR1A 1ECRA 2EWJA 4XR0A 4XR2A 2I05A
chains in the Genus database with same CATH superfamily
3RHUA 1V4PA 3RFNA 2EWJA 1V7OA 1QF6A 1TKYA 2ZZFA 1TKEA 1TJEA 4XR1A 1ECRA 4XR0A 1TKGA 4XR3A 1WNUA 2I06A 3WQZA 2ZZGA 1WXOA 4XR2A 2ZZEA 2ZTGA 2I05A
chains in the Genus database with same CATH topology
3RHUA 1V4PA 3RFNA 2EWJA 1V7OA 1QF6A 1TKYA 2ZZFA 1TKEA 1TJEA 4XR1A 1ECRA 4XR0A 1TKGA 4XR3A 1WNUA 2I06A 3WQZA 2ZZGA 1WXOA 4XR2A 2ZZEA 2ZTGA 2I05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR3 A;  2I06 A;  4XR1 A;  1ECR A;  2EWJ A;  4XR0 A;  4XR2 A;  2I05 A; 
#chains in the Genus database with same CATH topology
 3RHU A;  1V4P A;  3RFN A;  2EWJ A;  1V7O A;  1QF6 A;  1TKY A;  2ZZF A;  1TKE A;  1TJE A;  4XR1 A;  1ECR A;  4XR0 A;  1TKG A;  4XR3 A;  1WNU A;  2I06 A;  3WQZ A;  2ZZG A;  1WXO A;  4XR2 A;  2ZZE A;  2ZTG A;  2I05 A; 
#chains in the Genus database with same CATH homology
 3RHU A;  1V4P A;  3RFN A;  2EWJ A;  1V7O A;  1QF6 A;  1TKY A;  2ZZF A;  1TKE A;  1TJE A;  4XR1 A;  1ECR A;  4XR0 A;  1TKG A;  4XR3 A;  1WNU A;  2I06 A;  3WQZ A;  2ZZG A;  1WXO A;  4XR2 A;  2ZZE A;  2ZTG A;  2I05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...