4XR3A

Escherichia coli replication terminator protein (tus) complexed with dna- gc(6) swapped.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
305
structure length
305
Chain Sequence
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Replication/dna
molecule keywords DNA replication terminus site-binding protein
total genus 89
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 4xr3A02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 4xr3A01
4XR1A 4XR2A 2EWJA 4XR0A 1ECRA 2I05A 2I06A 4XR3A
chains in the Genus database with same CATH superfamily
1QF6A 4XR2A 1WXOA 1TJEA 1TKGA 3RHUA 4XR0A 3RFNA 4XR1A 1WNUA 2ZZEA 2I06A 4XR3A 1V7OA 2ZTGA 2ZZFA 1V4PA 2ZZGA 2EWJA 3WQZA 1ECRA 2I05A 1TKYA 1TKEA
chains in the Genus database with same CATH topology
1QF6A 4XR2A 1WXOA 1TJEA 1TKGA 3RHUA 4XR0A 3RFNA 4XR1A 1WNUA 2ZZEA 2I06A 4XR3A 1V7OA 2ZTGA 2ZZFA 1V4PA 2ZZGA 2EWJA 3WQZA 1ECRA 2I05A 1TKYA 1TKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR1 A;  4XR2 A;  2EWJ A;  4XR0 A;  1ECR A;  2I05 A;  2I06 A;  4XR3 A; 
#chains in the Genus database with same CATH topology
 1QF6 A;  4XR2 A;  1WXO A;  1TJE A;  1TKG A;  3RHU A;  4XR0 A;  3RFN A;  4XR1 A;  1WNU A;  2ZZE A;  2I06 A;  4XR3 A;  1V7O A;  2ZTG A;  2ZZF A;  1V4P A;  2ZZG A;  2EWJ A;  3WQZ A;  1ECR A;  2I05 A;  1TKY A;  1TKE A; 
#chains in the Genus database with same CATH homology
 1QF6 A;  4XR2 A;  1WXO A;  1TJE A;  1TKG A;  3RHU A;  4XR0 A;  3RFN A;  4XR1 A;  1WNU A;  2ZZE A;  2I06 A;  4XR3 A;  1V7O A;  2ZTG A;  2ZZF A;  1V4P A;  2ZZG A;  2EWJ A;  3WQZ A;  1ECR A;  2I05 A;  1TKY A;  1TKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...