4XR8C

Crystal structure of the hpv16 e6/e6ap/p53 ternary complex at 2.25 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
199
structure length
199
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, ubiquitin ligase E6AP
molecule tags Viral protein/ antitumor protein
source organism Escherichia coli
publication title Structure of the E6/E6AP/p53 complex required for HPV-mediated degradation of p53.
pubmed doi rcsb
total genus 48
structure length 199
sequence length 199
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xr8C00
5ABAA 2RMNA 2BIOA 4AGMA 2J1XA 1TUPA 4AGPA 2BIPA 4IBZA 5AOIA 3QYNA 1HU8A 5G4MA 2MEJB 2X0UA 1CMOA 2BINA 4AGNA 3WTYA 4IBQA 4LO9A 4IBTA 5KBDA 1H9DA 2BIQA 5AOMA 4AGQA 2PCXA 2VUKA 1E50A 4IJTA 3WU1A 1HJCA 4GUOA 3ZMEA 5BUAA 5AB9A 1LJMA 3US1A 3D09A 3IGKA 4IBVA 1EAOA 3VD1A 1TSRA 2J21A 4IBUA 4AGLA 3WTWA 4AGOA 3D0AA 1EANA 4IBSA 3Q06A 1IO4C 2OCJA 2IOIA 3TS8A 4QO1B 3WTUA 2WGXA 3Q05A 3D05A 2X0WA 5LGYA 1UOLA 3WTSA 3D06A 4L0ZA 4A63A 3WTTA 2J1ZA 4MZRA 4L18A 4GUQA 2XWCA 3EXLA 3VD2A 1GZHC 2FEJA 3D08A 5G4OA 3Q01A 4LOEA 3KMDA 2J6WA 2BIMA 1T4WA 2IOOA 2GEQA 2ADYA 4G82A 1GZHA 5AOKA 2XWRA 4MZIA 1KZYA 2J1WA 5A7BA 3VD0A 1HJBC 4HJEA 3WTVA 2YBGA 1EAQA 3KZ8A 4IBYA 3EXJA 1CO1A 2IOMA 4XR8C 2J1YA 1YCSA 5G4NA 2J20A 3D07A 5ECGA 3QYMA 2AC0A 2X0VA 4G83A 2P52A 5LAPA 4KVPA 3US0A 2AHIA 5AOJA 2ATAA 4IBWA 3IGLA 4LOFA 4L0YA 5AOLA 3WTXA 2H1LM
chains in the Genus database with same CATH superfamily
3MLTA 4L9LC 2KLTA 1CTOA 1CLVA 3EGDA 3T0XA 5KSBB 1MQKL 4CW1A 4GG6F 2VDRH 4QF1B 5HVFB 2NR6A 3FCTA 4GXUN 4PRPA 3I6LE 4R90H 1E4KA 3FPYA 5D5ME 3EGXA 4EOWL 2DQGH 1LDSA 2E8ZA 4F7CB 3BEWB 3N1GC 3UABA 4PGBB 5AOMA 2GJPA 3F7YA 3ZUCA 3K71B 4M43H 1JXDA 2O5YL 3O3BA 4G6FD 3T6XA 1E50A 1CFTB 1Y1DA 2QVMA 4FG2A 4WUKH 2VKXA 4N0CD 3QPXH 1RK0B 4TUOB 3Q6GL 3RNKA 5IWLA 3CN4A 4P49A 5DJ6B 3UTTD 3ZIYA 3UPRA 1DVXA 1XF3A 2RHEA 1JV5B 4FKEA 5TDNB 4F20A 2WNGA 3D85B 3NTCL 2AQTA 4YLQT 4IBVA 5FYKL 1NANH 1BP3B 4JRWA 2EDHA 1ZTMA 3S3DB 1MXDA 2YUWA 3DURA 5AWNH 3VXRE 5DYOA 4X5WA 4OQTA 1D9KA 2YRPA 1ZVSB 4FLRA 2QFPA 2O26U 1Q72L 2G3NA 2R2BA 1SLVA 4BK5C 4UM9A 2FJGB 4CSSA 1MFAH 2HRHA 1GS6X 4GKSA 3STLA 4NQSB 4F8PA 1DUYA 2DH2A 5EU5A 4O51A 2XICA 3KLDA 2W0FB 1E9PA 2BIHA 2F7OA 3ARGD 2FGWL 4RQQA 4HPHA 4UIMA 4APXA 2V17L 4HJ1A 4F58L 3MV7D 4AJ0A 4OCWL 1RMFH 4TQPA 3VWJA 4XH2B 2WSPA 5GSRA 3OJDB 2P3YA 1VFAA 3QARA 3VE0A 3NAAH 1OP9A 4ZX4A 3PIQB 3PNWA 1G7PA 4NUGH 4XB8A 5DRXB 2X09A 4K7PL 4N90E 2J8UE 1KCUH 3FT2B 5DQDH 1HWHB 3ZL4H 3O2WL 1GZHA 1YNKL 5CEZL 3MRFA 4XP6L 4XNUL 4WJ5A 2CDEA 3QIWC 4J8RA 1TZGH 4R4FL 5EU6E 4E9LA 2BS9A 1BD2A 3NJJA 3MA9L 1KFAH 4PP2B 4HCIA 3I6SA 2B20A 2YS4A 3FN9A 3O6LL 1Q8MA 5BQ7A 5L2KE 3EJQA 2H6UA 1AZUA 3DDFA 3GMNB 1SUHA 1T80A 2VLKD 3EJYD 3RGVC 1DBJL 3B7YA 5HHMD 2ATPB 1UEYA 5LO7A 1D3CA 3V79C 5C07A 4KI5C 3S36L 5IJVA 1JI2A 3EADA 5DLML 1EEYA 3RY5A 3VCLB 3TCLB 1BVLB 4XMTA 1AGDB 1G7PB 2FBJL 3NSYA 4H8WL 4XPTL 3QZWA 2H6PB 2E76C 4Q6IA 1S7UA 4M93C 1SF5A 1BAWA 2BIPA 4PJXF 2K6ZA 1CZ8L 1XF1A 3CN3A 1PFCA 4HJ0D 2B16A 2WV3A 4UIMB 4DTGH 1Z7JA 3JV0A 3OB8A 3FFOA 3HAEB 2A74B 4M1GH 1IC7H 3MBXH 4AQ1B 4DVBA 1X9LA 4J3OH 3GMOA 4RWHA 4L2LA 4D0CB 4Z7QF 4YR6B 2F58L 3HUJA 5DVLA 1GGCH 4X4ME 2FO1A 5HDOA 2B8OT 35C8H 2WTRB 3BSZA 3CN2A 3VI3A 3ARFC 4X6DB 3MRPB 4FL4C 5LQBL 4WEMB 4R4BA 5HGDB 1X4ZA 2X6BA 4MKTA 1NGXB 3MACL 5IOKA 3IRPX 1HIML 3QFJB 4QO1A 4DFIA 1QFWM 4I88A 1RCYA 5KVDH 2KMWA 3LPGA 2GJZA 4YSDA 5F71A 2ZUQC 3HG5A 4JHZA 4KKCD 1L9MA 1PL3A 5DS2A 4K9EC 1KCSL 3BPOB 1OT4A 5DJYB 3VNYA 2CA3A 3G5XA 4R26L 3CC5A 4KJYA 4APQA 4MQ7A 1JF1B 1NFIB 3ILQC 4QGYA 2FDBP 1IC0A 1YEGL 1TJGL 3S8FB 1TNMA 1RZJC 3IDNB 3O2DH 4AYSA 5AQ0A 5HDRA 4AEIL 1OSZA 4RGNB 1JDDA 4GRLD 1A7BA 3EXLA 1IC1A 3RUGB 3D6GA 2J5LB 1S5IL 3CIQA 4Y1AE 4FS0A 5KYXA 4B9CA 3U2JA 3MTXA 1X9QA 2DQEH 3AQXA 4M61A 3P77B 1B4LA 3BAEL 3OPZH 3WBDA 4PLKC 1WFIA 2J71A 2NXZB 4YPGB 1IJNA 3AAZA 3MRKA 3EZ8A 4RISH 2R2HB 5T33L 1FC2D 3RL1B 3VFTA 3P30H 3S9DB 1UD5A 3HW7A 4TQEL 1PCSA 4OM0H 4PJAE 1MCOL 1H8SA 1XGUA 2VITA 5LG1A 4O58H 4RMWA 4N3TA 1JHTB 3OWRA 2QDWA 3II2A 1GZPB 1TO5A 1CVSC 4NCDA 3ZQWA 1G84A 3KZ8A 4DP7X 1P7BA 1BF8A 1QVOA 3BN9C 4XT1C 2JIXB 3VRIA 3ULVC 3MNDA 3NFNB 1D5IL 4L37B 3QDJB 1AGCA 4MB4A 1NBQA 1JZFA 2Y5TB 5ABZA 3V55A 2HKFH 3BZDA 3QI9A 3QXWA 3O4LA 1YEIL 4OIIH 1K8DB 1P4BL 1XZ0B 1VPOL 3MOQA 3MQIA 4FQ1L 5CGYD 3CSYA 3NJVA 4QDGA 5J56B 1XCTB 4LPWA 3B3IA 1SVZA 2EH7L 1KJ2B 2BVPB 4QI3A 1I7TA 5JZ7D 3BP7B 4N0YH 3HHSA 4BDVB 3VXRA 2OMUB 1K4CA 3PWLA 2WLYA 5CJQL 4AQAB 5A40E 4XTRD 2R69L 4PWEA 4ZUSB 4RGMB 2XTSA 2IADA 2ZJSH 2W94A 1G7HA 1L3NA 2PXYD 2IGLA 2ADFH 4FQLH 4V1DD 4Z95L 4B9FA 2VLJA 4FQIL 4P5SA 1XGTB 3KYMA 2IANE 2VC2H 3BP6B 1SF3A 3O4LD 4UV7L 3WG7B 4EUPA 3UMNA 2AVGA 4WO0A 1WAAA 3GM0A 1QBLL 3TFKD 4NN6B 5FYJU 3H9SE 1JHLL 4OF5A 3P40A 4JVUA 3KPRA 1TKWA 1X5GA 1HILB 4AK2A 1ZAGA 4JFYB 1LMKA 4BM7A 1AQMA 2FQDA 2OK0H 3U6RA 3ES6A 4PCSA 3T8VA 2EH7H 4YPGA 1BM3L 1PY4A 1X5IA 2BSED 3BVXA 5I6XC 4KROB 3TH4T 1F11A 2MWCA 1RPKA 4ZUWA 3TO4B 5I19L 3QIWA 1HKFA 4JN1L 1FZOB 2CR3A 4ZMNA 4Q9QH 2WYHA 1GYCA 2BFVL 2E9GA 4PJCA 4J5VA 2XWDA 5GGQH 1I1AA 2BNRD 4ZJ9A 5HHOB 1J0IA 1PKQE 2Z1PA 2FLBT 3IJHA 4N2FA 4ZZKA 3G5WA 1K5WA 4U7SA 4L23A 4XCNB 5JOFB 3RHWF 4P46D 1F3JA 4IRSA 1ECYA 2GKIA 1X5AA 1BOYA 3L3GA 1A6WH 2JCWA 3L5HA 4QHLA 2FX7H 3AMLA 3A67L 1NGXA 4WHYH 5SWZA 4JHUA 2XYCA 5E1GA 1TVBA 3TO2B 5FKPB 4F1ZA 4KXCA 2FR4B 3QCUH 3AQZA 3MCLL 4MNGE 4PY7B 3X17A 2DJ4A 2BWQA 3CJJA 3DKHA 3V4VH 4JFHE 5DMKB 1YRKA 1E8ZA 4QY8A 3CX5J 3VAEA 4Q4IA 3NA9L 4HCRL 2CG9X 4DK5A 1I85C 4OCRH 2Y22A 2BW5A 4HJGA 1UUNA 3L2NA 1ESOA 4P06A 4M6OH 4Z0BL 2ED7A 1LO0H 3PAYA 4UT7H 1FLRL 1KXVC 4DCQA 2QVTA 5CZXC 3LNDA 3KM1A 5BRZA 1SDDB 1F4XH 4I5BB 4FG6C 1KIQA 1NA8A 2VXQA 5C0ND 3BLPX 1UWGL 4MD0B 3FTZA 5IMLA 1QLEL 1S7WA 3HMWL 5IBTL 4AJWA 1RK1B 2JTDA 3FL7A 1RZ7H 4NHUA 1EZVX 3FFCA 5LNDA 3WO4C 3MV8A 2XN0A 4DN3L 3PDGA 1AKJD 4PJFB 4U1JB 1FGNH 5AVUB 1OTSD 3FW6A 3VFNB 1VAHA 4UTBH 2NCEA 5FGCB 3W9DA 1FPTH 2BDNH 4W9LC 4B0MM 4JPQA 2DH3A 3UTSA 1OW0A 1HT6A 2W0LA 4PWFA 4IIZA 4FULA 1GGTA 2AV7B 4M7KH 4XP5H 3S6CA 4JPKL 1VEMA 2Q8AH 4Z5RB 1DYZA 1T2JA 3T0VA 3UZVA 1HJCA 2YD4A 4WSJA 4DKEL 2NUTB 4ZFGL 1JNJA 4K9EH 1JNLL 4HJJL 3JWNE 2Y36H 3UFIA 2WXJA 5EEYA 2F7IA 3ARGA 4WJ5B 3E3QE 3O4LE 1YQ2A 3MUZ1 4UQ2A 4WTWA 5JA8B 4W4NA 3PGFL 4KV5E 2E5EA 1WSST 1AR1D 2LABA 4Q0XH 1NGQL 4NI3A 1TZOA 1UEMA 4PTUB 1MFBH 3SJVB 2IOIA 2BVTA 3PWUB 3RE0A 3O3UN 1WH0A 3V5DA 3X11A 5KSUB 4NIKB 4X6BA 1XR8A 4BCZA 4QRRA 2OKMA 3AUVA 1CG9A 4HUNB 4WK0B 1DSWA 1JPEA 1WIPA 4JY4B 1QPPA 3L4XA 4AH2B 1BV8A 1FZJA 3CSTA 4AYBA 3P9MA 4W9ZA 5IFJA 5I5RA 1IKNA 2Z3FA 4PRDA 5HGBB 3SOBH 2QPDB 4JPWH 2ZTBA 1X9UA 1LNUA 2VMDA 3V4LA 1BJMA 3ULSA 2ICWA 4R8WL 1FL6B 5IB4A 5DS8B 1YY9C 2W07B 2PYFB 5MEOA 1MH5B 2AK1H 2WBXA 5ANME 5CP3A 4K5LA 3SKUD 1UA7A 4KVCL 4J1UB 1CDHA 4NN7C 5IKCA 1ZA3A 3QPXL 1DE4B 4KI5E 3FQNB 4F57L 4I0PB 5AYQA 1ZT1B 2JKWA 2VMFA 3V6OA 5CSZB 5DZPA 4XP5L 2FATH 3L5XL 5GGVH 2HFGL 3ZTCC 2AAAA 3LRMA 1BZ9B 5HXMA 3DUUB 2YC1A 2ICEC 4YL4A 1QSED 5I74B 4G8FA 1IARB 3H8NA 5I71C 3D87B 4NRXA 5E6IA 4N2BA 4UZUA 5E6SB 4OLXL 2PLTA 1MHCA 1HTYA 2D03H 3ROLB 1JYXA 2QGEA 1Q72H 1ZT4B 4KAQH 4LSVL 1IC5L 2BM3A 4O2CB 4LPVA 3MXWH 2YBRB 1FVEA 4JHWH 4L4VA 3ZRCC 3EFFB 1CT8A 1HL4A 1G87A 4IRJA 2AJUH 3P54A 3CLFL 1CLOL 5L8JB 3IJYA 3EGDB 5KSBA 3WMPA 3GSQB 3JSSA 3WFDH 1JTPA 4IQHA 1AI1L 1AG6A 3QJFB 2DWDB 2QL1A 4FQJH 3F12B 3TVMD 2MMXA 4DEUA 3V4VB 4C47A 2IWKA 4PJBE 4LLMB 2C9XA 2B0SL 5DD6B 3DX1A 3Q8AA 2VWEC 5IJKC 5AOIA 1EO8L 3WIIL 1UXLA 2M1KA 1PZ5B 2WYZA 5EORL 1E4XI 3B2UD 4NEHB 5AYUH 3EAKA 5IBLD 4HXBH 3QRGL 5ITBL 5GRUH 4WHTB 2BXZA 4HG4J 1E65A 2VDMH 2V7NA 1TITA 3VFSB 4NQDD 3AXLB 1BD2D 2HT3C 1UWGH 5C92A 4QGTA 5HDBB 4OBSA 4RAVB 4A2MA 4CN1A 2E3VA 4TVSa 3DO3A 1AP2B 1E40A 2LOEA 4GQZA 4G42B 2BNRB 3SBRA 4I18B 3KJ4B 1ZHNA 1DBJH 2NY2B 4IRSB 2QR0B 1PVHA 4DQOH 2OS7A 3MRDA 5GHWL 4OLXH 3NIGB 3VFWA 3N6YA 5HHOA 1EFXA 1FDLL 3LZFH 4WKZA 4XMKL 5I16A 2BJML 1KV7A 4IRJC 4ZD3H 2NLJA 1MAML 5L88H 5L2JA 3Q8FA 3RGBA 3MLYH 4QNPF 4L18A 2XKNB 1LWJA 3ZTDC 1LE5B 5DF0A 5EU5B 4J7RA 2ZUVA 1Z5HA 4QHUA 5E8EB 1S3KH 2JKNA 3L5WB 5HJ3B 4HV8B 2R2CA 2XKNA 4X4YB 4NQVB 5L4FA 4QRSA 1MWAH 3EH4B 2FX8L 4QHKI 2G3XA 1H3VA 2OSWA 4TOYH 3MUUA 4TUKH 1G0DA 4WW1A 5JIKA 3G5YB 4GAAA 5L2KD 1RAMA 4PH8A 3CZNA 4RRPG 1BJ1H 4M7JL 1IM3B 3TBSB 3VA6A 4B9YA 5GRUL 5SWSE 2DWXA 2YUZA 1DJSA 4HU2A 4RVBA 2E75C 2QR0A 1QLRB 4Q89A 4LHUB 1SUJA 1I3VA 1T5XA 3EXJA 1YLBB 2DL9A 4PJHA 1CK0L 3EIFA 1PG7X 4KFMA 4LIQL 4PGDA 3SQOH 1J8SA 2ZXEB 5FM4A 3B7SA 4LEOA 5CN1A 3IB4A 4F7EB 4MCZB 4PTTB 3P9LA 4NFCA 3CBKB 1AYOA 4GMSL 1R6VA 4G83A 4ZMAT 5AYTA 1EGJH 4JG0H 1QFHA 2A6IA 2DRUA 1NIDA 3WOVA 5IZ7A 3N06B 2X1PA 4DP9X 4G6JL 2GJRA 2Q87A 4K94H 2ED8A 3AT8A 4ZMPA 4N8VG 1NMAL 5AALA 8CGTA 3RZCD 3I6KA 4WI8A 4ATWA 3HE6B 4PJ8D 5TK4A 5LJYH 1S7XB 5D1QB 1OP5H 3T65B 3RY6C 1ASPA 2JKJA 4NT6A 2X0UA 1CMOA 2JVUA 4GBXA 4YLBA 4N8VA 3QDGB 4AL8C 1VLXA 2R7EB 2OI9C 4PGCA 3RBSA 3MRBA 1P1ZA 2WLZA 1MOEA 2RTTA 4AVHA 2PP7A 4LLYA 4KXZH 2WIIA 4HHWA 4XOBA 1D5ZA 3NK3A 1YJDL 3W5MA 2BY0A 3FRPA 3C5ZB 4KK5C 5DURD 5D2NC 1M2OA 3SZ6A 1U91B 3M45A 5I71B 3K6NA 1YPZF 1XL4A 2X7LA 3RWEB 2ICEB 3R0MA 2NYYC 3VB8A 4NO3A 4F9LC 2X6MA 2NY0C 3QAQA 3HS8A 2PMZA 3S35H 4J6IA 3FJTA 5BNXD 2BY2A 4ZT1A 2ZXAA 3RUGF 3DI2B 4NJAH 4S11A 4AVJA 3T4AC 4ELMA 4Y5XC 5JPMA 1JDCA 2BP8A 3UYOD 4CADA 2XA8L 3NJFA 1T1XB 3LRLA 3P2TA 5D6DA 4DSYA 5K9KA 3L1EA 4JDEA 3ATDA 4JFFB 2A9CA 2NTSP 1UD8A 1HOCA 3UJJL 3GXUB 4PY8I 1DCEA 1FN4B 2APSA 4FQCL 1DJHA 2FEEI 1A8JH 4WWKD 1JV2B 1AKJB 1KDJA 2Y69B 4Z7OB 4ONGH 5F1SA 4W9DC 3PL6D 1FHGA 1QACA 2OK0L 1COBA 2CKNA 3A5VA 4HKXA 2CK2A 2ZCKL 1ONQA 4IKJA 2AQSA 2OTPA 4Y5YB 1XTLA 2GBTA 2I7SA 3OMIB 4G8EA 3JTSA 4ABQA 5DS8A 1CLYL 2Z4TA 3IPBA 3WFEL 3BFQG 2XWRA 1L9RA 3FO1A 4WW2A 5GZOC 5KTEL 4NPYA 3QORC 4DGYH 1JZHA 3LEXB 1YECL 3VO0A 5A3IC 1AD0A 1I4FB 3CDGA 1QFWH 1TVHA 5FM5O 5I1GL 2KQNA 4YSOA 3HBZA 4XO4A 2C4XA 5CNHA 2W60A 1S9WA 4EUPH 3H7LA 4UQ2B 3C6LC 1ECZA 4TSAH 1Z9OA 1HNGA 4GO8A 1KY7A 3TJPA 1M42A 5FO2A 1R17A 2JKRM 4UQ3A 1BBDH 3S98A 2Y1VA 1RJCA 2JCCA 4A7QA 4HJTA 1R5IB 2PWFA 1JV2A 5I8KH 3D2TA 3LS4H 3ZHLA 2YAMA 5DJ2B 2ZCKH 1LEKB 1VSCA 3H56A 1XGQA 2WTRA 1G4MA 1Z9PA 3FTWA 3WO4B 1O7SA 2IH1A 2MOGA 1V3KA 1ACXA 2RJMA 3SEPA 4M9PA 1XGPA 3ARQA 3BPCA 3T04D 2M8XA 1KN4L 4Q6KA 1LDPH 2FD6H 3CFBA 4GKZB 1ZD6A 2YAFA 4NNXA 5DEZA 4Z0XA 3RL2B 5AW5B 1CJYA 2BINA 4XCYA 4BHUA 3X11B 2EDDA 4D7PA 2BP0B 5IVZA 4WU5B 1T89A 5BOJA 1PX3A 3KYNB 3JVFC 2B39A 4N2GA 3H9ZA 4LDLB 3S3SA 4EN3C 3VFMA 4YVUA 1C16B 3GWJA 1GA2A 3REWA 1MWAB 1J9RA 2CBTA 2P7TA 3U9PL 3W9EB 4UWQB 3MRNB 4MAYB 3RURA 1HYSC 2RCSH 3T3MB 3WI9A 5CLWA 4WFHE 1SOSA 5DUBA 3QZWB 4FA7B 5CJXC 3OC5A 4YDZA 3WS3A 1U41A 2GC4C 4AMXA 3ULVL 4OCMC 4NP9A 6FABH 3N5AA 1NC2B 5F7WC 4MXVE 2AV1A 5FA3B 4KU1A 4UQDA 2DYRB 2H9GA 4Y4KD 2MPAH 2R2EB 2AJSH 1HQ4A 4GB9A 1WT5C 4I4WA 1IEAB 1DQJA 1G1OA 1BEYL 3KR3L 5L8LB 1ZS8B 1ZA6B 4JRFA 3PWVB 4HGMA 4OZHF 4BELD 1MCJA 4PD4J 5E4IA 5DRXA 4K5MA 2O5XL 3AG3B 5EDSA 3WUZA 4G6FB 1F8TH 1JNNH 2YMTA 1FH5H 3H9SD 2XFXB 4YHKH 4L3EB 5AZ2H 5F0JB 3UPRB 4KPHH 1T5XB 4GQ9H 3QDMA 4EN3A 4IGBD 4L8SA 4MQSB 3JVGA 3AG2B 5HI5D 4DVRH 3MRMA 5AAMC 1U2CA 4AYMC 3OAZK 5DHVB 3IJHB 5IMOA 3SKJH 4LL1A 4YOKA 2X6AA 5ICYB 2IWEA 1JK9A 3SYAA 5JDJA 1B2WL 1U3JA 5E94A 4XH2A 4YBLB 5BXFA 4G8GA 4UBDD 1RJZB 4XGZB 5IEKA 2IALB 4NN6C 3QULB 5KOVC 4KKLD 1N0LA 1OAXH 3SDDA 3V4UH 4BFEA 4EVNB 3HS0C 4FFZH 3L3OB 3P0YH 5FYLL 5IHUL 2HT2C 1JN6B 1JMXA 1OP4A 3NEXA 3G04A 4PJFF 2BHFA 3RWIB 3SE6A 1AOZA 3NDZE 4KHTL 5D2NA 3HG1B 4JM4H 3VWKC 1XF3B 4BK8A 3VQ1C 5FFGA 4ISVA 2HFEA 4S1QH 1WGOA 4AL8H 4L9LA 2VJ0A 2X9YA 3RKDD 4UMSA 4IS6A 3MZTA 4KQ3H 1U58B 4KTEL 5T5FH 4MRCA 3S3CB 3WNPA 4XN8A 4P3CH 3C5ZD 5EBMA 1QOKA 3QWRA 5DK0A 3K6SB 3HE7C 3X12B 4FKKA 4XOAA 4XXDA 1TEFA 2VISA 3EDDA 1OP3K 1INQA 1YMMD 2IGTA 2XACC 1RFDL 1EHKB 5LGJA 4OI9A 3U0PB 1A6UH 4M03A 3V0VB 4PJEA 3BO8A 1GIGH 1I7TB 3UTQB 5GSVB 5C0BD 3KS0J 1Q1JH 1G7MB 1T4KB 4GW4B 1ZK5A 1C5DB 2KPWA 3W2DH 5DQDL 3S7GA 2FTAA 1TZHB 1II4E 4X5XA 3UTQA 1QP1A 3VDBA 1AGCB 1UD3A 4HX1B 1EAOA 4IYKA 4MFHA 4DETA 1HQRB 1MW1A 3FONB 3EOTL 4HS3A 3NIFF 1LD9B 4O02B 1CFSB 4MMXB 3HS0A 2KLRA 3FH7A 5IEHA 1QMUA 2FRGP 2JQZA 2NXZC 3EHBD 3MN8A 5TQ2L 3V0JA 1LXMA 5D7JB 1ZGLP 5IR1A 3C8HA 2PPDA 3RX9A 4I7ZC 1CZ8H 4POZD 4JDTL 1F5WA 2XWBA 2B0SH 5DVNA 4Y1TA 3RVXC 2R0ZL 4R6UA 4XO8A 4QJ5B 3QZMA 4RGNC 3MLXH 5TDOA 1YAZA 5G4OA 3PABA 4PV8A 3OTTA 4ORGB 4ZW5A 4ZUTB 3MRKB 2I25N 3IDNA 5E94B 3BPOC 4P2RA 4ZMZA 4C56E 1AIZA 2MHAB 3ARZA 1KWKA 1XHHA 1IBFA 2VDQH 1QEWB 5E8NB 5HP5A 4NRZB 5I1EH 1BZ9A 1HHHA 3VXNB 3AWGA 1UWYA 3QA3B 5FXCH 3OD3A 3P4OB 1HHIB 1MN4A 1I1AD 1J1PL 5EZJB 1BVNT 1ZEAH 2R59A 1KLFA 1OT1A 1BZOA 4KJPD 3U36A 5D1ZI 4RGOH 2QBWA 4PV1C 3STZB 4JCLA 2YD1A 2B14A 1I9IH 2XOTA 3DETD 3F84A 3GNML 3LHPL 2VABB 4KKQA 5LDUA 1RPUA 1NFDE 4LIQE 5T5NG 5AENA 2IFFH 1KGCD 1UM4H 3CH1A 4L8BB 3V7AG 5K1NA 4B9JA 3LNGA 1OAZL 5BOPA 1JZ6A 5DQJA 2MCPH 1DTUA 1H3WM 4LSUH 2X2UA 2Q5BA 3FFCE 4XO9A 1LEGB 1YYLH 1M3IA 2WXNA 3IN2A 1LM8V 3O9WC 1OE1A 3MBWA 4MMXC 4R3SA 2H9GB 5CWSA 4F2MB 4L0YA 1ID5I 5CKGA 1U3HD 2J4WL 4JDTH 1JMZA 4WVRA 1B88A 4HUWB 4B6ZA 5ACZA 1KTDB 4LEXH 4Z18A 4AYEC 4Q9QL 4Y4HD 4O02H 5GGTA 4TTDC 1L9SA 2IV8A 4LL9A 1F4YH 3RKPA 4G11A 4DEWA 2WSDA 1PLAA 2IXQA 4ZW6A 3X1BA 3K4ZA 2KZWA 4PPTA 3TEZA 4LO9A 1FGVL 2B77A 3NEEA 3WMSA 1SLUA 3K0YA 3NBNA 1P5UC 2UWEF 4OJAA 2GBVA 4DO5A 1YMME 3BZEB 4Q6IB 3N40F 3RTLA 1MW2A 3W0WE 3D69B 4ALAH 1LQBC 4QKTA 1TJHH 2BVOB 4GINA 3IDGB 4OZFA 1I1FA 1VEPA 3ZGHA 4HQQH 1ZA6A 4WAFA 3ZYOA 2JB6B 5I5MA 2ZOOA 4RGOL 3HFML 2VSDA 2FGWH 5C0FA 4PJFA 1D5XB 5K1VA 3GLZA 1F02I 1PNDA 1X5KA 2P5PA 1JUFB 4HGKC 4L4TE 3UAFA 5FA3A 4KV5F 4M02A 5JA9A 4XVUD 1BEXA 3GXNA 3PJNA 5GRJH 1NMAH 5KSAD 3QHFH 2Y7QA 4EI5C 4JFOB 2SEBA 4LQFL 4MDJB 3SE4A 3EYOA 2V5MA 3AT0A 3EYUH 4X4XB 1GW0A 4JM0A 2CXGA 2DI9A 5FR3A 4TVPH 5IVOA 5KBPA 3S3BB 4W4OC 4LMQE 1D6EA 2NDFA 2O5ZH 2WB7A 2X4SA 2H6OA 3BC9A 4G8IB 4HIHB 4HXAL 2CPCA 4LAQL 1CGTA 2COVD 2X4PA 4J3XA 1I8IA 4WI9A 4AM0Q 4XVUC 3IAPA 1JP5A 4P59L 5DMKA 5B1BB 4PJIE 3DVNA 1EVTC 4YWGH 4PRPE 3IDIB 1DVSA 1XIWC 3V5KB 3B5GA 3UBXB 4B3EA 4DGUA 1RUAH 2QHRL 4HLJA 5IQ7H 1A6VH 3ML9A 4XAKD 1EXUA 1KIPB 1QEXA 2O5NA 3I2CH 3NIGE 3SCMA 2R9HD 4JVPA 3KYKH 1YSOA 3HHMA 4EE2A 1DN0A 3WAKA 5J11B 4N25A 2OMVB 3WLWC 5ECGA 3A6CH 5F97E 4FNTA 3D51A 1D9KB 1BPLB 2X4UB 2Q86A 3PV6A 3WD5L 4JCMA 4NZRH 4H7VA 1RUQH 3VXMB 4DP5X 2AEPL 4XNYH 2G3MA 3VQ2C 4NXSA 4PHXA 4C54A 5LXGL 2ZPKH 1NBVL 1J9TA 2DKMA 3I85A 3IDUA 1J8HE 5DRZB 3RGVA 4YXKH 3CN1A 4Z7UF 5FKAA 5E95B 3IU4H 1YPZB 4IBZA 4IU3B 4BXVA 5IB3B 1AOHA 2XTJC 4KRPC 1JHKL 4HPOH 1DVUA 3DX7A 1JWSB 3CXDL 3MGOA 4EF3A 3BQUC 4PB9H 3JTTA 3MV9E 2F19H 4X98A 4BQ6A 1UZ6F 1HHJA 3IFLH 4MMYA 1V10A 4WEBH 3H7BA 3EHBB 3K1KC 3BFWA 3KDPB 3O3DA 2H0FA 4TQHA 2ZSWA 4A7TA 5BRZE 4U1LB 4IOSD 1M05B 2WCSA 3ARTA 5ALBH 2Y24A 1MF2H 3IE9A 1XO8A 2HJFB 5FF6A 2RD0A 2EABA 3DETC 1SYVB 1HHHB 4N1HB 2DYSB 1YA5A 4BZ2L 4LK4A 3UDWA 3ARBC 1FFNA 4PGEA 4L1BA 2JCCF 3R8BB 5FLUA 2CDFA 3RI5F 4JDEB 3U36B 3GFUA 5GS0H 2A38A 2P8MB 4K3JL 2D3LA 3US9A 4ZDHB 2HRGA 1J0JA 1MCSA 1TO4A 3CFTA 3DA0A 3C2SA 5EHFA 1T03L 3PXLA 2J73A 4NRZA 2AERT 3MRGB 2BW4A 3L3IB 4OLVL 1V3JA 4K7FB 1PGRB 1MLBA 1MJJB 3QC5X 5DHMC 4ZNCD 4OF6A 3FTYA 1YMMB 2D2CC 3EJSA 3K7UA 3NFSH 1JGEA 3RU8H 1F6AB 1NGPH 1IEBB 2NR6D 4QHKJ 4S10A 5EZLB 4K9EL 4MJIE 4X5RA 1EHLL 1FYTE 2CPUA 1SHSA 5KVDE 4U2YA 3FTGB 4LB8A 2J1KA 3FULA 1ZPUA 4OI7A 2HRLA 1C7TA 4XOEA 1B0RA 1MDAA 3DGCR 4NQXB 4PJCE 1KPVB 3V6FB 4EZKA 5IFHH 4IU2B 3RGHA 4AXWB 3WNNA 4J2QA 2ZWZA 2V9QA 4HUUA 4K8RL 4LLUA 1J5DA 3DV6B 3O11A 5HI3C 3VFTB 4X4YA 3IGUA 4HMCA 3NK4A 3IS1X 3QUZB 3QNXA 1WWBX 5E6YA 4JGUA 4PW9A 1MFNA 4CL7A 1F00I 4F33A 2DD8H 5AG8A 2DI7A 3OKDA 2W9DL 3HNSL 5L2JB 5CIPH 2ZXBA 2YPVA 4JDVB 4QXVA 3JTTB 2K7PA 4APQD 3RX7A 4HS8L 1EDQA 4PFEA 3GHPA 4MD5B 2FHBA 1TJGH 3IDYC 2O6EA 2H2SC 3VXSB 3NA9H 4HCRH 2DL2A 1XGYH 3M07A 2EVHA 4N2AA 1FFOA 4PCTA 2CMRH 3C5SB 5I66B 3GUTB 3C5ZC 4J3UA 3D9AL 3A24A 3V4PH 3VH8A 2X9WA 2AQ2A 3CSGA 3LH2H 4N9GA 2JJUA 5JXED 1T20A 4JMNA 2NY5L 2X6VA 3W0WD 3Q13A 5BUAA 5TF0A 1QBAA 3WDIA 2LU3A 3SDCB 4U1SA 1A5FH 2XPGA 3AROA 2EDMA 3RWFB 2APXA 2GTQA 5KSAB 5GRZA 2ZOKA 1NBCA 4J28A 3LS5L 4PUBL 3DVIA 3L3KB 4YBQD 5GRJL 1DVFA 4Q58C 4UDUA 5HHME 4UBDC 1TPXB 3OJMB 2ORBL 5CCHE 5GISL 1G4RA 4MAZA 4DPRA 4C57C 3B43A 2ETWA 1OM3H 3FB8B 4GQQA 5ADOH 4M1GL 4MDJA 5EH1A 5INDB 4FTVA 4FTVE 4HEPG 2YXMA 4ZOEA 2X2IA 3EJCA 4YHZL 5L7XH 4G8AC 3BE1L 3D06A 3NOIA 2RR3A 5E6UB 3UERA 1NMCB 1CLOH 4FKHA 1CF8L 4ANWA 5IOPA 4Z8FL 4HSCX 4K73A 4YHML 1RZIB 1I8MB 2O61B 3GF8A 2AW2A 3EO9L 1ZDQA 3BGAA 3LDBB 1YNTB 3ECQA 3B9AA 1G6RB 3BRDA 4MNQE 4NQED 1CLZH 4ZQTA 5F1IB 1AE6H 2GJ6B 4UQ9A 4FMVA 1SHWA 3GSRA 1Q38A 1LE9B 3HA0A 4A2GA 1DQJB 1KXQA 1I8IB 1QRKA 2WN2A 3MJ6A 3T3ME 5JO5A 1UD6A 2VYRE 5DFTA 1GOGA 3ZTJG 1Y6MR 3OZ9H 2W07A 3WD5H 1ACYL 2Z8RA 1HI6B 4QOKA 5F3FA 4ERSL 3OKNB 2YQ2A 4ZMVA 5CCGE 2AQRA 3MNZB 2OMZA 4L29B 1U92B 1XIWB 4WHDA 5EUKB 5B21A 3QAZB 4KC3B 5B38G 5CD5D 5CD5C 1XB6A 3TIEA 3VFOB 3WIFB 2QEJA 1F58H 4P2QA 4GUOA 2GEEA 3VX0A 3ZW3A 1G9HA 2YMXL 1AO7A 3V6ZB 1UZ8A 4OKVB 1C16A 3G7TA 1K85A 5CN2A 3QQDA 1UOVA 2IQ9L 4IBWA 4ENEC 4YFLI 3STLB 1IFHL 4I18C 4EJ1C 2VMCA 1UTDA 2XFGB 4I87A 1LO4H 4AYFB 1UYWL 4P46A 3CC1A 2JJSA 3TA3A 5A6IA 3I6GB 2IAMA 2ENPA 3OM3B 1U42A 1UASA 1YO4A 3L4UA 4M6AA 3BWZA 3MLRH 2IH9A 4C8XA 2O1AA 1J0YA 3NIFB 3VACA 3EUUA 3SE9H 2IDFA 4XNXH 3WLBA 1ORSA 2FYYB 4MA3A 1ASOA 1THAA 5IROA 4PMEA 1CYWA 2UZXB 2PYFA 3FF7A 4U2ZA 3ZKNC 4QRQA 2O30A 3KR3H 1CU4L 2YHGA 4CU6A 3FRUA 3DX9A 2EXWC 1WCBB 4HK3N 5FGBA 1IIIA 4ZFQA 4QJ3B 4ONHA 2LLGA 5HYJA 5I1HL 3BRGC 5ABDE 2NX5D 5IB1A 1JTTA 3S8WA 4IBUA 3BMWA 4R83A 4J39A 1KLUA 3LXUX 5I1DB 3QB7C 2V2TA 4GAJH 1CC3A 1A22B 1DSFL 4Q9RL 4S2SA 2Z92A 3IXTA 3QORD 4YFDB 5KANG 4RIRB 1MLCA 1YEEL 3GRGA 5IBUG 2MHAA 2XWBB 4WO4D 4S0SD 3R0NA 1KG0B 3QO1B 4Z7QE 3MCLH 2WJ7A 4LCWA 4UT9L 3EDJA 1UOLA 2X7LB 5DLLA 3MNZA 3D25A 3T0WA 1J9CT 3D3VA 4AW7A 5K59F 5KZCB 1HIMH 1PD1A 2XTJE 1A5FL 4H8VA 4MHHG 4X9GA 2ZWKA 5DJAB 4NGHH 3K4AA 1QRNB 1QSFA 4OJFL 3NH7L 2CKBH 3I9PA 2AKRA 4CILA 5L0QC 3T0AA 4QY8B 4CADB 2Y7MA 4MJ6A 4UINL 1ZIAA 3BJ91 1BGXL 4R7VA 4XHJC 2RA1A 5AVXB 1JYNA 1HSAA 5I75B 3TJEH 3SD2A 3CHPA 2B1OA 4A1RA 4Z3TA 3BJLA 2CIKA 4P99A 3OF6D 2YD9A 3WXWH 4D0DB 3DMMC 3KGTA 4KI1A 5E8OB 4APQC 4HFWA 1NL0H 3DUSA 3E80A 4YHPA 1S7WB 1XZWA 2E7HA 5AVQB 1LYQA 5AW9B 5LAXA 1Y18B 2NY4C 1I3GH 3F7PC 4KZ0A 4X9IA 2WBWB 4L4TD 4MS6A 1FL3A 5KYUB 4KI5F 1OCCB 2VO5A 4MNGA 5TFSH 3RA7L 3PL6B 3QEHA 5HI3D 3I6LD 5E6RB 4OKDA 4IMLA 5BQDA 2Q20A 3O3EB 4FXKA 4XAWL 3DXAA 5B3JE 1W80A 1VCBC 5BS0B 4YC2B 2FUTA 2XPGB 1BZ8A 2YGQA 4GAGH 1NCNA 2OJEA 2VDOH 5LB1A 3QCVL 3U6RB 2YK1H 4XI5D 2B3RA 3CU1A 1ROCA 4PREB 3PWPD 3U82B 4OFYA 4D9RD 4YZFE 3KPSA 4CVZB 3B37A 2F54B 1I75A 4YJZL 3PP3H 3GYRA 5GGRB 6CGTA 4P5RA 1A14L 2CJTA 4A2HA 3VH8B 5D7JC 3G04B 5DHVA 1WIOA 2D4FA 3RX8A 1ZTXH 2KDGA 1TTCA 2NNAB 4KXAA 5J12B 3VYPA 1RJZA 4YSPA 1YAIA 5CM1A 1DQQA 2YA2A 3L9EA 4XCEA 1DQML 5E6ID 2AABL 2VC2L 1N68A 5E2VL 4PG2A 1CGYA 4MA7L 1AC0A 2O6PA 3ECVA 3MLVH 4PYHA 1W72A 1R4XA 2WVVA 4L3AA 3MA9H 1J0KA 3L2LA 3DJTA 2AMUA 2X28A 2BVQA 3FUJA 2PCFB 4AENB 2Y07H 2FX8H 3BUYB 3KLHD 1F6FB 1LO2L 1D5MB 5A2FA 3B2DC 4KZDH 1UWXK 3CFQA 4LQ1A 3LJ3A 4XP4L 5D2LE 2NLJB 1KELL 8PAZA 4RFEA 2F19L 3HPJB 3BRFA 5A6MA 1TJIL 1DCLA 1ADWA 2HKFL 3UIYA 2Y4SA 4PLJC 2MRYA 1EA9C 1A1OA 4KHXH 4PBXA 4CAGA 2WXQA 2XTJD 1Y1UA 2EO7A 4L8SB 3VWKB 4IK6A 4PJGB 4Z78B 4IRJD 1MCPL 1XGTA 3KYMB 5ACLA 2IMMA 4LLMA 4ADJA 2A77H 5MHSD 3IGFA 3L3OC 1G6RH 1BFTA 3EYQC 5KJ7E 2VDNB 2DM3A 1AZBA 3ZQXA 2L7EA 3DRTA 2F8IA 3LRKA 2YZ1A 4MVBC 4C59B 4XCYB 4ZPVA 1KLGA 2HXAA 4RWYH 4MWFA 4L8CB 2OMXB 4LVNB 3D33A 4PS8A 1P7KB 2K8QA 5IIEA 3RVUC 2H41A 3A67H 3HHSB 1SYSA 4FJZA 4GW5B 1AZCA 2J7LA 2P5ED 2ZXGA 1FJ1B 1VZIA 3D39E 4NQEA 2IPTH 3GUFA 1S9VA 4ANUA 5C0BA 2R9HC 2VXQH 3FTXA 4ODSL 1I7ZB 1TTAA 3HG0A 3W1ZA 1U36A 5LAPA 2VAAA 2E9IA 1WQVT 1NC4B 2F6AA 3TBTB 3AW5A 3GZOA 4A6YH 8FABA 3GEWB 4UV4H 1AIFA 1ZRUA 4AZUA 2YO3A 4O5LL 2RMNA 3PAUA 3NFPB 3DVGA 1M05A 1RY7B 3MMEB 2CQVA 2P8PB 1KJVB 2WVTA 2MH4A 1BX2A 4GAYB 3VXQB 1SJEB 4URTB 3H2QA 2EIZA 2A6DB 3SGDH 4NQCA 1QFUH 3LNIA 3H7BB 4K23H 1XGQB 3TVMC 4UCFA 3J07A 5I15H 4J3BA 4M1DH 4OZGE 1H9DA 3IDMB 4PQXA 3LRSB 1AC6A 1LMIA 1ZXKA 2FNWA 3KWTA 5KSBE 4UQ3B 3SDYL 3T2OA 2QGBA 4CUCA 5D7IF 3AACA 4KX9A 4QKXB 5F6HI 2YPVL 2ARJQ 4RRPM 5EU6D 4GBXC 4CMMB 4RGMC 4EI5D 1S9WB 3MU3A 2HTLD 1MJ7H 4TKWA 5DJ8A 5CFHA 1S46A 4YSRA 5KZCD 3RPIA 4GG6A 1P6AB 1T7YA 4Y16D 3SQBA 4PJIA 3GMMB 1F42A 1XX9C 4D2NA 3WFHA 3LMJH 5BS0E 4HD5A 1OT2A 4Y2NA 2YQ3A 3DYMA 2P1YA 4L29A 4O00A 2AQQA 3EO1B 2IJ0C 4FXGA 4OZHE 3SIKA 4AKPA 3ZE1F 5EZIH 1MF2L 4N28A 1VRSA 4IJ3C 5C2BH 3VSUA 3MJGX 3M86A 4LGSB 3KWWA 3ARDC 1T1XA 1DLFH 2AITA 2LU5A 1MCHA 3KPSE 2GT9A 3O6FA 1X5LA 4ZTOH 1E6OL 3HR5A 4WCYH 4OD1L 3GI8H 1S8DB 1AIFB 1NCIA 3C87A 4X7SH 1SMDA 3K8KA 5CHNB 3UO1H 3GRWH 1IRAY 4AYFA 4GO9A 1N64L 4YFEA 3AC0A 2BWDA 3ZR5A 2VSKB 3NESA 3T3PB 4X80H 4Y4HC 4IM8A 2AZAA 3LKRA 1M9WA 4EZJA 1WYJA 1KZYA 1TNNA 1UXWA 1KBKA 2FJHB 1U3HC 1NBVH 3FU3A 5BMFL 1SJEA 3C6LB 2WO2B 4NNPH 1S7UB 4WGVB 3KW8A 1MRFH 4N5ED 3I9GL 1L0YA 4N8VB 1BWMA 2W80C 5IW1B 1WFNA 2UXFA 1ERNA 5D5MF 4FP8H 1RZFH 3BKJH 3GS0A 3M1OA 1ZLEA 5GGTL 3RDJA 3BUQA 3RYMA 5C8JB 5J6GB 3AY4A 3U1PA 5F7MC 1RZKL 3F3HA 4JN2B 3H42L 3PWPB 3IAQA 2Q3AA 1EMTL 4BE6A 1BZEA 3UTPD 2I24N 1TTGA 5C09E 4GW1B 4ODXB 1MCCA 1E90A 3QT2A 4Y1AB 1I1AC 1CQYA 2HX7A 1JRHI 2QQNL 3K46A 3MCKB 3V0WL 2AJ3B 3H9YA 3CK0L 4FEMA 1OTSC 2JQAA 3ARFB 3BUYA 2IO5A 3I3EA 3NIDE 1FE8L 3PHOB 4FFYL 4Z7UA 4AZ8B 3MRCB 1UACH 2APWA 2WCPA 1MPAL 5I73B 3D39B 4PCYA 2LAAA 4LVOC 4KTGA 3EKCA 3STBA 4RNRA 1ZY9A 4WUUB 4GXFA 4XNBA 2BNQA 4LSVH 3RVXD 2HSIA 4HUWA 4QXTA 4P2OD 5IG7A 2NNCA 3US1A 4XMPL 3TPUA 4FMKA 4EZLA 3V0GA 2WWKO 1HCFX 3CFMA 1EEZA 3E1ZA 3WHE0 2ZXWB 2HN7A 5DCCA 5E4AA 1LP9F 1X5ZA 2OZ4L 3TPKA 5D2NB 4P3WA 3AU0A 3AY4C 2HG5B 1D7BA 4JFZH 4L1HA 3D0VA 1S5HA 1C12A 2YN3A 1YN6A 1EEZB 3QYCA 4HIIB 4XWGH 3S5LB 5IHHA 5IV2B 3QULA 1TTFA 2A6JB 2GFBA 2CSPA 1OAZH 2PYEA 1N0XH 3GTNA 1G9MH 2DBLH 3STZA 3WTTA 1NCUA 1QSEA 5B1JC 1RIVH 3RI5K 1G1CA 1ZLVH 1IGIL 2H3KA 3SY0B 4N24A 1PG7H 1OAYH 3QIWB 5FW8A 4N0FA 1WP6A 1T66D 2IOOA 3BHBB 3IFOB 4ICWA 4PJFE 5EF2A 3JWNH 2YUVA 4FG4A 1X9RA 4RGNE 3SPVB 2TRYA 1KB5L 3HE7D 3DUHA 3VB9A 5T1LB 4DT2A 3PABB 4XC3H 1AZRA 4NKIL 5CGTA 1LWRA 5F0PB 4JN1H 4OI8A 5EIVA 4E36A 2QSVA 4G9FA 4Y16A 5C0CD 2G75B 3MJ9H 2GTWB 2WLIA 3VWKD 1PZ5A 2CDFB 3SZKC 3ZZLA 3KPSB 4ZO7A 4CVZA 3A0OA 2HT2D 4OIFA 2OW6A 1MIMH 3P0VH 4KKLC 3UCRA 2CLRB 4M43L 1PFOA 1ZMYA 5D70L 4NKDA 3HS9A 3VSVA 3JYBA 2MCMA 1ZE3C 4J3WA 3V8OA 2AJSL 1PW3A 3WJJC 3ESPA 5LBSH 3BH9B 1NLBL 2PXYC 4HMDA 1BVZA 2V3DA 2B59B 4JKPL 2V5YA 5IJDC 5ISZD 3DK0A 1R3IH 1FIGL 1IUZA 4J3SA 3B7TA 3BDYL 3Q2LA 1KOAA 3PHSA 3CSYB 3HNTL 3OJVC 2FBOJ 2FIKA 2VERN 2VGLM 3CG8A 4Z76A 4AW4A 1TFPA 5DD3L 3EO0B 5EOTA 5KBDA 5JZ7C 2ZIDA 3HFFA 4FQ1H 5F9JA 1T1YB 2IDTA 3RWHB 3THMH 1XCTA 4L5FH 3NCMA 1LO0L 1WBZB 3MREA 4CVWA 3F58H 3FHQA 4NC1E 4A38A 3S4SG 4UILL 3DTDA 3FUDA 3MLRL 2NQCA 3QW9A 2ZT9C 4AQ8A 3QUMH 1QFWI 1TFHA 1FVCA 1QUPA 3CPLA 1FNSH 2FT7A 2JJTC 4A37A 1Y6KR 2PR4L 3BN9D 3T6QC 1AAJA 2H32A 4Y4HA 3WTWA 1USZA 3REVB 2E7LC 4LDOB 1KG0A 3QO1A 4KUZH 1KBGH 1KCRH 2FWOB 3MX0B 5DZJA 4ZXBC 1UZ6E 5HGDA 5IT2H 4FI8A 2X0WA 2JK5B 4QR7A 2KT6A 1QUNA 4KHTH 2BCKB 1M2VB 1MNUL 3CXFA 1THCA 4QRRB 1OM9A 2CDGB 2EKSB 2YQBA 5KVFH 5IW6A 5E1HB 3LEXA 3K2MC 1CYGA 4P5TB 4WEBL 2ZUTA 1BOGB 2X4RA 2H1PH 1CGWA 5HDQH 1UWFA 2WLHA 4G8FB 4JL2A 1CFQA 3TIDB 3ROOB 4P04A 1Z32X 3BVDB 1UATA 3VFPA 3MBEC 2WNKA 4B41A 2HPTA 1RFDH 1XR8B 2YAHA 4AX3A 2Y9RT 2J57A 3KLSA 1VKXA 3NZ8B 4J3OF 1X7SA 1AD9A 1ZWIB 2O72A 4AITA 1IQWL 4H2AA 1A6ZB 4HLZG 2V4LA 3FU6A 3SDYH 1NKOA 1AG0A 4L5FL 3II1A 3SYOA 4WWKA 1L6PA 1UJ3A 2AMGA 4ETQA 3BZFA 1E4XH 4O4YH 3H9HA 2P24A 4PRIA 2XY1A 5GGSB 4ZFOL 4D0CA 1HL5A 3ARFD 4LXFA 1VACB 4P0DA 3RPIB 4GG6B 4FQHB 1YY8B 5I15L 5FYJH 4FI6A 2AV7A 3C6LD 3OG6B 1XL6A 4R7LA 4X4KA 5JQ6L 3ERXA 4HOXA 4KY2A 3WS3B 2FIKB 4X6DE 4LSQL 1OPGL 3GBDA 3UBXG 3TWCH 3VG9C 4OM1H 1U92A 5AOLA 4R26H 3MBED 2PP8A 2W91A 1RHHB 5F88A 4HS6B 1U3YA 4K71C 5AVTB 4HJ0C 1FA4A 3IS0X 5FAAA 1QG3A 2F18A 4LARH 4AGPA 1EUUA 3IJSB 4TUUA 3KPRE 2N56A 3ZHFA 5IJVB 1FNGB 4I5BA 1GJUA 5EUKA 3WAJA 2PO6A 4JQXA 2EUZA 4LSSL 4F7TA 1U9KA 1QSFE 5KVFE 1AGDA 1J5IA 4PJBA 2UVEA 3PUCA 2OW7A 4CRPA 4PJ7A 3RUGE 4ZXBD 3D4GA 1VACA 2WKOF 3N0AA 3P9WB 4U1IA 5E9AA 2N1TE 2ADJB 5J6HB 6TAAA 4PM1A 2R2BB 1TENA 5ENWB 4HULB 3R8QA 5D1XB 1YEJL 3WE1A 1OAUL 3R06B 3GXIA 1XR9B 3IDGA 3B9KB 2P49B 1XSIA 1DQTA 4UM8A 3SOTA 1KIQB 3Q05A 4AIOA 5TGBA 1AQDB 5D2NE 2NY0D 1XF4A 3WY1A 4B7LA 5HGHB 1R47A 2H2PC 3D7PA 2YLKA 2WVUA 4LE8A 2RIKA 3GIVB 4PJGF 4XZUA 3FT4A 3SDXA 4DKEH 2VW7A 3VXUA 1EV2E 2FJUB 2C3WA 4GIOA 1EK3A 3R1GL 1MEXL 5PAZA 4UNIA 4M5YL 1M7XA 5E1QA 5MHSE 3FOMB 4J4PD 2ENYA 3VU2A 3FZUC 4JG9A 1QKZH 4TLSA 4ZSOA 3NN8B 4OZHA 1JFQH 4U6TA 5CGBA 3FCTB 4YHLH 4HLEA 2FR4A 1NCGA 1HILA 2ADFL 4FQLL 5MEQB 4QXUH 3L3KA 3CZFB 1TMQA 2HLEB 4RFNC 3RZCC 1E7VA 1MHEA 5EOCJ 4RX4D 4ONFH 4DHLA 1SFDA 4AOFA 3JQOB 3F01A 3KEHA 1RZGA 3NCXA 2GUYA 1ETJA 2VLJB 1ZE3H 3IXAA 4WFGD 1WFUA 3RAJH 3MXVL 5M94B 4PGBA 4UAOC 7FABL 5I1AB 3E8UL 3CZEA 4FFYH 3IDXH 4FHJA 4U1HB 2ZSVB 4CC0A 1HQRA 4ANXA 4XNAA 5JW3H 5HPMB 2LFEA 4GSRA 3P2BA 2A9NL 1Q0XL 2NNAA 4UAOB 4DUVA 3US0A 3O6LH 2XBDA 2CNYA 2KL6A 2PPEA 1OARH 3CHXA 4HK0B 5E4EB 5F7DB 4HK3J 1OGSA 3GRWL 4M00A 3BXNA 4BQ9A 2GJ6D 5I1JL 1JGDB 5DJXB 5C9JB 1NCAH 4WY7L 7PCYA 3DIFB 1ZHBB 1KCLA 1EBAA 5T33H 4P2RD 2B4CH 4E5XG 1U6AL 1RIHL 3CGTA 2VLKB 4QT5B 4E9QA 3ILEA 1KYOK 2I5YH 5ISZB 4EN2A 3DV6A 3E1F1 4UT9A 1KBGL 4HISA 4TTGA 4PJDE 3TBWB 4R97B 1N3NB 4KROC 1JWUB 5I8CB 2VSCA 4B3VA 3BQUA 3ZE1B 4BGDA 3G9VA 2JMRA 3AAZB 4L37A 2WPGA 4YZFF 4DW2H 2EAEA 4N68A 2W88A 1PEZA 1CB4A 2DMBA 2Y6TE 4I77L 4BSVA 1RQ5A 1IAOA 4WEUD 5SV3A 1T0OA 4K15A 1NAMH 4KTEH 5IK3B 4K94L 4RDBA 1NFDA 2ZCZA 1KTLA 4IBSA 4RDQF 5IEKB 4YSAA 1BYPA 2OMWB 2FWSA 3IPEA 3QJHB 1OB1A 3SPVA 2GIXA 3WSQL 3CQFA 1AQKH 2DW5A 3SKOA 2QVIA 1HCVA 4G6KH 1IGJA 2Z8WC 3M6DA 2BNRE 3TNMA 3QI9B 5EO9B 3HN3A 1FSKC 4EEEA 2HT3D 3GKWL 3SGJC 3HZKA 1S9YB 4JCWA 4ZUVA 3OC8A 2IAMD 1FAIL 4QXWA 4N6RA 5KJRL 2I9TB 5IBLC 2COQA 5IVXF 1F56A 1ROWA 3PV6B 1X5JA 2YWZA 4L3CB 3B2UC 5GRWA 5T1KA 3RJDA 3QG6B 5DJAA 4ADGA 4X4ZA 2IAAC 1I8KB 1QAWA 2WQXA 1E4WH 3Q6FA 3D12B 3WUWG 5D1XE 4GXVL 5D1XA 5D70H 2HFEB 2YGPA 5KBMA 4X98B 3EYVB 1KBPA 3RVTC 4C56B 2Z6FA 1HE8A 4F7PA 3L5WA 5HJ3A 4IU3A 5IB3A 4PJ8B 4TS6A 4LKXB 4X50A 5LBSA 3KYAA 1NEZA 4YSUA 3WFDL 1S7RA 1A14H 4D9QD 1EJ8A 3DC0A 3LD8B 4QRFA 5HHXH 4TXVB 1ZDSA 2CM6A 3HMXA 2NSXA 1WEJH 4JFFE 1MW0A 2NX5E 4UTCA 2CBPA 3LRSA 1NAML 4HSAC 4LRIC 4MZ2A 4Z3FA 1NKRA 5BMFH 5JXEA 1A6TA 1JZEA 3TONA 5J4MA 1JPFA 3OXSB 4YHYB 3FCSA 3J8F7 1JZJA 4HIQA 2VDOB 3VM5A 5LGHL 4N87A 5DI8A 4P5TD 5F70A 1FZMB 3QIBB 2F61A 4AQEA 5C3LD 3DXAE 1BZQK 3PDOB 1AQDA 2HB0A 5GS3A 2WLKA 4PJ5D 4R84A 4UT6H 2HJKA 5DGRA 5E08L 4YZWA 1NMBH 3O45A 3ZE2B 2Y7NA 4FLOA 2B9AA 3L8QA 1ZLWH 5DWPA 3NCEB 3WS6C 5JORB 1QO3A 5EZOL 3ARDD 2CHNA 1GS8A 4Q6YA 5B38B 1IBBA 1TT6A 2JI3A 1OOWA 1PZBA 3D69A 3AB0C 1KBBA 1FVDB 2FZ3B 3CFKA 3OKEA 4FMFA 4JPVH 1RUKH 1QA9A 2W65A 3CDYA 1E9QA 3BVNA 2R2EA 3B2XA 4AMWA 1RUAL 2QHRH 5I0YA 4WTQA 4FCAA 4KDVA 3EOBB 4MJIA 1H6EA 4P5TC 1P7KA 1NFAA 5EBGA 3HZYA 3CNKA 1P5VA 4FL4B 4J12A 5ANMB 2FWUA 2DEXX 3UEZA 2F5BL 1K9TA 4Q7DA 4NO2A 2CNZA 3VWJB 4ENZA 4ZODA 9CGTA 2J4WH 4GBXD 2HH0H 3HAEH 4LBAA 3HI6L 1NCJA 3HZVB 1JK8A 4FQHA 5F96L 3VFMB 1IBYA 3C6SA 3RRQA 3LKNB 2XC8A 3ME0A 2ZCLL 5F9OH 5CEZE 2R1YA 3G08B 1VFAB 1I3RA 3DRQA 2YQGA 1D5RA 2BSSB 5DRWB 1UC6A 3RVTD 4M93B 2DTSA 4P4RB 1FYTA 1FG2A 4R5VA 1U8QB 1R34A 4MB1A 5C09A 2CO6B 3QS2A 2VXUH 4F93B 2A4ZA 3OBAA 4OQTL 2Y72A 3S3PA 2DYPB 4A7UA 1KLFB 1NGZA 4NLAA 5AW6B 5LGKA 3D4YA 1B0IA 1D2PA 3C2AH 3H9HB 4R5XA 1KTJA 4PU2A 4R5TA 4XWOD 2GEQA 2AJXL 1IKFL 3F8UB 2Q3ZA 3JV5A 1M7DB 1NCBL 3HI5H 3BAWA 3AVEA 1OGAA 2MTAA 1WBXA 2WXLA 3FQWB 5H8DA 1M71A 4NAQA 1LNUB 4AEHL 3BVTA 2QQLH 4U7KA 3V0EA 2ZKMX 4FG6D 2EKSA 3RVUD 4P57B 1YMHB 4PRPB 5CZXD 1IGFH 5FUOH 4KGLA 3W2DL 4MVBD 2AEWA 4PHZA 1GC1H 3NPSC 5J1TC 1DVFB 4JKWA 3ROOA 4X6BB 1ZSDA 1XEUA 4XC3L 4F15C 4P2RB 5BPPA 3SDCA 1J5CA 3FS9A 1WFTA 1IGTB 4MB3A 2FH8A 2R0LH 4HWBH 3VW3L 2MJWA 5D1QE 2J6EH 4OZIF 2K45A 4H13C 1KGWA 3WXVH 3VD4A 4NQXA 4E41E 1TUPA 1ULVA 1EHLH 2Y2YA 3C5JB 4BH8B 3QWOA 4ATTA 5TDNA 2AEQL 2QMJA 2H0JA 2Y7LA 3QJQB 4IW4C 4PR5B 3UJTH 3TBWA 4F15B 2NT0A 5F89A 3RWJB 2PWGA 3E6FB 3HE6A 3KLHC 4PWIA 1M57B 1TZHA 3K5RA 4P46C 3VTTA 4KDTA 4D8OA 1JD7A 5LAXB 5SX5H 4IGBA 3T1WA 3KBHE 3D2UD 4QXUL 4XN4A 1EHNA 5C0DA 4ESKA 2B59A 2V33A 4HIXH 4U3HA 1I1CA 2RFXA 4WNQB 4PIBA 3SKJL 3P9LB 3T09A 1TSRA 2ZP9A 4HBCH 4I2XE 4JQIH 2G60L 1XH3A 2V2XA 3WJMA 2ICEA 3IXAB 2EADA 4ZUTA 1L9OA 4LSRL 4ZMYA 1GC1L 3QPQD 2WQAA 3WTUA 1QZ1A 1KYFA 1V8HA 4MCYA 4RDQG 1D6VL 4DH2A 3TEYA 4W6YB 2AKRB 1XGRB 2LU4A 1B0WA 3MV11 4XI5C 3UEQA 3QZBA 5JHLL 2GTZB 3TFKC 4MCYB 5EUOE 1O9ZA 1K5NB 1N0LB 4LIQH 2VXSH 5JQHC 2GJJA 5IV2A 1KPUB 1YEHL 2XXMB 4WI6A 5F7DA 5I73C 1A9VA 2CE6A 1JGEB 2PW2A 3KPLB 3FZUD 2WINB 1KXQE 1KGUA 2X88A 1DLHB 1IQDA 2H1XA 3HUJE 4J4PC 1KEGH 1Q4NX 5IJKA 1UD2A 1ZHLB 2CU9A 4JGNA 2ZCHH 4BZ2H 2AEPH 4YSEA 2BSDA 5LN8A 1HXKA 4FNSA 4NKMA 4YHNB 1J9QA 3TF7C 3SDXE 2CHWA 5DJ0B 1J5OH 1CGVA 2NY4D 3HMWH 1HJBC 5FWRA 3KWUA 2G5UA 3RDTA 4WWNA 2H2PD 1F90H 4GRLA 3RLSA 4NOFA 3QDGE 4PN6A 3FRUB 4HUXA 3BOVA 4KX8A 5CGYC 3T4YA 1K8IA 1WZLA 3CXDH 5DTFB 1OP5K 1RUML 3QDMB 5EOCH 1SYVA 1AHWC 4NC1C 3AB0B 2DWEA 3KXFB 1GW6A 3ISWA 3POHA 4G42A 4QRRE 4BH7A 1VZGA 5F0MB 2LTQC 3GBEA 3GJFA 4JFUA 3DIVA 4F27A 1DQDL 2HTKC 3OR6A 1JZ8A 2A9ML 5INCB 4FA6A 3DOSB 4XHJD 4F1SA 3ZK0A 3ZDZE 2UZPA 1FO0A 5AKSA 4L1LA 1IM9D 1TKWB 5HDBF 1NLDH 3HNSH 2PTTA 1F4WL 3GI8L 1N7ML 3BGMB 3SGEI 3FO9B 3FB7B 4QRPB 3UO8B 4FAAB 1M6OB 3N85L 3OKOB 1NAMA 4P9MH 2Z0BA 2GBAA 4PJ7B 2BS71 5MERA 1KYAA 2BIQA 3BAEH 1G9NH 3C6EA 3LHPH 3D18A 5K93A 4QXTB 4YX2H 3LD8C 3OKYA 1KEGL 1JK9B 5HYFA 4GXVH 5ETUB 1AYRA 4XCFH 5HY9A 4JO4H 5ANHA 4WNSA 3WIIH 3MRDB 4HZLA 4LLQA 3VCLA 2BFVH 2TRHA 4PI2A 1T7XA 3BP5B 2FAUA 4ZFZA 2JKIS 5KJRH 4ZUUB 1XH1A 2V8LA 1CL7I 4WFHD 5CJ5A 1G7QB 4J2XA 2ITCA 2J2ZA 5D6CB 5I6PA 2DLTA 4LCWE 5E9DB 3UTZB 3SDAB 2X3CA 4DEPB 5L6YL 3T71A 1FYTB 3MVSA 2EVIA 2XWJB 3MJ9L 1S4IA 1VPOH 1ZS8A 4I1PA 2R0WH 1T7VA 4A63A 5IW1A 3ZO9A 4JZJB 3V6OE 5B7EA 1SEBB 1CFNB 1I8UA 1PLGL 2EYSA 3OAZH 1BD2B 2XZAH 4XX1G 4FFYA 1WG3A 2XKUA 2GHWB 1OALA 1T21A 3NSXA 2V2WB 5ESAB 5SWQB 1BBJB 5HVHC 2W95A 5DD6A 5JDSA 3L5JA 4GI6A 1QTSA 5D7LD 5ICUA 3N1QC 1F4HA 1JS4A 1ZS2A 2VRQA 3ESUF 4ENED 4R90L 4LCUB 1H6FA 5FDYA 5CUSH 3SGKA 2VZ3A 4LDCA 1IB5A 3D3VE 2Z65C 2YAPA 4FYRA 4XCCL 1CQKA 2BCKA 1TQSA 4NO0B 4Y5YA 2D4DA 4UUJB 1KNOA 2J72A 4ZRGA 4AV5A 2CK0H 1SLWA 4KI5D 2NX5A 2Z4QB 4U6HA 3R7RA 3UZQA 2ALWA 3O6ML 5BV7H 4DO4A 2CHXA 3EJYC 1QNIA 2GC7C 3AREB 2IANA 2AJYL 4OCNC 3QIUD 1RERA 4S1RH 3O45B 1EZSA 1AR2A 2EDTA 1OK0A 5ESVA 5AVZB 2MPAL 3KWWB 4ZTPL 4LRNH 1NAKH 3IWUA 1ITCA 3TA4D 4U3SB 4IOIB 1Z3GL 1PBYA 4Z5RA 4O58L 1LK3L 4OZIA 1D2OA 1L4IA 5FO8B 1RH8A 4N2LA 2WQVA 4PRNA 3U4AA 4HF5L 4MTMA 2DKSA 5IF0A 3M8OH 3DTXB 1MCKA 1R5VB 3LKQB 3MV8B 5J06A 1P4LB 2QELA 1UM4L 4Y7OC 2L7JA 5EEXA 1NINA 2V7HB 3FB6A 3I2CL 4U1KB 5EU4B 1EJFA 3HAEA 4WJKB 3SGKC 2EDYA 3D85D 4U6XA 2OMXA 3ARGC 4LP8A 2V5RA 2XQBH 3RJOA 1IC4L 5T3ZH 3QWQB 4Z76B 5I17B 4YDLB 3F62A 4H0LC 1W0VB 3UC0L 3SJVA 2ZX8A 4XAWH 4DTGL 3IDMA 1U8IA 1A1MB 5EU7E 2FX9H 1GR7A 2V0AA 1YDPB 5DD1L 3UBFA 1AS6A 3BW9B 3FRPB 5H94B 2VAAB 2VRAA 1QLEH 5JHLH 3IJ9A 4Z7OF 1FH5L 1FNAA 2E59A 2VLKA 3FMGH 4QT5A 3D2UB 4MA8L 5JHAA 4BQBA 2QSCL 3CVHL 3T0EB 2WWNA 5EFIA 3ZRFC 4F3FA 3MROA 4WHCA 3H1ZA 2X4TA 4V2CB 3VGBA 3DPBB 3MLPA 1P7QB 3BUDA 3DSFL 3TO2A 1Z3GH 2CKBA 1VGEL 1W6LA 1Z2KA 2YK1L 3BPLB 4PS3A 5J12C 4H1LG 1S9VB 2YD3A 4K7FA 4NDMA 2XA8H 5IBUB 2H2SD 4QPEA 4FG0A 4D3CL 1T66C 2P8LA 2LQRA 2QSQA 4HS8H 3MNVB 3BP5A 3SKNA 3Q3GA 5HPMA 1T4WA 1AH1A 5TDOB 4YXHL 3JUYA 4ZDHA 2Q8BH 4AUYA 1AMYA 4LFHG 3V6OC 3BWAA 4G82A 1WWAX 3AT9A 1SY6A 4H8UA 3HCVA 3U7AA 5I5JA 3O41A 4ZQKB 1WCQA 1WWCA 4X7FC 1A7QL 4LHQB 3PPSA 1Y07A 5L4IA 2I7OA 3C8KB 2VXVL 4FLHA 43CAA 2OMBA 1RZ8B 1WBYA 5FYKU 5BO0D 3NA4A 1A25A 4QRUB 2VDML 5IVXE 5HSFA 2ZYHA 1A6UL 4G7QB 4WI2A 3WIHA 4HWEH 2CRMA 1MJ8H 4UM9B 4QRAA 3F7KA 3B2MA 3U25A 4DZ8B 3CSFA 1FAKT 3T65A 2GYSA 2VC2B 1IBHA 1KGCE 3EBIA 1S7QA 2PPAA 4B0MB 1X7QB 3FU7A 5H2BA 4P59H 2AHIA 5HVWA 5I6OA 4AG4L 1KCSH 1JYVA 1L3WA 1V5JA 4P2OC 3C8DA 3K5SA 4OUUA 3UPCA 2A6KA 3HKFA 1RK7A 3VYOA 2X70B 1V3MA 1G7LA 2XV2A 3MACH 4XBGA 1PY0A 2H3NA 4JFED 1E6OH 2XLLA 4L4JA 5KWYC 4PJXA 1HU8A 3RVVD 5JW4N 3FU5A 3RU8L 3LKOB 3HCVB 3KYOA 3EBHA 6PCYA 4MJHA 1QSEB 4OF3A 3VXMA 5C0BE 4EXPX 2CGZA 5T1KD 2XZQL 3HRZB 4RAVA 4HKZA 2AJZB 2ENJA 1RUPH 2APFA 1FCGA 1KENL 5BUGA 4QTIH 1FUNA 3PQYD 4XX5A 4XO3A 2DQIL 4GSQA 4NQVA 3NJNA 4K3GA 2F54E 4M48L 5BRQA 1YZZA 3WNMA 1XEDA 3S96A 4IHOB 2YA1A 3CMOL 1FAIH 1JGIA 4A2LA 4M7LT 2R4RL 3RPKA 3C8KA 3HZ3A 43CAB 1GJWA 2E7CA 4CVXA 4HMEA 4P2OB 1U8JA 3OLDA 4UIKH 2DQ6A 5J3HD 1DFBL 2XIBA 1ZTXL 5HHQA 1HN1A 1KJ3H 4LPYA 1HXMB 4KUCD 1B0RB 2FT6A 5DUBB 3SDDC 2HJLA 1XF5B 4N5EC 1G9MC 1FNEA 3SQOL 3H0TA 4GS7B 4NC0B 3BQUD 4HZ1A 4AG4H 5F7AA 3TH2T 5C8JA 2A9MH 3RWDB 4KRPD 4FFZA 2EYRA 3GSXA 5C0CA 4R2GB 1FL5A 1H3PH 2CIKB 4NO0D 1MIEH 4ZTEA 4JNXA 4W9EC 2Y7QB 4HLZH 5CO1A 3WMQA 5E00B 1BHGA 3MRJA 2J6WA 5J9PB 1URLA 3EFFA 1QQDA 4GY4A 3IMUA 2C1OB 3CQQA 4Y1AA 5FUCE 5LVEA 1OHQA 1N2RB 2HAZA 3RB7A 1DUZA 3ETBJ 5MEND 1NCTA 1P9MA 3CFNA 3T0DA 3D2UA 4N0YL 2WUBH 2YOAA 3GJFH 1JGUL 4WWPA 4AMKH 3DWTA 3WLWD 1XB3A 1KZQA 3Q1SH 3BPLC 2VM3A 1K6QL 3P73B 4OZIB 5T1LD 2AI0H 3APMA 2DI8A 2DWDA 4F7TB 4UF7C 3QFDA 3S2AA 4YH6A 3O6FB 3WGVB 2XWEA 5D7KE 2CWRA 1P84K 5DDHB 4D3CH 1XIWD 3JV6B 2C3HA 2Q76A 5BJTA 3FXIC 3RNQB 1K4DA 1MH5A 3HG2A 3W0WB 2P7TB 2UVFA 4Y16C 4MX7A 3AREA 3ASOB 1DDHB 1T6WA 1YNLH 1BIHA 1LK2A 5CJOH 4D0BB 5HHNA 2HTLC 1CFBA 1A3QA 2PXYB 4PVNA 5A6LA 1KY6A 5A16B 2R23B 4B5ZA 1WA1X 1BREA 3MV9B 2BOLA 1DDHA 5TQ0L 4LCIL 4G8GD 1KBWA 5KG9A 4YDLC 4MJ5B 3IFNH 3GSVA 2XVKA 4KVNL 3IVKA 1BA9A 2FO4B 2PO6C 4JQXC 3HVNA 4M56A 3T2LA 1UCBH 3WLBB 3VXQA 5GS2D 4R7NB 5AVRB 4BKTC 2ZYSA 4UQAA 3HTLX 1NDMB 1A0QH 3EF7A 1J12A 5AVWB 2WY3B 1MZZA 3IMWA 3LDBC 3TCLA 5EZPA 2XPZA 1IVTA 1J1OL 3SBWC 3RY4A 2EZ0D 3X1NA 4F9LA 1OZTG 1OAKH 1WDAA 3MLUL 3AITA 1R5IA 4KUCF 4OCSL 1FN4A 2E7MA 4TV3A 3R7QA 5JW4M 1T21B 4G7VL 3CUPA 2A7BA 3FDWA 4N2OA 2YGOA 1VKXB 1AMXA 5KSVA 4TSBL 1J05B 4XN1A 2J5WA 3CLEL 2Y06L 5TF1L 1M1XA 4BA8A 4F2EA 1RZKH 3QIUB 3PP4L 3SE3A 1JNNL 5I8OH 1LO3H 3I9IA 5FGRA 2QV4A 1BZDA 4FNRA 3L4YA 5A16A 3H3KA 4F8LA 5HJBA 5GRYA 2VH5H 3AREC 1WGVA 5C0BB 3S36X 4MCMA 3FO1B 3MRIB 3UJIL 3ASWA 4FXKC 4ZG1A 1YNLL 5AAMA 3VI4B 1C8PA 4BFKA 2E7LA 3RB5A 3EYQD 3QUYD 4LEXL 4YDMA 2IPKA 4MYPA 2KHAA 3ZKSD 3NJLA 5IIEB 1PKOA 2EDJA 4HZLB 4LLQB 1PQZA 1E5UI 3GSUB 3G5ZB 5D96B 2CO3A 1RLWA 2VB5A 3K72A 5HPOA 4DGIH 4PLJD 4WFED 3V9FA 3O9WD 4PS7A 4JO3H 2CJSA 3FO2A 4YL9A 2C3XA 3SPJA 4ALAL 3PQYA 3ZTNL 3OAYH 2EEAA 4JUSA 1XBRA 2B9BA 5FYJD 1LO3L 2FSEB 1YJDH 4R8WH 4NHUB 4JUTA 4JZJA 3JWOC 4C4KO 2VZSA 2VLRA 2HKHH 3G6AA 2BFGA 2XIIA 4QJ4B 5IMMB 4ELME 1GGUA 5KVGL 1DJIA 4QUOA 4GEIA 1TSHA 5DEFB 2BDNL 1E2VA 4GPVA 1FCCA 3FN0L 3IJ8A 4X8JB 1FL5B 2P80D 1JFQL 1P6WA 4MS8C 3QYMA 4URKA 5DI8B 2IPUG 2IIJA 5E6IC 1G7LB 1O6SB 1ZIBA 4Z78A 1PLGH 1QYGH 5FHAH 3FT2A 4LLVB 2YXVA 1I9RL 4M8VA 1KIRB 4R96A 3ULUC 4K7PX 5DVKA 5DC2A 4F7CA 5SWZE 2I07B 4OZGA 5D7JD 2WQSA 4NGHL 3QUMA 4DIXA 4ACPA 1IAIM 4PG9B 4N9GB 2W0FA 5FYKH 2IH3B 4LASL 4C56D 3QSKB 4ETYA 5J13B 4PV9A 2HG5A 2WIMA 3QNZB 3DV4B 3QXDA 1CCZA 1WUNT 4I3RH 4NWUL 2AXJA 2IH3A 4UYQA 1NFKA 5F6HJ 4UOJA 5DUPH 2NXZD 1FDLH 4TNVF 1O0VA 1UFGA 4OGXH 5F44A 1MFAL 5FYKD 5GGVL 4Z95H 5T1KB 2EE9A 3PUUA 3ZYJA 1ND0A 2OSLA 4AWJC 3CZLA 4JFQB 5IMOB 4XCEB 4YNYA 2JTYA 4JKNA 1IO4C 3D1MC 1MQKH 1A3RL 1ZHNB 5JR1L 3S5LG 4R0LC 4U4BA 2Y5QA 3ATBA 3O0RL 5FW6A 1GAFL 3EBAA 3LXBA 3ARBB 5ID0A 3DMMD 1WISA 3KLKA 1J8RA 3QDJE 3BWAB 5H2BB 4FF9A 3ZDYB 4JJ5B 4JRLA 5F72S 4JHAH 3ES6B 4QD2E 5FOBB 3TWCL 1KTLB 4C55A 3GJEA 2YIHA 3VSTA 5FDWB 5JPNC 3U4EA 3SKMA 4G43A 2X2YA 1G7IB 2JKTM 1LDPL 4EXKA 2BRRH 2EVFA 3AWFA 3B1UA 5DSCA 4NJAL 4UTAA 3PWPA 5AKRA 4MMZA 3RKDC 2WXHA 4N8CL 4HKBB 3QORA 2MCPL 4KNQA 1JWUA 5I8CA 1PEWA 2EIMB 2XTJB 1UT1A 2IGFH 4V1DB 5F0LB 5H37G 5A7BA 3VXSE 4NI6A 4ZAKA 2HJFA 5BZZA 1F6AA 4Y4KB 1ZHKB 3GXPA 4GJTB 4RNRB 5ALCL 5I76B 2FE0A 2OMTB 4XPHL 1OAQH 4WO4C 3W9EA 4JE4B 3PAZA 2WYIA 3Q5TA 2VXTH 4KUZL 3GS7A 1NGYB 3PHOA 4Z7UB 5GGQL 5I18L 4Q4EA 5E2WH 5JOPE 1U8MB 1UT2A 3HC4L 3UIZA 5JIDA 1IGTA 4S1SH 4MA7H 2DWSA 2DLGA 1INDL 3SBWA 1JE6A 2A9DA 3ATAA 3KLAA 5HI5C 1NFIA 1U21A 1AXSA 4QTIL 3L3IA 4XOCA 3A6BH 2EXWD 1DBKL 3MJWA 4YK4B 3NZHL 4DN4L 3O6FD 5D4HA 5CSZA 5AZ2L 3ZKND 2ZAHA 3QWOB 1A7NL 4YNYB 3SE3C 3QXUA 2JKLA 1OTTD 2KH2B 2GCYB 4RZCB 2IGFL 4RSVA 4DPBX 1W72L 4LESA 1JF1A 1CXEA 3RTQA 4KY1L 3O2DA 3T77B 4PD4K 2Z1KA 4I3SL 1R1CA 1E30A 5AB1A 1JGVL 5J6GA 3OGCA 4OT1H 3KGSA 1N5AB 4IKNA 2Z35B 2BRRL 4P46B 2JCCB 4BH8A 4NBXB 3NJXA 4IOIA 2W1NA 4YHLL 5T3ZE 4IJTA 4J8QA 4ILDA 4XNZC 4AQ1A 1MFEH 1NBYB 1FNFA 3ASNB 2DIEA 4J6RH 1PIGA 1IGML 1LGVA 3EH5B 3JYCA 2FLMA 4OSUH 1MREL 4FNUA 5E5LA 3IRCA 3DTXA 4EO5A 2ROXA 3PJSB 4HIJA 4OLYH 3NACL 5C2UB 3MYJB 4PVMA 3U46B 2EDXA 4X8XA 2G2RB 1BVLA 5KYWA 4G7RB 1JNLH 4HJJH 4YLCA 1I7RA 1NEUA 2VUYA 5FM8A 4EN3D 2BHYA 2QSTA 4U6VL 3V9EA 4NKOA 5MEPB 2F8XC 2XFXA 1NCDH 5C07B 4PB9L 5K9OA 4NKIH 4JO3L 4Y5XA 1K2DB 3VW3H 2C8NA 3WIHH 4WZ9A 3C9NA 3SPHA 5IB5A 5I2IB 1GY1A 2CLZB 2DQJH 3MAWA 4FNQA 3EH3B 2EUXA 1F45A 1XWVA 3VXMD 1GYWA 3RG1C 3HIZA 3QJTB 5HGBA 2FSEA 1OE2A 2DOCA 4I3SH 4LHUD 1SY6H 3JVGC 4JFPA 1GAFH 4AH2A 3JWDH 1WPCA 3NCYS 4M5TA 4ZXBA 2B1HH 2BVUA 2X6UA 2JF1A 4LCYB 3VFUB 2RALA 4B5EA 4HKJB 3TEXA 4CJ1A 2J1YA 3MUGA 4JREB 2J2ZB 3NIFE 5TPWH 4MKMA 3FB8A 3KNBA 2Q8BL 1RMFL 5CLTA 4BK5A 3QCTH 2Z8SA 5IOPB 3QRFM 2EINB 2R69A 3KPQA 1B3IA 5AKVA 5A3ID 5T1DH 1S7VA 2A73B 3IEAA 2RH0A 1T83C 2AVFA 4XVJL 2EIDA 1G7JB 3HLAB 3BAXA 4YBQC 5ACZB 3ULVE 5FO9A 3CHOA 3AS1A 4YN3A 3QZLA 4KJWC 1E7UA 3GMLA 3FFDA 2E0PA 3FN3A 4R3SB 3OKLA 1M1XB 5CP3H 1G6VK 3GO1H 5JXEC 3PL6C 1F18A 4EIGB 2Z7YA 3PG2A 2BSRB 4WWKC 3CUPB 3NTCH 3TP4A 1DBBL 1UM5H 2A6IB 3KL0A 4QHPA 4BK4A 2YR3A 3HG3A 1UOWA 3O8XD 4OZFB 4PTTA 5SX4I 1QBMH 2EE2A 3QG6A 3UJJH 4KRNA 4X80L 3PIQA 1ED3A 1MFUA 3BEWA 4CDHA 3QQ9D 5AL0A 1AGBB 4AIZB 2EDFA 5B39A 3QQXA 5CR1A 2B3IA 2DWEB 3KXFA 2H3NB 4JANB 5CZRA 3RNKB 1E9PB 3IF1A 4I1RA 3L1GA 3QIBC 4YBHA 4ES9A 3FO9A 1E9OA 5T8IA 5M7QA 3CN0A 1YN7A 1UG9A 4HWUA 4QRTB 4XP4H 1OQXA 3QUZA 3NP3A 4FP8L 4C56A 3U9UA 4BHUI 5EUOF 2HUHA 4WW2B 2W9LA 1EO5A 4F7MA 4APXB 4MHHI 1RULL 3BEVB 3F85A 2FB4L 3WEAA 4YDKH 4L0ZA 5J1AB 5JHDB 3DXAD 3MLUH 4HV8A 2DM4A 1MCPH 1RSFA 1YEJH 2P47B 4GI9A 4M4RB 4XODA 2I69A 4QHLB 1BECA 2D31B 3X14B 3T5WA 3AQDA 5AUMA 1M4KA 4PJ8C 1ZGLM 1KFAL 4LLUB 4V1DA 4GFXA 1XSJA 4GRWH 2BC4B 3P4NA 3WFBL 3HMXH 1ZLUK 1C5BH 2XA3A 4GO6B 1C5CH 2OM5A 1N26A 5C1MB 2NR6C 3UBXI 5JHBA 5DSCB 4PBWD 4JKKA 4UTBA 4GT0A 2X4QB 2YA0A 2H45A 3V7MA 3HNTH 4WU7A 3GLAA 4LNVA 3TZVA 4TNVK 1BZ7B 2IEPA 3F83A 1GMIA 3VD3A 3TO4A 2Y06H 5TF1H 1JZIA 1IX2A 3GBNH 4K4KA 1YCSA 3QCVH 3U7WL 4HIEB 4JW3A 1YEHH 3VXTA 1L0XA 3HNVH 3WYRA 4EDWH 2MTPA 1Q9KA 3ARBD 1HOEA 4F24A 3KPRB 2NUPA 5BRPA 2B5IB 3BLBA 4P2AA 4L5FE 5EB9A 1JGVH 6PAZA 5DQ9B 1CL7L 3IGLA 2JLLA 2WQUA 1MXGA 2ZSWB 1QSFB 2AJVL 1HS6A 4YBLC 1CN4A 4X6EB 2IQAB 3WE6A 4DZBA 1S7TA 2X53A 5FK9B 5CJBA 1ZLSH 1EHAA 1WICA 2N0MA 3DOIA 4ZS7L 3LQAC 3QEQD 4NZUH 3QQNA 4UIKL 4B53A 4K0OA 3CFDB 5D7LA 5EBLB 4LSPL 1SN2A 4X99B 3GSNL 5EPMB 5F7BA 1BZ7A 1ZHBA 2ZKHH 5T3ZD 1DQLH 3KGRA 5KYXB 3S88H 5FPIA 2ZKWA 3WN5C 5GJSL 3HN8A 2AQ1A 3U7YL 1YMHA 2UWEE 2VO8A 4N2HA 3UYRL 4JRXD 3SN6N 1RJYB 1W16A 1NWOA 2GVYA 2MFNA 1I7UB 1R5VA 2VOTA 3JBG7 3LKQA 4UOW1 3UBHA 2AJYH 3X12A 3CBJB 1TZGL 3IMVA 4I0KA 3T08A 1NC2D 5ID0B 1A64A 3LXAA 2NY2D 3ML8A 4IRSD 3BESR 1HYRC 1RUQL 5ALCH 3QHZL 1RIHH 2VSMB 4ZMWA 2ZNWA 5FCSH 3WDJA 3AFLA 4AYGA 4ODVH 5FF6B 4AGLA 4UDTB 4O2EB 4P57A 4L3EA 4K7PH 5DJCB 3D0AA 3SCMB 4OF7A 3QFJA 4QO1B 3WN5B 2UZIH 4D9LH 4KTDL 3CZFA 3B1TA 3M88A 5I1AA 5ID1A 2DLIA 1FIGH 5FUZH 2GQHA 1QRNA 3GS4A 1YUKB 3FH5A 4S1DC 3RFZB 1YYML 3GTVA 3IDIA 4JG1H 4E5XA 1N6VA 2QLVB 5SWSA 3A21A 3D0LA 5HVGB 2NNXA 4UV4L 2AQ3A 1MHEB 1H15B 5ESQA 2KZKA 1YEWA 1T83A 3GKZA 3K6DA 3LKPA 3TXAA 3IDXL 5K69A 4DOHE 4LLDB 4K3EL 5DFAA 1R3JB 1U3ZA 1J1XH 2VWEE 4NZUL 4OFYD 3ABGA 2B5IC 3PWJA 4TQIA 2FBRA 2VE6B 4NO2B 5MP6L 1NGQH 1QLFA 2BNQB 4M7ZB 4QTHB 3KWVA 3VJ6B 1TPXC 2OP4L 4UT6A 1S2EA 4ONGL 4OH2A 2PCPA 5DVOA 4FZEL 5KSAC 4QHNA 4LQFH 3EFOB 1YEEH 4KZEL 1CE6B 3APDA 4OGZA 3L7EA 3B83A 4U3CA 3AXHA 3DX3A 1TOXA 2D0HA 2QQNH 3V0WH 1KCBA 4AIZA 3MLZH 5DD1H 3QNYB 5ERWB 2BPBA 2L7UA 3TV8A 5CEZD 2I85A 4NZTH 3P1VA 2XV6B 1W2KT 1KB9J 4MAUL 1WZ1H 4Z7NE 4B96A 1E9QB 3BPCB 3BVNB 3QISA 5D6CA 3TT1L 3BZEA 4YDJB 4BGLA 1GYVA 4J8RB 4NM8H 5EMYA 1YY9D 2E6QA 1JK8B 3KS0H 2VN7A 3NIDB 5CIPB 5DK3A 1AXIB 1MCRA 2IXQB 1MWOA 1PJWA