4XRCA

Antibody hemagglutinin complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
b'YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab light chain
molecule tags Viral protein/immune system
source organism Homo sapiens
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
total genus 40
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA01
2L7JA 2VR4A 5EUOA 3QBTB 4EIZC 4YHOL 3ULUC 5HVHC 2ZPKL 4OFIA 1KENH 5IB4A 2X4TA 3QWOA 2R29L 4H0GA 2DQGL 3D2UA 4F57L 4U1MA 4CGTA 1S9XB 1U58B 3BPNC 3GSOA 3MV11 3VGGA 3OGOE 4JFFA 5ALBH 5JXEC 3UBXG 1JWSA 3E6FB 4RX4A 4S1QL 2X4SA 1I1YB 3PIQB 1K3ZA 1M6OA 3OKEB 4PRHD 5IVOA 1I85C 4LPXA 3BHBB 4GRLA 4DTGH 4X6CA 3MRCA 3NZHL 1J12A 2AXJA 1UQSA 1R5IA 1LDPL 4LKXA 1NGWB 1VA9A 4KROC 4X7EC 5CGYD 4JRWA 4HCRL 4HS8L 1CXKA 1CGWA 1CFBA 1P4IH 3RWDA 4PJFA 3CH1B 4PJFF 2N4IA 1S7RA 3FT4B 4UIMA 5EBLB 3HC3H 1K6QL 4WW2B 1NCBH 1IEAA 3OXSB 1RJCA 1GJIA 4JM2F 2DM2A 2PTTB 3MUZ1 3V2AR 2XN9B 4GRMA 3SDDD 1ZE3C 3CFKA 3E0GA 5HJ3A 4RFNB 4RAUB 4RWYL 3LEXB 3KPOA 3GSNH 1A3LH 3SCMA 5CFHA 3HR6A 4PJEF 3WIIL 3RWIA 3VJ6A 2UUDK 4GRWE 4MD0A 4EI5D 1AXTH 2IAMC 2VOTA 3MRIB 1EHLH 4P3DB 2VISA 3HNTL 1MFDH 5I66B 1KPVB 4K8RH 2PXYB 1T1YA 3HR5A 4MB5A 4V1DE 3ZYOA 3STBA 4BUGA 1NLDH 1UCBL 3RUGE 2WINB 5FYJE 3T1WA 4NC2B 4U1GB 3BSZH 5I8EA 5GSVA 4WV1C 5DRXA 1WAAF 1OTTC 1U2CA 4NQEB 1I1FA 3O11A 2P4AB 4LHQB 4TQEL 3U4AA 1JZ7A 1A1OA 1BP3B 1F4YH 4F2MB 5FYLE 3DMMC 4NWUH 3KXFE 4CW1B 1FN4A 4PJ8C 1H0DB 3RIFK 1YN7B 3D87B 3WKML 1YC7A 1Z0NA 4OFYD 1AE6L 4L1HA 1QSZA 2X44D 5EZOH 2F8XC 1R3HA 3VD3A 4MAYD 2FB4H 1IM3A 2BK8A 3B9EA 4RQQB 1J1PH 2FATL 3KLAA 1HKFA 3K1KC 5BV7C 1DL7H 4U1JB 5E5MA 3TVMB 3MLZL 5CBAA 4OAWB 3DRTA 3VXRB 4LCWD 3KNBA 1W2KT 2VDOL 4R0LC 3RFZC 4HWNA 1O7SA 1U58A 5F7KC 1N0XL 3RI5F 2HN7B 4JO1H 4GAYA 3MRNA 3BAEH 2OL3B 2ZCLL 5F1IA 5EWIH 1RUQH 5GJSL 1PZUB 1U3ZA 5F6HI 3OKOB 4X6BA 5F9AC 1I9RL 3GMOB 1U93B 1NFKA 4LEXH 1SHMA 5CJBA 4OUUA 4FFYH 4PGCB 5DVKA 5IMKA 3P2TA 4PB9H 2H2SD 3Q48A 4XTRC 4HHAA 2A6IB 5TQ0H 4Y19A 5DLMH 2V9TA 5C07B 5C0BD 4WHYH 2HLAB 5I1GL 4NCDA 4LSDA 4JKMA 2PXYC 4NO2B 5I9QB 1JPFA 1Z3GH 3OTTA 1A7NL 4FMFA 3EDJA 1EGJH 5F9JB 4JANB 4D9RD 4PREA 4NFBA 1RZIB 1PG7L 1BLNB 4GKNB 3GIVA 2VH5L 1JGLH 5GGRB 4MXWH 1MFAL 2VQ1A 4PUBH 4X6FA 3CC5A 3D9AH 3WNNA 5EIIA 4LSPH 1IVLA 4Y4HC 3CAFA 2X4NB 3GSVA 2Y5TA 1AD9B 1OQOA 3AFLA 4TN9A 3TBVB 4OF3A 5C0BE 2CH8A 5IIEB 1XZ0A 3QXDA 3MBEB 4NNXA 2PW2A 2NY4B 4D0BB 2XKNB 1WVZA 1A6PA 4WEUD 1KB9K 3ES6A 4XNZB 4JREB 2ICES 2EEBA 3ARBB 4BZ2L 4G3YH 5HGAA 1T21A 5C0DB 1BAFL 1A9BA 1EUUA 1EVTC 1U8HA 1I1AB 4HG4K 2VDPH 2GJJA 3G9AB 5J56B 2XY1A 2B4CH 4YDLC 1LHZA 2X4UB 3VRJB 1OF2B 2OTWB 4PP2B 3S5LG 1S7SB 3V7AE 4OCXL 4P0DA 1ZANH 5J06A 1VDGA 5AG9A 1SEQH 3ARGB 4XBEL 3ARDC 4ZFOB 4HS3A 3BKMH 4DVBA 1DE4A 1KCUH 4PJEE 4M93B 3FT2A 5D93C 4IOIA 4A6YA 3BP5A 5HI5C 3V6ZA 1Z2KA 3MV8A 4MAYC 4WGVB 3ARGD 4K94C 5E5RB 5EU3B 2I9LB 2F15A 1DBKH 3R8QA 5IHUL 1KGCE 4DOHB 1HI6B 1S3KL 4FFZH 3D1MC 3EFDL 4F57H 1SY6A 5E2JA 2DM3A 4DFHA 4JPKH 1LO5A 5DURB 5D2LF 3G5ZA 5J57B 1J1OH 1JHKL 1LO4H 3E1F1 1NMCB 2WNGA 1MCIA 1F11A 2HTKD 2LU4A 5I1CL 1GZQB 5C0GB 5FYJU 5TDNA 5BQ7B 2AQ2A 3K0WA 1EHAA 3PJSB 3EOTH 4MJIB 4IRSB 4OD2B 1LD9A 2J88H 3O9WA 5GGTH 4RFEB 5KAQF 2V9RA 2XOTA 1HDMB 1IBGL 3I84A 1E4KA 1UH3A 1OTSC 3ZKNC 4LBEB 4DEPC 2ZSVB 3N85H 2W0FB 2JELH 1YEDB 5DVOA 4QRPE 3BPOC 4P59L 4U6VH 1YEJH 4AEHH 1V7NL 2FZ3B 2H2PC 1S5IL 5GGQH 1DEDA 4YHNA 5E6ZA 3UP1A 2FJFB 2Z35A 4IOIB 2XV6B 5DD6A 3QQ4A 5K9QG 4F9LA 1EHLL 5EU4A 5D7JB 4XP5H 3SQOL 2R0ZL 2Z91A 4NFCA 5JOFA 1XF4B 3PWPA 3BH9B 3QEQB 4Y8AA 2QHRH 2ZUYA 2AK4D 1UCBH 3DUUB 1JNNL 1AXSB 2J6EA 5HJ3B 5D7JD 3BSZL 4AM0A 3RY6C 3QDJB 4LNRB 5HHVL 3OKYA 4ZQKA 1QA9B 3D69B 1U3HB 1MWAB 1MJJB 1XCQB 3S36H 1N5YL 3K4ZA 1MFNA 5C6PB 5JZ7D 1EXUB 1KJMA 1AKJB 4G80A 1EGJA 3UEZA 4NYLB 5E6ID 4PRNA 3CFDB 3IGAB 1MAKA 4NBZB 3FT3B 1B6DA 3NCYS 5E99L 3MV8D 4HF5L 3E6HB 3MRCB 1YEFH 1WFTA 4N0FB 3RWHB 4YBQD 5MERA 1UB6B 5A2IH 2FX8L 3RX7A 1JHLL 1Y6KR 4PTTB 2F19H 1CD1B 2QADD 2FYYB 4GAFB 5FM4A 3JV6B 3RVUD 1YNTB 4KV5E 4N0YL 1PFCA 3TT3L 5D2NC 4HUNB 1EFXD 3F12A 1OARH 3OKDA 3ECBB 4FQJH 3ZKQD 5JMRA 1EERB 4X9BA 4HXBH 4XPFH 1N0XH 3NFPB 5C8JB 4F80A 1FFNA 3WIFB 3PWPE 5L9DH 3EYOA 1IGTA 2ZCLH 2W59A 1ZVSA 2ADGB 4JZJA 2UZIH 4MNQD 5DFVD 2HJLB 2R8SH 1ZHNA 2UWEE 1KTRL 4WI7A 4OF7A 4U0RC 3DRQA 4YBHA 2BSTB 3EO9H 4G43B 3RWFA 4M7JH 1IEBA 5HD8C 4H26A 1CG9B 4LDOB 1PG7W 5GS1C 4I18B 1YNKL 4HJJH 2CDEA 5IB3B 5F9DC 1Q8MA 3QPXL 3TO4A 4JZNB 3MRLB 4QOKB 1QRNA 5IEKB 3BX7C 3LKRB 5TH2B 4UNVA 1MRDH 5C2BL 4W68A 4G9DB 3QO1A 4U1KB 4R6UA 1BQLH 1E4XL 4PP1D 5IKCA 3NIDE 3JV4A 2OJEA 2AJXH 2WAHA 3FB7B 1G6RL 3O4LD 3WLWC 3VGFA 5I75C 4R97B 1YC8A 4Q0XL 2IPKA 1U92A 5ESVA 2MPAH 1X5JA 3MGTB 4TNVK 4OFVA 4WI9A 3KYNA 4MDIB 5J4MA 1KCSH 1OL0A 1IAMA 1QPXA 4LSPL 4PY7B 2V2XA 4X6DF 3H2WA 2RCSL 1YEHL 3MCLH 5L8LB 4LLAA 1J5OL 1R5VA 4WFGE 4QGYA 1IGML 5CINL 5LGHH 5DDHB 3IKKA 3CFEA 3V0WL 4I18C 4GG6F 1HXMA 4G42B 5SX5K 2APWA 5ITFB 2ITCA 2OMBA 2DD8L 4L4JA 1EXUA 1KJMB 4NT6B 4UT9H 3QUYA 4ZS7H 3OX8B 1BJ8A 1MRCL 2F53D 3HZVB 1UJ3B 3IDJB 3KJ4C 1JGEA 1EFXB 1YUHB 4BZ2H 1HIML 4JDZA 3BT2H 4UTBH 1ZT4B 5HHME 1DBBL 2X09A 5CP3A 4DW2L 3QR2A 4WHCA 2VDPL 5FGRA 5K9OB 3C09C 1ORSB 2R4SL 3N1MC 1ZTXH 1LO0L 2B4CL 3CFJA 3KYKL 2XT1B 3K4AA 4FZEH 4OLXL 1PEWA 5F21B 1DSFL 1WIOA 4OCXH 2X1QA 3HKFA 1T03H 5F3HB 4XBEH 1VCAA 1MFBL 4RRPG 5IW3A 2AJSH 1KCUL 1RJYA 5IVXE 3NPZB 4NN7C 3X11A 2EC9U 2VDML 4KI5F 5JQHC 4PJ9C 1SEBB 2GY5A 25C8H 4LRNH 3D18A 2FZ3A 4K9EC 3CXHJ 3MTRA 3MR9A 5FO7B 1GGCH 2ESVE 2VLJD 1Q0YL 5CBEA 4Z7VA 5IMLB 3HI6H 4XPBH 1RZFL 5T33L 3NFNB 1XIWD 1U8MB 5DEZA 4NQVA 4QRUB 1IC7L 1XH3A 5C0IB 3EFDH 3MYJB 3VA2C 1ZT1A 3HS0A 1A8JH 3U0TB 4Z7UA 4WHDA 2VQUA 4JPKL 4WO4A 2IFFL 1T66C 2ZOKB 4MVBD 3V9FA 2GITA 2PNDA 5I1CH 1QFWM 1UVQB 4KAQH 3ARFA 1YY9D 4Y5YB 3VXTA 3IDMA 4NCC2 3GMOA 1AQDA 1CDJA 3EOTL 4QY8A 1PGRB 3OR7A 5D71H 1FYTB 2NY6B 3I2CL 2XNAB 1ZHLA 1NMBH 4X0KA 1YYMH 2OLDA 1LO2H 4IHOA 1EPFA 1XIWB 5L7XH 5E8NB 1FGVH 4DGIL 5CP7A 5D7JC 1FYTA 2P8MA 4YDJA 2K1MA 2DDQH 3IYLW 3IF1B 1DQQB 4LEOA 3DRTB 2H41A 3D6GA 2GUOB 5F96L 3BN9C 4JRYE 4LLUA 4ODSL 4OBSA 3M45A 5C0ND 3K8KA 3FQXA 3PDOB 1WBXB 3RVWC 4TUOA 3MLPA 4M1DL 4YFEA 4IM8A 3MV7A 5TE6H 3MV01 4PYHA 4TTDC 5DHVH 5FO9A 2R0ZH 1U8JB 4Z7VB 5CBEB 3KPNB 2LTQC 4OB5H 5IB2B 3BP5B 1SEBA 1XH3B 5C0IA 1MHHB 1U2HA 2FD6H 4IMKA 1CVRA 2DQJL 3OGCB 4RNRA 1B0WA 4Y2OA 3TBWB 4L8BB 4UIKL 1YMHA 2MHAB 3QWRA 1EDQA 3PHOA 5E4IA 2XZQL 5LGJB 5D1ZC 3SJVD 1QSED 4P2CG 2EXWD 1CS6A 4W70A 2FIKA 4TUKL 4OD1L 5E99H 1H8NA 4P5TC 4PJ8D 1CU4H 1CLCA 2FO4A 3C6LB 1A9EA 3ARBA 3DPBA 5F6IC 4J3VA 4TOYL 4HT1H 3GMRA 3O2VL 4OD3H 2Q6WA 1Z0MA 1KPVA 1NCUA 4LSRL 4ZUUB 1J0ZA 4XVSL 1I1AD 1ZEAL 3UJIL 3CNKA 4DWHA 4C56E 3SE4C 2HWZL 3KPQA 4JQXA 2AKRA 4PJHE 3RNKB 4NKMA 2YC1A 5BOZG 1BZ7B 4PG2C 2C1OA 4GKNA 1JF6A 2D7NA 3REWB 1BWMA 2DTMH 1X7QB 3QHZH 4LPYA 4J23A 5I8KL 3TN0C 2CK0H 3MXWL 4YJZL 2HH0L 1KF9B 4U1HB 1KBGH 1NAKH 1Y6MR 1FE8L 3PV6A 5EBLA 1BM3L 3C08L 1QBAA 3PGFH 5J6GB 3D3VE 3ET9F 3A67L 5TE7L 1WT5A 4NC1C 2A6IA 2R8SL 3ZYZA 5FO9B 4PRDB 5JW3L 5DD0H 5F97E 2OZ4H 5FGBA 3D0VA 4GAGH 4MS8D 4GG6A 2EDTA 2YMXH 3P0YH 2G60H 5HGDA 2OI9C 3CVHH 4HJJL 1YPZB 2VXSL 2DQTH 4G6AC 5DWUH 3U4EB 4XC1L 4RAVA 1H3TA 3MRHB 3TF7C 3FB7A 3WL9B 3LPGA 4MNHA 3VXPB 4DCQA 1S7WB 5ID1B 4EN3D 1H5BC 5EULV 4FFWD 2JJTA 4G6FD 3B9AA 1YJDL 5E8OA 5JW4M 4QTIH 4LU5L 4HZLB 4HFUL 5DI8A 3ROLB 1RZGA 4I18A 1JGVL 5JXEA 1GYAA 3CVHA 5C08B 1HINL 2PKDA 4OIBA 4CVUA 3GSNA 3HFMH 2YWZA 3NFSH 1FFPA 4ZSOB 3TFKD 4M6AA 4Q2ZB 3M17A 4BK5A 1SYVA 1EK3A 1F02I 1Z9OA 5ANMB 5FK9A 1EEYA 4MAUH 1FL3A 2DL9A 4XVUC 2OR9L 1U8IA 3IU4L 4H1LB 2CGRL 3NAAL 3BQUD 2FDBP 1K6QH 3MMEA 5EBWA 2ZSWA 3K4DA 5KVFH 3GHEL 2X41A 4MQTB 5TFSL 4QOKE 1L7IH 1R5WB 3F12B 4OZ4B 1PYWA 3VFGH 4RWYH 1S7UA 4KHTH 4PGDA 3VA6A 3MJ6A 5DJ2B 4UV7H 4X5WB 4UTBL 5MEPA 4PRHE 4XXDA 1JP5A 3P9MB 3HNTH 4NZUL 4PGEB 4ODTH 3PQYB 2DQFA 1U9KA 3CMOL 1ZTXL 4HUUA 3HLAA 5T3ZL 3VGDA 3D0LA 1C12A 3BZDA 3L5IA 1XGPB 4AENB 1T22B 3CLEL 3H9HB 4G6FB 3WJJC 5HHPA 3U30B 3BRDA 1T03L 4OM0H 5TJWK 3QA3B 2VMFA 3FJTA 1T5WB 1ACZA 1MFBH 3U0WL 4NNYB 5IB1A 1WBZA 2C4FU 2JIXD 3WN5C 5IG7B 1ZT4A 4AK1A 3NABL 4JPWH 1H3WM 4KZDL 1F4YL 1G1YA 4LRNL 4JPVL 4G6MH 5D8JH 4EQ2A 3KJ4B 4LLMB 3HAEH 3JTTA 3CK0H 4RAHA 2GJ6B 1FSKC 3GBNL 1NBZB 5D1QB 2IFGA 3QQ9C 1BEYH 2PYFB 1IC7H 3DIFB 1QLFA 4M7KH 1JZ8A 1AE6H 1U8PA 1T66D 5FHAH 5EZOL 2IQ9L 5CEYA 1EO8L 1EZVY 4LGRB 4ETYA 1F2XK 1CGYA 3GKZA 4YWGL 1HSAB 4NFDA 2CKBA 2FATH 5FYJD 3BVNB 3T0XA 2GT9B 4XNMA 1FFOB 1MF2L 4KROB 3RKDC 1B90A 1GZPB 5IOPA 1C8PA 2FGZA 4PLJD 4ZO9A 5KS9B 2HJKB 4HUVA 2VQTA 4L3CB 4H88L 3RWCA 1CF8H 5D71L 5DMJB 4YDJB 4FRWA 1NMBL 1KTDA 3U30C 4XRCB 4G8IA 2UYLB 3LZFH 1BBJA 2HKHL 2ITDA 2ATPA 3P11L 1I7ZB 5DJ2A 4WFED 1Q94B 1RUQL 2CKBH 4OKVB 1T7YA 1F3JA 2ZG1A 1XCTB 5E2UH 2IMNA 1H8OA 1NCAL 4Q9RH 2YD5A 4ODSH 3VWJC 1QFHA 3INUH 4DKAA 2ZCHL 1CXIA 1MNUH 2C1PA 5C0FB 4LKCA 4Z76A 1D7FA 2VNCA 3G5VA 1AO7D 4HGWB 1FNFA 1NL0H 4J3OC 1ZLVH 4L4TA 5IVXA 4YHZL 5L8JB 4J3XA 4GW1A 1IJ9A 2F54D 5DVNA 3UJTH 3X3FH 2CIKA 2E7HA 3K46A 3LN4A 1AO7B 5DHXB 3QB7C 3E8UH 1LEGB 2FBJH 4HH8A 4HULB 5JO5B 5HI4D 1BZ9A 1CICC 2DQJH 3FQUB 1U8MA 1Z3GL 3MNWA 5DD3H 2X05A 4KVNL 4FP8L 4LPVA 1INQB 2ZKHH 4TULH 4EJ1C 4QOKD 5D2LE 4WNQB 2OTUB 1OPGL 2A38A 4CU7A 1IKNA 4ZPTB 4OGXL 4G8EA 3HI1A 4YDVB 4JY4A 2GIYA 4MXWL 4TUJA 5F89A 3H6JA 3V0VA 1I7TA 4LCUB 1N4XH 5IV2B 3S37L 1T21B 4LPCA 2X7LB 4QKXB 1VFBA 5FKAB 1YN6A 1I3GH 4Q9QL 3O2VH 4OD3L 5JR1H 5LVEA 3EOBA 3ES6B 2N1KA 3KR3H 4MXQD 5JTWA 3VW3L 1ZEAH 3ZZ1A 2C3VA 1VFOA 4MNGA 5C0DA 4C58B 1EIBA 2CPCA 4OLYL 1KB5H 1H3XA 3EHBD 1RZ7L 1F90L 2H32H 2X10A 4RGND 5J12B 2OP4L 3QHZL 5FV1L 2R0WH 32C2B 4FS0A 3CDFA 4NO5A 3D69A 4Y0GA 2HH0H 3L5HA 5F1NB 5F3BA 3BH8B 1FZOB 2EDJA 5DDHA 4D3CH 4JFHD 4LPUA 3WFHB 4L8DA 3AAZA 2Z93B 3A67H 2VE6B 1J0JA 1C16B 1RUMH 3RNKA 1KB5A 1SEQL 1NMAH 2FGWH 3S4SG 3MLXL 1FZOA 2IMMA 1S9VA 1H5BB 3MRJB 1MAMH 3LKSA 1NDMB 5BS0A 2JB5H 1QSFD 3JVGA 3X14A 1CVSC 3CVHL 3WO4B 5C07A 1C5BH 5T3ZE 2DQTL 4P4RA 5DWUL 4X9HA 3A6BL 4OTXH 4NKDA 3A6CL 1LK3H 2VN4A 3W11D 5FGBC 1G7HB 2UWEB 2F53E 1UEMA 4O2CB 4Z7QE 3DV4B 3RZWA 1TZHA 5I1AB 1I7UA 3O6FB 5J3HD 1AR1D 4K3DH 3H3BC 1INEL 4ZAKD 2BSSA 2CRZA 4J6RH 1LO4L 5F7LB 3PDGA 3OKOA 4JN1L 3QIBA 5ICXB 5ADOL 3WDJA 1CLOL 3MV8E 3NFSL 4UDUB 1XGYH 4PGCA 4HIHA 4ZD3H 1OWRM 2J5LB 2D0GA 4J4PA 5I0ZA 4IRJA 2E7CA 1Y0LA 3KPRE 3VE0B 3I6GA 3G5ZB 3BEWB 1BD2E 3A6OA 5GISL 2VLLB 4YHML 4L9LC 2WQRA 1W0VB 1UXSA 4TUOB 3CUPB 2WIMA 5AD0A 4J3WA 1Q38A 3N85L 1QFUL 4U1SA 3BD5A 3QNYB 4L3CA 3RWCB 1YEJL 4BQ9A 4P5TD 2GYSA 5LWYH 4K71C 3RKDD 5CZKA 1J8HE 3B83A 3BOVA 5DR5H 4Q6IC 1Q9LA 3BKCL 1NC2A 4K2UH 3GMQA 2JK5B 5DHYA 4PRAA 2Y06H 3ARDB 2QHRL 1U41A 1FNEA 2JJSA 4K3HA 1JNNH 3QXVA 4OCMC 1CWVA 1CL7I 1KOAA 1WITA 2YSSA 4XCFL 1MUJB 1M1SA 1P7QB 1OAKH 4LSTH 4CW1A 2R39A 3B43A 1QKZL 2OL3L 3WS3A 5GGUA 2I60L 1QQDB 5HDOA 3PDDA 4RFOH 4RGMB 3DNKA 3UDWC 3NACH 1GZPA 2EYRB 2EIDA 1KC5H 1VERA 3BPCB 1WQVT 3RU8L 4JDVA 4DQOL 3QDJA 4ORGB 2PO6A 1BEYL 3QXDB 5D2NB 4LDEB 1PD6A 3VJ6B 3ZMRA 1PKQB 1YEFL 1MCKA 4JDZB 4HAGA 4HK0A 3D25B 1D5XA 2IH3A 3VWKB 1EO8H 3BIAX 3LSOB 2FX8H 1HOCB 3FONB 3MRKB 1L7TL 3L3GB 2BY1A 3VRLE 1CE1H 4Y19E 4M4RA 2F19L 3PWUA 1PQZB 5FDYA 1KXQE 4L3EA 4NRZB 3FZUD 2ICWA 2HP4A 4O02L 3TT3H 4WW2A 5E8PA 3TO2B 3MJGX 1CF8L 1S7RB 3O2WH 4ZOEA 1Q9LB 5D2NA 2VZTA 4PRIE 2W0FA 4JKLA 5KVDL 3FQNB 2IJ0C 1YQVL 4Q97A 4X6DA 3CLFL 4F7EA 4KK5D 4U1NB 4H1LA 1EFXA 4U33A 4HSQA 3N1GC 4F8QA 1U95A 4Z0BL 3L7EA 1NFDB 4WWKB 4KDTA 1NGXB 2HG5A 5DQDH 2J3SA 3EO9L 4P5MB 4P9MH 3UBXA 4JB9H 5L0QB 2X1OA 1Q1JL 2YRZA 3CVIL 2DLFH 5TH2A 2F5BH 5EU7E 4Z7NF 4LCCC 3BGMA 2W92A 3OR7B 3OKKA 1CBVH 5B38G 1G7PA 3SDXB 4BFGA 5JQ6L 4LAQL 1I7TB 2BVPB 5IV2A 1P7KA 5ICXA 1AY1H 4OCRL 2A0LC 3JTSB 4KRLB 2FJGB 3SDDA 5HDBF 3T0BA 3FOLB 1BQLL 1E4XH 2KKQA 1QZ1A 3HN3A 4BQ6A 1KELL 3J8F7 3VDAA 1L9NA 1I9IL 5DD3L 2APVA 2GJZB 5DXWA 4LQFH 5IJKA 4WI6A 3QNYA 5TDOB 5D2NE 3F7YB 4MJID 4PJCF 5J13C 1DQJB 3SDCA 2AW2A 4W81A 3CSYB 1OLZA 3QZWA 3R06B 4WWKD 4U1IA 1GH7A 2COQA 1RK0B 3VFTA 5T1MA 3O2DH 5CWSA 2J8UA 1WK0A 4ZSOE 4HW6A 5B38B 3SGKC 3WFDL 1IM3B 1CQKA 1QRNB 1C7TA 4LHUA 1TFHA 5IFAL 2RCSH 3AGVA 2DQEL 4LOUC 4EBQL 3RZCC 2VLJA 2YUXA 3TFKC 4BZYA 1J5OH 1ZGLB 1SVZA 1OP3K 3VXSE 3JVGC 4GMTH 3MJ9L 1TJGL 1KB5L 2RR3A 1P4LA 3QUZA 4POZC 2DKSA 4QF1B 4HC1H 4QRRB 4ZS7L 1B0RB 1MY5A 1XF1A 2NY2C 2PN5A 3FZUC 4JM2B 4P2OC 1IE5A 3BYYA 1HIMH 5EB9A 5EPMA 1YDPB 3QCTH 3WE6A 3V6OC 1WBYA 3ABZA 1EJ6A 3G5YA 4FHBD 5I76B 4NYLA 4KPHH 2Y4SA 4PG9A 4RMSA 4XAKD 1NGZB 4ZPVB 4MGXA 5IWLC 2C3VB 4MNGB 1U91A 1X6NA 1AJ7L 3ZLQC 1NMAL 2EE3A 4ODUA 4Z7OE 1JI1A 1CFQA 2AJSL 1CGSH 4NM4L 2BSED 1LEIB 1NBVH 4YPGA 2AABL 2VDMH 4LIQH 4MD0B 4V2BA 4DZBB 4NO3B 2Y25A 4PRIA 2AV7A 3UAJC 3RBGA 1FNSL 1A1MB 1SJHB 1MHCB 5LJYH 1TCRB 5T5FH 5HVHB 4BKLB 1ETZB 3LPFA 4FXKB 5D2LA 3EOAA 2EKSA 3U9PL 1RULH 2AS5M 3L3IA 4QCIB 4JFFE 4QNPF 3HRPA 4MHHG 3UPCA 5DFVC 3M1BB 4LP4A 5IFHL 2IFFH 4APQC 4M7ZC 2BNQE 1MWAA 4XCYB 2HVKA 1UG9A 2A6DB 1ITBB 2DIBA 3FQUA 4JM4L 3U7AA 2GJ6D 2BFVL 5IFJB 1NAML 4G8GD 2A9MH 3HCVB 4JZJC 5I15L 3TPKA 4YGVA 1HDMA 4O58H 1B9ZA 4PLOB 3ZDYE 4DKFH 1MRFH 3C60C 4U6TA 4KUCD 4C55A 4QHLA 5IB3A 2VL4A 4ZYKA 5BW7A 3O3AA 4M5ZH 4P99A 3LIZH 4QRRE 3B9KC 1DUYB 2DIAA 5INDB 3QWOB 2X4TB 4W4OC 2MSPA 1E4WH 5FUCE 4WVRA 2B39A 1MVUA 1C08B 5TGBB 4DAGH 1QBMH 1CFTA 1L0QA 4I0PA 4PRAB 5ITBL 1RK0A 4IOSD 1T0PB 3ARFB 1H8SA 3KGRA 4NOFA 5CEZE 1UKSA 3BKCH 5EBWB 4K2UL 4IDJL 1EZVX 2RFXB 3LRHA 4Z7VF 3MUGA 3PXHA 2Q8AH 1KN4H 4ENED 5BVJA 5A2LH 3TJHC 2VDQL 3MV9B 1X3DA 1G0YR 2AXFA 2CO7B 2MKLC 4ETQB 1SQ2N 1X5KA 2FD6L 5IBLC 4J8RA 1B4JL 1DP0A 3NA9L 4NM8L 1YN7A 2OL3H 2E7BA 2R2HA 3G6DH 1PLGH 3NCYP 1S7SA 2I60H 3S97C 5CJQL 5C6WH 1PEZA 5CD3A 2Y6SD 4OD1H 1MJ8H 2JB6B 3QIBB 1F3DH 3SKJL 4Y88A 5CHNB 4UOJA 2AJ3B 1Q9KB 4TOYH 3MSPA 4HLZG 3BUTA 2EDQA 1YY9C 1L7TH 3K2MC 5HTSA 1XGQA 1A21A 2CJUH 4ZUVB 4RGOH 1S78D 1TQBB 2F54A 3H9HA 2X4QA 3OHXA 1P2CA 1CDBA 3EFFA 2ADFL 5D7KD 3RPIA 3RPKA 2DTML 4BH7A 2BNRA 2VLKB 4K7PH 5EIIB 1F6LL 5IR1A 1RZJL 3L3IB 1H5BA 4TPRL 4JFYB 4WI2A 5BS0E 4L3AA 3GMMB 4S1RL 1FE8H 3QIUB 4S0TD 3C08H 4YHNB 1CL7L 2BY0A 1N5AB 1N6QH 4WFFD 5KW9L 3F58L 4HDIB 3LMJH 5TE7H 5EC1A 3O8XA 1IGIL 2ZUQB 2BDNH 4E42B 4XVJL 3BW9B 4HBQA 5HHQB 3VG0L 3QRGH 1WIPA 1FDLH 2VITA 3SDAD 5IM7B 3MBED 2K7QA 1Q1JH 2X4OA 2DLFL 1U92B 3LKOA 2VZVA 4U3HA 4XC1H 4ZPVA 2X4SB 1IZJA 4CBPA 2OM5A 1BZQK 1CBVL 3PQYA 4HXAL 3HTLX 5ID0A 1SYVB 3V4VL 4D9LH 1P6AB 3CH8A 1HEZA 1RZGB 43C9A 3TN0A 1KSRA 4KGJA 4BM7A 3RVTD 1GGIL 2B7DT 3ILQD 5C08A 3U4BH 2XRAH 3DMMD 1YJDH 5E70A 5IVZB 4P3WA 3VGAB 4R7NA 4PS4L 4QTIL 4JQXC 3B3IB 1EMTL 1VESA 4PJDA 3AS1A 4MDIA 1XR8B 4F15B 3TPUA 3S6CA 3H9ZA 2CKNA 4Y1AB 2ZNWA 3PXJA 4NZJA 4ONFL 3QNXA 5L2JA 3O2DL 5GS2D 2IAMA 4LHUG 4YHKL 1IC5L 1X44A 5C0AB 5F72S 4P5TA 4QRQB 3HB3C 1HEZB 3ULUF 1HHIA 2Z8SA 1G7HA 4Y5XC 3BEVA 3T08A 4BQCA 2HVKB 2Q3AA 4FQIL 1E27B 3TC9A 1BX2A 5JO5A 3DVGB 3EGSA 5KVFL 3TLRA 2DICA 4DUVA 1RZKC 4N1HB 4LLQA 1OOAA 4L4VE 5C0AA 2BJML 5EORH 3LKSB 3P9WB 5BS0B 4YQXH 3IU3A 4KHTL 2FEDC 3BQUA 4OQTA 1K8IB 4U1HA 1UEYA 5L2JB 3MRPB 2GTWA 3QCTL 1KB5B 3GI8L 4I4WB 4U3XA 3WDHA 1SJHA 3C9NB 5CIPB 4JFEE 3LAFA 4PGJA 3PGDB 3UPRA 2E6PA 2CDFB 4KPHL 1GGBL 4DJMA 2XG5A 3NTCL 5DQ9A 1FO0B 5L0QC 4KK9D 5C9JB 1I7ZA 3WFBL 4PGBB 2P5EB 1GL4B 1PX3A 2VC2L 3TJHD 3WFEL 2JJWA 2DM7A 4BFEA 3BZEA 1MCWW 3U0WH 4HIJA 3L3JA 3WUZA 2NXZC 5CP3H 4GKZA 3F65A 4HK0B 2CRMA 3L7EB 2NLJA 2Y5TB 3NABH 4JPWL 1GIGL 4WJ5A 5I1KH 3WEXA 1KLFA 1JI2A 4Z7UB 4WUUA 2GT9A 3O81A 1UA6H 5EOTB 4XWGH 1I9JL 1RULL 2VXQH 2DI7A 4M7KL 2W0LA 3C5ZC 5EC1B 1D5BA 2Y7QA 4NQDA 5DJ0B 5BV7H 3WS3B 3KLHD 4OCSH 5FHAL 1WLHA 1D9KC 2BNQA 2VXTH 4BELD 1DLHB 4D0DB 3TBWA 4PJGA 1KNOA 1A3QA 5F8RC 1KPRB 4LRIC 1NBZA 5D1QA 4M48H 3QYCA 1NAMH 1QSFE 4OZIF 1ZSDB 2PTTA 2J8UE 3VFRB 1KLGA 4G80B 5DS8A 4DK3A 1RMFH 5I16B 4U6HB 5I15H 1R0AH 3S37X 4O58L 5JW5A 4P4KC 2D31A 3GMQB 3DVGA 3EGSB 3DYOA 4HMCA 1A9EB 5IGXL 5DJ6B 3AM8A 4EN3C 5A3ID 4NC0B 1FBIL 1LVEA 4ORGA 1P84J 3V5KB 1HH9A 2IAMD 5CMAA 1DDHA 4XP9H 5IK3A 4JRYB 1HKLH 2IANB 5CHNA 2NY2B 4P2OB 5F7UA 4MD5B 1OAYL 4QHUB 4Q9RL 1QR1A 2FJHB 3O3BB 4WCYL 3JTSA 1DR9A 1FVEA 5BZDA 4JFFB 5MHSD 3B9KA 3VFOB 3CFEB 1DFBH 5I19L 3MV9D 5C0AD 2YUWA 1FGNL 1VPOL 5I1IH 5FYJH 3Q5YA 5DK0A 2RBLA 1II4E 4YAQA 2H1PH 4NQXB 3GKWH 3WD5H 5IMOA 4KROD 1R6VA 1MFEL 1RHHB 4K3JL 2VDQH 1UKQA 1NGWA 4WWKA 3IVKA 2NCMA 3WHXB 4CVXA 4QHUA 5CLWA 1B4JH 4R26L 2VDKH 4XBPB 4LLUB 3LKQA 1TIUA 2IPKB 3HAEB 4FP8H 2A6JA 1FL3B 4U7SA 2XWJB 4NQVB 3JUZA 1QLEH 5FV2A 1PSKH 1A1NA 3B5HA 3B2UC 4UUJB 1KEMH 3V7AG 3REVA 1N6UA 5HYJD 3S4SA 1B2WL 4IJ3B 3S34H 2UZXB 4YDLB 4EOWL 5T1LB 3D39B 4LLYB 2VUYA 4UT6H 4ELKB 2I07A 1JWUA 4S2SB 3IKCA 3VXRE 2F8VA 1U8QA 4DGYL 2EKSB 2MMXA 5E8OB 3MO1A 4MXQC 5BCAA 2UYLA 3DUSB 2EC9T 2YHGA 4FNLH 4ZYKB 5B8CB 3H9SB 5CCKH 5GS0L 3BD4A 3C60B 3L3KB 1FJ1A 3VXMA 3X12B 3P9LB 3QEUB 3LY6A 2BOBB 4HH9B 1ZHBB 3LB6D 3MRQB 4JY6B 5CMAB 1MEXH 4L9DA 1RU9L 2OP4H 3S96A 5D1QD 2EYRA 3VD4A 1RZJH 5DK3A 1Y18A 4Y2DD 1MIML 5IBTH 3T77B 4LF3B 2QEJA 4WTWA 4NKDB 4KGLA 4TTDD 1N6QL 1E4XI 3VD9A 1OM3L 4JFDB 1QHPA 4G7VL 3WYRA 2ITCB 4K94L 3K81A 1JMXA 5GPRA 4XVJH 1YMME 5DUPL 5HYEA 5EFIB 3BN3B 5C70A 3MLXH 3I75A 3VFWA 1A1MA 4M5YL 2QR0A 4O5LH 2VKWA 3U7YH 4JFDD 2NTFA 5D7SL 1PY9A 1Z9MA 3OG4B 2HKFH 2KQMA 3EHBC 2NY0B 2AK1L 3ARBD 2YD3A 4FQLL 5CEXB 1G7MA 5I1JL 5K9OA 1DBJH 1LK3L 1VEMA 4RA0C 4UMGA 3H42L 3BH8A 2VAAA 5EU6E 4D9LL 4FQQA 1H9VA 5GRZA 1QSFA 1NGZA 1YZZA 3MGTA 4NZTH 3BXNB 3UC0H 4WHYG 3CU1A 3P3YA 3VXUA 4A6YH 4MQ7A 5GIRB 1MHPL 3ZKMC 3NCBB 5E8DH 2P5EA 4KY1L 3GRWH 4XMKL 5FUCC 1HHIB 2VXVL 4K3EH 1HHJA 1TZGL 3HMWL 4PFEA 5DJCA 3QI9A 4QRTA 4EDWH 4AMKH 1KCLA 1JNHA 5L88H 1ND0B 3KPMA 4BFIA 3WXWL 3MXVH 2NTSP 2FBOJ 4RIRA 4G6JL 1IL1A 1P4BH 1KIUA 2C4XA 2FWOA 1F58L 4FQIH 3AREC 3QQ3A 2HTLC 1F4WL 2APFA 5T3XL 1MQ8A 2PETA 2R1YB 3B2VL 2IADB 7FABL 4J4PD 2ESVD 2VLJE 3HCVA 1YEKH 4PRHB 3DURB 4NQCA 1S7QA 3RI5K 4I3SH 1QHOA 3MNWB 1NDGB 4Q2ZA 1B6UA 3TVMA 5ICYA 4KKLC 4X7SH 3QZWB 5DR5L 2OQJB 4XBGA 1MWAL 1G9NC 3CVHB 3V52L 2R0LL 1IT9L 4RQQA 3MRMB 3LKQB 3O4LB 4Z7WF 1CLYL 2B1AL 2EDLA 4IRSA 5DFWH 3QG6A 2E9BA 2D7MA 5T1DL 3DXAB 3ALPA 4YH6A 2UV3A 2B0SL 4YK4B 1N2RB 4PJHF 3WFEH 1MOEA 4DOHE 2XZCH 4XCFH 5CEXA 3BMWA 3OZ9H 4FMKA 3TJEH 3BDYH 2B4CC 5DD1H 1OLLA 4AEEA 5KSAB 4LSTL 1ZHNB 43C9B 4NHCL 4NBYB 3HE7D 4RFOL 4GSDL 4PBXA 2P49B 3L5XL 5LXGH 1MPAL 1G7QA 1ZHKA 3E6HA 1UA6L 3QCUL 3RA7L 4XWGL 4CNIA 1D5IL 3OHXB 3HE7B 3OJVC 3WNMA 3LRSB 5I76A 3VGHA 3O6LH 1NFIA 4P9HH 1BOYA 4XNUH 4Y2DC 2BERA 2HFGL 3FMGL 2PXYA 3GM8A 4KK8C 3DETC 2W9EH 5J1AA 1K4DA 3WDIA 5EU7C 1MCLA 2Q7YA 1MLCB 3RVXD 2VDRH 2GSGB 3VXUD 3QEHB 2QQLL 4KKNA 3RVVC 5H94B 4GAJH 1M05A 4P2QD 4ODXB 3ZKSD 3TA3B 4XX1G 3R0NA 1IAKA 5T1KB 2Z31D 5L2KB 1J11A 3BGFB 1QLFB 4QXUL 3DIFA 3SDDC 1KFAL 1QFWL 2BNQB 2EH7L 2R69L 3BUYB 1P9MA 1HKLL 1JFQL 3JTTB 4EDXA 3OR6A 2NY1C 3HI5L 3RIAK 2FX9L 2IH3B 2X1XR 4TYUA 2XZAH 5J11C 4X7TA 1SJEA 1OAYH 4UB0L 2V2WB 1XGQB 4WCYH 4HUWA 3S96B 4Y5XB 3G6AB 4C83B 5EUOE 4X6EA 5SWSD 1DFBL 3TN0D 5I19H 2IBGA 4JB9L 5FYKD 4QHNB 3TBVA 1MIEH 1LNUB 3PABB 3RL1A 5GGUB 1B4RA 2VAJA 1JGEB 4MB4A 1QQDA 2Q8BL 3PWPB 3FRUB 4JFZH 2BNRE 1X5AA 3GKWL 4RNRB 3WD5L 3N50A 1MFEH 4K3JH 4OCRH 2EH8H 5K9JH 3AREB 4DVRL 4JJ5A 5KVEL 3SN6N 1DQMH 3T0EA 2A74A 2FIRT 1P5UA 4KI5D 1FL6B 4P46B 1I8KA 4HIHB 3ARVA 3RZCB 4LQFL 1DUYA 2DI8A 1BECA 1QLEL 2DQDH 2NY3B 2IGFL 2ZSWB 3WFZA 5F6IB 3QQNA 1FAKT 2OXGA 4PRBB 1JN6A 4F9PC 4EOWH 2VTFA 1CFSA 3V4PL 1DBAL 3ARTA 4UT6L 4CVXB 5B3JF 1X5ZA 1XT5A 5F7HA 3EJZD 3ZDYF 5CP7B 2DLHA 1EAPA 3GBMH 2DQEH 3GSOB 3HC0A 3EJYD 4O4YL 3S35H 1PY4A 5CCKL 3MA7A 3T4AB 3FQWA 4J2XA 1FZMA 4PP2A 4MWFA 3VMNA 2VUOA 1OW0C 2CUHA 3MNVA 4M43H 4UBDC 3VI4F 3U83A 4K8RC 5C08D 3W82A 1NGYB 2FSEB 5GGTA 3UTSB 4XPHH 4BFIB 1VGKA 1LO3L 1S9WB 4XNQA 3NZ8B 3QAZB 4BZ1H 4X6EB 3O2DA 1F3RB 4HBCL 4YHPB 1AJ7H 1PX4A 1ZVYA 2ZJSL 3DV4A 2D7TH 5B39A 2RGSA 2RJMA 2VLKE 3M1BA 3BP6B 2GHWB 3O9WD 4RISL 4U6XB 3V6BR 1NKOA 1NBVL 5FO7A 4P57A 2X42A 3TYGH 3GI9H 5ITFA 5ELIA 3P9MA 4JG0L 4JO4L 5FUZH 3PP3K 4W6XB 2XWTB 4P23B 4Z77B 4MCYA 1L0YA 2DIJA 1F5WA 5I1DB 5GZND 3BKJH 2Z93A 4KVCL 4NHUA 1C16A 1OAXL 4OZHA 2DQUL 3EO0A 3TBTB 5IFHH 4JFYA 1OY3B 3RVTC 4O00A 3IAQA 4XMKH 2OSLB 1U8IB 3PWPD 2BFVH 2CDGB 3BGAA 3SKUD 3WHE1 3HE7C 1TZGH 5MI0C 3MJ8B 3OAYK 4CMMB 2NY2D 4P2OD 3SO3C 1F4XL 5D1XB 1BQHB 4FXGB 4Y4KA 4GG8B 4DKFL 3VFSA 5IUSA 2FSEA 1UWXH 1P4BL 1F58H 4PJ5D 4OUUB 4ODWB 5GSRB 1CR9H 1HE7A 1DQQA 3X12A 3TO4D 2GKIA 2D9CA 3PGDA 2Y07L 4JQVA 1AI1L 1CG9A 1BGXL 3DUSA 1QBML 2HFFA 4HUXA 4I3SL 4KKAC 3FFCD 4YEEA 2O5YH 2XWBB 3P0VL 5D7LB 3H8NA 4NDMA 1GGUA 3VFNB 4X7SL 5C7XH 4M6OL 4PJ7B 5J0BA 3GJEA 2J4WH 1H3VA 3L3DA 1T5XA 1JN6B 2YBRB 1JBJA 4J8RB 4JHWH 3D3VD 1FFNB 2J8HA 3BFOA 4OKDA 3WIFA 2YD4A 4D8PB 3O0RH 4KHXL 4ZFFB 5EUKA 2B0SH 3ECBA 1LWRA 3OZ9L 3LKOB 1S9KC 3OQ3B 3O9WB 5EN2B 1FFRA 4CJ0A 4GW4A 1CDIA 5SWZD 2FX7H 4FQ1L 5DT1H 3SDAC 2WBKA 4FFWC 3CDGA 4QT5B 5DMIL 4N8VG 1YY8A 3VH8B 3MR9B 2DWEB 3VWJA 5KZCD 1AQKL 3TO2A 3FTGB 1TDQA 2G75B 2XZZA 4WTZG 4AQ1B 3KYMA 3LH2H 2LVCA 5DJCB 3WLBB 5CEZD 5FYLH 3PP3H 3RTQA 2YPLD 2G2RA 4MS8C 5BVPL 4KV5F 1BQUA 3UTTA 3ULUE 3O3AB 3UYRL 5TE4L 3WKNA 3VFVA 3N1QC 2HT4C 3I50L 1EA9C 4U49A 4JGMA 1QRND 4XVTL 1MJJA 5DZLA 1DANT 4NQSA 1AD0B 3O45A 5DEFA 3FQNA 3HMXL 3QJHB 5JNYA 3FO1B 5EO9A 1T5WA 2K9UA 1JTOA 2EYSA 2WK2A 1U3HC 4QXUH 1X5GA 4JFXB 2NNAA 5FKAA 3KDMA 5CEYB 2EH7H 3RGVC 1FLRH 4ZFOA 4BK4A 2AJ3A 1NMCC 4PJEB 1ZSDA 5EU5A 5DO2C 1DJSA 1OF2A 2YPVH 3T2NL 3LMJL 3T0EC 1J7VR 1UZ6F 4KUZH 4PJGB 5GSVB 1TCRA 5T5NG 3MV7E 1J8HD 1MCPH 2X4QB 2W1NA 5D5MF 5DUML 5HY9A 1G6RA 5FIEA 4R7DA 2AXFB 3NIFE 3PHSA 5GHWH 4JLRA 2V17L 4IIQC 4G9FB 4JO2H 2NXYB 2KH2B 3NPSC 1NCTA 2DQHH 3IDXL 4P3DA 3T09A 2H32A 2XQYK 3AS0A 2OJZH 4I48A 1F97A 4LGSB 1IAII 3QCVH 1SJXA 2E7MA 1GGIH 1JWSB 2A77H 4AH2A 3HUJB 1FAIH 2YD7A 2EDEA 4XT1C 2Z91B 4LKCB 1HH6B 3HZKB 1A0QH 3EYUH 1WCBB 1QYGL 1BFOB 2CXGA 2XNAA 3GM0A 4AEIH 3B5GA 3QFJD 1F3JB 4ONFH 2AXHA 4C56B 1SY6L 1P6FA 3HPLA 4OBRA 1DBAH 4O2FA 1LK2B 1GGTA 1CGTA 1CFVL 1RJLB 3RX5A 4HC1A 2HT3C 2R9HC 1TPXB 4ZFZB 4M7LH 1DVFA 1W72L 2VL5B 3ULVL 3O6FD 1HXYB 1FCGA 2VLRE 5ANME 4U1IB 1NH6A 3R06A 2VIRB 1RY7B 1UWGH 4D8PA 4LLDB 4EEEA 2Y72A 3RL2A 5BQ7A 2OJEB 4ALAL 1KIQA 4XCYA 1P53A 4GXVH 3DVIA 3GEWB 5TDOA 4TSAL 2MWCA 5FA4B 4CVZB 3HZYA 4XMPL 3H3PL 4EVNA 5IW6B 1INDL 1GGBH 2M2DA 1A2YA 4LCWB 3OBAA 1V7ML 5DC4B 1CDGA 5EG6C 4PV9A 1FVCB 3GSQA 3SDCD 3WL9A 2D7TL 4MD5A 2X40A 1NGPH 4ZAKC 4UDTB 1KIRA 5HGDB 2PYEE 2HAZA 5T5NF 3D0VB 5F3BB 1KCVH 2PW2B 4LHUD 1V3LA 1OAUH 3H0TA 2NY4C 2LFGA 1N8ZA 3R8BB 3BKJL 4FQCH 4OV6F 4HKZB 1UGNA 4DN3L 3CFCL 1AP2A 4F15C 5MEOA 3SCMD 4OCSL 2DQUH 1HZHH 2VLMD 2BOCB 1ZWIB 2OTPA 2VWEE 4OIIH 4KTYA 5EIQA 4XC3L 3TV3H 4P3CH 5E8PB 3P4NA 5A2KH 3UAJD 5ETUA 2B8OT 2LQRA 4NJAH 1MCEA 1ZGLA 3GMLB 2P44B 3HI1B 4YDVA 4QWWD 4NC1E 3MMEB 2NXYC 3ULUL 3ULVF 1ERNA 4O2EB 2X9XA 3VWKA 4I2XE 3QUMA 4XP9L 3T8XA 1F00I 3SJVB 1AKJA 2I27N 1BHGA 5SWQA 5KSVA 4NJ9L 2H8PA 3F7RA 1AGDB 5EA0L 2X4NA 2HT4D 5F7NC 1J8KA 1AI1H 2AI0L 4Z95L 2V7NB 35C8L 2BVQA 1KLUB 3FN0H 2VQ1B 3ULVC 3O41B 4OZIB 5EZIL 2MJWA 3DJ9A 4HPYH 4MWFB 3K8MA 4M8QB 2CDEB 2H26B 4DKDC 4H8WC 4X4YA 2W38A 5SWSE 2WW8A 3LHPL 4Y16C 3QDMD 2DWEA 3VWJB 4JHWL 1OHQA 1M4KA 4FQXA 2AEQH 1I75A 1F11B 2BVUA 2BRRH 4LK4A 3P30L 5D7IF 2XWJA 1LP9F 5JPMB 2UVFA 3BPOB 4JAMA 5DJZA 4CKVX 3QUXC 4QTHA 1IC4H 2HRPH 4LPTA 2CK2A 3S4SB 4X5XA 1YEGL 1I7RA 2VDNL 3CSYA 1FO0H 2A1WL 2KBGA 4WWKC 5FO8B 3TM6A 4KTEH 5IMKB 3QH3A 5EBGA 4ZUSA 2ICCA 3KVQA 1MY7A 3V6ZB 4KK6D 4OD2A 1WZ1H 1R3KA 3FOLA 5DMKA 5EC2B 4MSWA 1PDKA 2XTLA 4DGYH 5HD8D 2XXMB 1HSAA 4JM2D 1RIVH 4PYGA 3U0PB 5JORA 4PY8J 1BVKB 1FG2B 4WW2C 4AH2B 4YDIL 5GS2H 3ZTJH 2MQ3A 3HZMB 1TZIA 1A4KA 4QHNA 4OSUH 1MEXL 3IDMB 2EDYA 2DYPA 5K59E 2EDFA 4U3CA 4J1UA 2WIIB 5IMMB 5EOQH 1CXHA 1ORSA 5GS0D 5HYJB 5KN5B 1WBZB 4M03A 1T6VN 2EKJA 5CEZH 4X5LA 1DBMH 7CGTA 3G6JA 1KXVC 2ADJB 5ISZE 2D4DA 3EAKA 1QBLL 3NFNA 1FIGH 3SGDI 3QUYB 1ZA6B 3U7YL 2F8OA 3QWQB 4FZ8L 1UB5B 4HWBL 2A9NH 5E08H 2VO5A 3BDBA 4FQLH 5DYOB 4NQCD 3E2HB 5D2LB 4TVPL 4QXGL 3QDMB 4UT7L 5HVFB 4D0DA 1JPSL 4M02A 4JCMA 3VI3F 1NCDH 3D85D 4I3RL 4QXWA 1A9BB 3LOWA 5F88B 4DZ8B 2VWEC 4Y1AE 5AZEL 1YA5A 5AAWA 1MHPH 2L0DA 2L7UA 4NUGH 4QEGA 4W6WB 4I13B 4G7YL 4O51B 1QYGH 2AJVH 2G2RB 2VSCA 3B5TA 3MRRA 3HZMA 1AGBA 4AMKL 5F9WB 3V5HB 4TVPD 3PWLA 4U1SB 1MSPA 3V5DA 4JRYD 3O6MH 1BVKA 4HPOH 4Z5RA 5HYSB 4G6JH 1FZJB 3H9YA 2APBA 4X5WA 1UACL 4PJBA 5ENWB 1B0RA 2NY0D 4OJFL 3STLB 4JN2A 3QI9D 3IU3B 4OZ4A 2P5WE 1AP2B 1F4WH 5T3XH 4I5BA 3DVNA 3U6RA 4UDUA 1TXKA 4XVUD 5HHXH 4TSCL 4Y1AD 1AGEA 1KT2B 2FECL 3MRDB 5J9PB 1S5HB 3WUWA 1J1XL 5EUKB 4O9HL 1MCRA 5DC9B 4ALAH 2ZUWA 3QDAA 1GHFH 3ARBC 1FYTD 2NY6D 3C6SB 4XMPH 1MWAH 5ESVB 3V52H 1IT9H 4NWTH 2IADA 1I1YA 2NR6C 1G84A 3SOBH 1NDGA 4HK3J 5DTFB 5DZNA 5IKCB 2XWBA 1MVUB 5BXFA 4FTVB 1RURL 1NCCH 2GJZA 3D18B 2XZCL 3CXHK 1J10A 3T2PA 3NH7H 3BDYL 5DD1L 3VFMB 5JHDD 3MUY1 1MFCL 1UENA 2BXZA 3HZYB 2BNRD 4KKCC 2A83A 4GSDH 2PR4L 4JJ5B 3L3HB 3DRQB 5F1IB 5K9KA 2Q7NA 2CLVB 3F7QA 3IDYC 2ZG3A 2FHFA 1MCCA 2O61B 4JHAL 3MGOA 4FQCL 2CRIA 2YEZA 3HE6A 3H9SD 3HNSH 3VD7A 4M3JA 3DARA 2UZYB 5F1NA 1G1CA 4JKPL 4PJHB 5IW1B 4XRCA 3HNVH 4XNXL 3GMLA 4E5XB 2C3WA 3SE3C 4X4XA 4OIIL 2R2EB 5C71A 2GY7B 4AG4L 5HHMD 4X7TB 4AY0A 1UYWL 3N06B 2V5MA 4MQXD 4JFQB 1BQHG 4PBVC 4FFVD 1JYXA 5FUOL 5A16A 1EJOL 2QR0B 2VB5A 4TSBL 4A2MA 1HYSD 1SM3L 3CXDH 2NX5D 4ONHA 1EVUA 5MP6H 5CIPH 3IT8D 1FPTH 4PJ9B 1N5AA 3DECA 4XPGL 4AIZB 5J6HB 3IFLH 4ZTOH 1JZ4A 5DHVA 3FOMA 1I8LA 2C3GA 1Z5LB 2AI0H 1YEIL 1ITCA 3VWJD 1CE6B 1EFQA 2QQKL 5K59F 2VN7A 1FZKB 2VKXA 3NZ8A 4HPYL 3G04B 1MIEL 2YPKB 3VXNB 3ROOA 3T0WA 4IRSC 3JV4B 2NY7H 4U0QB 4G5ZH 2EDDA 4EUPG 1R24A 4JFZL 4ZQKB 5DMYA 2HJFA 1A6VL 1YJDC 3STZB 1P1ZA 3PUCA 4LQ1A 3FOMB 5T1KD 1M6OB 5L2KD 5JOFB 1JWUB 4S2SA 1DN0B 1YMMA 3Q1SH 3KYMB 3KPRD 3BIKB 3FFCE 4H26B 3W0WA 1YEGH 4G8EB 3TYFA 5TDNB 3G6JB 5DFTA 2W0KA 1VKXA 3CZFB 2DQDL 1M7DA 2P24A 5GRVL 4LFHG 1RQ5A 2BC4B 3WNLA 1XFPA 3VI3E 3QUXA 4PLKC 4D9QE 5I2IA 4K23L 5C3LD 4HFWB 3QQ9D 3FQXB 3PDOA 3RVWD 4NKQB 3LVEA 2Z4QA 2OX5A 4FOMA 4Y4FD 3MUGB 1RIVL 4OCLC 2N7AA 2IEPA 3KPSE 4CMHC 4MA3B 3KLHC 1HNFA 3VU2A 2PUQT 3DYPA 1NBQA 3GRWA 1CICA 3CZFA 3WHXA 1G7JA 4JY5L 5IQ7L 4LLWB 5CILH 1M7DB 1FNLA 3P4LA 1CQYA 3LN5A 3OL2A 1W72A 2X4RB 2O5ZH 2VLRB 4HMDA 3MUJA 1UXWA 5I30H 1P9MC 1IL1B 3GFUA 4ELMF 5BO1L 4DKEH 4P5KB 4ONGH 2ZPKH 4ORZC 4XPHL 4WHTB 3QIBD 4ZG1A 4P2OA 5EO0B 4UU9B 2R29H 4YBLB 2AQ3A 4TVSa 3VFOA 5GSRA 2WSKA 5ALBL 5C0CE 4S1QH 1NJ9B 1TTGA 4F37F 1SMOA 1S9YB 4HKBB 4LVOC 3X17A 4RAVB 1F3DJ 4PJ5A 4KH2A 3JV5A 1UJTA 4RISH 5EU6B 1BFTA 1ZXQA 2ED8A 5JPMA 4GG6B 2WUCL 4JG0H 1LDPH 4Z7QF 2CDGA 5HI4C 4PTUA 3R0MA 1P4IL 4EI6B 1MJUL 4HKXA 1RAMA 2R1WB 1YUHA 4Y16A 2NW3A 1IAKB 1AD9A 3EDFA 2J6EL 5GQBA 1GCFA 2QQQA 3KPOB 1MCNA 4MNQA 3HC3L 3SKNA 5E7BA 5DS8B 5I16A 1OAXH 4MJIE 5FM5M 1T1WB 1KXTB 1RJYB 2X4UA 3KDMB 3QQ4B 3I75B 3VFWB 3D3VA 5DRZA 5KVMC 5I17A 3QDGA 3QIWA 3O8XC 4GS7C 4OGYL 4YFDB 2Q1EA 2XFXB 3G9VA 3X3GH 1RZIA 3Q6GH 5FA3A 1BZ7A 5BRZD 3TZVD 3NBNA 4R0LB 1K8DA 1N3NA 1IMHC 5I1LB 1NEZG 3MLRH 5DMGD 1JPFB 1MFDL 4MJ5B 2VABA 2A2QT 3CX5K 2IH1B 4PJHA 1FVDA 3DVFA 3L3OB 4G8FB 1N64L 4LVOB 1AFVL 4HQQL 1CR9L 2EYTB 1F4AA 3U1SH 3U82B 4CADA 3VXMB 2LAGB 4OV5A 5BJTA 1SBSH 2YA2A 1EHNA 3CC5B 3V4UL 3I85A 4OZGF 1W8NA 2O5YL 3P0VH 3GSWA 4O9HH 4PV9B 4JRXD 3W11C 3UMTA 2ATKB 3QHTC 4OLZL 1W8OA 3QXAA 1MCDA 3SKMA 5C0EB 1Q9OA 4OZIE 1HQRB 3Q2CA 5HI3D 5C0CB 2IWGA 1IGCL 4R4BB 4H5SB 4NWTL 2DWDA 5GGVL 3T3MF 1N8ZB 3JUYA 3ULVD 2NZ9C 2JCCF 4P23D 1S7XA 5SWSB 3LQAC 3GNMH 5I9QC 2HN7A 3VXQA 1ONQB 1A1NB 2M26A 2VIRA 1XR9B 4CMHB 4MMZC 4HIEB 5F7DB 3QUYD 3I6KB 5KSAD 1G7LA 2AJZA 3TNMA 1T7VA 2WBJD 4RGMC 5DT1L 3MLZH 4Z0XA 5DUBA 1IILE 2XQBH 5D7KE 3GUTB 3W5MA 3NN8A 5EO0A 3OKKB 4HX1B 1HN1A 4RMWA 3U7WH 1CN4A 1J8HA 1RI8A 2GAZB 1I9EA 3QP3A 1RVFL 1AHWB 4CVZA 4CN6A 1IEBB 4NP4L 2ED9A 3CPLB 3LS4L 2PYEB 1BFOA 2QADB 2J2ZA 4M61A 5EWIL 3ZYIA 1MI5E 1W72B 2X4RA 2DBJA 3M07A 3MLTB 5AUMA 1X7QA 3ESVF 4IRZH 4JREC 1FC1A 1AGBB 1HH6A 3HZKA 4Y4HA 1BQHA 1PVHA 4FFYL 4FXGA 4XVTH 3VDBA 3QIUD 4OF6A 2HVJB 2NQCA 3DX6A 1RZJC 1UYWH 1IGTB 2CQVA 5C6TL 1SYSA 1I3RB 4EXKA 2IANA 1FIEA 3RY6A 1H3UA 1DQDL 4GLRH 1VFAB 4K71B 5M95B 4E42A 3IDGA 5MP6L 4NGHL 4WO4D 2R56L 4P2RB 2X4OB 4XPGH 2RHEA 5I1GH 4PR5A 5E2WL 1A3RL 4YHLH 1KACB 1QO3A 5GGRA 3T2NH 5EFIA 4YX2L 1AGCB 2NY5H 5HYJE 4KUZL 3PWUB 2XPGB 3CFIC 1KEGH 4XCCH 4Z7NE 2VLKA 3D85A 3BIBX 5DGQA 3WIHA 3BIKA 1FH5L 3W0WB 2ILLA 2P46B 1H0DA 4LHJB 1A7RL 1WTLA 1MCPL 4NN6C 4RWHA 4N8PA 1G7IB 4YLQT 2BP3A 4H20L 5HDBE 4OI9A 1PQZA 3S8WA 4R9HA 4O51A 2GJ6A 1BVLB 3SDYH 4JFXA 1IEAB 1A6VH 3OXSA 2V7NA 2J7LA 4YHPA 1W0WA 5E6YA 2OJZL 4UOW0 4R0LA 4HCRA 4HD9A 4PJCE 2P45B 1VGKB 3GSRB 2Z0BA 5DQJA 1XF2A 2PO6C 3Q1SL 5ILTL 2B5IC 1FZKA 2G5BB 4UTAL 5HHOE 4LARL 1K2DB 3MREA 1R3JA 5B22A 3KWWB 1OD7A 1JYNA 1ZHKB 2OR8A 2X7LA 3JWNC 5DJXA 4Z9KB 4HUUB 5CJOH 4LRIA 4ZNCD 2JF1A 3DROB 1XF3B 3P4OB 2N7BA 3OV6A 4TVPE 3KHOA 4L8CA 4GMSH 4UIMB 2A6JB 2JJVA 4HLZH 3GSXB 5I18H 2HA1A 3F62A 2WIIA 3S35X 1GPOL 3IXAB 4M1CC 3JWDC 3GK8L 4PB0H 3IVKB 3TNMB 2OK0H 1UWGL 5F9OL 4PRPE 5I2IB 4IDLA 3MODH 1BBDH 4YC2C 4GXVL 3PIQA 4TSAH 1DBKL 4ZS6D 3BN9D 5F7DA 3H3PH 5J13B 1ZLSL 1ZA3A 3WXVH 1G9EA 3M17B 1INDH 1S3KH 4GXUM 3LV3A 5IQ9A 2AVGA 3T04D 3SO5A 3TGXA 1UXSB 4JGJA 1G0XA 3IDUA 4OCWL 3TESA 4MCZB 1JWMB 5DO2D 5GS0C 2X9YA 2BVTA 3OB8A 4LLWA 5JUEH 4M8QA 1CI5A 3B9VA 1J1OL 1JHKH 3FRUA 1FNHA 3QXAB 5C0EA 4HGKC 2BNUB 1P1ZB 3OKMA 1LNUA 3PABA 3O41A 3RL1B 3D48R 3KWWA 4GFTB 1C1EL 2OCFD 2WUCH 4G8IB 5T3ZD 4PJCA 2A0LD 3G6AA 1AGFB 2JCCE 2W0PA 4PRPD 5L8KB 5HHOB 3ARDD 5EOCH 5EU3A 4Q7DA 3B6SA 3V6OE 3B8YA 3VFPB 3QEQD 4UQ2B 2V2TB 5IBUB 4DN3H 4O2CA 4BQBA 4D0BA 3DLQR 2E6QA 3KS0H 1VSCA 2VISB 4RDQG 5EUOF 2MCG1 2W91A 4O2EA 1HZHL 2NX5B 3ZE1F 2B1HL 3G6JF 2GCYA 4ZUWA 2GSIA 5J9PA 5JLZB 4RIRB 4W6YB 3OKDB 2V7HB 1KUMA 2B2XL 1JK8A 1S7VA 4R4ND 5DGRA 5C09E 4HDIA 4LVEA 2DKMA 3FFDA 3Q6FA 5T1LD 3QUML 2O5XH 3GMNA 4XXCA 3HPJB 1CD0A 4ODWA 3MLRL 2NXYD 2XY2A 5ESQA 3SGEH 4WUUB 4J12A 8FABA 3WSQH 1NFIB 5TF0A 5I0DA 4GG6E 3VXNA 4L8DB 1IFHL 1XGRA 3IJHB 5CGMA 1MH5A 3CJJA 2GCYB 2H2SC 2R15A 3L7FB 1QSFB 4POUB 4KXZH 3LS5H 4JG1L 1M7XA 3X13B 2OSLA 3KXFD 2PW1B 2R2CA 4RRPA 1RZKL 2EDXA 2ARWA 4JM2A 4NT6A 3V95A 5B3JE 4ZTPH 4LVHC 4R90H 5HHNB 1HHHB 1VFBB 1GOHA 3MLUL 5CSGA 4F7TB 5GGVH 3ALWA 4HF5H 1OB1B 3AS3A 4H0HB 1UZ8A 3TA3C 3GNML 4M1CD 2JTDA 1CGUA 2E9JA 3IETA 4WHTA 3RKPA 1IKNC 1J05B 1UWEL 1MJ7L 4PREB 3BH9A 4UQ3A 4IRSD 4X9FA 3TO4C 3RHWF 1JL8A 3GUTA 4U6XA 3MRGA 2NX5A 1OP5H 4NO2A 4P9HC 5CWSB 4ELMA 2X2YA 4KMLB 4NQCE 3TT1H 2M1KA 3AY4C 1UWXK 2BVEA 4YR6B 2KDGA 4FQXC 5D72H 4KZEH 5DD5L 1EAPB 2A73A 4JRXE 5JXAH 2XQBL 5GJTL 3HG1D 3TBSA 1IKFH 1KJ2L 4PRHA 1NCWL 2J8UB 3BE1H 4KJYB 4XPFL 5H2BA 3C60A 3ETBF 3W2DH 2RAMA 1Q0XL 5BZWB 1GC1L 2EICA 1JHTA 2W07A 2E6JA 3C5JA 4QRSA 4OZFH 2EE6A 4S1SL 2BNUA 3DI3B 3IRZA 2OS7A 5SWZB 4IRZL 2HFTA 1KIPB 4G6AD 2P24B 3PQYD 2BY3A 5D1ZB 3QEGH 4ACPA 4HJ0D 5B39G 1XF3A 3UO1L 3ILPA 4CADB 2CLZA 2OXHA 1HHHA 4HS8H 4QHLB 4KJWC 2QSVA 3OJMB 1ZVSB 2R56H 2XTJE 5EOQL 5C2BH 3WN5A 1Z9LA 3FO9B 1YPZE 5C86A 2DQGH 4P5MA 5C8JA 4WU5B 3O4LE 4JRYA 5FKPA 2DYPD 3IXAA 1V3JA 2ORBL 2EDKA 4D2NA 3RJQB 4LSUL 5I1HH 1G6RH 3DGGA 4JFHE 4RCAA 3GSRA 1U95B 3FL7A 4XCCL 3GSXA 4Q0XH 4MJ4A 3RQ3A 3QNZB 1W0WB 2HFEB 5C0CD 1QA9A 4FZ8H 5ESQB 3RUGB 3T0EB 2DI9A 3KHQA 1AXTL 2IALA 1T7XA 4NDMB 4M62H 3IFOA 3DXAD 4FXKA 1OW0A 4F58L 3TIEA 1DLHA 1U8PB 4IOFC 2AXGA 1KTKE 5FB8A 1WUNT 2Q7YB 3V5KA 2AEWA 4NUGL 1JZ6A 1CFQB 3SDXE 4P2RE 5D70H 1WFOA 2ENSA 3FO0L 6FABL 2WINA 2V2WA 3WJJA 1A3LL 2E8YA 1JTTA 1FYHB 3L6FA 4M7ZB 5HHOA 4WJ5B 1CT8B 3W9DB 1WWAX 4X4MA 4WFEE 4XI5D 1OT1A 2Z8WC 1E4KC 3BZ4A 1GOGA 2X89D 5L6YH 4CRPA 4H1LG 3DWTA 1I3RA 2JJUA 3PHOB 4S1DD 4AQOA 4OLEA 1VFMA 3C60D 3EDDA 3FTGA 1DSFH 3EW3B 5GRYA 3CCHA 2CDFA 2D4FA 1S9XA 4M6ML 1GPOH 1BIHA 3ARQA 5J1AB 4PV8A 4J7RA 1OSPH 2Z31B 5KSBA 5DJ8A 1DL7L 5F9OH 3QZWG 5BVJB 2P7TA 4Q6IB 3CSGA 4P2RA 4GKSA 1GHFL 2LVEA 5IJKC 5EUOB 2Y1VA 5T33H 2NMSA 5FO8A 3SO3B 4HWZB 4U6YA 1VFAA 1RV6X 3SGDH 3DHMA 5F7EL 4I8DA 5GZOD 3GSNB 5GGVY 4J3UA 3C2AL 5JUEL 5KOMC 1NCCL 1EEYB 2G75A 2EDNA 3KYAA 2R1YA 2CSPA 3ILPB 5AAMA 2PYEA 3VCLB 3VXUE 1VHPA 3E2HC 4PJ5E 2HMID 2GTWB 4X4YB 1NC4B 1NUFA 4GRWH 4PB9L 3QG6B 1WEJH 2VDOH 1G0DA 5C0CA 5AEAA 2BSSB 3I2CH 4Y4HD 4XAWH 5EOCL 5LG1A 4C54A 5KSAC 4GOSA 5TQ0L 3T0DA 4YO0A 4JHAH 3STZA 1Z9SA 4CUCA 5B21A 3BAEL 3BD3A 3O6FA 3AXLB 4Z5RB 1ZAGA 1T1ZB 5BMFL 5EZJB 5BS0D 1A7NH 1I9RH 3AS2A 5F9WC 3MRHA 2LE9A 1U3YA 5JW5B 2HTLD 5HVGB 3NIFF 4FQHB 4F7PA 4U1JA 3MACL 3P4MB 1JRHL 2EZ0D 5AYQA 3KPRA 3PV6B 1XZ0B 4TSBH 2DWDB 3SBWC 4KQ4L 3GDBA 1AIFB 1F6FB 2E7LC 4OI8A 2H26A 1FPTL 4OB5L 3SHSA 2ATKA 5GRXG 3GJFK 5I1DA 4KJPD 4DZBA 1ACYH 1WTGT 1ZWIA 2BOCA 1IGFL 2XG4A 4XX1E 4N1EA 1TTUA 3GBLA 4WDIB 1XGTB 1JPTL 3Q6FB 1FN4B 4YXKL 4P57B 4IS6A 2QQKH 3DMMB 3MRKA 3L3GA 4GG8A 2X4PB 5HGBB 3UYPA 3F6LA 3IDGB 4ZTPL 1QLRB 5C0JB 3FFCA 3W0WE 3LDBC 3IJYA 5GZNC 4LCIH 3WNOA 4QRPD 5C0RL 5MENA 4MJ5A 2RQ8A 2HRLA 2DB8A 3ZL4L 4NOBA 4X7DC 3TP4A 2P8LB 1HXMB 43CAA 3MLTA 5AUMB 2E5EA 2AJYL 4Y7MA 2MCPL 4E41A 4G8GB 9CGTA 3OR6B 4X4ME 4EUPB 2ID5A 3BYTA 4XPAL 1D9KB 4XZUB 3TT1L 2ARJQ 4KRPD 4KZEL 4NQUA 4HEME 4N0UA 4U4BA 3SKNB 1I8LC 5JXAL 2YUZA 2EE9A 2NW2B 3RNQA 4Z8FH 1KJ2H 5HYQB 1MCHA 3FKUS 4PTUB 4EI6A 1KGCD 3U0PA 4U2ZA 1KBGL 5FDWA 2IF7A 5DRNB 1BM3H 1G7LB 3FB5A 3JXAA 4HJGB 3BEVB 1CICB 3MV7D 3DBXB 4FABL 5JNYB 3F8UB 2QHLA 3SGKA 2FR4B 1WFUA 3IFPB 1JF5A 1F13A 2NXZB 2YPLA 4P2QE 2AJUL 2WUBH 3BZFA 3VXQB 4V1DB 4B7IA 3PF2A 2YMXL 1CIUA 3FO9A 2G60L 1G9ML 3BHBA 2FLBT 4WTXA 1MCWM 3SGJA 4ZFGL 1P5VA 3UXFA 5IHUH 2EIZA 2LAAA 2MQCA 3D39A 5GGTL 2SEBB 3LEYL 4MA7L 2HMIC 4FFZL 1FCCA 3KXFB 5E4EB 5D1ZA 4LSUH 2YD6A 5I1HL 4X0KB 1NCNA 1NFDA 2EECA 2FJHA 2QSTA 3O3BA 3WO3B 3KNBB 4TNVF 4OQ1A 4AEHL 5I73B 3ARYA 5LBSH 2HJFB 3ZE0F 2BVQB 3RVUC 4JVPA 4QRUA 1WWWX 2R1XB 1MHEB 2DF3A 5KSBF 3L9RB 3SQOH 1X4XA 2JCCB 3I3BA 2X1WL 3L3DB 4OCYL 1IARB 1T1YB 1NFDF 5F7MC 4YR6A 5DA0B 4PTTA 1NSNH 4R8WL 1A7BA 2YR3A 4ODXA 5D70L 3QPQC 1JZ3A 4P59H 4U6VL 3MROA 1EBPA 4OGAC 3P4NB 3RWHA 1V7NH 4PJBF 4ELME 5B3NA 2Y36L 2XPGA 5C09B 2C9AA 2EYSB 1B3JA 3QISA 1I1CA 5TPWL 1E28B 2P5WA 5EOTA 2GW5A 4YZFE 3QFJA 4KKCD 5IROA 3ROOB 2Q86A 2P8LA 1ZK9A 1SJEB 1N64H 1T89A 3WEXB 4HV8B 4L8SA 1U3HA 5F70A 5KSVB 3RWJB 1DUZA 3MC0A 3ZT7A 4F7CB 4N90E 4EN3A 4M6MH 3RAJL 4L4VA 1LE5B 3F7VA 4LCCA 4S10A 3V4UH 2KL6A 5I6XB 3S36L 1N59B 5CZXD 4Z7WE 3QEQA 1N5YH 2CR6A 4OLZH 1FO0A 5DQ9B 1S7UB 1P4LB 3ARGC 4G42A 4ONHB 2C7UA 5D7JA 3QPQD 2APXA 4PJ9A 3GBNH 3L3HA 3C9NA 5CIPA 3THMH 1JUFA 3MBXL 1AXIB 2C3XA 5F7EH 2H45A 2GFBA 5HGHB 4L4TE 4R96A 1V3MA 3MV9A 1JPGA 5E8EB 1JE6A 4YK4C 4V1DD 3D39D 5IESL 3GSUB 3C5ZB 3EYFA 3DX9B 4HAFA 5LGKA 1IGYA 5F9JA 4ZUWB 4HIJB 3E3QE 4K9EH 1HXYA 2YS4A 1LD9B 4KJYA 5KAQG 5ISZA 1YNKH 1E4JA 3OKEA 2YWYA 4GLRI 4HIEA 5HVWA 4XAWL 4FQJL 4ERSH 4MXVE 1RJLA 4Y5VC 5B8CA 1V8HA 1S7XB 5SWSA 2DL2A 1NGYA 4ELMB 4P49A 5C0FA 2W65B 4BSVB 2AJXL 4JR9H 4EI5C 1LE9A 5IEKA 1T0NA 4KXZI 3RWEB 12E8H 4RGNC 1U8LA 3INUL 5F1KC 3DHJA 5FOJA 4M7JL 4XHQA 1ZLWH 4FTVA 2XN9D 4Y4FC 5C6TH 1DVFC 1TZHB 3MACH 1HI6A 3NZHH 5CAYB 3EYOB 3T0ED 3VFSB 3T3ME 3REVB 1NL0L 4OF0A 5ICZB 4MNHB 1AGDA 1FORL 1DQDH 1TCMA 2H8PB 4K7PY 4KQ4H 5D1XA 1OP9A 3UJTL 5HGGS 1IAOB 1C5DB 4OZFA 4PJ7E 1YEHH 3MCLL 1MRDL 3QHFH 1GRWA 1ACYL 2XTJB 4H0IA 1NCBL 1JPGB 1IGFH 5J11B 2CIIA 1A3RH 4YHLL 3OF6D 1AC6A 4KK9C 5A3IC 5DJAA 1AKJD 3V0WH 2NY5L 5AWNH 4KVNH 5I74B 3ARSA 4R4NC 3TZVC 4NQXA 4LAJH 8FABB 1MRCH 4OGXH 5E0QA 4LMQI 3V6FA 2E3VA 1MCJA 1YNTA 4KKLD 1TVBB 3TN0B 4F7MA 1BJ1J 4KWUA 5CZVH 4NBXB 3RGHA 4W4NA 5C0RH 3FT3A 1T1WA 3T0EE 5ID0B 4JFQA 4K8RL 2CD0A 3ZL4H 1LO0H 3KYKH 1FV1A 1I3GL 4Q9QH 3HUJA 3C5ZD 4H8WL 4OLXH 1HWGB 3KR3L 4GQPH 3CDYA 2ADJA 2AJYH 2MCPH 2A6KA 3FB8B 3VW3H 1DDHB 1L9MA 3IJYB 3RHWK 2DD8H 1KIRB 2I5YL 4GKOA 4PJAB 1NUNB 4HKBA 1CFNB 2D03H 3BT2L 4Z8FL 5HY9B 3KPTA 4L8BA 2BMKB 1DBBH 1Q72H 4AM0B 1GVIA 4I2XA 2VLJB 2VR5A 2I07B 1DEEA 2BVOB 3LKPB 1CXLA 5EBMA 3RPIB 2NW3B 3BDXA 3ILQC 3ME0A 4Y16B 5FA4A 2BSRB 5MHSE 4JRXB 2WUBL 5ESAA 1ZLUH 4NCC1 3GMPA 3ORJA 5D6DA 2VLRA 1UM4H 3D39E 3VWKC 4RMTA 1NAMA 1MLCA 2PO6B 1J1PL 1QO3B 4HEPG 2NY3D 4PB0L 2JB5L 3O6KH 2OK0L 2BHZA 1DQJA 1T7WA 25C8L 4HHAB 4ZFGH 4KJQC 3A6CH 1OAZH 3IF1A 4LEOB 5EZLB 4M00A 3L9RA 4Y4FB 5IVXB 3B2UD 2MOVA 4JO1L 1MUJA 2EDBA 1L0XA 3R1GL 4XI5C 3VMPA 1OSZB 5L7XL 3DVNB 3U6RB 3G5XA 2ESVB 3LD8C 4G9FE 1INEH 4Y4KD 1TZIB 4HIIB 3IKCB 2DDQL 3WLBA 2R2HB 5ERWA 1SJVA 4X8JA 5JORB 1AQDB 4JN1H 4GH7B 5E8NA 3LN5B 5ADOH 4XP1H 2ITDB 1H3PL 2O26U 1HHKA 3UBXI 1VACA 1C1EH 1ZLWK 3ZDXF 1AHWA 4ZD3L 4FFVC 2FL5A 5AZ2L 1YMMB 4Y4FA 3BQUB 1R3KB 4APQA 4OT1L 2W60A 4E41E 4OCYH 4N68A 4IBLT 1YPZA 3CFBB 1ZT1B 3HS0B 3U0TA 3DSFL 2DBLL 1FGVL 4DGIH 4L5FL 4X83A 1NSNL 4R8WH 1OGAB 3HE6C 3WNKA 2B1HH 1TPXC 2AERT 3AC0A 3RZCA 4JAMB 5ESAB 5ALCL 5F96H 1QBBA 1RJZA 2B2XH 1A6ZA 1PG7H 2Q87A 2XZQH 2VERN 4D9RE 4H25A 2BXYA 5CGYC 3GB7B 4OLUH 4MXVF 1LEKB 4KQ3H 1JGLL 1I1AA 3EJYC 1MFAH 1G7IA 4LNVA 3OAUH 1JMZA 4P4KD 2Y06L 3NIGF 4BKLA 5E24E 3DSNA 3S9DB 3UROR 3L5JA 2OTWA 5C07D 2CLRB 2HT2D 3DUHA 4HT1L 1YMMD 2GK0B 4OZHF 1KULA 1FQ9C 3GSWB 4S1DC 2K7PA 3TH3T 4PRPB 4UBDD 1U8NA 4OZIA 1TLKA 3OJDA 1OAKL 5I8CB 3UJIH 3LQZB 4UIKH 4PY8I 3BO8A 2P5EE 3JWOL 3MZTA 3MZGB 3UTTE 4R90L 1BJ1H 4G3YL 3CU7A 3SE8H 3QUMB 3T8XB 5I8KH 2CK0L 2VABB 2DYPB 3MXWH 4FG6C 4TUKH 4KRNA 1A4JA 2KUTA 3EJZC 1I1RA 3MBXH 3PL6A 1HK6A 5IJVA 2F9BT 3TA3A 4QHMA 3QDME 1OVZA 4PLNC 4IS6B 3DX8A 1ZANL 2IALB 3DTXA 2BVYA 4M61B 3OGCA 2P43B 5F7YC 4ZXBD 4X7FC 1V5JA 1TVBA 4PR5B 5EC2A 5DMKB 2HWZH 2OZ4L 5MEOB 5D72L 4X4ZA 4N0CD 2HFEA 3DXAE 1TJIL 5D5MA 1U91B 2AEIT 2CR3A 2V7HA 1VADB 3JZ7A 4DUXA 3OAYH 4ERSL 5JXED 3MCKA 4LKXB 4LLVB 3VD5A 4MZ3A 5D1XC 1P7QD 3RL2B 5TQ2H 3W2DL 1NAKL 3CLFH 5D93B 4QTHB 1TQCC 4U1LB 1I8IA 4ZNEE 2G9HB 4JR9L 5DEGB 3EZJB 3ULUD 1JV5A 3HRZA 1U93A 2IQAA 3LDBB 4HFUH 1A47A 5K9KB 4X99A 3PHQB 3UTSA 3QEGL 4Y8DC 2FL5B 4GAGL 1F45A 1VACB 1S7WA 3UO1H 5ID1A 3MNVB 4OQTH 1I8KB 1A2YB 2DMBA 4NQDD 4WIQA 1MAJA 3QI9B 4QRTB 3O4LA 1QFWI 3MFFA 2YKLL 4BSVA 1VENA 1AY1L 2J88L 3FQTB 2CGRH 5BZWA 1BBJB 4GAYB 2XA3A 4QLRA 1T20A 3D5OF 1GSMA 5D96C 5DSCA 2VL5A 2EDWA 5AWNL 1S8DA 3BWAB 2X9WA 1PJ9A 2AK4B 1A6WH 4PJDF 4P4RB 1JGVH 4Y4KC 5CBAB 4UINL 2VAAB 1HINH 1S5IH 5GGQL 1WC7B 3HFML 4P4KB 3GJFA 4CU6A 3MRJA 2VLME 4JFEB 4Z76B 2GFBB 3CD4A 3O3EA 2ZNXA 4MAUL 5IMOB 4XP5L 2FHBA 3SKMB 2YZ8A 3AU1A 1M71B 3CMOH 5T3ZH 4ZO7A 2OR9H 1UB6A 3N1PC 3ARXA 4FXLA 5H37H 4EBQH 4H8WH 1IEHA 1A1OB 4PJXE 1R3IL 3CLEH 3GHEH 3AY4A 3PNWB 4OM0L 2BNRB 5TFSH 2ZUTA 5T1KA 3C87A 4KC3B 5L2KA 1L7IL 1HHGB 2ZOLA 1TJGH 1P2CB 3RTQC 3ZDXE 1A6TA 3BPLB 1DUZB 4HC1L 3RWJA 4R4FL 3HAEG 5KS9A 4BFBD 3U46A 1LE5A 4X6DB 4L4VB 3CK0L 4QWWC 3OJDB 5MI0B 4ODTL 4Q74A 1X9QA 3VRIB 5TDPA 3QEUA 1G7MB 3QIBC 3LN9A 5LCVL 3PWVA 4CNIB 2ZUUA 3C8KB 5E00B 5D7LE 5I17B 4M1GH 3VFVB 5A2JH 3QXWA 5CD3B 1G7QB 3D2UD 4FQXD 3ZKXB 3CFKB 3EOAB 1OSPL 3O6KL 4KZDH 4JHBA 1FNSH 3SCMB 5E00A 5FOBA 4JPVH 3EFFB 2OR7A 3MOBL 1UM6L 5T5FL 1OARL 4RA3A 4WFHD 2Y6SC 4OFKA 5TDPB 2P48B 4OZHE 1FC2D 1NC2B 1WT5C 1WBXA 2QTEA 2P5ED 3R1GH 1T83A 4ODUB 4UV4H 1AO7A 3LN4B 3J7HA 4PJAE 5L9DL 5JIPA 1X5XA 4MLIA 4AZ8A 3P11H 3SDXF 1XGPA 4AENA 4XBPA 4L8SC 4ZFZA 5GS3A 2GJ6E 5EDXA 1NCAH 3QFDA 4YWGH 3E6FA 1A64A 4YDKH 1UQSB 4XP1L 2Z4QB 3QJFB 4JHZA 4EXPX 3PV7A 4XP4L 4GQ9L 3DX7A 3QT2A 4OZGE 1PAMA 3W39A 4BSWA 1A7OH 5AZ2H 4D0CA 4H88H 1JYWA 4PGDB 1WEJL 1W0YT 4YBQC 2NX5E 5SWZA 2CLZB 2ESVA 3FRPG 3X3FL 4HS6A 2GI7A 1LE9B 4NQED 3CPLA 1CXFA 2DBLH 3FQRA 1EEQA 1DQTA 3NCMA 3MRPA 4PPTA 4QRPA 1E4WL 1ZS8A 3V79C 2ZZUT 5GGSY 5ALCH 1LO5B 4OGZA 1QOKA 1HHJB 4ZFFA 3RTQD 3S3PA 4IIQB 1FFOA 5HDLA 2IBBA 3T1FB 3FB5B 4HJGA 2C26A 4OLUL 3FO2A 2DS4A 3OF6A 4RBPK 4ONOA 2FH8A 2XI9A 3SQBA 3OAUL 4GRLD 4WO4C 1N4XL 2HT2C 1NUDA 1Y0LB 3VE0A 1MI5A 4L8CB 1U0QA 1WIUA 4MZ2A 4N0RA 3PL6C 3QQ3B 5D7LA 2FBJL 1GOFA 1KJ2B 1ZOXA 5LGHL 3K3QA 4HGMA 4L9LB 3VFNA 3MRDA 3CGTA 4GRWB 2FECI 2JJSC 3VXSD 4LLMA 4F7TA 2H2PD 3EYQD 1PLGL 4YXKH 2NTFB 1FG9C 3UTPE 4HK3N 1OPGH 4UT9L 2NYYC 1QSEE 4MLSA 3JWOH 4QHMB 2VR9A 3NMEA 5INCB 1NEUA 2AKRB 4CDGC 2VDLH 4FG6D 3QXUA 4YNYA 2G5BA 4E0RB 3SKJH 1RD6A 5DK2A 3ULSB 3NA4A 4ZUUA 2BCKA 3O6FC 5GGSA 1RSFA 1Q9WA 4Y4KB 3HZVA 3VXUB 5JR1L 5HGBA 4FZEL 3L3OA 4G8FA 5I71B 4CMMA 4QCIA 5CSBA 4PGBA 4WV1A 4XXDB 4NPYB 5IF0A 4Z78B 3U79A 3QO0A 1RZ7H 1F90H 5KSAA 5D1ZD 1BLNA 4JFPB 1U8KA 2WBJA 5F7FA 3FN3A 2VRAA 4K7PL 5H35B 3A6BH 3OXRB 1GGCL 3PL6B 5IJVB 1MCOL 3CX5J 4YHYB 5F6HJ 1RZFH 4P23C 5IF0B 2HYMA 4WFHE 1WF5A 5A16B 4XGZA 4Z77A 3FQWB 1CL7H 1N0LA 3GB7A 1BJMA 5C3TA 1ADQH 4D94A 4K3DL 3S5LB 3U36B 4X4XB 4LCYA 3B6SB 5JLZA 1IGIH 3O4OC 1PG7X 2AJUH 4K55A 2FGWL 5C0BA 4J6RL 2DLIA