4XRCA

Antibody hemagglutinin complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
b'YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 40
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA01
2VLKA 1JL8A 5K9QG 2DM3A 2IAND 4LVOC 1VFUA 3IDXH 4P46D 3I3DA 4YHNA 4QXTA 4GW4A 3UTSE 4BZYA 3P4OA 5ENWB 5DJ8A 5DSCB 2YD1A 2HRPH 2ICWI 2PTVA 35C8H 3G5YA 4UT9L 4Y5VB 1AE6L 4EUPA 4N1HB 2V2TB 1F13A 1U8QA 1FFNA 5AZEL 3D85D 1UKQA 3CSYB 4F7PB 3W11C 1CDYA 4U1HA 1CGSH 2AKRB 3BW9A 5DFVD 3WO4C 1Z9LA 4F2MA 2VISB 1AGFB 2VXTL 4AEEA 2BNRA 4KUZH 1MCKA 3LAFA 3V8OA 1N6UA 4PV9B 1QA9A 3P9WB 1IGTA 3WJLC 1WBYA 1AR1D 2YPVH 5I0DA 3MRLA 4XVJH 4J23A 1ZHLB 4UIMA 1CDBA 5IBTL 3R8BB 2A6IB 5IG7B 1QFWH 3MLWL 5CJ5A 3QDJD 5KAQF 3V8CA 4CRPA 3P0YL 2OJEA 1GHFL 1G0XA 4JZJC 1KUMA 1HK6A 4YHOH 2AJVL 2IQAB 3UC0L 3WV0A 2Q6WB 2XA8L 5C0CA 2W9DH 2YA1A 3ES6B 3QQ4B 3QQ9C 1KIPB 3U6RA 1IILE 3C6LA 1EA9C 3U30C 3G6AB 3BP4B 3SO3C 1CFSA 1BEYH 3PV6B 1T3FA 2F53B 4HWBH 4NDMB 4NCC2 3LN4B 4WO4D 5ICYA 3VFRB 5TH2A 4EI6B 2AW2A 3ZTJG 1EVUA 1CD8A 1A6WH 3FQRB 3L3OB 3SDCC 3LMJL 1BVLB 1QBML 2XFXB 1UJ3B 4OKVA 3V6OC 5I1IH 1FIGH 5CJXA 3CJJA 1MIEL 1F6LL 1CFQA 4G9DA 3RKPA 2JJTA 1OTTC 3AREB 1LO0H 3TGXA 2RCSL 2XKNB 2ICEA 1QRNA 3CFBA 4JQIH 1U95A 5HDBE 3VFTB 5KSAA 4GBXC 2IEPA 4KI5D 4YHMH 3GSXA 2DS4A 3FZUC 1FNSH 2OR9H 4N9OB 3ZSSA 5LGJB 1UM4H 3OPZH 1CICD 2NXYD 3LEVH 3T0BA 3D1MC 1RZIA 3FHQA 1CLZL 3RVWC 2VYRE 1MELA 3WD5L 4Z76B 4GAYA 4FXGB 4AT6B 2LV4A 4ZAKB 4R2GD 1UM6L 5C0DA 4G6JH 3HS0A 4Y19B 4TOYH 3QUKA 1FH5H 2PXYB 4UQ3A 3STLA 3U4EB 5HHOD 1LILA 3IDNA 1GAFH 1TQBC 3JBG7 4MLSA 3A6CH 4OD3H 3WL9A 4MQ7B 9CGTA 5IEHA 4UBDC 5B38G 4TNWK 4YBQD 2MMXA 3PABA 5FO7A 3ZTJH 1J1XL 1KCVL 1NC2A 1R3HB 5JQHC 2XI9A 4U0RC 5EOTA 1JHTA 5GS1A 1I9EA 4NJ9L 5DZOA 3QHFL 1UB5B 1WITA 5DT1H 1PZ5A 4QXGL 1E27B 4WW2B 2XQBH 3U36B 2C4FT 2Z91A 1QHOA 1VHPA 2DM7A 4UTAH 1C08A 2MNUA 4QY8A 5L2KE 1N5YL 3HC0B 3O3AB 4N0CC 2N56A 4JRYA 3LV3A 4MB4A 3UTQA 1OCWL 4I1NB 3WIHL 1A14L 1IC5H 4KKAD 4KROD 3SE3C 3GIZL 3MNZB 2XZAL 4DVRH 5I8KL 1WFNA 4XPAH 1NGYB 4OIIH 3IRZA 2GK0B 4HF5H 1OQXA 1MH5B 3CC5A 4YK4C 3A6BH 4JFQB 1I9IH 2VQTA 3RPIA 4ODTL 4H1LG 5D2LF 5EUKA 1JWUA 2CUMA 2ZKHH 1ZT4B 3I3BA 3QQ3A 5IB3B 1BQHA 1YEHH 5DD6A 1JNNH 1K9TA 1S9VB 2CKBA 4JR9L 2CIIA 2F8XC 3EYVA 3ULUH 2YC1A 4LCCC 1QNZH 3E8UH 3N1PC 3NIDF 5EUOF 4UDUB 1P5UA 2HTKC 1KN2H 4PGDA 2N7BA 3O9WA 1OD7A 4OZFA 3QSKB 2YSSA 2G75B 3DX9A 5GISL 3MC0A 3I3EA 2D0GA 5DMIL 4DKFL 5DC9B 4HSQA 4AL8H 1HH9B 2BVQA 2YMXL 3NCMA 2QHRH 1IBGL 4JFFB 5ACZA 4RRPA 3FQUA 1RMFH 4OGZA 2F74A 1D3CA 4DGIH 3MV8E 4C58B 4RX4D 5DXWA 1RJLB 4ODHH 3TN0D 5JW3L 3UZVB 1AGBB 4X6DE 4Q9QL 2Q3ZA 2AVGA 1R3IH 3ZKNC 4Y5VC 4X98B 3NA4A 4YHIA 5FO9A 4RDQG 5EPMB 4Z7QF 5JMRA 1AH1A 2ZUXA 5IB1B 1BWWA 2QR0A 2CXKA 5GGTH 5DRZB 2QSQA 1DQQA 3MGOA 1FZOA 3PE9A 1VFBA 2VKXA 3QIBD 3VXSE 4POZC 3BPOB 3DUHA 5F9DC 4QRSB 1QO3A 1NSNL 4FQLH 3RU8H 5IMMA 4APQD 5C0AA 3BKJL 2HP4A 5D93B 1F6FB 5F8QC 1IKNA 3O6ML 1CQYA 4U6YB 8FABA 2IAMA 4XI5C 1UXSB 2H1PL 4ZFZB 3QFDB 3BZ4A 1OW0C 1FP5A 1NAMH 2AK1L 3D0VB 1VCAA 2CD0A 2X4OA 2XQYG 4PS4L 1OPGL 2ORBL 2RR3A 2ZCLL 3T0WA 4QHNB 1OD9A 3WFHA 5T1MA 4KDTC 1UCBL 1EAPB 1NLDH 2EICA 1K2DA 4JFOB 4G9FE 5TE7H 3JWOC 3QIWD 2BHUA 4M7JL 1UYWL 4GW1A 3T09A 4FZEH 3F58L 1S9WB 4HKJB 5HYSG 3MOBH 5DHYB 1I1FA 3NH7H 4QHMA 2BVOA 2VLRA 4LDOB 4NQTA 3UZEA 4NNPH 5L6YH 1UJ3C 2D0HA 5F7YC 1RY7B 4KUCD 4ZS6C 1A1MA 4D0BA 4I18A 3SDYL 2OSLB 3BP6A 1E4KA 2F15A 1QFHA 3AMKA 3CUPB 3X12B 1MPAL 3AREC 4CMHB 4OLUL 4EBQL 1R3LB 1NCCH 5CIPA 3EOAB 3HE7D 3KPMA 2C26A 4NQCB 4AH2B 3S98A 2QKIB 1PYWA 2R69L 3MFGB 4UI2A 4LRIA 1SJEB 4GT7A 3WFDL 4CW1A 2EE2A 2W9EH 3OHXA 5JW4M 3E0GA 1KJVA 4HFUH 1JZ5A 4ZAKC 3UZQA 5ABDE 4JRXB 4KJQC 3VXMA 3SKMA 4PYGA 3MLYH 4MHHI 2PXYC 3SJVD 3MUZ1 5LGHH 2I5YH 2XZQH 3VXPB 5I1DA 2YD4A 3ARBD 3JWOL 5HGDA 3EFDH 3I75B 3QCVL 1KTLA 1ORSB 2YN5A 3B2UC 5DJXA 4HUUB 3SE9H 4LCUB 4NHCL 4M5YH 3UYRH 5DJ0B 2X4QA 1HNFA 3QO0A 4KK8C 5ISZE 4U05A 2FZ3A 2UUDH 5DMKB 1D9KA 4M7ZB 2ADIA 1A6PA 3ARGD 3GHEH 4MX7B 4TTGA 5BRZB 3WJJC 5SWZD 1A6VL 2BRQA 5CZXC 5J6GB 2YD8A 5C09B 4P57A 5FK9B 4KKLC 4PY7A 3VRJB 3T4AA 4D0CB 5IMLB 5FM5M 2V17H 5CP3H 5EZJA 1T7VA 4CJ0A 5BXFA 2EXYD 2A73B 4LLVB 4WW2C 1ZHNB 4XCEB 3RWCA 3NIFF 4OF7A 3IJHA 1ZLWH 2CO6B 5IWLA 2R1XB 3MLPA 2P4AB 3DUSA 5JNYB 3VRIB 3OX8B 5HYJD 5DWUL 4LCYB 4LLWA 3I6LE 5C07E 2VH5L 1IAKB 4LKXA 3OKMB 4LLDB 1I8LA 2P42B 1ERNA 2VN7A 4RMTA 2UVFA 4I9WE 4KJWC 3C5SB 2X89D 1WFOA 1YEJL 1T83C 2Q8AL 4L4TA 5CD3B 4UT9H 1AE6H 1ZA3B 4B53A 2FHCA 4HLZG 3R4DA 3FO1A 1OM3L 5AZEH 1BJ8A 2FYYA 3ESVF 4P2CG 2ADGA 1CYGA 5FKPB 3W9EA 2X4UA 4CVZA 2Y7QA 5F6HJ 5AAWA 2VDPL 3PWVB 1TJGL 3EGSA 4PJ7B 4P4RA 4Y4FD 4HBCL 5EULV 2JB6A 1NFDE 5CS7A 1G9NL 3T0ED 2YUXA 1V3JA 2VXTH 1ZLVK 3OQ3B 4JO3L 5GS0D 1VSCA 3VWJA 4TUOB 1J10A 3BKML 2HJFA 1RUQL 3GGWB 2APFA 3N0PB 4EZMA 1AIFA 5IBTH 1CFNA 1H3GA 5D7KE 4BUGA 3O8XD 5SWQA 3OV6A 1O7SA 3MRHA 3U2SB 1EBAA 1WCQA 3P0YH 1MFAL 3DVGA 1GHFH 3H3PL 5D2LE 1PLGL 5GRYA 1B0GA 3FT4B 2AJVH 4XT1C 2HH0L 5DURB 2FATL 4Z7NF 1A02N 1N59B 2NY0B 2XA8H 3INUL 4LSRL 5IVZA 1WIUA 4OZIB 1WGOA 1D5MB 2CLZA 3WNNA 1X5YA 3FMGL 2DIAA 4MQSB 2C1PA 3NIDE 5EUOE 4RIRA 2AV1A 3MV9D 1I3UA 3OJVC 5TE6L 3MBEA 1KNOB 3KJ6L 3TT3L 3QNZB 2VDML 1IEBB 3GRWL 3LMJH 1QBMH 2GT9A 2UY6A 4ZFFA 1I8KB 3BPOC 5IIEA 2WAHA 2AEQL 1VGKB 3KAAA 3QUXD 5IROC 3OWEA 5I66A 1MIEH 2NLJA 1QZ1A 5IEKB 2RCSH 1T89C 5D93C 1ZHBB 4U1NA 4LLMA 3B9KA 3GMPA 3FQWA 5GRVK 1W72L 4K7FA 5ID0B 3R1GL 4AY0A 1XGUB 1U42A 4XCYB 2YPKB 2MQ0A 1CLZH 4JFHD 2WMPA 3HI1A 4Z7QE 3WD5H 3BPCA 3NAAL 5DRNA 3U1SL 2F5BL 2F19L 2EYTB 5EBGA 4WI8A 5BQ7B 1UM6H 2OL3A 4FN0A 4JFXA 3GZKA 2P8MA 1QFPA 3CZFA 3IU4L 4ZO6A 3KWWA 4IRJD 4LSQL 1QBAA 2WWKO 4GUPA 3LN5A 4LFHG 3DXAE 4IOFD 5F44A 1KYOJ 3D3VA 3ULSA 4Q2ZA 5HD8C 3SBWC 5FB8B 4J4PC 3H3KA 4PLNC 3LEXB 3K2MC 4PJBF 5T1KB 2Y6SC 2CRMA 4P2OA 1BLNB 5DDHA 4JQVA 3WS6C 2WUCL 5IVXB 5DHXB 1MHCA 1J1XH 1KCVH 3NN8B 2VWEE 4K3HA 3CDGB 5F88B 1MY5A 3OAZK 1BX2A 2O5ZH 4NJ9H 2D7PA 3QHFH 4O2FA 4MA3A 2CO7B 4CMHC 3KPLB 4WUUE 4QXGH 1IARB 1NGXB 1X6LA 2NQCA 2VSDA 3P4MA 3RWHA 1I8MA 3D25B 1N5YH 4NZJA 3ROLA 1U9KA 3WIHH 1A14H 4N0FB 3TM6A 3GJFA 1X5ZA 1NCAL 4LEXL 3GIZH 4H1LA 3TESA 4NRZB 2Q1EA 12E8L 2XZAH 3KXFA 2Y9RT 1TJIL 5EORH 3VXQA 3E6FA 2IBBA 1E28B 3K2UH 1YEKL 2VABA 1JWMA 1JGVL 3PHQB 4Y4HD 4HIXL 2AI0L 4KQ3L 4MD0A 4BSVB 3MJ8B 1WWCA 2ED9A 4ODTH 4QWWC 2I9LA 5T33L 2EDOA 1P9MC 3FO2A 3LQAC 4WTZG 1QQDA 4JR9H 4M7ZC 4Z78A 2IH3B 1JUFB 5IB5B 4L8DA 3H9SA 3FTGB 4OI9A 3MJ7B 1MLBA 5I1KL 3I85A 4M61B 5GISH 2CDEA 3UX9B 4EN3B 5FDWA 5AEAA 3QFJB 5DMIH 4DKFH 3VCLA 2IFGA 4XXDA 2YMXH 4PRAA 1IBGH 3BI9X 1OL0A 2IALB 3S34L 4HUMB 1EHLL 1AJ7L 1JJUA 3RZCA 4QGTA 4HKBB 3SGKC 5A16B 2H8PA 5JW3H 5FA4B 4HUXB 1DUZA 4ELMF 5HGBA 4Q9QH 2J12B 1MVUB 4F9LC 1C12B 4JVUA 5TE4L 3RDTD 1HQ4B 2DKMA 3BGMA 2WBJB 4JKLA 3VXRD 4XXCC 2H3NB 4OZHA 4Z5RB 2VXSL 3SQOL 4G8GA 1M6OA 1I8IB 2FSEB 4LKCA 3UTPE 3G6JB 2R9HD 3NIFE 4ZPTA 5E95B 3OXSB 2ICWJ 4Y4KA 3S3SA 1U93A 3KYOB 4I2XE 1NSNH 4G8IA 4HUWA 5ITFB 5FGCB 4HX1B 3BKJH 4MA7H 4L9LA 4M3KB 3O6MH 4GS7B 4Y5XA 5CLWA 1D5XA 4X6CA 5IW6B 1INDL 1MFDL 2NW2B 2H1PH 3HZMB 5JO5B 4RBPK 4ZXBD 1I1CA 1RZGA 4QRPA 1G7MB 4PRNB 2AK1H 5GS3A 3MACL 2CLRB 1AR2A 4GG8A 4NCC1 3BRGC 4PS4H 1DQJA 1OPGH 2ORBH 2ZCLH 2PYFB 5B4MC 5HYSA 2NY0C 3TBYA 1HNGA 4M7LL 1UCBH 1DEEB 4PRHB 5T1LD 2BFVL 1D6VL 3V6BR 4R0LB 1FYHB 3ZHKA 4Q9RL 3C8HA 3DBXA 4M7JH 5T5FL 1UYWH 1EZVY 3BH8B 3TZVA 5EU6D 5A2KH 3F58H 1D5BB 3VWKA 1U36A 1PKQE 1QFWM 1TVHB 4MJ5B 3ZT5A 5IMKB 2E9IA 4BFIB 2GK2A 2IPKB 4LIQL 5INDA 5CD5D 2PO6A 1HIML 3SDYH 1SVZA 4XTRD 2BC4B 1FG2A 1PX4A 3MA9L 4P4KD 5HYFA 5BS0E 1MPAH 2Q7YA 2VLJB 5D1ZB 4OLUH 1CXEA 4EBQH 3OKLA 1EAJA 2X9XA 4Z7NE 4U1IA 1XF1A 1K3ZA 2R0ZL 2R69H 3WFDH 2EC8A 4NC1E 4RGNB 3HZKB 4K3DL 4KVNL 4J3VA 2FJHB 3MCG1 4P23D 1LD9B 3MRJA 5CMAB 1I75A 4ONHA 3NFPA 2VB5A 3NFNB 3MRKB 3HPLA 3PGDB 4M8QB 5DZLA 4YHPB 4JANB 3IFLH 5E8NB 2NXYB 2GTZB 2X4TB 2NNAA 5C0NC 4J3UA 1TNMA 3JWOH 4WI2A 1C16A 2CK0L 3QCVH 4OCMC 2OTUB 4NHCH 1OAQL 5I74B 2WLYA 1U8NA 4BQ9A 4U6HB 2P5EE 1A6VH 4P0DA 5CEYA 2D4FA 4ODWA 3OG4B 4Y1AD 4RFEA 5C08E 3F7YA 4P5MA 2BSRB 4S10A 2YS4A 4M62L 2RIKA 4LF3B 5MENA 2ITCA 4PIRF 1IL1A 1JF1B 4F8TA 2Z4QB 3VH8G 2WM0A 2EKJA 2VQ1A 5HHQA 1Q9KA 1K4DB 4POYA 4PJ7E 3GSNL 2MFNA 5DWUH 1OF2A 3CDCA 3QJFB 3IGAA 3LKRB 3REVB 4XB7A 2VH5H 4ETQB 3LEYL 4LIQE 4WHTB 4PJBE 1YEJH 3IDIA 3TT1L 2FLBT 4HUKB 4PJHF 4Z7VF 2Q8AH 5BVJA 3PJSB 3O2DA 4KROB 1OM3H 1JGDA 3HTLX 4XPHL 2AV7B 4JDZB 3QXDA 1E4XL 3KPRD 2VDPH 1TJGH 1OT2A 2R2CA 4HBCH 3KLDA 1MQ8A 3VXUA 3EYOB 4GW5A 1G1YA 3SY0A 2O5YL 1XGPB 4S1DC 1RJZB 5EIIB 4OZIE 3NCBB 4CBPA 4N9GA 5DHVA 1CGXA 3BYTA 4JO3H 4Z7UF 4U7KA 2DRUA 2R1YB 3O6FD 4NRXA 3BKMH 3PWPA 1RUQH 4EN3C 3ZMRA 2NZ9C 1T1XB 3MV7D 2X05A 2MJWA 4KI5F 5D7LE 1L6ZA 1NGWB 5I71B 1G7HB 1UA6L 3IF1B 1MFAH 5DJ2B 2A74B 4DN4L 3H3PH 5E6YA 4P2RE 1GCFA 1UWXK 3QG7L 2HH0H 4PTTB 3SDCA 2FATH 1DE4B 2AXGB 4GRLD 4IMLB 2BNQD 3INUH 1D5ZA 1LP9A 4LSRH 3SKNB 2OM5A 1PGRB 3V6OA 1A8JH 4U49A 1ZVSA 1RZ7L 1EEYA 5KS9A 4Z0XA 1Z5LB 3T0XA 3FMGH 1K8DB 2PW2B 2WBJC 2H9GB 5JHDE 2JKXA 1A47A 1LK3L 2E9WA 5TE6H 1LO5B 2QTEA 3O4LA 4NKOB 3KJ6H 4OV6F 3TT3H 3P9MB 2VDMH 3C8DA 3GRWH 3AROA 4OD1H 2CR6A 2GTWB 4V1DA 2LTQB 1ZA6A 1TVBB 4XVTL 1EHNA 2AEQH 2FBJL 2K1MA 1F6AA 3EJYD 4ZUVB 3GUTB 3RX5A 1CGTA 1A2YA 1V3MA 1I7UB 2AXJA 2PCPB 4MAYA 2G9HA 3JUZA 4GS7C 4XVUD 4XP4L 4D94A 2R29L 1W72H 5AUMA 4ELME 3R1GH 2JK5B 4HKXA 3WN5B 4PV8B 1ONQA 1BF8A 3NAAH 3GSVB 3U1SH 2F5BH 4PJGF 2F19H 4DUXA 5EO0B 4MGXA 2IGFL 3PQYB 3IU4H 3IXTA 3IXAA 4LSQH 4CN1A 3ILQC 1NCNA 1RV6X 1JMZA 2OQJB 2VUOA 1MJJB 4YDKL 4BQ6A 2VLKD 4OKDA 1TFHA 2P43B 5MEOB 1YPZF 1YY8A 5CGYD 3PP4L 3IB4A 4NQEE 4R0LC 2DM2A 1UVQA 1FC2D 3MLTB 4E0RB 5ID1B 5ANME 3EFFA 2ATPA 2VL5A 3FT3A 1T7YA 2WUCH 3N1FC 3QDGE 4OV5A 2J8UB 2XWBA 1U6AL 1ADQA 1KB9J 5TQ0H 1T5WB 4HS8L 4Z7WF 1JVKA 3SE3A 4KJPD 5IM7B 2KH2B 3QIWB 4MNGA 1F90L 2E7LA 3ABZA 5D6CA 2DYPB 2FWOB 5D1ZC 3QUML 4PJEA 4YPGA 4HC1L 5L88L 2DKUA 1SMAA 5JW4Q 3DO3A 1MCEA 5DRXA 5HHNB 3SDDA 5CINL 5HI5D 4HKZB 2BNRD 5LBSL 3DGCR 4HK0A 4RGNC 3MJ9L 4JFYA 4J8RB 3ARPA 1IQDB 1LK2A 1NCAH 1HZHL 4LEXH 4MJ6B 3V0VB 3VU2A 1A4KB 1TJIH 4LCCA 5CP7A 3SCMB 1U8KA 1YEKH 4PY8I 2IFFL 1JGVH 2NXYC 4HIXH 4PGBA 2AI0H 4KQ3H 2EIEA 2XTJE 3T8XB 3O3EB 5C0CD 2XWJB 4WHCA 2ID5A 5I74C 2E6JA 5T33H 4QT5A 4KXZI 5FV2A 1OWWA 3MLZL 5F7LB 4K7PL 5GGQL 1P1ZA 3SJVB 2FCBA 5TJWK 3QWRA 4Q9CA 1GGCL 2VAJA 1F4HA 5IK3A 2EYRB 5JW5A 2R4SL 5CEXB 3TJHD 3CU7A 4Z6AT 5I1KH 2VKWA 5HHMD 3ZKMD 5ENWA 2VNCA 2DQGL 2IMMA 2ESVB 3ARGB 4XBPA 3TH2T 2IANE 2XACC 3DHJA 5GRZA 3TIDA 1FYTD 4Y5VA 5SWZB 1TZIB 3GB7B 2LABA 3ESUF 3X14B 1YNLL 1QRND 5ALBL 3HCVB 1KV3A 3S34H 5FOBB 5D72L 4G3YL 3KLSA 3AY4C 2CLVA 1ZKAA 1MRCL 1AJ7H 3TA3B 5IQ7L 3P40A 1S7UB 3OKOB 4XBGB 2XNAB 1CDUA 1S5HB 1KYOK 2IPUK 2ZNWA 3U7AA 1E4XI 2X09A 1CF8L 4PJ5B 2VISA 4D0DB 2XV6B 5TE4H 3DLQR 3ZHLA 3C60D 3IDUA 1GOHA 3OJ2C 3VW3L 4WTWA 2VXSH 4H25B 3SQOH 3MSPA 5DJCA 2V5SA 1SY6A 1ZHLA 3DVIA 1XF3A 2P47B 4Q74A 2A6IA 1YMMA 1HSBB 5CHNB 3DO7B 1TZHB 4CNIA 1OW0A 4CUCA 3GSQA 5JR1L 4WFED 1MLCB 1MCIA 4K23L 4KUCF 5IVNA 3RL1B 4ZDHA 3TBTB 3QDJE 3NABL 1NC2D 5GGRA 1IC7L 4GRWF 3QQ4A 5D6DA 4KDTA 2JCCF 1KTDB 1C8PA 2FJFB 4PRID 4Z7VE 4PJHE 5E8PB 3AS3A 1INDH 2IF7A 1MFDH 3HAEG 4A2MA 1J0JA 5I71C 1ZAGA 2A38A 2NTSP 4KZDL 2ED8A 1ZHKA 3UAJD 3LN4A 3MACH 3VFRA 5AYUL 3HMXA 5HHPB 2XN9A 1P7QA 1LGVA 1X5HA 5IW1B 5IOPA 1FN4A 3H9HB 4M7LH 4TULL 3DWTA 2NX5B 3HKFA 5EN2B 3O41B 2BFVH 2APWA 1D6VH 5A1AA 4L5FL 4K8RD 4Q9RH 3I6KB 3EOYG 2XKNA 4FQJL 5T5FH 2XWTA 5E03A 5KTEH 4Z7UE 2I07A 2OMNA 5C6TH 3S36L 3CFEB 4ZG1A 3FB8B 2NTFB 3K4DA 3GJEB 2LTQC 4KI5E 4L8SB 4LIQH 1HIMH 2Y36L 1U8JB 4Z76A 3ET9F 3TNMA 4AT6A 1ZT1B 4M1CD 3MA9H 5B8CA 4UAOB 3MV9B 3LKQB 3K81A 4BELD 4ACPA 2A83A 4P5TB 4XAKD 1EGJA 1B0RB 4MNQA 2PXYA 3ALPA 4PP2B 3VI4F 3ZKXB 1U3ZA 4PTUA 2RAMA 3OB0K 3O9WD 3O3UN 3EOBB 1TTGA 4K3DH 3WN5C 4KVNH 3PL6A 4LCWE 3RGVB 3KNBB 2WSKA 5HHOE 4GKOA 2X44D 1MCWW 3T4YA 5MERA 5C0BA 4PJAA 5D7IB 5C8JB 4EI5B 3HNTL 1YN6B 3S7GA 3RBGA 1U8PB 2JLLA 2VO5A 3S96B 3LKOB 2EIBA 5LAXB 4AIXA 2GY5A 3EYFB 1UB5A 2P24B 2CK0H 3LKSA 3MNVB 4E41B 1OAQH 1F02I 3U36A 1IT9L 4MCYA 4OT1L 2ADJB 1FO0A 3HC0A 1T66D 1KJ2B 1GGYA 1VEMA 3VH8A 2PETA 2DLEA 3ARVA 2OXGA 3QIWC 1H0DA 3UTTA 2A9ML 2ZSVB 3MFFB 3MNZA 4KXZH 1IAMA 4QRQA 4PJGE 1NGYA 1PJ9A 2C3VB 2E9JA 1MUJB 4ZTOH 1DN0B 3QWOA 2WP3O 1AHWB 1WLHA 3HE6A 3RHWK 3TBVB 2W0FB 1MCSA 1JPGB 1VB9A 3BZEA 5C0AD 3GSNH 1CDCA 1YPZE 2MSPA 4PRBB 3V6FB 3N1QC 2GUOA 2J3SA 2FL5A 1ZT4A 5IB3A 3LEYH 5C6PB 5KVEL 1FHGA 1GPOL 1U58B 4G6AD 4ZO8A 5IFAL 4TUJA 1AXSA 1CFTA 3V5HB 1GYAA 3TT1H 3SCMC 1ACYL 4JLRA 1K4CA 2QSCL 5CJOH 4PB0L 4Z7WE 5FV1L 4DJMA 3S88L 4UIKL 3KPOB 5FF6B 2XZZA 5F8RC 3ARWA 1OY3B 2NY1D 4XPHH 4HWNA 1E4XH 3KPSD 3B9EA 2IQ9L 4M48L 4OGAD 2VL4A 4LPXA 1ES0B 2IH1A 3GJFK 4GOSA 5KW9L 5LXGL 4JFFA 1EEZA 4KMTL 2O5YH 3RUGF 5DJZA 1DFBL 5EWIL 4TVPD 3KGRA 1LEKA 4F7MB 4ODUB 1QSEB 3D18B 1AXIB 2JTDA 2VLRD 4HJ0D 2JJWA 4L29A 4U0QB 2FX7L 3K1DA 4OFYA 1RJLA 4L1HA 3TYFA 2MOVA 3FQXA 5TGBA 1UZ8B 3ARGC 5B22A 2R23B 5I1GL 2Z8SA 2DBLL 1CGUA 1LEGB 4ZUSB 4NFDA 2A6DB 3FQNA 1UENA 3I2CL 1UA6H 2HFFB 3M1BA 1QSFB 1YMHB 4PLOB 3VE0B 4DN4H 3TA3C 2YWYA 3QG7H 4V2CB 2ZNXA 1HH6A 4ENEC 1FAKT 4QNPF 2GHWB 5K9OB 5IP4A 1J7VR 2ZUUA 5HHVL 3C5JA 3UPAA 5BCAA 1LK3H 4G5ZH 1KLGB 5DQ9B 4AM0A 5KZCD 3BH9A 3OAYH 2R1WB 3KYKH 3VFSB 1CFBA 1M05A 1UXSA 4G8FB 5DQDL 4WDIB 2QBWA 4ZFZA 3QFDA 1A22B 4BKLB 4M03A 4QYOB 2FBJH 4PJXA 1D9KD 4QHNA 3VFUB 3TPUB 4XP4H 4KK5D 2BMKA 1U91B 1KPVB 3SBWA 1NMBL 3K8KA 1JN6B 4QLRA 1S9WA 1F8TL 4OUUB 5D7SL 3WS6A 3IS1X 3GBNL 4BQCA 2IGFH 1BQSA 1UEYA 3BUYA 3BN9C 1T0PB 4FS0A 2V9TA 1OVZA 2XQYK 5LCVL 5A40E 4YDKH 1CE6B 4NQSB 1OGAB 1BOYA 3PP4H 4L8BB 1AO7B 2BCKA 1JPTL 4J6RL 3EOAA 4HT1H 4NWUL 4JGUA 4DZBB 2A6JA 4GRWE 4L4TD 5E94A 3PWLB 5I2IB 4ISVB 5E08L 2HT2C 1U6AH 5T1LB 4LHUA 4L8SC 2JE8A 3P9LB 3QO1B 5I8CB 1WWBX 1F90H 3EIFA 5EU6B 2D03L 4HH9A 4UAOC 4NYLB 3QUMH 1UG9A 1A7BA 4PJFB 3SE4C 3UMTA 4HC1H 5L88H 4PJIA 1N4XL 1X4XA 4P5TC 1VESA 1RZ8B 3VXPA 5CINH 3ZKXC 1TMCB 5JIIA 1G1CA 3IAPA 2DLFL 1ORSA 3C2SA 3LKPB 3MJ9H 2EIDA 4HUUA 5HI4C 3VWJD 3DIFA 2MCG1 4NO3B 3OKEA 5GS0L 3RGVC 5F1IB 4H26B 1HZHH 1P9MA 5L0QB 5EU4B 3DV6A 1CD1B 2RHEA 4QF1A 3PUCA 5F1NA 1RK1A 4EI5C 3DX8A 1P7KA 3U7WL 1S7SA 2IFFH 5C09A 1PEWA 1S8DA 1B3JA 1FFRA 4Z18A 5I1JL 1A3LL 5D4QA 1QVOB 5GZOD 3QNXB 2A73A 3CFIC 3AU1A 1ZHNA 4XCEA 3IFPB 1H15A 3MLZH 4Q6IA 4K7PH 3PGCA 1MWAL 1U3HB 2R1XA 5GGQH 5JNYA 4RISL 3OX8A 3R06B 2BOBB 4LCYA 5I8EA 1X6NA 5FYKU 1GGCH 3IDYB 4LDEB 1A6AB 3MBED 1IEAA 1L7TH 1IAKA 1KXQE 3OKMA 3L3DA 2R4SH 4PRPB 5F7DB 5HYJE 3X3FL 5ADPL 4HWBA 2C5DC 1BOGB 1IGYB 2KKQA 4GQ9L 2DQGH 4RZCA 3DUUA 1J11A 4UOW1 3AAZB 5GRWA 1AHWC 4JEGB 2BSTB 1ACZA 1KC5L 3F6LA 3WHE1 4NO5B 3MRGB 1YNLH 2MPAH 5ALBH 3BEWB 5FKPA 5D72H 4G3YH 3CDYA 3B9KD 2NY2D 4LU5L 1MRCH 5K93A 5IQ7H 5DRWB 5KOMC 2CIKA 4GG6B 2PTTB 3KPPB 3REWA 1T04B 5KN5B 1AC0A 4X8XA 1CF8H 2CDFA 4YUEL 4HIHA 1KBGL 3KYMA 4NO2A 1N0LA 2Q20A 4LVHB 5E6IB 3TBWB 3VW3H 4OM1L 3STZB 1HHHA 4O00A 3T0EE 5AD0B 4QKXB 2Z8WC 3D3VD 1KCUL 1LNUA 5HYQB 5EBLB 4X9FA 4OQTA 1ND0B 2KZ1B 5I17B 4A6YL 5JR1H 3HAEA 2YN3A 3B83A 3F65A 1BZ7B 2EDEA 2QL1A 3QXWA 4NRYA 2WBWB 3TNNA 3FT4A 3U46B 3NABH 1IC7H 3RWFB 4U1MB 3SKUD 5EZIL 1KULA 3CFDB 4GRMA 3L3KB 1D5MA 2DAVA 3AS1A 1XH3A 1QLRB 2EO1A 3AXLB 3MYZA 4KZDH 5ICXB 1PDKA 1B4RA 2E7BA 4HCRL 4G80B 1KNOA 4F7CB 5IB2A 5AYUH 3O6FB 4KRMB 3QNZA 5FUCE 1VGEL 5E8OA 3LZFL 5C71A 4X6EB 3RTQB 4AIZA 1WIPA 2LU3A 1T1ZB 4OZGF 4PBWD 1QFOA 5C2UB 5EU3B 1VGKA 3RUGE 1EPFA 1GGBL 4L5FH 4XPGL 1WAAF 3KXFD 5IEKA 1A64A 3WLBB 4FQJH 4NUGL 1UQSB 1ZHBA 5C92A 1MCRA 3JVGC 5I15L 5EFIA 1PX3A 3QRGL 3S36H 2FX9L 5ID0A 1SYVB 1G9ML 3Q48A 3ZYIA 4HMCA 2OR7A 1JWSB 2DMCA 1F11B 1ZK9A 1B4JH 4GAJL 4X7SL 2O61B 4YGVB 5IBLC 4JY4B 2Y36H 2Z93A 5DMGC 2EYTA 4YR6A 5H2BB 1BBJA 4JFHE 3V4UH 3ZDYE 4J3XA 4RNRB 1ED3B 1NCBL 3H9SD 4QNPE 4RQQA 2Q86B 2BVPA 3S3PA 3GSRB 2BXYA 1KELL 1YY9C 3ROOA 3P2TA 3BEVB 5T1KA 4X4ME 5IVXA 3Q0HA 4F33B 1XCTA 2A9NL 2YXFA 4C56B 1F3RB 3CDGA 2LU7A 3RZCD 4L3ED 2CMRH 4RMVA 4MDJB 1IT9H 4ESKA 4OT1H 2EIZA 3EJZD 4KU1A 1RURL 4J3SA 5DJAB 5E6ZA 4G43B 5HGHB 1P7HL 1AQKL 2KUTA 3ARDA 4G8GD 4QXTB 4N0FA 2A9MH 3P4OB 4NRZA 5DJ8B 1UKTA 1LVEA 1FJ1A 4DZ8A 3G5YB 2B4CL 4EUPB 5J7CC 2DL2A 4Y4KD 3VGFA 4PLKC 1BIIB 5CD5C 4BSVA 1ZGLA 4FFVD 2JF1A 4XTRC 3GBML 2HWZL 4U1HB 3BW9B 5J89A 1U92B 4MXQD 5KVEH 3ZKQD 5L0QC 1GPOH 3JZ7A 5IFAH 4KTDL 3IU3B 4QRPD 1ACYH 3WNLA 2QSCH 4BFGA 4PB0H 4MXVF 3S88H 4UIKH 3MJ7A 3NGBB 3MRLB 3DOSA 1FVCA 4I5BA 3HR6A 3ZTNH 4UIMB 4ZD3L 5JORA 3MRRB 4C4KT 4GMTL 1T2JA 3DURA 3QFJA 2IQ9H 5J0BA 4M48H 3E3QE 4FFWD 3MLXL 1U3HC 4PJCA 5LXGH 4KMTH 3RP1A 4XMKL 3LB6C 4LOUC 1DLFL 4PY8J 1NDMA 3IDYC 1ZMYA 3VWKD 1DFBH 2Z31B 5EWIH 2EDWA 2ED7A 1JV5A 5IR1A 5JOPD 4HAFA 3C6LB 1T80A 4YDJB 5FA4A 1H5BA 2CXGA 3A67L 1CFSB 2PO6D 1BJ1J 1MVUA 3X13A 1C12A 5I1GH 1HQ4A 5ICYB 2DBLH 1TZGH 4W70A 4XP5L 5KSBA 1IC1A 4LBEA 3CSBA 4J7RA 2WBJA 4GRWH 1PZUB 2H3NA 3I2CH 5GRXG 3F5WA 3RRQA 2FIKA 3UTSA 1MAML 4OKVB 5T3ZD 4XPFL 1I8IA 4P3CL 4Y2DB 4S0SD 1X9QA 3VXRE 4G7VL 4QRTA 1CFQB 4G9DB 4MS8D 3TCLA 4UNVA 4UTBL 3KLHD 5GGUA 5TF0A 1WT5A 2ICEB 1EXUA 1QRNB 2G2RA 1SMOA 3CFBB 5KSAB 4LVHC 5E6IC 2HLAB 5HHVH 5ITFA 5GRUL 4JFDE 3WS3A 4IBLT 1WTLA 1RZIB 2DLHA 1OP9A 5IW6A 2AERT 2PF6A 5JO5A 4GAYB 5E00A 1G7MA 2XZCL 5C0DB 5CEZE 3HS0B 1IEHA 3QUKB 3MRQA 3DROB 3I50L 3O4OB 2QQKH 5MEPB 4TSBL 2PYFA 1E0OB 1PY9A 1J1PL 3S97C 4UQ3B 2D31A 3STLB 3IDNB 3HFML 4X4XA 1IGJA 1C5BL 2JJSA 4PRHA 5GRVL 4YBHA 3J7HA 5IEHB 1KCKA 1DL7L 1FRGH 3DRQA 4CN4A 1S7WB 3BH8A 4ZQKB 3PABB 5FO7B 1RJYB 1F8TH 1NC2B 4LL9A 1MRDL 2F58L 3ARQA 1TVHA 3KDMB 5D7SH 5HXMA 3O6FC 3GBNH 3RTQC 1JHTB 4BFIA 4X7FC 4HWEL 4N90D 5JXEC 1YECL 4RAUA 3BZFA 5CJ8A 4W68A 5LCVH 1PZ5B 3W11D 4CDHA 2XT1B 3RGHA 2GI7A 4S11A 4WGVB 5F9AC 2VLJA 1JPTH 1KGCD 4ZS7L 1M4KA 1NBQA 4J6RH 4NWUH 4QY8B 1HE7A 3D5OF 1MAKA 1S7QA 4JRYB 4QEGA 2OK0L 3UTQB 1R5VA 4NNXA 5AAMA 5E08H 4X83A 3HZKA 3IYLW 4JM4L 2OJZL 2PNDA 2FJHA 4XGZA 3VXTB 1LD9A 2DMKA 1UC6A 3VXUD 3PGDA 4M8QA 5DK2B 1N4XH 5E8NA 4OZGE 3K0WA 1CIDA 5EUKB 1WBXA 2AGJL 2BXZA 1NKRA 1JWUB 3QQ3B 2DLFH 1BQHB 5DD6B 4NSKA 1WAAE 3QQ9D 15C8L 5H35B 2CKBB 5GS0H 3EYVB 2YC1B 4UT7L 5L2JA 4NHUA 2VR5A 4NCDA 4ZOBA 4XVUC 1S78C 4WW1A 2J7LA 3DRTA 5D5MB 3U7WH 2X9WA 25C8H 4PGDB 1V3LA 3SGEI 1N2RA 3OG6B 4HMDA 3DX9B 1LO4L 3SDCD 3CK0L 4X99B 4DFIA 2BVQB 2F9BT 1WZKA 1JF1A 2Z4QA 2FD6L 4Y1AE 2YXMA 4Q6YA 1OTTD 1K4DA 1OTSC 5J56B 1MWAH 4FG6D 3HNSL 4RISH 3O6KL 3O4LD 3UBXI 3FZUD 2CRZA 1AXTL 3QDAA 3X3FH 5ADPH 3RVWD 1MFBH 2DL9A 1NC4D 4YHIB 5FO9B 4GQ9H 5L2KA 5A43C 2ENYA 2WV3A 1UM5L 4R6UA 1KC5H 2X7LA 3U4AA 1DQQB 3MGOB 4QHLA 3JV0A 5CKGA 4MAYD 1VFBB 4JDZA 4LU5H 1QLFA 3MNWB 4OCNC 5J6HA 3EUUA 4BSWA 4M6ML 5GGVL 4LFHD 2ILLA 4C57C 1BP3B 4KWUA 3EYOA 1NL0L 1YJDC 4YDIL 5DD0L 1QO3B 3KPRE 4YUEH 3QXTA 1KTRL 4UBDD 5EIIA 1KBGH 1VERA 3GSWA 1N6VA 4M5ZL 3QWQB 5DC0A 3HA0A 1EJOL 5EA0L 3NGBC 4OM1H 4WEBL 1HI6B 2IAMB 1NUDA 1JYNA 3BZ4B 1CTOA 1KCUH 3TJEL 4F37K 5GQBA 1NGWA 4K3JL 4ELKB 2X4OB 3TH4T 4NQVA 2FR4A 1IAIM 5DJ2A 3MV7E 1X7QA 4DGYL 3IVKA 2A74A 2WBKA 2Z31C 5JLZA 2NY1B 1C5DA 4JG1L 2AJZA 3ALWA 4N0CD 3C6LC 1DE4A 2AXGA 1K2DB 3IS0X 4IMLA 5EZIH 1CI5A 4Q0XL 3C9NA 4CKVX 1KCLA 5GGRY 4GXVL 4GW1B 4GXUN 1Z5LA 2BNQE 1K8DA 2P46B 4MXVE 3EZ8A 4QHMB 5TDNB 1YNTA 2NY7L 4HCRH 3VG0L 1IZKA 1OAXL 1VGEH 3P9MA 1C7TA 4Y2DC 3U0WL 3LZFH 5BJTA 1A1MB 4X6DA 4D0BB 4I18B 5D9SB 2CH8A 3BP6B 5CGMA 2JJTC 5LVEA 3ZE0F 5K9JL 3IETA 5CIPB 4ZUVA 3RI5K 5DFWH 5KSAC 3KPMB 1GGBH 1CWVA 4XPGH 4ZPVA 1DDHA 2WQ8A 4NUGH 1I7UA 1P2CA 4XMLL 5DQJA 2OX5A 5E0QA 4CW1B 5I15H 3QAZB 2GJ6B 3OHXB 4KK9C 4DQOL 2HTKD 2FX9H 1KJVB 1G9MH 2JK5A 1DBJL 2AQ3A 4KQ4L 4X7SH 3WN5A 1AFVL 4LVNB 1L0XA 1P6FA 3VXMB 1RUKL 3O4OC 3SKMB 1KIQA 3RIFK 5KZCB 1J87A 1OP3K 5DVNA 4PYHA 5I1DB 1HHJB 3QT2A 5HGDB 1MJJA 2UYLA 1NCBH 1KTLB 4U1GB 3C2AL 5DJXB 2EC9T 1F45A 3CXDL 2QSTA 2X4QB 3MLTA 3WCYA 1CU4H 1KELH 4E0RA 1T5XA 1Z9SA 1D9KB 2VLKE 4JZNB 5EH1A 3ZKND 4OCRL 1QSZA 2H32A 2AJUL 1I3GL 4WRLA 2A9NH 3Q6FA 1UACL 1R3JB 4PY7B 3T4AB 4G9FA 3RJDA 3LH2L 3SGJA 5EZJB 1JZ3A 5BXFB 2XXMB 3WBDA 4WV1A 1CL7L 3BKCL 3RWCB 3IJHB 3RBSA 5HHNA 3SGEH 1XF2B 3SEPA 1RZKC 2VC2L 2ZUWA 3DYPA 4ORZC 4BQBA 4LKXB 3OJDA 4J8RA 1AQKH 4M43L 4YGAB 3T65A 3HR5B 5LWYL 4X5XB 2BNRE 1PY4A 2EEAA 4MJ6A 4XI5D 3X17A 4Z7OF 1F42A 4K3GA 2JJUA 2B4CH 2D7NA 1TDQA 2JCCB 3L5HA 1UKSA 3SOBL 2FYYB 3W9EB 2ADGB 1C7SA 2X4UB 4CVZB 2D9CA 2VDNL 2Y7QB 3O3EA 1CVSC 3EGSB 3GBMH 3TCXA 2HWZH 4P4RB 2CKNA 2XTLA 4G6ML 3NZ8A 2JB6B 1NANI 2FGWL 3L95A 5F93C 3P0VL 4NNYA 4HG4J 1EH9A 2B20A 3EAKA 3MV01 5C0CE 1WC7A 1NEUA 3DECA 5E2TL 4KH2A 3W0WE 1CZ8L 4BK5A 1N5AB 4C83B 3VWJB 1VACA 3N50A 5CEXA 5HGAA 5I75B 1G7QA 2HJFB 1P7QD 1OQOA 5J1SC 4PJ8B 3ECBB 3B9DA 5F72S 4ZD3H 5M7QA 4GMTH 3FONA 4HUVB 5IW3A 2Z35B 3FB7A 3Q5OA 5SWQB 3MRHB 3EKCA 1TZIA 3TBSB 3ARED 1CDJA 3MLXH 5HHME 2EZ0C 4XMKH 2B0SH 3HCVA 1MI5A 1DLFH 4K8RL 1XF4B 3BP7A 1FYTE 3MTRA 5E2VL 1KXTB 4EXPX 1MOEA 1ZLVH 1FCGA 1DLHA 1S5HA 2AXFA 4XX1G 1GJIA 4M6AA 2CLZB 3BYYA 3A67H 2C1PB 3RNQB 1T66C 1OWRM 3EO0B 2KQMA 2VZVA 4ZAKD 4XP5H 4YHYB 2AV1B 1IAOB 3MBEB 5C07A 1MCNA 4Y19D 4WI4A 3S35L 1HOCB 2CKBL 1A0QL 1MCOL 2PXYD 1MAMH 2GT9B 4XPFH 4ZFFB 3B6SB 4P3CH 1I7TB 5IIEB 2C9AA 4G7VH 4KK6D 5I66B 1E4WL 3B2UD 3MODL 1J86A 3NFSL 2NLJB 5DLML 4UTBH 3O45B 3K1KC 4QRRE 4U1NB 2YPLA 1IKNC 4HLJA 3RL1A 4GLRI 3B9KB 5C0BD 3GMPB 3QYCA 3FQWB 4K7FB 4KZEL 2IAMC 3QH3A 4G6AC 4WFEE 43C9B 3TFKD 3BOVA 3LKNB 3HI1B 3DX6B 2VXUL 1WWWX 2OXHA 4P2QA 5DVMA 2OL3B 2P8MB 4OFVA 3CZFB 4PRIE 4H0IA 3KWWB 2NY1C 3I50H 4GUPB 4TSBH 2AJYL 3G04A 5F3BB 3D3VB 4MYWB 4POUB 1J1PH 5IW1A 3H9HA 4Q2ZB 3HFMH 3HC4L 4DCQB 1TTUA 2NX5A 1C5BH 4XPBL 5EN2A 5H37G 4KJWD 4ODBD 3ZDZF 1DL7H 1HKLH 5D2LA 4P2OB 5DDHB 4XBEL 1JGEB 2YUVA 3CVHA 4KRLB 5DD5L 1MRDH 2F58H 5SWSB 4Y2OA 3FB8A 4TVSa 4I18C 2WQRA 3OKDA 4HWEH 1YECH 4P9HL 5J11B 1BX2B 5K59F 1RPQA 1FZKA 4MVBC 4O2FB 2V5TA 5EUOA 1U8JA 3H7LA 1X5XA 2UV3A 2J6EA 4HK3N 2BRRL 4GKZB 3HPJA 3LKQA 3SE4A 2ATKB 1NBZB 4ZS7H 3HUJF 2ZSWA 5H8DA 3RWHB 4LRIC 4P5TA 4K9EC 3QAZC 2BX5A 4BUHA 3ROLB 4PP2A 4IRZL 2YZ8A 1AKJB 4JM4H 4JCMA 2OJZH 4H1LB 4XAKE 4LVNC 3RGVA 3SQBA 3NPSB 3VXQB 3E6FB 3OAZH 5M94B 3U0TB 4ZNEE 3N06B 5I0ZA 5HPMB 2VABB 6FABL 1JWMB 4EI5A 4JFFD 1WV7T 3ME0A 3RAJL 3ELAT 4U1GC 2I9LB 1UWEL 2AGJH 3NCJH 3EYFA 4OFYD 2P24A 4O2EA 4TVPL 3ZE0E 2MCPL 2GJZA 3FO2B 15C8H 4K3EL 4E41A 1QQDB 1D9KC 3F12A 3QI9A 4BFEA 1FBIL 3UYPA 4UT7H 2P5WB 4NZUL 5MP6L 3ULVD 2ADJA 2X1WL 2BHYA 3L9RA 5C0IB 1CL7I 2EDHA 4JY5L 1JF5A 1NCDL 1NANH 2LAGB 5I1EL 4X5LA 3HG1B 4CVUA 2CDEB 1LO4H 1DVFB 3CK0H 3RWDA 4FXLA 3NVQA 3VCLB 1MUJA 5IWLC 1RUML 3R0NA 2FD6H 1AHWA 3ULUF 2FEDD 4PJ9A 4WJ5A 3HNSH 1I8LC 1RVFL 5C0FA 1CGSL 3O6KH 4R9HA 2H8PB 1YZZA 4WUUA 3RHWF 1DUZB 5C0AE 5C1MB 1BAFL 1F4YL 1X5IA 1AXTH 4KHXL 2HLFC 4IM8A 5GJSL 3S36X 4OZHB 4S2SB 3KPOA 5HVFB 4GMSL 4KKBC 3M8OL 1M6OB 5F70A 2IMNA 4LKCB 2GCYA 5IFJA 4ZPTB 1T0NA 4M6MH 1ES0A 5GGVH 2E9BA 5HD8D 4YDIH 3KPSE 1WZMA 5DD0H 4G8IB 4ZOCA 4HUWB 3S8WA 2Y6SD 4X4ZA 4M7KL 3FB6A 4L1DA 2OTWA 4L9LB 4ODUA 3VWJC 4M5ZH 1MCLA 4Y5XB 5EA0H 5I75C 3CFKB 1A9EB 3BRFA 4WEBH 4PJ8C 1UZ8A 5EBMA 4TVPE 4TUKL 3GMLA 3TJEH 2VLRE 1RZGB 3GBLA 4GG8B 4K3JH 4GLRH 1LEGA 2J1KA 4ZUSA 1YMHA 4DGYH 3TBYB 1OT1A 2YR3A 3E6HA 2F8OA 2I26N 5E4EB 5I8OL 3AUVA 4EUPH 4Q0XH 5K9OA 2FJGA 4FRWA 3SDXF 4CMMA 3DBXB 4BZ1L 3UYOD 4GXVH 1Q9WB 2X4RB 3TZVB 4YHYC 4YFDB 1X4YA 4OIAA 3MBEC 3NCYP 4JRXD 4LPVA 1XGQB 4OI7A 3VG0H 3JVGA 2OI9B 3BGFB 3VFVA 4H8WC 2K9UA 2H2PD 1OAXH 3V7AG 2R1WA 5INDB 3U0WH 3VFSA 1YJDH 1TETL 1T1WB 1ZOXA 1FG2B 5L9DL 4PFEA 3GMQA 2Q7YB 3OKLB 4NUJA 1NGZA 5K9JH 3BT2L 5C0EB 3B9KC 4RDQF 4U1IB 5HPOA 5BRZD 4WHDA 2BVEA 3VFUA 4G6FB 4CADA 4KAQL 4XMLH 3U79A 3JV6B 1QHPA 5C09D 4OLXL 4DQOH 2YD9A 5DJYB 3PWUA 1QG3A 1DBJH 3TO2B 1RU9H 3MRJB 4KQ4H 1AGDB 1AFVH 5FGRA 1AP2A 5EZOH 3HPLB 4JO2L 4D9RD 4ODVL 1RUKH 5HVWA 1JGLL 4L9DA 1JYXA 4BM7A 3KPTA 1CLOL 5B21A 1C16B 1CE6A 1OGAA 5IQ9B 3CXDH 1GIGL 3KJ4B 1U8NB 4P2OC 4UTAL 4JQVC 5ACMA 4XNQB 4U1JA 4DZBA 3NPZB 4H8WL 2VR9A 4OCRH 3IJSB 4N0RA 4N68A 5JOEA 1SJXA 2AJUH 1I3GH 3T08A 3UPCA 5F6HI 5J11C 1ROWA 4RFEB 1UACH 3P9LA 3QUYA 4L4TE 3QO1A 5I8CA 3LH2H 5IBUB 4JKKA 5MENB 2ITCB 1CL7H 3BKCH 5I19L 1PKQA 4PJFA 5FAAA 4PR5B 1MCJA 4YDVA 1Q9KB 1J0YA 4JFPB 1JMXA 1RZ8A 2VC2H 1JYWA 2OL3L 4QGYA 4M43H 3ZDZE 5BS0A 2D9QB 3NPSC 4X0KA 5LWYH 3IDIB 4FQQB 5EU4A 3AVEA 1IM3B 2X42A 3K4ZA 3HZVA 5BVJB 1XGTA 3OKNA 1JGDB 2AXHA 3SOBH 5K59E 4D3CL 5DURD 2VDNH 4HBQA 4WFFD 5B4MD 3ARXA 4ONFL 4G6MH 3VXUB 2FGWH 2EDLA 1DBAL 3HUJE 4GW5B 4RA0C 3SY0B 3T3PF 3P0VH 1A7NL 1JI2A 1A7QL 1U3HA 2EDYA 5E2TH 1CZ8H 3R06A 5HDBF 4N9GB 5DHVB 4ODHL 2B1AL 4LEOA 4PRPA 3PWPB 2DQJL 1DVFC 3VGAB 1BOGA 3BISA 1A3RL 3FFCB 3L7EA 1JI1A 3DVNB 2BSTA 1HDMA 1KCRL 1TENA 2APXA 1KOAA 3MRGA 5C08A 3BEWA 4K8RH 1AY1L 2HAZA 3HZYB 5DRWA 1D5ZB 1LP9B 4PGCB 4PGZA 5E2VH 3VGDA 1IGFL 4GG6A 2APBA 1ZVSB 1RIUL 1EEYB 2F8VA 1T04A 5KS9B 4DKEL 5KN5A 1MCDA 4EJ1C 3C5ZA 5GZNC 5C0GA 1TPXB 5E6IA 4L8CA 3UXFA 4ZSOB 3G5VA 3O4LB 5JXAL 3S35H 2EH7L 2CKBH 7CGTA 1MCOH 5C3LD 1I4FA 3O3BB 1YQ2A 2PYEA 3MRCB 3OTTA 4V1DB 4XC1L 3G08A 5K9QI 4B0MM 1ZA6B 2XA3A 1XR9A 1UWXH 5EBLA 4O51A 1ND0A 1E4WH 3MODH 3NFSH 1F6AB 3QUZB 5DLMH 2VDKL 1XAUA 4I0PB 5T1KD 4ERSL 4OZFH 1A2YB 1A7PL 4L9LC 4MAYB 4FQXB 2G9HB 4Y5XC 5FYKD 4N5UA 4MXQC 1ZWIA 2CPCA 5AUMB 4KZEH 4LSVL 4WNQA 3CMGA 4X7EC 2D7QA 4HKXB 5KANG 5KVGL 1CCZA 1ONQB 3RVUD 1BJMA 1P4LA 4LSPL 4WVRA 1SBBA 1I1YA 4WU7B 5ICXA 4MWFB 3ZHDA 1RUAL 1F4AA 4NNPL 3IXTB 3CLEL 3IXAB 4XP9L 1NDGA 1MRFL 2AJYH 4X6EA 3RTQA 5E4EC 5JXEA 3GO1L 3JXAA 1YY8B 1YDPA 3ARDD 3HC4H 4Q58C 5EU3A 2FHBA 4XPBH 1NCCL 3TZVC 43CAA 3EFFB 2D0FA 2ATPB 2BY3A 2VL5B 3PHSA 3FT3B 4P2RA 1NUGA 5DR5L 1UQSA 4XBEH 4YJZL 4OV5B 4PGEA 2XWBB 2PR4L 2OI9C 3BGFC 5DD5H 3H8NA 1A1OA 3VA2C 3KXFE 3WNMA 5F71A 1JPFB 1ORQB 4JJ5A 4OUOA 4IOSD 3H0TA 5DEGA 4P9HH 2O61A 2ARJA 4S1QL 4YGVA 5D6CB 5JHDA 5HI3D 4PJEB 4YPGB 2BRRH 4TN9A 4Y88A 5H2BA 3HLAB 5GSVA 3SDDB 3MRMA 1IGML 4LQFL 1H8SA 2JIXA 4HPYL 1NMAL 4S1DD 1REIA 4HK0B 2KL6A 4JFYB 4IRZH 5B3NA 2Q86A 3SDXE 3OR7A 1LK2B 4LSTL 3GSRA 4IRSB 3B2VL 1BPVA 1FGVL 2X4PA 4EN3D 3BEVA 3QFJD 3H9SE 2IBZX 1FQ9C 3PXJA 1U8KB 1JCKA 4F3FB 1EHXA 4YXKL 6FABH 2DBJA 3RAJH 4ELMA 3VD5A 4W6YB 4C56A 1G9EA 1UWEH 2GIYA 4DFHA 2FEEL 3KJ4C 4TVPH 3MO1B 4QT5B 2MCPH 4HMEA 4O2CA 4K3EH 5B3JF 4IMKA 3C09B 4MDJA 1FBIH 4NZUH 4L3EE 5MP6H 5SX5K 1MJ7L 2WBJD 5IK3B 3MLVL 4JY5H 5JW5B 4G43A 5HGHA 1NCDH 5GXBB 4R97B 5CIPH 5FCUL 5I1EH 4XNXL 3I84A 4I3GA 5T3ZL 4XBPB 3TIDB 1ZSDA 4G8GE 1RUMH 2AK4B 4RMWA 1BIIA 1LHZA 2CLVB 2BY0A 2Z8VC 1RVFH 2DJSA 3MRNA 1U92A 5HSFA 3TV3L 1BAFH 1F4YH 3BP5A 3IU3A 4KHXH 3W39A 5GJSH 4X6CE 4XHQA 3GIVB 4WCYL 1SQ2N 4GMSH 5DJCB 4QRPE 3MRPA 3M8OH 3ILQD 1JE6A 1XF3B 1T22B 4W4OA 3MRRA 1YMMB 1O7VA 4PJDB 4CNIB 4PRHD 3QCUL 4YC2B 1T1YA 3GSQB 2NYYC 4X6FB 4BJLA 2YBRB 4ZDHB 3DMMA 1M7IA 2ZUYA 3GK8L 4M7KH 5GGRB 4DVBA 2Z31A 2DQDL 4UQ2B 4YXLL 5CBEB 1RSFA 3VGAC 1LWRA 5J12B 4YDJA 5DK0A 5JA9A 5DUML 4BZ2L 4TUKH 4ZO9A 1INEL 1ZHKB 5JOPE 5KG9B 1AGEB 2VLJD 5D1ZD 4E42B 3ZZ1A 2X9YA 2XN9B 2CGRL 1P7QB 3Q2CA 5IOPB 3NCYS 1FN4B 4Y2DA 2V5YA 5IHBA 4RGND 2IANA 3T3PE 5I8OH 1OSZA 4P46A 1UZ6F 3O2DL 5T3ZE 3QNYA 4LPWA 4BZ1H 4FG6C 5ITBL 5I18L 1TPXC 4XAWL 2XWTB 2HLAA 5L8LB 2I07B 1AC6A 4XH2A 4XP6L 4UV7H 1F2XK 2Z9TA 2NY5C 1KPUA 3D85A 1YEDB 2ZZUT 2OP4L 1TETH 3QUZC 4I0KA 3TNMB 5L9DH 5JIHA 5B8CB 4I0PC 4KRNA 3DROA 4MAYC 2G5BB 2WK2A 3BT2H 5MEPA 4FQXC 2A83B 1CTNA 4MNQB 3V0WL 4WWKA 5L8JB 4KAQH 4Y16B 4PTUB 4EEEA 1IVLA 3OGOE 4OLXH 2L7JA 1T03L 4U6TA 3PL6B 4CJ1A 4X8JB 1BREA 3ILPA 2DMBA 2YZ1A 2MKWA 1S7WA 1EDQA 1DBKL 4P99A 4ZQKA 5C0BB 5MERB 3T4YB 4PJAB 1RJYA 4JO2H 3KDMA 4ODVH 1JGLH 2OBGA 1N0XL 1TTFA 2YA0A 3H6JA 3WIIL 4Z7VA 1CLOH 1MHEA 2O5ZL 4ETYA 3LKSB 3O2WL 3HNVL 1ZLUK 1L0QA 1S9XA 2AABL 1GIGH 4N90E 4N8CL 4YO0A 5IJKA 3BDBA 3OB0H 4MCYB 1NFDF 1FO0B 3WDHA 2NY5L 4ZYKA 4H8WH 3D39E 5IF0B 3VH8B 4M8VA 1QSVA 1YC8A 1KGCE 3JSSA 1H0DB 3UTTB 2E7LC 3WKMH 4QRQB 4MMXC 5EORL 5DJDA 3VXTA 4MAUL 1TCRA 3K2UL 1G7IA 1QOKA 5DC4B 5I19H 3QWOB 1N64L 3HE6B 3UTZB 5HDLA 3SDDC 1RULL 5DK2A 1IJ9A 3BZEB 1FPTH 4FTVA 3VXUE 2GUOB 3VDAA 2FL5B 2FHFA 5KVFL 2OL3H 4IRSC 5H35A 4TUJB 1AXSB 1CFTB 4BSJA 4IIQB 2FEEI 4RWYH 4JLRB 1K4CB 3JV5A 3CH1A 5D5MA 4ZFOB 1B9ZA 3B8SA 4D3CH 4LCWA 5H94A 5GRJH 4ZNCD 4X99A 3BQUB 4ONFH 1U41A 2IH1B 3C09C 1DBAH 3L3HB 1EEZB 4ZOEA 1A7NH 1A7QH 4NQUA 5DJZB 1LEKB 4KMLB 4LCIL 3V6OE 5J9PA 4L29B 4M1DL 3TYFB 4GKNA 2B1AH 4R97C 5FM8A 1BD2E 3BZDA 3FQXB 5KS9E 1KIRA 1MCBA 4CVXA 5TGBB 2DQJH 1PBYA 1QEWA 4D2NA 3GKWH 2DJ4A 1A3RH 1KN4H 1PG7X 3FQNB 3M1BB 5BW7A 1KCRH 3GJFH 4DOHB 4H1LH 4HGWB 1MFCL 1FNGB 1AY1H 3JWDC 4PJGA 1KCSL 1HH6B 2ERJB 3MNWA 1Y6MR 3KLAA 5B3JE 1IGFH 4WW2F 1RIUH 4DKEH 3TVMB 5FKAB 3C5JB 1YPZA 4MA7L 3T77A 2FX8L 2C3XA 1GZQA 3PQYD 4AM0B 5JXAH 3BH9B 2EH7H 1HI6A 1M05B 5MHSD 4XC1H 5CZKA 4F8QA 3PWJA 5AYQA 5AG9A 3QZWG 3UO1L 4YC2C 4HULB 4ELKA 1C1EL 4PJXB 4L4VE 4ORGB 2VDKH 4ERSH 1A7PH 1QP1A 4P49A 1AI1L 5D6DC 1NGQH 4IS6B 1JNLL 5J12C 1EFQA 3K46A 4PUBL 2BMKB 3H9YA 4LSVH 4P3DA 5C0RL 3OB8A 5KVGH 3MA7A 5SX4I 2DYPD 4HAGA 4LSPH 4MJIE 3C8KB 3V5DA 1D7FA 2GAZA 5FO8B 3JWDL 5TDNA 1RUAH 5FECB 4MNGE 3BUYB 3CLEH 4XP9H 4O9HH 5HGGS 1MRFH 2I25N 1PAMA 1BWMA 1IZJA 3B9VA 2V2XA 4RX4A 5D9SA 3GO1H 3E1F1 1JZ2A 1OAZL 2BCKB 2BNUA 1W8NA 3T1FB 2A6JB 1SY6L 1JK8A 5E94B 3CFJA 5DR5H 5F7EL 3SCMD 1S7RA 2B8OT 2PR4H 1CG9A 2GJ6A 4LHUB 3RI5F 1FNHA 1Z0NA 3LQZB 5B8CC 4N0UA 3WNOA 4S1QH 4HH9B 4QOKE 5T3XL 2RJMA 3D87B 4PJIB 3IFLL 2OMBA 3G5XA 4ZOAA 1IGMH 4LQFH 1EEUA 1HHJA 4HPYH 3DV4B 4Y16C 5E2JA 1NMAH 2QJDA 3QPXH 4APQA 4KK6C 1FLRL 3ZT7A 1UZ6E 3DIFB 5FUOL 2W07A 5I16A 3PL6C 3OKEB 4OTXL 3NBNA 3HMXL 1T7XA 4LSTH 1QBBA 1NUNB 2CDGB 5F7MC 3DV6B 1E6OL 1AGCA 3B2VH 1FGVH 4QF1B 5F1NB 2ESVD 1RK1B 4JZNA 5HDQL 3DX8B 1P7KB 1L9MA 1S7SB 4YXKH 3TFKC 2GFBA 1LMKA 1S8DB 4DUWA 1MI5D 1T6WA 1H3WM 2HTLD 1R3JA 1WVZA 2DWEB 3TA3D 1WFTA 1FFOA 2VTFA 1S5IL 3AU1B 4ENED 4U4BA 3P73A 5IJVA 4FQ1L 1H15B 2ADFL 2Q76A 3C87A 4Q6IB 1MFEH 4RGOL 2M8XA 3PGCB 5ADOL 4PJ5D 3RWJA 4HDIA 1XF2A 1MJ7H 1L4IA 3LPGA 5I8EB 3RX8A 4MZ2A 1IEAB 3MLVH 5IBUG 4XPTL 3L3DB 3SGDI 1AQDA 3FOMA 4KTEL 3J8F7 2XOTA 1NCTA 5FCUH 4XNXH 3HR5A 4X5XA 3QR2A 1EGJL 4RZCB 3DUUB 5T3ZH 4JPWL 3HE6C 2JCCA 4FMFA 5GS2H 5D71L 4JM2B 2YPLD 2HT4D 5IHZA 5FHAL 3L1OL 4NKQB 2CIKB 2ZOKB 1HSAA 3REWB 3DSFL 3TV3H 4IIQC 3D9AL 2CDFB 4HIHB 4P2QD 3KYMB 4NO2B 4UINL 3C08L 3MCLH 1N5AA 1EFXA 1MQKL 4C83A 2FH8A 1HHHB 1OAKL 4WCYH 1U8IB 1UB6B 1HXYA 2F53E 1FO0L 3BN9D 3BQUC 4LK4A 4MDIA 1LNUB 4PJ8A 3ECBA 5JOFA 1J1OL 2HFTA 5D7KD 2NX5D 1QRKA 4UU9A 4HUVA 2Z35A 3QCUH 3EZJB 3TBSA 1MHHA 3HAEB 3MXWL 4L4JA 1F4XL 5F7WC 1NLBL 3TNNB 4NRYB 4KGLA 2IJ0C 1XF4A 3GK8H 3A0OA 2DQDH 1ZLSL 4YXLH 2DLGA 5HJ3B 2IPTL 2HT2D 4GRMB 1OLZA 1XH3B 4NGHL 3ISWA 1HQRB 5DUMH 3ULVC 3QDMB 4NO0A 2VZOA 3EO9L 3OF6D 4JY6B 4BZ2H 3RNQA 1INEH 3EO0A 3U7YL 4HLZH 3MZGB 1A6TA 1IAOA 4X5WA 5IB2B 2FB4L 1HOCA 2ZUTA 4EVNA 5E8OB 1FL6A 3WYRA 5KSVA 2CGRH 4OD1L 4HS3A 4P5TD 3V6ZB 4AIZB 2BSED 2ERJC 3B6SA 5SX4H 1I7TA 3D0LA 5MEQA 4Y19E 3AGVA 5HI4D 2FEDC 3O2DH 3TVMC 2X89A 2ZG1A 3RGVD 1Q0XH 4D9QE 3O45A 5ITBH 5I18H 4W4NA 3QG6A 4XAWH 2BSSA 3DJ9A 4WFHD 4EI5D 4UDTA 5EFIB 1EMTL 1GL4B 4PD4K 5EOCJ 4XP6H 2DICA 43C9A 3O6LL 3ARFA 3LKNA 2FECL 3DX6A 2OP4H 1FDLL 5JIKA 1RZJC 2Z93B 4Y4FA 3VMPA 4YR6B 1KPRA 4E41D 1BBJB 3QI9D 3GHBL 4WTXA 1Z6JT 3LHPH 2X4NA 4KPHL 3S37L 1FSKB 5F3BA 3V0WH 3ULVL 4PJ7F 5GHWH 4RQQB 4R7NA 4DCQA 4U1LB 2BVPB 3B5GA 3CVIL 1R24A 1T03H 3HHRB 3ROOB 4U1KB 2IG2L 3FFDA 3Q5YA 3FN3A 1DBKH 4GH7B 5K33A 1JGEA 3O8XA 1FFPA 4M6NL 1XCTB 4DTGL 5TQ0L 3DGGB 5SWSA 1N0XH 1NBYA 2Q87A 3DI3B 3WIIH 2P8PA 2UWEB 1MREL 2YD5A 3O2WH 3CXHK 3HNVH 1VFOA 2LVCA 3BIKB 4PGJA 2AABH 2ZOLB 4N8CH 4GKZA 1PW3A 1SJHA 1ZTXL 2ATKA 1NBZA 3MRFA 2EIZB 2NY5H 3NCEB 1EHAA 1RZJL 3WNPA 4OZIF 4X80L 3ARDB 1UFUA 3FN9A 3VD7A 1NFKA 1ZANL 1AKJA 3MRIA 3RUGA 4NQXA 1OHQA 1W0WA 3PWNA 4OGXL 1F3JA 1HWGB 1FJ1B 4JPIA 4DZ8B 3RWGA 2L0DA 2APVA 4MAUH 3U0TA 1W8OA 3QUXA 4FQCL 5HPMA 4JFEB 1G6RA 4QXWA 1N64H 3RWEB 5ICZA 5IHLB 3SGDH 1RULH 2YK1L 2H2PC 2DLIA 4FZ8L 1ZGLB 5E5MA 1P84K 3SPVB 1Q72L 3FCTA 1QSED 4M9PA 3PIQA 1J8HB 4JFFE 4DUVA 5KVFH 1DUYA 4ZUWA 3QEHA 1X5GA 3T04D 3VDBA 3UPRA 2OZ4A 3DX7B 2P5WA 2SEBA 1KLUB 4G42B 5C0IA 5I1LA 32C2A 2P1YA 1QSFD 3NCCB 4IRJA 1FVCB 4I5BB 3HG1A 5JORB 1S9KC 1SHMA 1DVFA 3DURB 5IKCB 2W38A 4X4MA 4A6YA 1I1AA 5DD1L 4Q6IC 4B41A 8CGTA 1ADQH 5EB9A 3BIBX 4PJCB 1DQML 1NDMB 3GSOA 4XZUA 2Z92A 4IOIA 2VXQL 4LCIH 1JV5B 4M1DH 3S4SA 5IR1B 5E8EA 4R4FL 4N0YL 2ZPKL 4C55A 1D6EA 1H5BB 3NACL 1B2WL 2DQHL 3QHTC 1FNEA 3TO4B 2WIMA 3X13B 2VDLL 5IVXF 5KSBB 4LBEB 5IBLD 3GI8H 5DMGD 2X1XR 4KDWA 4NIKB 4JM2C 3H3BC 3F5WB 4S2SA 3O11A 2FIKB 2XICA 3UTSB 2F54A 3LQAL 3GMOA 1MFCH 2HKFL 3QXVA 1KCSH 2GITA 2C1OB 4QRTB 3RY5A 3TCLB 5GGUB 2YD7A 1EXUB 2V6HA 2G2RB 5IUSA 1SYSA 1YY9D 3QZWA 3H7BA 3IKCA 3RIAF 3WS3B 2FX8H 4Y4HA 3IAGC 3WO3B 3CFKA 4NKDA 1A9EA 1NAKL 3MBXL 4HFWA 2DQTL 3H42L 3PDDA 5E00B 1OGAD 3UO1H 4TSAL 4DW2L 1AO7D 3OZ9L 1C1EH 3MRQB 1Y0LB 4OF5A 3V2AR 2D31B 2HJLA 4JGMA 1AI1H 4AENA 1JNLH 4X4XB 5E9DA 1IGJB 4NQCE 4PUBH 2VE6A 3QUYD 4HPOL 5BZWA 3TC9A 3DRQB 4RMUA 5C0RH 1Q9WA 2X4RA 2I24N 5GSRB 5KTEL 1LE5A 4NKMB 5BV7B 5C6TL 3JWDH 4HZAA 3F7VA 3D69A 1XGQA 1U8MA 2Y25A 2R0LL 4PLKD 4RAUB 3BZFB 3L3IA 3LRHA 2WZPD 4JRXE 1T1WA 1ZS8A 2HYMA 2BVTA 3DTXA 1OAZH 4F80A 4Q97A 1LQSR 4MA1B 2FECI 4AEFA 4NWTL 4YHZL 5C0EA 2O26U 2W0PA 1SY6H 1S7QB 3S3JA 1KFAL 4UOW0 5F7EH 4F58L 1R5VB 4OQTL 4NNXB 5HYEA 3JV6A 5I1AB 1DCLA 3WHE0 3PV7A 3FO0H 5TF1L 2K7QA 5DJYA 3BFOA 2XXCB 5D1QA 5BRZE 4M93B 4XGZB 3TO2A 1EV2E 2AAVA 1AGDA 2ZJSL 5C09E 3RVVC 5B39B 5T3XH 4OF3A 4JFDA 2NCMA 3VXNA 1S7TA 2X10A 3NTCL 2XPGA 1FSKC 1U3HD 1WBXB 2J88L 3LB6D 4LOUD 5A3IC 2ZWLT 3G6JF 4HIJA 4D9RE 5FHBL 3ULUC 3KPNA 1FLRH 3IDJA 4NSKB 4PRPD 5FUOH 4OJFL 5IQ9A 4OTXH 4V2BA 1ODAA 3OXRB 3HMXH 1CK0L 5L2JB 5DVLA 4NHUB 2EE9A 4EDXA 1E6OH 4XNQA 3RNKA 1ETZA 2Y72A 1G84A 4WW1B 5HDQH 3IJSA 2N1KA 2Z8RA 4RGMB 3DRTB 3EDJA 4NOFA 3RFZC 3RY4A 3VRLF 5C9JB 5FCSH 5JTWA 1N2RB 1RJCA 4I4WB 2GKIA 2QQLL 3RVUC 5DA0B 3QIUB 2D7OA 4DGVL 4H88L 4ZTOL 1S5IH 3QEQA 4HQQL 4YQXL 5INCB 4FQ1H 4PR5A 2ADFH 1G6VK 1TITA 4RGOH 5ADOH 4JFPA 3OBAA 3C5ZD 3VXOA 1B0WA 5E6ID 4OSUL 3ARDC 4XPTH 1IAIL 4KTEH 5EU7C 2PYED 4I3SL 4BA8A 1T0MA 4JFZL 1NUFA 4JN1L 2Y4SA 5ESQA 4FQQA 5L2KB 1EGJH 1X44A 4OAWA 1IM3A 1NFIA 5CJOL 2COQA 4JPWH 4N8VG 2X7LB 4PP1C 4HWUA 4QHLB 5D71H 2UZYB 4MNHA 1CVRA 4TPRL 2EXWC 2C3GA 1QLFB 1R3KB 5FHAH 3L1OH 5FUZL 5HI3C 2QQNL 3PDOA 5J6HB 4BSWB 1WFUA 2HVJA 2VQUA 5FYKL 3CNKA 3DSFH 1JHLL 4WFFE 3D9AH 4W81A 4P23A 3LCYA 4WENB 4OZGA 1VENA 3GSWB 4UINH 5EO1B 5HVGB 2IC2A 3I6GA 3C08H 3QEUA 1FVDB 1MQKH 5A2FA 5J3HD 1OAKH 5T5NG 1H9VA 3RTQD 3QPQD 1FO0H 3LS5H 4JREB 5JXED 1J1OH 3CLFL 2K3TA 3FFCA 3DVNA 4LDLB 1KT2A 4NQVB 2GSIB 2FR4B 3WHXA 2HT3C 4HIEB 4HS6A 1X7QB 3MXWH 3IVKB 1F4XH 5JLZB 1JNJA 1NLBH 1C5DB 5IV2A 2AJZB 3MROA 2K7PA 3HZYA 4PG2A 1A6UL 2HMID 5FXCH 1ZLSH 1BFOB 4PGCA 3MGAA 3C9NB 2IPTH 1H5BC 3TO4C 4NGHH 3T2PA 3EO9H 3W5NA 5JHDD 2OYPA 3WXWL 5BO1L 4G5ZL 3U7YH 1CGVA 4HZLA 2DTML 1YNTB 4JKWA 4ZSOA 3L5IA 2FB4H 1MNUL 3EYSL 3KYKL 2JIXD 5BJTB 4JN2A 4X6DB 1JRHL 3MRCA 3O3BA 3MXVL 3V95A 1JYVA 1UADC 4BK4A 4HJGB 3A6OA 1HHGB 5FYJU 1X5AA 3KPQA 3QUZA 5F7KC 1WT5C 3IETB 5D8JL 4ZPVB 4I0PA 2NXZB 1DDHB 3QXAB 1A4JB 1VADA 1P2CB 3VFWA 3DARA 4FQXA 1K3IA 5DQJB 3NZHL 1CFVL 1S78D 1PD6A 3VXSB 3LQMA 1EMTH 3M17B 1KEML 4MLIA 4OCYL 4C56D 5LQBL 1II4E 1S3KL 3O6LH 3QDHA 3RY6C 4X6BA 2E8YA 5IVXE 4I3RL 2WNGA 1FDLH 3KPRA 5FYKE 4OF0A 4WU7A 4Z95L 2NMSA 5D96B 1KIQB 2DJUA 4MWFA 3GHBH 3O0RL 4OCSL 3MLSH 5LKNA 3B9AA 3PHOA 4KPHH 3S37H 1OTSD 1T21B 2UYLB 3ULVH 2JJSC 4MCZA 2VR4A 4JB9L 1GZPB 2PUQT 1MY7A 3CVIH 3IJYA 4HT1L 1T5XB 2NW3B 1P53A 2IG2H 5BV7C 2H32B 1G0DA 4M6NH 4DN3L 2YUWA 1URLA 3IKKA 4DTGH 4HJJL 4YIQA 3Q6FB 5EU7E 5EU5B 1JPFA 4Y8AA 1O0VA 4X7TA 5JIPA 1ORQA 4G9FB 1A3QA 4GRLA 1YYMH 2F5AL 4OLYL 4WV1B 1MREH 4MA1C 2NY3D 2I9TA 3HLAA 1ZTXH 4LHUG 5ESVB 2DF3A 1OARL 2PKDA 3OJDB 1RZJH 4X80H 1ZANH 5DO2C 3T65B 4M93C 1FGNL 4F57L 4IRSA 4J1UB 4OGXH 2XY2A 4R96B 2YRPA 4F3FA 2DLTA 2XG5A 4FQCH 5HTSA 2YK1H 2L7UA 5E24E 3WE6A 3QFJE 4HXAL 4FZ8H 4MD5A 2Z31D 1Q72H 3NZ8B 1WJ3A 2B7DT 3C6LD 3MO1A 3L95B 1ZT7A 3UJIL 4NNYB 1L0YA 4NT6A 1Y18A 3JUYA 1WC7B 3DPBA 4LSSL 4RGMC 4NM4L 2VITA 1K8IA 1CLCA 1L7TL 1VACB 3PP3K 5HGAB 1VKXA 1G7QB 3HRZB 5ISZB 2GSGA 4UV4L 3QIUC 5KSBE 5LGKA 4Y2DD 5JDSB 3FONB 1VPOL 5ALCL 1IAII 2V9QA 3FB7B 2N7AA 4KKCC 5HYIA 4R3SA 3U9UA 5DD1H 1BVKA 2EO9A 4X9GA 2AK4A 1DQMH 2MPAL 5KSAD 3G6JE 1MI5B 3QA3A 3BP7B 2VXQH 4LLQA 3WDJA 4R4FH 4FXKA 4N0YH 1CDGA 1DLHB 2AXFB 3QB7C 4KK9D 5GIRA 3IFOA 1UWGH 2ZPKH 2FO4B 3P4NA 1V7ML 2D4DA 3MGTB 3NACH 1B2WH 5FGCE 4E5XA 2DQHH 4DK3A 2VDLH 1P4BL 3GM0A 5D70H 3VRLE 2J8UF 1QPPA 5C07B 4XHJC 3T0VA 2W60A 3GIVA 3L5WB 3LQAH 2HKFH 4WWKD 1T22A 2R0WL 4JCLA 4PJDA 4O58L 5FYLD 1SM3L 1EBPA 3L3JA 4PG9A 2FIRT 4X6FA 1NCUA 5DMYA 2YBRA 2YPLB 1WWAX 3ORJA 4CU6A 5ERWA 4PRHE 2A0LC 3WKNA 4OD2A 5DK3A 5DUPL 4UQ2A 5CBEA 3QH3B 4UILL 4U33A 3X11A 2P7TA 4JDVA 1NFDB 1NAKH 1QR4A 4JREC 3MBXH 3CD4A 1Q94B 2X6MA 2DQTH 4P2QB 3LDBB 3W0WA 3H42H 2R4RH 4TSAH 4DW2H 5KG9A 1AGEA 3OZ9H 4E42A 4WU5A 5JZ7D 1WF5A 3G04B 5E1AA 4EXKA 5CAYB 4F15B 1T2QL 4LLYB 4JRYD 2VLJE 5E2UL 1GXEA 4HPOH 1JRHI 5D2LB 3QEGL 1NQBA 1HCFX 4RGNE 3NMEA 1MCQA 1FYTA 3CVHB 3MOQA 3W9DB 5KSUA 4G7YH 3OSKA 2R0LH 4M00A 3OKDB 4P59L 4FTVD 4MQXD 1NJ9A 2Y5EA 1YEDA 1B4JL 1FZKB 3MCKB 3QRFM 5EUOB 1WSST 1B6DA 4NPYB 1Z9OA 4O4YL 3V4UL 3HPJB 2NXZC 2YKLL 2ZSWB 4NWTH 4YHZH 2G5BA 1F00I 1KFAH 1MIML 1W0VA 3C60A 4F58H 4OQTH 4Y16A 4TSCL 5L7XH 4JHBA 6CGTA 3X3GL 4WEMB 5TF1H 3B3IA 1MHPL 1U8OA 3HAEH 1FL3A 4LCWD 4QXUL 4X8JA 4QRRA 5D96C 2ZJSH 4DEPB 2XG4A 2LFGA 4CVWA 4PREA 3NTCH 4P5KA 2EZ0D 2J88H 3QXUA 4I0CC 1FG9C 3BIAX 3K74B 4TNWF 5AG8A 4O2EB 2AJ3A 5FHBH 2BJMH 2GJZB 2CMRL 3CGTA 3TF7C 2J4WL 4OJFH 4TNVK 3F12B 1QFUL 3QI9B 4PRIA 1EIBA 2JB5L 1CK0H 4C4KO 2EE6A 4X7DC 2O93L 3L9RB 4EOWL 3DXAB 5DD3L 4XB8A 4LLUA 5IF0A 1CE1L 4WGWB 1WQVT 1BJ1H 3SGJC 1I7RB 2QQLH 4NC2B 3RWDB 4WV1C 3OL2A 3MUY1 4DGVH 2B2XL 4H88H 2C7UA 1I85A 4HQQH 4RAHA 4YQXH 3WDIA 3UTZA 4KKNA 3BDYH 4NBYB 4PJ9B 5F3HB 4WJ5B 4UZGA 4N8VA 2ICES 4OSUH 5C0FB 2R39A 1IAIH 4WUUB 2IAMD 3VFOA 2VDRL 4I3SH 4JFZH 4JN1H 4AJ0A 4J3TA 2EDQA 4IIQA 3LRGA 4W6XB 3CH8A 4ZFOA 2AEWA 3AC0A 2R15A 3ZTNL 4TPRH 1IKFL 2GCYB 5FGBC 5FUZH 3BQUA 5IFJB 2QQNH 1T0NB 2YA2A 4ZNEA 1JNHB 5FYKH 3DSNA 3L3HA 2DIJA 4TTDC 5C70A 1JHLH 1NEZB 1W72B 3GSUB 3FB6B 2OTWB 2P49B 2Y06L 4LMQE 5D2NA 1CDIA 1UH3A 1J0HA 5EBMB 4RMSA 1FVEA 3GMLB 1TZGL 3CLFH 4MVBD 3HB3C 2BDNL 5D7IF 3D2UB 2HTLC 5CJQL 5TDPA 3FQTB 4HGMA 4HGWA 4QO1A 3AM8C 1FNGA 3JTSA 3ZDYF 3E6HB 1A6UH 3ETBF 2GJ6D 3ZKSD 1N8ZA 1OSPL 3EOTH 2FJGB 2VRAA 3TEUA 4CMMB 4Z8FL 5EZLA 2LQRA 3TVMA 5F7UA 5FKAA 2A77L 3WXWH 5BO1H 2C4XA 4C54A 3VXMD 3OAUL 1E6JL 2DTMH 3VFVB 3ZDXF 1MNUH 3EYSH 1JRHH 3MXVH 1IGCL 2BHZA 4Z9KB 2A6KA 5HDOA 1U0QA 3PQYE 1J12A 3GMQB 5I1CL 2H26A 4QHKJ 1S7XB 4OBRA 4NUJB 1NGZB 3GEWB 5D8JH 5HY9A 1FNLA 4FA8A 4ORGA 2HT4C 2QQKL 5MHSE 1HYSC 1IM9A 1OP5K 4LNRA 2Y5TA 4ODXA 4CADB 1HEZA 4FFZL 4MB5A 3NZHH 4IS6A 1CFVH 3BRDA 3N85L 2QQQA 1KEMH 5DS8A 3PWUB 2QV2A 1YQVL 4OCYH 2D3VA 5LQBH 1KB5A 1JGUL 1S3KH 1FRGL 1FZJA 3VD4A 3LDBC 4I2XB 4I3RH 3KPSA 2VZUA 2J8UE 1CLYL 2IWGA 1F4WL 1AP2B 3C8KA 2KQNA 4HD9A 4QTHA 4KDVA 4Z95H 5FO8A 3ZYOA 1G7LB 3O0RH 5FECA 4F15C 1JP5A 4OCSH 1NMCB 1ZE3C 1JPST 1DQLL 1ZV5A 2DKSA 4YZFF 2Y23A 4JB9H 3TPKA 2EDDA 3CZJA 4UMGA 3T1FA 5JPMA 4WI5A 4U1JB 3HC3L 5ECJE 4LHQB 4KHTL 2HLFD 5FIEA 4Y5YA 2BOCB 4DN3H 4HJJH 3QUYB 4R8WL 3CPLA 1I1RA 4KKBD 2EDKA 3KS0J 1HHKA 1BQLL 3CCHA 3LQZA 2CUIA 2F5AH 4OLYH 4TYUA 1PKQB 1S7VB 4WI3A 4YDVB 4LP5A 2O5XL 4LLAA 4WUKL 1EFXD 1OARH 1RIVL 3DV4A 4X4YA 2BY1A 4OQ1A 4LMQI 3VFMA 1I9JL 5B39G 5BS0B 2JELL 3SJVE 1FGNH 4X0KB 4F57H 1J8KA 4PJ8D 2CDGA 2M2DA 4F9PA 4DEPC 3BWAA 3H2WA 3HZVB 5A2IH 1YA5A 4U6XA 1XGTB 25C8L 3UDWA 3OKNB 5CUSH 3KYAA 4HXAH 1OTUC 2ESVE 3FJTA 4AIOA 4IDJH 1BM3L 2DWEA 5SWZE 5E7BA 2VLLA 1G9NC 3CVHL 1U3JA 3QI9C 5BV7H 1MI5E 3WFBH 3UJIH 1AD0A 1EUTA 3F7RA 4KY1L 4NO0D 4ZUUA 4Z77A 4RCAA 4LSSH 1FLTX 4NM4H 2J6EL 4LEOB 3QCTL 2IBZY 4H0GA 1K5NA 2VSCA 4PJ5E 4XWOC 4UV4H 4OLVL 1SBSL 1MFBL 3WIFB 3L7EB 1VPOH 2P5EB 4CU7A 5ALCH 1XCQA 2BERA 2VWEC 4FP8L 4PJ9C 1HDMB 1F97A 4R4BA 4UUJA 4JM2A 3MLRL 5C08B 4OCWL 1DBML 4PB9L 5ILTL 1C5CL 5EBWB 2DWDA 2ZOKA 2Q7NA 1BQUA 2ITDB 2E6PA 3BPLB 2YPLE 5JW4N 3ARFD 3CX5K 1V7MH 3DI2B 4QRUA 1GGUA 3C5ZB 3CSGA 4XNMB 5C0GB 1CDHA 4L8CB 1P4BH 1XFPA 3G5VB 4YDLB 1RK0B 4PJBB 5DVOA 1I4FB 4P2QE 2PYEB 1U8IA 1UB6A 1FV1A 3G08B 5F97E 2R0WH 1XR9B