4XRCA

Antibody hemagglutinin complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
YELTQPPSVSVSPGQTVNITCSGDTLGDKYVCWYQQKPGQSPVLVIYQDTKRPSGIPERFSGSNSGDTATLTVSGTQAMDEADYYCQAWDSSSFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab light chain
publication title Vaccine-elicited antibody that neutralizes H5N1 influenza and variants binds the receptor site and polymorphic sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 40
structure length 208
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xrcA01
5IB2A 5I19L 5ADPH 3UPCA 5JO5B 4AEHH 3QJHA 5EU7C 3LN9A 3HLAB 2YC1A 5BW7C 3EYOA 1OARH 1NUDA 4OGAC 4OBRA 4RMSA 3ZE2E 3EJZC 3BD4A 3RVWD 4CU8A 3SCMD 3RFZC 4MX7B 4OF3A 2DM3A 2VLKE 2W91A 2A74B 1T1WA 3EDEA 5E9DA 1S7QB 5HI5C 3QUYD 1AP2A 3L3IB 3BIKA 1N59B 4JB9L 4YHZL 3PWUB 4XPGH 2WWKT 1GC1C 3SDAB 1AHWA 1RZGA 1P1ZB 2IMNA 2UVEA 1JPTH 1V7NL 3MNVB 4QRTB 1G7IB 5JQ6H 4FQCH 2VKXA 3GMQB 1IAKA 3RAJH 4ZUVB 2VZSA 4Z7QF 1D5BA 4PRHB 3MRRB 4NOBA 2YD5A 4MSWA 1ZHLA 4YQXL 5EBWB 5IB2B 3W11C 4MJ5A 4JFFD 1BOYA 3QJHB 4QRRA 4J4PC 4JVWA 4Y5YA 4WWKD 2YC1B 4OFKA 4DK6A 4JZNA 5IW1A 1JPSL 1FZOA 2NY3B 4PV9A 2C1OA 2YR3A 2D7MA 1OAZL 5FYKD 4XVJH 2VLLA 1IGTB 5EN2A 1RZ8A 4OCMC 1T1WB 4PP1D 1SMAA 1AP2B 3BIKB 1ZLSH 1A7RH 4RFNB 2HP4A 2JJWA 3MA9L 1AHWB 1RZGB 3VXOA 4NQCA 3KLDA 4N1HB 1UH4A 2NCMA 5KSAD 4PJ9C 1FHGA 2VSDA 1IAKB 3ORJA 3OMZA 2VLKD 4P49A 1D5BB 2HH0L 3SE8H 3ZYIA 2YBRA 4MSWB 3MBXL 1D7FA 1ZHLB 4YHYC 5ELIA 4MJ5B 3PDOA 2WW8A 3MGOA 4KI5E 4IRZL 4QRRB 2XG4A 4Y5YB 4OLYH 3CSGA 3GKWL 2RB8A 4JZNB 5IW1B 5F96H 3E8UL 3SE4C 2CO6B 1FZOB 4PV9B 4DJMA 1WWAX 5KVFH 2C1OB 5FO8A 4MNGE 2LU3A 4S11A 5BZWA 2VLLB 5EN2B 1RZ8B 1CVRA 4BZ2H 4ODVL 4H0IA 3QI9C 1JFQL 1MFAL 4RMQA 4BFBD 3UPRA 2EC9T 1L0YA 3RTQD 4D2NA 1C8PA 4U6HB 1OP3H 2XICA 3IB4A 3NCMA 5I1KH 1P7HL 3VXOB 4N0FA 3C60A 4NQCB 1FNEA 1MCPH 2VXSL 4X7DC 2JKXA 3VCLA 2BSTA 1OAXL 1P7QD 4HK3N 1ZLVH 2RQ8A 2FZ3A 4LOUC 1UH2A 4GBXD 2F8XC 1RFDL 5B4MD 5I6XC 2RR3A 5EULV 4RISL 4K7PX 4YPJA 2AXFA 1Q0XH 1IT9L 1KLUA 3MGOB 5AWNL 4EUPA 4LSTL 4R4ND 1C16A 1YNKL 3ZHDA 4ELMA 5KSBE 2AVGA 1DSFH 1HXMA 4RNRA 4FFVD 4YE4L 3BEWA 4ZAKD 1QSZA 3WNNA 5KW9L 2OR9L 1KNOB 5IQ7H 3NFNB 1Q1JL 3BGFB 3QUMA 5FO8B 5BZWB 1JNLL 4NDMA 3STZA 4EDXA 5HTSA 1TDQA 4KI5D 3UPRB 2E7BA 3RDTC 1VGEL 3NPZB 1JMZA 5EBLA 5C0DA 3OAYH 2X1WL 4N0FB 1A7PH 3FOMA 3C60B 1EZVX 1FNEB 5DVLA 5E4EC 3VMPA 3ZYJA 3LMJH 3IU3A 4F15C 5F9OL 5ILTH 1LVEA 3ZDZE 3SE9L 3VCLB 1AKJA 1JRHL 3MRCB 4HZAA 3VDAA 5AUMB 1UYWH 3BKML 3UJJH 5JXEC 2FZ3B 2AXFB 2WUCH 1DBJH 4RAHA 1X5LA 3BH8A 5C0AA 4AEEA 1YJDL 4ZUUB 4RDQF 2MKWA 4HEME 3V95A 4EUPB 2VLME 1C16B 4ELMB 2FJGA 1AD0A 1MCFA 4M43L 1HXMB 4RNRB 3HS0A 3SDXE 2X4SB 1OW0A 1MCRA 1ZLWH 3V5HB 1EFQA 1AFVH 4PJ8D 4QY8A 3ILQC 4X5WA 3MNZA 3T2NL 1FO0H 4DZ8B 5JQHC 1ZA6A 3TN0C 3F7RA 4NDMB 3STZB 4C4KT 1HI6A 3G6JA 4GKZA 1XIWC 2HKHH 3WKNA 2DKMA 4EDXB 5CKAA 5L88L 5H37G 5C9KA 1VERA 5EBLB 5C0DB 1TQCB 3FOMB 3RU8H 1H8SA 1E4XI 2CLRA 5LCVL 5DJXB 1X5YA 4PTUA 1AKJB 5DEZA 5I8CA 3S3JA 3BMVA 1LO5A 1RMFL 1AE6H 2EDNA 4YJZL 1A3LH 4MLIA 5DLMH 2D7TL 2RGSA 2UWEA 3NFPB 1OVZA 5B3JE 1MFBH 4O58H 3BH8B 5C0AB 3SGJC 4DGIH 2IBBA 3UMTA 3O81A 4I2XA 3EZ8A 3MLTA 1A7OL 1J18A 1B4JH 1AD0B 2FJGB 3MLVH 3TVMA 5EZOH 4MS8D 3QHZH 2EO1A 4PIRF 4IEFB 1MAMH 4NPYA 4QY8B 4X5WB 4MXWL 5GGRA 1P5UA 3MNZB 4HBCH 1F8TH 4RA0C 1PEWA 2BDNH 1ZA6B 2P7TA 2KQNA 1HI6B 1FYHB 3G6JB 1BX2A 3KS0J 4NHCL 5IBTH 3ZYZA 4W6WB 4DEPB 2R0ZL 1C5BH 4M7LL 5DMIL 1NCDH 2VLMD 1ED3A 4PGEA 2AEWA 3SJVA 3QIBD 3ZKQD 3S96A 4MAYA 2CLRB 5HHMB 1I7ZA 5CBEA 4HULB 4PTUB 4BSVA 1OSZA 5I8CB 1U3HA 5DK3A 1LO5B 1FJ1A 5F6HJ 2GJZB 3ARGC 1LO3H 1IGFL 2EYRA 3MXVL 1NFDA 1Q9LA 4KK6C 2PXYC 1OCWH 2HJLA 5BV7H 3NIFE 5TJWK 3MLTB 4HIHA 4X9FA 1ZGLP 1J0YA 3I75A 3TVMB 4J3UA 1JZ3A 5IVNA 1MPAH 5INDA 5GS1A 2HFFA 4NPYB 4Y16D 3R1GL 1D5XA 5GGRB 1HWHB 3UTZA 3BYYA 1HKLH 1BX2B 2AJVL 2CSPA 3H3PH 1XF5B 3GBML 5SV3A 1FNLA 4TUKH 3AU1A 3MLPA 5J8OA 1JGLL 1IGML 5F9WB 3GIZL 2ITDA 4LPXA 1MREH 3SJVB 3S96B 2J8HA 4MAYB 2VIRA 5LBSL 5CBEB 2AP2A 1B9ZA 2AJSH 4BSVB 1OSZB 5FECA 3Q6FA 1U3HB 2RFXA 2V7NA 2MJWA 5E00A 1DQTA 4IRSD 1A3RH 1FJ1B 1CFTA 2FBJH 4MJ2A 4KGLA 5FOBA 5GS0D 5IVXB 2XACC 2K7QA 1LO4L 2EYRB 1UM4H 1NFDB 3K2MC 1Q9LB 3KPLA 3MUGA 4P4KD 4KK8C 3RA7H 1TCMA 1GAFL 4RQQA 3UTOA 4HIHB 1S9YA 4LSUL 3RKDC 3I75B 4JDVA 3IAGC 4ZOEA 4A2LA 3OB0H 5INDB 2VH5H 1A9BA 5GS1B 2HFFB 4FP8L 3EJYD 5SX5K 4PB9H 1D5XB 4QRSA 4JDZA 4BELD 3UTZB 4N68A 4BM7A 1Z9LA 5EU6B 4FMFA 4KXZI 1MLBA 1QO3A 5ALCH 5GRUH 2CKBA 5A16B 4DUVA 3AU1B 3JTTA 5TE7L 1JGEA 3G9VA 3MXWH 4RRPA 4AYFA 1OY3B 1YPZE 1DTUA 4UB0L 2V2TA 2VIRB 1RV6X 4DN3H 4PJIE 2YRLA 2E8YA 3QWQB 2Z31D 3B9AA 3VRIA 2VC2L 4UZGA 1INDH 1WIOA 1RU9H 3Q6FB 2BC4A 2D7NA 5KVGL 2RFXB 2V7NB 5E00B 1HYSD 1YYMH 3OV6A 1CFTB 3RNKB 1EO5A 1DBKL 1FV1A 5FOBB 3VGGA 5CMAA 3CFJA 4Z7VA 1SBSH 5I8OL 2UY7A 4IMKC 3KPLB 3MUGB 3TLRA 1C7SA 5L2KE 3BWUC 4RQQB 3KJ4C 3NCBB 1S9YB 5I30L 4JDVB 2YPKA 3H9YA 4G6JH 1J1PL 3RVXC 4ZUTA 5D93C 1A9BB 4LAJH 4M4PA 3BDBA 4QRSB 4JDZB 4ORZC 3C6SA 4Y89A 3TBTA 2XFXA 2DQJH 1BJ1H 4ZFOL 5DQDL 1MLBB 4JG0H 3SKOA 5FM5O 1QO3B 2IAMD 2CKBB 1MCHA 2WM0A 1CU4H 4GRWF 3EOYG 4NJAH 4NO5B 4P99A 3JTTB 4WI8A 1DEEA 3EHBD 1JGEB 4X80L 5EFIA 4P9ML 4NZRL 2V2TB 2FL5A 3Q6GH 4LASH 4OZHE 4GW5A 2QBWA 3VRIB 1UQSA 1FG2A 2BC4B 1BF8A 1KJ2L 4K7PL 3V2AR 4LSRH 5TFSL 1FV1B 2JJVA 3UYRH 1VSCA 4E5XB 5D6DA 5CMAB 1EFXD 1J7VR 3CFJB 4Z7VB 3FAWA 5DUBA 3DI2B 1QSVA 2OL3L 3G5VA 5TF0A 4OZFH 5IIEA 1OLZA 4U7SA 1FFPB 4X6CA 4E41A 3MLRH 3HG1E 1GVIA 4G6KH 1NFIA 3S34H 4KTDH 4KY1L 4XZUA 4ZUTB 4N5UA 4F7TA 5ALBH 1GGCH 4HKJB 2C5DC 5E7BA 2R8SH 4PYHA 3N85L 3C6SB 4DGVH 1KLGA 1OAKL 5E08H 3GJFA 3SKOB 3WIIH 3ESVF 3LPFA 5L2KD 1YJDC 3VD4A 2E6JA 1DEEB 2I26N 4PRPA 3HRZB 1UM6H 4M7JL 3JWDH 1JZ8A 5JW3L 5EFIB 1LD9A 2V5MA 1NGPL 4BQBA 3OKOA 2FL5B 1S9WA 2NYYC 2YXFA 4GW5B 1U91A 5HJ3A 5FHAH 1PLGH 1MVFA 2VXQL 5DT1H 4I0CC 5E9DE 1J0KA 1QLEL 1FG2B 1UQSB 4H8WL 4QWWD 1RK1A 3BIAX 4OLVL 1IAIH 4XPFH 2EDYA 5AZEL 2NY4C 5DUBB 3U4AA 5FDWA 4QHUA 2B4CL 3G5VB 3MV7A 3MOBL 5CAYB 2IJ0C 4LPVA 4X6CB 4E41B 5I76A 5AZ2H 4WW2A 1NFIB 3MLWH 4V2CB 4H1LG 1AC0A 4XZUB 5D8JL 2P8LA 4WI3A 1K4CA 2EXYC 3TZVB 2F5AL 3WFCH 4K3HA 3HE6C 1YEKH 2DKSA 4QHKJ 5D2NA 4K7PY 3LD8B 4XPBH 1KLGB 4AQ1B 2X2YA 3GJFB 2A73A 4YXHL 5KVMC 5JMOC 1CR9L 4U6TA 4PRPB 2Z92A 3HG1D 1P9MC 1LP9F 3GBNL 4D0DA 4LCYA 3BZEA 1TETL 1S9WB 4HQQL 4R7DA 1U91B 4K8RH 5HJ3B 2OK0L 4LHUG 4PJFB 3HCVA 1BQSA 1HNGA 3CNKA 1IQDA 1M4KA 3O3DA 4HJJL 3UBXA 3HUJA 1J0IA 2EE6A 4MA7L 4X0KA 1RK1B 4NO3B 4M6ML 5ACLA 1NGWB 3TO4A 1JV5A 5KAQG 1NCUA 2XWJA 1EZVY 1ZV5A 5FDWB 2NY3D 1N0LA 2MHAA 3MV7B 5E2JA 3UAJC 1OM3L 1UJ3C 5I76B 3GI8L 1NAMH 4WW2B 1NGZA 1CD8A 1AR1C 5E9DD 2NPLX 1MI5E 2P8LB 2OBGA 2UZXB 2HG5B 1K4CB 4G5ZH 4XMPL 4UBDC 4CU7A 5LG1A 2R56L 5LQBH 2CK0L 4GMTH 4ESKA 2NX5A 2BSED 4JHAL 4LBEA 1JZ4A 4Q6IA 2LTQB 5DA0B 4PJGF 3BWAA 5HGHA 1U3ZA 2Z92B 4WO4D 4D0DB 4LCYB 3BZEB 4OIAA 2VXVL 3P9WB 1N8ZA 4GSDL 5DJDA 5L0QB 4R7DB 4M1CC 1WICA 5IJVA 4YR6A 3U7WL 3WKML 3WS3A 5GGTH 2GSGA 4NQDA 5GHWH 3HCVB 5C0BA 1IQDB 1AI1H 3O3DB 3P30L 3UBXB 3HUJB 4X0KB 5EG6C 4QRRD 3TCLA 2ERJC 1U95A 2G9HB 5HY9A 3TO4B 1JV5B 2ATPB 3FJTA 3KPSE 3K4ZA 4HC1H 2XWJB 4R6UA 1AXTH 4FMKA 2MHAB 5TQ2L 4NFBA 2V17H 1KENL 2NW3A 3I6KA 4B5EA 1NGZB 3D3VE 1J1XH 3MV8A 5J56B 4JQXA 4X4XA 4Y2DA 2M1KA 5MENE 4DVRL 4CN4A 1KB9K 2VN7A 1VB9A 1VKXA 5FF6A 3TJHC 4HG4K 2NX5B 4LBEB 2XA8L 4Q6IB 4ZO6A 2BVUA 3SDDC 2EDRA 4ELME 1IC4L 5FM5M 1KTRL 5HGHB 1TPXC 2EIEA 5T5NF 3WS6A 3VI3E 4XHJD 3H42L 5FCUH 1MI5D 5DJDB 1N8ZB 3WIFA 1AC6A 4JKKA 3T77A 3MRQA 5IJVB 4HFUH 1BBJA 4YR6B 1F11A 4MQSB 3WS3B 2DDQH 1GOFA 2GSGB 4NQDB 5E5MA 5T1DH 1BBDL 1QFWI 3ARRA 3VGHA 2CQVA 3HC3L 3LS4L 4MWFA 5I1IL 1U95B 5EU5A 5HY9B 3F58H 4YHMH 2BJML 1GXEA 5IGXH 5CINH 4YDKH 2HLFC 1NFKA 4PYGA 3WXVH 3OPZL 4Q74A 1ZWIA 3BYTA 2VDOH 1KN4L 1NBQA 1R3HA 1QSEB 4MNQE 1MIEL 2CDEA 2XN9E 1DDHA 4NQXA 3C5ZC 5DR5L 2X7LA 5E6YA 4Y2DB 1EEYA 4H25A 2BY1A 3F7PC 5GRJL 3B9DA 5IHLB 5FF6B 2ZSWA 4X4ZA 4L8BA 3PJSA 4OCRH 5A2LH 4RWYH 1FE8L 5MI0B 1FH5H 1BIIA 1ZVHA 5KJRH 1SEBA 4N8VA 4OZFA 4YFEA 3DSNA 5IW6A 2D3VA 3D3VD 5T5FL 3VXMA 4F80A 3C08H 4U6YA 5HVWA 2E27H 3T77B 3MRQB 1TZGH 3CSBA 4A6YA 1BBJB 1KG0A 4G8FA 5J6GB 3GZKA 1CL7I 5MEND 5E5MB 1Q72H 4MWFB 5EU5B 3VXUA 2DQDL 1FCGA 1MCWM 3L7EB 3DGGB 2VDLH 2XXCB 4UAOB 5GGVL 4EIGB 3EFDL 5CZVL 4YK4C 5BOZG 3UDWA 2IALA 1ZWIB 1BPVA 1R3HB 4M1GL 1O7SA 2CDEB 1DDHB 1RUQL 4NQXB 4YC2B 3HE7C 4QXTA 2XPGB 2X7LB 4AMKH 2UWEE 4ONGH 1EEYB 2DLFL 4H25B 2XY1A 4XH2A 4EBQL 2NZIA 2UUDK 5K33A 2ZSWB 3KYNA 3IFNL 4L8BB 5C6TH 4CVXA 3PJSB 4I2XE 4UU9A 5CZKA 1BIIB 1IM9B 1CDUA 3HI6L 1G84A 5DJ8A 3L1OH 1AKJD 1JJUA 3S5LA 4N8VB 1J0ZA 2GFBA 5B38G 2XN9D 4X83A 5IW6B 3VXMB 3ILPA 4U6YB 2B7DT 4F3FA 2HRLA 5DEFA 4A6YB 1S5IH 3KYKH 4G8FB 2GTZA 5B8CC 5DRNA 3NTCL 1I1AC 2BVOA 2O5ZH 2P43B 4NUGL 2O5YL 3PHQA 3VXUB 5I8KL 1ORQA 4EDWL 5DD5H 2DJ4A 1OGAE 3FN0L 1W0WB 4M3KB 4M3JA 2VSCA 4J3WA 2FB4H 1WAAA 3MUJA 5F71A 1Z9MA 35C8L 1CD9B 2ZJSH 2R29L 3DSFH 4N0YH 4NJ9H 3QPXH 1CTOA 4H8WC 3TA3A 3MBED 4QXTB 4Q9CA 5E8NA 5FCSH 4I3GA 2YRPA 1RIHH 1JN6A 2NY1C 3CAFA 4JKLA 4NWUL 2E7HA 4ZXBD 3ZTJH 3KYNB 3LDBB 2GSIA 2C26A 1Y6MR 4PLKD 4UU9B 9CGTA 3VXRA 2B4CC 4KUZL 5GGVY 5DJ8B 2GYSA 2A6IA 3NCYP 4N90E 3WNLA 3S5LB 1IQWL 2GFBB 5JZ7C 2UYLB 3ZL4H 2NXZB 4F3FB 1LMKA 5DEFB 5FGBC 5I1CL 4FABH 4JN1L 2ORBH 2GTZB 1MLCA 1MHPL 5DRNB 2BVOB 1XF2A 3PHQB 1KOAA 1ORQB 2QQKL 4AQOA 1FL3A 3ZE1E 3TNNA 1B2WH 1F4XH 5TQ0L 2XWBA 2FLRT 4IHOB 2ZUWA 3T4YA 1JYWA 1CZ8H 3UTTE 4OLEA 3GJFK 5IB3A 4APQB 2E6PA 5ERWA 4QF1A 3TA3B 1IAOA 4X6DA 5CZXC 2R4RH 5E8NB 3RIFF 2FJFA 2NR6D 3ROOA 1JN6B 2AJ3A 1OGAD 2PNDA 2GSIB 3FTGA 4Q0XL 3SJVD 4HKZA 4U6VL 4MAYD 4MJIA 1ITBB 3VXRB 2B0SH 4HC1A 4M62H 1AGDA 2HJFA 3QPQC 4PTTA 3K1DA 4JGUA 1NCAL 3TJEH 1BZQK 5JHLL 3ZHKA 2HT3D 1S7SA 2PUQT 4KHTL 3IDIA 1C5CL 4BFGA 1HDMB 1OSPL 2EZ0C 1MLCB 3MLXL 1XF2B 4X7CC 3A6BL 4I48A 3T0AA 5D96C 4WCYH 2JCCF 4N90D 1FL3B 1J1OL 1QBML 3TNNB 4Y7MA 2VDQL 1CDYA 4XWGL 2XWBB 1MRCH 3DWTA 3HNVL 3MUHL 4MJ4A 4Z76A 3T4YB 1WUNT 5D1ZD 2BVTA 3B2VL 4MA1C 5IB3B 5ERWB 4QF1B 4WFFE 2O26U 4I0PA 1BAFL 1IAOB 1SM3L 4P23A 5GRXG 3RVUC 3T1WA 3ZDXE 4UT9H 2FJFB 3CDCA 3ROOB 4U1KA 3KXFE 3SOBH 2AJ3B 3HAEA 2YUWA 1XGTA 3PNWB 3SO5A 2AQ3A 3FTGB 4HKZB 2VABA 5D70H 4MJIB 3PHOB 1MFDL 3B9KC 4N0UE 4H88L 1AGDB 4JPWH 5C6WH 2HJFB 3I2CL 1YNLL 5FM8A 3UTTD 4PTTB 1BQLH 1N2RA 3GHEL 4QTHA 3AS1A 2Q8AH 2QSVA 4DVBA 1S7SB 3KLHC 5C2UB 1BJ8A 1DVFC 1UZ8B 4XVUC 4BK5A 4PJDF 1RUAL 3DPBA 4I48B 4XXDA 1WCQA 2MNUA 3O2DL 1CGUA 1PDKA 2QQLL 3EYVA 1ZGLM 4PRIE 4S2SA 5BCAA 3LZFH 3BISA 4L3EA 3LQMA 1X5JA 3RWGA 1PY9A 4J2XA 1QKZL 4WTWA 4C83A 3UP1A 3ULUE 4V1DA 4I0PB 5GRVK 4P23B 4J23A 2Q8BH 4AENA 5IUSA 4TUJB 4X5XA 3HRPA 3HAEB 3TWCH 1XGTB 2OXHA 4WNQA 2VABB 2ZG1A 4X6CE 2AK1H 5CLTA 3GDBA 2ZWLT 4EI5D 1N2RB 1KCKA 2QQNL 4WFFD 5E95B 2E7LC 2WUBH 4DVBB 1TJHH 2YKLH 1R3IH 3RWIB 4LIQH 5FDYA 1E6JH 4MLSA 1AQKL 4PY8J 4Y1AA 4XXDB 2F74B 4PRPE 3FQNA 3EYVB 3TBVA 4X98A 2J88L 3BPLB 5JUEL 4XVSH 3MRJA 3X13A 3ARDB 1LP9E 2LFGA 4LU5H 4TNWF 1WQVT 2UV3A 2DQUL 2F58L 4FQPA 4L3EB 4FG6C 1FGNH 3RWGB 3ZKND 4C83B 3QIUA 4OAWB 4U0RC 3WO4B 4V1DB 3TP4A 3BZDA 4IOFD 4AENB 2QHRL 5IP4A 4IDJL 1NLBH 4ENEC 3MV7E 2X1PA 3F12A 1LGVA 4JRYA 4PRID 4WNQB 1EJ6A 2MWCA 5CSGA 4KDTC 5K9QI 1GC1H 5HGDB 2AEPH 3UCRA 4NO0A 4OKVA 3LIZH 3BEVA 4O4YL 3ULUD 1KYOJ 1D6EA 5LAXA 1FIEA 5D2NE 4KPHH 4LPUA 3K7UA 3NGBB 3C5SA 3WHE0 3LB6C 4ODSL 2W9EH 4OLZL 5CS7A 2R69H 1A6ZA 1WISA 4M5ZL 1JBJA 4E41D 3FQNB 1UA6L 1PJ9A 1Y6KR 5I17A 3TBVB 4X98B 3PDDA 4XBEL 3IRPX 3MRJB 3X13B 3WJJA 3K81A 4UINH 1BOGA 4OQTA 4F8QA 3FO1A 4RDQG 3SDYH 2CK2A 3QIUB 3RY4A 4RIRA 1V3MA 5I0ZA 2P4AB 5GJSL 1FVEA 4PG9A 4PRPD 4Y4HC 3T2PA 3UBXI 5JW4N 4YX2H 4RGNB 5TPWH 5ADOL 3F12B 1L7IL 4ZD3L 4OGXH 4MDJB 4CN6A 4PJBE 3PL6B 1FLTX 3EZJB 4NKIL 3RVTD 4R2GD 4GAGH 4DQOL 4OKVB 3QUZB 1D6EB 5LAXB 5DD1H 2CO7B 1YC8A 2JJTA 4NRXA 4XMKL 4OZIF 3BKCH 3C5SB 5LWYH 2NX5E 3QQ9C 3SQOL 1FDLL 1VFBA 3GSNA 2W0LA 4OFYA 2IFFH 2YA1A 5CIPA 3MV7D 3NFSL 5HHOA 5A40E 1F45A 3BN9C 5IESH 4JCMA 2YSSA 5D5MF 3VFVA 3ES6A 4K2UL 3S88L 3CH1A 5SV4A 1BOGB 1L0XA 5C0BE 3KLSA 3MO1A 1IC5L 5HGAA 3FO1B 1ZVSA 2NY0D 2ZG2A 3RZCD 4FFWD 2GQHA 1EH9A 5CD5D 4RIRB 3VWJD 4KVNH 2FX9H 3VI4E 4H0GA 1FVEB 4Y4FA 3FO0H 2D7PA 1NMBH 1I8LA 2IH3A 1FVCA 1OD7A 1CE6A 4F57L 4TTDC 1YEDA 2PW1A 3DROA 3RWCA 4XT1C 5TE6H 1FNSH 3C5JA 1A64A 4ODHH 4Y5XC 1DUZA 4JR9H 5BQ7A 1IARB 5HHVH 3MV8E 3G6DH 3QQ4A 5FYLH 4F33A 5LGHL 4JY5H 4KK9D 3PQYA 4XP6L 5EUKA 1HSBA 4NRXB 5GGUA 3MLUH 1XT5A 2C3XA 2EC8A 2WANA 3WNKA 3OBAA 1Y6NR 1VFBB 3GSNB 5HYJA 2VQTA 5I1AA 2IH1A 1A6WH 5CIPB 4ZNCD 3UO1H 5HHOB 1FL6A 1TCRB 3K8KA 2YSSB 3C8KA 1QVOA 3AC0A 4TRPH 3ES6B 5A2JH 2OI9B 3CH1B 2DBLH 1JTPA 4H20L 4XPAL 2NY6C 4LSPH 5HGAB 1N5YH 4YHKL 1ZVSB 4KQ3H 5ITBH 1CI5A 3V8OA 2DD8L 4OFVA 2NX5D 5E5RB 5JOPE 2E9BA 4Y4FB 2OMBA 1F4YH 5EDXA 2IH3B 4R97C 5IBLC 5BJTA 3V5KA 1CE6B 2DYPA 3ARFD 1YEDB 2PW1B 1MCBA 3DROB 1IKFL 4JKPH 4KRNA 4LLVA 3RWCB 4NQEA 1NCCL 2VL5A 3C5JB 4KMLB 3WJLA 3W82A 3F7VA 5C0BD 3T3MF 1DUZB 5BQ7B 2VL4A 2R9HD 3QCVL 3QQ4B 2PYEA 3CXHJ 4F33B 4PJAF 3ARBC 4HIEA 2Y07H 4OJFL 1MY7A 2Z4QB 5EUKB 4NQTA 1HSBB 5GGUB 2SEBA 2BNRE 2Q20A 2F5BH 3GSUB 1X5GA 4Z5RA 2BNQA 1NLDH 1EHLH 5I1AB 4OD3H 4M93B 2VOTA 4JHZA 4HH9A 5F6IC 1FL6B 1L7TL 1T4KA 2NY2C 4HX1A 4NC1C 1RZFL 3C8KB 1QVOB 3T0WA 2C3HA 3MV8D 3SDAC 4Y2DD 2OZ4A 1AXSA 5CEZL 1E28A 3T8XA 4HWBL 3MJ9A 3HZMB 5K93A 1DQQA 5DS8A 4XVTH 3QWRA 3VXUE 4P9HH 1ERNA 1KCSL 1BLNA 3P0VL 4ZFGL 5CILH 5BJTB 3V5KB 5D7IA 2DYPB 3GRWL 4XNMA 1B6DA 4LLVB 4NQEB 2VL5B 1WIPA 3U7YH 3F7VB 5H2BA 2RJMA 1PD6A 1YEFH 1BGXL 3AS2A 4HIEB 4QOKA 4Y5VB 5JOPD 4Z7WF 5BW7A 3QULA 4MQTB 3ALPA 5D71H 2SEBB 4FZ8L 7FABL 3BGMA 3OZ9L 4XC1L 4Z5RB 5DEGA 5DDHA 3MRKA 3R06A 2ZNWA 2I25N 4HH9B 1W72H 3QAZB 2WQRA 3OWEA 1DJSA 1T4KB 4HX1B 1OAQL 3DETD 5GRWA 4HJ0C 4RFNC 5JORB 3T3PE 1BEYL 4LSSL 3NCCB 1L6ZA 4MHHG 2F15A 4Q9QH 1E28B 3T8XB 1ORSB 2BNRD 2KQMA 1DQQB 5DS8B 3R0MA 4D9RE 1JTOA 4FQJH 4HIJA 1BLNB 3MOAL 1SJHA 1TTUA 4DN4L 2VDNH 2VUOA 5IFJA 1FL5A 1WAAE 2DQIL 4N9OB 5CJQL 5EBGA 4XNMB 4KZEH 2H6PA 1QFHA 3OJ2C 5I19H 4NQUA 5D2LF 1T2QL 5H2BB 4S1DD 3ULVE 3BMWA 4KV5F 2PCPA 2E3VA 4J4PA 4QOKB 1BD2A 4WRLA 2BOBB 5DUMH 3QULB 3VXUD 3V8CA 4ODTL 1WV7T 1U3YA 1WC7A 3BGMB 4JQIL 3IRZA 4EOWL 5IV2A 3CX5K 5DEGB 5DDHB 4ERSL 4KKCD 5F7YC 1BM3H 1KT2A 4LLWB 1CGTA 3MRKB 3R06B 3LRHA 2A9NH 4X8XA 5I15H 5I18L 4MAUH 4DKFL 3EDFA 4XCNA 4YHZH 1JGUL 4ODXA 3NIGF 4IS6A 4JKMA 3O6KH 3D1MC 2VR4A 3O2WH 1MHEA 4GKOA 3RX7A 4I0KA 5F70A 4R90H 5TE4H 3RUGE 3IXAA 3I9GL 1K2DB 1RVFL 1UC6A 1S7VA 4PJHF 5DO2C 1RJLA 1P7KA 4PJ9A 4K9EH 1HXYB 2YD3A 1EXUA 3FT3A 1RURL 4HIJB 3ARUA 3P4OA 1SJHB 3QNZB 5F7EH 3B6SA 1FL5B 3CLEL 2YD1A 4XAKE 3ARXA 3RGVC 3FRPA 4YQXH 4HKBA 2H6PB 2B2XH 3QCUL 3CSYA 1CBVH 1CFBA 4OF7A 3P3YA 1QRNA 4KTEL 4X6DE 3MFFA 2PCPB 1BD2B 1HWGB 4QT5B 2EECA 3VMOA 2VZ1A 3SE4A 1FZKA 3IJSA 5IV2B 1N3NA 3FQXB 4GT7A 2D0FA 2H2PC 4MJIE 3VGDA 1KT2B 4TQEL 1REIA 1LNUA 5BVPL 3RWEA 4PJ7F 5IR1A 5LGJA 4XCNB 1IGJA 4ODXB 5D7JB 3CXDH 1N6QH 3QI9A 4IS6B 4K8RD 4U2ZA 1EX0A 4UOW1 3TA3D 3ULVD 3RI5F 1PX3A 2I9LB 2HT2D 1MHEB 2VWEE 4DKEL 3C60C 1JCKA 3IXAB 1KB5A 4J8RA 3SKNB 2ESVA 1QBBA 1S7VB 4MB3A 1RJLB 1P7KB 1EXUB 3FT3B 3OR6B 3P4OB 4MYWB 3BN3B 1HILA 1ZT7A 4XI5C 3D85D 3A6OA 3R4DA 4DZBA 4O2FA 1BWWA 3QDJE 4GG8A 3CSYB 2WZPD 3VMNA 2X05A 3DO7A 1IJ9A 4YHYB 1NBVH 2OP4H 4NZUL 1KJMB 3U6RA 1QRNB 4HUUA 2EH8L 2PN5A 3KR3H 4BQ6A 5CGYC 5E56A 1N0XH 1EAPA 4HWUA 2KL6A 1FZKB 5F1OB 1GCFA 3ABZA 5F9AC 4XAKD 1ZLUK 1T0MA 1GZQA 1LNUB 2DQFA 2D7OA 2NZ9D 3RWEB 1DR9A 4POYA 5IR1B 2HVJA 5ID0B 3V52L 4GQ9H 1IGJB 2HKFH 1I1YA 1DLFL 2ZG3A 1U42A 3QI9B 1F97A 1N7ML 5D7KE 4G7YL 1N4XL 3RDTA 3LEVH 3CFBA 5A2KH 4F7EA 4GRWB 5FYKU 1KB5B 4J8RB 4P46B 3RQ3A 3R8BB 4DKAA 1QFUL 2P5WE 4MJID 4XMLH 1RZKL 3BDYL 4PFEA 1HILB 1ZT7B 4ODBD 2NY5H 2ZP0T 4DZBB 3TCXA 1RFDH 3CX2A 4WEBH 4X4ME 4XC3H 4GG8B 5JXEA 3DO7B 5ISZB 5AWNH 3IDUA 1CIUA 2K9UA 3MOQA 2XQBH 3U6RB 4O00A 4V1DE 4HUUB 3QEQA 1UKSA 1JUFA 1CYGA 2X4NA 4NC2B 2R1YA 1OW0C 1DEDA 4OM1L 5FA3A 4D0BB 4OLUH 1U92A 4GAFB 3QDJD 4FFZL 3HZYA 4JPKL 1GZQB 3V4UL 2HVJB 1WWWX 3ECBA 1T20A 5CHNA 3TN0A 1I1YB 3KPRE 1VGEH 4DEPC 3F6LA 1XIWA 1DBAL 4CU6A 2BSRA 4P23D 4UQ2B 5IJKC 3RDTB 3CFBB 4HIIB 4NNYA 5BRZA 3RY6C 3BFOA 1IEAA 4F7EB 2F54A 5AG9A 2J8OA 1A5FL 3MNWA 4GMSL 5E4EB 3Q2CA 4QYOA 4Y1AE 4F2MB 5IEKA 1E4WH 4RFOH 1G9NL 3TIDB 5CUSL 2X9YA 3RWHA 3GI9H 4NN5C 3D39A 4YHIA 3VFRA 4MD5B 3P77A 5D7KD 2GJ6E 3ZKMC 1CICA 2QL1A 3ARZA 1YJDH 2FGWH 4XP4H 1F02I 5IB5A 5J7CC 4RZCA 4Y2OA 3SGJA 3W39A 4RGOH 1ACYL 2P5WD 5T5NG 1JUFB 2X4NB 1T7VA 2R1YB 1DQLH 5F97E 4P59L 1AGBA 4LEXH 4JRYE 5FA3B 1U92B 2R0LL 4L3ED 1ZOXA 3HZYB 1IGCH 3TH3T 3QJFB 5CHNB 3ECBB 1T20B 2ITCA 3WFEH 1KPVA 3GMRA 3TN0B 1G0XA 1P4LB 2VDRH 1XIWB 2XKUA 2FSEA 3LKOA 4V1DD 2BSRB 3A6CH 4NNYB 5F9WC 2FEDD 5BRZB 4JM2D 4R26H 4PJGA 1VFMA 5DI8A 4YWGL 5M7QA 4OZIE 2A9MH 2ID5A 3MNWB 5JIHA 5F6HI 1UWEL 2XKNA 4QYOB 5KVDH 2L4OA 2N56A 5IEKB 1RMFH 3VGBA 3RWHB 2RIKA 5J4MA 4KAQL 2DWDA 2JELL 3MRLA 3D39B 1N64L 3KPRD 3LPWA 4JEGB 4YHIB 2YWZA 5K59F 3BI9X 3ARGA 3M07A 1CICB 4LHJB 4DOHB 1ZAGA 1S9KC 1CLZL 4XTRC 2D03H 5GRVL 2PXYA 5IB5B 1YEJL 3HTLX 4RZCB 3W39B 4Y1AD 2DQEH 1YDPB 3JUYA 4WW1A 2XRAL 2DQTL 2R1WA 1AGBB 3CSPA 3PV6A 4OBSA 4MXWH 1ZGLA 2Z91A 3WXWL 1KCRH 4TVPL 2JB5H 2GJ6D 2PTUA 4NHCH 5AG8A 3I84A 1W2KT 2ITCB 3PP4H 1KPVB 3GMRB 2R0ZH 1SVZA 4M7LH 3QIUD 2G75A 2FSEB 3PF2A 3K3QA 4GS7B 5DJZA 3LKOB 1XF3B 2DM7A 4P5TC 1IM3A 2QV2A 1J87A 2OJZL 4PJGB 4ZTPL 2WMPA 2APBA 2Y4SA 1YEIH 4MCZA 5HDQH 4LLYA 2D2OA 3G5YA 2AQ2A 4JRYD 2XKNB 5HHOE 5TGBA 4XWOC 4ZSOA 3LQAL 1EJOH 4MMZC 1F2XK 2BCKB 2DWDB 3MRLB 4NO0D 4GG6A 2QADD 4TTGA 4LFHG 4RMRA 5CJBA 3ARGB 5EA0L 3MTRA 1E4JA 4LRIC 3B9VA 3T0EC 1WFTA 1AY1H 3SY0A 4QHLA 4ONFH 1UG9A 3EYSL 5JXAL 2GT9A 3HMXH 2XZQL 4XCFL 2AXHA 4WW1B 3U30C 4GKSA 2H2SD 1OTUD 2R1WB 2MQ0A 5IG7A 2ICWJ 2XNAA 1ZGLB 3PV6B 4PS4H 4KMTL 4X7TB 2HVKA 4CJ1A 2O5XL 4PGZA 3QUXC 4OTXH 1EIBA 3AREC 1MF2L 3L3OA 2CRZA 4S10A 3GBMH 4ZS6C 3CCHA 2IQ9H 1NUGA 4KDVA 1JGLH 1IGMH 3BE1L 4TPRH 5MHSE 3GIZH 3PQYE 4Z7UA 1LEGA 2R2EA 1SEQH 4I3SL 3OR7A 2Y5EA 5LBSH 5HYJE 4LLYB 1Q8MA 4QXUH 3DYOA 5FUZH 4KK5C 1I7RA 2OS7A 5TGBB 4ZSOB 4XBPA 5LXGL 3BRFA 3QFDA 3GGWA 3U36A 1MJUL 1RZ7H 3C6LA 2Y06H 1SY6H 5IROC 2AJXL 4IMKA 4I9WE 3SY0B 2EDLA 5T33L 2YUXA 4OFYD 2GT9B 2CXKA 3UTSE 5HHOD 4BZYA 4L1DA 4MA3B 5C71A 3OAUL 3UPAA 3MODH 1I9RH 4GKSB 1AO7B 5DGQA 5IG7B 1RIUH 2XNAB 4FZEL 3CLFH 2O93L 5EZLA 5KSUA 5K9JH 2Q6WA 5ETUA 3L3OB 3LAFA 1BVZA 4P2QA 3MLZL 4Y88A 4BFEA 4KJPD 3CCHB 2PYEE 4HCRL 1CFVL 4BZ1L 4EQ2A 4Z7UB 4Y4FD 5GPRA 2R2EB 4ZO7A 3GHBH 5E4IA 3OR7B 2BNQE 5SX4I 3WNPA 1ADQL 4M5YL 3H9SA 1JF6A 1MFEL 1H8NA 1K3ZA 1I7RB 3GK8H 4XBPB 1H3PH 3EOTH 1WVZA 4H5SA 3EO9L 3QFDB 1OP3K 3LRGA 4HDIA 1DBKH 3DXAE 3GGWB 3QCTH 4ZMAT 5I1GL 1CGSL 2VLJB 3QEGL 3U36B 2DQHL 2I5YL 3FZUD 3P11L 3C6LB 1V8HA 3PQYD 4MXQC 3E0GA 3OF6A 1FLRL 1IILE 4HMDA 2XZAH 5HYJD 1GL4B 4BUGA 4TYUA 1ZLVK 3NCJL 1RZKC 3VH8G 5EUOF 5D7IE 3GMMA 3E3QE 1WEJH 3TZVC 3S8WA 5D93B 1FAIL 1YEHL 2J8UF 3H3KA 5KSUB 2Q6WB 1TLKA 5DQDH 3LD8C 4C55A 5ETUB 2BMKA 2XZCL 5HHNA 1ZXQA 4P2QB 3V79C 1I7TA 5T3XD 4I9WD 5EU7E 2JJUA 1W8OA 1NC2A 3MROA 4KV5E 3QWOA 4KRMB 4P9MH 5DHVH 3UTSD 2BP3A 3PP3H 4PG2C 5FYKH 3O3UN 3H9SB 5DD0L 4MDIA 4HXBL 1KJ2H 4TOYL 3FFCA 4K7PH 4H5SB 1EEUA 4R9HA 4YBQC 4GXUM 4JRWA 5D7LA 1K9TA 3OAYK 2PYED 4U1LA 4MVBD 4NRZA 3TYGH 4MNHA 5E8OA 5CKGA 2GEEA 4XGZA 4DW2L 3PUCA 2BNQD 2COQA 4C56B 3JXAA 3CVHL 4WW2C 5MP6L 4KY1H 2EDOA 3LSOA 4QHKI 4HSQA 4U4BA 4FQXC 3GMMB 3O6LH 1G9NC 4LARL 1A6UH 1OQOA 4LHQB 3EOAA 3HE6A 3N1QC 2BMKB 5HHNB 2XTJC 1VGKA 2VXUL 1I7TB 3P4NA 2AEQL 2LTQC 5CP3A 2G60H 3DRQA 3QWRD 1NC2B 3MROB 3OKDB 1ZLWK 3QWOB 5IHUL 5JW3H 1NGPH 2OJEA 4NRYA 5JIPA 5BXFA 1P9MA 5ICXA 3WIHL 4XAWH 5A43C 4MDIB 3QFJB 1QLEH 3PG2A 4HMCA 1Z0NA 1OAUH 4DKDC 3FFCB 1F3RB 4HF5L 4R4FH 4PJ7E 4PRDB 4OLVH 1MCCA 4R4NC 4ZO9A 5D7LB 3IDXH 4WTZG 4U1LB 3H7BB 4NRZB 4FFVC 2NY4B 4MNHB 5E8OB 3P73A 4XGZB 4OGAD 4JPVH 3EJZD 2JCCA 3GSQA 4LLQA 1UJ3A 1MJ7L 2O61A 4HV8A 1CD0A 1ZS8A 4LAQH 4KI5C 2ZNXA 5JIKA 1CXIA 4F37F 5HI5D 1ZT4A 3EOAB 12E8L 2CPCA 5E2UH 1VGKB 3P4NB 1QRNE 1GGUA 4Q7DA 5JDJA 3K4DA 3R8QA 5KANI 3DRQB 1U8IA 3Q1SL 4OZGA 4Z8FH 2OJEB 1R5IA 2XTLA 4HQQH 3GFUA 4OCWH 5ICXB 5I1LB 1CE1L 5L6YH 1QSFB 1RHHA 5KVEH 3W11D 2FRGP 1KELH 5JLZB 1F2QA 3L5XL 4J4PD 4K07A 5DJYA 4OCYL 1MNUL 1DQDL 4PJ8C 2ESVE 1M7DA 5J13C 3INUH 2JCCB 2XKSA 3GSQB 2KZWA 3L5IA 1D5IH 1UJ3B 2HFTA 2FD6L 4LLQB 4HV8B 4U31A 1ZS8B 4TSCL 5SWZA 3LQAC 4XMPH 4R0LB 4JQXC 4YGAB 4NZDA 1NBZA 2R56H 1ZT4B 5KSVA 3S36H 4M00A 5DZOA 2EDHA 1HIML 3WD5H 4OI7A 4G6AC 4PJEF 4Y4KC 4GRMA 3IU4L 3TNMA 5MI0C 1LK2A 1EMTL 4PJ9D 4H26B 3SDDA 1U8IB 4DK3A 4OZGB 1K3IA 1FZJA 1UJTA 3C2AL 4NM4L 1R5IB 4BKLA 5MEOB 1AD9A 1EPFA 2WINB 3WKMH 2BY3A 1J11A 1RK0A 2N4IA 4KHXL 4NZTL 1S5HA 1CTNA 3CMGA 3P30H 1RHHB 3U4EA 1EO8H 4JDTH 1QRND 3KPPA 1FPTH 3K1KC 3U0WL 2ERJB 1NUFA 5DJYB 3W2DL 1D6VL 4UAOC 2YXMA 3DIFA 2X4PA 5BVJA 3MLYL 5T1KA 4P2RE 2X4RA 4NM8H 4JFZL 3HI5H 3SKJL 3AXLA 3S7GA 4RFEA 5L8LB 2P46B 3RBGA 1EHNA 3QI9D 3C5ZA 1CF8L 1NBZB 2DS4A 4CL7A 1WLHA 3L3KA 1KXTB 5KSVB 2VTFA 4KRPC 1M1SA 3LKSB 3ZTJG 4GRMB 3TNMB 2WBJA 3JUZA 4K94H 3PWPA 1C5DA 1LK2B 2ESVD 3QEQE 1P5VA 3L95A 3PGFL 5HXMA 1G9MH 3SDDB 3WDHA 1BHGA 5IF0A 3H42H 3WLBA 1ZT1A 1INQB 4NBZB 4BKLB 2W59A 1AD9B 1MAKA 1A8JH 4FQLL 4FFYH 5C0IA 1RK0B 5TF1L 1UM5L 1S5HB 3O8XD 4LOUD 1YMMA 5KN5A 3OGCA 3ARPA 3U9PL 4C57C 3U4EB 5SWSB 3RZWA 5J06A 4C54A 2P48B 3TBWB 3KPPB 2A1WL 1HHJA 4ZFOA 4OIBA 1KV3A 2F54E 1PQZB 3IFPA 3DIFB 2X4PB 1CLYL 2OTWA 2QSCH 5BVJB 4JLRB 3OPZH 5T1KB 1TNMA 3QBTB 2XOTA 5F1NB 1NCNA 3M45A 1CIDA 1ZA3A 4RFEB 3L3JA 3OL2A 2C3VA 3HE7A 3C5ZB 4S0TD 5GRJH 3ARTA 3BIBX 2FHBA 3L3KB 3HB3C 3V5DA 3TPKA 2Z8WC 3RDTD 2BXYA 1G0DA 4JFEB 5I1JH 3HFMH 3BUTA 5EOCH 2WBJB 3PWPB 4P2RD 1C5DB 5GGSY 2YK1H 3L95B 2OL3A 1CN4A 1MCQA 5IF0B 3O2VL 3WLBB 2R0KH 1ZT1B 1FFOA 2NXZC 5IMOA 4JO1L 1VACA 4D0CA 5C0IB 1G6VK 5JXED 1YMMB 4KQ4H 5KN5B 3OGCB 4ZTOL 5B8CA 4J7RA 1SMOA 4LVHC 1I1AA 5DYOA 1HHJB 4ZFOB 3T4AA 5IEHA 1H3TA 3QEQD 3WL9A 3QDMA 4UV4H 1PAMA 1ZK9A 2OTWB 3A67H 3EJYC 2EIDA 4YK4B 5LVEA 3T65B 3K74B 1RUQH 1ZA3B 4K23H 1I3VA 4APQC 2BNUB 3I3DA 5DVOA 3TN0D 1CXKA 3L3JB 2FATH 15C8L 1XIWD 2C3VB 3HE7B 3IFLL 4XCEA 3CVIL 5I1DA 3C8HA 4M48H 3V5DB 4EN3B 3U7AA 3D0LA 3IFNH 2AXGA 1KB9J 1Z3GH 2F54D 4PJXE 4HG4J 2EE2A 4G8IA 1QPPA 3FQTA 2OL3B 2FHFA 1HYSC 1K4DA 1FFOB 4XNYH 5C2BH 4D0CB 2KH2B 4POZC 1NKOA 1PZUB 4GW4A 3EIFA 3FHQA 5FGBA 5JHDA 4N9GA 5F44A 2DOCA 5CCKH 1H5BC 4M6NH 4NUGH 3HZKA 5B8CB 1YY9C 3S35X 1I1AB 2ZUUA 5DYOB 3T4AB 4AIOA 3WL9B 3QDMB 5CFHA 4G7VH 3GMNA 5JR1H 1TJIL 1RIVL 3VFGL 1HEZB 1E4KC 4JO2H 4GLRH 2MFNA 4ZSOE 3DVGA 1NGYA 1Z0MA 1YYLL 5FK9A 4I5BB 4MGXA 3IGAA 4GG6E 4JHWL 3W81A 4XCEB 5I1DB 4J6RL 3D0LB 2AXGB 5AAWA 2LVEA 1I1CA 3TV3H 4KUZH 3HNSL 1WTGT 5EO9A 1WZ1L 1UB5A 3BPOC 3FQTB 4ZS7L 5DQJB 1OPGH 1K4DB 4TULL 1IFHL 4HUXA 4LPCA 1V7MH 5I1CH 4GW4B 4JN1H 4B0MM 2Q1EA 3ARGD 5K9KB 1MHPH 1GPOL 4N9GB 4KK6D 5F7DA 3WHE1 2PXYD 2XQYG 1KULA 4Z7UE 4X4YA 4HWNA 1F58H 3IJYA 1NBYA 3GMNB 3JBG7 3LRSA 1INEH 3WFDH 3SDCD 1NC4A 3Q3GA 4OCXH 4W81A 3RIFK 3DVGB 1NGYB 4KI5F 1PG7X 3FFDA 3BP7A 5FK9B 1GIGL 1ZE3C 1S78C 3IGAB 4I0PC 2J4WL 2ZCLH 4G3YH 2WLZA 1NEZA 3DX8A 1TVBA 4U1SB 4YAQB 4Q0XH 1J8HB 1JHKL 3WDIA 1CLOL 2X4QA 4ELKA 2BRQA 1UB5B 5HD8D 1UACL 3WUWA 4LK4A 3B9KA 4S0SD 4QWWC 3D6GA 4MD0A 4K3JH 1NCAH 2CDGA 2WWKO 4HUXB 4UNUA 5FFLA 1FNFA 4AEHL 5I0DA 3BH9A 3ZO0A 4PJAB 1B90A 1DVFA 5F7DB 5AAMA 1JE6A 4J1UA 4P2YA 4KK8D 1NEUA 3WHXA 4Z6AT 1I9IH 1IRAY 3L7FB 2BVQA 3RKDD 5E5UB 3LRSB 1NC4B 3ARDC 3EDKA 3Q3GB 2Y36H 3HNVH 2BVPA 1CGYA 1CFSA 4XPGL 5IFHH 1B0GA 3FFDB 3BP7B 3IF1A 4MA1B 5EBMB 2VXTH 1U8LA 5KSBF 5DGRA 1NEZB 5JQ6L 3DX8B 4FQCL 1TVBB 3RAJL 2K1MA 3D87B 5DMKA 4JZOA 2AJYL 2X4QB 1MFDH 4ELKB 4F58H 43CAA 3WUWB 3I2CH 1YNLH 4FXLA 5IT2L 1OWWA 2CDGB 1XMWA 1JF1A 3KVQA 1QNZH 3BH9B 4PY8I 1JI2A 2E7LA 2HT4C 3LS5L 2VAJA 4WV1C 3ZDZF 5A2IH 2V7HA 1JRHI 1MFCL 5AEAA 5IFAL 2DI9A 5EZJA 5KANG 2BVQB 2C4XA 2IPTH 3QB7C 5HHQB 4XVJL 3KPOA 3O9WC 3RVXD 2BVPB 1CFSB 1T5WA 4BQCA 1A14H 1DBML 1EK3A 1ZLSL 1A7RL 3TF7C 1UEYA 5FKPA 1B0RA 3FFCE 5E2TH 1B0GB 3LKQA 5CJXC 1TFHA 3FO2A 5DTFA 5A1AA 1FC1A 3IF1B 3NBNA 2IG2L 1U8LB 3T0XA 4K71B 2AGJH 3UX9B 3HNTH 2HFGH 1EGJL 1U8PA 4RGNC 5DMKB 2W9DH 1UKTA 4JZOB 1CG9A 5IM7A 3SE8L 43CAB 5CSBA 2AAVA 3PL6C 2DICA 4KDTA 1J10A 3GSXA 2EKSA 3QUZC 1JF1B 4AEIH 1OP5K 3V0AC 1DUYA 2CIIA 1I9EA 2APXA 1T0PB 5F96L 2QTEA 3OF6D 4N5EC 2CDFA 3O41A 1IE5A 2V7HB 4TNWK 5KVFL 2GK0A 1U8OB 3TFKC 1F42A 1R3KB 4P5MA 3KPOB 2AKRA 3WJJC 3O3AA 4LP5A 5DC9B 5B3JF 5CWSA 4BSWA 5KZCB 5FKPB 1B0RB 2OXGA 3LKQB 2FYYB 5I1KL 4L9DA 1UWGH 5DTFB 4ZYKA 4U0RB 3ZKSD 3S37X 4PJHB 2YMXH 4Z77A 2DI7A 3OQ3B 4XHJC 4Y4HA 4RMTA 1U8PB 1CVSC 3T08A 3BHBB 3SPVB 1LO0H 3GM0A 1CG9B 4OF5A 2A0LC 2NYYD 3EKCA 3MQIA 4M6AA 4X7EC 4EKXA 2FIKA 3FFCD 4PRBA 3GSXB 4PJCA 2EKSB 3NH7L 1L0QA 2JJTC 4OUOA 4L4VA 1DUYB 4HUVA 2CIIB 2CRYA 2NY4D 4L8SA 1DSFL 2VRAA 1U8KA 2CDFB 4G80B 2IANA 2GI7A 2BVYA 3MV9A 2HLAA 4TVSa 4LLUA 4OZGE 4UMGA 3VD3A 3OKMA 4U3XA 1IBGH 3OHXA 3O3AB 2FIRT 2ICWA 4KJYA 4LPTA 1UGNA 2EXYD 3OGOE 5CWSB 4JFPA 4BSWB 3HE6D 2FEEL 2IQAB 2W07A 4BYHA 3NIFF 4KRLB 1A7PL 4PREA 4ZYKB 1DE4B 5EWIL 3LMJL 4I77L 4L3CB 3HKFA 5ILTL 5IHZA 1L7IH 1FBIH 2CIKB 2DJUA 4KKLD 2YPLE 3MRHA 1X4XA 4NKIH 1UYWL 3BT2L 3UJJL 2V5YA 4GAJH 1PGRB 2FIKB 5SWZE 4PRBB 5F7NC 4PJCB 1QEWA 4Y5XA 2W60A 2WUCL 1DBJL 4O9HL 4L4VB 3S35L 3QXAA 2HN7A 4HUVB 4LL9A 3SQOH 3KYMA 3O0RH 4L8SB 1U8KB 2IANB 2ZUVA 3MV9B 5EOQH 2HLAB 3UAJD 4LLUB 1AFVL 1NSNH 1M6OA 1A6TB 3DJ9A 1MRDL 3OKMB 4K2UH 2YPVH 1JWSB 1AR1D 3GB7B 3GIVA 3OKEA 3OHXB 2ICWB 4KJYB 2HKHL 2GW5A 2J3SA 2MOVA 3MCLH 3GNMH 3I02A 4JFPB 4EUPH 4UBDD 4ZDHA 3HI1B 1K8IA 4HWEH 3G6AA 5F7LB 5B22A 3UJTL 3ALXA 4PREB 1HHKB 4JM4L 1DLHA 2Z35A 3JV6A 4OGYL 3WFZA 5I1EH 5IHZB 5HHXL 3D2UA 4ZFZA 2DTML 1ZKAA 4LVNC 5GJTH 1AE6L 3MRHB 3NZHL 3ISWA 1ZMYA 4M1CD 1A3LL 1R6VA 5DLML 1WITA 4MD4A 1FG9C 1BWMA 1MFBL 2W60B 4Y5VC 3QHFH 2EEAA 1DFBH 3ARBA 1JHLH 1HHHA 4DGIL 2EEBA 3QXAB 2HN7B 4PJ5A 1YPZF 2BY0A 1U8HA 4Z9KB 1B4JL 2X4OA 4PJIF 3MLVL 2A6KB 3PWPE 4XNXL 4FOMA 4YPGA 3SQBA 3UTPE 3QHZL 3QAZC 4GO6B 4CBPA 5CD3A 1KIRA 1MAML 5A2FA 1M6OB 1G6RA 3VGEA 3HC4H 3VJ6A 2CRMA 4HBCL 1F8TL 5SWZD 3SGDI 3ZTNL 4KI1A 2BDNL 3GIVB 1PG7L 3OKEB 3EYQD 3PWUA 5IBTL 4XPAH 2GITB 3SDAA 4YHKH 3WO3B 3I02B 1C5BL 4ZXBC 3VGAC 4ZDHB 1UXWA 3BQUB 1K8IB 1NCDL 3G6AB 3KHQA 2NY6B 1CL7H 5I73C 3BRDA 3QQ3A 3TJHD 1DLHB 2Z35B 3JV6B 2V9QA 2DWEB 4PGJA 3SDDD 1AQDB 4R97B 4ZFZB 4LPWA 1QFOA 3O2DA 1NCCH 2BZDA 2P5EB 3AB0C 3QRGH 2M26A 1D5ZA 2J5LC 5EBWA 3LPGA 1PBYA 2JB6A 4MD4B 3MYZA 3T04D 1RUKH 1OCWL 3ARBB 1HHHB 4PR5A 4PJ5B 3ULSA 1T83C 4OZHF 1U8HB 2X4OB 1ONQA 2YUVA 4YPGB 4UTBH 4C59B 1A9EA 1MPAL 2HLFD 1NGQH 5CD3B 1KIRB 5F6IB 1G6RB 1IGTA 4U1HA 3VJ6B 2NY2B 4LVEA 2DM2A 5F3BA 4Q9RL 5CEZH 2Q86A 3C5ZD 3H3PL 4HK0A 1UXWB 4C58B 4HLZG 3H9HA 5DMYA 5E6ZA 3QQ3B 4ZFGH 5BS0A 3P0VH 3EBAA 3PWPD 5EIIA 3UTPD 2AXJA 3QDME 3RVVC 5B21A 2AJSL 3FRUA 2WP3O 4JO4H 1D5ZB 3FB6A 4XX1G 2JB6B 1NL0H 1BGXH 1UM4L 1OTSD 1JVKA 1KCUL 5HDBE 2I24N 4X6EB 4HPOH 3RA7L 3V6BR 4K3EH 2A83B 4PR5B 4XC1H 5J3HC 1U0QA 3ULSB 1F3DJ 4U1JA 1ONQB 3D9AH 1TTGA 2WBWB 3IT8D 1A9EB 2VH5L 4EQ3A 1UT9A 1DANU 1OAQH 4LCUB 2EC9U 4PB9L 1LK3H 4U1HB 1A7QL 3QUKB 3K2UL 5D7JC 4BK4A 1BEYH 4LSSH 1Z9OA 4QLRA 5F3BB 4NKOA 1XR8A 4UV7L 5H37H 4PD4K 1MSPA 3HE7D 2Q86B 4U6HA 1CS6A 5ALCL 2H26A 2XQYK 3AMLA 5JHDE 3U82B 4HK0B 3H9HB 1FORH 2LE9A 3MXWL 5EIVA 5BS0B 5EIIB 3WN5C 4B7IA 2DQCH 1U3JA 1TITA 4DN3L 1OB1A 3CMOH 4NFCA 1WFNA 2YZ8A 5L9DH 1ZANH 2R2BA 3FRUB 4HK3J 1RU9L 3PGCA 3RGVA 1YYML 2ZKHH 3QDGB 3FB6B 4RCAA 1V3KA 1GGYA 4Q9BA 1SBSL 1CDBA 1T89C 2VLRA 1I1AD 4OFIA 4Z7NE 3QDMD 3SGKC 2PETA 1P6FA 4U1JB 3X3FL 5HYIA 2RAMA 1KNOA 4M6OH 5I18H 3NFNA 3GJEA 3QO0A 4LKCA 4W6YB 1HZHL 1VCAA 1EHAA 3AMKA 1KBGH 4RAUA 2B1HH 4ZQKA 5C0FA 2DQGH 4NKOB 1XR8B 4JG0L 5H8DA 1CU4L 2H26B 3I9GH 3S37L 1RVFH 1MIMH 1S7XA 5J89A 1IZJA 4P46C 1MJ8H 2NY1D 3Q6GL 4LASL 3CLEH 3S3SA 4X9BA 1OB1B 3O11A 4EI5C 5ICYA 3MRCA 3QCUH 2R2BB 4YBLB 3PGCB 5AUMA 5TDNA 1FFNB 5JZ7D 3RGVB 1RZJH 3LY6A 2CKBH 4LSRL 3UYRL 4KTEH 5JHDD 4UUJA 4MZ3A 4MXVE 4AL8L 4ZUUA 4AZ8A 2VLRB 1MHHA 3WE6A 1C1EH 3ZYOA 3D0VA 1Q9WB 4KROC 3MLRL 1NQBA 1LILA 2X4SA 3S34L 4KTDL 3QNYA 5EUOA 5J57B 3V5HA 1R24A 5DWUH 3I3EA 4JFHD 3ZT7A 3GJEB 1FGVH 3QO0B 3RI5K 5ALBL 3CIQA 4LKCB 4DZ8A 1GGCL 1T1XA 2R8SL 4YIQA 4M7KL 4RAUB 4YNYA 2ARJQ 4HPYL 4ZQKB 4DGVL 5C0FB 5D9SB 1G7QA 1JHTA 3WIIL 4XB7A 4W4NA 3RJDA 2B8OT 2AJUH 1S7XB 3AY4A 1U41A 3QIWD 3JWDL 2J2ZA 2PR4L 3U1SH 5DJXA 1JZ2A 4QXWA 3T09A 3BKJH 1YMHB 3O11B 5FHAL 5ICYB 4U6XA 3VA6A 1X6LA 1YQVH 2ZUYA 5DT1L 2AK4E 3QPQD 5L7XH 3NZ8B 5TDNB 4WY7L 5LGKA 3NFPA 1Z5LB 1IAIL 4NZUH 4EVNA 4HH8A 4HD9A 5IWLC 4UUJB 1WBXA 3CFCH 4ELMF 2EZ0D 2CD0A 2APVA 1KGCE 1MHHB 3WE6B 5F1KC 1FIGH 3D0VB 2R1XA 5FYJU 3VI3F 5AZ2L 1D9KB 2PO6D 3IDNA 2YRZA 3CD4A 1NC4D 3MLWL 3QNYB 4YHNA 5EUOB 3V0VA 5DJ6A 1R24B 3S6CA 3ULUH 5E1AA 5I16B 2D7QA 3WFCL 1FAKT 5DHYA 1T1XB 4W4OC 4YIQB 1I4FA 2Q7NA 4YNYB 5IOPB 1EO7A 1LHZA 1RUPH 4HGMA 3SHSA 4NUJA 4ZPTA 1G7QB 3OAZH 1JHTB 2R15A 4P4RB 4L4TB 3RVUD 2FLBT 5IJKA 2VQ1A 2RHEA 3RY6A 3RPIA 1A7NH 2CLVA 2DBJA 3BDYH 4ZODA 1TTFA 2R4SH 1JNHA 1T03L 3TPUA 2H1PH 2H41A 4QCIA 4R2GC 3KYAA 5JNYB 4K8RL 3B9KD 4U6XB 4H0HB 2JJSC 3CFDA 5GS3A 2GJZA 3GJFH 1CICC 4PY7A 4ZG1A 4EVNB 1UB6A 1WBXB 4J3SA 3VXNA 1DVFD 4YDIH 4XVUD 1RQ5A 1BMGA 4HWBA 3M8OH 1T66D 3SO3C 1QP1A 4PRAB 5FIEA 1M7IA 2R1XB 1NAML 3IDNB 1F6FB 1HCFX 4YHNB 1DCLA 3BP5A 3V0VB 2AK4D 5DJ6B 5E1AB 3GRWA 4G5ZL 2VDKL 2NY0C 5DHYB 3P40A 1BQHG 4FFWC 4JCLA 5CD5C 2FH8A 3VWJC 1UVQA 1I4FB 2P47B 1X9QA 4UOW0 5LQBL 4GMTL 1NAKL 1XF5A 4GS7C 4FTVB 4NUJB 4ZPTB 4U33A 1KGCD 3OG4B 3X14A 2VQ1B 3RPIB 4RAVA 4IBLT 2CLVB 4U1GC 5EOTA 5C09E 3ZKXC 1JNHB 5JW4R 3TPUB 1OF2A 2CH8A 2IWGA 4MB5A 3J7HA 1TVDA 4QCIB 4M9PA 1VFAA 5GHWL 5AYUH 3CFDB 2UWEF 4NN5B 4KZDL 4KK9C 1AI1L 4U2YA 1GHFH 5IVXA 5C92A 3TC9A 4PY7B 5CJ8A 5E6ID 1QBLH 4OLWH 4Z0BH 1UB6B 3VXNB 2A6DA 3QEUB 1AXTL 2BRRH 2Y25A 4YFDB 3THMH 2V17L 1M7IB 3LCYA 4LKXB 3BP5B 2V5SA 4YHOL 3FL7A 3NAAH 1J1XL 5KZCD 4FG6D 5FGCB 4PJCE 5EU6A 2EDDA 1WBZA 1UVQB 1CXEA 3LKPB 5A16A 4L4VE 4QTIH 3X14B 4N8PA 3IS0X 4P5TA 4L5FH 5EH1A 3ARFC 4RAVB 4GLRI 2IANE 1QR4A 5EOTB 4ENED 2CMRL 2PYFA 5FGSA 1UCBH 5FCUL 1OF2B 4NP4H 1VFAB 3EFFB 4HFUL 5FV2A 4JO3H 1N64H 4RX4A 2DDQL 2DM4A 4WDIA 4NIKB 5T1DL 3RNKA 3EGSA 1IGYA 2DF3A 4OUUA 4HS8L 2AV7A 1PKQA 4LRIA 3T0EA 3WFBH 3F58L 3LB6D 2ICWI 2A6DB 5HYEA 5CINL 4YDKL 2X10A 5C09D 2D31A 1S3KH 4Q58C 4ETQA 2VDOL 2VKWA 3WXWH 5D1QD 2HTLC 2YD7A 5E8DH 1B4RA 3LKNA 4TVPH 4U0QB 5E2VL 3OKNA 3QUXA 1YN7A 3AREA 1EBAA 1WBZB 4J3TA 4OD1L 1EAJA 4NO5A 3NIDE 2NQCA 1FH5L 2F53E 4P5TB 4YUEL 2B5IC 3ZE1F 1TIUA 5C9JA 2AQ1A 4Y4HD 5KJRL 1NDMA 2PYFB 4NSKA 5I1HH 2FR4B 5F93C 2OX5A 1KEMH 1TZGL 4WDIB 5GS2H 3HMWH 5B39G 5EA0H 3EGSB 1IGYB 3C6LC 1KFAH 1BQHB 3IJHB 4OUUB 3GUTA 1OAYH 1Q72L 2AV7B 4L4VD 4E5XA 1T80A 1PKQB 3T0EB 3EYSH 5IROA 3RHWF 2X1OA 3SCMA 2VDLL 2IAND 3QQ9D 1KEGH 5JOFA 3IDYB 4WUKH 4XCFH 2ZUTA 1FFPA 4V2BA 2D31B 1BVLA 3WSQH 3RY5A 4ETQB 3U30B 3BO8A 1OL0A 3LKNB 5T1LA 1J0JA 1MF2H 3Q5TA 1J05A 3OKNB 4HKJA 1WZKA 3QUXB 1YN7B 1S7UA 3TM6A 3AREB 1B6UA 1A3QA 3Q0HA 3C09C 2FX7H 4IOSD 3QDAA 5C6TL 3HRZA 3IKKA 4GXVH 5C9JB 2HWZH 1YNTA 3RWFA 1PSKH 3C8DA 1B3JA 1NDMB 2I27N 5LXGH 4NSKB 4X7SL 1XGPA 4EXKA 1BFVH 3LOWA 3HN3A 1PKOA 3D5OF 4NC1E 2YHGA 4LLDA 2P49B 3ZDXF 4WWKA 3H9ZA 2ZCKH 3JWOH 3GUTB 4ZUSA 1JWUA 2F53D 5T33H 2E5EA 4KKCC 2Q7YA 5DD5L 3W5NA 3SCMB 4KVCH 4HAFA 4M03A 5JOFB 2FB4L 4NBXB 3JWDC 1BVLB 1OD9A 1Q9OA 1ETZA 4A6YH 3DMMD 4LCIH 4PRHE 3QUYB 2ZJSL 3BO8B 3DSFL 1Q38A 1FZMA 3KWWA 1O7VA 3QPXL 4LQFH 4N0YL 4NJ9L 4S1SL 5CP7B 5T1LB 3TZVA 1QPXA 2EDTA 1J05B 4UTAH 3BESR 3S3PA 1WFOA 2VJXA 1S7UB 3JWNC 1RIHL 3KG5A 2YZ1A 3NABL 4HW6A 2NY6D 3MZGB 2ADFL 5HI4C 4O51B 4LSVL 2OTPA 3QZWG 4M9OA 1QYGH 2RCSL 4M5YH 4LDEB 3D2UD 4PG2A 3IAQA 1YNTB 3RWFB 1H3WM 3JV4A 4YO0A 5HYQA 3I6GA 5FEBA 3ZL4L 5ENWA 4PJFA 5GISH 1SYSA 1XGPB 3ULUF 5DFVD 5C0JA 5ICZA 4FABL 4JREC 4LLDB 2WV3A 2DQHH 2I5YH 2ORBL 4WWKB 2QQQA 3ARBD 4HZLB 4NO3A 3CU7A 3P2TA 4ZUSB 1JWUB 1FLRH 1NGWA 4PJ5D 3MCKA 2X1QA 1DBBH 3VG9C 1EHXA 2Q7YB 4X6CF 1U93A 5H35A 2DKUA 1S9VA 3MCG1 4XP9H 1B2WL 1F4XL 1L9NA 1Q9OB 1ETZB 1U2HA 3PWJA 4JQVC 5FYJH 2E7CA 4FQXA 2NY2D 3KWWB 4K8RC 1CZ8L 4X4YB 1FZMB 3RTQA 2HG5A 5J12C 1UWXK 4Z95H 3LEYH 4D9LH 3LHPH 5HGGS 3VFUB 3SDAD 1L9MA 2R4RL 8FABA 4LRNL 2F19H 4QRRE 1F3DH 1A0QH 3N06B 3SE3C 4CVWA 5EB9A 1MQ8A 4KDWA 2ICEA 2B0SL 4M62L 5D72H 2DLHA 4DAGH 2HMID 4PRHD 3JV4B 4YO0B 5HYQB 3I6GB 1J0HA 2J1KA 5ENWB 3UJIH 3ULVH 1SYSB 1T04A 2IBGA 3F5WA 2W0FA 5C0JB 5ICZB 5GSRA 1NJ9A 1IGIH 1X5XA 2G9HA 2ATPA 3MCKB 4ZAKA 4NQCE 2W1NA 1VHPA 4WCYL 4DUWA 1U93B 5H35B 1S9VB 2NZ9C 3OSKA 1B0WA 4Y8AA 5JPNA 3PWJB 3GEWB 3MRMA 5J1SC 1K6QL 1K8DA 4FQXB 4R0LC 3O45A 5KS9A 3RTQB 3N9GH 2N1KA 3FB8A 4HJ0D 8FABB 3W5MA 4XNUH 3DVNB 2XTJB 2VB5A 1CGXA 2EH7L 3VFSA 5BS0D 2H8PA 4WWID 4AG4H 5D70L 3GBLA 4MNGA 4YH6A 2ICEB 4M7ZC 2CGRH 1DL7L 2YUZA 4O5LL 1BQLL 4LGRB 4H1LA 2Q8AL 3HUJF 1T04B 3F5WB 2W0FB 2X6MA 3B2UC 5GSRB 1KTKE 1HINH 1NJ9B 1ZTXH 1ZHNA 1MWAB 5C70A 4HJGA 5F1IA 6FABH 3TT3H 4ODWA 4ZAKB 1GOGA 1I75A 4CN1A 4L8CA 4PJ8A 5C8JA 4PJBF 4KJQC 1MJ7H 4F37K 1QR1A 1K5NA 3LZFL 5JPNB 2OR8A 4ACPA 1QSEA 3U83A 4O2EA 3MRMB 3NA9H 4QEGA 1K8DB 3O45B 5KS9B 4LHUA 4WENB 3OKLA 3FB8B 5DHXB 2Q8BL 2DL9A 2R39A 1T3FA 1MFNA 3ARWA 3P0YH 4NQCD 4YZFF 4Y4KA 3TWCL 5DD3H 3VFSB 2H8PB 4LPYA 1FVDA 5DO2D 3S4SG 4MNGB 2AK1L 5FHBH 5JDSA 3G9AB 3O4LA 5GGQH 5HYSG 3UTQB 3RGVD 3VXPA 4H1LB 5J6GA 2WUBL 1KXQE 2YKLL 3VI4F 3L5XH 3HAEH 1R3IL 3H6JA 1ZHNB 2Z8SA 4HJGB 1MNUH 4LIQL 5E99H 5F1IB 1CK0H 1E6JL 4ODWB 3L7EA 3DGGA 4HXAH 3BP4A 2UZIL 4YDVA 4L8CB 2A77H 1IC7H 1YUHA 4PJ8B 4XVSL 1LEKA 5C8JB 4WHYH 2H2PD 4XB8A 5J13B 4D3CL 4LU5L 1QR1B 1K5NB 2XZZA 2R2HA 4HAGA 5J9PB 4O2EB 1FGNL 5ABDE 3FAXA 4LHUB 2XPGA 3OKLB 1H3VA 4JM2C 2DMCA 5KSBB 1IL1A 1T3FB 4IJ3C 3C60D 3SDXA 2VDMH 5C0AE 1EMTH 2WBJC 2Y6SD 4Y4KB 5C6PB 1NLBL 2XWTA 1IM9A 1FVDB 1MCWW 4G6MH 2Y7QA 3KPQA 4BH7A 5JDSB 4XI5D 3O4LB 4KHXH 5T3ZL 4NZTH 2EICA 3LIZL 3VXPB 5FB8A 2WIIA 1GGBH 1OLLA 4LSQH 4D9QD 5IKCB 1VESA 3HA0A 4XCCH 3G6JE 4KPHL 4DFIA 2FECI 2W9EL 4F9LC 3W2DH 3FB5A 1D6VH 4HCRA 2R69L 1W0WA 2EE3A 5TH2B 3BP4B 4GJTB 4JFZH 4YDVB 4MQXC 1YUHB 1LEKB 5HHME 4Z18A 1ADQA 2HYMA 2AABH 4JY4A 1SJXA 2VZVA 2VYRE 2R2HB 4OKDA 5DURB 1U8QA 5HHPA 1TXKA 1CF8H 4ZOCA 1T2XA 3RP1A 4EN3C 1X7QA 1SJVA 1IL1B 5F7MC 4KRPB 5CJOH 5CEZE 2EEDA 3SDXB 3QIBB 5BO1H 4K55A 2X4UA 4YX2L 2XWTB 2P1YA 4UIKL 2NNAA 2C9AA 2CRIA 2Y7QB 3KPQB 4BH7B 1T6VN 2QADC 1OT1A 2UYLA 3CXHK 5C0RH 3VFOB 1MCKA 3KS0H 5FB8B 2WIIB 1PW3A 1S7RA 4F9PC 3BKCL 5C0AD 3ZSSA 4EEEA 4JE4B 3FB5B 3IYLW 2IFFL 1LDSA 1CLYH 1OTUC 2H2SC 4N8CL 1P4BL 4I4WA 3SJVE 2KZ1B 4GAYA 1F4HA 4JFYA 2QEJA 4UIMA 1JGVH 4ETYA 4IHOA 2WIMA 4JY4B 2R0WH 5HYSB 4AEFA 1J88A 1U8QB 2D0HA 5HHPB 4APQA 5C3LD 1AH1A 5F1SA 1S7TB 5IVXE 1BJMA 1X7QB 2FX9L 4KVNL 1NFDE 4CADB 3FO0L 3OJVC 1NMBL 5D1XC 3PGDA 1A4JB 2CXGA 2X4UB 2MCG1 1BVKA 3QXUA 5HHMD 1H0DA 2NNAB 2KBGA 5TE6L 1PZ5A 4OQTH 3CVHA 4JFOA 3B9EA 3T3PF 4ODHL 4JR9L 3ARQA 5HHVL 5FYLL 3G6DL 3QHTC 1NANH 4G9FA 5FAAA 2HJKA 4XCYA 4JY5L 5EU6E 1S7RB 3ZKMD 4YHPA 1HDMA 3MLUL 4P4KB 1VA9A 5CEZD 3P4MA 1H5BA 3PP3K 4LVHB 1Q0YH 2G5RA 4LMQI 4CMMA 3UO1L 1WAAF 3AM8C 2PW2A 2OM5A 4QNPE 3D48R 3TVMD 4B53A 1YN6B 4I4WB 4LLMB 1GJIA 5JOEA 2Q87A 4GAYB 4JFYB 1E4KA 4UIMB 3NN8A 4HT1H 5B38A 5DJ0A 2EE9A 3WIHA 2DBLL 15C8H 3ULVF 1H3GA 3CVIH 2AI0L 4KQ3L 1PG7W 3V6OC 3PIQA 3ARYA 3GSNH 5IVZA 5CIPH 3VD9A 3FOLA 3T0EE 1F4YL 3PNWA 3PGDB 5JTWA 2EKJA 1E6OH 4OLXH 3PHOA 1P4IH 4JKPL 1BVKB 2I60L 1H0DB 2FWOA 1I3GH 1PZ5B 1JL8A 3REVA 1U3HD 3CVHB 4JFOB 4DFHA 5FO9A 2OMNA 1GGIL 4G9FB 2HJKB 4Z0XA 3RUGF 2Y07L 3CU1A 4XCYB 3NCEB 5FO7A 4J3VA 4YHPB 1UZ8A 4J3XA 3KJ6H 1YPZA 3P4MB 1H5BB 4GFTB 4XTRD 5IK3A 1NLDL 4PJIA 4OD3L 1RIVH 4CMMB 2PW2B 1AGCA 1SJEB 1AGFA 3B5GA 3IDJB 3NN8B 5B38B 5DJ0B 4WUUA 2WBKA 4X6DF 2DRUA 5EU6D 4BJLA 1G1YA 2IAMB 4MA8H 3PIQB 1PYWA 1WFUA 5IVZB 4WVRA 4XVTL 4TUJA 4Z7VE 3FOLB 4P5TD 4P9HL 5FUCC 1R5VB 5CILL 1JP5A 4B50A 2I9TA 2W9LA 1MCSA 1G6RL 3VG0H 1NGXA 1EUUA 3BPOB 2FWOB 3STLA 2VNCA 4NWTH 3REVB 1TZHA 3U7YL 3ARVA 5FO9B 3JVGC 5T3XH 1ND0A 3CFIC 4LNRA 3MLSL 1YEFL 2E9WA 4Z0XB 2X40A 4YGVB 4GRLC 5FO7B 5D71L 3T0ED 1YPZB 3RWIA 3DBXA 3S98A 4WTXA 5EORH 3KYOA 5IK3B 4PJIB 5JPMB 1KJ3L 2F74A 5DJCB 5GZOC 1W72L 1AGCB 3U4BH 3ARDA 3H7LA 5SX4H 1AGFB 5FGRA 4ODUA 1NCBH 4N0CC 1MRFH 4WUUB 5E8PA 3ARED 1WBYB 3W9EA 1MY5A 4OAWA 4IM8A 1QTYT 4K71C 4ZS6D 5L2KB 3VD5A 1PYWB 1HHIA 2CR3A 3BAEH 3HG1A 4HWZA 4IRJC 3E3QC 4B7LA 1ZEAH 3RKPA 1S9XA 3EOBA 5GGSA 1L6XA 2I9TB 3I85A 1XCTA 1NGXB 1SQ2N 4E41E 3WFHA 4KZEL 2GCYA 4KK5D 2YN5A 5DRWA 3STLB 3EO0A 2OZ4H 2X42A 1HKFA 1H3UA 5HGDA 1TZHB 2L7UA 4OIIL 1ND0B 3MJ9H 4LNRB 3DHMA 4XPTH 1JZ7A 2E9IA 3BVNA 5BMFL 5DC4B 1MVUA 5DUML 3B43A 4Q6YA 4WV1A 1JNJA 3DBXB 4OZHB 5C1MB 4NKQB 3V4VH 3KYOB 1BM3L 1CDCA 3GO1H 43C9A 1YECL 2A9NL 5I15L 1WGOA 4MAUL 5F7WC 1N5AA 3O9WA 5T1LD 4RBPH 1A02N 4ODUB 3VW3H 4PJFE 3O6KL 1Z6JT 3O2WL 5E8PB 3VXSA 5L2JB 4NNPL 3W9EB 4NBYB 1QA9A 4R90L 5TE4L 5CJXA 4JPIA 4JM2F 3CPLA 2BFVH 1HHIB 4I18C 1KUMA 4KUCD 4AIZA 2ATKA 3HG1B 4HWZB 2AJYH 4K9EL 3FT2A 4UNTA 4WO4A 4OSUH 1VEOA 5F7EL 1QG3A 1F90H 1S9XB 3EOBB 3BZ4A 5GGSB 4KKBC 4PP2A 1J8KA 1AJ7L 1XCTB 2W0PA 4MDJA 3WFHB 2QJDA 2GCYB 5HBBA 1CDIA 3RPKA 2B2XL 5JMRA 5IT2H 3PL6A 5DRWB 3EO0B 1CBVL 1P84K 1RHFA 2DLIA 3ZSTA 3QUZA 4K3DL 1KCLA 3LS5H 3EYOB 4OF6A 1FRGH 5M95B 3BVNB 1MVUB 4LDLB 1BF2A 1MFCH 2XTJE 4MXQD 4WV1B 6CGTA 1YEGH 3CK0L 5IFAH 2EDWA 2ZCHL 43C9B 1DN0A 5E9DB 5T1MA 5IHBA 3NACH 1HN1A 1DBMH 3L6FA 3NPSB 1FYTA 1N5AB 3O9WB 4UILL 5IBUG 3SKUD 3TZVD 3CXDL 1N6QL 2DMKA 2HRPL 4EUPG 2XYCA 1T7YA 2IG2H 2YD4A 3VXSB 4NN6C 3HUJE 1QA9B 3TBSA 3UYPA 4JPIB 4YDLC 3VWKC 4WGWB 3CPLB 2WWMC 2ARWA 4RWHA 1EGJH 4AIZB 2ATKB 3FT2B 5E7FA 4WO4B 1NDGA 5E2WH 4G8GA 1MI5A 3VD7A 3BZ4B 4PP2B 4P3CL 1XCQA 4NZJA 1RULH 2MPAH 1MEXH 1CDGA 1OTTC 3TESA 1N26A 3O6FC 5KS9E 5I71B 5EU3A 1NBVL 4YBQD 2OP4L 2QR0A 4R8WH 3BOVA 2YWYA 3KR3L 4QXGL 4L8SC 4ONOA 1N0XL 2ADGA 32C2A 1IZKA 4ALAL 2V5RA 4YZFE 5I74C 1T5XA 1FC2D 1DN0B 4CMHB 1TCRA 5C07A 3FMGH 5T1MB 4FQXD 1DANT 3L6FB 4GQ9L 3DI3B 1FYTB 2HKFL 4IDLA 5DK0A 1KC5H 5HVHC 1WJ3A 4BUHA 4UT6H 4MB4A 2WQ8A 4NQDE 5GRYA 3KPSA 3LEVL 1IAIM 4TVPE 3TBSB 2XTJD 4MZ2A 1FNHA 3MREA 2ADJA 4XMLL 3CJJA 1NDGB 1A1NA 3D3VA 4G8GB 1A6VL 1MI5B 2GK2A 2HFEA 5A3ID 5JW4M 5EC2A 2NY5L 2YBRB 3O8XC 4N0RA 1OWRM 4FRWA 1XCQB 4WEBL 4XC3L 5MENA 2CKNA 1QSEE 3PDOB 3V0WL 3NH7H 4OI8A 4KKAD 4GRWH 1PX4A 5EU3B 4YHLH 2QR0B 4NCC2 1KB5H 2XQBL 1HYRC 2Z4QA 4JN2A 3TO4D 3N1FC 2ADGB 32C2B 3GSUA 4M1DH 3BD3A 3QSKB 4QRPA 4OB5H 1A4KA 4OLUL 1T5XB 3CZJA 1KCVH 5C7XH 3WLWC 3O4LE 5C07B 3G08A 1ES0A 1JNNH 1LE9A 4JKWA 5DK0B 3L3GA 3IS1X 3BQUC 3X3GH 1AR2A 3KPSB 4FXGA 5EWIH 3HZMA 2JE8A 4I77H 2IPUG 4Q2ZA 3MREB 2H32A 2ADJB 2P24A 2BSTB 1E4WL 4MNQA 4RFOL 1A1NB 2XN9A 3D3VB 4XP5L 2M2DA 2HFEB 3GI9L 3JTSA 5EC2B 2ENYA 3BT2H 2OTUA 4OT1H 4XXCA 3LKRA 5MENB 3DUSA 3V4PH 4NQDD 1J9CT 5IBUB 1KLUB 4TVPD 4O9HH 2PTVA 3EYFA 3S35H 2FGWL 2HTKC 4XP4L 4Y5VA 4JN2B 4RGOL 1X5FA 3BEWB 4PUBH 1RY7B 4P9HC 1DQLL 4QRPB 1X3DA 1U6AH 1A4KB 4LEXL 3LH2L 1MRDH 3QUMB 2DLEA 3I3BA 4UT7L 1QSED 1IGCL 3G08B 1ES0B 3MBEA 1F4WL 4FQ2H 3VXME 5J11C 5JORA 1LE9B 2Y72A 3WFEL 3BPNB 4LHUD 2VDRL 5LKNA 1T6WA 3L3GB 3UJTH 3A6CL 4ZXBA 5GS2D 4JFQA 1ORSA 4JM4H 4FXGB 4OF0A 4R26L 5CLWA 1EBPA 4G6AD 4OGYH 3IU3B 4Y4KD 4MQ7A 2MSPA 5HHXH 2A9ML 4Q2ZB 2DTMH 2H32B 2P24B 2QSQA 5KVDL 4NT6A 4MNQB 3BSZH 1PFCA 2XN9B 3NZHH 3O4LD 4LVNB 2B1AH 3JTSB 4HEPG 2XIDA 3QXWA 2OTUB 3IDMA 3LKRB 3DUSB 5F7FA 4AY0A 3CDYA 3ZT6A 4S1QL 1LDPH 1U36A 4FQIL 5KTEH 4QGTA 1CQKA 3EYFB 5D7SH 2D03L 2BOBA 2LABA 1ACZA 2CJUH 2EXWC 3MACH 4XNXH 2DQEL 3HS0B 1T83A 1XGYL 2PF6A 3DHJA 4LLWA 4Y0GA 2IEPA 4L9LC 4G9DA 2J12B 1GZPA 1KCRL 3ZTNH 4XPHH 3FKUS 1PG7H 5DURD 2JB5L 1M05A 4GKZB 3MBEB 3D69A 4HMEA 7CGTA 3K8LA 1I3UA 1CFQA 3PP4L 4YBHA 1TZIA 3JSSA 3S36X 5HPMA 5FYJE 3RIAF 1OGAA 4ZXBB 3VGAB 4KRPD 4JFQB 1K2DA 4TSAH 5I75C 4A2MA 5I73B 4MQ7B 1YEIL 4U7KA 5HDQL 1HXYA 1QLFA 1IM9D 4X9HA 5D7IF 3W9DA 5L8JB 3QNZA 4DGYL 4NT6B 4WI4A 4DTGH 1EJOL 2X9XA 2VZUA 1GYAA 3VXMD 1GOHA 1QOKA 3AB0B 2UWEB 3IDMB 3U46A 2EO9A 2J5LB 3HR6A 2ICCA 1PY4A 1QFPA 2L0DA 4RRPG 3TGXA 1FN4A 1AY1L 4I2XB 5MEPA 4ONFL 2NXYC 4QT5A 3SDCC 3HMXL 5K9OA 4K9EC 3FQXA 1VENA 3DO3A 1EGJA 3VXRE 4PS4L 1I8KA 4G9DB 1GZPB 5D1ZA 4OTXL 4Q9RH 4JB9H 2P7TB 1M05B 5D7JA 3D69B 1CFQB 2X9WA 4G9FE 1TZIB 2IQ9L 2RBLA 2BOCA 5HPMB 4KJWC 2I9LA 1ED3B 4TPRL 4PGEB 3HB3D 1OGAB 1V7NH 1SEQL 3SKNA 5HD8C 1XR9A 1I7ZB 3WN5A 1QLFB 1KIUA 1TVHA 3OR6A 3P9LA 4QXUL 3W9DB 2C7UA 5FUZL 3ZDYE 4AK1A 1I7UA 3KDMA 3UTTA 3OJMB 4YBLC 4IIQC 4AIXA 2NXZD 4LDOB 4W70A 3SGEI 3U46B 4Z78A 4AJ0A 5EZIL 5FYJD 1RZ7L 2VERN 1KCUH 4YFLI 2Y06L 1SY6L 1HNFA 1KJMA 2HJLB 3U0TA 1FN4B 5MEPB 1SVCP 1T89A 2YD8A 3NCYS 4D94A 4KTYA 1JPSH 4OFPA 3SGKA