4XROA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
211
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 71
structure length 211
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xroA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xroA02
1AK4C 3G26A 4COPA 4COCA 4U0BA 1BAJA 4E92A 3DS3A 4PH3A 1M9XC 2BUOA 2XDEA 5I4TG 2PXRC 1EM9A 2ONTA 4NX4C 2M8PA 3G0VA 4E91A 2Y4ZA 1QRJA 4INBA 2JO0A 5HGKA 4PH2A 4PH1A 3DS5A 5HGMA 3P05A 3DTJA 1AUMA 1M9DC 4HTWA 4LQWC 4U0FA 3VRLC 2L6EA 3MGEA 4XROA 4XFYA 2JYGA 5HGOA 3NTEA 5HGLA 2XGYA 4B4NA 1G03A 1U7KA 3G29A 5HGNA 1L6NA 2EIAA 3H4EA 4U0AA 3G21A 2KODA 3LRYA 2LF4A 2GONA 1D1DA 1AFVA 3DPHA 2M8NA 3DS0A 3H47A 2PWMA 1M9FC 2WLVB 2XT1A 4IPYA 2PWOA 1GWPA 4U0DA 3BP9A 3DS2A 4XFZA 1EIAA 5DCKA 1EOQA 4QNBA 1M9EC 2X83A 2M8LA 2KGFA 3G28A 2WLVA 4XFXA 4U0CA 4DGEC 3G1IA 2GOLB 4J93A 1A8OA 2XV6A 1M9YC 2XGVA 1E6JP 4M0IA 3DS4A 3G1GA 2JYLA 4XRQA 2V4XA 5JPAA 3DS1A 1A43A 4DGAC 2JPRA 1P7NA 2X82A 2XGUA 2XXMA 4PH0A 2X2DD 4WYMA 4U0EA 1M9CC
chains in the Genus database with same CATH superfamily
1AK4C 3G26A 3M1MA 1QVGO 3DS3A 4E92A 2GDYA 2ROQA 4H2XC 2EHSA 2PXRC 1GXGA 2LPKA 2KOQA 2ONTA 4R0MA 1QRJA 2FHSC 1YITP 2K0YA 5HGKA 1YHQP 2KGCA 3DTJA 1AUMA 3LMOA 4HTWA 2N6ZA 3VRLC 1DNYA 4XROA 2P9XA 5HGOA 3CCRP 2OTJP 2XZ0D 5HGNA 2PNGA 4PXHB 2VLQA 2GDXA 3U43A 2K0XA 3DS0A 2X2BA 1M9FC 2PWOA 4U0DA 2CQ8A 2JAZA 3DS2A 2GDWA 2GYKA 1EOQA 2FVAA 3EJEA 2K92A 2X83A 2KGFA 2JQ4A 1VQ4P 2L22A 3G1IA 2PENA 1GPJA 4QKOA 2K0DX 4M0IA 1M1KQ 2KG9A 3DS4A 1VQNP 2KWLA 2DNWA 2V4XA 2KGEA 1M6EX 2E1MA 1VKUA 1T8KA 3CC2P 1A43A 4CA3A 4DGAC 2JPRA 1JJ2O 2X82A 1VHNA 2BHVA 2LIWA 4GR2A 2LIUA 1KD1Q 2AFEA 2GZFA 4COPA 1X3OA 3HYBA 2FVFA 4F37A 2K93A 3GZLA 1ZMBA 2CGQA 3G0VA 4E91A 1HQBA 5KP8B 3RG2A 3B4QA 1NQ4A 5F2KA 1CEIA 2KGAA 4PH2A 2KOSA 5HGMA 1M9DC 2OTLP 2KOPA 3CC7P 1Q82Q 1EMVA 1E0HA 3NY7B 1YJNP 3EJDA 4XFYA 1AF8A 3NTEA 5HGLA 2PY8A 2GZJA 1L6NA 2LL8A 2EIAA 3H4EA 1IMPA 1M74A 1YJ9P 1VQLP 1D1DA 2KR5A 1W2BO 1AFVA 3GJNA 2FACA 2M8NA 2PEOA 1VQ7P 3B5IA 2JBGA 2XT1A 1VQMP 1IUQA 3BP9A 3CD6P 5DCKA 7CEIA 5CZDB 1VQPP 1M9EC 1RO0A 2PEMA 4H2WC 2WLVA 4XFXA 2N5IA 2MY5A 1A8OA 2AF8A 5KP7B 2GZIA 2JU1A 1M9YC 2XGVA 1E6JP 2VLNA 3CC4P 1YIJP 3G1GA 3CCVP 4BPGA 2CG5B 3CCEP 2PEKA 1RNIA 2XGUA 2CNRA 3G6EP 1GXHA 4WYMA 3OW2O 4U0EA 3I55P 3WBHA 2K5XA 1MZ8A 1L0HA 1FR2A 1BAJA 4PH3A 1M9XC 5I4TG 1EM9A 5BS1A 2DGYA 2KW2A 2M8PA 2Z46A 4MRTC 2Y4ZA 4PH1A 3DS5A 3CCJP 4U0FA 2PEIA 1BXIA 2MR7A 3MGEA 1HY8A 2MVVA 3CCUP 2FQ2A 2FAEA 2QA4P 2JU2A 1U7KA 3G29A 1Z6MA 3G21A 2KODA 3LRYA 2LF4A 2EG5A 2L4BA 1NJIQ 2VLOA 2MD9A 2PWMA 4IPYA 2WLVB 2GZGA 1KC8Q 2K2QA 1L0IA 2AFDA 1IMQA 4IZ6A 4XFZA 1EIAA 2VSQA 1YI2P 3CE7A 3CXCO 4DGEC 4J93A 1N8RQ 1VQ8P 2XV6A 2LOLA 2EFJA 2OARA 2JYLA 2WPTA 5F2NA 4PWVB 4XRQA 2EHTA 4BPFA 1K8AQ 5HV8A 3DS1A 1Q86Q 1UJZA 2KORA 1P7NA 2MF4A 2VLPA 2XXMA 4PH0A 3CCMP 2X2DD 2NO8A 1Q7YQ 3I56P 1OR5A 5F2OA 3CMEP 2LMLA 3RG6C 1VQ6P 1AYIA 1K73Q 1VQ5P 4COCA 4U0BA 2N50A 1UNKA 2BUOA 2XDEA 3G71P 1K30A 2N98A 2KOOA 4GR6A 3G4SP 5EW5E 4NX4C 5KP6B 2FADA 4INBA 1M6NA 1Q81Q 2QNWA 2JO0A 1M90Q 3P05A 2L0QA 4LQWC 4DG9A 2KG8A 2Z44A 1KLPA 3HZQA 2L6EA 2JB0A 2JYGA 2CWOA 3Q20A 2XGYA 4B4NA 1G03A 1VQKP 4U0AA 5HVCA 3CCLP 2KGDA 2GONA 1ZNVA 3DPHA 3CMAP 1VQOP 1RO2A 3E2DA 3H47A 2LKIA 1YJWP 2MVUA 1QVFO 1GWPA 3H0DA 2K94A 3EJBA 2AVAA 2FQ0A 4QNBA 2ERHA 2GZEA 2M5RA 4NEOA 5BS2A 4UHPB 2M8LA 3G28A 4U0CA 2GOLB 4BPHA 4HKGA 2PEJA 2JGPA 2FVEA 1KQSO 2KG6A 2MR8A 2N5HA 2N6YA 3GKLC 5EJDA 1S72P 1DV5A 1ACPA 5JPAA 1F80D 2Z45A 3CPWO 3CCQP 2LTEA 4H2YC 2FQ1A 2PEQA 1K9MQ 3GZMA 3CCSP 1VQ9P 2L9FA 2XZ1C 2QEXP 1M9CC
chains in the Genus database with same CATH topology
1AK4C 3G26A 3M1MA 3RG6C 4COPA 1K73Q 1VQ5P 1VQ6P 1QVGO 4COCA 4U0BA 1BAJA 4E92A 3DS3A 4PH3A 1M9XC 2BUOA 2XDEA 3HYBA 5I4TG 3G71P 1K30A 2PXRC 4GR6A 1EM9A 5BS1A 2DGYA 2ONTA 3G4SP 4NX4C 1ZMBA 2M8PA 3G0VA 4E91A 2Z46A 2Y4ZA 1QRJA 4INBA 1M6NA 1Q81Q 1YITP 5F2KA 2JO0A 5HGKA 4PH2A 4PH1A 3DS5A 1YHQP 5HGMA 1M90Q 3CCJP 3P05A 3DTJA 1AUMA 1M9DC 2OTLP 4HTWA 4LQWC 4U0FA 2Z44A 2PEIA 3CC7P 3VRLC 1Q82Q 3HZQA 2L6EA 3MGEA 4XROA 1YJNP 2P9XA 4XFYA 2JYGA 3CCUP 5HGOA 3CCRP 2CWOA 3NTEA 5HGLA 2XGYA 3Q20A 2OTJP 2PY8A 2QA4P 4B4NA 1G03A 1U7KA 3G29A 5HGNA 1L6NA 1VQKP 2EIAA 3H4EA 4U0AA 3G21A 2KODA 1M74A 3CCLP 3LRYA 2LF4A 2EG5A 1YJ9P 2GONA 1D1DA 1VQLP 1W2BO 1AFVA 1VQOP 3DPHA 3CMAP 2M8NA 1RO2A 3E2DA 1NJIQ 3DS0A 2PEOA 1VQ7P 3H47A 3B5IA 2PWMA 1M9FC 2WLVB 2XT1A 4IPYA 1YJWP 1KC8Q 2PWOA 1QVFO 1GWPA 1VQMP 4U0DA 3H0DA 1IUQA 3BP9A 3DS2A 3CD6P 4XFZA 1EIAA 5DCKA 1YI2P 1EOQA 4QNBA 1VQPP 1M9EC 3CXCO 2X83A 5BS2A 2M8LA 1RO0A 2KGFA 2PEMA 3G28A 2WLVA 1VQ4P 4XFXA 4U0CA 4DGEC 2PENA 2GOLB 4J93A 3G1IA 1N8RQ 1VQ8P 1A8OA 2XV6A 2PEJA 1M9YC 2XGVA 1E6JP 2EFJA 4M0IA 1KQSO 1M1KQ 3CC4P 2OARA 3DS4A 1YIJP 3G1GA 2JYLA 3CCVP 1VQNP 5F2NA 4XRQA 5F2OA 2V4XA 1S72P 1M6EX 3CCEP 2E1MA 2PEKA 5JPAA 1K8AQ 1RNIA 3DS1A 3CC2P 1Q86Q 1A43A 2Z45A 3CPWO 3CCQP 4DGAC 2JPRA 1JJ2O 1P7NA 2X82A 2XGUA 2XXMA 4PH0A 3CCMP 2X2DD 2BHVA 2PEQA 3CMEP 3G6EP 1K9MQ 4WYMA 1Q7YQ 3I56P 4GR2A 1KD1Q 3CCSP 3OW2O 1VQ9P 4U0EA 3I55P 3WBHA 2QEXP 1M9CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AK4 C;  3G26 A;  4COP A;  4COC A;  4U0B A;  1BAJ A;  4E92 A;  3DS3 A;  4PH3 A;  1M9X C;  2BUO A;  2XDE A;  5I4T G;  2PXR C;  1EM9 A;  2ONT A;  4NX4 C;  2M8P A;  3G0V A;  4E91 A;  2Y4Z A;  1QRJ A;  4INB A;  2JO0 A;  5HGK A;  4PH2 A;  4PH1 A;  3DS5 A;  5HGM A;  3P05 A;  3DTJ A;  1AUM A;  1M9D C;  4HTW A;  4LQW C;  4U0F A;  3VRL C;  2L6E A;  3MGE A;  4XRO A;  4XFY A;  2JYG A;  5HGO A;  3NTE A;  5HGL A;  2XGY A;  4B4N A;  1G03 A;  1U7K A;  3G29 A;  5HGN A;  1L6N A;  2EIA A;  3H4E A;  4U0A A;  3G21 A;  2KOD A;  3LRY A;  2LF4 A;  2GON A;  1D1D A;  1AFV A;  3DPH A;  2M8N A;  3DS0 A;  3H47 A;  2PWM A;  1M9F C;  2WLV B;  2XT1 A;  4IPY A;  2PWO A;  1GWP A;  4U0D A;  3BP9 A;  3DS2 A;  4XFZ A;  1EIA A;  5DCK A;  1EOQ A;  4QNB A;  1M9E C;  2X83 A;  2M8L A;  2KGF A;  3G28 A;  2WLV A;  4XFX A;  4U0C A;  4DGE C;  3G1I A;  2GOL B;  4J93 A;  1A8O A;  2XV6 A;  1M9Y C;  2XGV A;  1E6J P;  4M0I A;  3DS4 A;  3G1G A;  2JYL A;  4XRQ A;  2V4X A;  5JPA A;  3DS1 A;  1A43 A;  4DGA C;  2JPR A;  1P7N A;  2X82 A;  2XGU A;  2XXM A;  4PH0 A;  2X2D D;  4WYM A;  4U0E A;  1M9C C; 
#chains in the Genus database with same CATH topology
 1AK4 C;  3G26 A;  3M1M A;  1QVG O;  3DS3 A;  4E92 A;  2GDY A;  2ROQ A;  4H2X C;  2EHS A;  2PXR C;  1GXG A;  2LPK A;  2KOQ A;  2ONT A;  4R0M A;  1QRJ A;  2FHS C;  1YIT P;  2K0Y A;  5HGK A;  1YHQ P;  2KGC A;  3DTJ A;  1AUM A;  3LMO A;  4HTW A;  2N6Z A;  3VRL C;  1DNY A;  4XRO A;  2P9X A;  5HGO A;  3CCR P;  2OTJ P;  2XZ0 D;  5HGN A;  2PNG A;  4PXH B;  2VLQ A;  2GDX A;  3U43 A;  2K0X A;  3DS0 A;  2X2B A;  1M9F C;  2PWO A;  4U0D A;  2CQ8 A;  2JAZ A;  3DS2 A;  2GDW A;  2GYK A;  1EOQ A;  2FVA A;  3EJE A;  2K92 A;  2X83 A;  2KGF A;  2JQ4 A;  1VQ4 P;  2L22 A;  3G1I A;  2PEN A;  1GPJ A;  4QKO A;  2K0D X;  4M0I A;  1M1K Q;  2KG9 A;  3DS4 A;  1VQN P;  2KWL A;  2DNW A;  2V4X A;  2KGE A;  1M6E X;  2E1M A;  1VKU A;  1T8K A;  3CC2 P;  1A43 A;  4CA3 A;  4DGA C;  2JPR A;  1JJ2 O;  2X82 A;  1VHN A;  2BHV A;  2LIW A;  4GR2 A;  2LIU A;  1KD1 Q;  2AFE A;  2GZF A;  4COP A;  1X3O A;  3HYB A;  2FVF A;  4F37 A;  2K93 A;  3GZL A;  1ZMB A;  2CGQ A;  3G0V A;  4E91 A;  1HQB A;  5KP8 B;  3RG2 A;  3B4Q A;  1NQ4 A;  5F2K A;  1CEI A;  2KGA A;  4PH2 A;  2KOS A;  5HGM A;  1M9D C;  2OTL P;  2KOP A;  3CC7 P;  1Q82 Q;  1EMV A;  1E0H A;  3NY7 B;  1YJN P;  3EJD A;  4XFY A;  1AF8 A;  3NTE A;  5HGL A;  2PY8 A;  2GZJ A;  1L6N A;  2LL8 A;  2EIA A;  3H4E A;  1IMP A;  1M74 A;  1YJ9 P;  1VQL P;  1D1D A;  2KR5 A;  1W2B O;  1AFV A;  3GJN A;  2FAC A;  2M8N A;  2PEO A;  1VQ7 P;  3B5I A;  2JBG A;  2XT1 A;  1VQM P;  1IUQ A;  3BP9 A;  3CD6 P;  5DCK A;  7CEI A;  5CZD B;  1VQP P;  1M9E C;  1RO0 A;  2PEM A;  4H2W C;  2WLV A;  4XFX A;  2N5I A;  2MY5 A;  1A8O A;  2AF8 A;  5KP7 B;  2GZI A;  2JU1 A;  1M9Y C;  2XGV A;  1E6J P;  2VLN A;  3CC4 P;  1YIJ P;  3G1G A;  3CCV P;  4BPG A;  2CG5 B;  3CCE P;  2PEK A;  1RNI A;  2XGU A;  2CNR A;  3G6E P;  1GXH A;  4WYM A;  3OW2 O;  4U0E A;  3I55 P;  3WBH A;  2K5X A;  1MZ8 A;  1L0H A;  1FR2 A;  1BAJ A;  4PH3 A;  1M9X C;  5I4T G;  1EM9 A;  5BS1 A;  2DGY A;  2KW2 A;  2M8P A;  2Z46 A;  4MRT C;  2Y4Z A;  4PH1 A;  3DS5 A;  3CCJ P;  4U0F A;  2PEI A;  1BXI A;  2MR7 A;  3MGE A;  1HY8 A;  2MVV A;  3CCU P;  2FQ2 A;  2FAE A;  2QA4 P;  2JU2 A;  1U7K A;  3G29 A;  1Z6M A;  3G21 A;  2KOD A;  3LRY A;  2LF4 A;  2EG5 A;  2L4B A;  1NJI Q;  2VLO A;  2MD9 A;  2PWM A;  4IPY A;  2WLV B;  2GZG A;  1KC8 Q;  2K2Q A;  1L0I A;  2AFD A;  1IMQ A;  4IZ6 A;  4XFZ A;  1EIA A;  2VSQ A;  1YI2 P;  3CE7 A;  3CXC O;  4DGE C;  4J93 A;  1N8R Q;  1VQ8 P;  2XV6 A;  2LOL A;  2EFJ A;  2OAR A;  2JYL A;  2WPT A;  5F2N A;  4PWV B;  4XRQ A;  2EHT A;  4BPF A;  1K8A Q;  5HV8 A;  3DS1 A;  1Q86 Q;  1UJZ A;  2KOR A;  1P7N A;  2MF4 A;  2VLP A;  2XXM A;  4PH0 A;  3CCM P;  2X2D D;  2NO8 A;  1Q7Y Q;  3I56 P;  1OR5 A;  5F2O A;  3CME P;  2LML A;  3RG6 C;  1VQ6 P;  1AYI A;  1K73 Q;  1VQ5 P;  4COC A;  4U0B A;  2N50 A;  1UNK A;  2BUO A;  2XDE A;  3G71 P;  1K30 A;  2N98 A;  2KOO A;  4GR6 A;  3G4S P;  5EW5 E;  4NX4 C;  5KP6 B;  2FAD A;  4INB A;  1M6N A;  1Q81 Q;  2QNW A;  2JO0 A;  1M90 Q;  3P05 A;  2L0Q A;  4LQW C;  4DG9 A;  2KG8 A;  2Z44 A;  1KLP A;  3HZQ A;  2L6E A;  2JB0 A;  2JYG A;  2CWO A;  3Q20 A;  2XGY A;  4B4N A;  1G03 A;  1VQK P;  4U0A A;  5HVC A;  3CCL P;  2KGD A;  2GON A;  1ZNV A;  3DPH A;  3CMA P;  1VQO P;  1RO2 A;  3E2D A;  3H47 A;  2LKI A;  1YJW P;  2MVU A;  1QVF O;  1GWP A;  3H0D A;  2K94 A;  3EJB A;  2AVA A;  2FQ0 A;  4QNB A;  2ERH A;  2GZE A;  2M5R A;  4NEO A;  5BS2 A;  4UHP B;  2M8L A;  3G28 A;  4U0C A;  2GOL B;  4BPH A;  4HKG A;  2PEJ A;  2JGP A;  2FVE A;  1KQS O;  2KG6 A;  2MR8 A;  2N5H A;  2N6Y A;  3GKL C;  5EJD A;  1S72 P;  1DV5 A;  1ACP A;  5JPA A;  1F80 D;  2Z45 A;  3CPW O;  3CCQ P;  2LTE A;  4H2Y C;  2FQ1 A;  2PEQ A;  1K9M Q;  3GZM A;  3CCS P;  1VQ9 P;  2L9F A;  2XZ1 C;  2QEX P;  1M9C C; 
#chains in the Genus database with same CATH homology
 1AK4 C;  3G26 A;  3M1M A;  3RG6 C;  4COP A;  1K73 Q;  1VQ5 P;  1VQ6 P;  1QVG O;  4COC A;  4U0B A;  1BAJ A;  4E92 A;  3DS3 A;  4PH3 A;  1M9X C;  2BUO A;  2XDE A;  3HYB A;  5I4T G;  3G71 P;  1K30 A;  2PXR C;  4GR6 A;  1EM9 A;  5BS1 A;  2DGY A;  2ONT A;  3G4S P;  4NX4 C;  1ZMB A;  2M8P A;  3G0V A;  4E91 A;  2Z46 A;  2Y4Z A;  1QRJ A;  4INB A;  1M6N A;  1Q81 Q;  1YIT P;  5F2K A;  2JO0 A;  5HGK A;  4PH2 A;  4PH1 A;  3DS5 A;  1YHQ P;  5HGM A;  1M90 Q;  3CCJ P;  3P05 A;  3DTJ A;  1AUM A;  1M9D C;  2OTL P;  4HTW A;  4LQW C;  4U0F A;  2Z44 A;  2PEI A;  3CC7 P;  3VRL C;  1Q82 Q;  3HZQ A;  2L6E A;  3MGE A;  4XRO A;  1YJN P;  2P9X A;  4XFY A;  2JYG A;  3CCU P;  5HGO A;  3CCR P;  2CWO A;  3NTE A;  5HGL A;  2XGY A;  3Q20 A;  2OTJ P;  2PY8 A;  2QA4 P;  4B4N A;  1G03 A;  1U7K A;  3G29 A;  5HGN A;  1L6N A;  1VQK P;  2EIA A;  3H4E A;  4U0A A;  3G21 A;  2KOD A;  1M74 A;  3CCL P;  3LRY A;  2LF4 A;  2EG5 A;  1YJ9 P;  2GON A;  1D1D A;  1VQL P;  1W2B O;  1AFV A;  1VQO P;  3DPH A;  3CMA P;  2M8N A;  1RO2 A;  3E2D A;  1NJI Q;  3DS0 A;  2PEO A;  1VQ7 P;  3H47 A;  3B5I A;  2PWM A;  1M9F C;  2WLV B;  2XT1 A;  4IPY A;  1YJW P;  1KC8 Q;  2PWO A;  1QVF O;  1GWP A;  1VQM P;  4U0D A;  3H0D A;  1IUQ A;  3BP9 A;  3DS2 A;  3CD6 P;  4XFZ A;  1EIA A;  5DCK A;  1YI2 P;  1EOQ A;  4QNB A;  1VQP P;  1M9E C;  3CXC O;  2X83 A;  5BS2 A;  2M8L A;  1RO0 A;  2KGF A;  2PEM A;  3G28 A;  2WLV A;  1VQ4 P;  4XFX A;  4U0C A;  4DGE C;  2PEN A;  2GOL B;  4J93 A;  3G1I A;  1N8R Q;  1VQ8 P;  1A8O A;  2XV6 A;  2PEJ A;  1M9Y C;  2XGV A;  1E6J P;  2EFJ A;  4M0I A;  1KQS O;  1M1K Q;  3CC4 P;  2OAR A;  3DS4 A;  1YIJ P;  3G1G A;  2JYL A;  3CCV P;  1VQN P;  5F2N A;  4XRQ A;  5F2O A;  2V4X A;  1S72 P;  1M6E X;  3CCE P;  2E1M A;  2PEK A;  5JPA A;  1K8A Q;  1RNI A;  3DS1 A;  3CC2 P;  1Q86 Q;  1A43 A;  2Z45 A;  3CPW O;  3CCQ P;  4DGA C;  2JPR A;  1JJ2 O;  1P7N A;  2X82 A;  2XGU A;  2XXM A;  4PH0 A;  3CCM P;  2X2D D;  2BHV A;  2PEQ A;  3CME P;  3G6E P;  1K9M Q;  4WYM A;  1Q7Y Q;  3I56 P;  4GR2 A;  1KD1 Q;  3CCS P;  3OW2 O;  1VQ9 P;  4U0E A;  3I55 P;  3WBH A;  2QEX P;  1M9C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...