4XROA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
211
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQATETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 71
structure length 211
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xroA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xroA02
2PXRC 4U0DA 5HGKA 4XFZA 2X83A 3DPHA 3G21A 5DCKA 5JPAA 5I4TG 2Y4ZA 2GONA 2XGVA 1D1DA 1GWPA 3NTEA 4DGEC 4E92A 5HGOA 4QNBA 4IPYA 1EM9A 1M9FC 1EOQA 3G28A 4U0EA 1A8OA 5HGNA 2L6EA 2ONTA 2XGUA 1P7NA 4PH3A 1BAJA 2XXMA 2XV6A 4J93A 4B4NA 3DS4A 2X82A 3G26A 1M9DC 4U0CA 1AK4C 4WYMA 3DS0A 3P05A 2XT1A 2XDEA 4U0FA 4XFXA 4INBA 2XGYA 3H47A 3G29A 1QRJA 1E6JP 2M8PA 2V4XA 3DS5A 4PH0A 4PH2A 4XRQA 5HGLA 2X2DD 4M0IA 2LF4A 3G1GA 2WLVB 4NX4C 3DS1A 4U0AA 1M9EC 1AUMA 2M8LA 4COPA 4E91A 3DS3A 2GOLB 3G0VA 4LQWC 1M9CC 2EIAA 2PWMA 2JYGA 2JO0A 3G1IA 3DTJA 1U7KA 4PH1A 1A43A 2KGFA 4DGAC 2WLVA 4XROA 1L6NA 1G03A 1EIAA 3MGEA 4XFYA 1M9YC 5HGMA 2PWOA 3BP9A 3DS2A 2KODA 2M8NA 3H4EA 4HTWA 2JYLA 2BUOA 4COCA 1M9XC 4U0BA 3LRYA 3VRLC 2JPRA 1AFVA
chains in the Genus database with same CATH superfamily
1AF8A 5JPAA 1VQMP 1YHQP 2Y4ZA 2XGVA 3CPWO 3G71P 3I56P 3HZQA 2MR7A 2VLOA 4U0EA 5KP7B 2ERHA 2XZ0D 2L6EA 1ACPA 2GZEA 2XGUA 1VQPP 1BAJA 1VQ9P 4B4NA 2LKIA 3DS4A 1K9MQ 3U43A 4WYMA 2XDEA 2FQ1A 4GR6A 4XFXA 2KOSA 2XGYA 1F80D 1FR2A 2LIUA 4PH0A 5EW5E 1M74A 1OR5A 4M0IA 2VSQA 2DNWA 2AF8A 4NX4C 4IZ6A 2GDWA 1M6NA 3CCMP 2M8LA 3I55P 4E91A 2GOLB 2L9FA 2JB0A 1AYIA 2JYGA 2X2BA 1UJZA 2KGFA 1KLPA 1K8AQ 3RG6C 1YITP 1L6NA 1IMQA 1EIAA 2EG5A 2NO8A 1VQ4P 5KP6B 1GPJA 2ROQA 2KODA 2JU1A 2JYLA 4BPFA 1YJNP 1M9XC 1GXGA 2N98A 3VRLC 2GDYA 1VQ6P 4PWVB 5KP8B 1GXHA 2PXRC 2X83A 2FACA 3DPHA 5I4TG 1GWPA 3NTEA 2JQ4A 1Q82Q 5HGOA 1YIJP 1DV5A 1EM9A 3GZLA 5HGNA 1HQBA 3EJEA 2PEKA 2PEMA 2K5XA 2LIWA 2ONTA 1S72P 1W2BO 2QA4P 4PXHB 2CNRA 1YJ9P 2XXMA 2XV6A 2KGEA 3CE7A 2KG8A 1N8RQ 2PEJA 5HV8A 3G26A 4U0CA 3Q20A 1KC8Q 1Q81Q 1T8KA 2CG5B 3DS0A 3CCQP 4BPHA 2MD9A 1KQSO 2KOQA 2BHVA 2KOOA 2KWLA 3EJBA 1VQOP 1Q86Q 3CCSP 3CXCO 3HYBA 1ZMBA 2LF4A 1VQKP 4MRTC 2K2QA 1VQ7P 4U0AA 1M9EC 1K73Q 4COPA 5EJDA 3DS3A 4LQWC 1M9CC 2CQ8A 2PWMA 3G1IA 3CMEP 2FVAA 1VKUA 2LOLA 2FVEA 2FVFA 1A43A 1DNYA 2KW2A 1G03A 1Z6MA 1VQ5P 3MGEA 1UNKA 2KGAA 3CCUP 2FQ0A 4R0MA 3DS2A 2KR5A 4HTWA 1EMVA 3H0DA 2PNGA 4H2WC 3CMAP 3LRYA 1L0HA 2QNWA 5BS2A 2JPRA 3GKLC 5HGKA 4XFZA 5BS1A 5DCKA 3WBHA 3CCRP 2GONA 3CD6P 3EJDA 2QEXP 2M5RA 2KGDA 3G28A 2L4BA 2K92A 2K0XA 3GZMA 1X3OA 2JU2A 2PY8A 4J93A 1ZNVA 3B5IA 2X82A 2LMLA 1AK4C 4U0FA 2N5IA 3B4QA 4H2YC 4INBA 1QRJA 2LL8A 1E6JP 1RO2A 2L0QA 2K94A 3E2DA 2V4XA 2Z45A 2N6YA 2KOPA 3CCEP 1VQNP 3RG2A 4XRQA 4HKGA 1RO0A 2EHTA 5HGLA 2FAEA 3CC7P 2MVUA 3G1GA 1KD1Q 3M1MA 2GZFA 2N5HA 3G0VA 2LPKA 2EIAA 1CEIA 2GYKA 4DG9A 5HVCA 1IMPA 4H2XC 3GJNA 4F37A 2GZGA 1NQ4A 3NY7B 2PWOA 3BP9A 2M8NA 2Z44A 1IUQA 1QVFO 2BUOA 3CCVP 4U0BA 3G6EP 2EFJA 4GR2A 1MZ8A 7CEIA 2AFEA 2XZ1C 1JJ2O 4UHPB 3G4SP 1Q7YQ 4U0DA 3CCJP 3G21A 2PEQA 1RNIA 4QKOA 1D1DA 2KORA 4DGEC 4E92A 2PEIA 1VHNA 4QNBA 3OW2O 2CWOA 4IPYA 4NEOA 1M9FC 1EOQA 2PEOA 1BXIA 1M90Q 1A8OA 1VQ8P 2MVVA 2K93A 1P7NA 3CC4P 4PH3A 2N6ZA 2AFDA 2JBGA 2DGYA 2FQ2A 2JAZA 2GDXA 2AVAA 1M9DC 1HY8A 2EHSA 2L22A 2KGCA 3P05A 4BPGA 4CA3A 3CC2P 2LTEA 2XT1A 2GZJA 2N50A 2OTJP 2MF4A 1YI2P 3H47A 2KG6A 3G29A 2MR8A 2E1MA 2M8PA 3DS5A 2GZIA 4PH2A 2WPTA 2X2DD 1VQLP 5CZDB 2Z46A 2WLVB 3DS1A 2PENA 1AUMA 5F2KA 2VLPA 2K0YA 1E0HA 2JO0A 3DTJA 2KG9A 2OARA 1M1KQ 1U7KA 4PH1A 1NJIQ 3CCLP 4DGAC 2WLVA 3LMOA 2VLQA 4XROA 1QVGO 2P9XA 4XFYA 1M9YC 2FHSC 5F2OA 5HGMA 2K0DX 3H4EA 1K30A 2OTLP 4COCA 5F2NA 2VLNA 2FADA 2JGPA 1M6EX 1YJWP 1L0IA 2CGQA 2MY5A 1AFVA
chains in the Genus database with same CATH topology
3G4SP 2PXRC 1Q7YQ 4U0DA 3CCJP 5HGKA 4XFZA 2X83A 5BS1A 3DPHA 3G21A 5DCKA 3WBHA 5JPAA 1VQMP 1YHQP 5I4TG 2Y4ZA 2PEQA 2GONA 3CCRP 2XGVA 1RNIA 3CPWO 1D1DA 1GWPA 3NTEA 3G71P 3CD6P 1Q82Q 4DGEC 4E92A 3I56P 5HGOA 2PEIA 4QNBA 3HZQA 2QEXP 3OW2O 1YIJP 2CWOA 4IPYA 1EM9A 1M9FC 1EOQA 2PEOA 4U0EA 3G28A 1M90Q 1A8OA 5HGNA 2L6EA 1VQ8P 2PEKA 2PEMA 2ONTA 2XGUA 2PY8A 1S72P 1P7NA 2QA4P 1VQPP 1W2BO 3CC4P 4PH3A 1BAJA 1YJ9P 1VQ9P 2XXMA 2XV6A 4J93A 4B4NA 1N8RQ 2DGYA 2PEJA 3B5IA 3DS4A 2X82A 3G26A 1M9DC 4U0CA 3Q20A 1KC8Q 1AK4C 1Q81Q 4WYMA 1K9MQ 3DS0A 3P05A 3CC2P 2XT1A 3CCQP 2XDEA 4U0FA 4GR6A 4XFXA 1KQSO 2OTJP 4INBA 2XGYA 1YI2P 3H47A 3G29A 2BHVA 1QRJA 2E1MA 1E6JP 1RO2A 2M8PA 3E2DA 2V4XA 2Z45A 3DS5A 3CCEP 1VQNP 4PH0A 1VQOP 4PH2A 4XRQA 1RO0A 5HGLA 2X2DD 1M74A 1Q86Q 3CC7P 3CCSP 3CXCO 1VQLP 3HYBA 1ZMBA 2LF4A 4M0IA 2Z46A 1VQKP 3G1GA 1KD1Q 3M1MA 2WLVB 4NX4C 1VQ7P 3DS1A 1M6NA 3CCMP 2PENA 4U0AA 1M9EC 1AUMA 5F2KA 2M8LA 1K73Q 4COPA 3I55P 4E91A 3DS3A 2GOLB 3G0VA 4LQWC 1M9CC 2EIAA 2PWMA 2JYGA 2JO0A 3G1IA 3CMEP 3DTJA 1M1KQ 2OARA 1U7KA 4PH1A 1NJIQ 1A43A 2KGFA 3CCLP 4DGAC 1K8AQ 2WLVA 3RG6C 1YITP 1QVGO 4XROA 1L6NA 1G03A 1EIAA 2EG5A 1VQ4P 1VQ5P 2P9XA 3MGEA 4XFYA 1M9YC 3CCUP 5F2OA 5HGMA 2PWOA 3BP9A 3DS2A 2KODA 2M8NA 3H4EA 4HTWA 1K30A 1IUQA 2JYLA 2Z44A 3H0DA 1YJNP 1QVFO 2BUOA 2OTLP 4COCA 1M9XC 5F2NA 4U0BA 3G6EP 3CCVP 2EFJA 4GR2A 3CMAP 1M6EX 1YJWP 3LRYA 3VRLC 1VQ6P 1JJ2O 5BS2A 2JPRA 1AFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXR C;  4U0D A;  5HGK A;  4XFZ A;  2X83 A;  3DPH A;  3G21 A;  5DCK A;  5JPA A;  5I4T G;  2Y4Z A;  2GON A;  2XGV A;  1D1D A;  1GWP A;  3NTE A;  4DGE C;  4E92 A;  5HGO A;  4QNB A;  4IPY A;  1EM9 A;  1M9F C;  1EOQ A;  3G28 A;  4U0E A;  1A8O A;  5HGN A;  2L6E A;  2ONT A;  2XGU A;  1P7N A;  4PH3 A;  1BAJ A;  2XXM A;  2XV6 A;  4J93 A;  4B4N A;  3DS4 A;  2X82 A;  3G26 A;  1M9D C;  4U0C A;  1AK4 C;  4WYM A;  3DS0 A;  3P05 A;  2XT1 A;  2XDE A;  4U0F A;  4XFX A;  4INB A;  2XGY A;  3H47 A;  3G29 A;  1QRJ A;  1E6J P;  2M8P A;  2V4X A;  3DS5 A;  4PH0 A;  4PH2 A;  4XRQ A;  5HGL A;  2X2D D;  4M0I A;  2LF4 A;  3G1G A;  2WLV B;  4NX4 C;  3DS1 A;  4U0A A;  1M9E C;  1AUM A;  2M8L A;  4COP A;  4E91 A;  3DS3 A;  2GOL B;  3G0V A;  4LQW C;  1M9C C;  2EIA A;  2PWM A;  2JYG A;  2JO0 A;  3G1I A;  3DTJ A;  1U7K A;  4PH1 A;  1A43 A;  2KGF A;  4DGA C;  2WLV A;  4XRO A;  1L6N A;  1G03 A;  1EIA A;  3MGE A;  4XFY A;  1M9Y C;  5HGM A;  2PWO A;  3BP9 A;  3DS2 A;  2KOD A;  2M8N A;  3H4E A;  4HTW A;  2JYL A;  2BUO A;  4COC A;  1M9X C;  4U0B A;  3LRY A;  3VRL C;  2JPR A;  1AFV A; 
#chains in the Genus database with same CATH topology
 1AF8 A;  5JPA A;  1VQM P;  1YHQ P;  2Y4Z A;  2XGV A;  3CPW O;  3G71 P;  3I56 P;  3HZQ A;  2MR7 A;  2VLO A;  4U0E A;  5KP7 B;  2ERH A;  2XZ0 D;  2L6E A;  1ACP A;  2GZE A;  2XGU A;  1VQP P;  1BAJ A;  1VQ9 P;  4B4N A;  2LKI A;  3DS4 A;  1K9M Q;  3U43 A;  4WYM A;  2XDE A;  2FQ1 A;  4GR6 A;  4XFX A;  2KOS A;  2XGY A;  1F80 D;  1FR2 A;  2LIU A;  4PH0 A;  5EW5 E;  1M74 A;  1OR5 A;  4M0I A;  2VSQ A;  2DNW A;  2AF8 A;  4NX4 C;  4IZ6 A;  2GDW A;  1M6N A;  3CCM P;  2M8L A;  3I55 P;  4E91 A;  2GOL B;  2L9F A;  2JB0 A;  1AYI A;  2JYG A;  2X2B A;  1UJZ A;  2KGF A;  1KLP A;  1K8A Q;  3RG6 C;  1YIT P;  1L6N A;  1IMQ A;  1EIA A;  2EG5 A;  2NO8 A;  1VQ4 P;  5KP6 B;  1GPJ A;  2ROQ A;  2KOD A;  2JU1 A;  2JYL A;  4BPF A;  1YJN P;  1M9X C;  1GXG A;  2N98 A;  3VRL C;  2GDY A;  1VQ6 P;  4PWV B;  5KP8 B;  1GXH A;  2PXR C;  2X83 A;  2FAC A;  3DPH A;  5I4T G;  1GWP A;  3NTE A;  2JQ4 A;  1Q82 Q;  5HGO A;  1YIJ P;  1DV5 A;  1EM9 A;  3GZL A;  5HGN A;  1HQB A;  3EJE A;  2PEK A;  2PEM A;  2K5X A;  2LIW A;  2ONT A;  1S72 P;  1W2B O;  2QA4 P;  4PXH B;  2CNR A;  1YJ9 P;  2XXM A;  2XV6 A;  2KGE A;  3CE7 A;  2KG8 A;  1N8R Q;  2PEJ A;  5HV8 A;  3G26 A;  4U0C A;  3Q20 A;  1KC8 Q;  1Q81 Q;  1T8K A;  2CG5 B;  3DS0 A;  3CCQ P;  4BPH A;  2MD9 A;  1KQS O;  2KOQ A;  2BHV A;  2KOO A;  2KWL A;  3EJB A;  1VQO P;  1Q86 Q;  3CCS P;  3CXC O;  3HYB A;  1ZMB A;  2LF4 A;  1VQK P;  4MRT C;  2K2Q A;  1VQ7 P;  4U0A A;  1M9E C;  1K73 Q;  4COP A;  5EJD A;  3DS3 A;  4LQW C;  1M9C C;  2CQ8 A;  2PWM A;  3G1I A;  3CME P;  2FVA A;  1VKU A;  2LOL A;  2FVE A;  2FVF A;  1A43 A;  1DNY A;  2KW2 A;  1G03 A;  1Z6M A;  1VQ5 P;  3MGE A;  1UNK A;  2KGA A;  3CCU P;  2FQ0 A;  4R0M A;  3DS2 A;  2KR5 A;  4HTW A;  1EMV A;  3H0D A;  2PNG A;  4H2W C;  3CMA P;  3LRY A;  1L0H A;  2QNW A;  5BS2 A;  2JPR A;  3GKL C;  5HGK A;  4XFZ A;  5BS1 A;  5DCK A;  3WBH A;  3CCR P;  2GON A;  3CD6 P;  3EJD A;  2QEX P;  2M5R A;  2KGD A;  3G28 A;  2L4B A;  2K92 A;  2K0X A;  3GZM A;  1X3O A;  2JU2 A;  2PY8 A;  4J93 A;  1ZNV A;  3B5I A;  2X82 A;  2LML A;  1AK4 C;  4U0F A;  2N5I A;  3B4Q A;  4H2Y C;  4INB A;  1QRJ A;  2LL8 A;  1E6J P;  1RO2 A;  2L0Q A;  2K94 A;  3E2D A;  2V4X A;  2Z45 A;  2N6Y A;  2KOP A;  3CCE P;  1VQN P;  3RG2 A;  4XRQ A;  4HKG A;  1RO0 A;  2EHT A;  5HGL A;  2FAE A;  3CC7 P;  2MVU A;  3G1G A;  1KD1 Q;  3M1M A;  2GZF A;  2N5H A;  3G0V A;  2LPK A;  2EIA A;  1CEI A;  2GYK A;  4DG9 A;  5HVC A;  1IMP A;  4H2X C;  3GJN A;  4F37 A;  2GZG A;  1NQ4 A;  3NY7 B;  2PWO A;  3BP9 A;  2M8N A;  2Z44 A;  1IUQ A;  1QVF O;  2BUO A;  3CCV P;  4U0B A;  3G6E P;  2EFJ A;  4GR2 A;  1MZ8 A;  7CEI A;  2AFE A;  2XZ1 C;  1JJ2 O;  4UHP B;  3G4S P;  1Q7Y Q;  4U0D A;  3CCJ P;  3G21 A;  2PEQ A;  1RNI A;  4QKO A;  1D1D A;  2KOR A;  4DGE C;  4E92 A;  2PEI A;  1VHN A;  4QNB A;  3OW2 O;  2CWO A;  4IPY A;  4NEO A;  1M9F C;  1EOQ A;  2PEO A;  1BXI A;  1M90 Q;  1A8O A;  1VQ8 P;  2MVV A;  2K93 A;  1P7N A;  3CC4 P;  4PH3 A;  2N6Z A;  2AFD A;  2JBG A;  2DGY A;  2FQ2 A;  2JAZ A;  2GDX A;  2AVA A;  1M9D C;  1HY8 A;  2EHS A;  2L22 A;  2KGC A;  3P05 A;  4BPG A;  4CA3 A;  3CC2 P;  2LTE A;  2XT1 A;  2GZJ A;  2N50 A;  2OTJ P;  2MF4 A;  1YI2 P;  3H47 A;  2KG6 A;  3G29 A;  2MR8 A;  2E1M A;  2M8P A;  3DS5 A;  2GZI A;  4PH2 A;  2WPT A;  2X2D D;  1VQL P;  5CZD B;  2Z46 A;  2WLV B;  3DS1 A;  2PEN A;  1AUM A;  5F2K A;  2VLP A;  2K0Y A;  1E0H A;  2JO0 A;  3DTJ A;  2KG9 A;  2OAR A;  1M1K Q;  1U7K A;  4PH1 A;  1NJI Q;  3CCL P;  4DGA C;  2WLV A;  3LMO A;  2VLQ A;  4XRO A;  1QVG O;  2P9X A;  4XFY A;  1M9Y C;  2FHS C;  5F2O A;  5HGM A;  2K0D X;  3H4E A;  1K30 A;  2OTL P;  4COC A;  5F2N A;  2VLN A;  2FAD A;  2JGP A;  1M6E X;  1YJW P;  1L0I A;  2CGQ A;  2MY5 A;  1AFV A; 
#chains in the Genus database with same CATH homology
 3G4S P;  2PXR C;  1Q7Y Q;  4U0D A;  3CCJ P;  5HGK A;  4XFZ A;  2X83 A;  5BS1 A;  3DPH A;  3G21 A;  5DCK A;  3WBH A;  5JPA A;  1VQM P;  1YHQ P;  5I4T G;  2Y4Z A;  2PEQ A;  2GON A;  3CCR P;  2XGV A;  1RNI A;  3CPW O;  1D1D A;  1GWP A;  3NTE A;  3G71 P;  3CD6 P;  1Q82 Q;  4DGE C;  4E92 A;  3I56 P;  5HGO A;  2PEI A;  4QNB A;  3HZQ A;  2QEX P;  3OW2 O;  1YIJ P;  2CWO A;  4IPY A;  1EM9 A;  1M9F C;  1EOQ A;  2PEO A;  4U0E A;  3G28 A;  1M90 Q;  1A8O A;  5HGN A;  2L6E A;  1VQ8 P;  2PEK A;  2PEM A;  2ONT A;  2XGU A;  2PY8 A;  1S72 P;  1P7N A;  2QA4 P;  1VQP P;  1W2B O;  3CC4 P;  4PH3 A;  1BAJ A;  1YJ9 P;  1VQ9 P;  2XXM A;  2XV6 A;  4J93 A;  4B4N A;  1N8R Q;  2DGY A;  2PEJ A;  3B5I A;  3DS4 A;  2X82 A;  3G26 A;  1M9D C;  4U0C A;  3Q20 A;  1KC8 Q;  1AK4 C;  1Q81 Q;  4WYM A;  1K9M Q;  3DS0 A;  3P05 A;  3CC2 P;  2XT1 A;  3CCQ P;  2XDE A;  4U0F A;  4GR6 A;  4XFX A;  1KQS O;  2OTJ P;  4INB A;  2XGY A;  1YI2 P;  3H47 A;  3G29 A;  2BHV A;  1QRJ A;  2E1M A;  1E6J P;  1RO2 A;  2M8P A;  3E2D A;  2V4X A;  2Z45 A;  3DS5 A;  3CCE P;  1VQN P;  4PH0 A;  1VQO P;  4PH2 A;  4XRQ A;  1RO0 A;  5HGL A;  2X2D D;  1M74 A;  1Q86 Q;  3CC7 P;  3CCS P;  3CXC O;  1VQL P;  3HYB A;  1ZMB A;  2LF4 A;  4M0I A;  2Z46 A;  1VQK P;  3G1G A;  1KD1 Q;  3M1M A;  2WLV B;  4NX4 C;  1VQ7 P;  3DS1 A;  1M6N A;  3CCM P;  2PEN A;  4U0A A;  1M9E C;  1AUM A;  5F2K A;  2M8L A;  1K73 Q;  4COP A;  3I55 P;  4E91 A;  3DS3 A;  2GOL B;  3G0V A;  4LQW C;  1M9C C;  2EIA A;  2PWM A;  2JYG A;  2JO0 A;  3G1I A;  3CME P;  3DTJ A;  1M1K Q;  2OAR A;  1U7K A;  4PH1 A;  1NJI Q;  1A43 A;  2KGF A;  3CCL P;  4DGA C;  1K8A Q;  2WLV A;  3RG6 C;  1YIT P;  1QVG O;  4XRO A;  1L6N A;  1G03 A;  1EIA A;  2EG5 A;  1VQ4 P;  1VQ5 P;  2P9X A;  3MGE A;  4XFY A;  1M9Y C;  3CCU P;  5F2O A;  5HGM A;  2PWO A;  3BP9 A;  3DS2 A;  2KOD A;  2M8N A;  3H4E A;  4HTW A;  1K30 A;  1IUQ A;  2JYL A;  2Z44 A;  3H0D A;  1YJN P;  1QVF O;  2BUO A;  2OTL P;  4COC A;  1M9X C;  5F2N A;  4U0B A;  3G6E P;  3CCV P;  2EFJ A;  4GR2 A;  3CMA P;  1M6E X;  1YJW P;  3LRY A;  3VRL C;  1VQ6 P;  1JJ2 O;  5BS2 A;  2JPR A;  1AFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...