4XROA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
211
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 71
structure length 211
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xroA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xroA02
4NX4C 1AFVA 4XFYA 2M8LA 4COCA 4LQWC 2PXRC 4PH2A 1AK4C 2X2DD 1M9EC 1E6JP 4XRQA 3DPHA 3G28A 1EOQA 5HGMA 2ONTA 2X83A 2L6EA 3G0VA 4U0FA 2GONA 3H4EA 2Y4ZA 2XV6A 4XFZA 2JO0A 2KODA 4IPYA 2XGVA 3DS3A 3G1IA 2XGYA 4PH1A 1EM9A 3G29A 2XXMA 3G21A 2V4XA 1A8OA 5JPAA 2PWMA 2GOLB 2XGUA 4QNBA 1M9DC 1U7KA 2JYGA 4WYMA 3H47A 4INBA 3DTJA 1EIAA 3MGEA 5HGKA 1BAJA 4COPA 2WLVB 3BP9A 2LF4A 2KGFA 2JPRA 4E91A 5I4TG 1L6NA 4U0CA 3DS0A 4PH3A 1D1DA 4E92A 1A43A 4M0IA 4DGEC 2BUOA 3DS4A 3VRLC 1QRJA 4XROA 1M9CC 1P7NA 1M9FC 2XT1A 4B4NA 3G26A 4DGAC 2X82A 4XFXA 4PH0A 3DS5A 2EIAA 2M8PA 2XDEA 2M8NA 3P05A 3G1GA 4J93A 3DS2A 5HGNA 5HGLA 5DCKA 2WLVA 1AUMA 5HGOA 4HTWA 3DS1A 4U0EA 1GWPA 2PWOA 4U0DA 4U0BA 1G03A 3LRYA 2JYLA 1M9XC 3NTEA 1M9YC 4U0AA
chains in the Genus database with same CATH superfamily
1AFVA 2N6YA 2CWOA 4COCA 2N50A 4PH2A 1VQ5P 5F2NA 5KP6B 2KGCA 1M9EC 1GPJA 4XRQA 1VQOP 2X83A 3GJNA 3H4EA 1AYIA 1IUQA 2KODA 3CCLP 4IPYA 1HQBA 1W2BO 3G1IA 1T8KA 1VQMP 2DGYA 2GDWA 2FADA 2KGDA 2MR8A 1KD1Q 2E1MA 3G29A 2LIUA 1FR2A 1YHQP 1DV5A 1L0HA 3GZLA 2EFJA 5HV8A 1UJZA 5JPAA 1VHNA 3CXCO 1YJWP 2VLPA 2Z44A 4WYMA 2L22A 2KOQA 3DTJA 1VQ6P 1EIAA 3MGEA 5HGKA 2WLVB 2JPRA 4E91A 1L6NA 3CC2P 2ERHA 4M0IA 1VQKP 2BUOA 2MD9A 3VRLC 2GZJA 3RG2A 1VQ8P 2PEJA 4GR2A 4PXHB 2KG6A 1M9FC 1HY8A 4B4NA 2XT1A 4PWVB 2QEXP 2JBGA 3CMAP 5BS1A 2EIAA 2XDEA 1VQPP 3P05A 4UHPB 5HGNA 5CZDB 2FQ1A 2KG9A 4GR6A 2PY8A 2PENA 3NY7B 3CCEP 2AFEA 3CCUP 4U0DA 2M5RA 5KP8B 1Z6MA 3LRYA 2N6ZA 2FQ2A 2KW2A 4IZ6A 3NTEA 1M9YC 4QKOA 2GZFA 2LOLA 1KLPA 4HKGA 2L9FA 2PXRC 3EJBA 2KOSA 2X2DD 2CQ8A 2KORA 3GKLC 2K0DX 1EMVA 2EG5A 1M90Q 2N5HA 4F37A 1NQ4A 1S72P 3CCVP 3G0VA 4U0FA 2XV6A 2K92A 4XFZA 2JO0A 2OARA 4BPGA 3H0DA 5EW5E 2KWLA 1AF8A 4PH1A 1EM9A 2MVUA 2QA4P 2Z45A 1OR5A 2MY5A 3EJEA 5EJDA 1VQNP 3G21A 1YI2P 2V4XA 1A8OA 2KOPA 5KP7B 2Z46A 3B5IA 2PWMA 2GOLB 2XGUA 2VLQA 1M9DC 2AFDA 3H47A 3Q20A 4INBA 2K94A 4NEOA 1M1KQ 3I56P 3BP9A 2LF4A 3CC7P 1YITP 3DS0A 2DNWA 1K8AQ 1D1DA 2X2BA 3EJDA 4E92A 1A43A 5F2OA 2KOOA 2K5XA 2FVFA 2MVVA 1ZMBA 3DS4A 1QRJA 2MF4A 4XROA 3RG6C 2ROQA 3LMOA 4PH0A 2M8PA 2EHTA 5HVCA 1X3OA 3I55P 4R0MA 2JQ4A 5HGOA 1K30A 1L0IA 3DS1A 2PWOA 2VLOA 1DNYA 2N98A 4NX4C 4XFYA 2M8LA 2OTLP 1F80D 1K9MQ 1CEIA 1ACPA 2AVAA 1E6JP 7CEIA 3DPHA 1EOQA 4BPFA 2JU1A 5HGMA 2ONTA 3HZQA 2L6EA 1VQLP 2LIWA 2XGVA 1BXIA 2FAEA 2CNRA 2JAZA 2XZ1C 3CPWO 3CCRP 3CC4P 1KC8Q 1M74A 3M1MA 1GXHA 3CD6P 1U7KA 3B4QA 1UNKA 2PEOA 2AF8A 2L4BA 2KG8A 3CCSP 3E2DA 4COPA 2GDYA 3GZMA 2KGFA 1YJNP 2JGPA 1IMPA 4PH3A 2CGQA 4DGEC 1JJ2O 3CCQP 1M9CC 3CCJP 3G26A 2PEQA 1Q86Q 3DS5A 2K0YA 2NO8A 2GZIA 3CE7A 3HYBA 3G1GA 3DS2A 5HGLA 2WLVA 2GDXA 1AUMA 2BHVA 2KR5A 2KGEA 2N5IA 2FQ0A 4HTWA 2GYKA 1GWPA 1QVGO 1GXGA 2L0QA 4U0BA 3U43A 1YJ9P 1G03A 4MRTC 1M9XC 3CCMP 2JYGA 2PEMA 2GZEA 2OTJP 1M6NA 1E0HA 1RNIA 4LQWC 2QNWA 1YIJP 1AK4C 3CMEP 2XZ0D 1QVFO 2K0XA 2LTEA 2KGAA 3G28A 4H2WC 2EHSA 2GONA 1RO2A 2Y4ZA 2LMLA 2JU2A 1ZNVA 2FACA 2WPTA 3DS3A 2XGYA 5BS2A 2PEKA 2XXMA 2GZGA 2LL8A 2FVAA 2PNGA 2JB0A 4QNBA 2K93A 4BPHA 5F2KA 3G6EP 2K2QA 1BAJA 5I4TG 4H2YC 4U0CA 2FVEA 1N8RQ 1NJIQ 3G71P 2FHSC 1P7NA 2LKIA 4DGAC 2X82A 1Q7YQ 4XFXA 1RO0A 3G4SP 2M8NA 1Q81Q 2LPKA 3OW2O 1M6EX 4J93A 3WBHA 2MR7A 1VQ7P 5DCKA 2CG5B 1K73Q 1VQ4P 2PEIA 4U0EA 4DG9A 4CA3A 1Q82Q 1MZ8A 1VKUA 2P9XA 2JYLA 2VLNA 4H2XC 2VSQA 1VQ9P 1KQSO 1IMQA 4U0AA
chains in the Genus database with same CATH topology
4NX4C 2PEMA 1AFVA 4XFYA 2M8LA 2OTJP 1M6NA 2OTLP 2CWOA 4COCA 1RNIA 4LQWC 1K9MQ 2PXRC 4PH2A 1VQ5P 1YIJP 1AK4C 5F2NA 2X2DD 3CMEP 1M9EC 1E6JP 1QVFO 4XRQA 1VQOP 3DPHA 3G28A 1EOQA 5HGMA 2EG5A 2ONTA 3HZQA 2X83A 2L6EA 1M90Q 1S72P 3CCVP 3G0VA 4U0FA 2GONA 1RO2A 1VQLP 3H4EA 2Y4ZA 2XV6A 4XFZA 2JO0A 2OARA 3H0DA 1IUQA 2KODA 3CCLP 4IPYA 2XGVA 1W2BO 3DS3A 3G1IA 2XGYA 1VQMP 4PH1A 2DGYA 5BS2A 1EM9A 2QA4P 1KD1Q 2Z45A 2PEKA 2E1MA 3G29A 2XXMA 3CPWO 1YHQP 3CCRP 3CC4P 1VQNP 3G21A 2EFJA 1YI2P 2V4XA 1A8OA 1KC8Q 1M74A 5JPAA 3CXCO 2Z46A 3B5IA 1YJWP 2PWMA 2GOLB 2XGUA 3M1MA 4QNBA 2Z44A 1M9DC 3CD6P 1U7KA 2JYGA 5F2KA 4WYMA 3H47A 3G6EP 3Q20A 4INBA 3DTJA 1VQ6P 1EIAA 3MGEA 2PEOA 5HGKA 1BAJA 1M1KQ 3I56P 3CCSP 3E2DA 4COPA 2WLVB 3BP9A 2LF4A 3CC7P 2KGFA 2JPRA 4E91A 5I4TG 1YITP 1L6NA 4U0CA 3CC2P 1YJNP 3DS0A 1N8RQ 1K8AQ 4PH3A 1D1DA 4E92A 1A43A 4M0IA 1VQKP 1NJIQ 4DGEC 2BUOA 5F2OA 3G71P 3DS4A 1ZMBA 3VRLC 1VQ8P 1QRJA 2PEJA 4GR2A 1JJ2O 3CCQP 4XROA 1M9CC 1P7NA 1M9FC 2XT1A 4B4NA 2QEXP 3CCJP 3G26A 3RG6C 4DGAC 2X82A 2PEQA 5BS1A 3CMAP 4XFXA 1RO0A 4PH0A 3DS5A 2EIAA 2M8PA 2XDEA 3G4SP 1VQPP 1Q86Q 2M8NA 1Q81Q 3P05A 3OW2O 1Q7YQ 1M6EX 3HYBA 3G1GA 3I55P 4J93A 3WBHA 3DS2A 5HGNA 1VQ7P 5HGLA 5DCKA 2WLVA 1AUMA 2BHVA 5HGOA 1K73Q 1K30A 4GR6A 2PY8A 4HTWA 2PENA 1VQ4P 2PEIA 3DS1A 3CCEP 4U0EA 1GWPA 3CCUP 1QVGO 2PWOA 4U0DA 4U0BA 1YJ9P 1G03A 1Q82Q 3LRYA 2P9XA 2JYLA 1M9XC 1KQSO 1VQ9P 3NTEA 1M9YC 3CCMP 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NX4 C;  1AFV A;  4XFY A;  2M8L A;  4COC A;  4LQW C;  2PXR C;  4PH2 A;  1AK4 C;  2X2D D;  1M9E C;  1E6J P;  4XRQ A;  3DPH A;  3G28 A;  1EOQ A;  5HGM A;  2ONT A;  2X83 A;  2L6E A;  3G0V A;  4U0F A;  2GON A;  3H4E A;  2Y4Z A;  2XV6 A;  4XFZ A;  2JO0 A;  2KOD A;  4IPY A;  2XGV A;  3DS3 A;  3G1I A;  2XGY A;  4PH1 A;  1EM9 A;  3G29 A;  2XXM A;  3G21 A;  2V4X A;  1A8O A;  5JPA A;  2PWM A;  2GOL B;  2XGU A;  4QNB A;  1M9D C;  1U7K A;  2JYG A;  4WYM A;  3H47 A;  4INB A;  3DTJ A;  1EIA A;  3MGE A;  5HGK A;  1BAJ A;  4COP A;  2WLV B;  3BP9 A;  2LF4 A;  2KGF A;  2JPR A;  4E91 A;  5I4T G;  1L6N A;  4U0C A;  3DS0 A;  4PH3 A;  1D1D A;  4E92 A;  1A43 A;  4M0I A;  4DGE C;  2BUO A;  3DS4 A;  3VRL C;  1QRJ A;  4XRO A;  1M9C C;  1P7N A;  1M9F C;  2XT1 A;  4B4N A;  3G26 A;  4DGA C;  2X82 A;  4XFX A;  4PH0 A;  3DS5 A;  2EIA A;  2M8P A;  2XDE A;  2M8N A;  3P05 A;  3G1G A;  4J93 A;  3DS2 A;  5HGN A;  5HGL A;  5DCK A;  2WLV A;  1AUM A;  5HGO A;  4HTW A;  3DS1 A;  4U0E A;  1GWP A;  2PWO A;  4U0D A;  4U0B A;  1G03 A;  3LRY A;  2JYL A;  1M9X C;  3NTE A;  1M9Y C;  4U0A A; 
#chains in the Genus database with same CATH topology
 1AFV A;  2N6Y A;  2CWO A;  4COC A;  2N50 A;  4PH2 A;  1VQ5 P;  5F2N A;  5KP6 B;  2KGC A;  1M9E C;  1GPJ A;  4XRQ A;  1VQO P;  2X83 A;  3GJN A;  3H4E A;  1AYI A;  1IUQ A;  2KOD A;  3CCL P;  4IPY A;  1HQB A;  1W2B O;  3G1I A;  1T8K A;  1VQM P;  2DGY A;  2GDW A;  2FAD A;  2KGD A;  2MR8 A;  1KD1 Q;  2E1M A;  3G29 A;  2LIU A;  1FR2 A;  1YHQ P;  1DV5 A;  1L0H A;  3GZL A;  2EFJ A;  5HV8 A;  1UJZ A;  5JPA A;  1VHN A;  3CXC O;  1YJW P;  2VLP A;  2Z44 A;  4WYM A;  2L22 A;  2KOQ A;  3DTJ A;  1VQ6 P;  1EIA A;  3MGE A;  5HGK A;  2WLV B;  2JPR A;  4E91 A;  1L6N A;  3CC2 P;  2ERH A;  4M0I A;  1VQK P;  2BUO A;  2MD9 A;  3VRL C;  2GZJ A;  3RG2 A;  1VQ8 P;  2PEJ A;  4GR2 A;  4PXH B;  2KG6 A;  1M9F C;  1HY8 A;  4B4N A;  2XT1 A;  4PWV B;  2QEX P;  2JBG A;  3CMA P;  5BS1 A;  2EIA A;  2XDE A;  1VQP P;  3P05 A;  4UHP B;  5HGN A;  5CZD B;  2FQ1 A;  2KG9 A;  4GR6 A;  2PY8 A;  2PEN A;  3NY7 B;  3CCE P;  2AFE A;  3CCU P;  4U0D A;  2M5R A;  5KP8 B;  1Z6M A;  3LRY A;  2N6Z A;  2FQ2 A;  2KW2 A;  4IZ6 A;  3NTE A;  1M9Y C;  4QKO A;  2GZF A;  2LOL A;  1KLP A;  4HKG A;  2L9F A;  2PXR C;  3EJB A;  2KOS A;  2X2D D;  2CQ8 A;  2KOR A;  3GKL C;  2K0D X;  1EMV A;  2EG5 A;  1M90 Q;  2N5H A;  4F37 A;  1NQ4 A;  1S72 P;  3CCV P;  3G0V A;  4U0F A;  2XV6 A;  2K92 A;  4XFZ A;  2JO0 A;  2OAR A;  4BPG A;  3H0D A;  5EW5 E;  2KWL A;  1AF8 A;  4PH1 A;  1EM9 A;  2MVU A;  2QA4 P;  2Z45 A;  1OR5 A;  2MY5 A;  3EJE A;  5EJD A;  1VQN P;  3G21 A;  1YI2 P;  2V4X A;  1A8O A;  2KOP A;  5KP7 B;  2Z46 A;  3B5I A;  2PWM A;  2GOL B;  2XGU A;  2VLQ A;  1M9D C;  2AFD A;  3H47 A;  3Q20 A;  4INB A;  2K94 A;  4NEO A;  1M1K Q;  3I56 P;  3BP9 A;  2LF4 A;  3CC7 P;  1YIT P;  3DS0 A;  2DNW A;  1K8A Q;  1D1D A;  2X2B A;  3EJD A;  4E92 A;  1A43 A;  5F2O A;  2KOO A;  2K5X A;  2FVF A;  2MVV A;  1ZMB A;  3DS4 A;  1QRJ A;  2MF4 A;  4XRO A;  3RG6 C;  2ROQ A;  3LMO A;  4PH0 A;  2M8P A;  2EHT A;  5HVC A;  1X3O A;  3I55 P;  4R0M A;  2JQ4 A;  5HGO A;  1K30 A;  1L0I A;  3DS1 A;  2PWO A;  2VLO A;  1DNY A;  2N98 A;  4NX4 C;  4XFY A;  2M8L A;  2OTL P;  1F80 D;  1K9M Q;  1CEI A;  1ACP A;  2AVA A;  1E6J P;  7CEI A;  3DPH A;  1EOQ A;  4BPF A;  2JU1 A;  5HGM A;  2ONT A;  3HZQ A;  2L6E A;  1VQL P;  2LIW A;  2XGV A;  1BXI A;  2FAE A;  2CNR A;  2JAZ A;  2XZ1 C;  3CPW O;  3CCR P;  3CC4 P;  1KC8 Q;  1M74 A;  3M1M A;  1GXH A;  3CD6 P;  1U7K A;  3B4Q A;  1UNK A;  2PEO A;  2AF8 A;  2L4B A;  2KG8 A;  3CCS P;  3E2D A;  4COP A;  2GDY A;  3GZM A;  2KGF A;  1YJN P;  2JGP A;  1IMP A;  4PH3 A;  2CGQ A;  4DGE C;  1JJ2 O;  3CCQ P;  1M9C C;  3CCJ P;  3G26 A;  2PEQ A;  1Q86 Q;  3DS5 A;  2K0Y A;  2NO8 A;  2GZI A;  3CE7 A;  3HYB A;  3G1G A;  3DS2 A;  5HGL A;  2WLV A;  2GDX A;  1AUM A;  2BHV A;  2KR5 A;  2KGE A;  2N5I A;  2FQ0 A;  4HTW A;  2GYK A;  1GWP A;  1QVG O;  1GXG A;  2L0Q A;  4U0B A;  3U43 A;  1YJ9 P;  1G03 A;  4MRT C;  1M9X C;  3CCM P;  2JYG A;  2PEM A;  2GZE A;  2OTJ P;  1M6N A;  1E0H A;  1RNI A;  4LQW C;  2QNW A;  1YIJ P;  1AK4 C;  3CME P;  2XZ0 D;  1QVF O;  2K0X A;  2LTE A;  2KGA A;  3G28 A;  4H2W C;  2EHS A;  2GON A;  1RO2 A;  2Y4Z A;  2LML A;  2JU2 A;  1ZNV A;  2FAC A;  2WPT A;  3DS3 A;  2XGY A;  5BS2 A;  2PEK A;  2XXM A;  2GZG A;  2LL8 A;  2FVA A;  2PNG A;  2JB0 A;  4QNB A;  2K93 A;  4BPH A;  5F2K A;  3G6E P;  2K2Q A;  1BAJ A;  5I4T G;  4H2Y C;  4U0C A;  2FVE A;  1N8R Q;  1NJI Q;  3G71 P;  2FHS C;  1P7N A;  2LKI A;  4DGA C;  2X82 A;  1Q7Y Q;  4XFX A;  1RO0 A;  3G4S P;  2M8N A;  1Q81 Q;  2LPK A;  3OW2 O;  1M6E X;  4J93 A;  3WBH A;  2MR7 A;  1VQ7 P;  5DCK A;  2CG5 B;  1K73 Q;  1VQ4 P;  2PEI A;  4U0E A;  4DG9 A;  4CA3 A;  1Q82 Q;  1MZ8 A;  1VKU A;  2P9X A;  2JYL A;  2VLN A;  4H2X C;  2VSQ A;  1VQ9 P;  1KQS O;  1IMQ A;  4U0A A; 
#chains in the Genus database with same CATH homology
 4NX4 C;  2PEM A;  1AFV A;  4XFY A;  2M8L A;  2OTJ P;  1M6N A;  2OTL P;  2CWO A;  4COC A;  1RNI A;  4LQW C;  1K9M Q;  2PXR C;  4PH2 A;  1VQ5 P;  1YIJ P;  1AK4 C;  5F2N A;  2X2D D;  3CME P;  1M9E C;  1E6J P;  1QVF O;  4XRQ A;  1VQO P;  3DPH A;  3G28 A;  1EOQ A;  5HGM A;  2EG5 A;  2ONT A;  3HZQ A;  2X83 A;  2L6E A;  1M90 Q;  1S72 P;  3CCV P;  3G0V A;  4U0F A;  2GON A;  1RO2 A;  1VQL P;  3H4E A;  2Y4Z A;  2XV6 A;  4XFZ A;  2JO0 A;  2OAR A;  3H0D A;  1IUQ A;  2KOD A;  3CCL P;  4IPY A;  2XGV A;  1W2B O;  3DS3 A;  3G1I A;  2XGY A;  1VQM P;  4PH1 A;  2DGY A;  5BS2 A;  1EM9 A;  2QA4 P;  1KD1 Q;  2Z45 A;  2PEK A;  2E1M A;  3G29 A;  2XXM A;  3CPW O;  1YHQ P;  3CCR P;  3CC4 P;  1VQN P;  3G21 A;  2EFJ A;  1YI2 P;  2V4X A;  1A8O A;  1KC8 Q;  1M74 A;  5JPA A;  3CXC O;  2Z46 A;  3B5I A;  1YJW P;  2PWM A;  2GOL B;  2XGU A;  3M1M A;  4QNB A;  2Z44 A;  1M9D C;  3CD6 P;  1U7K A;  2JYG A;  5F2K A;  4WYM A;  3H47 A;  3G6E P;  3Q20 A;  4INB A;  3DTJ A;  1VQ6 P;  1EIA A;  3MGE A;  2PEO A;  5HGK A;  1BAJ A;  1M1K Q;  3I56 P;  3CCS P;  3E2D A;  4COP A;  2WLV B;  3BP9 A;  2LF4 A;  3CC7 P;  2KGF A;  2JPR A;  4E91 A;  5I4T G;  1YIT P;  1L6N A;  4U0C A;  3CC2 P;  1YJN P;  3DS0 A;  1N8R Q;  1K8A Q;  4PH3 A;  1D1D A;  4E92 A;  1A43 A;  4M0I A;  1VQK P;  1NJI Q;  4DGE C;  2BUO A;  5F2O A;  3G71 P;  3DS4 A;  1ZMB A;  3VRL C;  1VQ8 P;  1QRJ A;  2PEJ A;  4GR2 A;  1JJ2 O;  3CCQ P;  4XRO A;  1M9C C;  1P7N A;  1M9F C;  2XT1 A;  4B4N A;  2QEX P;  3CCJ P;  3G26 A;  3RG6 C;  4DGA C;  2X82 A;  2PEQ A;  5BS1 A;  3CMA P;  4XFX A;  1RO0 A;  4PH0 A;  3DS5 A;  2EIA A;  2M8P A;  2XDE A;  3G4S P;  1VQP P;  1Q86 Q;  2M8N A;  1Q81 Q;  3P05 A;  3OW2 O;  1Q7Y Q;  1M6E X;  3HYB A;  3G1G A;  3I55 P;  4J93 A;  3WBH A;  3DS2 A;  5HGN A;  1VQ7 P;  5HGL A;  5DCK A;  2WLV A;  1AUM A;  2BHV A;  5HGO A;  1K73 Q;  1K30 A;  4GR6 A;  2PY8 A;  4HTW A;  2PEN A;  1VQ4 P;  2PEI A;  3DS1 A;  3CCE P;  4U0E A;  1GWP A;  3CCU P;  1QVG O;  2PWO A;  4U0D A;  4U0B A;  1YJ9 P;  1G03 A;  1Q82 Q;  3LRY A;  2P9X A;  2JYL A;  1M9X C;  1KQS O;  1VQ9 P;  3NTE A;  1M9Y C;  3CCM P;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...