4XRSA

Heterodimeric complex of transcription factors meis1 and dlx3 on specific dna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)-3')
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrsA00
4DYCA 2FJ1A 1FJLA 3S17J 5C4JJ 2TRTA 3G1OA 3HOYJ 2LR8A 1HOMA 2NS8A 4CYCA 2G0EA 4A93J 2Y31A 5C4XJ 2ZB9A 2CQXA 2ECCA 5IYCJ 5FLVA 3S1NJ 1TWAJ 3M3YJ 2EZHA 4BBRJ 2K9NA 4IHXA 1BW5A 2IAIA 3G1MA 3RQIA 1HDDC 2HXOA 5IYDJ 1TWCJ 3LOCA 5E3MA 4HNVA 4S0HB 4XRSG 1JTXA 3CCYA 1IUFA 2JN6A 4QIWN 2CUFA 1FIPA 1VI0A 3QPLA 2D5VA 1Q1VA 2JA6J 1JGGA 3B6AA 1ZKGA 1K61A 1R9TJ 2GLOA 5J1YA 3Q0WA 5FJ8J 2JA7J 4G12A 4XIDA 2MG4A 5F08A 3BR5A 1F43A 4W97A 2H1KA 1ZGWA 1Y1VJ 2CUEA 2KT0A 3FISA 2RAEA 3UKGA 2NVTJ 2E2HJ 5EZGA 2ELKA 3JRCA 1MBGA 1P7JA 1TWGJ 4D5FA 1A6IA 2I10A 1QPIA 5EF6A 2Y9YA 2HYJA 1MSFC 5IP9J 3K7AJ 4A3FJ 4JX6A 1RKWA 9ANTA 4UUSB 2L7FP 2YS9A 3VPRA 3GTKJ 1JKRC 1JUMA 2P81A 2DJNA 1PUFB 5EGOA 4A3MJ 3IH2A 5FKKA 4ABZA 3S15J 4CYCB 4FE4A 3JRFA 2O7OA 2DA5A 1ENHA 4M3FA 2OPTA 3HOZJ 1IV6A 1DU6A 2KDZA 2L9RA 5M5XJ 2Y9ZA 4A3EJ 1JTYA 1OCPA 3S2DJ 1Y1WJ 4MFEA 1TWHJ 2VKVA 1GT0C 3S1MJ 2HI3A 4X6AJ 2EQRA 3W6VA 3BQYA 2K9QA 3H3VK 2Y0SN 3OIOA 3ZQIA 4DW6A 3JR9A 1AKHA 2E19A 1IGNA 3PM1A 2IEKA 1GUUA 1QRYA 1BJZA 2VKEA 2W48A 3GTOJ 1EF4A 2ME6A 1BA5A 3C2BA 2K9SA 1F36A 2XPVA 3S16J 2FX0A 1MBEA 4XRSA 3HB9A 4NDLA 3ZQLA 3OOUA 1K83J 1MBHA 1WCMJ 3O8GA 1H8AC 3GTQJ 1GDTA 1G2HA 1I3QJ 3I4NJ 3SJMA 2MSYA 2R7ZJ 2E2JJ 2ID6A 5F0CA 1MH3A 4UUTA 5EG0A 5K7HA 4A3GJ 5GP9A 1FEXA 5EDNA 4Y7NJ 5FKNA 5C44J 2VI6A 2DTZA 3WHCA 2ECBA 2L0KA 2DMTA 1IJWC 4BY1J 1HF0A 2WV1A 1SANA 1ZQ3P 3TP3A 2DMNA 3IH3A 2N8GA 1WPKA 4A3DJ 3BR1A 4DZJA 5DS9A 1UG2A 3DCFA 2CU7A 2L7ZA 4C3IJ 5JLXA 5E3NA 3Q0UA 3A03A 3BR0A 3ZQGA 2M34A 3E7LA 3HDDA 2PMZN 5IOYA 4J19A 1JJ6C 1GVDA 2X6OA 3BTCA 5M3FJ 3Q3SA 4B3AA 5EGOB 1X2MA 4BKXA 2X48A 1RESA 1VF9A 3GTJJ 4V2GA 5K7ZA 4MLOA 2GM4A 2E2IJ 1AHDP 1RR7A 3PO3J 3JRDA 3Q0VA 2H8RA 1HDPA 3S1QJ 3RKQA 3BG5A 1QVTA 4MO7A 2XSDC 2AO9A 3B6CA 1Z0XA 5HODA 3OSFA 1ETVA 2DMQA 4JYKA 3A01A 1VFCA 2M2EA 1AKHB 3F0CA 3BR6A 4IHWA 1WI3A 1JKPC 5C3EJ 3BR2A 3FK6A 4DYRA 3HBLA 3LSGA 1FTZA 1B8IB 3DEWA 4JP0A 2WAQN 1ZK8A 4XRMA 4MIMA 5M5YJ 3S14J 5JLWA 3SFIA 2NS7A 3HGYA 3NARA 4IEJA 4A3JJ 3GBGA 1WH5A 2X9DA 1B72A 1ETOA 4M3EA 2CQQA 3JRBA 2EZKA 2LY9A 1ORKA 1A5JA 2DMUA 2HXIA 3HOWJ 1YRNA 5BNGA 2IBDA 1U9OA 4JX5A 2JWTA 1UHSA 1W0TA 1ZTRA 3GTLJ 2JA5J 1MBKA 4A3LJ 2AHQA 2XB5A 3ZQCA 3JRHA 1LFUP 1ZR2A 1IDYA 3TW6A 4FE7A 4DZPA 1UMQA 3GTGJ 2XPWA 1DU0A 3ZQHA 1TC3C 3RZOJ 1Z77A 4A3KJ 4GFBA 4D7MA 1WH7A 3HOVJ 1QVUA 1MBJA 2YUSA 2E1OA 1E3OC 5F0HA 2EH3A 2XGCA 2DA2A 3CQZJ 1JKOC 3TEDA 4BY7J 1APLC 4AUXA 4AC0A 2DMPA 5E3LA 4EEFG 3A01B 4LOCA 3ZQFA 2LLKA 1ETYA 2L7MP 1P7IA 2LK2A 1XG1A 2M8GX 4RBOA 3NAUA 3LSJA 3M4OJ 2QF7A 2JJ7A 5DTDA 4M3BA 4M6VA 3BG9A 3CDLA 3FKIJ 3A02A 5J1RA 3RZDJ 1W0UA 1XC5A 4L5EA 3BTJA 2EZLA 2XB0X 1IG7A 3HM5A 2HDDA 2R5YA 3TW7A 1IC8A 3ZOBA 1B72B 1JUSA 4RDUA 1ETXA 4B4CA 1WGXA 5F04A 2XGDA 5IYBJ 1I50J 4XK4A 1PUFA 3QQAA 1MH4A 1GV5A 5FLMJ 4M3DA 2LKXA 3SDGA 2VUMJ 1MSEC 2JMWA 1YRNB 2VPRA 3JRAA 2Y30A 4JX4A 3HKZN 4X1EA 1FTTA 3S2HJ 3O8HA 2EZIA 3OSGA 2R0QC 4C3HJ 4I6ZA 4BXXJ 1GV2A 3JRGA 3LSPA 2CJJA 1LE8A 2XPUA 2R5ZA 1RKTA 5K7FA 1OCTC 3HGGA 1RPWA 1JT0A 2R93J 1FIAA 3H0GJ 3K2AA 1OJLA 3S1RJ 5FKMA 2LP0A 5IP6A 2M0CA 5GPCA 4MFDA 5IOZA 3IH4A 4A69C 5EEAA 1JJ8C 4QSHA 3FK7A 1ZR4A 1JUPA 4QTRA 1HLVA 1HCRA 1MBFA 3MVPA 3JRIA 1TWFJ 2FD5A 1X2NA 3GTPJ 2O8KA 2XGEA 1IRZA 3LSRA 4DYQA 5GPAA 1MNMC 2DA7A 2O9LA 5EZHA 2GBYA 1X58A 3BTIA 5EG0B 2NOGA 3IV5A 1ITYA 5FKOA 2EBIA 2WB1N 5F0FA 1NK3P 2DA6A 3WHBA 1ETQA 4A3IJ 4W1UA 5F1JA 4M3GA 1CQTA 2MW8A 3TP0A 2K40A 3HOXJ 1ETKA 2QCOA 4FISA 1XS9A 2OF7A 1S7EA 1U9NA 5J3LA 2R5YB 1LFBA 1ETWA 1AU7A 2LVSA 2YU9J 1O4XA 3HEFA 1RETA 2B63J 1NK2P 3BG3A 5IPAA 4A3CJ 5IP7J 4C3JJ 3I4MJ 2ME0A 2XRLA 2CRGA 2DA1A 2HOSA 1T56A 2DA3A 4B1RA 4V2FA 4AYBN 4D7NA 1H88C 3JREA 1U8BA 1I6HJ 3G1LA 2LFBA 2DN0A 2Y2ZA 4C2MJ 1SFOJ 4Y52J 2TCTA 2ID3A 3BTLA 5E3OA 1OFCX 4IHVA 3CMYA 2MGQA 3BT9A 4FTHA 4I76A 2COBA 3BR3A 3QPSA 3D1NI 2DA4A 1NTCA 5M3MJ 1H89C 3MN2A 3FIWA 1LE8B 2R5ZB 2NVQJ 1U78A 3PO2J 2HQ5A 5F27A 1T33A 1JKQC 2HOAA 2R92J 3HOUJ 4BBSJ 2JK3A 4IHYA 1JT6A 1POGA 3GTMJ 1B8IA 1BL0A 2LTPA 2JA8J 3L1PA 5M5WJ 3LNQA 1IDZA 4FCYA 1D5YA 2NVXJ 2LD5A 3MKLA 5EYRA 1VNDA 2M9HA 5J1UA 4A3BJ 2FQ4A 4D5CA 4XICA 5FKLA 1BW6A 4UUSA 2NVYJ 2HOTA 3BQZA
chains in the Genus database with same CATH superfamily
4DYCA 2IJLA 2FJ1A 1FYMA 2HU9A 2BZTA 2GIVA 2OTLI 2LYCA 3RI4A 1HOMA 3U1DA 4A12A 2KZGA 2Y31A 2H6BA 2KIUA 2ECCA 5IYCJ 1PP8F 3I53A 3T8TA 4ZDOA 3CD6I 3LAJA 3I0TA 2V1NA 5IYDJ 3RQIA 5FFZA 3LOCA 3M9AA 2XAQA 5E3MA 4S0HB 5ILVA 1MGTA 3CCYA 1HC8A 2L9VA 2I8DA 2DAOA 3T1BA 1FIPA 1BR4A 1KYZA 2MD0A 1QA6A 2VOOA 4BE0A 1ZN2A 4A5MA 1OR7C 3VSLA 3CTAA 1JGGA 1R9TJ 3VDXA 1SFKA 3Q0WA 4XIDA 1VQ7I 2Y0SA 4P1WA 5F08A 4L9NA 1FT9A 3VWBA 4HX8A 1KZHA 3KLOA 3CCLI 3DLAA 1Y1VJ 5TGTA 2V6CA 1WSUA 2LSOA 4MHGA 1Y8RB 2BY1A 1A6IA 2ZJQF 3QYEA 1OR7A 3TOBA 3CO7C 3RTRA 2FOWA 2ZFUA 1VQLI 2LRDA 4BDZA 1J0RA 2VJ4A 1QZEA 3K7AJ 4II3A 2V4JC 4RMNA 4EATA 3MZHA 1YIJI 4C2UA 3RYRA 2L7FP 2MC3A 1XGMA 2YS9A 2CW8A 3SDBA 3S3MA 3R0JA 1RZ4A 1I39A 5GAEJ 3LSKA 1QPMA 2Z16A 2PG4A 2Y75A 4NC8A 2VN2A 4CYCB 1BR1A 3JRFA 2O7OA 4G7ZF 1ENHA 2KIMA 5D4RA 1YX5A 1IXCA 4HX4A 1IN6A 4PSWA 3S32A 2DYSH 2Q8KA 3HRTA 3K1MA 4HQMA 2K85A 1MW7A 2MC4A 3W6VA 3FMSA 3DWLE 2NXNB 3GZNB 5LRSA 3P5JA 3H3VK 2MLGA 4XLHA 2JRMA 1FYLA 3AKZA 3MAJA 4CZCA 2HQRA 4U88A 1IGNA 3HUGA 3L2WA 1GUUA 1QRYA 1BJZA 1WJFA 2M7AA 3HG9A 5D6FA 1F36A 2XPVA 3MD2A 4PJJA 2BHYA 1Z05A 4XRSA 3H0DA 2ZO4A 3HB9A 4NDLA 5DCFA 3ZQLA 4OIPF 2GZWA 1K83J 2IRFG 1X4PA 3I71A 2Z3YA 1T98A 3W3CA 1USSA 1LDKB 2Y69H 4AU7A 3SJMA 2MSYA 3F9KA 1A35A 1XDUA 1FOYA 5CQEA 1FZPB 4U0YA 1R1VA 2X6WA 2P5KA 5EG0A 5K7HA 5FB2A 4A3GJ 5C44J 5LEJA 4MEYF 2DTZA 3FXUA 4E7JA 2ECBA 4N9HA 4BQOA 1IJWC 1WJAA 4AM3A 1SANA 1ZQ3P 3J7AY 3SFZA 4G6QA 3TP3A 3EUHA 2KFDA 3L2QA 4V19K 2YX7A 3ZMTA 3L2UA 3GZ5A 1UHWA 2VT2A 1EA3A 4UNOA 1LEAA 2O8XA 3QU3A 4IF4A 4CA0A 2GXGA 5ICGA 1QHHD 2L7ZA 3HZJA 4C3IJ 5E3NA 2BW3B 4BEHB 2DW4A 3BR0A 3E7LA 3HDDA 1WQ2A 1KU2A 4J19A 1JJ6C 2XUBA 2X6OA 1A6QA 3BTCA 3PL8A 2NNNA 3KZZA 4XKWA 1XGSA 1Y56A 2Z99A 1LNWA 1X2MA 3HOTA 3HTSB 2X48A 1J59A 3TQNA 1R71A 5HDNA 3T0YA 5K7ZA 1NH3A 1AHDP 2ZBKA 1FSEA 3PUFA 1LPQA 2HDWA 3E5XA 4A0YA 3FBIB 3MWMA 2XSDC 5D6EA 3DBHB 3L2VA 2DMQA 4JYKA 4HF1A 2JUCA 4AYBA 2RNJA 1VFCA 4U0VA 4LG0B 2R7RA 1AKHB 5HLTA 1WI3A 3C3WA 3FK6A 3FX3A 3HBLA 4Y15A 2OD5A 4ZYHA 4LIUA 4ZYAA 2WAQN 3E1SA 4XRMA 1YJWI 4F7ZA 1U2WA 1QHGA 4DNCA 4IO9F 2XF6A 4M9ZA 3K2ZA 2L3DA 1FY7A 2RQQA 3HGYA 4PGHA 5CVJA 1GXPA 1MD0A 3ML6A 3JW4A 2PFBA 1YI2I 1F1ZA 2B0LA 2CUZA 3PSIA 3MKZA 1XD7A 4CICA 4G8XA 1LVAA 3E5UA 2LF8A 3MQ0A 3JRBA 3CJRB 1R4MB 2A05A 4LG3A 2HYGD 1A5JA 3D5LA 4DBQA 3VYTB 4R1HA 4PSXA 2DOAA 2FXAA 3QPHA 2PN6A 1I6XA 2A6HF 4ZJZA 3I55I 5E1ZB 1HXDA 4CCKA 1V5EA 3GEZA 2B9SA 4R79A 1FOWA 4RLFA 1ZR2A 3H3UA 3W2VA 3ROUA 3MCZA 4HLXA 1ZREA 3MMYB 1UMQA 3E5QA 4I0AA 3GTGJ 2XPWA 4X0GA 4LJZF 4O6JA 5J8FA 3ZQHA 4F93B 2QEXI 2XASA 1TC3C 3RZOJ 1D8KA 4A3KJ 1BIAA 4AD9A 1B9NA 4PCQA 3LAPA 3GFMA 3N97A 1MMDA 1D0XA 2VBWA 3JCUC 3FXMA 2Q0OA 2E60A 2UXXA 3EQLF 2V9KA 4B8XA 3DFGA 4PZJA 1APLC 4M74A 4NNJA 5ED4A 2LBFA 2K7LA 2IS1A 1N75A 3QPTA 4RGXA 4XLPF 3ZQFA 1P7IA 2LK2A 2OQRA 3FXLA 3M4OJ 2M8EA 1B1BA 2YSRA 3H35A 2CV2A 1MMSA 4XRFA 4M3BA 4M6VA 3RZDJ 4XOPA 3A02A 1WKMA 4FASD 3BPVA 2VKDA 1VQ6I 4L0ZB 1ZHFA 2EFNA 2EZLA 3N4MA 3PIOF 4EJVA 2HDDA 2KRHA 3UR3C 2CG4A 2KIFA 2V1DA 4L5IA 3TW7A 3ZOBA 2RV8A 2FBHA 4L5JA 2P4WA 1ZGAA 3E0JB 2GOMA 4RAZA 5IYBJ 4CCMA 3FKJA 4LD5A 5E17F 2VUMJ 4Y33A 1YRNB 3JRAA 2NAZA 2EZIA 2R0QC 4CZZA 2RN7A 1HA8A 4C3HJ 2OC6A 4ENKA 2QGUA 5D8LB 2ESHA 2QM3A 3H5NA 5A2QK 2OUMA 2R5ZA 1RKTA 5K7FA 4RB2C 2RC4A 2RNGA 1RPWA 1JT0A 4OAYA 3G71I 1FIAA 2JVHA 5E79C 3ESWB 5FKMA 2ZMEA 5IP6A 2M0CA 2IS6A 3LQRA 4A69C 5IOZA 4BAYA 1SFUA 5KAFC 1YLFA 3GO5A 4QTRA 2A61A 3JRIA 2ZFWA 4HDUA 2O8KA 3WODF 4HLYA 3J81Z 1GVJA 5GTHC 1K78B 5K1YA 2O9LA 2KPMA 5EZHA 3FDYA 4PJLA 2F5FA 1W7PB 4PJMA 4A6DA 4AIHA 5EG0B 4XMYA 4I2OA 2D1HA 2W57A 5FKOA 2EBIA 2WB1N 3DKXA 2OU2A 4BQNA 3OYCA 4W1UA 2IGOA 2CFOA 1VQKI 1U5TB 2FEZA 3CUQB 2GWRA 2HVQA 2KKOA 3HSFA 4M3GA 2V9PA 3FXOA 2GAUA 1ZLJA 1ETKA 2QCOA 2G7UA 2MBFA 2OF7A 4GGGA 1U9NA 2VQHA 3G4SI 2FA5A 2OZUA 5AIQA 4BQQA 1AU7A 5DYMA 3B73A 3WTXC 1FC3A 3DPLC 4ZDLA 2BE5F 4OIRF 2B63J 1LQ1A 2MLKA 4IRHA 5J40A 2OA4A 2VASA 5LEKA 1BN5A 4KT5C 4KUMA 1DP7P 2IA1A 4C30A 5LGNA 1R23A 4CCOA 1U6GA 1H88C 3BC8A 1U8BA 3CMEI 4DIQA 1Z91A 1SFOJ 2F4OB 2KHMA 4CCNA 3DPUA 1FPQA 1SMYF 3F8CA 3BTLA 1WJBA 2IPQX 4BXFA 3CCJI 4I09A 1XCVA 2MGQA 1IV8A 3BT9A 4FTHA 5BPDA 2COBA 3BR3A 1ZG3A 1FP1D 3QPSA 2R7OA 4JK1X 3PIPF 4DJAA 3RKYA 1H89C 1VQ5I 2M7BA 2DT5A 1JHHA 2MH2A 3EDPA 2L02A 4P96A 4E7SA 5F27A 1LFPA 3QP6A 1VTNC 5ERIA 3PUBA 3E6CC 2WADA 4Q4ZF 3HOUJ 4BBSJ 2JK3A 1JT6A 2IW5A 2LTPA 4EVIA 2JA8J 5B3SH 1V55H 2ZNZA 1Z21A 4HNUA 1IDZA 2GOXB 3V8LA 2NVXJ 5CLSA 2CMPA 2W85A 2M9HA 2FBKA 5J1UA 4U7BA 4XLNF 3HRSA 2IT0A 3S93A 4NBQA 2K86A 2XROA 4HBLA 4R8HA 1BW6A 2HOTA 4DBRA 3WTUC 1XSDA 4YIFA 2VB6A 5FRNA 3WGHA 2X6XA 4RB1A 3MKWB 4MTDA 4A93J 4CYCA 2VC0A 1IN7A 5ILSA 2CQXA 5FLVA 1OCZH 3S1NJ 1TWAJ 2W84A 3U21A 5J47A 2QBYB 3M3YJ 2CGPA 1T08B 2EZHA 2K9NA 2OAZA 5D5XB 1ZRDA 1SD4A 4YRVA 1F4KA 4XRSG 2YPRA 4IPAA 1SFXA 4IRIA 1VI0A 1RUOA 4H4KC 1I1SA 4RB0A 5K5RA 3KPHA 2EV5A 2DBBA 1ZKGA 3ZXSA 3HRMA 1E3PA 2QENA 5J1YA 5FJ8J 3OYDA 2DTRA 3CMMA 1WVRA 1YO5C 4LGWA 4HNTA 4DQ2A 3BR5A 4IXAA 2CW7A 3F3XA 3BZCA 3OYHA 1F43A 3FZVA 5D5WB 1IUYA 1WFXA 4FX4A 2HS5A 2L5QA 1ZGWA 4U0WA 2CUEA 2W24A 2KT0A 2EV0A 4CCLA 1U3EM 3C7JA 4UHTA 5EZGA 1VQ4I 3JRCA 1O3SA 3DKYA 2OTJI 3KP4A 1QGPA 1Z3XA 4P55A 5CVIA 1Y8QB 4XLCA 4IKFA 2EA4A 4CSWA 2UWMA 2HYJA 2EIMH 1MSFC 4RGRA 1S29A 2JTVA 4UVAA 2D45A 1RKWA 2BW3A 9ANTA 3L00A 4BEHA 3ZMVA 3GTKJ 2DODA 1JKRC 3W6JB 2O6GE 4L0YB 1TT0A 2W82A 3CP2A 3BPXA 2DJNA 1HW5A 2F5EA 3KYCB 2LY1A 3IH2A 3VYUB 2DA5A 2M45A 5FRMA 2D1VA 2YR2A 4M3FA 3IWZA 1DU6A 4Q47A 3G6EI 4RS8A 2NOJB 3I56I 4A3EJ 1JTYA 5TRDA 1SAUA 4BS9A 1KU7A 3KYDB 3OYKA 1Y1WJ 1GT0C 3H9QA 5FD6A 3S1MJ 2HI3A 1JXSA 2EQRA 3BQYA 1MMNA 2J5PA 1ON2A 1USTA 2QQAA 4KFCA 2OBPA 2Y0SN 2MD5A 2COMA 2KRFA 3SXYA 3CC7I 2HKOA 3JR9A 2WBMA 4LG0A 4DW6A 1CGPA 1OCRH 1FMVA 2E19A 1AKHA 5L3DA 3ONQA 4KIBA 2ZMEB 1J7KA 4RM2A 3WGGA 2W48A 3VB2A 3JAMZ 1XX5A 1VQ9I 2PI0A 3GTOJ 2ME6A 3C2BA 2R3SA 1PJRA 3I54A 4XORA 5KNLA 1Z3YA 1K79A 2E71A 4G9YA 4KA4A 2JSCA 1W4MA 4YEJA 3CCQI 2EIJH 1MBHA 1WCMJ 5CJ9A 4RGSA 1FX7A 1DGRM 1IRXA 2V79A 3WTTC 2WY8Q 3K4JA 3OS2A 3GFLA 2PMUA 1H8AC 3VFZA 2I5UA 3PFYA 2P0WA 3I4NJ 2L2OA 2VPLA 2R7ZJ 3ZGKA 2Y48A 4QPOA 3IKTA 3DBRB 3TOAA 5F0CA 1MH3A 3HPGA 2IGMA 3DEUA 5EDNA 2VC1A 4E4HA 4DOZA 3WHCA 2FF4A 1HBXG 2QSGX 3IC7A 1XPXA 2DMTA 2QQ8A 2GA2A 4CH7A 4BE2A 2O0YA 4WWCA 5J4VA 2EB7A 3T8RA 2RGVA 4G94A 2BXYA 2Y0MA 3H5AA 4NB5A 2O03A 1YIOA 3M8EA 5KCMA 3JTGA 5GTIC 1WPKA 3RSNA 5BMZA 1YHQI 2XAJA 4LITA 3ZRGA 1FOKA 1HSTA 1XTAA 5DS9A 2KLOA 4BL0B 1HKSA 3RPUD 3A03A 3ZQGA 2M34A 3CC2I 2DDAA 1HQCA 1SD5A 2ETHA 5FLXZ 3HIFA 5E18F 1IN4A 2DLLA 3Q3SA 5EGOB 2V9VA 3I58A 3J80Z 1E0EA 1JGSA 3RKWA 1VF9A 2ISYA 3F8BA 3KLNA 4MLOA 4XLAA 4A5NA 1OCOH 2ESNA 2K27A 2E2IJ 1RR7A 4HW0A 2Q2EB 2FOKA 2E1NA 3Q0VA 1HDPA 2H8RA 2EK5A 2VQLA 5EEHA 3TKYA 3CCVI 3BG5A 2R4GA 1D0YA 4LLNA 2AO9A 2BV6A 3B6CA 3OSFA 1ETVA 1O7LA 5ICCA 1D5VA 3IAM2 4I0BA 2LNBA 2IS2A 4ZH4F 5D8KB 4IHWA 2JPCA 4XBFA 3CMAI 1JKPC 3BR2A 4ASNA 4NC7A 5DDGA 4EV0A 1EH6A 3DEWA 1BI3A 1MKMA 3SYTA 2BGCA 2NYXA 3SQNA 5JVTA 2LH9A 1TTYA 1ZK8A 4KICA 1KONA 4XONA 3ABMH 2R7WA 1YG2A 4PJNA 3O3KA 2X6YA 3LFUA 2R7SA 2H27A 2FU4A 3GBGA 2WA0A 2X9DA 2MH9A 2L01A 3NEUA 1YTYA 2LF7A 2K9MA 3KP6A 3M1EA 2CQQA 2VBYA 2Z5UA 2HTSA 3DV8A 3FXRA 3NWSA 1ORKA 3F8NA 5DM7F 4BDYA 5KAIC 3HOWJ 3H92A 5FO5A 2X1EA 2RVCA 1YRNA 3LA3A 2DJIA 2ZNYA 4JX5A 2JWTA 1DQUA 1T0FC 1BM9A 3FHNA 2DK5A 2JA5J 1MBKA 4HAMA 5LD2C 1D3YA 2DOEA 1IDYA 3K9TA 2R7DA 3TW6A 1R00A 4YELA 4EJOA 2BEOA 2DQLA 1E17A 3FM5A 3ZMUA 4Y3OA 2PLYA 2WV0A 3EUAA 4AWXB 3L2RA 4GFBA 2LOOA 3K4CA 2J5OA 1WH7A 5BOXA 3I5UA 1U5TC 1X19A 4CDGA 3CUQC 2E1OA 4EM1A 3EUHC 5F0HA 2EH3A 2XGCA 2XAFA 2DA2A 3N05A 4B43A 1T0FA 1JKOC 5HS7A 4F52A 2QQ9A 4BY7J 4AUXA 3BZ6A 4AC0A 2ZJPF 2IP2A 1K78A 3OIPA 5E3LA 4XLFA 4D0PA 2A07F 3A01B 2LLKA 3P7NA 1I27A 1W7PA 2XVCA 4KMUX 3F21A 1QBJA 1T38A 4XOTA 3DPTA 1TLHB 2DFHA 4JOMA 1SMTA 2JJ7A 5DTDA 1U5TA 2HVSA 3CUQA 5J1RA 1W0UA 3TO6A 3DTIA 2WTEA 5GAGJ 4BE1A 1X3WB 2K9LA 3A2KA 1FNNA 4Q48A 1HW2A 1UFMA 2AXTC 2CH0A 1FWZA 2H1LA 1XGNA 4HYEA 4YFKF 1B72B 2BVMA 1ZARA 3MZ8A 2EPFA 4RDUA 1ETXA 3OR2C 1G59A 4TV7A 2D2WA 3OOPA 1I50J 2CUJA 4G6DA 3QQAA 4CGZA 3OYMA 3TL4X 5L3EA 3IRQA 4M3DA 1YS6A 1RUNA 2MYSA 2JMWA 2VL8A 4YIIA 4BJTA 3F22A 2Y30A 2PX9A 4ZZLA 3S2HJ 3FMQA 1FTTA 4HV6A 1KQ0A 3HHHA 2EFWA 4E7LA 3NRVA 5D4SA 5CVUA 4I6ZA 2HTJA 4BXXJ 1Z1DA 3QAHA 1B4AA 1N25A 4BGDA 5LHIA 4AIJA 2C6YA 1GLNA 4ZYEA 4RB3C 2VQCA 5CQGA 1ZGJA 2VXZA 2EA2A 3H0GJ 3OL3A 3CC4I 2CQKA 1OJLA 4NUBA 3U2RA 3DP7A 2FRHA 2QYOA 2LP0A 3S1RJ 1F5TA 2LREA 4MFDA 3PNYA 3IH4A 3QRFF 4LB5A 3V4GA 3S2WA 4QSHA 3AAFA 1WJEA 3G2BA 1JUPA 1W1WE 1HLVA 5LFAA 1TWFJ 1X2NA 3GTPJ 1IRZA 3LSRA 2ZXJA 5IT9K 4BYYA 2ZSIB 4DYQA 2DA7A 4IJAA 3E3VA 5DUIA 2AQFA 1WWXA 1X58A 2RDPA 3AL0B 2NOGA 1VQNI 1JHFA 4WXDA 1RNLA 2OCEA 4Y4RA 5DEQA 1STZA 4JBAA 4F3QA 1ZYRF 2DA6A 1IZ1A 3L9FA 1AOYA 3ZMDA 2OCCH 3O6BB 3M8JA 2NNYA 4BQAA 3HOXJ 1FP2A 3WTYC 3BCAA 2P7VB 2QBYA 1ZAOA 5KHDA 2A69F 1ETWA 4UB8C 4IZZA 1SVLA 2P6SA 4EM0B 3ULQB 2EJRA 5IPAA 3BY6A 4IRGA 5J4YA 1R4NB 3HC7A 4A3CJ 4C3JJ 2O61A 1L0OC 3G73A 3I4MJ 2CRGA 2G9WA 4BNCA 2Y2ZA 2DN0A 4C2MJ 4KN4X 4I7HA 4GYGA 2TCTA 2ID3A 1ZRCA 4OINF 1OYWA 5E3OA 4IHVA 3CMYA 1MJBA 3X2QH 2A6TA 1B59A 2IXSA 4OIQF 3I9V2 1HW1A 3WTSC 1WJCA 5LRRA 1U78A 3CP8A 3KYLA 2HQ5A 3FBNB 1JKQC 2HOAA 1CF7B 2XAUA 3GLXA 2KJCA 3GTMJ 1BL0A 5CPRB 2HVRA 2LC2A 1JE8A 4K2EA 3KZYA 3HSEA 1XSVA 2LD5A 5EYRA 3WG7H 3ZCOA 1J2XA 1VNDA 1QO0D 4N0BA 2FQ4A 4D5CA 2M4GA 3K69A 4XICA 1KGSA 2XV4S 5IY5H 3BG7A 3NQOA 5B1AH 3K10A 4WXCA 1ZG1A 3WTVC 3Q5FA 3CLOA 4KMFA 3V7CA 4YFNF 3S17J 3G1OA 2DFEA 2ZMEC 3TBIA 2HKXA 2NS8A 4LK0F 2G0EA 2DFIA 3M8FA 1DUXC 3DBLB 1G3TA 4M9XA 3BJ6A 3O2PE 5HNHA 2FUG2 3M7GA 1MMGA 3OIQA 4XQFA 2ZKZA 4ANJA 1N77A 4OU0A 3D5RC 1BW5A 2BY3A 2IAIA 2HYFA 2HXOA 2STWA 1TWCJ 5F64A 2CV0A 1V5FA 4HNVA 1Z7LA 5CKTA 3OYGA 2CQ7A 3PQKA 4AIKA 4IQJA 4QIWN 4P9UA 1N78A 2QLZA 2PMHA 1KU9A 1TT5B 3KETA 4F55A 1FBQA 3GYHX 3CF2A 3QPLA 3CJNA 5LLQA 4BHCA 4ESBA 4BHPA 3ZQQA 3B6AA 1X3ZB 2F2EA 2E36A 4M73A 1PYVA 3ZN1A 2GLOA 2JA7J 4G12A 5H2FC 5B1BH 1T95A 2JPBA 2MG4A 1XCBA 3OL4A 1RRJA 3I64A 2HDCA 1UCRA 3HOSA 4OIOF 4UXNA 4BXUA 1G3YA 5LHGA 4W97A 5J8CA 1E3HA 3RJPA 1S72I 3R60A 2RAEA 3UKGA 2NVTJ 4M6YA 2QZ8A 2QSHX 1P7JA 1TWGJ 4D5FA 3BJOA 3EUKL 1W7PD 1S5LC 3RPUA 5CYVA 2Y9YA 1XMAA 3KIOA 2BXZA 1JI8A 3IRRA 3WU1B 3DF8A 3ABKH 2E34A 3J7YJ 1RIOH 2V26A 2DO7A 4XSXF 1IO2A 4XNFA 1LKXA 4JX6A 3DU5A 4CHUA 3D0SA 4ENJA 3IWFA 3S3NA 4FT8A 1FBUA 1JUMA 2P81A 3KX2A 1SFEA 1OQYA 5EGOA 4HSRA 4FE4A 2IA2A 4UY8I 2L9NA 1FMWA 1WRJA 2EFOA 2OPTA 2HR3A 3HOZJ 2X4HA 4MQ9F 2ADUA 2KDZA 2IGNA 1R5HA 3K70D 2Q2EA 2OQGA 2P8TA 4QLCU 1TWHJ 2DXIA 2CW0F 2PMZA 2NRAC 4X6AJ 2M4KA 5TJJA 2JSPA 5DV5A 1J09A 1B6AA 1OCCH 3FF5A 4F91B 2LG4A 4WX9A 3KP7A 4ZYDA 1TZLA 4OMZA 3VOEA 1XGOA 1RR8C 2CV1A 2QUFA 3PM1A 2IEKA 1MNDA 2VKEA 1YJ9I 3V8JA 1EF4A 1BA5A 2ZC2A 3LQQA 1XSXA 4RGUA 3OYIA 1MBEA 3BG6A 3J7AO 1IRGA 2VLAA 4E70A 1P2FA 4XKCA 1BOBA 3O8GA 4M6XA 1DP3A 1KQ8A 3GTQJ 3R0AA 5HVQC 4J01A 1WZ2A 4HRIA 4L9TA 1P92A 1D0ZA 4MNUA 3J80K 1M1EB 2P5LC 4EJWA 1R49A 1FEXA 5FKNA 2ICWG 4HZFA 3H3ZA 3W6KB 1ZLKA 1YOVB 1Z7UA 2L0KA 3ECOA 3KFWX 5JHFA 2BHZA 2OV7A 3GVAA 4IQ4A 2WV1A 5DM6F 1VZ0A 3OY9A 2O5RA 3OS1A 3IH3A 2N8GA 1OISA 2VONA 5GAHJ 3HSRA 3ZMSA 5L3FA 1DPUA 1X1DA 4DGWB 2CU7A 5JLXA 4XL9A 3C2HA 1K6YA 2DCEA 4HDVA 2E35A 5IOYA 3J7ZI 2AS5F 2MA3A 1GVDA 1D8JA 5M3FJ 4B3AA 4D1QA 4H0EA 4KISA 1S7AA 5HS8A 3GTJJ 2F5VA 1K7AA 3GCMA 2GM4A 2PJRB 4BJ6C 3GFJA 5ILUA 3JRDA 2KZVA 4XN0A 3ZQ7A 3KEQA 4JQFA 1UZCA 1XMXA 4MO7A 2K3FA 1LVKA 1R7JA 4QWQA 3IAS2 5GADJ 3COAC 2DYRH 2M30A 2WAFA 4B09A 3A01A 1W5CC 3AG2H 5J6XA 3B02A 1A04A 3RPQA 2TDXA 3F0CA 3BR6A 5C3EJ 1MDMB 1H9GA 1YQAA 1J9IA 1QU3A 3LSHA 3LSGA 1ODDA 3VEPA 1DDNA 1EH8A 4CYDA 2X1CA 1HKTA 2LKPA 2FSWA 1FSHA 3S14J 5JLWA 2PQ8A 2E5ZA 1G3SA 3G3ZA 4RA2A 2MFZA 1U0JA 2A3SA 3NARA 3BOQA 3C18A 3A0BC 1WH5A 2EINH 1B72A 5H20A 1Y39A 2VODA 2V7FA 5L3CA 4M3EA 5A2QZ 2V1UA 1IN5A 1LEBA 2W7NA 2DMUA 2NVUB 1T39A 4ESJA 4A0XA 4A0ZA 5BQTA 4HX7A 5DD8A 3WE3A 3E6BA 2PEXA 5KK1A 2HPIA 2OJED 2KDOA 1UHSA 3ZMZA 1W0TA 1ZTRA 2CWEA 3E6MA 1UB9A 1T8IA 1MJAA 1WHUA 2AHQA 2XB5A 4EM2A 5HDKA 1LFUP 1XB4A 3UNGC 3QU6A 4FE7A 4D9JA 3K1PA 3K4BA 1W5SA 1YW7A 1KU3A 3F8MA 1DU0A 3AG1H 3LFKA 2DQRA 1Z77A 4I01A 3WTWC 4D7MA 2E7XA 3HKZA 4AVPA 1PP7U 3HOVJ 3E6DA 1QVUA 1R5ID 4ZC3A 2YUSA 2VE8A 1XN7A 4ZZDA 4BACA 1E3OC 3OYJA 1X1BA 3ZP5A 1TNSA 1EJ9A 4XLEA 3CQZJ 1EKEA 4UUVA 5LHHA 1WI9A 4EMSA 2XGXA 2QQBA 5L3GA 3VODA 1PUEE 1R22A 2VQGA 3BCBA 4GDFA 2L7MP 2IGKA 1XG1A 4RBOA 1V5GA 2E1MB 3KEOA 3NAUA 3I3LA 3H1CA 4IHSA 3F23A 2BY0A 4ON0A 3FKIJ 2M1BA 3CDLA 2M0MA 2EILH 4L5EA 3BTJA 1TQPA 3DQVC 3CESA 3P9IA 2XB0X 1IG7A 2KJBA 1IC8A 1JUSA 2QWWA 4B4CA 1WGXA 4Y17A 2XGDA 5F04A 3ZPLA 3ERMA 1R36A 4XK4A 2FNAA 1PUFA 4EGYA 1E2XA 1MH4A 1GV5A 2LKXA 5ICFA 3SDGA 4J00A 1MSEC 5CVRA 4YIRX 3P9CA 3ZN0A 2F5CA 4X1EA 1Z67A 1T6SA 3CJQB 3O8HA 5FGMA 3OSGA 1KYWA 2AXLA 2KISA 1UG0A 3K4MA 3V8KA 3MZYA 2F4IA 3SEZA 3OYNA 2L4MA 2CJJA 3LMMA 4GCVA 3F72A 1OCTC 4E7ZA 2VBZA 2FNPA 4FHTA 4HSTA 4E7KA 1MIJA 3GUDA 4UV9A 1SD6A 2ACJA 1CF7A 1J5YA 2W1OA 3OYFA 5EEAA 3FK7A 2ELHA 1HCRA 4LLLA 3OYBA 3MVPA 1Y0UA 2H94A 2XGEA 3IP4B 3GMEA 3CF5F 4L9JA 2LMDA 3CCUI 1IAWA 2F4MB 1L3LA 1ACIA 1ERDA 5GPAA 3A0HC 3QP5A 4MEXF 4HG2A 3P9KA 2GBYA 3RDIA 3BTIA 1P4WA 3DLLF 2WAEA 2JZYA 1D1BA 3IV5A 1YW9A 1ITYA 5F0FA 4I98B 1NK3P 3WHBA 2BYVE 3SZPA 2QKMB 4XM3A 3E97A 5F1JA 5D5VB 2K02A 1MNEA 2RREA 4BH9A 4AVZA 1CQTA 4QPQA 2MW8A 4BUPA 1SEUA 3HJEA 3TP0A 2K40A 4UV8A 1BI2A 4FISA 1LB2A 3SEQA 1S7EA 3BDDA 1BC7C 2R5YB 2ZSHB 3HRUA 1EV7A 1V3FA 1HSJA 2PBIA 5ICEA 2WY7Q 3SZTA 3MKYB 1OYYA 1NK2P 4XN3A 2JVGA 2QA4I 2XRLA 3CUOA 2DA1A 4WCGA 2HOSA 5DD4A 1T56A 2M3AA 2DA3A 2HNHA 4AYBN 2A5YB 4D7NA 2VBXA 3JREA 4CXFA 3GZ6A 4KYWA 3G1LA 3ABLH 4Y52J 4C9YA 3FHZA 1OFCX 3L09A 4M9SA 2X0LA 1QZZA 3D1NI 4LMYA 1X3UA 1ZH5A 2ZXWH 2H6CA 3MN2A 3OMYA 3FIWA 1LE8B 1G3WA 2E1CA 3R4KA 4A6EA 3PO2J 4L9VA 3V7RA 5DCMA 4RLQA 1TP4A 4M71A 3K70C 3KEYA 2UXNA 4GYIA 4M72A 4NHJA 2R92J 3RYPA 4FQGA 1IXSB 3LSMA 4LLGF 3Q9SA 3H9GA 1B8IA 1YW8A 3F6VA 5M5WJ 2XKPA 2ZJ2A 1SC7A 2K3PA 4FCYA 1R6RA 2MABA 3VYRB 3MKLA 3U9GA 1YS7A 5AIPA 2BY2A 2CS3A 4LK1F 4PDKA 3FXJA 2XF5A 5FKLA 3KCCA 3CO6C 2NVYJ 2VXDA 3LL7A 3BQZA 4UVBA 3OR1C 5AONA 4PFOA 4A2UA 1FJLA 1P4AA 2TRTA 5C4JJ 4BU2A 3HOYJ 2LR8A 2G7HA 1WJDA 2VJ5A 5C4XJ 2W4SA 4I99C 2ZB9A 3ZR8X 3BZKA 3J81K 1YYVA 4HQEA 4EQQA 2R7TA 4E6KG 3ASNH 2JQ7A 5FROA 4BBRJ 4IHXA 1S8NA 3G1MA 3IL2A 1HDDC 1U8RA 1Y0NA 2HGCA 4HF2A 2E5NA 5H6QA 5KVRA 4HEA2 1WJ5A 3EYYA 1JTXA 5B66C 1IUFA 2JN6A 2JT1A 4U87A 4FETA 2ISZA 2CUFA 1R5GA 1S3JA 4G6TB 3GLLA 5HNFA 2D5VA 3FM3A 1Q1VA 3KZIC 4IX7A 3CJTB 2JA6J 2CO5A 3IHUA 3M1CA 1K61A 1FYKA 3H5RA 1O3TA 2L7KA 4UVCA 3K4KA 5EJCA 3LSIA 3AG4H 1X1CA 1P6RA 2EFPA 4S05A 3R61A 1X4OA 3H9JA 2NS0A 1G4DA 2H1KA 2GQQA 1O3QA 3EYIA 2JA2A 3K4LA 3FISA 5E1WA 2Q1ZB 3WGIA 3RCOA 3I59B 2E2HJ 4NQWB 2A6EF 2ELKA 1MBGA 1D1AA 3CDIA 2I10A 2XF7A 2E7WA 2DI3A 4LFUA 1QPIA 4WXHA 5EF6A 4P9FA 5IP9J 4A3FJ 2DT7B 4U7DA 3BP8A 4ZYGA 2R7UA 3ISPA 1OLTA 2VE9A 1LDJA 4UUSB 2F5DA 3DU6A 3VPRA 5E20A 1REPC 1PUFB 1NHAA 3AG3H 3NWTA 4PFPA 1FLIA 2YX4A 1V4RA 5FKKA 5E8GA 4ABZA 4A3MJ 3S15J 2V1XA 2EFQA 4F92B 3DTKA 1S7OA 3RKXA 5HLHA 1IV6A 1G6NA 2L9RA 5M5XJ 3OYEA 2Y9ZA 3HL2A 2PJRA 1NG7A 5E8IA 1OCPA 2R7FA 3S2DJ 3CCSI 4MFEA 2VKVA 3R6SA 2IS4A 1R1UA 1O57A 2FBIA 1PVEA 1H9TA 4S04A 1YITI 4HF0A 2FE3A 4ZTFA 2IVMA 1IW7F 2K9QA 2CFXA 5JI6A 1FBSA 3CDHA 2DOFA 3OIOA 3ZQIA 1DGWY 3GWZA 2XRNA 2LKSA 2XHKA 4LIVA 1W36D 1A31A 1MDMA 1TNTA 4GO1A 2K9SA 2X85A 3KP3A 3EPZA 3OV8A 3S16J 2FX0A 2VJIA 4ETSA 3OOUA 4EJUA 3ECHA 2H8WA 1B9MA 4RM3A 5K5QA 3MFKA 4N4OB 1P9QC 2DU9A 1LDDA 3CZ6A 1GDTA 4OWRB 3JSOA 1G2HA 1I3QJ 2FQ3A 2E2JJ 3DTEA 2ID6A 3L2CA 4UUTA 3Q9VA 5GP9A 4Y7NJ 2VI6A 5DUKA 4BHBA 4G7HF 2WAQA 3WU2C 4EGZA 1O7FA 4BY1J 1HF0A 3V7SA 2B7EA 2M5WA 2DMNA 3GW2A 2DDBA 3DKWA 2PJPA 4N4NB 3HTUA 3W2AA 1T2KA 1LUJB 2L4AA 4A3DJ 3BR1A 4DZJA 5CVVA 3K0LA 1UG2A 3DCFA 1BBYA 3S3OA 2L9SA 3C1DA 3GF2A 3Q0UA 3AFHA 5H6RA 4LB6B 2PMZN 4BJ5C 1SAXA 3PSFA 1W5TA 4BKXA 2ELJA 2E1MC 1ONVA 1RESA 2LY2A 1OMIA 4II2A 4V2GA 4RAGA 4IHTA 1XMKA 2L54A 3BWGA 1Y6IA 2XSJC 3PO3J 3JSPA 4C2TA 3FMRA 3FXQA 4PK4A 3ERED 3S1QJ 1P4XA 3DEEA 3OWTA 3RKQA 1Z6RA 1QVTA 6PAXA 4WK8F 1Z0XA 5HODA 1S9HA 1H0MA 3QOPA 1K6OA 1FOXA 5BS6A 2GA1A 5DCMB 3HPHA 2BVLA 2EWNA 4CUGA 2M2EA 2EIKH 3HUGB 1LJ9A 3OYAA 4B44A 3OS0A 4DYRA 2CQNA 1FTZA 1B8IB 4L18B 4JP0A 2CSOA 3IUOA 1O3RA 1IXRC 1MZBA 2K4BA 4MIMA 1Z9CA 3F6OA 5M5YJ 2QVOA 1K4TA 2KRCA 2JRTA 1OYIA 3K1NA 3SFIA 4YFXF 2NS7A 5JVGF 5K5OA 1IN8A 4IEJA 4A3JJ 3T5XA 2EV6A 5HOOA 4RAFA 1ETOA 3JAMK 1K4SA 1I5ZA 3A4CA 2GXBA 3PJRA 2W25A 2F6CA 2EZKA 4FX0A 2AQEA 2LY9A 2HXIA 1MMAA 4MTEA 3PNVA 1HKQA 2XKOA 1VQOI 2P5VA 1A36A 1TW2A 2KQRA 5TISC 5BNGA 2IBDA 4Y13A 1U9OA 1V54H 3GTLJ 3MEXA 1YFHA 2HWVA 3D5SC 4A3LJ 3ZQCA 3VYSB 3JRHA 3ELKA 4ZDPA 1ZELA 4ENNA 3SHFA 5HLGA 2F48A 2HEOA 1UELB 5IT9Z 4DZPA 3A1YA 4NC6A 2VOPA 2KP6A 3WE2A 4GRIA 2KL4A 3BLYA 4Z6YA 2VIXA 4WF2A 1IRFA 2K4JA 1MBJA 4ITVA 2JUGA 2CYYA 3KP2A 2UZKA 1J75A 4XKVA 2P7CB 3PFIA 4OOIA 2P6TA 3ABTA 2BOLA 3TEDA 1SVOA 2DK8A 2UV1A 4PUSA 2VT3A 5FLXK 2DMPA 4ENMA 2VJJA 3TDZC 4IL6C 4EEFG 4XR6A 2XIGA 4E7IA 3DXJF 3K4NA 1TQMA 4LOCA 4CO8A 4GXOA 1ETYA 3QODA 2M8GX 4HOBA 2YU3A 1NG6A 1D1CA 3LSJA 2X1DA 1BI1A 1RI7A 3FWEA 2QF7A 5FD5A 3GX4X 1TBXA 1BR2A 1G8XA 2HQAA 3REOA 3BG9A 3OYLA 3LA2A 1XC5A 3CCEI 1TW3A 5JHUA 4RAYA 4P5OA 1Z6TA 1BJAA 2OZ6A 2ZXIA 3HM5A 4YG2F 5B5EC 2R5YA 4I02A 2KMUA 1VQMI 3BROA 3KP5A 4OAZA 5LBQA 3M07A 3KE2A 1OPCA 3HYIA 4B48A 2DT6A 2WB1A 4KDPA 1ULYA 3WU0A 3VSKA 2LDUA 3WTZA 5F6FA 1KQ9A 3LSTA 1SVMA 2DPDA 2QKLB 4KN7X 3PQJA 2Z1DA 5EEGA 1RC9A 5FLMJ 3TDUC 3C2GA 1BC8C 2QSFX 1QNTA 4N9IA 3S8PA 2VPRA 1BIBA 5IT3A 2VKHA 2RQPA 2DFFA 4JX4A 3HKZN 2HPMA 2KIQA 2GIZA 1UHMA 4E7HA 4Z2YA 5JFRA 2A5WA 4IOCF 5HS9A 3EETA 2IA0A 2XDVA 5LGTA 1GV2A 4OMYA 3JRGA 3LSPA 1PDNC 1LE8A 2XPUA 5HDGA 3HGGA 1ON1A 2HZTA 2R93J 4AIDA 1TQIA 3K2AA 2RKHA 3F8FA 3IKVA 2X51A 1YJNI 5GPCA 2STTA 4ESFA 3V42A 1ZG5A 4KNYA 1JJ8C 1ZR4A 1R58A 4CCJA 3TO9A 1MBFA 2FD5A 4KJZA 2GXAA 2DPUA 3TO7A 1MNMC 2LBFB 3QOEA 4MQVA 4ZTJA 2Z33A 2FMLA 4B47A 1UAAA 2WC2A 3I4PA 2R7VA 3JTHA 1X1PA 3W2WA 5E1XA 3L7WA 1KA8A 3ASOH 3GXOA 3TMOA 5JR3A 3GFIA 2V6EA 1ETQA 4A3IJ 2R7XA 5BPIA 2HZDA 5HLIA 1R1TA 2HOEA 5L3BA 4KT6A 3ABUA 2O3FA 3HXLA 2XC7A 2XAHA 2ZJRF 1XS9A 3K6GA 1DPRA 1VQ8I 4IOAF 4HV5A 4XKBA 1AWCA 5J3LA 5F1RA 1LFBA 2LVSA 2YU9J 1BI0A 1O4XA 3HEFA 2Z9OA 1RETA 2ZCWA 1AA7A 4KITB 2HFHA 1ZRFA 3BG3A 4KIGA 3QWLA 3LA7A 5IP7J 3CCRI 5D5UB 3AL0C 2ME0A 4HPQA 1XDSA 4EJTA 1SD7A 2HQNA 4O5VA 4B1RA 4V2FA 3WG9A 4HA8A 1I6HJ 1I3AA 3U1KA 2LFBA 3QYFA 1F9NA 1Q1HA 2WWYA 3CCMI 1YX3A 1MJ9A 3LWFA 4I76A 2UUZA 2XAGA 2DA4A 1NTCA 1EH7A 2BBYA 3BJAA 5M3MJ 4PJ0C 4B3XA 1GXQA 2R5ZB 2NVQJ 3TGNA 2K5CA 1X1AA 1QQIA 3PNTA 1TL8A 4UB6C 4G7OF 1VQPI 1T33A 4XSZF 3SZGA 2H09A 2FMYA 1C0WA 1UJ8A 1IF1A 4IHYA 1POGA 3I59A 3RIRA 4NQWA 1OKRA 3L1PA 2W00A 3QYBA 3LNQA 1I1GA 4O3MA 2R7QA 3RQ4A 4KIFA 1D5YA 2Z2SB 1YE9A 1S6LA 1BOAA 5FFXA 4A3BJ 4MGRA 1GHCA 4IVNA 1W36C 3H36A 1QZYA 4Q5SF 5LGUA 3CLQA 2ZXHA 4UUSA 3HHGA 2M87A 2A68F 4PGGA 3FXKA
chains in the Genus database with same CATH topology
4DYCA 2FJ1A 1FJLA 3S17J 5C4JJ 2TRTA 3G1OA 3HOYJ 2LR8A 1HOMA 2NS8A 4CYCA 2G0EA 4A93J 2Y31A 5C4XJ 2ZB9A 2CQXA 2ECCA 5IYCJ 5FLVA 3S1NJ 1TWAJ 3M3YJ 2EZHA 4BBRJ 2K9NA 4IHXA 1BW5A 2IAIA 3G1MA 3RQIA 1HDDC 2HXOA 5IYDJ 1TWCJ 3LOCA 5E3MA 4HNVA 4S0HB 4XRSG 1JTXA 3CCYA 1IUFA 2JN6A 4QIWN 2CUFA 1FIPA 1VI0A 3QPLA 2D5VA 1Q1VA 2JA6J 1JGGA 3B6AA 1ZKGA 1K61A 1R9TJ 2GLOA 5J1YA 3Q0WA 5FJ8J 2JA7J 4G12A 4XIDA 2MG4A 5F08A 3BR5A 1F43A 4W97A 2H1KA 1ZGWA 1Y1VJ 2CUEA 2KT0A 3FISA 2RAEA 3UKGA 2NVTJ 2E2HJ 5EZGA 2ELKA 3JRCA 1MBGA 1P7JA 1TWGJ 4D5FA 1A6IA 2I10A 1QPIA 5EF6A 2Y9YA 2HYJA 1MSFC 5IP9J 3K7AJ 4A3FJ 4JX6A 1RKWA 9ANTA 4UUSB 2L7FP 2YS9A 3VPRA 3GTKJ 1JKRC 1JUMA 2P81A 2DJNA 1PUFB 5EGOA 4A3MJ 3IH2A 5FKKA 4ABZA 3S15J 4CYCB 4FE4A 3JRFA 2O7OA 2DA5A 1ENHA 4M3FA 2OPTA 3HOZJ 1IV6A 1DU6A 2KDZA 2L9RA 5M5XJ 2Y9ZA 4A3EJ 1JTYA 1OCPA 3S2DJ 1Y1WJ 4MFEA 1TWHJ 2VKVA 1GT0C 3S1MJ 2HI3A 4X6AJ 2EQRA 3W6VA 3BQYA 2K9QA 3H3VK 2Y0SN 3OIOA 3ZQIA 4DW6A 3JR9A 1AKHA 2E19A 1IGNA 3PM1A 2IEKA 1GUUA 1QRYA 1BJZA 2VKEA 2W48A 3GTOJ 1EF4A 2ME6A 1BA5A 3C2BA 2K9SA 1F36A 2XPVA 3S16J 2FX0A 1MBEA 4XRSA 3HB9A 4NDLA 3ZQLA 3OOUA 1K83J 1MBHA 1WCMJ 3O8GA 1H8AC 3GTQJ 1GDTA 1G2HA 1I3QJ 3I4NJ 3SJMA 2MSYA 2R7ZJ 2E2JJ 2ID6A 5F0CA 1MH3A 4UUTA 5EG0A 5K7HA 4A3GJ 5GP9A 1FEXA 5EDNA 4Y7NJ 5FKNA 5C44J 2VI6A 2DTZA 3WHCA 2ECBA 2L0KA 2DMTA 1IJWC 4BY1J 1HF0A 2WV1A 1SANA 1ZQ3P 3TP3A 2DMNA 3IH3A 2N8GA 1WPKA 4A3DJ 3BR1A 4DZJA 5DS9A 1UG2A 3DCFA 2CU7A 2L7ZA 4C3IJ 5JLXA 5E3NA 3Q0UA 3A03A 3BR0A 3ZQGA 2M34A 3E7LA 3HDDA 2PMZN 5IOYA 4J19A 1JJ6C 1GVDA 2X6OA 3BTCA 5M3FJ 3Q3SA 4B3AA 5EGOB 1X2MA 4BKXA 2X48A 1RESA 1VF9A 3GTJJ 4V2GA 5K7ZA 4MLOA 2GM4A 2E2IJ 1AHDP 1RR7A 3PO3J 3JRDA 3Q0VA 2H8RA 1HDPA 3S1QJ 3RKQA 3BG5A 1QVTA 4MO7A 2XSDC 2AO9A 3B6CA 1Z0XA 5HODA 3OSFA 1ETVA 2DMQA 4JYKA 3A01A 1VFCA 2M2EA 1AKHB 3F0CA 3BR6A 4IHWA 1WI3A 1JKPC 5C3EJ 3BR2A 3FK6A 4DYRA 3HBLA 3LSGA 1FTZA 1B8IB 3DEWA 4JP0A 2WAQN 1ZK8A 4XRMA 4MIMA 5M5YJ 3S14J 5JLWA 3SFIA 2NS7A 3HGYA 3NARA 4IEJA 4A3JJ 3GBGA 1WH5A 2X9DA 1B72A 1ETOA 4M3EA 2CQQA 3JRBA 2EZKA 2LY9A 1ORKA 1A5JA 2DMUA 2HXIA 3HOWJ 1YRNA 5BNGA 2IBDA 1U9OA 4JX5A 2JWTA 1UHSA 1W0TA 1ZTRA 3GTLJ 2JA5J 1MBKA 4A3LJ 2AHQA 2XB5A 3ZQCA 3JRHA 1LFUP 1ZR2A 1IDYA 3TW6A 4FE7A 4DZPA 1UMQA 3GTGJ 2XPWA 1DU0A 3ZQHA 1TC3C 3RZOJ 1Z77A 4A3KJ 4GFBA 4D7MA 1WH7A 3HOVJ 1QVUA 1MBJA 2YUSA 2E1OA 1E3OC 5F0HA 2EH3A 2XGCA 2DA2A 3CQZJ 1JKOC 3TEDA 4BY7J 1APLC 4AUXA 4AC0A 2DMPA 5E3LA 4EEFG 3A01B 4LOCA 3ZQFA 2LLKA 1ETYA 2L7MP 1P7IA 2LK2A 1XG1A 2M8GX 4RBOA 3NAUA 3LSJA 3M4OJ 2QF7A 2JJ7A 5DTDA 4M3BA 4M6VA 3BG9A 3CDLA 3FKIJ 3A02A 5J1RA 3RZDJ 1W0UA 1XC5A 4L5EA 3BTJA 2EZLA 2XB0X 1IG7A 3HM5A 2HDDA 2R5YA 3TW7A 1IC8A 3ZOBA 1B72B 1JUSA 4RDUA 1ETXA 4B4CA 1WGXA 5F04A 2XGDA 5IYBJ 1I50J 4XK4A 1PUFA 3QQAA 1MH4A 1GV5A 5FLMJ 4M3DA 2LKXA 3SDGA 2VUMJ 1MSEC 2JMWA 1YRNB 2VPRA 3JRAA 2Y30A 4JX4A 3HKZN 4X1EA 1FTTA 3S2HJ 3O8HA 2EZIA 3OSGA 2R0QC 4C3HJ 4I6ZA 4BXXJ 1GV2A 3JRGA 3LSPA 2CJJA 1LE8A 2XPUA 2R5ZA 1RKTA 5K7FA 1OCTC 3HGGA 1RPWA 1JT0A 2R93J 1FIAA 3H0GJ 3K2AA 1OJLA 3S1RJ 5FKMA 2LP0A 5IP6A 2M0CA 5GPCA 4MFDA 5IOZA 3IH4A 4A69C 5EEAA 1JJ8C 4QSHA 3FK7A 1ZR4A 1JUPA 4QTRA 1HLVA 1HCRA 1MBFA 3MVPA 3JRIA 1TWFJ 2FD5A 1X2NA 3GTPJ 2O8KA 2XGEA 1IRZA 3LSRA 4DYQA 5GPAA 1MNMC 2DA7A 2O9LA 5EZHA 2GBYA 1X58A 3BTIA 5EG0B 2NOGA 3IV5A 1ITYA 5FKOA 2EBIA 2WB1N 5F0FA 1NK3P 2DA6A 3WHBA 1ETQA 4A3IJ 4W1UA 5F1JA 4M3GA 1CQTA 2MW8A 3TP0A 2K40A 3HOXJ 1ETKA 2QCOA 4FISA 1XS9A 2OF7A 1S7EA 1U9NA 5J3LA 2R5YB 1LFBA 1ETWA 1AU7A 2LVSA 2YU9J 1O4XA 3HEFA 1RETA 2B63J 1NK2P 3BG3A 5IPAA 4A3CJ 5IP7J 4C3JJ 3I4MJ 2ME0A 2XRLA 2CRGA 2DA1A 2HOSA 1T56A 2DA3A 4B1RA 4V2FA 4AYBN 4D7NA 1H88C 3JREA 1U8BA 1I6HJ 3G1LA 2LFBA 2DN0A 2Y2ZA 4C2MJ 1SFOJ 4Y52J 2TCTA 2ID3A 3BTLA 5E3OA 1OFCX 4IHVA 3CMYA 2MGQA 3BT9A 4FTHA 4I76A 2COBA 3BR3A 3QPSA 3D1NI 2DA4A 1NTCA 5M3MJ 1H89C 3MN2A 3FIWA 1LE8B 2R5ZB 2NVQJ 1U78A 3PO2J 2HQ5A 5F27A 1T33A 1JKQC 2HOAA 2R92J 3HOUJ 4BBSJ 2JK3A 4IHYA 1JT6A 1POGA 3GTMJ 1B8IA 1BL0A 2LTPA 2JA8J 3L1PA 5M5WJ 3LNQA 1IDZA 4FCYA 1D5YA 2NVXJ 2LD5A 3MKLA 5EYRA 1VNDA 2M9HA 5J1UA 4A3BJ 2FQ4A 4D5CA 4XICA 5FKLA 1BW6A 4UUSA 2NVYJ 2HOTA 3BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYC A;  2FJ1 A;  1FJL A;  3S17 J;  5C4J J;  2TRT A;  3G1O A;  3HOY J;  2LR8 A;  1HOM A;  2NS8 A;  4CYC A;  2G0E A;  4A93 J;  2Y31 A;  5C4X J;  2ZB9 A;  2CQX A;  2ECC A;  5IYC J;  5FLV A;  3S1N J;  1TWA J;  3M3Y J;  2EZH A;  4BBR J;  2K9N A;  4IHX A;  1BW5 A;  2IAI A;  3G1M A;  3RQI A;  1HDD C;  2HXO A;  5IYD J;  1TWC J;  3LOC A;  5E3M A;  4HNV A;  4S0H B;  4XRS G;  1JTX A;  3CCY A;  1IUF A;  2JN6 A;  4QIW N;  2CUF A;  1FIP A;  1VI0 A;  3QPL A;  2D5V A;  1Q1V A;  2JA6 J;  1JGG A;  3B6A A;  1ZKG A;  1K61 A;  1R9T J;  2GLO A;  5J1Y A;  3Q0W A;  5FJ8 J;  2JA7 J;  4G12 A;  4XID A;  2MG4 A;  5F08 A;  3BR5 A;  1F43 A;  4W97 A;  2H1K A;  1ZGW A;  1Y1V J;  2CUE A;  2KT0 A;  3FIS A;  2RAE A;  3UKG A;  2NVT J;  2E2H J;  5EZG A;  2ELK A;  3JRC A;  1MBG A;  1P7J A;  1TWG J;  4D5F A;  1A6I A;  2I10 A;  1QPI A;  5EF6 A;  2Y9Y A;  2HYJ A;  1MSF C;  5IP9 J;  3K7A J;  4A3F J;  4JX6 A;  1RKW A;  9ANT A;  4UUS B;  2L7F P;  2YS9 A;  3VPR A;  3GTK J;  1JKR C;  1JUM A;  2P81 A;  2DJN A;  1PUF B;  5EGO A;  4A3M J;  3IH2 A;  5FKK A;  4ABZ A;  3S15 J;  4CYC B;  4FE4 A;  3JRF A;  2O7O A;  2DA5 A;  1ENH A;  4M3F A;  2OPT A;  3HOZ J;  1IV6 A;  1DU6 A;  2KDZ A;  2L9R A;  5M5X J;  2Y9Z A;  4A3E J;  1JTY A;  1OCP A;  3S2D J;  1Y1W J;  4MFE A;  1TWH J;  2VKV A;  1GT0 C;  3S1M J;  2HI3 A;  4X6A J;  2EQR A;  3W6V A;  3BQY A;  2K9Q A;  3H3V K;  2Y0S N;  3OIO A;  3ZQI A;  4DW6 A;  3JR9 A;  1AKH A;  2E19 A;  1IGN A;  3PM1 A;  2IEK A;  1GUU A;  1QRY A;  1BJZ A;  2VKE A;  2W48 A;  3GTO J;  1EF4 A;  2ME6 A;  1BA5 A;  3C2B A;  2K9S A;  1F36 A;  2XPV A;  3S16 J;  2FX0 A;  1MBE A;  4XRS A;  3HB9 A;  4NDL A;  3ZQL A;  3OOU A;  1K83 J;  1MBH A;  1WCM J;  3O8G A;  1H8A C;  3GTQ J;  1GDT A;  1G2H A;  1I3Q J;  3I4N J;  3SJM A;  2MSY A;  2R7Z J;  2E2J J;  2ID6 A;  5F0C A;  1MH3 A;  4UUT A;  5EG0 A;  5K7H A;  4A3G J;  5GP9 A;  1FEX A;  5EDN A;  4Y7N J;  5FKN A;  5C44 J;  2VI6 A;  2DTZ A;  3WHC A;  2ECB A;  2L0K A;  2DMT A;  1IJW C;  4BY1 J;  1HF0 A;  2WV1 A;  1SAN A;  1ZQ3 P;  3TP3 A;  2DMN A;  3IH3 A;  2N8G A;  1WPK A;  4A3D J;  3BR1 A;  4DZJ A;  5DS9 A;  1UG2 A;  3DCF A;  2CU7 A;  2L7Z A;  4C3I J;  5JLX A;  5E3N A;  3Q0U A;  3A03 A;  3BR0 A;  3ZQG A;  2M34 A;  3E7L A;  3HDD A;  2PMZ N;  5IOY A;  4J19 A;  1JJ6 C;  1GVD A;  2X6O A;  3BTC A;  5M3F J;  3Q3S A;  4B3A A;  5EGO B;  1X2M A;  4BKX A;  2X48 A;  1RES A;  1VF9 A;  3GTJ J;  4V2G A;  5K7Z A;  4MLO A;  2GM4 A;  2E2I J;  1AHD P;  1RR7 A;  3PO3 J;  3JRD A;  3Q0V A;  2H8R A;  1HDP A;  3S1Q J;  3RKQ A;  3BG5 A;  1QVT A;  4MO7 A;  2XSD C;  2AO9 A;  3B6C A;  1Z0X A;  5HOD A;  3OSF A;  1ETV A;  2DMQ A;  4JYK A;  3A01 A;  1VFC A;  2M2E A;  1AKH B;  3F0C A;  3BR6 A;  4IHW A;  1WI3 A;  1JKP C;  5C3E J;  3BR2 A;  3FK6 A;  4DYR A;  3HBL A;  3LSG A;  1FTZ A;  1B8I B;  3DEW A;  4JP0 A;  2WAQ N;  1ZK8 A;  4XRM A;  4MIM A;  5M5Y J;  3S14 J;  5JLW A;  3SFI A;  2NS7 A;  3HGY A;  3NAR A;  4IEJ A;  4A3J J;  3GBG A;  1WH5 A;  2X9D A;  1B72 A;  1ETO A;  4M3E A;  2CQQ A;  3JRB A;  2EZK A;  2LY9 A;  1ORK A;  1A5J A;  2DMU A;  2HXI A;  3HOW J;  1YRN A;  5BNG A;  2IBD A;  1U9O A;  4JX5 A;  2JWT A;  1UHS A;  1W0T A;  1ZTR A;  3GTL J;  2JA5 J;  1MBK A;  4A3L J;  2AHQ A;  2XB5 A;  3ZQC A;  3JRH A;  1LFU P;  1ZR2 A;  1IDY A;  3TW6 A;  4FE7 A;  4DZP A;  1UMQ A;  3GTG J;  2XPW A;  1DU0 A;  3ZQH A;  1TC3 C;  3RZO J;  1Z77 A;  4A3K J;  4GFB A;  4D7M A;  1WH7 A;  3HOV J;  1QVU A;  1MBJ A;  2YUS A;  2E1O A;  1E3O C;  5F0H A;  2EH3 A;  2XGC A;  2DA2 A;  3CQZ J;  1JKO C;  3TED A;  4BY7 J;  1APL C;  4AUX A;  4AC0 A;  2DMP A;  5E3L A;  4EEF G;  3A01 B;  4LOC A;  3ZQF A;  2LLK A;  1ETY A;  2L7M P;  1P7I A;  2LK2 A;  1XG1 A;  2M8G X;  4RBO A;  3NAU A;  3LSJ A;  3M4O J;  2QF7 A;  2JJ7 A;  5DTD A;  4M3B A;  4M6V A;  3BG9 A;  3CDL A;  3FKI J;  3A02 A;  5J1R A;  3RZD J;  1W0U A;  1XC5 A;  4L5E A;  3BTJ A;  2EZL A;  2XB0 X;  1IG7 A;  3HM5 A;  2HDD A;  2R5Y A;  3TW7 A;  1IC8 A;  3ZOB A;  1B72 B;  1JUS A;  4RDU A;  1ETX A;  4B4C A;  1WGX A;  5F04 A;  2XGD A;  5IYB J;  1I50 J;  4XK4 A;  1PUF A;  3QQA A;  1MH4 A;  1GV5 A;  5FLM J;  4M3D A;  2LKX A;  3SDG A;  2VUM J;  1MSE C;  2JMW A;  1YRN B;  2VPR A;  3JRA A;  2Y30 A;  4JX4 A;  3HKZ N;  4X1E A;  1FTT A;  3S2H J;  3O8H A;  2EZI A;  3OSG A;  2R0Q C;  4C3H J;  4I6Z A;  4BXX J;  1GV2 A;  3JRG A;  3LSP A;  2CJJ A;  1LE8 A;  2XPU A;  2R5Z A;  1RKT A;  5K7F A;  1OCT C;  3HGG A;  1RPW A;  1JT0 A;  2R93 J;  1FIA A;  3H0G J;  3K2A A;  1OJL A;  3S1R J;  5FKM A;  2LP0 A;  5IP6 A;  2M0C A;  5GPC A;  4MFD A;  5IOZ A;  3IH4 A;  4A69 C;  5EEA A;  1JJ8 C;  4QSH A;  3FK7 A;  1ZR4 A;  1JUP A;  4QTR A;  1HLV A;  1HCR A;  1MBF A;  3MVP A;  3JRI A;  1TWF J;  2FD5 A;  1X2N A;  3GTP J;  2O8K A;  2XGE A;  1IRZ A;  3LSR A;  4DYQ A;  5GPA A;  1MNM C;  2DA7 A;  2O9L A;  5EZH A;  2GBY A;  1X58 A;  3BTI A;  5EG0 B;  2NOG A;  3IV5 A;  1ITY A;  5FKO A;  2EBI A;  2WB1 N;  5F0F A;  1NK3 P;  2DA6 A;  3WHB A;  1ETQ A;  4A3I J;  4W1U A;  5F1J A;  4M3G A;  1CQT A;  2MW8 A;  3TP0 A;  2K40 A;  3HOX J;  1ETK A;  2QCO A;  4FIS A;  1XS9 A;  2OF7 A;  1S7E A;  1U9N A;  5J3L A;  2R5Y B;  1LFB A;  1ETW A;  1AU7 A;  2LVS A;  2YU9 J;  1O4X A;  3HEF A;  1RET A;  2B63 J;  1NK2 P;  3BG3 A;  5IPA A;  4A3C J;  5IP7 J;  4C3J J;  3I4M J;  2ME0 A;  2XRL A;  2CRG A;  2DA1 A;  2HOS A;  1T56 A;  2DA3 A;  4B1R A;  4V2F A;  4AYB N;  4D7N A;  1H88 C;  3JRE A;  1U8B A;  1I6H J;  3G1L A;  2LFB A;  2DN0 A;  2Y2Z A;  4C2M J;  1SFO J;  4Y52 J;  2TCT A;  2ID3 A;  3BTL A;  5E3O A;  1OFC X;  4IHV A;  3CMY A;  2MGQ A;  3BT9 A;  4FTH A;  4I76 A;  2COB A;  3BR3 A;  3QPS A;  3D1N I;  2DA4 A;  1NTC A;  5M3M J;  1H89 C;  3MN2 A;  3FIW A;  1LE8 B;  2R5Z B;  2NVQ J;  1U78 A;  3PO2 J;  2HQ5 A;  5F27 A;  1T33 A;  1JKQ C;  2HOA A;  2R92 J;  3HOU J;  4BBS J;  2JK3 A;  4IHY A;  1JT6 A;  1POG A;  3GTM J;  1B8I A;  1BL0 A;  2LTP A;  2JA8 J;  3L1P A;  5M5W J;  3LNQ A;  1IDZ A;  4FCY A;  1D5Y A;  2NVX J;  2LD5 A;  3MKL A;  5EYR A;  1VND A;  2M9H A;  5J1U A;  4A3B J;  2FQ4 A;  4D5C A;  4XIC A;  5FKL A;  1BW6 A;  4UUS A;  2NVY J;  2HOT A;  3BQZ A; 
#chains in the Genus database with same CATH topology
 4DYC A;  2IJL A;  2FJ1 A;  1FYM A;  2HU9 A;  2BZT A;  2GIV A;  2OTL I;  2LYC A;  3RI4 A;  1HOM A;  3U1D A;  4A12 A;  2KZG A;  2Y31 A;  2H6B A;  2KIU A;  2ECC A;  5IYC J;  1PP8 F;  3I53 A;  3T8T A;  4ZDO A;  3CD6 I;  3LAJ A;  3I0T A;  2V1N A;  5IYD J;  3RQI A;  5FFZ A;  3LOC A;  3M9A A;  2XAQ A;  5E3M A;  4S0H B;  5ILV A;  1MGT A;  3CCY A;  1HC8 A;  2L9V A;  2I8D A;  2DAO A;  3T1B A;  1FIP A;  1BR4 A;  1KYZ A;  2MD0 A;  1QA6 A;  2VOO A;  4BE0 A;  1ZN2 A;  4A5M A;  1OR7 C;  3VSL A;  3CTA A;  1JGG A;  1R9T J;  3VDX A;  1SFK A;  3Q0W A;  4XID A;  1VQ7 I;  2Y0S A;  4P1W A;  5F08 A;  4L9N A;  1FT9 A;  3VWB A;  4HX8 A;  1KZH A;  3KLO A;  3CCL I;  3DLA A;  1Y1V J;  5TGT A;  2V6C A;  1WSU A;  2LSO A;  4MHG A;  1Y8R B;  2BY1 A;  1A6I A;  2ZJQ F;  3QYE A;  1OR7 A;  3TOB A;  3CO7 C;  3RTR A;  2FOW A;  2ZFU A;  1VQL I;  2LRD A;  4BDZ A;  1J0R A;  2VJ4 A;  1QZE A;  3K7A J;  4II3 A;  2V4J C;  4RMN A;  4EAT A;  3MZH A;  1YIJ I;  4C2U A;  3RYR A;  2L7F P;  2MC3 A;  1XGM A;  2YS9 A;  2CW8 A;  3SDB A;  3S3M A;  3R0J A;  1RZ4 A;  1I39 A;  5GAE J;  3LSK A;  1QPM A;  2Z16 A;  2PG4 A;  2Y75 A;  4NC8 A;  2VN2 A;  4CYC B;  1BR1 A;  3JRF A;  2O7O A;  4G7Z F;  1ENH A;  2KIM A;  5D4R A;  1YX5 A;  1IXC A;  4HX4 A;  1IN6 A;  4PSW A;  3S32 A;  2DYS H;  2Q8K A;  3HRT A;  3K1M A;  4HQM A;  2K85 A;  1MW7 A;  2MC4 A;  3W6V A;  3FMS A;  3DWL E;  2NXN B;  3GZN B;  5LRS A;  3P5J A;  3H3V K;  2MLG A;  4XLH A;  2JRM A;  1FYL A;  3AKZ A;  3MAJ A;  4CZC A;  2HQR A;  4U88 A;  1IGN A;  3HUG A;  3L2W A;  1GUU A;  1QRY A;  1BJZ A;  1WJF A;  2M7A A;  3HG9 A;  5D6F A;  1F36 A;  2XPV A;  3MD2 A;  4PJJ A;  2BHY A;  1Z05 A;  4XRS A;  3H0D A;  2ZO4 A;  3HB9 A;  4NDL A;  5DCF A;  3ZQL A;  4OIP F;  2GZW A;  1K83 J;  2IRF G;  1X4P A;  3I71 A;  2Z3Y A;  1T98 A;  3W3C A;  1USS A;  1LDK B;  2Y69 H;  4AU7 A;  3SJM A;  2MSY A;  3F9K A;  1A35 A;  1XDU A;  1FOY A;  5CQE A;  1FZP B;  4U0Y A;  1R1V A;  2X6W A;  2P5K A;  5EG0 A;  5K7H A;  5FB2 A;  4A3G J;  5C44 J;  5LEJ A;  4MEY F;  2DTZ A;  3FXU A;  4E7J A;  2ECB A;  4N9H A;  4BQO A;  1IJW C;  1WJA A;  4AM3 A;  1SAN A;  1ZQ3 P;  3J7A Y;  3SFZ A;  4G6Q A;  3TP3 A;  3EUH A;  2KFD A;  3L2Q A;  4V19 K;  2YX7 A;  3ZMT A;  3L2U A;  3GZ5 A;  1UHW A;  2VT2 A;  1EA3 A;  4UNO A;  1LEA A;  2O8X A;  3QU3 A;  4IF4 A;  4CA0 A;  2GXG A;  5ICG A;  1QHH D;  2L7Z A;  3HZJ A;  4C3I J;  5E3N A;  2BW3 B;  4BEH B;  2DW4 A;  3BR0 A;  3E7L A;  3HDD A;  1WQ2 A;  1KU2 A;  4J19 A;  1JJ6 C;  2XUB A;  2X6O A;  1A6Q A;  3BTC A;  3PL8 A;  2NNN A;  3KZZ A;  4XKW A;  1XGS A;  1Y56 A;  2Z99 A;  1LNW A;  1X2M A;  3HOT A;  3HTS B;  2X48 A;  1J59 A;  3TQN A;  1R71 A;  5HDN A;  3T0Y A;  5K7Z A;  1NH3 A;  1AHD P;  2ZBK A;  1FSE A;  3PUF A;  1LPQ A;  2HDW A;  3E5X A;  4A0Y A;  3FBI B;  3MWM A;  2XSD C;  5D6E A;  3DBH B;  3L2V A;  2DMQ A;  4JYK A;  4HF1 A;  2JUC A;  4AYB A;  2RNJ A;  1VFC A;  4U0V A;  4LG0 B;  2R7R A;  1AKH B;  5HLT A;  1WI3 A;  3C3W A;  3FK6 A;  3FX3 A;  3HBL A;  4Y15 A;  2OD5 A;  4ZYH A;  4LIU A;  4ZYA A;  2WAQ N;  3E1S A;  4XRM A;  1YJW I;  4F7Z A;  1U2W A;  1QHG A;  4DNC A;  4IO9 F;  2XF6 A;  4M9Z A;  3K2Z A;  2L3D A;  1FY7 A;  2RQQ A;  3HGY A;  4PGH A;  5CVJ A;  1GXP A;  1MD0 A;  3ML6 A;  3JW4 A;  2PFB A;  1YI2 I;  1F1Z A;  2B0L A;  2CUZ A;  3PSI A;  3MKZ A;  1XD7 A;  4CIC A;  4G8X A;  1LVA A;  3E5U A;  2LF8 A;  3MQ0 A;  3JRB A;  3CJR B;  1R4M B;  2A05 A;  4LG3 A;  2HYG D;  1A5J A;  3D5L A;  4DBQ A;  3VYT B;  4R1H A;  4PSX A;  2DOA A;  2FXA A;  3QPH A;  2PN6 A;  1I6X A;  2A6H F;  4ZJZ A;  3I55 I;  5E1Z B;  1HXD A;  4CCK A;  1V5E A;  3GEZ A;  2B9S A;  4R79 A;  1FOW A;  4RLF A;  1ZR2 A;  3H3U A;  3W2V A;  3ROU A;  3MCZ A;  4HLX A;  1ZRE A;  3MMY B;  1UMQ A;  3E5Q A;  4I0A A;  3GTG J;  2XPW A;  4X0G A;  4LJZ F;  4O6J A;  5J8F A;  3ZQH A;  4F93 B;  2QEX I;  2XAS A;  1TC3 C;  3RZO J;  1D8K A;  4A3K J;  1BIA A;  4AD9 A;  1B9N A;  4PCQ A;  3LAP A;  3GFM A;  3N97 A;  1MMD A;  1D0X A;  2VBW A;  3JCU C;  3FXM A;  2Q0O A;  2E60 A;  2UXX A;  3EQL F;  2V9K A;  4B8X A;  3DFG A;  4PZJ A;  1APL C;  4M74 A;  4NNJ A;  5ED4 A;  2LBF A;  2K7L A;  2IS1 A;  1N75 A;  3QPT A;  4RGX A;  4XLP F;  3ZQF A;  1P7I A;  2LK2 A;  2OQR A;  3FXL A;  3M4O J;  2M8E A;  1B1B A;  2YSR A;  3H35 A;  2CV2 A;  1MMS A;  4XRF A;  4M3B A;  4M6V A;  3RZD J;  4XOP A;  3A02 A;  1WKM A;  4FAS D;  3BPV A;  2VKD A;  1VQ6 I;  4L0Z B;  1ZHF A;  2EFN A;  2EZL A;  3N4M A;  3PIO F;  4EJV A;  2HDD A;  2KRH A;  3UR3 C;  2CG4 A;  2KIF A;  2V1D A;  4L5I A;  3TW7 A;  3ZOB A;  2RV8 A;  2FBH A;  4L5J A;  2P4W A;  1ZGA A;  3E0J B;  2GOM A;  4RAZ A;  5IYB J;  4CCM A;  3FKJ A;  4LD5 A;  5E17 F;  2VUM J;  4Y33 A;  1YRN B;  3JRA A;  2NAZ A;  2EZI A;  2R0Q C;  4CZZ A;  2RN7 A;  1HA8 A;  4C3H J;  2OC6 A;  4ENK A;  2QGU A;  5D8L B;  2ESH A;  2QM3 A;  3H5N A;  5A2Q K;  2OUM A;  2R5Z A;  1RKT A;  5K7F A;  4RB2 C;  2RC4 A;  2RNG A;  1RPW A;  1JT0 A;  4OAY A;  3G71 I;  1FIA A;  2JVH A;  5E79 C;  3ESW B;  5FKM A;  2ZME A;  5IP6 A;  2M0C A;  2IS6 A;  3LQR A;  4A69 C;  5IOZ A;  4BAY A;  1SFU A;  5KAF C;  1YLF A;  3GO5 A;  4QTR A;  2A61 A;  3JRI A;  2ZFW A;  4HDU A;  2O8K A;  3WOD F;  4HLY A;  3J81 Z;  1GVJ A;  5GTH C;  1K78 B;  5K1Y A;  2O9L A;  2KPM A;  5EZH A;  3FDY A;  4PJL A;  2F5F A;  1W7P B;  4PJM A;  4A6D A;  4AIH A;  5EG0 B;  4XMY A;  4I2O A;  2D1H A;  2W57 A;  5FKO A;  2EBI A;  2WB1 N;  3DKX A;  2OU2 A;  4BQN A;  3OYC A;  4W1U A;  2IGO A;  2CFO A;  1VQK I;  1U5T B;  2FEZ A;  3CUQ B;  2GWR A;  2HVQ A;  2KKO A;  3HSF A;  4M3G A;  2V9P A;  3FXO A;  2GAU A;  1ZLJ A;  1ETK A;  2QCO A;  2G7U A;  2MBF A;  2OF7 A;  4GGG A;  1U9N A;  2VQH A;  3G4S I;  2FA5 A;  2OZU A;  5AIQ A;  4BQQ A;  1AU7 A;  5DYM A;  3B73 A;  3WTX C;  1FC3 A;  3DPL C;  4ZDL A;  2BE5 F;  4OIR F;  2B63 J;  1LQ1 A;  2MLK A;  4IRH A;  5J40 A;  2OA4 A;  2VAS A;  5LEK A;  1BN5 A;  4KT5 C;  4KUM A;  1DP7 P;  2IA1 A;  4C30 A;  5LGN A;  1R23 A;  4CCO A;  1U6G A;  1H88 C;  3BC8 A;  1U8B A;  3CME I;  4DIQ A;  1Z91 A;  1SFO J;  2F4O B;  2KHM A;  4CCN A;  3DPU A;  1FPQ A;  1SMY F;  3F8C A;  3BTL A;  1WJB A;  2IPQ X;  4BXF A;  3CCJ I;  4I09 A;  1XCV A;  2MGQ A;  1IV8 A;  3BT9 A;  4FTH A;  5BPD A;  2COB A;  3BR3 A;  1ZG3 A;  1FP1 D;  3QPS A;  2R7O A;  4JK1 X;  3PIP F;  4DJA A;  3RKY A;  1H89 C;  1VQ5 I;  2M7B A;  2DT5 A;  1JHH A;  2MH2 A;  3EDP A;  2L02 A;  4P96 A;  4E7S A;  5F27 A;  1LFP A;  3QP6 A;  1VTN C;  5ERI A;  3PUB A;  3E6C C;  2WAD A;  4Q4Z F;  3HOU J;  4BBS J;  2JK3 A;  1JT6 A;  2IW5 A;  2LTP A;  4EVI A;  2JA8 J;  5B3S H;  1V55 H;  2ZNZ A;  1Z21 A;  4HNU A;  1IDZ A;  2GOX B;  3V8L A;  2NVX J;  5CLS A;  2CMP A;  2W85 A;  2M9H A;  2FBK A;  5J1U A;  4U7B A;  4XLN F;  3HRS A;  2IT0 A;  3S93 A;  4NBQ A;  2K86 A;  2XRO A;  4HBL A;  4R8H A;  1BW6 A;  2HOT A;  4DBR A;  3WTU C;  1XSD A;  4YIF A;  2VB6 A;  5FRN A;  3WGH A;  2X6X A;  4RB1 A;  3MKW B;  4MTD A;  4A93 J;  4CYC A;  2VC0 A;  1IN7 A;  5ILS A;  2CQX A;  5FLV A;  1OCZ H;  3S1N J;  1TWA J;  2W84 A;  3U21 A;  5J47 A;  2QBY B;  3M3Y J;  2CGP A;  1T08 B;  2EZH A;  2K9N A;  2OAZ A;  5D5X B;  1ZRD A;  1SD4 A;  4YRV A;  1F4K A;  4XRS G;  2YPR A;  4IPA A;  1SFX A;  4IRI A;  1VI0 A;  1RUO A;  4H4K C;  1I1S A;  4RB0 A;  5K5R A;  3KPH A;  2EV5 A;  2DBB A;  1ZKG A;  3ZXS A;  3HRM A;  1E3P A;  2QEN A;  5J1Y A;  5FJ8 J;  3OYD A;  2DTR A;  3CMM A;  1WVR A;  1YO5 C;  4LGW A;  4HNT A;  4DQ2 A;  3BR5 A;  4IXA A;  2CW7 A;  3F3X A;  3BZC A;  3OYH A;  1F43 A;  3FZV A;  5D5W B;  1IUY A;  1WFX A;  4FX4 A;  2HS5 A;  2L5Q A;  1ZGW A;  4U0W A;  2CUE A;  2W24 A;  2KT0 A;  2EV0 A;  4CCL A;  1U3E M;  3C7J A;  4UHT A;  5EZG A;  1VQ4 I;  3JRC A;  1O3S A;  3DKY A;  2OTJ I;  3KP4 A;  1QGP A;  1Z3X A;  4P55 A;  5CVI A;  1Y8Q B;  4XLC A;  4IKF A;  2EA4 A;  4CSW A;  2UWM A;  2HYJ A;  2EIM H;  1MSF C;  4RGR A;  1S29 A;  2JTV A;  4UVA A;  2D45 A;  1RKW A;  2BW3 A;  9ANT A;  3L00 A;  4BEH A;  3ZMV A;  3GTK J;  2DOD A;  1JKR C;  3W6J B;  2O6G E;  4L0Y B;  1TT0 A;  2W82 A;  3CP2 A;  3BPX A;  2DJN A;  1HW5 A;  2F5E A;  3KYC B;  2LY1 A;  3IH2 A;  3VYU B;  2DA5 A;  2M45 A;  5FRM A;  2D1V A;  2YR2 A;  4M3F A;  3IWZ A;  1DU6 A;  4Q47 A;  3G6E I;  4RS8 A;  2NOJ B;  3I56 I;  4A3E J;  1JTY A;  5TRD A;  1SAU A;  4BS9 A;  1KU7 A;  3KYD B;  3OYK A;  1Y1W J;  1GT0 C;  3H9Q A;  5FD6 A;  3S1M J;  2HI3 A;  1JXS A;  2EQR A;  3BQY A;  1MMN A;  2J5P A;  1ON2 A;  1UST A;  2QQA A;  4KFC A;  2OBP A;  2Y0S N;  2MD5 A;  2COM A;  2KRF A;  3SXY A;  3CC7 I;  2HKO A;  3JR9 A;  2WBM A;  4LG0 A;  4DW6 A;  1CGP A;  1OCR H;  1FMV A;  2E19 A;  1AKH A;  5L3D A;  3ONQ A;  4KIB A;  2ZME B;  1J7K A;  4RM2 A;  3WGG A;  2W48 A;  3VB2 A;  3JAM Z;  1XX5 A;  1VQ9 I;  2PI0 A;  3GTO J;  2ME6 A;  3C2B A;  2R3S A;  1PJR A;  3I54 A;  4XOR A;  5KNL A;  1Z3Y A;  1K79 A;  2E71 A;  4G9Y A;  4KA4 A;  2JSC A;  1W4M A;  4YEJ A;  3CCQ I;  2EIJ H;  1MBH A;  1WCM J;  5CJ9 A;  4RGS A;  1FX7 A;  1DGR M;  1IRX A;  2V79 A;  3WTT C;  2WY8 Q;  3K4J A;  3OS2 A;  3GFL A;  2PMU A;  1H8A C;  3VFZ A;  2I5U A;  3PFY A;  2P0W A;  3I4N J;  2L2O A;  2VPL A;  2R7Z J;  3ZGK A;  2Y48 A;  4QPO A;  3IKT A;  3DBR B;  3TOA A;  5F0C A;  1MH3 A;  3HPG A;  2IGM A;  3DEU A;  5EDN A;  2VC1 A;  4E4H A;  4DOZ A;  3WHC A;  2FF4 A;  1HBX G;  2QSG X;  3IC7 A;  1XPX A;  2DMT A;  2QQ8 A;  2GA2 A;  4CH7 A;  4BE2 A;  2O0Y A;  4WWC A;  5J4V A;  2EB7 A;  3T8R A;  2RGV A;  4G94 A;  2BXY A;  2Y0M A;  3H5A A;  4NB5 A;  2O03 A;  1YIO A;  3M8E A;  5KCM A;  3JTG A;  5GTI C;  1WPK A;  3RSN A;  5BMZ A;  1YHQ I;  2XAJ A;  4LIT A;  3ZRG A;  1FOK A;  1HST A;  1XTA A;  5DS9 A;  2KLO A;  4BL0 B;  1HKS A;  3RPU D;  3A03 A;  3ZQG A;  2M34 A;  3CC2 I;  2DDA A;  1HQC A;  1SD5 A;  2ETH A;  5FLX Z;  3HIF A;  5E18 F;  1IN4 A;  2DLL A;  3Q3S A;  5EGO B;  2V9V A;  3I58 A;  3J80 Z;  1E0E A;  1JGS A;  3RKW A;  1VF9 A;  2ISY A;  3F8B A;  3KLN A;  4MLO A;  4XLA A;  4A5N A;  1OCO H;  2ESN A;  2K27 A;  2E2I J;  1RR7 A;  4HW0 A;  2Q2E B;  2FOK A;  2E1N A;  3Q0V A;  1HDP A;  2H8R A;  2EK5 A;  2VQL A;  5EEH A;  3TKY A;  3CCV I;  3BG5 A;  2R4G A;  1D0Y A;  4LLN A;  2AO9 A;  2BV6 A;  3B6C A;  3OSF A;  1ETV A;  1O7L A;  5ICC A;  1D5V A;  3IAM 2;  4I0B A;  2LNB A;  2IS2 A;  4ZH4 F;  5D8K B;  4IHW A;  2JPC A;  4XBF A;  3CMA I;  1JKP C;  3BR2 A;  4ASN A;  4NC7 A;  5DDG A;  4EV0 A;  1EH6 A;  3DEW A;  1BI3 A;  1MKM A;  3SYT A;  2BGC A;  2NYX A;  3SQN A;  5JVT A;  2LH9 A;  1TTY A;  1ZK8 A;  4KIC A;  1KON A;  4XON A;  3ABM H;  2R7W A;  1YG2 A;  4PJN A;  3O3K A;  2X6Y A;  3LFU A;  2R7S A;  2H27 A;  2FU4 A;  3GBG A;  2WA0 A;  2X9D A;  2MH9 A;  2L01 A;  3NEU A;  1YTY A;  2LF7 A;  2K9M A;  3KP6 A;  3M1E A;  2CQQ A;  2VBY A;  2Z5U A;  2HTS A;  3DV8 A;  3FXR A;  3NWS A;  1ORK A;  3F8N A;  5DM7 F;  4BDY A;  5KAI C;  3HOW J;  3H92 A;  5FO5 A;  2X1E A;  2RVC A;  1YRN A;  3LA3 A;  2DJI A;  2ZNY A;  4JX5 A;  2JWT A;  1DQU A;  1T0F C;  1BM9 A;  3FHN A;  2DK5 A;  2JA5 J;  1MBK A;  4HAM A;  5LD2 C;  1D3Y A;  2DOE A;  1IDY A;  3K9T A;  2R7D A;  3TW6 A;  1R00 A;  4YEL A;  4EJO A;  2BEO A;  2DQL A;  1E17 A;  3FM5 A;  3ZMU A;  4Y3O A;  2PLY A;  2WV0 A;  3EUA A;  4AWX B;  3L2R A;  4GFB A;  2LOO A;  3K4C A;  2J5O A;  1WH7 A;  5BOX A;  3I5U A;  1U5T C;  1X19 A;  4CDG A;  3CUQ C;  2E1O A;  4EM1 A;  3EUH C;  5F0H A;  2EH3 A;  2XGC A;  2XAF A;  2DA2 A;  3N05 A;  4B43 A;  1T0F A;  1JKO C;  5HS7 A;  4F52 A;  2QQ9 A;  4BY7 J;  4AUX A;  3BZ6 A;  4AC0 A;  2ZJP F;  2IP2 A;  1K78 A;  3OIP A;  5E3L A;  4XLF A;  4D0P A;  2A07 F;  3A01 B;  2LLK A;  3P7N A;  1I27 A;  1W7P A;  2XVC A;  4KMU X;  3F21 A;  1QBJ A;  1T38 A;  4XOT A;  3DPT A;  1TLH B;  2DFH A;  4JOM A;  1SMT A;  2JJ7 A;  5DTD A;  1U5T A;  2HVS A;  3CUQ A;  5J1R A;  1W0U A;  3TO6 A;  3DTI A;  2WTE A;  5GAG J;  4BE1 A;  1X3W B;  2K9L A;  3A2K A;  1FNN A;  4Q48 A;  1HW2 A;  1UFM A;  2AXT C;  2CH0 A;  1FWZ A;  2H1L A;  1XGN A;  4HYE A;  4YFK F;  1B72 B;  2BVM A;  1ZAR A;  3MZ8 A;  2EPF A;  4RDU A;  1ETX A;  3OR2 C;  1G59 A;  4TV7 A;  2D2W A;  3OOP A;  1I50 J;  2CUJ A;  4G6D A;  3QQA A;  4CGZ A;  3OYM A;  3TL4 X;  5L3E A;  3IRQ A;  4M3D A;  1YS6 A;  1RUN A;  2MYS A;  2JMW A;  2VL8 A;  4YII A;  4BJT A;  3F22 A;  2Y30 A;  2PX9 A;  4ZZL A;  3S2H J;  3FMQ A;  1FTT A;  4HV6 A;  1KQ0 A;  3HHH A;  2EFW A;  4E7L A;  3NRV A;  5D4S A;  5CVU A;  4I6Z A;  2HTJ A;  4BXX J;  1Z1D A;  3QAH A;  1B4A A;  1N25 A;  4BGD A;  5LHI A;  4AIJ A;  2C6Y A;  1GLN A;  4ZYE A;  4RB3 C;  2VQC A;  5CQG A;  1ZGJ A;  2VXZ A;  2EA2 A;  3H0G J;  3OL3 A;  3CC4 I;  2CQK A;  1OJL A;  4NUB A;  3U2R A;  3DP7 A;  2FRH A;  2QYO A;  2LP0 A;  3S1R J;  1F5T A;  2LRE A;  4MFD A;  3PNY A;  3IH4 A;  3QRF F;  4LB5 A;  3V4G A;  3S2W A;  4QSH A;  3AAF A;  1WJE A;  3G2B A;  1JUP A;  1W1W E;  1HLV A;  5LFA A;  1TWF J;  1X2N A;  3GTP J;  1IRZ A;  3LSR A;  2ZXJ A;  5IT9 K;  4BYY A;  2ZSI B;  4DYQ A;  2DA7 A;  4IJA A;  3E3V A;  5DUI A;  2AQF A;  1WWX A;  1X58 A;  2RDP A;  3AL0 B;  2NOG A;  1VQN I;  1JHF A;  4WXD A;  1RNL A;  2OCE A;  4Y4R A;  5DEQ A;  1STZ A;  4JBA A;  4F3Q A;  1ZYR F;  2DA6 A;  1IZ1 A;  3L9F A;  1AOY A;  3ZMD A;  2OCC H;  3O6B B;  3M8J A;  2NNY A;  4BQA A;  3HOX J;  1FP2 A;  3WTY C;  3BCA A;  2P7V B;  2QBY A;  1ZAO A;  5KHD A;  2A69 F;  1ETW A;  4UB8 C;  4IZZ A;  1SVL A;  2P6S A;  4EM0 B;  3ULQ B;  2EJR A;  5IPA A;  3BY6 A;  4IRG A;  5J4Y A;  1R4N B;  3HC7 A;  4A3C J;  4C3J J;  2O61 A;  1L0O C;  3G73 A;  3I4M J;  2CRG A;  2G9W A;  4BNC A;  2Y2Z A;  2DN0 A;  4C2M J;  4KN4 X;  4I7H A;  4GYG A;  2TCT A;  2ID3 A;  1ZRC A;  4OIN F;  1OYW A;  5E3O A;  4IHV A;  3CMY A;  1MJB A;  3X2Q H;  2A6T A;  1B59 A;  2IXS A;  4OIQ F;  3I9V 2;  1HW1 A;  3WTS C;  1WJC A;  5LRR A;  1U78 A;  3CP8 A;  3KYL A;  2HQ5 A;  3FBN B;  1JKQ C;  2HOA A;  1CF7 B;  2XAU A;  3GLX A;  2KJC A;  3GTM J;  1BL0 A;  5CPR B;  2HVR A;  2LC2 A;  1JE8 A;  4K2E A;  3KZY A;  3HSE A;  1XSV A;  2LD5 A;  5EYR A;  3WG7 H;  3ZCO A;  1J2X A;  1VND A;  1QO0 D;  4N0B A;  2FQ4 A;  4D5C A;  2M4G A;  3K69 A;  4XIC A;  1KGS A;  2XV4 S;  5IY5 H;  3BG7 A;  3NQO A;  5B1A H;  3K10 A;  4WXC A;  1ZG1 A;  3WTV C;  3Q5F A;  3CLO A;  4KMF A;  3V7C A;  4YFN F;  3S17 J;  3G1O A;  2DFE A;  2ZME C;  3TBI A;  2HKX A;  2NS8 A;  4LK0 F;  2G0E A;  2DFI A;  3M8F A;  1DUX C;  3DBL B;  1G3T A;  4M9X A;  3BJ6 A;  3O2P E;  5HNH A;  2FUG 2;  3M7G A;  1MMG A;  3OIQ A;  4XQF A;  2ZKZ A;  4ANJ A;  1N77 A;  4OU0 A;  3D5R C;  1BW5 A;  2BY3 A;  2IAI A;  2HYF A;  2HXO A;  2STW A;  1TWC J;  5F64 A;  2CV0 A;  1V5F A;  4HNV A;  1Z7L A;  5CKT A;  3OYG A;  2CQ7 A;  3PQK A;  4AIK A;  4IQJ A;  4QIW N;  4P9U A;  1N78 A;  2QLZ A;  2PMH A;  1KU9 A;  1TT5 B;  3KET A;  4F55 A;  1FBQ A;  3GYH X;  3CF2 A;  3QPL A;  3CJN A;  5LLQ A;  4BHC A;  4ESB A;  4BHP A;  3ZQQ A;  3B6A A;  1X3Z B;  2F2E A;  2E36 A;  4M73 A;  1PYV A;  3ZN1 A;  2GLO A;  2JA7 J;  4G12 A;  5H2F C;  5B1B H;  1T95 A;  2JPB A;  2MG4 A;  1XCB A;  3OL4 A;  1RRJ A;  3I64 A;  2HDC A;  1UCR A;  3HOS A;  4OIO F;  4UXN A;  4BXU A;  1G3Y A;  5LHG A;  4W97 A;  5J8C A;  1E3H A;  3RJP A;  1S72 I;  3R60 A;  2RAE A;  3UKG A;  2NVT J;  4M6Y A;  2QZ8 A;  2QSH X;  1P7J A;  1TWG J;  4D5F A;  3BJO A;  3EUK L;  1W7P D;  1S5L C;  3RPU A;  5CYV A;  2Y9Y A;  1XMA A;  3KIO A;  2BXZ A;  1JI8 A;  3IRR A;  3WU1 B;  3DF8 A;  3ABK H;  2E34 A;  3J7Y J;  1RIO H;  2V26 A;  2DO7 A;  4XSX F;  1IO2 A;  4XNF A;  1LKX A;  4JX6 A;  3DU5 A;  4CHU A;  3D0S A;  4ENJ A;  3IWF A;  3S3N A;  4FT8 A;  1FBU A;  1JUM A;  2P81 A;  3KX2 A;  1SFE A;  1OQY A;  5EGO A;  4HSR A;  4FE4 A;  2IA2 A;  4UY8 I;  2L9N A;  1FMW A;  1WRJ A;  2EFO A;  2OPT A;  2HR3 A;  3HOZ J;  2X4H A;  4MQ9 F;  2ADU A;  2KDZ A;  2IGN A;  1R5H A;  3K70 D;  2Q2E A;  2OQG A;  2P8T A;  4QLC U;  1TWH J;  2DXI A;  2CW0 F;  2PMZ A;  2NRA C;  4X6A J;  2M4K A;  5TJJ A;  2JSP A;  5DV5 A;  1J09 A;  1B6A A;  1OCC H;  3FF5 A;  4F91 B;  2LG4 A;  4WX9 A;  3KP7 A;  4ZYD A;  1TZL A;  4OMZ A;  3VOE A;  1XGO A;  1RR8 C;  2CV1 A;  2QUF A;  3PM1 A;  2IEK A;  1MND A;  2VKE A;  1YJ9 I;  3V8J A;  1EF4 A;  1BA5 A;  2ZC2 A;  3LQQ A;  1XSX A;  4RGU A;  3OYI A;  1MBE A;  3BG6 A;  3J7A O;  1IRG A;  2VLA A;  4E70 A;  1P2F A;  4XKC A;  1BOB A;  3O8G A;  4M6X A;  1DP3 A;  1KQ8 A;  3GTQ J;  3R0A A;  5HVQ C;  4J01 A;  1WZ2 A;  4HRI A;  4L9T A;  1P92 A;  1D0Z A;  4MNU A;  3J80 K;  1M1E B;  2P5L C;  4EJW A;  1R49 A;  1FEX A;  5FKN A;  2ICW G;  4HZF A;  3H3Z A;  3W6K B;  1ZLK A;  1YOV B;  1Z7U A;  2L0K A;  3ECO A;  3KFW X;  5JHF A;  2BHZ A;  2OV7 A;  3GVA A;  4IQ4 A;  2WV1 A;  5DM6 F;  1VZ0 A;  3OY9 A;  2O5R A;  3OS1 A;  3IH3 A;  2N8G A;  1OIS A;  2VON A;  5GAH J;  3HSR A;  3ZMS A;  5L3F A;  1DPU A;  1X1D A;  4DGW B;  2CU7 A;  5JLX A;  4XL9 A;  3C2H A;  1K6Y A;  2DCE A;  4HDV A;  2E35 A;  5IOY A;  3J7Z I;  2AS5 F;  2MA3 A;  1GVD A;  1D8J A;  5M3F J;  4B3A A;  4D1Q A;  4H0E A;  4KIS A;  1S7A A;  5HS8 A;  3GTJ J;  2F5V A;  1K7A A;  3GCM A;  2GM4 A;  2PJR B;  4BJ6 C;  3GFJ A;  5ILU A;  3JRD A;  2KZV A;  4XN0 A;  3ZQ7 A;  3KEQ A;  4JQF A;  1UZC A;  1XMX A;  4MO7 A;  2K3F A;  1LVK A;  1R7J A;  4QWQ A;  3IAS 2;  5GAD J;  3COA C;  2DYR H;  2M30 A;  2WAF A;  4B09 A;  3A01 A;  1W5C C;  3AG2 H;  5J6X A;  3B02 A;  1A04 A;  3RPQ A;  2TDX A;  3F0C A;  3BR6 A;  5C3E J;  1MDM B;  1H9G A;  1YQA A;  1J9I A;  1QU3 A;  3LSH A;  3LSG A;  1ODD A;  3VEP A;  1DDN A;  1EH8 A;  4CYD A;  2X1C A;  1HKT A;  2LKP A;  2FSW A;  1FSH A;  3S14 J;  5JLW A;  2PQ8 A;  2E5Z A;  1G3S A;  3G3Z A;  4RA2 A;  2MFZ A;  1U0J A;  2A3S A;  3NAR A;  3BOQ A;  3C18 A;  3A0B C;  1WH5 A;  2EIN H;  1B72 A;  5H20 A;  1Y39 A;  2VOD A;  2V7F A;  5L3C A;  4M3E A;  5A2Q Z;  2V1U A;  1IN5 A;  1LEB A;  2W7N A;  2DMU A;  2NVU B;  1T39 A;  4ESJ A;  4A0X A;  4A0Z A;  5BQT A;  4HX7 A;  5DD8 A;  3WE3 A;  3E6B A;  2PEX A;  5KK1 A;  2HPI A;  2OJE D;  2KDO A;  1UHS A;  3ZMZ A;  1W0T A;  1ZTR A;  2CWE A;  3E6M A;  1UB9 A;  1T8I A;  1MJA A;  1WHU A;  2AHQ A;  2XB5 A;  4EM2 A;  5HDK A;  1LFU P;  1XB4 A;  3UNG C;  3QU6 A;  4FE7 A;  4D9J A;  3K1P A;  3K4B A;  1W5S A;  1YW7 A;  1KU3 A;  3F8M A;  1DU0 A;  3AG1 H;  3LFK A;  2DQR A;  1Z77 A;  4I01 A;  3WTW C;  4D7M A;  2E7X A;  3HKZ A;  4AVP A;  1PP7 U;  3HOV J;  3E6D A;  1QVU A;  1R5I D;  4ZC3 A;  2YUS A;  2VE8 A;  1XN7 A;  4ZZD A;  4BAC A;  1E3O C;  3OYJ A;  1X1B A;  3ZP5 A;  1TNS A;  1EJ9 A;  4XLE A;  3CQZ J;  1EKE A;  4UUV A;  5LHH A;  1WI9 A;  4EMS A;  2XGX A;  2QQB A;  5L3G A;  3VOD A;  1PUE E;  1R22 A;  2VQG A;  3BCB A;  4GDF A;  2L7M P;  2IGK A;  1XG1 A;  4RBO A;  1V5G A;  2E1M B;  3KEO A;  3NAU A;  3I3L A;  3H1C A;  4IHS A;  3F23 A;  2BY0 A;  4ON0 A;  3FKI J;  2M1B A;  3CDL A;  2M0M A;  2EIL H;  4L5E A;  3BTJ A;  1TQP A;  3DQV C;  3CES A;  3P9I A;  2XB0 X;  1IG7 A;  2KJB A;  1IC8 A;  1JUS A;  2QWW A;  4B4C A;  1WGX A;  4Y17 A;  2XGD A;  5F04 A;  3ZPL A;  3ERM A;  1R36 A;  4XK4 A;  2FNA A;  1PUF A;  4EGY A;  1E2X A;  1MH4 A;  1GV5 A;  2LKX A;  5ICF A;  3SDG A;  4J00 A;  1MSE C;  5CVR A;  4YIR X;  3P9C A;  3ZN0 A;  2F5C A;  4X1E A;  1Z67 A;  1T6S A;  3CJQ B;  3O8H A;  5FGM A;  3OSG A;  1KYW A;  2AXL A;  2KIS A;  1UG0 A;  3K4M A;  3V8K A;  3MZY A;  2F4I A;  3SEZ A;  3OYN A;  2L4M A;  2CJJ A;  3LMM A;  4GCV A;  3F72 A;  1OCT C;  4E7Z A;  2VBZ A;  2FNP A;  4FHT A;  4HST A;  4E7K A;  1MIJ A;  3GUD A;  4UV9 A;  1SD6 A;  2ACJ A;  1CF7 A;  1J5Y A;  2W1O A;  3OYF A;  5EEA A;  3FK7 A;  2ELH A;  1HCR A;  4LLL A;  3OYB A;  3MVP A;  1Y0U A;  2H94 A;  2XGE A;  3IP4 B;  3GME A;  3CF5 F;  4L9J A;  2LMD A;  3CCU I;  1IAW A;  2F4M B;  1L3L A;  1ACI A;  1ERD A;  5GPA A;  3A0H C;  3QP5 A;  4MEX F;  4HG2 A;  3P9K A;  2GBY A;  3RDI A;  3BTI A;  1P4W A;  3DLL F;  2WAE A;  2JZY A;  1D1B A;  3IV5 A;  1YW9 A;  1ITY A;  5F0F A;  4I98 B;  1NK3 P;  3WHB A;  2BYV E;  3SZP A;  2QKM B;  4XM3 A;  3E97 A;  5F1J A;  5D5V B;  2K02 A;  1MNE A;  2RRE A;  4BH9 A;  4AVZ A;  1CQT A;  4QPQ A;  2MW8 A;  4BUP A;  1SEU A;  3HJE A;  3TP0 A;  2K40 A;  4UV8 A;  1BI2 A;  4FIS A;  1LB2 A;  3SEQ A;  1S7E A;  3BDD A;  1BC7 C;  2R5Y B;  2ZSH B;  3HRU A;  1EV7 A;  1V3F A;  1HSJ A;  2PBI A;  5ICE A;  2WY7 Q;  3SZT A;  3MKY B;  1OYY A;  1NK2 P;  4XN3 A;  2JVG A;  2QA4 I;  2XRL A;  3CUO A;  2DA1 A;  4WCG A;  2HOS A;  5DD4 A;  1T56 A;  2M3A A;  2DA3 A;  2HNH A;  4AYB N;  2A5Y B;  4D7N A;  2VBX A;  3JRE A;  4CXF A;  3GZ6 A;  4KYW A;  3G1L A;  3ABL H;  4Y52 J;  4C9Y A;  3FHZ A;  1OFC X;  3L09 A;  4M9S A;  2X0L A;  1QZZ A;  3D1N I;  4LMY A;  1X3U A;  1ZH5 A;  2ZXW H;  2H6C A;  3MN2 A;  3OMY A;  3FIW A;  1LE8 B;  1G3W A;  2E1C A;  3R4K A;  4A6E A;  3PO2 J;  4L9V A;  3V7R A;  5DCM A;  4RLQ A;  1TP4 A;  4M71 A;  3K70 C;  3KEY A;  2UXN A;  4GYI A;  4M72 A;  4NHJ A;  2R92 J;  3RYP A;  4FQG A;  1IXS B;  3LSM A;  4LLG F;  3Q9S A;  3H9G A;  1B8I A;  1YW8 A;  3F6V A;  5M5W J;  2XKP A;  2ZJ2 A;  1SC7 A;  2K3P A;  4FCY A;  1R6R A;  2MAB A;  3VYR B;  3MKL A;  3U9G A;  1YS7 A;  5AIP A;  2BY2 A;  2CS3 A;  4LK1 F;  4PDK A;  3FXJ A;  2XF5 A;  5FKL A;  3KCC A;  3CO6 C;  2NVY J;  2VXD A;  3LL7 A;  3BQZ A;  4UVB A;  3OR1 C;  5AON A;  4PFO A;  4A2U A;  1FJL A;  1P4A A;  2TRT A;  5C4J J;  4BU2 A;  3HOY J;  2LR8 A;  2G7H A;  1WJD A;  2VJ5 A;  5C4X J;  2W4S A;  4I99 C;  2ZB9 A;  3ZR8 X;  3BZK A;  3J81 K;  1YYV A;  4HQE A;  4EQQ A;  2R7T A;  4E6K G;  3ASN H;  2JQ7 A;  5FRO A;  4BBR J;  4IHX A;  1S8N A;  3G1M A;  3IL2 A;  1HDD C;  1U8R A;  1Y0N A;  2HGC A;  4HF2 A;  2E5N A;  5H6Q A;  5KVR A;  4HEA 2;  1WJ5 A;  3EYY A;  1JTX A;  5B66 C;  1IUF A;  2JN6 A;  2JT1 A;  4U87 A;  4FET A;  2ISZ A;  2CUF A;  1R5G A;  1S3J A;  4G6T B;  3GLL A;  5HNF A;  2D5V A;  3FM3 A;  1Q1V A;  3KZI C;  4IX7 A;  3CJT B;  2JA6 J;  2CO5 A;  3IHU A;  3M1C A;  1K61 A;  1FYK A;  3H5R A;  1O3T A;  2L7K A;  4UVC A;  3K4K A;  5EJC A;  3LSI A;  3AG4 H;  1X1C A;  1P6R A;  2EFP A;  4S05 A;  3R61 A;  1X4O A;  3H9J A;  2NS0 A;  1G4D A;  2H1K A;  2GQQ A;  1O3Q A;  3EYI A;  2JA2 A;  3K4L A;  3FIS A;  5E1W A;  2Q1Z B;  3WGI A;  3RCO A;  3I59 B;  2E2H J;  4NQW B;  2A6E F;  2ELK A;  1MBG A;  1D1A A;  3CDI A;  2I10 A;  2XF7 A;  2E7W A;  2DI3 A;  4LFU A;  1QPI A;  4WXH A;  5EF6 A;  4P9F A;  5IP9 J;  4A3F J;  2DT7 B;  4U7D A;  3BP8 A;  4ZYG A;  2R7U A;  3ISP A;  1OLT A;  2VE9 A;  1LDJ A;  4UUS B;  2F5D A;  3DU6 A;  3VPR A;  5E20 A;  1REP C;  1PUF B;  1NHA A;  3AG3 H;  3NWT A;  4PFP A;  1FLI A;  2YX4 A;  1V4R A;  5FKK A;  5E8G A;  4ABZ A;  4A3M J;  3S15 J;  2V1X A;  2EFQ A;  4F92 B;  3DTK A;  1S7O A;  3RKX A;  5HLH A;  1IV6 A;  1G6N A;  2L9R A;  5M5X J;  3OYE A;  2Y9Z A;  3HL2 A;  2PJR A;  1NG7 A;  5E8I A;  1OCP A;  2R7F A;  3S2D J;  3CCS I;  4MFE A;  2VKV A;  3R6S A;  2IS4 A;  1R1U A;  1O57 A;  2FBI A;  1PVE A;  1H9T A;  4S04 A;  1YIT I;  4HF0 A;  2FE3 A;  4ZTF A;  2IVM A;  1IW7 F;  2K9Q A;  2CFX A;  5JI6 A;  1FBS A;  3CDH A;  2DOF A;  3OIO A;  3ZQI A;  1DGW Y;  3GWZ A;  2XRN A;  2LKS A;  2XHK A;  4LIV A;  1W36 D;  1A31 A;  1MDM A;  1TNT A;  4GO1 A;  2K9S A;  2X85 A;  3KP3 A;  3EPZ A;  3OV8 A;  3S16 J;  2FX0 A;  2VJI A;  4ETS A;  3OOU A;  4EJU A;  3ECH A;  2H8W A;  1B9M A;  4RM3 A;  5K5Q A;  3MFK A;  4N4O B;  1P9Q C;  2DU9 A;  1LDD A;  3CZ6 A;  1GDT A;  4OWR B;  3JSO A;  1G2H A;  1I3Q J;  2FQ3 A;  2E2J J;  3DTE A;  2ID6 A;  3L2C A;  4UUT A;  3Q9V A;  5GP9 A;  4Y7N J;  2VI6 A;  5DUK A;  4BHB A;  4G7H F;  2WAQ A;  3WU2 C;  4EGZ A;  1O7F A;  4BY1 J;  1HF0 A;  3V7S A;  2B7E A;  2M5W A;  2DMN A;  3GW2 A;  2DDB A;  3DKW A;  2PJP A;  4N4N B;  3HTU A;  3W2A A;  1T2K A;  1LUJ B;  2L4A A;  4A3D J;  3BR1 A;  4DZJ A;  5CVV A;  3K0L A;  1UG2 A;  3DCF A;  1BBY A;  3S3O A;  2L9S A;  3C1D A;  3GF2 A;  3Q0U A;  3AFH A;  5H6R A;  4LB6 B;  2PMZ N;  4BJ5 C;  1SAX A;  3PSF A;  1W5T A;  4BKX A;  2ELJ A;  2E1M C;  1ONV A;  1RES A;  2LY2 A;  1OMI A;  4II2 A;  4V2G A;  4RAG A;  4IHT A;  1XMK A;  2L54 A;  3BWG A;  1Y6I A;  2XSJ C;  3PO3 J;  3JSP A;  4C2T A;  3FMR A;  3FXQ A;  4PK4 A;  3ERE D;  3S1Q J;  1P4X A;  3DEE A;  3OWT A;  3RKQ A;  1Z6R A;  1QVT A;  6PAX A;  4WK8 F;  1Z0X A;  5HOD A;  1S9H A;  1H0M A;  3QOP A;  1K6O A;  1FOX A;  5BS6 A;  2GA1 A;  5DCM B;  3HPH A;  2BVL A;  2EWN A;  4CUG A;  2M2E A;  2EIK H;  3HUG B;  1LJ9 A;  3OYA A;  4B44 A;  3OS0 A;  4DYR A;  2CQN A;  1FTZ A;  1B8I B;  4L18 B;  4JP0 A;  2CSO A;  3IUO A;  1O3R A;  1IXR C;  1MZB A;  2K4B A;  4MIM A;  1Z9C A;  3F6O A;  5M5Y J;  2QVO A;  1K4T A;  2KRC A;  2JRT A;  1OYI A;  3K1N A;  3SFI A;  4YFX F;  2NS7 A;  5JVG F;  5K5O A;  1IN8 A;  4IEJ A;  4A3J J;  3T5X A;  2EV6 A;  5HOO A;  4RAF A;  1ETO A;  3JAM K;  1K4S A;  1I5Z A;  3A4C A;  2GXB A;  3PJR A;  2W25 A;  2F6C A;  2EZK A;  4FX0 A;  2AQE A;  2LY9 A;  2HXI A;  1MMA A;  4MTE A;  3PNV A;  1HKQ A;  2XKO A;  1VQO I;  2P5V A;  1A36 A;  1TW2 A;  2KQR A;  5TIS C;  5BNG A;  2IBD A;  4Y13 A;  1U9O A;  1V54 H;  3GTL J;  3MEX A;  1YFH A;  2HWV A;  3D5S C;  4A3L J;  3ZQC A;  3VYS B;  3JRH A;  3ELK A;  4ZDP A;  1ZEL A;  4ENN A;  3SHF A;  5HLG A;  2F48 A;  2HEO A;  1UEL B;  5IT9 Z;  4DZP A;  3A1Y A;  4NC6 A;  2VOP A;  2KP6 A;  3WE2 A;  4GRI A;  2KL4 A;  3BLY A;  4Z6Y A;  2VIX A;  4WF2 A;  1IRF A;  2K4J A;  1MBJ A;  4ITV A;  2JUG A;  2CYY A;  3KP2 A;  2UZK A;  1J75 A;  4XKV A;  2P7C B;  3PFI A;  4OOI A;  2P6T A;  3ABT A;  2BOL A;  3TED A;  1SVO A;  2DK8 A;  2UV1 A;  4PUS A;  2VT3 A;  5FLX K;  2DMP A;  4ENM A;  2VJJ A;  3TDZ C;  4IL6 C;  4EEF G;  4XR6 A;  2XIG A;  4E7I A;  3DXJ F;  3K4N A;  1TQM A;  4LOC A;  4CO8 A;  4GXO A;  1ETY A;  3QOD A;  2M8G X;  4HOB A;  2YU3 A;  1NG6 A;  1D1C A;  3LSJ A;  2X1D A;  1BI1 A;  1RI7 A;  3FWE A;  2QF7 A;  5FD5 A;  3GX4 X;  1TBX A;  1BR2 A;  1G8X A;  2HQA A;  3REO A;  3BG9 A;  3OYL A;  3LA2 A;  1XC5 A;  3CCE I;  1TW3 A;  5JHU A;  4RAY A;  4P5O A;  1Z6T A;  1BJA A;  2OZ6 A;  2ZXI A;  3HM5 A;  4YG2 F;  5B5E C;  2R5Y A;  4I02 A;  2KMU A;  1VQM I;  3BRO A;  3KP5 A;  4OAZ A;  5LBQ A;  3M07 A;  3KE2 A;  1OPC A;  3HYI A;  4B48 A;  2DT6 A;  2WB1 A;  4KDP A;  1ULY A;  3WU0 A;  3VSK A;  2LDU A;  3WTZ A;  5F6F A;  1KQ9 A;  3LST A;  1SVM A;  2DPD A;  2QKL B;  4KN7 X;  3PQJ A;  2Z1D A;  5EEG A;  1RC9 A;  5FLM J;  3TDU C;  3C2G A;  1BC8 C;  2QSF X;  1QNT A;  4N9I A;  3S8P A;  2VPR A;  1BIB A;  5IT3 A;  2VKH A;  2RQP A;  2DFF A;  4JX4 A;  3HKZ N;  2HPM A;  2KIQ A;  2GIZ A;  1UHM A;  4E7H A;  4Z2Y A;  5JFR A;  2A5W A;  4IOC F;  5HS9 A;  3EET A;  2IA0 A;  2XDV A;  5LGT A;  1GV2 A;  4OMY A;  3JRG A;  3LSP A;  1PDN C;  1LE8 A;  2XPU A;  5HDG A;  3HGG A;  1ON1 A;  2HZT A;  2R93 J;  4AID A;  1TQI A;  3K2A A;  2RKH A;  3F8F A;  3IKV A;  2X51 A;  1YJN I;  5GPC A;  2STT A;  4ESF A;  3V42 A;  1ZG5 A;  4KNY A;  1JJ8 C;  1ZR4 A;  1R58 A;  4CCJ A;  3TO9 A;  1MBF A;  2FD5 A;  4KJZ A;  2GXA A;  2DPU A;  3TO7 A;  1MNM C;  2LBF B;  3QOE A;  4MQV A;  4ZTJ A;  2Z33 A;  2FML A;  4B47 A;  1UAA A;  2WC2 A;  3I4P A;  2R7V A;  3JTH A;  1X1P A;  3W2W A;  5E1X A;  3L7W A;  1KA8 A;  3ASO H;  3GXO A;  3TMO A;  5JR3 A;  3GFI A;  2V6E A;  1ETQ A;  4A3I J;  2R7X A;  5BPI A;  2HZD A;  5HLI A;  1R1T A;  2HOE A;  5L3B A;  4KT6 A;  3ABU A;  2O3F A;  3HXL A;  2XC7 A;  2XAH A;  2ZJR F;  1XS9 A;  3K6G A;  1DPR A;  1VQ8 I;  4IOA F;  4HV5 A;  4XKB A;  1AWC A;  5J3L A;  5F1R A;  1LFB A;  2LVS A;  2YU9 J;  1BI0 A;  1O4X A;  3HEF A;  2Z9O A;  1RET A;  2ZCW A;  1AA7 A;  4KIT B;  2HFH A;  1ZRF A;  3BG3 A;  4KIG A;  3QWL A;  3LA7 A;  5IP7 J;  3CCR I;  5D5U B;  3AL0 C;  2ME0 A;  4HPQ A;  1XDS A;  4EJT A;  1SD7 A;  2HQN A;  4O5V A;  4B1R A;  4V2F A;  3WG9 A;  4HA8 A;  1I6H J;  1I3A A;  3U1K A;  2LFB A;  3QYF A;  1F9N A;  1Q1H A;  2WWY A;  3CCM I;  1YX3 A;  1MJ9 A;  3LWF A;  4I76 A;  2UUZ A;  2XAG A;  2DA4 A;  1NTC A;  1EH7 A;  2BBY A;  3BJA A;  5M3M J;  4PJ0 C;  4B3X A;  1GXQ A;  2R5Z B;  2NVQ J;  3TGN A;  2K5C A;  1X1A A;  1QQI A;  3PNT A;  1TL8 A;  4UB6 C;  4G7O F;  1VQP I;  1T33 A;  4XSZ F;  3SZG A;  2H09 A;  2FMY A;  1C0W A;  1UJ8 A;  1IF1 A;  4IHY A;  1POG A;  3I59 A;  3RIR A;  4NQW A;  1OKR A;  3L1P A;  2W00 A;  3QYB A;  3LNQ A;  1I1G A;  4O3M A;  2R7Q A;  3RQ4 A;  4KIF A;  1D5Y A;  2Z2S B;  1YE9 A;  1S6L A;  1BOA A;  5FFX A;  4A3B J;  4MGR A;  1GHC A;  4IVN A;  1W36 C;  3H36 A;  1QZY A;  4Q5S F;  5LGU A;  3CLQ A;  2ZXH A;  4UUS A;  3HHG A;  2M87 A;  2A68 F;  4PGG A;  3FXK A; 
#chains in the Genus database with same CATH homology
 4DYC A;  2FJ1 A;  1FJL A;  3S17 J;  5C4J J;  2TRT A;  3G1O A;  3HOY J;  2LR8 A;  1HOM A;  2NS8 A;  4CYC A;  2G0E A;  4A93 J;  2Y31 A;  5C4X J;  2ZB9 A;  2CQX A;  2ECC A;  5IYC J;  5FLV A;  3S1N J;  1TWA J;  3M3Y J;  2EZH A;  4BBR J;  2K9N A;  4IHX A;  1BW5 A;  2IAI A;  3G1M A;  3RQI A;  1HDD C;  2HXO A;  5IYD J;  1TWC J;  3LOC A;  5E3M A;  4HNV A;  4S0H B;  4XRS G;  1JTX A;  3CCY A;  1IUF A;  2JN6 A;  4QIW N;  2CUF A;  1FIP A;  1VI0 A;  3QPL A;  2D5V A;  1Q1V A;  2JA6 J;  1JGG A;  3B6A A;  1ZKG A;  1K61 A;  1R9T J;  2GLO A;  5J1Y A;  3Q0W A;  5FJ8 J;  2JA7 J;  4G12 A;  4XID A;  2MG4 A;  5F08 A;  3BR5 A;  1F43 A;  4W97 A;  2H1K A;  1ZGW A;  1Y1V J;  2CUE A;  2KT0 A;  3FIS A;  2RAE A;  3UKG A;  2NVT J;  2E2H J;  5EZG A;  2ELK A;  3JRC A;  1MBG A;  1P7J A;  1TWG J;  4D5F A;  1A6I A;  2I10 A;  1QPI A;  5EF6 A;  2Y9Y A;  2HYJ A;  1MSF C;  5IP9 J;  3K7A J;  4A3F J;  4JX6 A;  1RKW A;  9ANT A;  4UUS B;  2L7F P;  2YS9 A;  3VPR A;  3GTK J;  1JKR C;  1JUM A;  2P81 A;  2DJN A;  1PUF B;  5EGO A;  4A3M J;  3IH2 A;  5FKK A;  4ABZ A;  3S15 J;  4CYC B;  4FE4 A;  3JRF A;  2O7O A;  2DA5 A;  1ENH A;  4M3F A;  2OPT A;  3HOZ J;  1IV6 A;  1DU6 A;  2KDZ A;  2L9R A;  5M5X J;  2Y9Z A;  4A3E J;  1JTY A;  1OCP A;  3S2D J;  1Y1W J;  4MFE A;  1TWH J;  2VKV A;  1GT0 C;  3S1M J;  2HI3 A;  4X6A J;  2EQR A;  3W6V A;  3BQY A;  2K9Q A;  3H3V K;  2Y0S N;  3OIO A;  3ZQI A;  4DW6 A;  3JR9 A;  1AKH A;  2E19 A;  1IGN A;  3PM1 A;  2IEK A;  1GUU A;  1QRY A;  1BJZ A;  2VKE A;  2W48 A;  3GTO J;  1EF4 A;  2ME6 A;  1BA5 A;  3C2B A;  2K9S A;  1F36 A;  2XPV A;  3S16 J;  2FX0 A;  1MBE A;  4XRS A;  3HB9 A;  4NDL A;  3ZQL A;  3OOU A;  1K83 J;  1MBH A;  1WCM J;  3O8G A;  1H8A C;  3GTQ J;  1GDT A;  1G2H A;  1I3Q J;  3I4N J;  3SJM A;  2MSY A;  2R7Z J;  2E2J J;  2ID6 A;  5F0C A;  1MH3 A;  4UUT A;  5EG0 A;  5K7H A;  4A3G J;  5GP9 A;  1FEX A;  5EDN A;  4Y7N J;  5FKN A;  5C44 J;  2VI6 A;  2DTZ A;  3WHC A;  2ECB A;  2L0K A;  2DMT A;  1IJW C;  4BY1 J;  1HF0 A;  2WV1 A;  1SAN A;  1ZQ3 P;  3TP3 A;  2DMN A;  3IH3 A;  2N8G A;  1WPK A;  4A3D J;  3BR1 A;  4DZJ A;  5DS9 A;  1UG2 A;  3DCF A;  2CU7 A;  2L7Z A;  4C3I J;  5JLX A;  5E3N A;  3Q0U A;  3A03 A;  3BR0 A;  3ZQG A;  2M34 A;  3E7L A;  3HDD A;  2PMZ N;  5IOY A;  4J19 A;  1JJ6 C;  1GVD A;  2X6O A;  3BTC A;  5M3F J;  3Q3S A;  4B3A A;  5EGO B;  1X2M A;  4BKX A;  2X48 A;  1RES A;  1VF9 A;  3GTJ J;  4V2G A;  5K7Z A;  4MLO A;  2GM4 A;  2E2I J;  1AHD P;  1RR7 A;  3PO3 J;  3JRD A;  3Q0V A;  2H8R A;  1HDP A;  3S1Q J;  3RKQ A;  3BG5 A;  1QVT A;  4MO7 A;  2XSD C;  2AO9 A;  3B6C A;  1Z0X A;  5HOD A;  3OSF A;  1ETV A;  2DMQ A;  4JYK A;  3A01 A;  1VFC A;  2M2E A;  1AKH B;  3F0C A;  3BR6 A;  4IHW A;  1WI3 A;  1JKP C;  5C3E J;  3BR2 A;  3FK6 A;  4DYR A;  3HBL A;  3LSG A;  1FTZ A;  1B8I B;  3DEW A;  4JP0 A;  2WAQ N;  1ZK8 A;  4XRM A;  4MIM A;  5M5Y J;  3S14 J;  5JLW A;  3SFI A;  2NS7 A;  3HGY A;  3NAR A;  4IEJ A;  4A3J J;  3GBG A;  1WH5 A;  2X9D A;  1B72 A;  1ETO A;  4M3E A;  2CQQ A;  3JRB A;  2EZK A;  2LY9 A;  1ORK A;  1A5J A;  2DMU A;  2HXI A;  3HOW J;  1YRN A;  5BNG A;  2IBD A;  1U9O A;  4JX5 A;  2JWT A;  1UHS A;  1W0T A;  1ZTR A;  3GTL J;  2JA5 J;  1MBK A;  4A3L J;  2AHQ A;  2XB5 A;  3ZQC A;  3JRH A;  1LFU P;  1ZR2 A;  1IDY A;  3TW6 A;  4FE7 A;  4DZP A;  1UMQ A;  3GTG J;  2XPW A;  1DU0 A;  3ZQH A;  1TC3 C;  3RZO J;  1Z77 A;  4A3K J;  4GFB A;  4D7M A;  1WH7 A;  3HOV J;  1QVU A;  1MBJ A;  2YUS A;  2E1O A;  1E3O C;  5F0H A;  2EH3 A;  2XGC A;  2DA2 A;  3CQZ J;  1JKO C;  3TED A;  4BY7 J;  1APL C;  4AUX A;  4AC0 A;  2DMP A;  5E3L A;  4EEF G;  3A01 B;  4LOC A;  3ZQF A;  2LLK A;  1ETY A;  2L7M P;  1P7I A;  2LK2 A;  1XG1 A;  2M8G X;  4RBO A;  3NAU A;  3LSJ A;  3M4O J;  2QF7 A;  2JJ7 A;  5DTD A;  4M3B A;  4M6V A;  3BG9 A;  3CDL A;  3FKI J;  3A02 A;  5J1R A;  3RZD J;  1W0U A;  1XC5 A;  4L5E A;  3BTJ A;  2EZL A;  2XB0 X;  1IG7 A;  3HM5 A;  2HDD A;  2R5Y A;  3TW7 A;  1IC8 A;  3ZOB A;  1B72 B;  1JUS A;  4RDU A;  1ETX A;  4B4C A;  1WGX A;  5F04 A;  2XGD A;  5IYB J;  1I50 J;  4XK4 A;  1PUF A;  3QQA A;  1MH4 A;  1GV5 A;  5FLM J;  4M3D A;  2LKX A;  3SDG A;  2VUM J;  1MSE C;  2JMW A;  1YRN B;  2VPR A;  3JRA A;  2Y30 A;  4JX4 A;  3HKZ N;  4X1E A;  1FTT A;  3S2H J;  3O8H A;  2EZI A;  3OSG A;  2R0Q C;  4C3H J;  4I6Z A;  4BXX J;  1GV2 A;  3JRG A;  3LSP A;  2CJJ A;  1LE8 A;  2XPU A;  2R5Z A;  1RKT A;  5K7F A;  1OCT C;  3HGG A;  1RPW A;  1JT0 A;  2R93 J;  1FIA A;  3H0G J;  3K2A A;  1OJL A;  3S1R J;  5FKM A;  2LP0 A;  5IP6 A;  2M0C A;  5GPC A;  4MFD A;  5IOZ A;  3IH4 A;  4A69 C;  5EEA A;  1JJ8 C;  4QSH A;  3FK7 A;  1ZR4 A;  1JUP A;  4QTR A;  1HLV A;  1HCR A;  1MBF A;  3MVP A;  3JRI A;  1TWF J;  2FD5 A;  1X2N A;  3GTP J;  2O8K A;  2XGE A;  1IRZ A;  3LSR A;  4DYQ A;  5GPA A;  1MNM C;  2DA7 A;  2O9L A;  5EZH A;  2GBY A;  1X58 A;  3BTI A;  5EG0 B;  2NOG A;  3IV5 A;  1ITY A;  5FKO A;  2EBI A;  2WB1 N;  5F0F A;  1NK3 P;  2DA6 A;  3WHB A;  1ETQ A;  4A3I J;  4W1U A;  5F1J A;  4M3G A;  1CQT A;  2MW8 A;  3TP0 A;  2K40 A;  3HOX J;  1ETK A;  2QCO A;  4FIS A;  1XS9 A;  2OF7 A;  1S7E A;  1U9N A;  5J3L A;  2R5Y B;  1LFB A;  1ETW A;  1AU7 A;  2LVS A;  2YU9 J;  1O4X A;  3HEF A;  1RET A;  2B63 J;  1NK2 P;  3BG3 A;  5IPA A;  4A3C J;  5IP7 J;  4C3J J;  3I4M J;  2ME0 A;  2XRL A;  2CRG A;  2DA1 A;  2HOS A;  1T56 A;  2DA3 A;  4B1R A;  4V2F A;  4AYB N;  4D7N A;  1H88 C;  3JRE A;  1U8B A;  1I6H J;  3G1L A;  2LFB A;  2DN0 A;  2Y2Z A;  4C2M J;  1SFO J;  4Y52 J;  2TCT A;  2ID3 A;  3BTL A;  5E3O A;  1OFC X;  4IHV A;  3CMY A;  2MGQ A;  3BT9 A;  4FTH A;  4I76 A;  2COB A;  3BR3 A;  3QPS A;  3D1N I;  2DA4 A;  1NTC A;  5M3M J;  1H89 C;  3MN2 A;  3FIW A;  1LE8 B;  2R5Z B;  2NVQ J;  1U78 A;  3PO2 J;  2HQ5 A;  5F27 A;  1T33 A;  1JKQ C;  2HOA A;  2R92 J;  3HOU J;  4BBS J;  2JK3 A;  4IHY A;  1JT6 A;  1POG A;  3GTM J;  1B8I A;  1BL0 A;  2LTP A;  2JA8 J;  3L1P A;  5M5W J;  3LNQ A;  1IDZ A;  4FCY A;  1D5Y A;  2NVX J;  2LD5 A;  3MKL A;  5EYR A;  1VND A;  2M9H A;  5J1U A;  4A3B J;  2FQ4 A;  4D5C A;  4XIC A;  5FKL A;  1BW6 A;  4UUS A;  2NVY J;  2HOT A;  3BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...