4XRSA

Heterodimeric complex of transcription factors meis1 and dlx3 on specific dna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)-3')
total genus 8
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrsA00
1RR7A 2Y30A 2KT0A 5IP9J 2LK2A 1FEXA 2E2IJ 1ZKGA 2AO9A 1IV6A 3JRGA 1A5JA 2Y2ZA 1Y1VJ 3JRDA 4A93J 1QRYA 2CJJA 3ZQGA 3JRAA 1FIAA 1B72A 1JTYA 2IAIA 2DJNA 2CQXA 2RAEA 1ZR4A 1UMQA 5M3FJ 2FX0A 2L7MP 1MSFC 4IHVA 1H8AC 4Y52J 1BJZA 5IP7J 1MBKA 4IHXA 3GBGA 1R9TJ 3FKIJ 2ID3A 1U8BA 1TWFJ 5K7FA 4FISA 3FK7A 2ELKA 5M5XJ 3S1QJ 5IOZA 1WI3A 3ZQCA 5C3EJ 1JUMA 2X9DA 5IPAA 3H0GJ 4X1EA 1ZR2A 1HF0A 2TCTA 2XB5A 4DYQA 1MSEC 1GDTA 3JREA 3LOCA 4XRSG 4BKXA 1JUPA 3LSJA 1OCPA 1T33A 3S15J 5IYBJ 1MNMC 5F04A 5EF6A 1AHDP 4M3GA 2NOGA 3TP0A 1TC3C 1ETOA 1Q1VA 1JJ6C 2CRGA 2DA7A 1ETXA 2HOTA 2H1KA 2K40A 3Q0UA 2O8KA 2R5YB 3PM1A 2N8GA 2FD5A 2DMQA 4B4CA 2K9QA 3H3VK 2IBDA 3GTQJ 1W0TA 3HOWJ 1RKWA 2DN0A 3S1NJ 4IHWA 4D7NA 3BQZA 2VI6A 4RBOA 2MW8A 4IHYA 3M4OJ 2GBYA 2W48A 4BXXJ 1FTTA 4C3JJ 5C4JJ 4AYBN 5K7HA 2HXIA 3IH4A 2FQ4A 1H89C 2LR8A 1ZK8A 3OIOA 1AKHB 1MBJA 2QCOA 4AC0A 3O8GA 2LTPA 1ENHA 3JRIA 4X6AJ 2DMNA 1FTZA 3ZOBA 1ZTRA 2R5ZB 3RZOJ 2YU9J 4JP0A 4M3FA 1RKTA 2VPRA 2ECBA 4MIMA 3ZQIA 4BBSJ 5J1UA 2O9LA 1H88C 1I50J 2R7ZJ 4FE7A 5EG0A 2DMUA 2L7FP 5J1RA 5M3MJ 1OJLA 3G1MA 1IDYA 1MBFA 1WH7A 4XK4A 4M6VA 3OOUA 2ME6A 4D5CA 1P7IA 3C2BA 4QIWN 5J3LA 3FK6A 3HDDA 1XG1A 1X2NA 2Y9ZA 4FCYA 2LY9A 4GFBA 1K83J 3HGGA 2DA3A 4V2GA 2TRTA 4UUTA 1D5YA 4A3GJ 5FKKA 1CQTA 5JLXA 5IOYA 2XPUA 5JLWA 4I6ZA 2JK3A 5C44J 3G1LA 1RESA 3IH2A 4A3BJ 1B8IB 2ME0A 3MN2A 3BQYA 1Y1WJ 3CMYA 1TWCJ 4Y7NJ 2JMWA 4A3FJ 3BTJA 3CCYA 3F0CA 1U9OA 1DU6A 5FKNA 1JKOC 4MLOA 5F27A 4XICA 2YUSA 2JA7J 2LKXA 2X6OA 1IDZA 4QTRA 2WV1A 3QPLA 1UG2A 1XC5A 1BA5A 2Y0SN 2HYJA 2M8GX 4UUSA 1W0UA 4DZPA 2E19A 2E2HJ 4JX4A 5E3NA 1IGNA 1ETQA 3QQAA 4A3DJ 5FLMJ 3OSFA 1JUSA 1HDPA 2DTZA 5BNGA 4A3EJ 3BR5A 3PO2J 3B6AA 4JX6A 3JRBA 3NARA 1K61A 5IYDJ 3S17J 3TW7A 4DW6A 2O7OA 1LFBA 2L7ZA 1TWHJ 2HDDA 1FIPA 4M3EA 4JYKA 2YS9A 2HOAA 5FKOA 3S16J 1G2HA 4XRMA 4C3HJ 1E3OC 2OPTA 3JRHA 5M5YJ 3UKGA 1IG7A 1WH5A 1VF9A 1T56A 1UHSA 3GTKJ 1AU7A 4A3CJ 3GTGJ 1U9NA 2K9SA 1GUUA 2NS7A 1ETKA 3QPSA 2Y31A 1HCRA 1MBEA 3A01A 2XRLA 3HOYJ 1WCMJ 2NVYJ 1MBGA 2JWTA 2L9RA 3HOUJ 2JJ7A 1POGA 4DYCA 3ZQFA 2I10A 3L1PA 2ECCA 2EZIA 2NVXJ 2LLKA 2CU7A 3SDGA 2CUFA 4L5EA 3HOZJ 2M2EA 3A03A 3BR0A 1JJ8C 1X58A 4C2MJ 4LOCA 2HXOA 1NTCA 5EYRA 4B1RA 3IV5A 1IC8A 1PUFB 2LD5A 1VNDA 4W97A 1EF4A 5F08A 9ANTA 2DMPA 4S0HB 2NS8A 3G1OA 3BT9A 3BR3A 1B72B 3ZQHA 1BW6A 3K2AA 2JA8J 1OCTC 3LSRA 1VI0A 1ETWA 4QSHA 5GPCA 1MBHA 3OSGA 5GPAA 2NVQJ 2E2JJ 1HOMA 2DMTA 3S2HJ 3CQZJ 3S1RJ 2MSYA 3BR2A 3DCFA 1YRNB 1IUFA 2KDZA 3S14J 1ITYA 1X2MA 3I4MJ 2EBIA 1RETA 2XSDC 3LNQA 1LE8A 3HB9A 1SANA 2D5VA 1JT6A 1Z77A 4NDLA 2EZLA 3HOXJ 3A01B 3HM5A 3LSPA 1HLVA 4RDUA 4M3DA 4FTHA 5E3OA 1RPWA 3O8HA 3RQIA 4ABZA 4MO7A 5EZHA 2QF7A 2VUMJ 3HBLA 4XIDA 5EGOB 5M5WJ 1ZGWA 5EEAA 1I6HJ 1LFUP 3BG3A 2XPVA 2R93J 2JA6J 4A3IJ 2AHQA 5J1YA 1GVDA 2VKVA 3A02A 2HQ5A 5F1JA 4CYCB 3SFIA 1S7EA 1A6IA 1AKHA 2CUEA 2R92J 4G12A 2LFBA 3HKZN 1IRZA 5FKLA 2H8RA 3MVPA 4A69C 1TWGJ 3SJMA 3BTIA 4UUSB 3DEWA 2XB0X 2EZKA 2DA1A 1NK3P 3S2DJ 5K7ZA 2EZHA 5F0CA 1VFCA 1QVUA 2K9NA 2XGDA 5IYCJ 1FJLA 1BW5A 1DU0A 5DTDA 2B63J 1ETYA 3D1NI 2DA6A 5E3MA 2EQRA 1GV2A 3BR6A 1Z0XA 3JR9A 5EZGA 2M34A 2Y9YA 4C3IJ 1B8IA 2VKEA 1QVTA 3MKLA 3GTPJ 1APLC 4A3LJ 1F43A 1ETVA 1JT0A 4V2FA 2ID6A 3TW6A 4BY7J 3I4NJ 2L0KA 3VPRA 5EGOA 4W1UA 3FISA 3M3YJ 2MG4A 2HOSA 1MH4A 4A3JJ 1JGGA 5C4XJ 1OFCX 3GTOJ 1JKRC 2XGCA 4BY1J 1YRNA 5EG0B 2X48A 1JKPC 1P7JA 2LVSA 1ZQ3P 5FKMA 4IEJA 1ORKA 1LE8B 5F0HA 3GTLJ 1QPIA 2JN6A 4B3AA 3S1MJ 3NAUA 1I3QJ 2CQQA 1JKQC 3GTJJ 2MGQA 3WHCA 1TWAJ 2LP0A 2OF7A 2R5ZA 4D7MA 4I76A 4M3BA 3JRFA 1WGXA 5E3LA 3W6VA 4MFEA 3BTCA 2WAQN 5EDNA 3B6CA 2FJ1A 1U78A 2GLOA 3HEFA 1F36A 2XPWA 5HODA 1XS9A 4BBRJ 2HI3A 1GT0C 2ZB9A 3K7AJ 3BTLA 2G0EA 4DZJA 1PUFA 2R0QC 3HOVJ 5GP9A 4J19A 2GM4A 1WPKA 5FLVA 3GTMJ 3BR1A 4CYCA 4HNVA 4A3MJ 1IJWC 2IEKA 5DS9A 3E7LA 5FJ8J 3Q0VA 2R5YA 3RZDJ 1HDDC 2M0CA 3FIWA 2DA4A 3IH3A 4MFDA 2EH3A 2WB1N 3Q0WA 3TP3A 1BL0A 5F0FA 3WHBA 1JTXA 1O4XA 1NK2P 2JA5J 1MH3A 2E1OA 3Q3SA 3JRCA 4XRSA 4DYRA 1GV5A 4A3KJ 2DA2A 3HGYA 2PMZN 3RKQA 2XGEA 4FE4A 3TEDA 2COBA 3PO3J 3BG5A 1SFOJ 2M9HA 2DA5A 3CDLA 3ZQLA 2P81A 4EEFG 4AUXA 4D5FA 4JX5A 3BG9A 3LSGA 5IP6A 2NVTJ
chains in the Genus database with same CATH superfamily
3LAJA 4P5OA 2Y30A 1DP3A 1SC7A 3QAHA 1U5TB 2KJCA 1YYVA 1ZHFA 2AO9A 4ZYAA 3CCEI 4RB1A 1BC7C 2BY1A 5HLIA 1YJNI 3JCUC 3JRDA 4A93J 1QRYA 3JRAA 2G7HA 1B72A 2IAIA 5K1YA 3ABLH 2BHZA 1Z3XA 1UMQA 2J5OA 3CLQA 2DDAA 2FX0A 4BS9A 4F7ZA 5FRNA 4Y52J 2DQRA 2HR3A 5KAFC 1R9TJ 1R4NB 3IC7A 5FFXA 4Q5SF 2VBZA 4NB5A 2X0LA 2JUGA 4ZJZA 4FISA 1W5CC 2JRMA 4D0PA 2ELKA 4HF2A 3WTYC 1P4XA 2EFWA 1FSHA 1K6OA 4B48A 4C9YA 3HXLA 4N4NB 3KP4A 3ZMZA 4RLQA 5IPAA 3MQ0A 1W7PA 3VSLA 3CC4I 2TCTA 1DDNA 1MSEC 2HEOA 4L5JA 4NC8A 4PJJA 1UFMA 2BY3A 2W25A 2Z5UA 2EV6A 3OS0A 4F93B 2L3DA 1E17A 3LSJA 4BHPA 4LK0F 4HX7A 2NRAC 1T33A 1WFXA 5IYBJ 1SVMA 2L54A 2M4GA 2JUCA 2D2WA 2JT1A 1TZLA 1Z7UA 3K69A 4ENKA 3ERMA 4U88A 3S2WA 4RM3A 4CCOA 5FB2A 4IPAA 2XF5A 2H1KA 2O8KA 2O03A 3QPHA 2O3FA 2K9QA 3H3VK 2IBDA 1HKQA 4NC7A 1OYWA 3V7SA 1XDUA 1LUJB 1RKWA 2DN0A 1P2FA 3S1NJ 1T0FC 4D7NA 3BQZA 2VI6A 4RBOA 3RPUD 3M4OJ 2MH2A 3VYRB 1XD7A 3RKXA 2XAJA 5C4JJ 2HDWA 3EPZA 4MGRA 4AYBN 2HXIA 3IH4A 1Z7LA 4QWQA 2Z3YA 1H89C 1P6RA 1ZK8A 3L9FA 2ZO4A 1AKHB 2OC6A 2K27A 2M7BA 1J0RA 4UV8A 1D8KA 1FOWA 4OIRF 4AVZA 2V1UA 1FTZA 2XHKA 4HLXA 4CXFA 2FEZA 1VQNI 2ZJQF 3GFLA 3W6KB 3H9JA 4KIFA 2QSFX 1LEAA 2COMA 2XKOA 2E60A 3H5AA 2ECBA 3B73A 4GGGA 4BBSJ 5EJCA 3TQNA 1MJ9A 1AOYA 2E34A 2BHYA 2WWYA 1K78B 2DMUA 2FSWA 4XSXF 2IW5A 4O5VA 1MBFA 1PJRA 1WH7A 2R7SA 4BACA 1N77A 2KRHA 2QSHX 3OOUA 2FU4A 5FD6A 2CMPA 1X3ZB 2P8TA 2GOMA 2HU9A 2GXAA 3HDDA 1XG1A 3FKJA 4GFBA 3RJPA 1D5YA 4UUTA 1CQTA 2LKPA 1J2XA 2ZXWH 3E0JB 2IGNA 1HKSA 1X1PA 3IH2A 2BOLA 2ME0A 5FO5A 2O0YA 3CMYA 2VIXA 1P9QC 2PFBA 4A3FJ 1TBXA 2LG4A 2OV7A 3JW4A 4ETSA 3S3OA 3DV8A 1HXDA 3ZQ7A 2NS0A 4L5IA 1XGOA 1G6NA 3BROA 5FKNA 2HZDA 1YHQI 2YUSA 1D3YA 3LSTA 4G8XA 5E79C 1IDZA 2RV8A 3OYCA 5CJ9A 2ZC2A 2ZSHB 2M87A 3AL0B 2WV1A 3QPLA 2WBMA 1BA5A 2CUZA 2Y0SN 2M8GX 4UUSA 4YEJA 2E2HJ 5E20A 5E3NA 1IGNA 3QQAA 1HSJA 2EWNA 1I39A 1JUSA 1HDPA 2DTZA 2W1OA 3M8EA 4U7BA 4A3EJ 3PO2J 4N9HA 3TW7A 4DW6A 4RM2A 1USTA 2FQ3A 5DEQA 3BDDA 2EILH 5FGMA 5FKOA 1FZPB 3EYYA 1HW1A 2R7OA 1D1AA 3BOQA 4MTEA 1E3OC 1HKTA 3OR2C 1KU3A 2A5YB 1QBJA 5J47A 2HQRA 1VF9A 1UHSA 3GTKJ 2CS3A 2CG4A 1OCCH 1BR1A 1U9NA 2K9SA 1GUUA 2DU9A 2OQRA 3A0BC 3FMSA 1KYZA 3HSFA 3VYSB 4ZYDA 3VSKA 3V4GA 1WVRA 2B9SA 3O2PE 1SMYF 3ESWB 2YX7A 3ZMTA 2XRLA 4CCMA 2XVCA 1EA3A 3QP5A 4WXHA 3GFIA 4N9IA 1WCMJ 5TRDA 3IAS2 2CW8A 2JVGA 1MNDA 4A2UA 4MQ9F 2ICWG 5HLGA 2MC3A 1POGA 1EH7A 4ENMA 4OIOF 2DOFA 3L1PA 4IQJA 2QQ8A 4HYEA 2NVXJ 1FWZA 4ZDLA 1J5YA 2WTEA 2DPDA 4WX9A 3OL3A 3F23A 3SDGA 2CUFA 3DQVC 2LYCA 2M2EA 3REOA 4XORA 1JJ8C 2R7XA 3PL8A 4B1RA 5EYRA 1TQPA 2IA0A 2PMHA 5D5XB 5CVVA 1OLTA 2LD5A 3TDZC 1MJBA 2ZMEB 5GAGJ 5LD2C 1B4AA 5F08A 2ELHA 4BGDA 3E6DA 4NHJA 3Q5FA 3W2WA 2CQNA 1B72B 2F4OB 3BR3A 2FMLA 3ZQHA 2JA8J 3V8LA 4LLGF 3ZMSA 4F91B 1ETWA 1L0OC 4QSHA 1FP1D 4ENNA 4II3A 2X51A 3WE2A 3MMYB 2A68F 3FBIB 5ICCA 3S2HJ 4E6KG 3WTSC 1YRNB 4U0VA 5B1BH 5DDGA 2CO5A 2KDZA 1T38A 3HKZA 3GX4X 3CUQC 5LHIA 2CYYA 4PGHA 1W4MA 2JQ7A 3FMQA 2XSDC 1SANA 2D5VA 1JT6A 5HDGA 1GLNA 4DQ2A 4M74A 3F22A 2L4AA 4AIDA 4HRIA 2VJ5A 1U0JA 4E4HA 3LSPA 4OU0A 1HLVA 4RDUA 4M3DA 3CD6I 3CJRB 2ZKZA 3CCQI 4FTHA 1OKRA 4CCJA 3RQIA 2HOEA 4MO7A 4P96A 5EZHA 4LIUA 4LG3A 1XGSA 4KMUX 2VUMJ 3VDXA 3R60A 3NRVA 2DI3A 1ZGWA 1ZGJA 4OIPF 1LFUP 3BG3A 2IRFG 2YSRA 3HPGA 4DGWB 5E1ZB 4A3IJ 3K4JA 1GVDA 2BY2A 1BIAA 3CDIA 3GZ6A 3OYDA 3DU5A 2F2EA 1VQ7I 3A1YA 1YE9A 2FF4A 4ZZDA 3KYDB 4ZYHA 3HKZN 3GEZA 5FKLA 5ERIA 2DCEA 2FNAA 3K4KA 3F6VA 1UAAA 2DFFA 5K7ZA 4G7ZF 5F0CA 4EJVA 1VFCA 3ML6A 1QVUA 3QWLA 4GYIA 4UV9A 3VODA 1KONA 5B5EC 4HW0A 5ILVA 1USSA 3R0AA 3QYFA 4G6TB 1E0EA 4R8HA 2IA1A 1UJ8A 1FJLA 1Z6TA 1PDNC 1VQ6I 1HQCA 2B63J 1FOKA 2EQRA 4RAFA 4A5MA 2GIZA 2LNBA 1ZARA 4KUMA 3COAC 3FDYA 2UWMA 2DO7A 4LB6B 3VWBA 1H9TA 3GTPJ 2LBFA 3MD2A 1SVOA 2OUMA 2XAGA 2EIKH 1B9MA 1OPCA 1WQ2A 2A6TA 4CYDA 3M3YJ 4YRVA 1A36A 3HOTA 3E1SA 3FXJA 3U1DA 3KLNA 4BXFA 1JGGA 2R7FA 5GADJ 3OYGA 1G4DA 1QHHD 3W2VA 3CCMI 3C2GA 2M8EA 3H3UA 2GWRA 4PSXA 3RIRA 5EG0B 4L0YB 4S04A 5FKMA 1ORKA 5D4SA 3KP2A 3V42A 1CGPA 4IVNA 5F0HA 1QPIA 3GTLJ 4B3AA 3I59A 3JAMK 2LDUA 3NWSA 1TWAJ 2KFDA 2DAOA 2OF7A 3SFZA 2V9KA 1SEUA 4I76A 4M3BA 5FLXK 5E3LA 2K3FA 1W7PD 5ED4A 3BTCA 3LQQA 1IN6A 2Q0OA 2ESHA 4H0EA 4UHTA 2QBYA 1O7FA 5HODA 2UXXA 2HZTA 2P0WA 2ZB9A 3BZ6A 3N97A 1TW2A 2FXAA 3QOPA 4EVIA 3FHZA 4XMYA 1PUFA 3HOVJ 4GO1A 3RKYA 3ULQB 4ANJA 2GM4A 1Y0NA 3PIOF 3GTMJ 2UZKA 2BZTA 1F1ZA 2K85A 1OR7C 1IJWC 5DS9A 2WAEA 3E7LA 5FJ8J 3BC8A 4XLHA 2MABA 2R5YA 1B59A 3FIWA 2DA4A 2R7TA 2Y75A 5BQTA 4A0YA 2WB1N 2RKHA 3F8CA 1BL0A 1MMDA 1X1DA 4IHSA 1YJWI 1ZAOA 3GO5A 1HC8A 1MH3A 4P9UA 1IZ1A 3TGNA 1QQIA 2GA1A 2OQGA 2DXIA 5ICEA 2KRFA 3DP7A 3H36A 3TEDA 3PO3J 4HAMA 2DA5A 1N78A 1G3SA 2MD5A 3I4PA 2KPMA 1Y8QB 2EV5A 4BE2A 3G2BA 2HQAA 1FBQA 3BY6A 2Q1ZB 2W00A 3HRTA 1BJAA 2NVTJ 5HS9A 2KT0A 1PVEA 3T8RA 2LK2A 1ZKGA 2HFHA 4LB5A 2MA3A 3F8BA 4TV7A 1IV6A 1TW3A 1A5JA 2Y2ZA 2QBYB 3EDPA 3V7CA 2WAFA 1U8RA 3MWMA 1JTYA 2DJNA 2CQXA 4HLYA 2DOEA 1Y56A 2A69F 5CPRB 2L7MP 1YW8A 5ILUA 5KNLA 1FPQA 1MSFC 1PP7U 1E2XA 1MBKA 3P5JA 3SQNA 3GBGA 2EJRA 3CCVI 4QPQA 3CP8A 3FKIJ 1U8BA 5HLHA 2ELJA 2DQLA 3U21A 2DPUA 3DEUA 3S1QJ 4IO9F 6PAXA 4LFUA 4L18B 2EFOA 3Q9VA 3H92A 2K02A 5IOZA 5BPIA 1W36C 2QSGX 4X1EA 1X3UA 4FQGA 4KICA 2VQHA 2VBYA 1HF0A 2XB5A 3G73A 5FROA 3CCJI 1P4WA 4EJTA 3DTIA 4XRSG 3ABUA 1RI7A 1OCPA 4I2OA 5J4VA 3K9TA 2QEXI 3NWTA 4E7IA 3ZPLA 4F3QA 2CFXA 4Y3OA 2B0LA 3FF5A 1CF7A 1TC3C 1ETOA 1QA6A 1IXCA 3AG1H 2PJRB 2OD5A 1V3FA 5KVRA 2DA7A 1ETXA 2HOTA 4XLCA 2ZXIA 3DFGA 2DMQA 5JR3A 2X6WA 4EJWA 2BW3A 5IT9Z 3HOWJ 1VQOI 5HDKA 4IHWA 3FXQA 3AG4H 4HQMA 1W36D 2L01A 4PK4A 2E71A 2IGKA 3RSNA 2W48A 3WTXC 1FTTA 4PGGA 4CHUA 3R0JA 2F5VA 4NQWA 2ZXHA 3HRUA 5K7HA 2FQ4A 2GQQA 5DCMB 2LR8A 5D8KB 3C18A 3CCLI 3FM5A 2HVQA 1GXQA 1MBJA 1TTYA 4BL0B 2CV1A 2HVSA 2LTPA 3JRIA 3RQ4A 3HUGA 3IL2A 2YU9J 2O8XA 4FX0A 2XV4S 1STZA 3V7RA 3CO6C 3ZQIA 2EA2A 3SYTA 2VOPA 5J1UA 4XSZF 3I9V2 1QGPA 5GTIC 3FXMA 5HNHA 2ZJRF 2L7FP 2UXNA 3OS1A 1H9GA 5M3MJ 3AKZA 1OJLA 3G1MA 2FUG2 3OS2A 2I5UA 4XK4A 1X1AA 2P7CB 1P7IA 2PQ8A 5E8IA 4YIFA 3OV8A 4CCLA 1G3WA 3ZMVA 3CESA 1X2NA 4FCYA 4UVAA 1K83J 2JSCA 2DA3A 2TRTA 3LSMA 3C3WA 2P5VA 5JLXA 2XPUA 2JK3A 4AIHA 3G1LA 1B6AA 1RESA 2ZFWA 3RTRA 4Q47A 1BI3A 5K5OA 3MN2A 3CZ6A 3QP6A 3BQYA 4BU2A 3CMAI 1TWCJ 4AU7A 2VXDA 3KP6A 4JOMA 4Y7NJ 3HYIA 2DT7B 2M45A 1W5TA 2K86A 3ZGKA 3CCYA 3F0CA 3KZZA 1HSTA 5HOOA 1FYMA 2R7WA 2PI0A 1U9OA 2EIJH 3GUDA 5JHFA 1DU6A 5F27A 2R7VA 4UXNA 4KA4A 2LKXA 2FA5A 2X6OA 3MFKA 1MNEA 4HSTA 5B66C 1UG2A 1TLHB 5B3SH 1LFPA 3SZPA 5TGTA 2BVMA 3WGIA 2E19A 1QO0D 3ZQQA 4BNCA 3WU0A 1OCZH 5K5RA 4RAYA 1V5FA 2VONA 1K61A 2Y0MA 3F3XA 3HOSA 4CZCA 2O7OA 2M3AA 3OMYA 5D8LB 1IN8A 3F21A 1TWHJ 1JE8A 2HDDA 1FIPA 2L9SA 4M3EA 3K1PA 2HVRA 3HSEA 2DYRH 2HOAA 2V1DA 4ON0A 3S8PA 4DBQA 1G2HA 1LNWA 4F92B 2NNYA 4IJAA 3C2HA 2WY8Q 2Q2EA 4YFNF 1WH5A 3ZMDA 1T2KA 1T56A 3VFZA 5LGUA 2W7NA 2EPFA 4XBFA 3GTGJ 2ZNZA 2RN7A 3F8MA 3CMEI 4ZDOA 1BC8C 1ZG3A 1YTYA 4KT5C 2RVCA 4E70A 1HCRA 3A01A 1LVKA 2VKDA 3HSRA 3DU6A 2JWTA 4OAYA 2QQBA 3K4BA 3D5SC 2IXSA 1TNSA 1Y0UA 3EUKL 2QM3A 3M8JA 2EFQA 2JJ7A 4DJAA 3OIQA 2IPQX 3OYBA 4ZTFA 4XKBA 4XRFA 4H4KC 2RNJA 4DYCA 3W2AA 4L9TA 1ZG5A 4O3MA 1Z21A 4ZDPA 3TOBA 4FETA 4XNFA 2CU7A 1U3EM 1QNTA 3A03A 2E1CA 4C2MJ 2HXOA 1I6XA 3X2QH 2K3PA 3CF2A 2VLAA 2KIMA 2JZYA 4Y33A 2LKSA 4BE0A 3LSIA 3KIOA 3WTTC 1PUEE 1EF4A 9ANTA 1K4SA 1IW7F 2XAFA 3DBHB 1OCTC 3LSRA 4M6YA 2WY7Q 1MJAA 1SD7A 1JHHA 3GFMA 5GPAA 2NVQJ 1HOMA 3TL4X 2DMTA 2MSYA 4RB0A 3J81K 2VXZA 2VOOA 1IUFA 1ZGAA 3DTKA 5JVTA 1ITYA 2PX9A 4FASD 3I71A 3L00A 3KYLA 3K4LA 3OR1C 2EBIA 5D4RA 5CVUA 3LNQA 4M9SA 2BE5F 1Z9CA 1SD5A 2EZLA 1ULYA 3HM5A 1ZRDA 4HV6A 3J7ZI 5LEJA 1MZBA 3F8NA 3O8HA 4ABZA 3J81Z 5IT9K 1WWXA 2VJ4A 1K78A 3EUHC 4IRHA 3DPLC 4XIDA 2MH9A 5BMZA 1XSDA 1R71A 3ZP5A 4X0GA 2QKMB 1SVLA 3HIFA 3D5LA 5FLXZ 2W4SA 2R93J 4O6JA 2LH9A 4ESFA 1SAUA 2AHQA 4L9NA 3KETA 5J1YA 1IAWA 3DPTA 3A02A 5D6FA 2HQ5A 4GRIA 5F1JA 4CYCB 2IA2A 3WE3A 1Y39A 1AKHA 1A6IA 2K4BA 3L2QA 5BPDA 2KLOA 4G12A 4NUBA 2LFBA 1XX5A 1QZYA 4IQ4A 3WG9A 4RB2C 3GVAA 2H6CA 3BCAA 5LBQA 2EV0A 3HUGB 2H8RA 3T0YA 3MVPA 3PQJA 3K6GA 3OIPA 4PZJA 3HPHA 4DNCA 1YO5C 2X6YA 2FOKA 2TDXA 2RC4A 2XB0X 1HA8A 1Y6IA 2DA1A 3S2DJ 1UG0A 2H27A 2EZHA 1S7AA 4PJLA 5H6RA 4NQWB 2RQPA 2VT2A 3SEQA 4J01A 2XGDA 4OMZA 4PDKA 1VQMI 2CUJA 5DTDA 4AIJA 5LRRA 2DA6A 4OIQF 1YX3A 2V4JC 2IVMA 4Q48A 2XRNA 3CUOA 4XOTA 2G7UA 2M34A 3S93A 2Y9YA 4C30A 3E5QA 4CCNA 1LJ9A 3MKYB 3I64A 2BXYA 2QZ8A 1APLC 4A3LJ 1JT0A 3TW6A 1R1TA 2WADA 4L9VA 3S3NA 3J7AY 4ZYEA 3I4NJ 2VC1A 3VPRA 4W1UA 4KISA 3FISA 3ABMH 3U9GA 2HOSA 2NXNB 4A3JJ 2B7EA 3BG6A 4OAZA 1LB2A 1YITI 2XGCA 1J09A 2R4GA 1R7JA 3ABTA 2BBYA 2MBFA 5E8GA 1TT5B 1ZQ3P 2DT5A 3BPXA 3GMEA 2XF6A 3VYUB 2ISZA 3NAUA 5JFRA 2CQQA 2DK5A 3F8FA 3WHCA 1Z1DA 4D7MA 4ZH4F 2R7RA 2LMDA 3HTSB 2WAQN 4BH9A 5EDNA 3B6CA 1U78A 4XONA 5ILSA 3LFUA 1YFHA 1ON1A 3HEFA 1F36A 4BJ6C 4BDZA 1OYYA 3FZVA 4K2EA 3TDUC 4BBRJ 3K7AJ 2F4MB 2Z9OA 5DV5A 2JRTA 2NOJB 3GCMA 4KYWA 2A61A 2UV1A 3FM3A 1DGWY 3BR1A 3I59B 2IS6A 2I8DA 1MMGA 2QQAA 1LKXA 2Z2SB 4MQVA 1SFEA 1YLFA 1OR7A 4HEA2 2FOWA 2VB6A 2EH3A 3FXLA 3TP3A 5F0FA 4G7OF 1XCVA 4BUPA 2VQCA 2VPLA 4F52A 1O4XA 2M1BA 5B1AH 3I56I 4LITA 4PFPA 4RA2A 2E1OA 3Q3SA 5F1RA 1GV5A 4HPQA 2OU2A 3CCRI 2PMZN 1WRJA 3BJOA 1YW7A 4NBQA 4WXDA 2XGEA 3E97A 4BDYA 3DWLE 3JTHA 1KZHA 2CWEA 5DUIA 3DPUA 4UNOA 2O61A 3MZYA 2EINH 2MYSA 1HW5A 4ITVA 1ZRFA 2PN6A 1IF1A 2QVOA 3ZCOA 4A6DA 4JX5A 5FD5A 1YQAA 1T39A 4HNTA 3EETA 2Q2EB 5IP6A 3TKYA 2W84A 3U2RA 3GFJA 5FRMA 4CICA 1FEXA 2M30A 1T95A 4B8XA 1U2WA 3JRGA 2RREA 5CVJA 1Y1VJ 1Z6RA 2QYOA 3M07A 3PSFA 5J8CA 4OMYA 5LHGA 2CJJA 3ZQGA 1FIAA 4LG0B 3A4CA 1R1UA 4GYGA 3KPHA 4QPOA 5M3FJ 2ZSIB 2X1EA 3HJEA 3KE2A 2IT0A 4E7LA 4IHVA 2VE9A 1H8AC 1BJZA 5IP7J 1F5TA 3QPTA 2XAUA 4NNJA 3G4SI 4GCVA 1FP2A 2G9WA 2YU3A 3JSPA 1K6YA 1R5HA 1R4MB 1EH8A 2KZVA 1TWFJ 3IRQA 4RLFA 3ZMUA 3AAFA 1XSXA 2KQRA 3KP3A 5M5XJ 3V8JA 1TQMA 1K4TA 1K79A 3IHUA 4IOCF 1UCRA 4WWCA 1BR4A 1FOYA 5C3EJ 5D5VB 1JUMA 2X9DA 3FHNA 2ACJA 3ZXSA 4RGSA 4E7HA 1O3RA 2XAQA 2LSOA 1I27A 2DK8A 3JREA 3HHHA 1OISA 2XGXA 3R4KA 5JI6A 3LOCA 2E1MC 4Z6YA 5LLQA 3WTVC 3OYLA 5F04A 5EF6A 2DFHA 4M3GA 2NOGA 3M7GA 3RCOA 3TP0A 2LF8A 2BGCA 3SDBA 4IKFA 4R1HA 3OY9A 1KU2A 2DFEA 1NG7A 1Q1VA 1G59A 2CRGA 2R7DA 1QHGA 3GLLA 3L09A 3L2WA 2H94A 2N8GA 2FD5A 4B4CA 2VJIA 4JBAA 1WJEA 4P55A 3PUBA 2YR2A 2AXTC 3F72A 1QZEA 1IO2A 1KGSA 4OOIA 4IHYA 3WTUC 5TJJA 3ERED 2GBYA 2R3SA 3DBRB 4BXXJ 4C3JJ 4XLFA 3H9QA 3R6SA 4BEHA 1SFKA 1RZ4A 2HPIA 5A2QK 1M1EB 1TNTA 2FBIA 1GHCA 3KX2A 3J7AO 2HKOA 2QCOA 4PJ0C 3ZR8X 1ENHA 1VQLI 1J75A 2R7QA 5CLSA 3KZYA 1ZTRA 2M7AA 2HTSA 1YOVB 2P6SA 3HC7A 3M9AA 3KLOA 4EATA 4M3FA 1IN4A 1XCBA 2X6XA 4LLNA 2ESNA 4MIMA 2KISA 3WU2C 3M8FA 1H88C 2R7ZJ 1TT0A 4FE7A 3H5NA 3ZN0A 5J1RA 5AIPA 1WZ2A 1IDYA 1VQKI 2ZXJA 1T98A 3S32A 2AXLA 3LWFA 4D5CA 4KNYA 4IRIA 5E18F 2DTRA 3C2BA 1O3QA 4QIWN 4KIGA 5J3LA 3CF5F 3FK6A 3CMMA 3P7NA 4IF4A 2OA4A 4HBLA 4E7ZA 2LY9A 3E6BA 1D1CA 3FWEA 1BI2A 5CVIA 4IRGA 2GAUA 3ASOH 4V2GA 3WGHA 1FBUA 5JLWA 4ZC3A 2GA2A 1XTAA 3DTEA 1EV7A 4AIKA 4Y15A 2CW7A 3L2CA 3PJRA 2IGMA 2MD0A 1U6GA 2XDVA 1YG2A 4A3BJ 5ICFA 1LVAA 1RUOA 4MEYF 4C2UA 3AG3H 1WHUA 4R79A 2JSPA 3BTJA 4BAYA 2OTLI 4KN4X 4HDUA 1MW7A 2EK5A 2Z33A 2E35A 3CDHA 3HG9A 4XICA 1OMIA 3QU3A 4CO8A 4EQQA 2Y48A 1WSUA 1BR2A 1R5GA 1XGMA 3WTZA 2IS1A 1KQ0A 1XC5A 2L9VA 2XKPA 4II2A 1R22A 4DZPA 3MKWB 5L3FA 4HSRA 4WK8F 3DXJF 3DKXA 3CO7C 4A3DJ 3PNYA 5FLMJ 2O5RA 1MMNA 2BXZA 3OSFA 3BR5A 4HF1A 3B6AA 4JX6A 2MLGA 3NARA 2FMYA 1YI2I 1FMVA 3S17J 2CV0A 2JTVA 3GZNB 1LFBA 4Y13A 5HS8A 1XMAA 2JVHA 1BOAA 2PEXA 4KITB 3SXYA 2XROA 3BPVA 1ZG1A 3S16J 1LQ1A 2X4HA 3JRHA 5M5YJ 3UKGA 2FBHA 2KL4A 3HZJA 3KFWX 2CQ7A 2AQEA 2LRDA 4A3CJ 1DUXC 1ZREA 3P9KA 1OCRH 3SHFA 4UY8I 4EM2A 2W57A 2NS7A 2A5WA 1LDKB 1DQUA 5K5QA 3QPSA 2AS5F 1AWCA 2VN2A 3H5RA 3O6BB 2Y31A 1MBEA 3CCSI 3PSIA 4PJNA 2F5EA 2AQFA 3WG7H 1X4OA 1VQ9I 1MBGA 1S29A 2FBKA 4S05A 1G3YA 4LD5A 2W82A 3QODA 2PJPA 2V9VA 3MKZA 3ZQFA 1IUYA 2K5CA 1WJCA 2QWWA 3VOEA 5AIQA 1MGTA 3AL0C 3HOZJ 3ELKA 3PUFA 2F5DA 2A05A 2KHMA 3BR0A 3LSHA 3OYJA 4UB6C 1YS7A 4UUVA 1NTCA 4BEHB 4YIRX 1WJAA 1PUFB 5IY5H 2BY0A 4W97A 1I5ZA 4U7DA 3FX3A 2OTJI 3QOEA 4MTDA 3G1OA 4LG0A 2V26A 3P9CA 4XLPF 2OZUA 2VODA 5GPCA 2X1CA 2E2JJ 5GAEJ 1XB4A 4CZZA 4A12A 4U0WA 3S1RJ 3K70C 5EEHA 3BR2A 3DCFA 2EA4A 1KYWA 3K0LA 1X2MA 2L7KA 3L2RA 3I4MJ 5J6XA 1RETA 4ESBA 4J00A 1RRJA 4A5NA 1J7KA 3HRMA 3TBIA 3OYKA 4KDPA 4NDLA 3HOXJ 3A01B 3UNGC 4BQQA 4KMFA 5E3OA 1RPWA 2A3SA 3D5RC 2X1DA 2QF7A 1V54H 3HBLA 2L9NA 2A6EF 4XL9A 1XDSA 5M5WJ 3RYRA 1W7PB 5L3DA 1TQIA 5EEAA 1O3SA 2L02A 1TP4A 4CH7A 3TO7A 4E7KA 1SD6A 5LEKA 3L7WA 2H1LA 2RDPA 2VKVA 4DOZA 1AA7A 5H2FC 1VQPI 2DFIA 2KJBA 2Y69H 4CA0A 3SFIA 3OYEA 3IUOA 4LK1F 1QU3A 3K10A 1S7EA 2LOOA 1B9NA 2OCCH 3LQRA 4LLLA 2R92J 1D0XA 2V1XA 5LHHA 1S8NA 1IRZA 1BI0A 2ZMEA 2ZNYA 1W5SA 3NEUA 3KEYA 3I0TA 4A69C 4AVPA 3I3LA 1S6LA 4BQOA 3BTIA 3SJMA 1VTNC 1KQ8A 4PSWA 4BHBA 1VQ8I 1KU9A 2GZWA 1ZYRF 5GTHC 3TMOA 1Q1HA 4AD9A 1NK3P 4EGZA 2ISYA 2NNNA 1IN7A 4BQNA 2Z99A 4GXOA 2W85A 3LMMA 2EFNA 4YELA 5L3GA 1BW5A 1MMAA 1L3LA 4M72A 1REPC 5JVGF 3PFIA 4BQAA 1CF7B 1S9HA 3PQKA 1Z0XA 3JR9A 5EZGA 3E5UA 2E1MB 2KIFA 4XQFA 2STWA 4PCQA 4C3IJ 5LRSA 1B8IA 2C6YA 1FC3A 3MKLA 1H0MA 4FHTA 1XMXA 4ENJA 1EKEA 1ETVA 3WTWC 2ID6A 3RI4A 4BY7J 1V4RA 2L0KA 1JI8A 2MG4A 1V55H 2KIQA 1BN5A 5C4XJ 3E6MA 2K7LA 3GTOJ 3IWZA 5D5UB 2VC0A 5F6FA 2IP2A 2WC2A 2XF7A 3RPQA 4PJMA 4BY1J 4B43A 2X48A 1JKPC 5DD8A 1P7JA 2LVSA 3CUQA 4Y4RA 2VQLA 3ZRGA 1WJFA 1S3JA 2BV6A 2JN6A 3LL7A 3S1MJ 4GDFA 3GW2A 2Z16A 3PFYA 1PP8F 3FXKA 2IGOA 2XSJC 4D9JA 1IRXA 2R5ZA 2LP0A 4PUSA 3JRFA 3BZCA 3W6VA 2BVLA 4MFEA 3K1NA 2FJ1A 2GLOA 4V19K 4I99C 3K4MA 1HW2A 4YFKF 5F64A 5DUKA 2D1VA 3IRRA 1WKMA 2HTJA 1XS9A 2HI3A 4Q4ZF 3MZ8A 4A0XA 1IRGA 1YS6A 2LY1A 4BYYA 2KRCA 3WODF 4HNUA 2R0QC 2HYFA 5GP9A 1QZZA 2NVUB 2RNGA 1T08B 4UVCA 4CYCA 4HNVA 3DLLF 3Q0VA 2QUFA 1R5ID 2H09A 3RZDJ 2M0CA 1FMWA 3IH3A 1HDDC 2E5ZA 1U5TA 3G71I 3AG2H 1JHFA 1I3AA 1RR8C 3EYIA 3Q0WA 1GXPA 3OOPA 4EM1A 5J40A 3WHBA 4RAGA 1JTXA 3RYPA 3PNTA 4G7HF 2BEOA 3I54A 1N25A 3CJQB 1X1CA 4XRSA 4DYRA 3JRCA 3H35A 2BYVE 3RKQA 1RUNA 1VQ4I 4BHCA 3KP5A 2COBA 3BG5A 4B44A 1R36A 3G6EI 3MZHA 3R61A 2VBWA 3CDLA 2CQKA 3JAMZ 3ZQLA 3IKVA 1DPRA 2EIMH 4WXCA 1IXSB 3ROUA 4D5FA 2OZ6A 2KDOA 3BG9A 3LSGA 2M0MA 1RR7A 5IP9J 4HDVA 5EEGA 2E2IJ 3ABKH 3Q9SA 3LA3A 4I01A 4XLNF 2DOAA 1MDMA 3BCBA 1Z67A 3LA7A 4LIVA 4LJZF 1PYVA 4F55A 5KCMA 1IV8A 2L4MA 3VEPA 2RAEA 3QYEA 2P4WA 4XLEA 3UR3C 1ZR4A 2ZJ2A 4EGYA 4XM3A 1W1WE 2M4KA 3BG7A 3IKTA 1FY7A 2P5LC 1ZRCA 4B3XA 4MNUA 2KP6A 3CJTB 4IHXA 3FXOA 2PG4A 5H6QA 2ID3A 4FX4A 3OYHA 2O6GE 3I55I 1WJ5A 5K7FA 4ZYGA 3K70D 1MKMA 3FK7A 3G3ZA 3PIPF 2FE3A 2KKOA 1V5EA 3RPUA 2CW0F 1FOXA 3B02A 5FFZA 1WI3A 3ZQCA 4XLAA 3H0GJ 2DYSH 1ZR2A 4M73A 3BP8A 4M6XA 4DYQA 3OYMA 1OYIA 1GDTA 2DODA 2CH0A 2WB1A 1B1BA 3T5XA 2GIVA 4RMNA 4BKXA 3P9IA 1JUPA 1UELB 3S15J 3IWFA 5BOXA 1MNMC 4EJUA 1VQ5I 1LEBA 4HA8A 2CGPA 2JPCA 2HQNA 5HDNA 1AHDP 2UUZA 2V6CA 2DJIA 4EV0A 1KA8A 3EUAA 2DT6A 1C0WA 1JJ6C 3T1BA 1G8XA 1J9IA 2E7WA 2K40A 2V7FA 3Q0UA 4IL6C 2R5YB 3PM1A 4RS8A 1Z3YA 3GTQJ 2V79A 5H20A 3W3CA 1T0FA 3OYIA 3DKWA 2E36A 4IHTA 1W0TA 4CSWA 4IOAF 1OQYA 3A0HC 1X3WB 4CCKA 4G94A 5DCMA 1NHAA 1XSVA 2X85A 2MW8A 5LGTA 4ESJA 1NG6A 1RIOH 3E5XA 1F9NA 5E17F 5DD4A 4KT6A 1EH6A 3E6CC 1Y8RB 2QENA 1ZLKA 5DM6F 3OIOA 2P6TA 2VKHA 5AONA 1S72I 5HLTA 4KJZA 3ZN1A 2LF7A 2H6BA 3O8GA 4AC0A 4UB8C 2HKXA 4X6AJ 1WJBA 2DMNA 3TO6A 3M1EA 3ZOBA 4I98B 2R5ZB 3RZOJ 2F48A 2MLKA 4JP0A 5IT3A 2Z1DA 2F4IA 1R23A 3LA2A 1RKTA 2VPRA 2HS5A 5D5WB 4Z2YA 5CKTA 5JHUA 2O9LA 4WF2A 1I50J 5BS6A 3H1CA 2IJLA 5EG0A 4DIQA 1XGNA 1IXRC 3LFKA 4ZZLA 2L2OA 1LDDA 5J8FA 4M6VA 2QA4I 2ME6A 3KCCA 1UZCA 4I0AA 1TL8A 2HPMA 2FRHA 2QKLB 3I5UA 3L2VA 2JA2A 4OWRB 2Y9ZA 4MHGA 1SD4A 3BJ6A 4ZTJA 1DP7P 1FX7A 3HGGA 4A3GJ 1ON2A 5FKKA 2D1HA 5IOYA 2QLZA 4I6ZA 4RGUA 4PFOA 2LBFB 5C44J 2A6HF 1X19A 2PMZA 5A2QZ 3WU1B 1B8IB 3CJNA 2ZBKA 1Y1WJ 2R7UA 3IAM2 4JQFA 4ASNA 4E7SA 2JMWA 4CDGA 2CSOA 2W24A 1ZELA 4AM3A 1N75A 3I58A 2L5QA 4DBRA 4G9YA 1J59A 5KK1A 1JKOC 4MLOA 1YJ9I 3OL4A 2JA7J 1D8JA 3VYTB 4QTRA 3CC2I 3C1DA 3N05A 3DF8A 1K7AA 3ONQA 2V6EA 2E1NA 2HYJA 1S5LC 3MEXA 4HG2A 4KN7X 4YFXF 3QU6A 1KU7A 1W0UA 3N4MA 2GXGA 4JX4A 5CQEA 1ETQA 3K4NA 4CGZA 2YPRA 4QLCU 5BNGA 3KEOA 2EB7A 1BM9A 3JRBA 5IYDJ 2A07F 4NC6A 2PMUA 3RDIA 1ZN2A 2L7ZA 3HRSA 3SZGA 4AWXB 2PBIA 2QQ9A 3SEZA 2WAQA 4JYKA 2YS9A 2HGCA 5DM7F 2F5CA 5TISC 5CVRA 4XRMA 4C3HJ 2STTA 5CYVA 2OPTA 1X1BA 3KZIC 1LDJA 4WCGA 1R49A 1IG7A 3MCZA 2WV0A 4HZFA 3OYNA 2HWVA 4L9JA 1AU7A 4G6QA 1O57A 3WGGA 1ERDA 2XAHA 3K2ZA 1ETKA 2DLLA 3KP7A 4HX8A 3S3MA 1R00A 4LMYA 2ADUA 2MFZA 3QRFF 2E5NA 3HOYJ 2NVYJ 1SFXA 2L9RA 2M5WA 1BOBA 3SZTA 1P4AA 3HOUJ 1JXSA 4UVBA 5DYMA 1ODDA 3HTUA 4Y17A 2JPBA 1GVJA 4JK1X 2K9LA 2VL8A 1ONVA 2I10A 2K4JA 4HX4A 1R1VA 2ECCA 2EZIA 2WA0A 3GYHX 2LLKA 3CTAA 4L5EA 1YW9A 2HNHA 4D1QA 1X58A 1NH3A 4LOCA 3J80Z 3GF2A 3IV5A 1IC8A 2HDCA 4P9FA 1XN7A 2DDBA 1E3PA 3F6OA 2KIUA 3K4CA 1VNDA 1Z05A 1WI9A 4XN0A 2DBBA 2DMPA 3NQOA 2NS8A 4S0HB 1O7LA 3BT9A 4BE1A 1BW6A 3K2AA 3IP4B 2LY2A 3TO9A 1VI0A 1YIJI 4B09A 3OSGA 1MBHA 1V5GA 1MDMB 3LAPA 1UHWA 2LC2A 2BW3B 1VZ0A 3CQZJ 3DLAA 1ACIA 1A04A 1IN5A 2ETHA 4KIBA 2VQGA 5CQGA 3S14J 3A2KA 4I09A 3O3KA 1A31A 3OYFA 4N0BA 4I0BA 2PJRA 1FNNA 1LE8A 1FT9A 3HB9A 4XN3A 2P7VB 1Z77A 2DW4A 4P1WA 1ZH5A 4HOBA 4HF0A 4BJTA 1D0YA 1OCOH 1SMTA 2CFOA 3ISPA 2NYXA 3E3VA 1MIJA 2OAZA 3ECOA 1FYKA 1UHMA 3CLOA 2PLYA 1BI1A 3I53A 2F6CA 1T8IA 3CC7I 5ICGA 4XKWA 5EGOB 1I1GA 1R58A 5J4YA 2E7XA 1I6HJ 3C7JA 5L3CA 3BJAA 2XPVA 2JA6J 3T8TA 4M71A 4E7JA 3W6JB 3ASNH 3JSOA 3FXUA 2Y0SA 2Q8KA 3J80K 1A6QA 3AFHA 1EJ9A 2CUEA 5HVQC 2VT3A 2ZCWA 4XR6A 5HS7A 3ECHA 1D1BA 5L3BA 1TWGJ 3RKWA 3BWGA 4UUSB 1YIOA 2VBXA 5L3EA 1JGSA 3F9KA 3TOAA 3DEWA 2ZMEC 2EZKA 3OYAA 4A0ZA 4L0ZB 1DGRM 4M9ZA 2ZJPF 5KAIC 4YIIA 4BJ5C 2K9NA 3GLXA 4IX7A 5IYCJ 1DU0A 1ETYA 3M1CA 5E3MA 3D1NI 1BIBA 1GV2A 3BR6A 1XMKA 3EQLF 2D45A 4HQEA 4XKCA 3CUQB 3FXRA 2VKEA 1QVTA 4XOPA 1F43A 3GXOA 4B47A 4V2FA 2V1NA 2GXBA 2F5FA 5GAHJ 3CP2A 2VASA 4EJOA 5D6EA 5EGOA 4FT8A 2OCEA 3U1KA 1G3TA 1MH4A 3JTGA 1OFCX 3GZ5A 1JKRC 1E3HA 4C2TA 1BBYA 2RQQA 3HHGA 1YRNA 1QPMA 4OINF 2J5PA 1RNLA 2H8WA 1FYLA 1HBXG 4EM0B 2XC7A 1XPXA 4U87A 2RGVA 4IEJA 2VE8A 4IXAA 3QYBA 3DBLB 1LE8B 4RB3C 1DPUA 2XASA 3KEQA 3FBNB 1I3QJ 4AYBA 1FBSA 1JKQC 2YX4A 3GTJJ 2MGQA 1MMSA 2KMUA 1P92A 1T6SA 1FSEA 2XUBA 1WGXA 3H3ZA 3VB2A 5LFAA 1I1SA 4I02A 3H0DA 4XKVA 1MD0A 4HV5A 2NAZA 2QGUA 4A6EA 4M9XA 2ZFUA 2HYGD 3BLYA 3J7YJ 1D5VA 2OBPA 3EUHA 2XPWA 3FMRA 5DCFA 1SFUA 1RC9A 1GT0C 2LREA 3BTLA 3H9GA 4G6DA 4CUGA 2G0EA 4DZJA 1SAXA 3PNVA 1LPQA 4J19A 4LGWA 2KZGA 1WPKA 1WJDA 5FLVA 4I7HA 1D0ZA 4YG2F 3LSKA 1YX5A 4A3MJ 2IEKA 4EMSA 5LGNA 3MAJA 4RGRA 2IS2A 4MFDA 3GWZA 2XIGA 1UB9A 2EFPA 1X4PA 3V8KA 1U5TC 3K1MA 2K9MA 1ZLJA 5E1WA 4BXUA 1NK2P 2JA5J 2FNPA 1FLIA 4N4OB 2GOXB 5KHDA 2OJED 2VJJA 2IS4A 4IZZA 4A3KJ 2DA2A 3HGYA 1Z91A 3HL2A 3D0SA 3DEEA 1S7OA 4RAZA 2CV2A 1O3TA 4FE4A 5E1XA 2P5KA 1R6RA 2M9HA 3OWTA 1SFOJ 4RGXA 2V9PA 4MEXF 3KYCB 5HNFA 1IRFA 3L2UA 3CCUI 2P81A 2MC4A 4AUXA 4EEFG 1F4KA 1KQ9A 4KFCA 3DKYA 3BZKA 1A35A 4U0YA
chains in the Genus database with same CATH topology
1RR7A 2Y30A 2KT0A 5IP9J 2LK2A 1FEXA 2E2IJ 1ZKGA 2AO9A 1IV6A 3JRGA 1A5JA 2Y2ZA 1Y1VJ 3JRDA 4A93J 1QRYA 2CJJA 3ZQGA 3JRAA 1FIAA 1B72A 1JTYA 2IAIA 2DJNA 2CQXA 2RAEA 1ZR4A 1UMQA 5M3FJ 2FX0A 2L7MP 1MSFC 4IHVA 1H8AC 4Y52J 1BJZA 5IP7J 1MBKA 4IHXA 3GBGA 1R9TJ 3FKIJ 2ID3A 1U8BA 1TWFJ 5K7FA 4FISA 3FK7A 2ELKA 5M5XJ 3S1QJ 5IOZA 1WI3A 3ZQCA 5C3EJ 1JUMA 2X9DA 5IPAA 3H0GJ 4X1EA 1ZR2A 1HF0A 2TCTA 2XB5A 4DYQA 1MSEC 1GDTA 3JREA 3LOCA 4XRSG 4BKXA 1JUPA 3LSJA 1OCPA 1T33A 3S15J 5IYBJ 1MNMC 5F04A 5EF6A 1AHDP 4M3GA 2NOGA 3TP0A 1TC3C 1ETOA 1Q1VA 1JJ6C 2CRGA 2DA7A 1ETXA 2HOTA 2H1KA 2K40A 3Q0UA 2O8KA 2R5YB 3PM1A 2N8GA 2FD5A 2DMQA 4B4CA 2K9QA 3H3VK 2IBDA 3GTQJ 1W0TA 3HOWJ 1RKWA 2DN0A 3S1NJ 4IHWA 4D7NA 3BQZA 2VI6A 4RBOA 2MW8A 4IHYA 3M4OJ 2GBYA 2W48A 4BXXJ 1FTTA 4C3JJ 5C4JJ 4AYBN 5K7HA 2HXIA 3IH4A 2FQ4A 1H89C 2LR8A 1ZK8A 3OIOA 1AKHB 1MBJA 2QCOA 4AC0A 3O8GA 2LTPA 1ENHA 3JRIA 4X6AJ 2DMNA 1FTZA 3ZOBA 1ZTRA 2R5ZB 3RZOJ 2YU9J 4JP0A 4M3FA 1RKTA 2VPRA 2ECBA 4MIMA 3ZQIA 4BBSJ 5J1UA 2O9LA 1H88C 1I50J 2R7ZJ 4FE7A 5EG0A 2DMUA 2L7FP 5J1RA 5M3MJ 1OJLA 3G1MA 1IDYA 1MBFA 1WH7A 4XK4A 4M6VA 3OOUA 2ME6A 4D5CA 1P7IA 3C2BA 4QIWN 5J3LA 3FK6A 3HDDA 1XG1A 1X2NA 2Y9ZA 4FCYA 2LY9A 4GFBA 1K83J 3HGGA 2DA3A 4V2GA 2TRTA 4UUTA 1D5YA 4A3GJ 5FKKA 1CQTA 5JLXA 5IOYA 2XPUA 5JLWA 4I6ZA 2JK3A 5C44J 3G1LA 1RESA 3IH2A 4A3BJ 1B8IB 2ME0A 3MN2A 3BQYA 1Y1WJ 3CMYA 1TWCJ 4Y7NJ 2JMWA 4A3FJ 3BTJA 3CCYA 3F0CA 1U9OA 1DU6A 5FKNA 1JKOC 4MLOA 5F27A 4XICA 2YUSA 2JA7J 2LKXA 2X6OA 1IDZA 4QTRA 2WV1A 3QPLA 1UG2A 1XC5A 1BA5A 2Y0SN 2HYJA 2M8GX 4UUSA 1W0UA 4DZPA 2E19A 2E2HJ 4JX4A 5E3NA 1IGNA 1ETQA 3QQAA 4A3DJ 5FLMJ 3OSFA 1JUSA 1HDPA 2DTZA 5BNGA 4A3EJ 3BR5A 3PO2J 3B6AA 4JX6A 3JRBA 3NARA 1K61A 5IYDJ 3S17J 3TW7A 4DW6A 2O7OA 1LFBA 2L7ZA 1TWHJ 2HDDA 1FIPA 4M3EA 4JYKA 2YS9A 2HOAA 5FKOA 3S16J 1G2HA 4XRMA 4C3HJ 1E3OC 2OPTA 3JRHA 5M5YJ 3UKGA 1IG7A 1WH5A 1VF9A 1T56A 1UHSA 3GTKJ 1AU7A 4A3CJ 3GTGJ 1U9NA 2K9SA 1GUUA 2NS7A 1ETKA 3QPSA 2Y31A 1HCRA 1MBEA 3A01A 2XRLA 3HOYJ 1WCMJ 2NVYJ 1MBGA 2JWTA 2L9RA 3HOUJ 2JJ7A 1POGA 4DYCA 3ZQFA 2I10A 3L1PA 2ECCA 2EZIA 2NVXJ 2LLKA 2CU7A 3SDGA 2CUFA 4L5EA 3HOZJ 2M2EA 3A03A 3BR0A 1JJ8C 1X58A 4C2MJ 4LOCA 2HXOA 1NTCA 5EYRA 4B1RA 3IV5A 1IC8A 1PUFB 2LD5A 1VNDA 4W97A 1EF4A 5F08A 9ANTA 2DMPA 4S0HB 2NS8A 3G1OA 3BT9A 3BR3A 1B72B 3ZQHA 1BW6A 3K2AA 2JA8J 1OCTC 3LSRA 1VI0A 1ETWA 4QSHA 5GPCA 1MBHA 3OSGA 5GPAA 2NVQJ 2E2JJ 1HOMA 2DMTA 3S2HJ 3CQZJ 3S1RJ 2MSYA 3BR2A 3DCFA 1YRNB 1IUFA 2KDZA 3S14J 1ITYA 1X2MA 3I4MJ 2EBIA 1RETA 2XSDC 3LNQA 1LE8A 3HB9A 1SANA 2D5VA 1JT6A 1Z77A 4NDLA 2EZLA 3HOXJ 3A01B 3HM5A 3LSPA 1HLVA 4RDUA 4M3DA 4FTHA 5E3OA 1RPWA 3O8HA 3RQIA 4ABZA 4MO7A 5EZHA 2QF7A 2VUMJ 3HBLA 4XIDA 5EGOB 5M5WJ 1ZGWA 5EEAA 1I6HJ 1LFUP 3BG3A 2XPVA 2R93J 2JA6J 4A3IJ 2AHQA 5J1YA 1GVDA 2VKVA 3A02A 2HQ5A 5F1JA 4CYCB 3SFIA 1S7EA 1A6IA 1AKHA 2CUEA 2R92J 4G12A 2LFBA 3HKZN 1IRZA 5FKLA 2H8RA 3MVPA 4A69C 1TWGJ 3SJMA 3BTIA 4UUSB 3DEWA 2XB0X 2EZKA 2DA1A 1NK3P 3S2DJ 5K7ZA 2EZHA 5F0CA 1VFCA 1QVUA 2K9NA 2XGDA 5IYCJ 1FJLA 1BW5A 1DU0A 5DTDA 2B63J 1ETYA 3D1NI 2DA6A 5E3MA 2EQRA 1GV2A 3BR6A 1Z0XA 3JR9A 5EZGA 2M34A 2Y9YA 4C3IJ 1B8IA 2VKEA 1QVTA 3MKLA 3GTPJ 1APLC 4A3LJ 1F43A 1ETVA 1JT0A 4V2FA 2ID6A 3TW6A 4BY7J 3I4NJ 2L0KA 3VPRA 5EGOA 4W1UA 3FISA 3M3YJ 2MG4A 2HOSA 1MH4A 4A3JJ 1JGGA 5C4XJ 1OFCX 3GTOJ 1JKRC 2XGCA 4BY1J 1YRNA 5EG0B 2X48A 1JKPC 1P7JA 2LVSA 1ZQ3P 5FKMA 4IEJA 1ORKA 1LE8B 5F0HA 3GTLJ 1QPIA 2JN6A 4B3AA 3S1MJ 3NAUA 1I3QJ 2CQQA 1JKQC 3GTJJ 2MGQA 3WHCA 1TWAJ 2LP0A 2OF7A 2R5ZA 4D7MA 4I76A 4M3BA 3JRFA 1WGXA 5E3LA 3W6VA 4MFEA 3BTCA 2WAQN 5EDNA 3B6CA 2FJ1A 1U78A 2GLOA 3HEFA 1F36A 2XPWA 5HODA 1XS9A 4BBRJ 2HI3A 1GT0C 2ZB9A 3K7AJ 3BTLA 2G0EA 4DZJA 1PUFA 2R0QC 3HOVJ 5GP9A 4J19A 2GM4A 1WPKA 5FLVA 3GTMJ 3BR1A 4CYCA 4HNVA 4A3MJ 1IJWC 2IEKA 5DS9A 3E7LA 5FJ8J 3Q0VA 2R5YA 3RZDJ 1HDDC 2M0CA 3FIWA 2DA4A 3IH3A 4MFDA 2EH3A 2WB1N 3Q0WA 3TP3A 1BL0A 5F0FA 3WHBA 1JTXA 1O4XA 1NK2P 2JA5J 1MH3A 2E1OA 3Q3SA 3JRCA 4XRSA 4DYRA 1GV5A 4A3KJ 2DA2A 3HGYA 2PMZN 3RKQA 2XGEA 4FE4A 3TEDA 2COBA 3PO3J 3BG5A 1SFOJ 2M9HA 2DA5A 3CDLA 3ZQLA 2P81A 4EEFG 4AUXA 4D5FA 4JX5A 3BG9A 3LSGA 5IP6A 2NVTJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RR7 A;  2Y30 A;  2KT0 A;  5IP9 J;  2LK2 A;  1FEX A;  2E2I J;  1ZKG A;  2AO9 A;  1IV6 A;  3JRG A;  1A5J A;  2Y2Z A;  1Y1V J;  3JRD A;  4A93 J;  1QRY A;  2CJJ A;  3ZQG A;  3JRA A;  1FIA A;  1B72 A;  1JTY A;  2IAI A;  2DJN A;  2CQX A;  2RAE A;  1ZR4 A;  1UMQ A;  5M3F J;  2FX0 A;  2L7M P;  1MSF C;  4IHV A;  1H8A C;  4Y52 J;  1BJZ A;  5IP7 J;  1MBK A;  4IHX A;  3GBG A;  1R9T J;  3FKI J;  2ID3 A;  1U8B A;  1TWF J;  5K7F A;  4FIS A;  3FK7 A;  2ELK A;  5M5X J;  3S1Q J;  5IOZ A;  1WI3 A;  3ZQC A;  5C3E J;  1JUM A;  2X9D A;  5IPA A;  3H0G J;  4X1E A;  1ZR2 A;  1HF0 A;  2TCT A;  2XB5 A;  4DYQ A;  1MSE C;  1GDT A;  3JRE A;  3LOC A;  4XRS G;  4BKX A;  1JUP A;  3LSJ A;  1OCP A;  1T33 A;  3S15 J;  5IYB J;  1MNM C;  5F04 A;  5EF6 A;  1AHD P;  4M3G A;  2NOG A;  3TP0 A;  1TC3 C;  1ETO A;  1Q1V A;  1JJ6 C;  2CRG A;  2DA7 A;  1ETX A;  2HOT A;  2H1K A;  2K40 A;  3Q0U A;  2O8K A;  2R5Y B;  3PM1 A;  2N8G A;  2FD5 A;  2DMQ A;  4B4C A;  2K9Q A;  3H3V K;  2IBD A;  3GTQ J;  1W0T A;  3HOW J;  1RKW A;  2DN0 A;  3S1N J;  4IHW A;  4D7N A;  3BQZ A;  2VI6 A;  4RBO A;  2MW8 A;  4IHY A;  3M4O J;  2GBY A;  2W48 A;  4BXX J;  1FTT A;  4C3J J;  5C4J J;  4AYB N;  5K7H A;  2HXI A;  3IH4 A;  2FQ4 A;  1H89 C;  2LR8 A;  1ZK8 A;  3OIO A;  1AKH B;  1MBJ A;  2QCO A;  4AC0 A;  3O8G A;  2LTP A;  1ENH A;  3JRI A;  4X6A J;  2DMN A;  1FTZ A;  3ZOB A;  1ZTR A;  2R5Z B;  3RZO J;  2YU9 J;  4JP0 A;  4M3F A;  1RKT A;  2VPR A;  2ECB A;  4MIM A;  3ZQI A;  4BBS J;  5J1U A;  2O9L A;  1H88 C;  1I50 J;  2R7Z J;  4FE7 A;  5EG0 A;  2DMU A;  2L7F P;  5J1R A;  5M3M J;  1OJL A;  3G1M A;  1IDY A;  1MBF A;  1WH7 A;  4XK4 A;  4M6V A;  3OOU A;  2ME6 A;  4D5C A;  1P7I A;  3C2B A;  4QIW N;  5J3L A;  3FK6 A;  3HDD A;  1XG1 A;  1X2N A;  2Y9Z A;  4FCY A;  2LY9 A;  4GFB A;  1K83 J;  3HGG A;  2DA3 A;  4V2G A;  2TRT A;  4UUT A;  1D5Y A;  4A3G J;  5FKK A;  1CQT A;  5JLX A;  5IOY A;  2XPU A;  5JLW A;  4I6Z A;  2JK3 A;  5C44 J;  3G1L A;  1RES A;  3IH2 A;  4A3B J;  1B8I B;  2ME0 A;  3MN2 A;  3BQY A;  1Y1W J;  3CMY A;  1TWC J;  4Y7N J;  2JMW A;  4A3F J;  3BTJ A;  3CCY A;  3F0C A;  1U9O A;  1DU6 A;  5FKN A;  1JKO C;  4MLO A;  5F27 A;  4XIC A;  2YUS A;  2JA7 J;  2LKX A;  2X6O A;  1IDZ A;  4QTR A;  2WV1 A;  3QPL A;  1UG2 A;  1XC5 A;  1BA5 A;  2Y0S N;  2HYJ A;  2M8G X;  4UUS A;  1W0U A;  4DZP A;  2E19 A;  2E2H J;  4JX4 A;  5E3N A;  1IGN A;  1ETQ A;  3QQA A;  4A3D J;  5FLM J;  3OSF A;  1JUS A;  1HDP A;  2DTZ A;  5BNG A;  4A3E J;  3BR5 A;  3PO2 J;  3B6A A;  4JX6 A;  3JRB A;  3NAR A;  1K61 A;  5IYD J;  3S17 J;  3TW7 A;  4DW6 A;  2O7O A;  1LFB A;  2L7Z A;  1TWH J;  2HDD A;  1FIP A;  4M3E A;  4JYK A;  2YS9 A;  2HOA A;  5FKO A;  3S16 J;  1G2H A;  4XRM A;  4C3H J;  1E3O C;  2OPT A;  3JRH A;  5M5Y J;  3UKG A;  1IG7 A;  1WH5 A;  1VF9 A;  1T56 A;  1UHS A;  3GTK J;  1AU7 A;  4A3C J;  3GTG J;  1U9N A;  2K9S A;  1GUU A;  2NS7 A;  1ETK A;  3QPS A;  2Y31 A;  1HCR A;  1MBE A;  3A01 A;  2XRL A;  3HOY J;  1WCM J;  2NVY J;  1MBG A;  2JWT A;  2L9R A;  3HOU J;  2JJ7 A;  1POG A;  4DYC A;  3ZQF A;  2I10 A;  3L1P A;  2ECC A;  2EZI A;  2NVX J;  2LLK A;  2CU7 A;  3SDG A;  2CUF A;  4L5E A;  3HOZ J;  2M2E A;  3A03 A;  3BR0 A;  1JJ8 C;  1X58 A;  4C2M J;  4LOC A;  2HXO A;  1NTC A;  5EYR A;  4B1R A;  3IV5 A;  1IC8 A;  1PUF B;  2LD5 A;  1VND A;  4W97 A;  1EF4 A;  5F08 A;  9ANT A;  2DMP A;  4S0H B;  2NS8 A;  3G1O A;  3BT9 A;  3BR3 A;  1B72 B;  3ZQH A;  1BW6 A;  3K2A A;  2JA8 J;  1OCT C;  3LSR A;  1VI0 A;  1ETW A;  4QSH A;  5GPC A;  1MBH A;  3OSG A;  5GPA A;  2NVQ J;  2E2J J;  1HOM A;  2DMT A;  3S2H J;  3CQZ J;  3S1R J;  2MSY A;  3BR2 A;  3DCF A;  1YRN B;  1IUF A;  2KDZ A;  3S14 J;  1ITY A;  1X2M A;  3I4M J;  2EBI A;  1RET A;  2XSD C;  3LNQ A;  1LE8 A;  3HB9 A;  1SAN A;  2D5V A;  1JT6 A;  1Z77 A;  4NDL A;  2EZL A;  3HOX J;  3A01 B;  3HM5 A;  3LSP A;  1HLV A;  4RDU A;  4M3D A;  4FTH A;  5E3O A;  1RPW A;  3O8H A;  3RQI A;  4ABZ A;  4MO7 A;  5EZH A;  2QF7 A;  2VUM J;  3HBL A;  4XID A;  5EGO B;  5M5W J;  1ZGW A;  5EEA A;  1I6H J;  1LFU P;  3BG3 A;  2XPV A;  2R93 J;  2JA6 J;  4A3I J;  2AHQ A;  5J1Y A;  1GVD A;  2VKV A;  3A02 A;  2HQ5 A;  5F1J A;  4CYC B;  3SFI A;  1S7E A;  1A6I A;  1AKH A;  2CUE A;  2R92 J;  4G12 A;  2LFB A;  3HKZ N;  1IRZ A;  5FKL A;  2H8R A;  3MVP A;  4A69 C;  1TWG J;  3SJM A;  3BTI A;  4UUS B;  3DEW A;  2XB0 X;  2EZK A;  2DA1 A;  1NK3 P;  3S2D J;  5K7Z A;  2EZH A;  5F0C A;  1VFC A;  1QVU A;  2K9N A;  2XGD A;  5IYC J;  1FJL A;  1BW5 A;  1DU0 A;  5DTD A;  2B63 J;  1ETY A;  3D1N I;  2DA6 A;  5E3M A;  2EQR A;  1GV2 A;  3BR6 A;  1Z0X A;  3JR9 A;  5EZG A;  2M34 A;  2Y9Y A;  4C3I J;  1B8I A;  2VKE A;  1QVT A;  3MKL A;  3GTP J;  1APL C;  4A3L J;  1F43 A;  1ETV A;  1JT0 A;  4V2F A;  2ID6 A;  3TW6 A;  4BY7 J;  3I4N J;  2L0K A;  3VPR A;  5EGO A;  4W1U A;  3FIS A;  3M3Y J;  2MG4 A;  2HOS A;  1MH4 A;  4A3J J;  1JGG A;  5C4X J;  1OFC X;  3GTO J;  1JKR C;  2XGC A;  4BY1 J;  1YRN A;  5EG0 B;  2X48 A;  1JKP C;  1P7J A;  2LVS A;  1ZQ3 P;  5FKM A;  4IEJ A;  1ORK A;  1LE8 B;  5F0H A;  3GTL J;  1QPI A;  2JN6 A;  4B3A A;  3S1M J;  3NAU A;  1I3Q J;  2CQQ A;  1JKQ C;  3GTJ J;  2MGQ A;  3WHC A;  1TWA J;  2LP0 A;  2OF7 A;  2R5Z A;  4D7M A;  4I76 A;  4M3B A;  3JRF A;  1WGX A;  5E3L A;  3W6V A;  4MFE A;  3BTC A;  2WAQ N;  5EDN A;  3B6C A;  2FJ1 A;  1U78 A;  2GLO A;  3HEF A;  1F36 A;  2XPW A;  5HOD A;  1XS9 A;  4BBR J;  2HI3 A;  1GT0 C;  2ZB9 A;  3K7A J;  3BTL A;  2G0E A;  4DZJ A;  1PUF A;  2R0Q C;  3HOV J;  5GP9 A;  4J19 A;  2GM4 A;  1WPK A;  5FLV A;  3GTM J;  3BR1 A;  4CYC A;  4HNV A;  4A3M J;  1IJW C;  2IEK A;  5DS9 A;  3E7L A;  5FJ8 J;  3Q0V A;  2R5Y A;  3RZD J;  1HDD C;  2M0C A;  3FIW A;  2DA4 A;  3IH3 A;  4MFD A;  2EH3 A;  2WB1 N;  3Q0W A;  3TP3 A;  1BL0 A;  5F0F A;  3WHB A;  1JTX A;  1O4X A;  1NK2 P;  2JA5 J;  1MH3 A;  2E1O A;  3Q3S A;  3JRC A;  4XRS A;  4DYR A;  1GV5 A;  4A3K J;  2DA2 A;  3HGY A;  2PMZ N;  3RKQ A;  2XGE A;  4FE4 A;  3TED A;  2COB A;  3PO3 J;  3BG5 A;  1SFO J;  2M9H A;  2DA5 A;  3CDL A;  3ZQL A;  2P81 A;  4EEF G;  4AUX A;  4D5F A;  4JX5 A;  3BG9 A;  3LSG A;  5IP6 A;  2NVT J; 
#chains in the Genus database with same CATH topology
 3LAJ A;  4P5O A;  2Y30 A;  1DP3 A;  1SC7 A;  3QAH A;  1U5T B;  2KJC A;  1YYV A;  1ZHF A;  2AO9 A;  4ZYA A;  3CCE I;  4RB1 A;  1BC7 C;  2BY1 A;  5HLI A;  1YJN I;  3JCU C;  3JRD A;  4A93 J;  1QRY A;  3JRA A;  2G7H A;  1B72 A;  2IAI A;  5K1Y A;  3ABL H;  2BHZ A;  1Z3X A;  1UMQ A;  2J5O A;  3CLQ A;  2DDA A;  2FX0 A;  4BS9 A;  4F7Z A;  5FRN A;  4Y52 J;  2DQR A;  2HR3 A;  5KAF C;  1R9T J;  1R4N B;  3IC7 A;  5FFX A;  4Q5S F;  2VBZ A;  4NB5 A;  2X0L A;  2JUG A;  4ZJZ A;  4FIS A;  1W5C C;  2JRM A;  4D0P A;  2ELK A;  4HF2 A;  3WTY C;  1P4X A;  2EFW A;  1FSH A;  1K6O A;  4B48 A;  4C9Y A;  3HXL A;  4N4N B;  3KP4 A;  3ZMZ A;  4RLQ A;  5IPA A;  3MQ0 A;  1W7P A;  3VSL A;  3CC4 I;  2TCT A;  1DDN A;  1MSE C;  2HEO A;  4L5J A;  4NC8 A;  4PJJ A;  1UFM A;  2BY3 A;  2W25 A;  2Z5U A;  2EV6 A;  3OS0 A;  4F93 B;  2L3D A;  1E17 A;  3LSJ A;  4BHP A;  4LK0 F;  4HX7 A;  2NRA C;  1T33 A;  1WFX A;  5IYB J;  1SVM A;  2L54 A;  2M4G A;  2JUC A;  2D2W A;  2JT1 A;  1TZL A;  1Z7U A;  3K69 A;  4ENK A;  3ERM A;  4U88 A;  3S2W A;  4RM3 A;  4CCO A;  5FB2 A;  4IPA A;  2XF5 A;  2H1K A;  2O8K A;  2O03 A;  3QPH A;  2O3F A;  2K9Q A;  3H3V K;  2IBD A;  1HKQ A;  4NC7 A;  1OYW A;  3V7S A;  1XDU A;  1LUJ B;  1RKW A;  2DN0 A;  1P2F A;  3S1N J;  1T0F C;  4D7N A;  3BQZ A;  2VI6 A;  4RBO A;  3RPU D;  3M4O J;  2MH2 A;  3VYR B;  1XD7 A;  3RKX A;  2XAJ A;  5C4J J;  2HDW A;  3EPZ A;  4MGR A;  4AYB N;  2HXI A;  3IH4 A;  1Z7L A;  4QWQ A;  2Z3Y A;  1H89 C;  1P6R A;  1ZK8 A;  3L9F A;  2ZO4 A;  1AKH B;  2OC6 A;  2K27 A;  2M7B A;  1J0R A;  4UV8 A;  1D8K A;  1FOW A;  4OIR F;  4AVZ A;  2V1U A;  1FTZ A;  2XHK A;  4HLX A;  4CXF A;  2FEZ A;  1VQN I;  2ZJQ F;  3GFL A;  3W6K B;  3H9J A;  4KIF A;  2QSF X;  1LEA A;  2COM A;  2XKO A;  2E60 A;  3H5A A;  2ECB A;  3B73 A;  4GGG A;  4BBS J;  5EJC A;  3TQN A;  1MJ9 A;  1AOY A;  2E34 A;  2BHY A;  2WWY A;  1K78 B;  2DMU A;  2FSW A;  4XSX F;  2IW5 A;  4O5V A;  1MBF A;  1PJR A;  1WH7 A;  2R7S A;  4BAC A;  1N77 A;  2KRH A;  2QSH X;  3OOU A;  2FU4 A;  5FD6 A;  2CMP A;  1X3Z B;  2P8T A;  2GOM A;  2HU9 A;  2GXA A;  3HDD A;  1XG1 A;  3FKJ A;  4GFB A;  3RJP A;  1D5Y A;  4UUT A;  1CQT A;  2LKP A;  1J2X A;  2ZXW H;  3E0J B;  2IGN A;  1HKS A;  1X1P A;  3IH2 A;  2BOL A;  2ME0 A;  5FO5 A;  2O0Y A;  3CMY A;  2VIX A;  1P9Q C;  2PFB A;  4A3F J;  1TBX A;  2LG4 A;  2OV7 A;  3JW4 A;  4ETS A;  3S3O A;  3DV8 A;  1HXD A;  3ZQ7 A;  2NS0 A;  4L5I A;  1XGO A;  1G6N A;  3BRO A;  5FKN A;  2HZD A;  1YHQ I;  2YUS A;  1D3Y A;  3LST A;  4G8X A;  5E79 C;  1IDZ A;  2RV8 A;  3OYC A;  5CJ9 A;  2ZC2 A;  2ZSH B;  2M87 A;  3AL0 B;  2WV1 A;  3QPL A;  2WBM A;  1BA5 A;  2CUZ A;  2Y0S N;  2M8G X;  4UUS A;  4YEJ A;  2E2H J;  5E20 A;  5E3N A;  1IGN A;  3QQA A;  1HSJ A;  2EWN A;  1I39 A;  1JUS A;  1HDP A;  2DTZ A;  2W1O A;  3M8E A;  4U7B A;  4A3E J;  3PO2 J;  4N9H A;  3TW7 A;  4DW6 A;  4RM2 A;  1UST A;  2FQ3 A;  5DEQ A;  3BDD A;  2EIL H;  5FGM A;  5FKO A;  1FZP B;  3EYY A;  1HW1 A;  2R7O A;  1D1A A;  3BOQ A;  4MTE A;  1E3O C;  1HKT A;  3OR2 C;  1KU3 A;  2A5Y B;  1QBJ A;  5J47 A;  2HQR A;  1VF9 A;  1UHS A;  3GTK J;  2CS3 A;  2CG4 A;  1OCC H;  1BR1 A;  1U9N A;  2K9S A;  1GUU A;  2DU9 A;  2OQR A;  3A0B C;  3FMS A;  1KYZ A;  3HSF A;  3VYS B;  4ZYD A;  3VSK A;  3V4G A;  1WVR A;  2B9S A;  3O2P E;  1SMY F;  3ESW B;  2YX7 A;  3ZMT A;  2XRL A;  4CCM A;  2XVC A;  1EA3 A;  3QP5 A;  4WXH A;  3GFI A;  4N9I A;  1WCM J;  5TRD A;  3IAS 2;  2CW8 A;  2JVG A;  1MND A;  4A2U A;  4MQ9 F;  2ICW G;  5HLG A;  2MC3 A;  1POG A;  1EH7 A;  4ENM A;  4OIO F;  2DOF A;  3L1P A;  4IQJ A;  2QQ8 A;  4HYE A;  2NVX J;  1FWZ A;  4ZDL A;  1J5Y A;  2WTE A;  2DPD A;  4WX9 A;  3OL3 A;  3F23 A;  3SDG A;  2CUF A;  3DQV C;  2LYC A;  2M2E A;  3REO A;  4XOR A;  1JJ8 C;  2R7X A;  3PL8 A;  4B1R A;  5EYR A;  1TQP A;  2IA0 A;  2PMH A;  5D5X B;  5CVV A;  1OLT A;  2LD5 A;  3TDZ C;  1MJB A;  2ZME B;  5GAG J;  5LD2 C;  1B4A A;  5F08 A;  2ELH A;  4BGD A;  3E6D A;  4NHJ A;  3Q5F A;  3W2W A;  2CQN A;  1B72 B;  2F4O B;  3BR3 A;  2FML A;  3ZQH A;  2JA8 J;  3V8L A;  4LLG F;  3ZMS A;  4F91 B;  1ETW A;  1L0O C;  4QSH A;  1FP1 D;  4ENN A;  4II3 A;  2X51 A;  3WE2 A;  3MMY B;  2A68 F;  3FBI B;  5ICC A;  3S2H J;  4E6K G;  3WTS C;  1YRN B;  4U0V A;  5B1B H;  5DDG A;  2CO5 A;  2KDZ A;  1T38 A;  3HKZ A;  3GX4 X;  3CUQ C;  5LHI A;  2CYY A;  4PGH A;  1W4M A;  2JQ7 A;  3FMQ A;  2XSD C;  1SAN A;  2D5V A;  1JT6 A;  5HDG A;  1GLN A;  4DQ2 A;  4M74 A;  3F22 A;  2L4A A;  4AID A;  4HRI A;  2VJ5 A;  1U0J A;  4E4H A;  3LSP A;  4OU0 A;  1HLV A;  4RDU A;  4M3D A;  3CD6 I;  3CJR B;  2ZKZ A;  3CCQ I;  4FTH A;  1OKR A;  4CCJ A;  3RQI A;  2HOE A;  4MO7 A;  4P96 A;  5EZH A;  4LIU A;  4LG3 A;  1XGS A;  4KMU X;  2VUM J;  3VDX A;  3R60 A;  3NRV A;  2DI3 A;  1ZGW A;  1ZGJ A;  4OIP F;  1LFU P;  3BG3 A;  2IRF G;  2YSR A;  3HPG A;  4DGW B;  5E1Z B;  4A3I J;  3K4J A;  1GVD A;  2BY2 A;  1BIA A;  3CDI A;  3GZ6 A;  3OYD A;  3DU5 A;  2F2E A;  1VQ7 I;  3A1Y A;  1YE9 A;  2FF4 A;  4ZZD A;  3KYD B;  4ZYH A;  3HKZ N;  3GEZ A;  5FKL A;  5ERI A;  2DCE A;  2FNA A;  3K4K A;  3F6V A;  1UAA A;  2DFF A;  5K7Z A;  4G7Z F;  5F0C A;  4EJV A;  1VFC A;  3ML6 A;  1QVU A;  3QWL A;  4GYI A;  4UV9 A;  3VOD A;  1KON A;  5B5E C;  4HW0 A;  5ILV A;  1USS A;  3R0A A;  3QYF A;  4G6T B;  1E0E A;  4R8H A;  2IA1 A;  1UJ8 A;  1FJL A;  1Z6T A;  1PDN C;  1VQ6 I;  1HQC A;  2B63 J;  1FOK A;  2EQR A;  4RAF A;  4A5M A;  2GIZ A;  2LNB A;  1ZAR A;  4KUM A;  3COA C;  3FDY A;  2UWM A;  2DO7 A;  4LB6 B;  3VWB A;  1H9T A;  3GTP J;  2LBF A;  3MD2 A;  1SVO A;  2OUM A;  2XAG A;  2EIK H;  1B9M A;  1OPC A;  1WQ2 A;  2A6T A;  4CYD A;  3M3Y J;  4YRV A;  1A36 A;  3HOT A;  3E1S A;  3FXJ A;  3U1D A;  3KLN A;  4BXF A;  1JGG A;  2R7F A;  5GAD J;  3OYG A;  1G4D A;  1QHH D;  3W2V A;  3CCM I;  3C2G A;  2M8E A;  3H3U A;  2GWR A;  4PSX A;  3RIR A;  5EG0 B;  4L0Y B;  4S04 A;  5FKM A;  1ORK A;  5D4S A;  3KP2 A;  3V42 A;  1CGP A;  4IVN A;  5F0H A;  1QPI A;  3GTL J;  4B3A A;  3I59 A;  3JAM K;  2LDU A;  3NWS A;  1TWA J;  2KFD A;  2DAO A;  2OF7 A;  3SFZ A;  2V9K A;  1SEU A;  4I76 A;  4M3B A;  5FLX K;  5E3L A;  2K3F A;  1W7P D;  5ED4 A;  3BTC A;  3LQQ A;  1IN6 A;  2Q0O A;  2ESH A;  4H0E A;  4UHT A;  2QBY A;  1O7F A;  5HOD A;  2UXX A;  2HZT A;  2P0W A;  2ZB9 A;  3BZ6 A;  3N97 A;  1TW2 A;  2FXA A;  3QOP A;  4EVI A;  3FHZ A;  4XMY A;  1PUF A;  3HOV J;  4GO1 A;  3RKY A;  3ULQ B;  4ANJ A;  2GM4 A;  1Y0N A;  3PIO F;  3GTM J;  2UZK A;  2BZT A;  1F1Z A;  2K85 A;  1OR7 C;  1IJW C;  5DS9 A;  2WAE A;  3E7L A;  5FJ8 J;  3BC8 A;  4XLH A;  2MAB A;  2R5Y A;  1B59 A;  3FIW A;  2DA4 A;  2R7T A;  2Y75 A;  5BQT A;  4A0Y A;  2WB1 N;  2RKH A;  3F8C A;  1BL0 A;  1MMD A;  1X1D A;  4IHS A;  1YJW I;  1ZAO A;  3GO5 A;  1HC8 A;  1MH3 A;  4P9U A;  1IZ1 A;  3TGN A;  1QQI A;  2GA1 A;  2OQG A;  2DXI A;  5ICE A;  2KRF A;  3DP7 A;  3H36 A;  3TED A;  3PO3 J;  4HAM A;  2DA5 A;  1N78 A;  1G3S A;  2MD5 A;  3I4P A;  2KPM A;  1Y8Q B;  2EV5 A;  4BE2 A;  3G2B A;  2HQA A;  1FBQ A;  3BY6 A;  2Q1Z B;  2W00 A;  3HRT A;  1BJA A;  2NVT J;  5HS9 A;  2KT0 A;  1PVE A;  3T8R A;  2LK2 A;  1ZKG A;  2HFH A;  4LB5 A;  2MA3 A;  3F8B A;  4TV7 A;  1IV6 A;  1TW3 A;  1A5J A;  2Y2Z A;  2QBY B;  3EDP A;  3V7C A;  2WAF A;  1U8R A;  3MWM A;  1JTY A;  2DJN A;  2CQX A;  4HLY A;  2DOE A;  1Y56 A;  2A69 F;  5CPR B;  2L7M P;  1YW8 A;  5ILU A;  5KNL A;  1FPQ A;  1MSF C;  1PP7 U;  1E2X A;  1MBK A;  3P5J A;  3SQN A;  3GBG A;  2EJR A;  3CCV I;  4QPQ A;  3CP8 A;  3FKI J;  1U8B A;  5HLH A;  2ELJ A;  2DQL A;  3U21 A;  2DPU A;  3DEU A;  3S1Q J;  4IO9 F;  6PAX A;  4LFU A;  4L18 B;  2EFO A;  3Q9V A;  3H92 A;  2K02 A;  5IOZ A;  5BPI A;  1W36 C;  2QSG X;  4X1E A;  1X3U A;  4FQG A;  4KIC A;  2VQH A;  2VBY A;  1HF0 A;  2XB5 A;  3G73 A;  5FRO A;  3CCJ I;  1P4W A;  4EJT A;  3DTI A;  4XRS G;  3ABU A;  1RI7 A;  1OCP A;  4I2O A;  5J4V A;  3K9T A;  2QEX I;  3NWT A;  4E7I A;  3ZPL A;  4F3Q A;  2CFX A;  4Y3O A;  2B0L A;  3FF5 A;  1CF7 A;  1TC3 C;  1ETO A;  1QA6 A;  1IXC A;  3AG1 H;  2PJR B;  2OD5 A;  1V3F A;  5KVR A;  2DA7 A;  1ETX A;  2HOT A;  4XLC A;  2ZXI A;  3DFG A;  2DMQ A;  5JR3 A;  2X6W A;  4EJW A;  2BW3 A;  5IT9 Z;  3HOW J;  1VQO I;  5HDK A;  4IHW A;  3FXQ A;  3AG4 H;  4HQM A;  1W36 D;  2L01 A;  4PK4 A;  2E71 A;  2IGK A;  3RSN A;  2W48 A;  3WTX C;  1FTT A;  4PGG A;  4CHU A;  3R0J A;  2F5V A;  4NQW A;  2ZXH A;  3HRU A;  5K7H A;  2FQ4 A;  2GQQ A;  5DCM B;  2LR8 A;  5D8K B;  3C18 A;  3CCL I;  3FM5 A;  2HVQ A;  1GXQ A;  1MBJ A;  1TTY A;  4BL0 B;  2CV1 A;  2HVS A;  2LTP A;  3JRI A;  3RQ4 A;  3HUG A;  3IL2 A;  2YU9 J;  2O8X A;  4FX0 A;  2XV4 S;  1STZ A;  3V7R A;  3CO6 C;  3ZQI A;  2EA2 A;  3SYT A;  2VOP A;  5J1U A;  4XSZ F;  3I9V 2;  1QGP A;  5GTI C;  3FXM A;  5HNH A;  2ZJR F;  2L7F P;  2UXN A;  3OS1 A;  1H9G A;  5M3M J;  3AKZ A;  1OJL A;  3G1M A;  2FUG 2;  3OS2 A;  2I5U A;  4XK4 A;  1X1A A;  2P7C B;  1P7I A;  2PQ8 A;  5E8I A;  4YIF A;  3OV8 A;  4CCL A;  1G3W A;  3ZMV A;  3CES A;  1X2N A;  4FCY A;  4UVA A;  1K83 J;  2JSC A;  2DA3 A;  2TRT A;  3LSM A;  3C3W A;  2P5V A;  5JLX A;  2XPU A;  2JK3 A;  4AIH A;  3G1L A;  1B6A A;  1RES A;  2ZFW A;  3RTR A;  4Q47 A;  1BI3 A;  5K5O A;  3MN2 A;  3CZ6 A;  3QP6 A;  3BQY A;  4BU2 A;  3CMA I;  1TWC J;  4AU7 A;  2VXD A;  3KP6 A;  4JOM A;  4Y7N J;  3HYI A;  2DT7 B;  2M45 A;  1W5T A;  2K86 A;  3ZGK A;  3CCY A;  3F0C A;  3KZZ A;  1HST A;  5HOO A;  1FYM A;  2R7W A;  2PI0 A;  1U9O A;  2EIJ H;  3GUD A;  5JHF A;  1DU6 A;  5F27 A;  2R7V A;  4UXN A;  4KA4 A;  2LKX A;  2FA5 A;  2X6O A;  3MFK A;  1MNE A;  4HST A;  5B66 C;  1UG2 A;  1TLH B;  5B3S H;  1LFP A;  3SZP A;  5TGT A;  2BVM A;  3WGI A;  2E19 A;  1QO0 D;  3ZQQ A;  4BNC A;  3WU0 A;  1OCZ H;  5K5R A;  4RAY A;  1V5F A;  2VON A;  1K61 A;  2Y0M A;  3F3X A;  3HOS A;  4CZC A;  2O7O A;  2M3A A;  3OMY A;  5D8L B;  1IN8 A;  3F21 A;  1TWH J;  1JE8 A;  2HDD A;  1FIP A;  2L9S A;  4M3E A;  3K1P A;  2HVR A;  3HSE A;  2DYR H;  2HOA A;  2V1D A;  4ON0 A;  3S8P A;  4DBQ A;  1G2H A;  1LNW A;  4F92 B;  2NNY A;  4IJA A;  3C2H A;  2WY8 Q;  2Q2E A;  4YFN F;  1WH5 A;  3ZMD A;  1T2K A;  1T56 A;  3VFZ A;  5LGU A;  2W7N A;  2EPF A;  4XBF A;  3GTG J;  2ZNZ A;  2RN7 A;  3F8M A;  3CME I;  4ZDO A;  1BC8 C;  1ZG3 A;  1YTY A;  4KT5 C;  2RVC A;  4E70 A;  1HCR A;  3A01 A;  1LVK A;  2VKD A;  3HSR A;  3DU6 A;  2JWT A;  4OAY A;  2QQB A;  3K4B A;  3D5S C;  2IXS A;  1TNS A;  1Y0U A;  3EUK L;  2QM3 A;  3M8J A;  2EFQ A;  2JJ7 A;  4DJA A;  3OIQ A;  2IPQ X;  3OYB A;  4ZTF A;  4XKB A;  4XRF A;  4H4K C;  2RNJ A;  4DYC A;  3W2A A;  4L9T A;  1ZG5 A;  4O3M A;  1Z21 A;  4ZDP A;  3TOB A;  4FET A;  4XNF A;  2CU7 A;  1U3E M;  1QNT A;  3A03 A;  2E1C A;  4C2M J;  2HXO A;  1I6X A;  3X2Q H;  2K3P A;  3CF2 A;  2VLA A;  2KIM A;  2JZY A;  4Y33 A;  2LKS A;  4BE0 A;  3LSI A;  3KIO A;  3WTT C;  1PUE E;  1EF4 A;  9ANT A;  1K4S A;  1IW7 F;  2XAF A;  3DBH B;  1OCT C;  3LSR A;  4M6Y A;  2WY7 Q;  1MJA A;  1SD7 A;  1JHH A;  3GFM A;  5GPA A;  2NVQ J;  1HOM A;  3TL4 X;  2DMT A;  2MSY A;  4RB0 A;  3J81 K;  2VXZ A;  2VOO A;  1IUF A;  1ZGA A;  3DTK A;  5JVT A;  1ITY A;  2PX9 A;  4FAS D;  3I71 A;  3L00 A;  3KYL A;  3K4L A;  3OR1 C;  2EBI A;  5D4R A;  5CVU A;  3LNQ A;  4M9S A;  2BE5 F;  1Z9C A;  1SD5 A;  2EZL A;  1ULY A;  3HM5 A;  1ZRD A;  4HV6 A;  3J7Z I;  5LEJ A;  1MZB A;  3F8N A;  3O8H A;  4ABZ A;  3J81 Z;  5IT9 K;  1WWX A;  2VJ4 A;  1K78 A;  3EUH C;  4IRH A;  3DPL C;  4XID A;  2MH9 A;  5BMZ A;  1XSD A;  1R71 A;  3ZP5 A;  4X0G A;  2QKM B;  1SVL A;  3HIF A;  3D5L A;  5FLX Z;  2W4S A;  2R93 J;  4O6J A;  2LH9 A;  4ESF A;  1SAU A;  2AHQ A;  4L9N A;  3KET A;  5J1Y A;  1IAW A;  3DPT A;  3A02 A;  5D6F A;  2HQ5 A;  4GRI A;  5F1J A;  4CYC B;  2IA2 A;  3WE3 A;  1Y39 A;  1AKH A;  1A6I A;  2K4B A;  3L2Q A;  5BPD A;  2KLO A;  4G12 A;  4NUB A;  2LFB A;  1XX5 A;  1QZY A;  4IQ4 A;  3WG9 A;  4RB2 C;  3GVA A;  2H6C A;  3BCA A;  5LBQ A;  2EV0 A;  3HUG B;  2H8R A;  3T0Y A;  3MVP A;  3PQJ A;  3K6G A;  3OIP A;  4PZJ A;  3HPH A;  4DNC A;  1YO5 C;  2X6Y A;  2FOK A;  2TDX A;  2RC4 A;  2XB0 X;  1HA8 A;  1Y6I A;  2DA1 A;  3S2D J;  1UG0 A;  2H27 A;  2EZH A;  1S7A A;  4PJL A;  5H6R A;  4NQW B;  2RQP A;  2VT2 A;  3SEQ A;  4J01 A;  2XGD A;  4OMZ A;  4PDK A;  1VQM I;  2CUJ A;  5DTD A;  4AIJ A;  5LRR A;  2DA6 A;  4OIQ F;  1YX3 A;  2V4J C;  2IVM A;  4Q48 A;  2XRN A;  3CUO A;  4XOT A;  2G7U A;  2M34 A;  3S93 A;  2Y9Y A;  4C30 A;  3E5Q A;  4CCN A;  1LJ9 A;  3MKY B;  3I64 A;  2BXY A;  2QZ8 A;  1APL C;  4A3L J;  1JT0 A;  3TW6 A;  1R1T A;  2WAD A;  4L9V A;  3S3N A;  3J7A Y;  4ZYE A;  3I4N J;  2VC1 A;  3VPR A;  4W1U A;  4KIS A;  3FIS A;  3ABM H;  3U9G A;  2HOS A;  2NXN B;  4A3J J;  2B7E A;  3BG6 A;  4OAZ A;  1LB2 A;  1YIT I;  2XGC A;  1J09 A;  2R4G A;  1R7J A;  3ABT A;  2BBY A;  2MBF A;  5E8G A;  1TT5 B;  1ZQ3 P;  2DT5 A;  3BPX A;  3GME A;  2XF6 A;  3VYU B;  2ISZ A;  3NAU A;  5JFR A;  2CQQ A;  2DK5 A;  3F8F A;  3WHC A;  1Z1D A;  4D7M A;  4ZH4 F;  2R7R A;  2LMD A;  3HTS B;  2WAQ N;  4BH9 A;  5EDN A;  3B6C A;  1U78 A;  4XON A;  5ILS A;  3LFU A;  1YFH A;  1ON1 A;  3HEF A;  1F36 A;  4BJ6 C;  4BDZ A;  1OYY A;  3FZV A;  4K2E A;  3TDU C;  4BBR J;  3K7A J;  2F4M B;  2Z9O A;  5DV5 A;  2JRT A;  2NOJ B;  3GCM A;  4KYW A;  2A61 A;  2UV1 A;  3FM3 A;  1DGW Y;  3BR1 A;  3I59 B;  2IS6 A;  2I8D A;  1MMG A;  2QQA A;  1LKX A;  2Z2S B;  4MQV A;  1SFE A;  1YLF A;  1OR7 A;  4HEA 2;  2FOW A;  2VB6 A;  2EH3 A;  3FXL A;  3TP3 A;  5F0F A;  4G7O F;  1XCV A;  4BUP A;  2VQC A;  2VPL A;  4F52 A;  1O4X A;  2M1B A;  5B1A H;  3I56 I;  4LIT A;  4PFP A;  4RA2 A;  2E1O A;  3Q3S A;  5F1R A;  1GV5 A;  4HPQ A;  2OU2 A;  3CCR I;  2PMZ N;  1WRJ A;  3BJO A;  1YW7 A;  4NBQ A;  4WXD A;  2XGE A;  3E97 A;  4BDY A;  3DWL E;  3JTH A;  1KZH A;  2CWE A;  5DUI A;  3DPU A;  4UNO A;  2O61 A;  3MZY A;  2EIN H;  2MYS A;  1HW5 A;  4ITV A;  1ZRF A;  2PN6 A;  1IF1 A;  2QVO A;  3ZCO A;  4A6D A;  4JX5 A;  5FD5 A;  1YQA A;  1T39 A;  4HNT A;  3EET A;  2Q2E B;  5IP6 A;  3TKY A;  2W84 A;  3U2R A;  3GFJ A;  5FRM A;  4CIC A;  1FEX A;  2M30 A;  1T95 A;  4B8X A;  1U2W A;  3JRG A;  2RRE A;  5CVJ A;  1Y1V J;  1Z6R A;  2QYO A;  3M07 A;  3PSF A;  5J8C A;  4OMY A;  5LHG A;  2CJJ A;  3ZQG A;  1FIA A;  4LG0 B;  3A4C A;  1R1U A;  4GYG A;  3KPH A;  4QPO A;  5M3F J;  2ZSI B;  2X1E A;  3HJE A;  3KE2 A;  2IT0 A;  4E7L A;  4IHV A;  2VE9 A;  1H8A C;  1BJZ A;  5IP7 J;  1F5T A;  3QPT A;  2XAU A;  4NNJ A;  3G4S I;  4GCV A;  1FP2 A;  2G9W A;  2YU3 A;  3JSP A;  1K6Y A;  1R5H A;  1R4M B;  1EH8 A;  2KZV A;  1TWF J;  3IRQ A;  4RLF A;  3ZMU A;  3AAF A;  1XSX A;  2KQR A;  3KP3 A;  5M5X J;  3V8J A;  1TQM A;  1K4T A;  1K79 A;  3IHU A;  4IOC F;  1UCR A;  4WWC A;  1BR4 A;  1FOY A;  5C3E J;  5D5V B;  1JUM A;  2X9D A;  3FHN A;  2ACJ A;  3ZXS A;  4RGS A;  4E7H A;  1O3R A;  2XAQ A;  2LSO A;  1I27 A;  2DK8 A;  3JRE A;  3HHH A;  1OIS A;  2XGX A;  3R4K A;  5JI6 A;  3LOC A;  2E1M C;  4Z6Y A;  5LLQ A;  3WTV C;  3OYL A;  5F04 A;  5EF6 A;  2DFH A;  4M3G A;  2NOG A;  3M7G A;  3RCO A;  3TP0 A;  2LF8 A;  2BGC A;  3SDB A;  4IKF A;  4R1H A;  3OY9 A;  1KU2 A;  2DFE A;  1NG7 A;  1Q1V A;  1G59 A;  2CRG A;  2R7D A;  1QHG A;  3GLL A;  3L09 A;  3L2W A;  2H94 A;  2N8G A;  2FD5 A;  4B4C A;  2VJI A;  4JBA A;  1WJE A;  4P55 A;  3PUB A;  2YR2 A;  2AXT C;  3F72 A;  1QZE A;  1IO2 A;  1KGS A;  4OOI A;  4IHY A;  3WTU C;  5TJJ A;  3ERE D;  2GBY A;  2R3S A;  3DBR B;  4BXX J;  4C3J J;  4XLF A;  3H9Q A;  3R6S A;  4BEH A;  1SFK A;  1RZ4 A;  2HPI A;  5A2Q K;  1M1E B;  1TNT A;  2FBI A;  1GHC A;  3KX2 A;  3J7A O;  2HKO A;  2QCO A;  4PJ0 C;  3ZR8 X;  1ENH A;  1VQL I;  1J75 A;  2R7Q A;  5CLS A;  3KZY A;  1ZTR A;  2M7A A;  2HTS A;  1YOV B;  2P6S A;  3HC7 A;  3M9A A;  3KLO A;  4EAT A;  4M3F A;  1IN4 A;  1XCB A;  2X6X A;  4LLN A;  2ESN A;  4MIM A;  2KIS A;  3WU2 C;  3M8F A;  1H88 C;  2R7Z J;  1TT0 A;  4FE7 A;  3H5N A;  3ZN0 A;  5J1R A;  5AIP A;  1WZ2 A;  1IDY A;  1VQK I;  2ZXJ A;  1T98 A;  3S32 A;  2AXL A;  3LWF A;  4D5C A;  4KNY A;  4IRI A;  5E18 F;  2DTR A;  3C2B A;  1O3Q A;  4QIW N;  4KIG A;  5J3L A;  3CF5 F;  3FK6 A;  3CMM A;  3P7N A;  4IF4 A;  2OA4 A;  4HBL A;  4E7Z A;  2LY9 A;  3E6B A;  1D1C A;  3FWE A;  1BI2 A;  5CVI A;  4IRG A;  2GAU A;  3ASO H;  4V2G A;  3WGH A;  1FBU A;  5JLW A;  4ZC3 A;  2GA2 A;  1XTA A;  3DTE A;  1EV7 A;  4AIK A;  4Y15 A;  2CW7 A;  3L2C A;  3PJR A;  2IGM A;  2MD0 A;  1U6G A;  2XDV A;  1YG2 A;  4A3B J;  5ICF A;  1LVA A;  1RUO A;  4MEY F;  4C2U A;  3AG3 H;  1WHU A;  4R79 A;  2JSP A;  3BTJ A;  4BAY A;  2OTL I;  4KN4 X;  4HDU A;  1MW7 A;  2EK5 A;  2Z33 A;  2E35 A;  3CDH A;  3HG9 A;  4XIC A;  1OMI A;  3QU3 A;  4CO8 A;  4EQQ A;  2Y48 A;  1WSU A;  1BR2 A;  1R5G A;  1XGM A;  3WTZ A;  2IS1 A;  1KQ0 A;  1XC5 A;  2L9V A;  2XKP A;  4II2 A;  1R22 A;  4DZP A;  3MKW B;  5L3F A;  4HSR A;  4WK8 F;  3DXJ F;  3DKX A;  3CO7 C;  4A3D J;  3PNY A;  5FLM J;  2O5R A;  1MMN A;  2BXZ A;  3OSF A;  3BR5 A;  4HF1 A;  3B6A A;  4JX6 A;  2MLG A;  3NAR A;  2FMY A;  1YI2 I;  1FMV A;  3S17 J;  2CV0 A;  2JTV A;  3GZN B;  1LFB A;  4Y13 A;  5HS8 A;  1XMA A;  2JVH A;  1BOA A;  2PEX A;  4KIT B;  3SXY A;  2XRO A;  3BPV A;  1ZG1 A;  3S16 J;  1LQ1 A;  2X4H A;  3JRH A;  5M5Y J;  3UKG A;  2FBH A;  2KL4 A;  3HZJ A;  3KFW X;  2CQ7 A;  2AQE A;  2LRD A;  4A3C J;  1DUX C;  1ZRE A;  3P9K A;  1OCR H;  3SHF A;  4UY8 I;  4EM2 A;  2W57 A;  2NS7 A;  2A5W A;  1LDK B;  1DQU A;  5K5Q A;  3QPS A;  2AS5 F;  1AWC A;  2VN2 A;  3H5R A;  3O6B B;  2Y31 A;  1MBE A;  3CCS I;  3PSI A;  4PJN A;  2F5E A;  2AQF A;  3WG7 H;  1X4O A;  1VQ9 I;  1MBG A;  1S29 A;  2FBK A;  4S05 A;  1G3Y A;  4LD5 A;  2W82 A;  3QOD A;  2PJP A;  2V9V A;  3MKZ A;  3ZQF A;  1IUY A;  2K5C A;  1WJC A;  2QWW A;  3VOE A;  5AIQ A;  1MGT A;  3AL0 C;  3HOZ J;  3ELK A;  3PUF A;  2F5D A;  2A05 A;  2KHM A;  3BR0 A;  3LSH A;  3OYJ A;  4UB6 C;  1YS7 A;  4UUV A;  1NTC A;  4BEH B;  4YIR X;  1WJA A;  1PUF B;  5IY5 H;  2BY0 A;  4W97 A;  1I5Z A;  4U7D A;  3FX3 A;  2OTJ I;  3QOE A;  4MTD A;  3G1O A;  4LG0 A;  2V26 A;  3P9C A;  4XLP F;  2OZU A;  2VOD A;  5GPC A;  2X1C A;  2E2J J;  5GAE J;  1XB4 A;  4CZZ A;  4A12 A;  4U0W A;  3S1R J;  3K70 C;  5EEH A;  3BR2 A;  3DCF A;  2EA4 A;  1KYW A;  3K0L A;  1X2M A;  2L7K A;  3L2R A;  3I4M J;  5J6X A;  1RET A;  4ESB A;  4J00 A;  1RRJ A;  4A5N A;  1J7K A;  3HRM A;  3TBI A;  3OYK A;  4KDP A;  4NDL A;  3HOX J;  3A01 B;  3UNG C;  4BQQ A;  4KMF A;  5E3O A;  1RPW A;  2A3S A;  3D5R C;  2X1D A;  2QF7 A;  1V54 H;  3HBL A;  2L9N A;  2A6E F;  4XL9 A;  1XDS A;  5M5W J;  3RYR A;  1W7P B;  5L3D A;  1TQI A;  5EEA A;  1O3S A;  2L02 A;  1TP4 A;  4CH7 A;  3TO7 A;  4E7K A;  1SD6 A;  5LEK A;  3L7W A;  2H1L A;  2RDP A;  2VKV A;  4DOZ A;  1AA7 A;  5H2F C;  1VQP I;  2DFI A;  2KJB A;  2Y69 H;  4CA0 A;  3SFI A;  3OYE A;  3IUO A;  4LK1 F;  1QU3 A;  3K10 A;  1S7E A;  2LOO A;  1B9N A;  2OCC H;  3LQR A;  4LLL A;  2R92 J;  1D0X A;  2V1X A;  5LHH A;  1S8N A;  1IRZ A;  1BI0 A;  2ZME A;  2ZNY A;  1W5S A;  3NEU A;  3KEY A;  3I0T A;  4A69 C;  4AVP A;  3I3L A;  1S6L A;  4BQO A;  3BTI A;  3SJM A;  1VTN C;  1KQ8 A;  4PSW A;  4BHB A;  1VQ8 I;  1KU9 A;  2GZW A;  1ZYR F;  5GTH C;  3TMO A;  1Q1H A;  4AD9 A;  1NK3 P;  4EGZ A;  2ISY A;  2NNN A;  1IN7 A;  4BQN A;  2Z99 A;  4GXO A;  2W85 A;  3LMM A;  2EFN A;  4YEL A;  5L3G A;  1BW5 A;  1MMA A;  1L3L A;  4M72 A;  1REP C;  5JVG F;  3PFI A;  4BQA A;  1CF7 B;  1S9H A;  3PQK A;  1Z0X A;  3JR9 A;  5EZG A;  3E5U A;  2E1M B;  2KIF A;  4XQF A;  2STW A;  4PCQ A;  4C3I J;  5LRS A;  1B8I A;  2C6Y A;  1FC3 A;  3MKL A;  1H0M A;  4FHT A;  1XMX A;  4ENJ A;  1EKE A;  1ETV A;  3WTW C;  2ID6 A;  3RI4 A;  4BY7 J;  1V4R A;  2L0K A;  1JI8 A;  2MG4 A;  1V55 H;  2KIQ A;  1BN5 A;  5C4X J;  3E6M A;  2K7L A;  3GTO J;  3IWZ A;  5D5U B;  2VC0 A;  5F6F A;  2IP2 A;  2WC2 A;  2XF7 A;  3RPQ A;  4PJM A;  4BY1 J;  4B43 A;  2X48 A;  1JKP C;  5DD8 A;  1P7J A;  2LVS A;  3CUQ A;  4Y4R A;  2VQL A;  3ZRG A;  1WJF A;  1S3J A;  2BV6 A;  2JN6 A;  3LL7 A;  3S1M J;  4GDF A;  3GW2 A;  2Z16 A;  3PFY A;  1PP8 F;  3FXK A;  2IGO A;  2XSJ C;  4D9J A;  1IRX A;  2R5Z A;  2LP0 A;  4PUS A;  3JRF A;  3BZC A;  3W6V A;  2BVL A;  4MFE A;  3K1N A;  2FJ1 A;  2GLO A;  4V19 K;  4I99 C;  3K4M A;  1HW2 A;  4YFK F;  5F64 A;  5DUK A;  2D1V A;  3IRR A;  1WKM A;  2HTJ A;  1XS9 A;  2HI3 A;  4Q4Z F;  3MZ8 A;  4A0X A;  1IRG A;  1YS6 A;  2LY1 A;  4BYY A;  2KRC A;  3WOD F;  4HNU A;  2R0Q C;  2HYF A;  5GP9 A;  1QZZ A;  2NVU B;  2RNG A;  1T08 B;  4UVC A;  4CYC A;  4HNV A;  3DLL F;  3Q0V A;  2QUF A;  1R5I D;  2H09 A;  3RZD J;  2M0C A;  1FMW A;  3IH3 A;  1HDD C;  2E5Z A;  1U5T A;  3G71 I;  3AG2 H;  1JHF A;  1I3A A;  1RR8 C;  3EYI A;  3Q0W A;  1GXP A;  3OOP A;  4EM1 A;  5J40 A;  3WHB A;  4RAG A;  1JTX A;  3RYP A;  3PNT A;  4G7H F;  2BEO A;  3I54 A;  1N25 A;  3CJQ B;  1X1C A;  4XRS A;  4DYR A;  3JRC A;  3H35 A;  2BYV E;  3RKQ A;  1RUN A;  1VQ4 I;  4BHC A;  3KP5 A;  2COB A;  3BG5 A;  4B44 A;  1R36 A;  3G6E I;  3MZH A;  3R61 A;  2VBW A;  3CDL A;  2CQK A;  3JAM Z;  3ZQL A;  3IKV A;  1DPR A;  2EIM H;  4WXC A;  1IXS B;  3ROU A;  4D5F A;  2OZ6 A;  2KDO A;  3BG9 A;  3LSG A;  2M0M A;  1RR7 A;  5IP9 J;  4HDV A;  5EEG A;  2E2I J;  3ABK H;  3Q9S A;  3LA3 A;  4I01 A;  4XLN F;  2DOA A;  1MDM A;  3BCB A;  1Z67 A;  3LA7 A;  4LIV A;  4LJZ F;  1PYV A;  4F55 A;  5KCM A;  1IV8 A;  2L4M A;  3VEP A;  2RAE A;  3QYE A;  2P4W A;  4XLE A;  3UR3 C;  1ZR4 A;  2ZJ2 A;  4EGY A;  4XM3 A;  1W1W E;  2M4K A;  3BG7 A;  3IKT A;  1FY7 A;  2P5L C;  1ZRC A;  4B3X A;  4MNU A;  2KP6 A;  3CJT B;  4IHX A;  3FXO A;  2PG4 A;  5H6Q A;  2ID3 A;  4FX4 A;  3OYH A;  2O6G E;  3I55 I;  1WJ5 A;  5K7F A;  4ZYG A;  3K70 D;  1MKM A;  3FK7 A;  3G3Z A;  3PIP F;  2FE3 A;  2KKO A;  1V5E A;  3RPU A;  2CW0 F;  1FOX A;  3B02 A;  5FFZ A;  1WI3 A;  3ZQC A;  4XLA A;  3H0G J;  2DYS H;  1ZR2 A;  4M73 A;  3BP8 A;  4M6X A;  4DYQ A;  3OYM A;  1OYI A;  1GDT A;  2DOD A;  2CH0 A;  2WB1 A;  1B1B A;  3T5X A;  2GIV A;  4RMN A;  4BKX A;  3P9I A;  1JUP A;  1UEL B;  3S15 J;  3IWF A;  5BOX A;  1MNM C;  4EJU A;  1VQ5 I;  1LEB A;  4HA8 A;  2CGP A;  2JPC A;  2HQN A;  5HDN A;  1AHD P;  2UUZ A;  2V6C A;  2DJI A;  4EV0 A;  1KA8 A;  3EUA A;  2DT6 A;  1C0W A;  1JJ6 C;  3T1B A;  1G8X A;  1J9I A;  2E7W A;  2K40 A;  2V7F A;  3Q0U A;  4IL6 C;  2R5Y B;  3PM1 A;  4RS8 A;  1Z3Y A;  3GTQ J;  2V79 A;  5H20 A;  3W3C A;  1T0F A;  3OYI A;  3DKW A;  2E36 A;  4IHT A;  1W0T A;  4CSW A;  4IOA F;  1OQY A;  3A0H C;  1X3W B;  4CCK A;  4G94 A;  5DCM A;  1NHA A;  1XSV A;  2X85 A;  2MW8 A;  5LGT A;  4ESJ A;  1NG6 A;  1RIO H;  3E5X A;  1F9N A;  5E17 F;  5DD4 A;  4KT6 A;  1EH6 A;  3E6C C;  1Y8R B;  2QEN A;  1ZLK A;  5DM6 F;  3OIO A;  2P6T A;  2VKH A;  5AON A;  1S72 I;  5HLT A;  4KJZ A;  3ZN1 A;  2LF7 A;  2H6B A;  3O8G A;  4AC0 A;  4UB8 C;  2HKX A;  4X6A J;  1WJB A;  2DMN A;  3TO6 A;  3M1E A;  3ZOB A;  4I98 B;  2R5Z B;  3RZO J;  2F48 A;  2MLK A;  4JP0 A;  5IT3 A;  2Z1D A;  2F4I A;  1R23 A;  3LA2 A;  1RKT A;  2VPR A;  2HS5 A;  5D5W B;  4Z2Y A;  5CKT A;  5JHU A;  2O9L A;  4WF2 A;  1I50 J;  5BS6 A;  3H1C A;  2IJL A;  5EG0 A;  4DIQ A;  1XGN A;  1IXR C;  3LFK A;  4ZZL A;  2L2O A;  1LDD A;  5J8F A;  4M6V A;  2QA4 I;  2ME6 A;  3KCC A;  1UZC A;  4I0A A;  1TL8 A;  2HPM A;  2FRH A;  2QKL B;  3I5U A;  3L2V A;  2JA2 A;  4OWR B;  2Y9Z A;  4MHG A;  1SD4 A;  3BJ6 A;  4ZTJ A;  1DP7 P;  1FX7 A;  3HGG A;  4A3G J;  1ON2 A;  5FKK A;  2D1H A;  5IOY A;  2QLZ A;  4I6Z A;  4RGU A;  4PFO A;  2LBF B;  5C44 J;  2A6H F;  1X19 A;  2PMZ A;  5A2Q Z;  3WU1 B;  1B8I B;  3CJN A;  2ZBK A;  1Y1W J;  2R7U A;  3IAM 2;  4JQF A;  4ASN A;  4E7S A;  2JMW A;  4CDG A;  2CSO A;  2W24 A;  1ZEL A;  4AM3 A;  1N75 A;  3I58 A;  2L5Q A;  4DBR A;  4G9Y A;  1J59 A;  5KK1 A;  1JKO C;  4MLO A;  1YJ9 I;  3OL4 A;  2JA7 J;  1D8J A;  3VYT B;  4QTR A;  3CC2 I;  3C1D A;  3N05 A;  3DF8 A;  1K7A A;  3ONQ A;  2V6E A;  2E1N A;  2HYJ A;  1S5L C;  3MEX A;  4HG2 A;  4KN7 X;  4YFX F;  3QU6 A;  1KU7 A;  1W0U A;  3N4M A;  2GXG A;  4JX4 A;  5CQE A;  1ETQ A;  3K4N A;  4CGZ A;  2YPR A;  4QLC U;  5BNG A;  3KEO A;  2EB7 A;  1BM9 A;  3JRB A;  5IYD J;  2A07 F;  4NC6 A;  2PMU A;  3RDI A;  1ZN2 A;  2L7Z A;  3HRS A;  3SZG A;  4AWX B;  2PBI A;  2QQ9 A;  3SEZ A;  2WAQ A;  4JYK A;  2YS9 A;  2HGC A;  5DM7 F;  2F5C A;  5TIS C;  5CVR A;  4XRM A;  4C3H J;  2STT A;  5CYV A;  2OPT A;  1X1B A;  3KZI C;  1LDJ A;  4WCG A;  1R49 A;  1IG7 A;  3MCZ A;  2WV0 A;  4HZF A;  3OYN A;  2HWV A;  4L9J A;  1AU7 A;  4G6Q A;  1O57 A;  3WGG A;  1ERD A;  2XAH A;  3K2Z A;  1ETK A;  2DLL A;  3KP7 A;  4HX8 A;  3S3M A;  1R00 A;  4LMY A;  2ADU A;  2MFZ A;  3QRF F;  2E5N A;  3HOY J;  2NVY J;  1SFX A;  2L9R A;  2M5W A;  1BOB A;  3SZT A;  1P4A A;  3HOU J;  1JXS A;  4UVB A;  5DYM A;  1ODD A;  3HTU A;  4Y17 A;  2JPB A;  1GVJ A;  4JK1 X;  2K9L A;  2VL8 A;  1ONV A;  2I10 A;  2K4J A;  4HX4 A;  1R1V A;  2ECC A;  2EZI A;  2WA0 A;  3GYH X;  2LLK A;  3CTA A;  4L5E A;  1YW9 A;  2HNH A;  4D1Q A;  1X58 A;  1NH3 A;  4LOC A;  3J80 Z;  3GF2 A;  3IV5 A;  1IC8 A;  2HDC A;  4P9F A;  1XN7 A;  2DDB A;  1E3P A;  3F6O A;  2KIU A;  3K4C A;  1VND A;  1Z05 A;  1WI9 A;  4XN0 A;  2DBB A;  2DMP A;  3NQO A;  2NS8 A;  4S0H B;  1O7L A;  3BT9 A;  4BE1 A;  1BW6 A;  3K2A A;  3IP4 B;  2LY2 A;  3TO9 A;  1VI0 A;  1YIJ I;  4B09 A;  3OSG A;  1MBH A;  1V5G A;  1MDM B;  3LAP A;  1UHW A;  2LC2 A;  2BW3 B;  1VZ0 A;  3CQZ J;  3DLA A;  1ACI A;  1A04 A;  1IN5 A;  2ETH A;  4KIB A;  2VQG A;  5CQG A;  3S14 J;  3A2K A;  4I09 A;  3O3K A;  1A31 A;  3OYF A;  4N0B A;  4I0B A;  2PJR A;  1FNN A;  1LE8 A;  1FT9 A;  3HB9 A;  4XN3 A;  2P7V B;  1Z77 A;  2DW4 A;  4P1W A;  1ZH5 A;  4HOB A;  4HF0 A;  4BJT A;  1D0Y A;  1OCO H;  1SMT A;  2CFO A;  3ISP A;  2NYX A;  3E3V A;  1MIJ A;  2OAZ A;  3ECO A;  1FYK A;  1UHM A;  3CLO A;  2PLY A;  1BI1 A;  3I53 A;  2F6C A;  1T8I A;  3CC7 I;  5ICG A;  4XKW A;  5EGO B;  1I1G A;  1R58 A;  5J4Y A;  2E7X A;  1I6H J;  3C7J A;  5L3C A;  3BJA A;  2XPV A;  2JA6 J;  3T8T A;  4M71 A;  4E7J A;  3W6J B;  3ASN H;  3JSO A;  3FXU A;  2Y0S A;  2Q8K A;  3J80 K;  1A6Q A;  3AFH A;  1EJ9 A;  2CUE A;  5HVQ C;  2VT3 A;  2ZCW A;  4XR6 A;  5HS7 A;  3ECH A;  1D1B A;  5L3B A;  1TWG J;  3RKW A;  3BWG A;  4UUS B;  1YIO A;  2VBX A;  5L3E A;  1JGS A;  3F9K A;  3TOA A;  3DEW A;  2ZME C;  2EZK A;  3OYA A;  4A0Z A;  4L0Z B;  1DGR M;  4M9Z A;  2ZJP F;  5KAI C;  4YII A;  4BJ5 C;  2K9N A;  3GLX A;  4IX7 A;  5IYC J;  1DU0 A;  1ETY A;  3M1C A;  5E3M A;  3D1N I;  1BIB A;  1GV2 A;  3BR6 A;  1XMK A;  3EQL F;  2D45 A;  4HQE A;  4XKC A;  3CUQ B;  3FXR A;  2VKE A;  1QVT A;  4XOP A;  1F43 A;  3GXO A;  4B47 A;  4V2F A;  2V1N A;  2GXB A;  2F5F A;  5GAH J;  3CP2 A;  2VAS A;  4EJO A;  5D6E A;  5EGO A;  4FT8 A;  2OCE A;  3U1K A;  1G3T A;  1MH4 A;  3JTG A;  1OFC X;  3GZ5 A;  1JKR C;  1E3H A;  4C2T A;  1BBY A;  2RQQ A;  3HHG A;  1YRN A;  1QPM A;  4OIN F;  2J5P A;  1RNL A;  2H8W A;  1FYL A;  1HBX G;  4EM0 B;  2XC7 A;  1XPX A;  4U87 A;  2RGV A;  4IEJ A;  2VE8 A;  4IXA A;  3QYB A;  3DBL B;  1LE8 B;  4RB3 C;  1DPU A;  2XAS A;  3KEQ A;  3FBN B;  1I3Q J;  4AYB A;  1FBS A;  1JKQ C;  2YX4 A;  3GTJ J;  2MGQ A;  1MMS A;  2KMU A;  1P92 A;  1T6S A;  1FSE A;  2XUB A;  1WGX A;  3H3Z A;  3VB2 A;  5LFA A;  1I1S A;  4I02 A;  3H0D A;  4XKV A;  1MD0 A;  4HV5 A;  2NAZ A;  2QGU A;  4A6E A;  4M9X A;  2ZFU A;  2HYG D;  3BLY A;  3J7Y J;  1D5V A;  2OBP A;  3EUH A;  2XPW A;  3FMR A;  5DCF A;  1SFU A;  1RC9 A;  1GT0 C;  2LRE A;  3BTL A;  3H9G A;  4G6D A;  4CUG A;  2G0E A;  4DZJ A;  1SAX A;  3PNV A;  1LPQ A;  4J19 A;  4LGW A;  2KZG A;  1WPK A;  1WJD A;  5FLV A;  4I7H A;  1D0Z A;  4YG2 F;  3LSK A;  1YX5 A;  4A3M J;  2IEK A;  4EMS A;  5LGN A;  3MAJ A;  4RGR A;  2IS2 A;  4MFD A;  3GWZ A;  2XIG A;  1UB9 A;  2EFP A;  1X4P A;  3V8K A;  1U5T C;  3K1M A;  2K9M A;  1ZLJ A;  5E1W A;  4BXU A;  1NK2 P;  2JA5 J;  2FNP A;  1FLI A;  4N4O B;  2GOX B;  5KHD A;  2OJE D;  2VJJ A;  2IS4 A;  4IZZ A;  4A3K J;  2DA2 A;  3HGY A;  1Z91 A;  3HL2 A;  3D0S A;  3DEE A;  1S7O A;  4RAZ A;  2CV2 A;  1O3T A;  4FE4 A;  5E1X A;  2P5K A;  1R6R A;  2M9H A;  3OWT A;  1SFO J;  4RGX A;  2V9P A;  4MEX F;  3KYC B;  5HNF A;  1IRF A;  3L2U A;  3CCU I;  2P81 A;  2MC4 A;  4AUX A;  4EEF G;  1F4K A;  1KQ9 A;  4KFC A;  3DKY A;  3BZK A;  1A35 A;  4U0Y A; 
#chains in the Genus database with same CATH homology
 1RR7 A;  2Y30 A;  2KT0 A;  5IP9 J;  2LK2 A;  1FEX A;  2E2I J;  1ZKG A;  2AO9 A;  1IV6 A;  3JRG A;  1A5J A;  2Y2Z A;  1Y1V J;  3JRD A;  4A93 J;  1QRY A;  2CJJ A;  3ZQG A;  3JRA A;  1FIA A;  1B72 A;  1JTY A;  2IAI A;  2DJN A;  2CQX A;  2RAE A;  1ZR4 A;  1UMQ A;  5M3F J;  2FX0 A;  2L7M P;  1MSF C;  4IHV A;  1H8A C;  4Y52 J;  1BJZ A;  5IP7 J;  1MBK A;  4IHX A;  3GBG A;  1R9T J;  3FKI J;  2ID3 A;  1U8B A;  1TWF J;  5K7F A;  4FIS A;  3FK7 A;  2ELK A;  5M5X J;  3S1Q J;  5IOZ A;  1WI3 A;  3ZQC A;  5C3E J;  1JUM A;  2X9D A;  5IPA A;  3H0G J;  4X1E A;  1ZR2 A;  1HF0 A;  2TCT A;  2XB5 A;  4DYQ A;  1MSE C;  1GDT A;  3JRE A;  3LOC A;  4XRS G;  4BKX A;  1JUP A;  3LSJ A;  1OCP A;  1T33 A;  3S15 J;  5IYB J;  1MNM C;  5F04 A;  5EF6 A;  1AHD P;  4M3G A;  2NOG A;  3TP0 A;  1TC3 C;  1ETO A;  1Q1V A;  1JJ6 C;  2CRG A;  2DA7 A;  1ETX A;  2HOT A;  2H1K A;  2K40 A;  3Q0U A;  2O8K A;  2R5Y B;  3PM1 A;  2N8G A;  2FD5 A;  2DMQ A;  4B4C A;  2K9Q A;  3H3V K;  2IBD A;  3GTQ J;  1W0T A;  3HOW J;  1RKW A;  2DN0 A;  3S1N J;  4IHW A;  4D7N A;  3BQZ A;  2VI6 A;  4RBO A;  2MW8 A;  4IHY A;  3M4O J;  2GBY A;  2W48 A;  4BXX J;  1FTT A;  4C3J J;  5C4J J;  4AYB N;  5K7H A;  2HXI A;  3IH4 A;  2FQ4 A;  1H89 C;  2LR8 A;  1ZK8 A;  3OIO A;  1AKH B;  1MBJ A;  2QCO A;  4AC0 A;  3O8G A;  2LTP A;  1ENH A;  3JRI A;  4X6A J;  2DMN A;  1FTZ A;  3ZOB A;  1ZTR A;  2R5Z B;  3RZO J;  2YU9 J;  4JP0 A;  4M3F A;  1RKT A;  2VPR A;  2ECB A;  4MIM A;  3ZQI A;  4BBS J;  5J1U A;  2O9L A;  1H88 C;  1I50 J;  2R7Z J;  4FE7 A;  5EG0 A;  2DMU A;  2L7F P;  5J1R A;  5M3M J;  1OJL A;  3G1M A;  1IDY A;  1MBF A;  1WH7 A;  4XK4 A;  4M6V A;  3OOU A;  2ME6 A;  4D5C A;  1P7I A;  3C2B A;  4QIW N;  5J3L A;  3FK6 A;  3HDD A;  1XG1 A;  1X2N A;  2Y9Z A;  4FCY A;  2LY9 A;  4GFB A;  1K83 J;  3HGG A;  2DA3 A;  4V2G A;  2TRT A;  4UUT A;  1D5Y A;  4A3G J;  5FKK A;  1CQT A;  5JLX A;  5IOY A;  2XPU A;  5JLW A;  4I6Z A;  2JK3 A;  5C44 J;  3G1L A;  1RES A;  3IH2 A;  4A3B J;  1B8I B;  2ME0 A;  3MN2 A;  3BQY A;  1Y1W J;  3CMY A;  1TWC J;  4Y7N J;  2JMW A;  4A3F J;  3BTJ A;  3CCY A;  3F0C A;  1U9O A;  1DU6 A;  5FKN A;  1JKO C;  4MLO A;  5F27 A;  4XIC A;  2YUS A;  2JA7 J;  2LKX A;  2X6O A;  1IDZ A;  4QTR A;  2WV1 A;  3QPL A;  1UG2 A;  1XC5 A;  1BA5 A;  2Y0S N;  2HYJ A;  2M8G X;  4UUS A;  1W0U A;  4DZP A;  2E19 A;  2E2H J;  4JX4 A;  5E3N A;  1IGN A;  1ETQ A;  3QQA A;  4A3D J;  5FLM J;  3OSF A;  1JUS A;  1HDP A;  2DTZ A;  5BNG A;  4A3E J;  3BR5 A;  3PO2 J;  3B6A A;  4JX6 A;  3JRB A;  3NAR A;  1K61 A;  5IYD J;  3S17 J;  3TW7 A;  4DW6 A;  2O7O A;  1LFB A;  2L7Z A;  1TWH J;  2HDD A;  1FIP A;  4M3E A;  4JYK A;  2YS9 A;  2HOA A;  5FKO A;  3S16 J;  1G2H A;  4XRM A;  4C3H J;  1E3O C;  2OPT A;  3JRH A;  5M5Y J;  3UKG A;  1IG7 A;  1WH5 A;  1VF9 A;  1T56 A;  1UHS A;  3GTK J;  1AU7 A;  4A3C J;  3GTG J;  1U9N A;  2K9S A;  1GUU A;  2NS7 A;  1ETK A;  3QPS A;  2Y31 A;  1HCR A;  1MBE A;  3A01 A;  2XRL A;  3HOY J;  1WCM J;  2NVY J;  1MBG A;  2JWT A;  2L9R A;  3HOU J;  2JJ7 A;  1POG A;  4DYC A;  3ZQF A;  2I10 A;  3L1P A;  2ECC A;  2EZI A;  2NVX J;  2LLK A;  2CU7 A;  3SDG A;  2CUF A;  4L5E A;  3HOZ J;  2M2E A;  3A03 A;  3BR0 A;  1JJ8 C;  1X58 A;  4C2M J;  4LOC A;  2HXO A;  1NTC A;  5EYR A;  4B1R A;  3IV5 A;  1IC8 A;  1PUF B;  2LD5 A;  1VND A;  4W97 A;  1EF4 A;  5F08 A;  9ANT A;  2DMP A;  4S0H B;  2NS8 A;  3G1O A;  3BT9 A;  3BR3 A;  1B72 B;  3ZQH A;  1BW6 A;  3K2A A;  2JA8 J;  1OCT C;  3LSR A;  1VI0 A;  1ETW A;  4QSH A;  5GPC A;  1MBH A;  3OSG A;  5GPA A;  2NVQ J;  2E2J J;  1HOM A;  2DMT A;  3S2H J;  3CQZ J;  3S1R J;  2MSY A;  3BR2 A;  3DCF A;  1YRN B;  1IUF A;  2KDZ A;  3S14 J;  1ITY A;  1X2M A;  3I4M J;  2EBI A;  1RET A;  2XSD C;  3LNQ A;  1LE8 A;  3HB9 A;  1SAN A;  2D5V A;  1JT6 A;  1Z77 A;  4NDL A;  2EZL A;  3HOX J;  3A01 B;  3HM5 A;  3LSP A;  1HLV A;  4RDU A;  4M3D A;  4FTH A;  5E3O A;  1RPW A;  3O8H A;  3RQI A;  4ABZ A;  4MO7 A;  5EZH A;  2QF7 A;  2VUM J;  3HBL A;  4XID A;  5EGO B;  5M5W J;  1ZGW A;  5EEA A;  1I6H J;  1LFU P;  3BG3 A;  2XPV A;  2R93 J;  2JA6 J;  4A3I J;  2AHQ A;  5J1Y A;  1GVD A;  2VKV A;  3A02 A;  2HQ5 A;  5F1J A;  4CYC B;  3SFI A;  1S7E A;  1A6I A;  1AKH A;  2CUE A;  2R92 J;  4G12 A;  2LFB A;  3HKZ N;  1IRZ A;  5FKL A;  2H8R A;  3MVP A;  4A69 C;  1TWG J;  3SJM A;  3BTI A;  4UUS B;  3DEW A;  2XB0 X;  2EZK A;  2DA1 A;  1NK3 P;  3S2D J;  5K7Z A;  2EZH A;  5F0C A;  1VFC A;  1QVU A;  2K9N A;  2XGD A;  5IYC J;  1FJL A;  1BW5 A;  1DU0 A;  5DTD A;  2B63 J;  1ETY A;  3D1N I;  2DA6 A;  5E3M A;  2EQR A;  1GV2 A;  3BR6 A;  1Z0X A;  3JR9 A;  5EZG A;  2M34 A;  2Y9Y A;  4C3I J;  1B8I A;  2VKE A;  1QVT A;  3MKL A;  3GTP J;  1APL C;  4A3L J;  1F43 A;  1ETV A;  1JT0 A;  4V2F A;  2ID6 A;  3TW6 A;  4BY7 J;  3I4N J;  2L0K A;  3VPR A;  5EGO A;  4W1U A;  3FIS A;  3M3Y J;  2MG4 A;  2HOS A;  1MH4 A;  4A3J J;  1JGG A;  5C4X J;  1OFC X;  3GTO J;  1JKR C;  2XGC A;  4BY1 J;  1YRN A;  5EG0 B;  2X48 A;  1JKP C;  1P7J A;  2LVS A;  1ZQ3 P;  5FKM A;  4IEJ A;  1ORK A;  1LE8 B;  5F0H A;  3GTL J;  1QPI A;  2JN6 A;  4B3A A;  3S1M J;  3NAU A;  1I3Q J;  2CQQ A;  1JKQ C;  3GTJ J;  2MGQ A;  3WHC A;  1TWA J;  2LP0 A;  2OF7 A;  2R5Z A;  4D7M A;  4I76 A;  4M3B A;  3JRF A;  1WGX A;  5E3L A;  3W6V A;  4MFE A;  3BTC A;  2WAQ N;  5EDN A;  3B6C A;  2FJ1 A;  1U78 A;  2GLO A;  3HEF A;  1F36 A;  2XPW A;  5HOD A;  1XS9 A;  4BBR J;  2HI3 A;  1GT0 C;  2ZB9 A;  3K7A J;  3BTL A;  2G0E A;  4DZJ A;  1PUF A;  2R0Q C;  3HOV J;  5GP9 A;  4J19 A;  2GM4 A;  1WPK A;  5FLV A;  3GTM J;  3BR1 A;  4CYC A;  4HNV A;  4A3M J;  1IJW C;  2IEK A;  5DS9 A;  3E7L A;  5FJ8 J;  3Q0V A;  2R5Y A;  3RZD J;  1HDD C;  2M0C A;  3FIW A;  2DA4 A;  3IH3 A;  4MFD A;  2EH3 A;  2WB1 N;  3Q0W A;  3TP3 A;  1BL0 A;  5F0F A;  3WHB A;  1JTX A;  1O4X A;  1NK2 P;  2JA5 J;  1MH3 A;  2E1O A;  3Q3S A;  3JRC A;  4XRS A;  4DYR A;  1GV5 A;  4A3K J;  2DA2 A;  3HGY A;  2PMZ N;  3RKQ A;  2XGE A;  4FE4 A;  3TED A;  2COB A;  3PO3 J;  3BG5 A;  1SFO J;  2M9H A;  2DA5 A;  3CDL A;  3ZQL A;  2P81 A;  4EEF G;  4AUX A;  4D5F A;  4JX5 A;  3BG9 A;  3LSG A;  5IP6 A;  2NVT J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...