4XS5A

Crystal structure of sulfate transporter/antisigma-factor antagonist stas from dyadobacter fermentans dsm 18053
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
DFKLEKKEQYVYIETDAPAFAGDVPAAFEETARSLFREGYHSLIVNMQTVKSLDATGITTLKKVNYLCANDLGMLAIVTRDDDFIDLLEDLRIPDLTVLPTKEEAIDAVFMHSLENEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfate transporter/antisigma-factor antagonist STAS
publication title Crystal structure of Sulfate transporter/antisigma-factor antagonist STAS from Dyadobacter fermentans DSM 18053
rcsb
source organism Dyadobacter fermentans (strain atcc 700827 / dsm 18053 / ns114)
molecule tags Transport protein
total genus 38
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4xs5A00
1SBOA 2KLNA 4DGFA 4DGHA 3ZXNA 3AGEA 5EUWA 1TH8B 3OIRA 3IHAA 1VC1A 5EUZA 5EZBA 3LKLA 3MGLA 1TIDB 5EUSA 1T6RA 1THNB 5EUXA 3T6OA 1H4XA 1H4YA 3IH8A 5EUUA 3IH9A 2KA5A 3IF5A 1TILB 3OIZA 4XS5A 3IHBA 1H4ZA 2VY9A 4QTPA 3ZTBA 4HYLA 1AUZA 3AGDA 1BUZA 3F43A 3NY7A 3LLOA
chains in the Genus database with same CATH superfamily
2KLNA 4DGHA 3OIRA 3IHAA 2AS0A 3VSEA 3LKLA 3MGLA 1WXWA 1H4YA 4GHNA 2B78A 3D3UA 3OIZA 3IHBA 4QTPA 3LLOA 1K32A 1HF2A 3ZXNA 3AGEA 4AEJA 1FCFA 4L1CA 4AE2A 5EZBA 5EUSA 1FC7A 1T6RA 3C0KA 2OASA 1TILB 4HIZA 3GMFA 4L8KA 3ZTBA 1BUZA 3EH7A 2RRLA 1SBOA 3DJAA 4DMGA 4DGFA 3DUPA 2ZO9B 3GVJA 3V97A 5EUWA 3QDQA 5EUZA 1TIDB 3D03A 5EUXA 3T6OA 3IH8A 5EUUA 3IH9A 1N6FA 1N6EA 3IF5A 4XS5A 1J7XA 1H4ZA 1BPLA 1AUZA 3AGDA 3LDFA 3F43A 3NY7A 3GHFA 3JU4A 1TH8B 3V8VA 1N6DA 1FC9A 1VC1A 2ZOAA 1V0FA 1WXXA 1V0EA 3MOGA 1THNB 4JC0A 3GVKA 1H4XA 2DXLA 2KA5A 1FC6A 3DORA 2CWWA 3GVLA 3GK7A 2VY9A 4HYLA 3K50A 2DXNA
chains in the Genus database with same CATH topology
1SBOA 2KLNA 4DGFA 4DGHA 3ZXNA 3AGEA 5EUWA 1TH8B 3OIRA 3IHAA 1VC1A 5EUZA 5EZBA 3LKLA 3MGLA 1TIDB 5EUSA 1T6RA 1THNB 5EUXA 3T6OA 1H4XA 1H4YA 3IH8A 5EUUA 3IH9A 2KA5A 3IF5A 1TILB 3OIZA 4XS5A 3IHBA 1H4ZA 2VY9A 4QTPA 3ZTBA 4HYLA 1AUZA 3AGDA 1BUZA 3F43A 3NY7A 3LLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBO A;  2KLN A;  4DGF A;  4DGH A;  3ZXN A;  3AGE A;  5EUW A;  1TH8 B;  3OIR A;  3IHA A;  1VC1 A;  5EUZ A;  5EZB A;  3LKL A;  3MGL A;  1TID B;  5EUS A;  1T6R A;  1THN B;  5EUX A;  3T6O A;  1H4X A;  1H4Y A;  3IH8 A;  5EUU A;  3IH9 A;  2KA5 A;  3IF5 A;  1TIL B;  3OIZ A;  4XS5 A;  3IHB A;  1H4Z A;  2VY9 A;  4QTP A;  3ZTB A;  4HYL A;  1AUZ A;  3AGD A;  1BUZ A;  3F43 A;  3NY7 A;  3LLO A; 
#chains in the Genus database with same CATH topology
 2KLN A;  4DGH A;  3OIR A;  3IHA A;  2AS0 A;  3VSE A;  3LKL A;  3MGL A;  1WXW A;  1H4Y A;  4GHN A;  2B78 A;  3D3U A;  3OIZ A;  3IHB A;  4QTP A;  3LLO A;  1K32 A;  1HF2 A;  3ZXN A;  3AGE A;  4AEJ A;  1FCF A;  4L1C A;  4AE2 A;  5EZB A;  5EUS A;  1FC7 A;  1T6R A;  3C0K A;  2OAS A;  1TIL B;  4HIZ A;  3GMF A;  4L8K A;  3ZTB A;  1BUZ A;  3EH7 A;  2RRL A;  1SBO A;  3DJA A;  4DMG A;  4DGF A;  3DUP A;  2ZO9 B;  3GVJ A;  3V97 A;  5EUW A;  3QDQ A;  5EUZ A;  1TID B;  3D03 A;  5EUX A;  3T6O A;  3IH8 A;  5EUU A;  3IH9 A;  1N6F A;  1N6E A;  3IF5 A;  4XS5 A;  1J7X A;  1H4Z A;  1BPL A;  1AUZ A;  3AGD A;  3LDF A;  3F43 A;  3NY7 A;  3GHF A;  3JU4 A;  1TH8 B;  3V8V A;  1N6D A;  1FC9 A;  1VC1 A;  2ZOA A;  1V0F A;  1WXX A;  1V0E A;  3MOG A;  1THN B;  4JC0 A;  3GVK A;  1H4X A;  2DXL A;  2KA5 A;  1FC6 A;  3DOR A;  2CWW A;  3GVL A;  3GK7 A;  2VY9 A;  4HYL A;  3K50 A;  2DXN A; 
#chains in the Genus database with same CATH homology
 1SBO A;  2KLN A;  4DGF A;  4DGH A;  3ZXN A;  3AGE A;  5EUW A;  1TH8 B;  3OIR A;  3IHA A;  1VC1 A;  5EUZ A;  5EZB A;  3LKL A;  3MGL A;  1TID B;  5EUS A;  1T6R A;  1THN B;  5EUX A;  3T6O A;  1H4X A;  1H4Y A;  3IH8 A;  5EUU A;  3IH9 A;  2KA5 A;  3IF5 A;  1TIL B;  3OIZ A;  4XS5 A;  3IHB A;  1H4Z A;  2VY9 A;  4QTP A;  3ZTB A;  4HYL A;  1AUZ A;  3AGD A;  1BUZ A;  3F43 A;  3NY7 A;  3LLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...