4XSHB

The complex structure of c3cer exoenzyme and gtp bound rhoa (nadh-bound state)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 67
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4xshB00
5D1UA 2C8BX 4PKRA 2C8EE 1GIRA 2C89A 5H03A 4PKWA 1J7NA 4PKQA 1PWVA 2J3VA 2A9KB 1PWWA 3BUZA 4FMLA 3NTSA 5D1TA 1OG3A 2BOVB 2WN4A 2C8FE 1GIQA 1GXYA 1PWQA 4FK7A 4H0XA 1ZXVA 4XM7A 1OG1A 4XSHB 2WN8A 4H03A 1R45A 1QS2A 4GF1A 1YQYA 2WN7A 4XM8A 4DV8A 1G24A 4H0TA 1PWPA 5H04A 4FXQA 4TR5A 4PKSA 4XSGB 2C8CA 2C8GA 2GWLA 4PKTA 1R4BA 1GXZA 4H0YA 4H0VA 4PKVA 1OJZA 2GWMA 5BWMB 3U0JA 2C8DA 1QS1A 2C8HA 2WN6A 5DZQA 4ELNA 1GZEA 2C8AA 4XM6A 4GY2A 5GTTA 2A78B 1JKYA 1GZFA 2J3ZA 2J3XA 4WF6A 1PWUA 5D1SA 1GY0A 1UZIA 1OJQA 4PKUA 3BW8A 2WN5A 1OG4A
chains in the Genus database with same CATH superfamily
5D1UA 2C8BX 4PKRA 2C8EE 1GIRA 2C89A 5H03A 4PKWA 1J7NA 4PKQA 1PWVA 2J3VA 2A9KB 1PWWA 3BUZA 4FMLA 3NTSA 5D1TA 1OG3A 2BOVB 2WN4A 2C8FE 1GIQA 1GXYA 1PWQA 4FK7A 4H0XA 1ZXVA 4XM7A 1OG1A 4XSHB 2WN8A 4H03A 1R45A 1QS2A 4GF1A 1YQYA 2WN7A 4XM8A 4DV8A 1G24A 4H0TA 1PWPA 5H04A 4FXQA 4TR5A 4PKSA 4XSGB 2C8CA 2C8GA 2GWLA 4PKTA 1R4BA 1GXZA 4H0YA 4H0VA 4PKVA 1OJZA 2GWMA 5BWMB 3U0JA 2C8DA 1QS1A 2C8HA 2WN6A 5DZQA 4ELNA 1GZEA 2C8AA 4XM6A 4GY2A 5GTTA 2A78B 1JKYA 1GZFA 2J3ZA 2J3XA 4WF6A 1PWUA 5D1SA 1GY0A 1UZIA 1OJQA 4PKUA 3BW8A 2WN5A 1OG4A
chains in the Genus database with same CATH topology
5D1UA 2C8BX 4PKRA 2C8EE 1GIRA 2C89A 5H03A 4PKWA 1J7NA 4PKQA 1PWVA 2J3VA 2A9KB 1PWWA 3BUZA 4FMLA 3NTSA 5D1TA 1OG3A 2BOVB 2WN4A 2C8FE 1GIQA 1GXYA 1PWQA 4FK7A 4H0XA 1ZXVA 4XM7A 1OG1A 4XSHB 2WN8A 4H03A 1R45A 1QS2A 4GF1A 1YQYA 2WN7A 4XM8A 4DV8A 1G24A 4H0TA 1PWPA 5H04A 4FXQA 4TR5A 4PKSA 4XSGB 2C8CA 2C8GA 2GWLA 4PKTA 1R4BA 1GXZA 4H0YA 4H0VA 4PKVA 1OJZA 2GWMA 5BWMB 3U0JA 2C8DA 1QS1A 2C8HA 2WN6A 5DZQA 4ELNA 1GZEA 2C8AA 4XM6A 4GY2A 5GTTA 2A78B 1JKYA 1GZFA 2J3ZA 2J3XA 4WF6A 1PWUA 5D1SA 1GY0A 1UZIA 1OJQA 4PKUA 3BW8A 2WN5A 1OG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1U A;  2C8B X;  4PKR A;  2C8E E;  1GIR A;  2C89 A;  5H03 A;  4PKW A;  1J7N A;  4PKQ A;  1PWV A;  2J3V A;  2A9K B;  1PWW A;  3BUZ A;  4FML A;  3NTS A;  5D1T A;  1OG3 A;  2BOV B;  2WN4 A;  2C8F E;  1GIQ A;  1GXY A;  1PWQ A;  4FK7 A;  4H0X A;  1ZXV A;  4XM7 A;  1OG1 A;  4XSH B;  2WN8 A;  4H03 A;  1R45 A;  1QS2 A;  4GF1 A;  1YQY A;  2WN7 A;  4XM8 A;  4DV8 A;  1G24 A;  4H0T A;  1PWP A;  5H04 A;  4FXQ A;  4TR5 A;  4PKS A;  4XSG B;  2C8C A;  2C8G A;  2GWL A;  4PKT A;  1R4B A;  1GXZ A;  4H0Y A;  4H0V A;  4PKV A;  1OJZ A;  2GWM A;  5BWM B;  3U0J A;  2C8D A;  1QS1 A;  2C8H A;  2WN6 A;  5DZQ A;  4ELN A;  1GZE A;  2C8A A;  4XM6 A;  4GY2 A;  5GTT A;  2A78 B;  1JKY A;  1GZF A;  2J3Z A;  2J3X A;  4WF6 A;  1PWU A;  5D1S A;  1GY0 A;  1UZI A;  1OJQ A;  4PKU A;  3BW8 A;  2WN5 A;  1OG4 A; 
#chains in the Genus database with same CATH topology
 5D1U A;  2C8B X;  4PKR A;  2C8E E;  1GIR A;  2C89 A;  5H03 A;  4PKW A;  1J7N A;  4PKQ A;  1PWV A;  2J3V A;  2A9K B;  1PWW A;  3BUZ A;  4FML A;  3NTS A;  5D1T A;  1OG3 A;  2BOV B;  2WN4 A;  2C8F E;  1GIQ A;  1GXY A;  1PWQ A;  4FK7 A;  4H0X A;  1ZXV A;  4XM7 A;  1OG1 A;  4XSH B;  2WN8 A;  4H03 A;  1R45 A;  1QS2 A;  4GF1 A;  1YQY A;  2WN7 A;  4XM8 A;  4DV8 A;  1G24 A;  4H0T A;  1PWP A;  5H04 A;  4FXQ A;  4TR5 A;  4PKS A;  4XSG B;  2C8C A;  2C8G A;  2GWL A;  4PKT A;  1R4B A;  1GXZ A;  4H0Y A;  4H0V A;  4PKV A;  1OJZ A;  2GWM A;  5BWM B;  3U0J A;  2C8D A;  1QS1 A;  2C8H A;  2WN6 A;  5DZQ A;  4ELN A;  1GZE A;  2C8A A;  4XM6 A;  4GY2 A;  5GTT A;  2A78 B;  1JKY A;  1GZF A;  2J3Z A;  2J3X A;  4WF6 A;  1PWU A;  5D1S A;  1GY0 A;  1UZI A;  1OJQ A;  4PKU A;  3BW8 A;  2WN5 A;  1OG4 A; 
#chains in the Genus database with same CATH homology
 5D1U A;  2C8B X;  4PKR A;  2C8E E;  1GIR A;  2C89 A;  5H03 A;  4PKW A;  1J7N A;  4PKQ A;  1PWV A;  2J3V A;  2A9K B;  1PWW A;  3BUZ A;  4FML A;  3NTS A;  5D1T A;  1OG3 A;  2BOV B;  2WN4 A;  2C8F E;  1GIQ A;  1GXY A;  1PWQ A;  4FK7 A;  4H0X A;  1ZXV A;  4XM7 A;  1OG1 A;  4XSH B;  2WN8 A;  4H03 A;  1R45 A;  1QS2 A;  4GF1 A;  1YQY A;  2WN7 A;  4XM8 A;  4DV8 A;  1G24 A;  4H0T A;  1PWP A;  5H04 A;  4FXQ A;  4TR5 A;  4PKS A;  4XSG B;  2C8C A;  2C8G A;  2GWL A;  4PKT A;  1R4B A;  1GXZ A;  4H0Y A;  4H0V A;  4PKV A;  1OJZ A;  2GWM A;  5BWM B;  3U0J A;  2C8D A;  1QS1 A;  2C8H A;  2WN6 A;  5DZQ A;  4ELN A;  1GZE A;  2C8A A;  4XM6 A;  4GY2 A;  5GTT A;  2A78 B;  1JKY A;  1GZF A;  2J3Z A;  2J3X A;  4WF6 A;  1PWU A;  5D1S A;  1GY0 A;  1UZI A;  1OJQ A;  4PKU A;  3BW8 A;  2WN5 A;  1OG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...