4XSHB

The complex structure of c3cer exoenzyme and gtp bound rhoa (nadh-bound state)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
205
Chain Sequence
KYKLCTNKEEADAWGKKQFNKWSKEEKSAIRDYTKNARPYNEFLRMHAGKLDSDPTMKKKIESLDKALNRKEAKVNDNIKVYRGDDAWIFGKEYDNSIIKNGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYAKTRPVMTEFKVGSGTHGAYMNSDDLTAYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEATIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Rho GTPase Recognition by C3 Exoenzyme Based on C3-RhoA Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 67
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03496 ADPrib_exo_Tox ADP-ribosyltransferase exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 4xshB00
4H0XA 4H03A 2A78B 4PKTA 4XM6A 5D1SA 1JKYA 2J3XA 3BW8A 4FK7A 1PWPA 5H04A 4XSHB 2C8BX 4PKSA 4PKWA 2A9KB 4DV8A 2C89A 1GY0A 5D1TA 4PKRA 2J3ZA 2C8EE 2C8FE 2GWLA 4XM8A 1OG4A 2WN6A 1OJZA 2WN7A 1OG3A 1G24A 1PWVA 1GIRA 2C8DA 2C8HA 1UZIA 2C8CA 4H0VA 2WN4A 1OJQA 2C8AA 4PKQA 1GZEA 4GY2A 4WF6A 5D1UA 4TR5A 1PWQA 1PWWA 4H0TA 5GTTA 4FXQA 1GXYA 1YQYA 3BUZA 5DZQA 4ELNA 1GIQA 1R45A 4H0YA 4XM7A 1OG1A 4FMLA 4PKUA 2WN5A 3NTSA 4PKVA 4XSGB 1GZFA 2BOVB 2C8GA 1R4BA 1ZXVA 2GWMA 2J3VA 1QS1A 1J7NA 2WN8A 3U0JA 1QS2A 1GXZA 4GF1A 1PWUA 5BWMB 5H03A
chains in the Genus database with same CATH superfamily
4H0XA 4H03A 2A78B 4PKTA 4XM6A 5D1SA 1JKYA 2J3XA 3BW8A 4FK7A 1PWPA 5H04A 4XSHB 2C8BX 4PKSA 4PKWA 2A9KB 4DV8A 2C89A 1GY0A 5D1TA 4PKRA 2J3ZA 2C8EE 2C8FE 2GWLA 4XM8A 1OG4A 2WN6A 1OJZA 2WN7A 1OG3A 1G24A 1PWVA 1GIRA 2C8DA 2C8HA 1UZIA 2C8CA 4H0VA 2WN4A 1OJQA 2C8AA 4PKQA 1GZEA 4GY2A 4WF6A 5D1UA 4TR5A 1PWQA 1PWWA 4H0TA 5GTTA 4FXQA 1GXYA 1YQYA 3BUZA 5DZQA 4ELNA 1GIQA 1R45A 4H0YA 4XM7A 1OG1A 4FMLA 4PKUA 2WN5A 3NTSA 4PKVA 4XSGB 1GZFA 2BOVB 2C8GA 1R4BA 1ZXVA 2GWMA 2J3VA 1QS1A 1J7NA 2WN8A 3U0JA 1QS2A 1GXZA 4GF1A 1PWUA 5BWMB 5H03A
chains in the Genus database with same CATH topology
4H0XA 4H03A 2A78B 4PKTA 4XM6A 5D1SA 1JKYA 2J3XA 3BW8A 4FK7A 1PWPA 5H04A 4XSHB 2C8BX 4PKSA 4PKWA 2A9KB 4DV8A 2C89A 1GY0A 5D1TA 4PKRA 2J3ZA 2C8EE 2C8FE 2GWLA 4XM8A 1OG4A 2WN6A 1OJZA 2WN7A 1OG3A 1G24A 1PWVA 1GIRA 2C8DA 2C8HA 1UZIA 2C8CA 4H0VA 2WN4A 1OJQA 2C8AA 4PKQA 1GZEA 4GY2A 4WF6A 5D1UA 4TR5A 1PWQA 1PWWA 4H0TA 5GTTA 4FXQA 1GXYA 1YQYA 3BUZA 5DZQA 4ELNA 1GIQA 1R45A 4H0YA 4XM7A 1OG1A 4FMLA 4PKUA 2WN5A 3NTSA 4PKVA 4XSGB 1GZFA 2BOVB 2C8GA 1R4BA 1ZXVA 2GWMA 2J3VA 1QS1A 1J7NA 2WN8A 3U0JA 1QS2A 1GXZA 4GF1A 1PWUA 5BWMB 5H03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0X A;  4H03 A;  2A78 B;  4PKT A;  4XM6 A;  5D1S A;  1JKY A;  2J3X A;  3BW8 A;  4FK7 A;  1PWP A;  5H04 A;  4XSH B;  2C8B X;  4PKS A;  4PKW A;  2A9K B;  4DV8 A;  2C89 A;  1GY0 A;  5D1T A;  4PKR A;  2J3Z A;  2C8E E;  2C8F E;  2GWL A;  4XM8 A;  1OG4 A;  2WN6 A;  1OJZ A;  2WN7 A;  1OG3 A;  1G24 A;  1PWV A;  1GIR A;  2C8D A;  2C8H A;  1UZI A;  2C8C A;  4H0V A;  2WN4 A;  1OJQ A;  2C8A A;  4PKQ A;  1GZE A;  4GY2 A;  4WF6 A;  5D1U A;  4TR5 A;  1PWQ A;  1PWW A;  4H0T A;  5GTT A;  4FXQ A;  1GXY A;  1YQY A;  3BUZ A;  5DZQ A;  4ELN A;  1GIQ A;  1R45 A;  4H0Y A;  4XM7 A;  1OG1 A;  4FML A;  4PKU A;  2WN5 A;  3NTS A;  4PKV A;  4XSG B;  1GZF A;  2BOV B;  2C8G A;  1R4B A;  1ZXV A;  2GWM A;  2J3V A;  1QS1 A;  1J7N A;  2WN8 A;  3U0J A;  1QS2 A;  1GXZ A;  4GF1 A;  1PWU A;  5BWM B;  5H03 A; 
#chains in the Genus database with same CATH topology
 4H0X A;  4H03 A;  2A78 B;  4PKT A;  4XM6 A;  5D1S A;  1JKY A;  2J3X A;  3BW8 A;  4FK7 A;  1PWP A;  5H04 A;  4XSH B;  2C8B X;  4PKS A;  4PKW A;  2A9K B;  4DV8 A;  2C89 A;  1GY0 A;  5D1T A;  4PKR A;  2J3Z A;  2C8E E;  2C8F E;  2GWL A;  4XM8 A;  1OG4 A;  2WN6 A;  1OJZ A;  2WN7 A;  1OG3 A;  1G24 A;  1PWV A;  1GIR A;  2C8D A;  2C8H A;  1UZI A;  2C8C A;  4H0V A;  2WN4 A;  1OJQ A;  2C8A A;  4PKQ A;  1GZE A;  4GY2 A;  4WF6 A;  5D1U A;  4TR5 A;  1PWQ A;  1PWW A;  4H0T A;  5GTT A;  4FXQ A;  1GXY A;  1YQY A;  3BUZ A;  5DZQ A;  4ELN A;  1GIQ A;  1R45 A;  4H0Y A;  4XM7 A;  1OG1 A;  4FML A;  4PKU A;  2WN5 A;  3NTS A;  4PKV A;  4XSG B;  1GZF A;  2BOV B;  2C8G A;  1R4B A;  1ZXV A;  2GWM A;  2J3V A;  1QS1 A;  1J7N A;  2WN8 A;  3U0J A;  1QS2 A;  1GXZ A;  4GF1 A;  1PWU A;  5BWM B;  5H03 A; 
#chains in the Genus database with same CATH homology
 4H0X A;  4H03 A;  2A78 B;  4PKT A;  4XM6 A;  5D1S A;  1JKY A;  2J3X A;  3BW8 A;  4FK7 A;  1PWP A;  5H04 A;  4XSH B;  2C8B X;  4PKS A;  4PKW A;  2A9K B;  4DV8 A;  2C89 A;  1GY0 A;  5D1T A;  4PKR A;  2J3Z A;  2C8E E;  2C8F E;  2GWL A;  4XM8 A;  1OG4 A;  2WN6 A;  1OJZ A;  2WN7 A;  1OG3 A;  1G24 A;  1PWV A;  1GIR A;  2C8D A;  2C8H A;  1UZI A;  2C8C A;  4H0V A;  2WN4 A;  1OJQ A;  2C8A A;  4PKQ A;  1GZE A;  4GY2 A;  4WF6 A;  5D1U A;  4TR5 A;  1PWQ A;  1PWW A;  4H0T A;  5GTT A;  4FXQ A;  1GXY A;  1YQY A;  3BUZ A;  5DZQ A;  4ELN A;  1GIQ A;  1R45 A;  4H0Y A;  4XM7 A;  1OG1 A;  4FML A;  4PKU A;  2WN5 A;  3NTS A;  4PKV A;  4XSG B;  1GZF A;  2BOV B;  2C8G A;  1R4B A;  1ZXV A;  2GWM A;  2J3V A;  1QS1 A;  1J7N A;  2WN8 A;  3U0J A;  1QS2 A;  1GXZ A;  4GF1 A;  1PWU A;  5BWM B;  5H03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...