4XT1B

Structure of a nanobody-bound viral gpcr bound to human chemokine cx3cl1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
b'EHHGVTKCAITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G-protein coupled receptor homolog US28
publication title Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor.
pubmed doi rcsb
source organism Cytomegalovirus
molecule tags Viral protein/signalling protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xt1B00
2KOLA 4ZAIA 2EOTA 2K28A 2L12A 4CJ2C 1G6ZA 1DOLA 2B2YA 4RAUC 4R8IA 1EL0A 1BO0A 2BDNA 1SSOA 3N52A 1G2SA 1VMCA 3D6WA 4RWSC 4OIKA 4ZLTF 1PFNA 2B2UA 2B2TA 2D9UA 2KEDA 1B3AA 1EQTA 4HSVA 4CJ1B 2KEEA 4UAIA 2HDLA 5CMDA 1O7ZA 4X3UA 2B2YC 3TZDA 1U4PA 1QG7A 2MP1A 1AZPA 3I90A 1HRJA 2L4NA 1GUWA 5E4XA 2B2WA 1EOTA 2EPBA 5CBAE 2MPMA 1WTWA 2L1BA 1RJTA 1O80A 2JP1A 2B2TC 4QUCA 1KNAA 4XDXA 2HCCA 2XIWA 5EQ0A 5CORA 3Q6SA 2DY8A 2Q8RE 4IUQA 3DEPA 3ONAB 1ZXTA 4IUTA 4ZKBB 1CA6A 1NAPA 1U4LA 1C8CA 2HUGA 3F2UA 2FJ2A 3GV6A 2B2WC 1TVXA 2N88A 4R9WA 1IKMA 1PFBA 4ZK9B 5EPKA 2KUMA 1RODA 2FHTA 1AP0A 5EKIA 2M2LA 1F9SA 2J7ZA 4ZKCB 2KECA 1G2TA 1HHVA 3I91A 3SVMA 1RTNA 1NR2A 2RVLA 1F9RA 4IUVA 1WTRA 1EIGA 1Q3LA 2HCIA 1RHPA 1M8AA 1X3PA 1BNZA 2MGSA 1ML0D 4X3SA 4HCSA 3LWEA 1G91A 2FFKB 4IUUA 1IL8A 2HDMA 1MI2A 2R3ZA 1J9OA 2B2UC 5JJZA 1WTOA 1U4MA 4XT3B 1VMPA 1ICWA 1B4OA 4IURA 1WVLA 1X3QA 2NYZD 5COYA 1E0BA 2L11A 4X3KA 3I3CA 3GV3A 3UI2A 2K05A 2K03A 1DONA 1X32A 2X69A 1WTXA 1CM9A 1NR4A 1SDFA 2B2VA 5D14A 1HUMA 2H1EA 2NWGA 3TN2A 1O7YA 1BBXC 1F9QA 2RSOA 1WD1A 4MN3A 1PLFA 1JE4A 1S4ZA 2CVRA 4U68A 1U4RA 3HP3A 3MWYW 1XYIA 5DNFA 3QO2A 5T1IA 3DM1A 2EE1A 2B2VC 4QUFA 1WTVA 1JICA 1HUNA 2MJ8A 1B53A 1RTOA 3G7LA 2FMMA 1QE6A 3H91A 4CJ0B 5E4WC 1HFNA 1MSHA 1ESRA 3P7JA 5EJWA 2IL8A 2DY7A 1MSGA 1DOKA 2X6GA 4IUPA 3DEOA 1LV9A 4MHEA 2N55A 1ILQA 1F9PA 4NW2A 1DZ1A 1EIHA 2JYOA 5D65A 5CBEE 4HEDA 2VXWA 2KVMA 3IL8A 5EPJA 1WTPA 2K1BA 4LMQD 5T1GA 1NCVA 3I8ZA 3IFDA 1HFGA 2NZ1D 1HA6A 1QNKA 4HAEA 3KUPA 1BF4A 4XT1B 3FDTA 4OIJA 1WD0A 1F2LA 5EPLA 1AZQA 4O42A 4RA8A 1CA5A 1ILPA 1B50A 4X3TA 2RSNA 3MTSA 1PDQA 2Q8TA 2RA4A 2X6LA 2SDFA 3R93A 1A15A 1SAPA 2FINB 3FPUB 1WTQA 1KNEA 1MGSA 2L9HA 1J8IA 1PFMA 1DOMA 5AFWA 4DN4M 1IKLA 1XX8A 2K01A 3KBXA 2K04A 1B2TA
chains in the Genus database with same CATH superfamily
3J7AV 1SMYD 2XWBB 3KOJA 1Y1WH 4YWMA 4BBRG 1S5ED 4J6HA 2F0HA 5EKKA 2OEOA 4M1UB 4R1JA 5IY0A 1Q8KA 2ID0A 4PG3A 4DR7Q 1KQSA 1UE6A 2K14A 4GNXC 1SMXA 5IGDA 3AFQA 4J8QA 1FL0A 3EIVA 4A3FH 1E3PA 1Q12A 4FDBA 1IYJB 1LTBD 4JI1L 5IT9E 1EOTA 4KKSA 1YIJA 4B3RL 5IOCA 1RDPD 1J6QA 3KDFA 2RF4A 1CHQD 1GKHA 5IE8A 3HS0C 3GTJH 3F2UA 1EY9A 4DXGA 2R93H 3WOFA 3CQZH 4P73A 1C48A 4JI3Q 4DK0A 4OO1I 2A68C 1PH1A 2C35B 4MTNA 1WTRA 1EWIA 2MGSA 3IAYA 4DUZQ 1ML0D 1VQ7A 3LWEA 2VQEQ 3E3XA 3FRPB 1VMPA 3IFTA 1ZYRD 2QA4A 4QMGA 4RKLA 3RR5A 3I3CA 3TQYA 1HPCA 3VYUA 5GAEC 3G4SA 1IYUA 1EWCA 1CM9A 2F3VA 5M9OA 3PO2B 1XNRL 2EZVA 1A8VA 5E3FA 3DM3A 1AE3A 4FF2A 3UDGA 1XYIA 3J7AF 3QR8A 1HQMC 3CHBD 1OXVA 2B2VC 3HOVG 4JI0Q 4PNYA 2HQLA 3ERSX 1HFNA 3S17H 3ND9A 1I6VC 4JPBW 2JQOA 2ICEC 4HMIA 1L1OC 5FLMH 4RGOS 3MZ5A 1TU2B 3M9BA 1VQAA 5EPJA 2F0GA 4RFBA 4ULLA 4WRDA 1XTDA 2M00A 4BXXH 1TWAH 1S5BD 1JOQA 2Q2HA 4X66L 4EQPA 2JA5G 4O42A 1NY4A 3MTSA 2A19A 1WTQA 1MGSA 1EU4A 3I70A 4UP8A 4LF5Q 3I4MB 4A93G 1X3FA 4YCVA 4MTKA 3L0OA 3I56A 2B2YA 1NMFA 2JJQA 2Z0SA 2UXBL 1A63A 3PQIA 1KL9A 1SYDA 4B3MQ 1G2SA 3S14H 2EYFA 3BZCA 1KAWA 5ELFA 1WYDA 3HOWH 1PYBA 2RKSA 4KY6A 4TQUS 2D2CC 1WTHA 2F4VQ 5M3FB 2JK8A 4IPCA 3CXCA 2IW3A 3ERQA 3DHQA 4E6IA 4FF1A 2J0TD 2CHBD 4FYDA 2HHHQ 1C8CA 3QIAA 1F2MA 4R9WA 4WJ4A 1ASZA 3KDFB 4K14A 1Q46A 4JV5L 3M7GA 1Y1VG 1Q1BA 1PH8A 2WAQB 1AN8A 1IYVA 5C3EH 2GVBA 3NPPA 3STBC 4JK1C 1Q81C 5CV8A 3SVMA 3HOUB 2L0CA 1D5ZC 5JEAH 1H9KA 1TXYA 2PZTA 4IUUA 2HDMA 5C6AA 3H3VH 5M3FH 5IODA 1UE1A 2R7ZG 5C0XG 1CKNA 5I9OA 4DR5L 2A69D 1BKBA 4QIWB 2F0LA 3DMUA 3PF4A 3TP8A 5ELDA 2PQEA 4XTCS 3X3MA 3L2PA 4DR1L 3DWQA 5KIXA 1BCPC 4C3JG 3H0GG 1U9RA 2VS1A 1Z47A 1N32Q 2PMZE 3MC0B 4A3IG 3BJUA 1ONLA 1PRTB 3NWTA 1UE5A 3DEOA 3UE0A 1V9PA 1BBUA 1UWVA 3CPWA 1HR0Q 1L0WA 3NWSA 4DNIA 3I8ZA 2DJGC 4YHHQ 3D6CA 4FP5D 4CHTB 4OIJA 4GKJL 4LFAL 1HZCA 2EY5A 4G4KA 2X6LA 1EWHA 1N9WA 3U50C 1DJRD 4JI6Q 5C4JH 1HNWL 2F0UA 2FMCA 4JOIC 2C9OA 1EL0A 3K59A 5M5YB 3N52A 2B2UA 1A6XA 1A3UA 4IFDH 1N33Q 4A3LG 1XJVA 3J80i 3N6RA 3GTKB 1HRJA 2NVYB 3J81L 5C4XG 3HOYB 2ZTEA 5IGCA 4N8X1 1N36Q 4CDDC 4RCOA 4DU9A 2JA6H 1CA6A 1K8OA 2D0OA 5IWAL 4A3BB 3RLNA 2ENBA 3CRLC 2AQ3B 4PZ8A 2E5LQ 2O5JC 3KYHC 1JC7A 1R4PB 1XMQL 4EQNA 1G6PA 2AWOA 3GD7A 2WFWA 4LNQA 4UPAA 2IX0A 1HNXQ 5C44B 2D0PA 1YNNC 2RCFA 1CQFA 1H9SA 3GTKH 1D7QA 1HZ9A 1SR3A 4NXMQ 2B2UC 1VQNA 1YNJC 4POFA 4LFCL 1S40A 1E0BA 2EJGC 4L8JA 2VQFQ 4ZYSA 4AIMA 5CGKA 4A3BH 1ET9A 1D5XC 1S5FD 1FVIA 2K50A 3TN2A 1CKNB 2EVBA 4IJLA 4L5TA 1OXUA 4DUYQ 2CVRA 4FXGC 1TWCH 1D2BA 1A3VA 1L0XB 2GVAA 1CZGA 3T13A 4JYAL 5KNDA 4HJ7A 2OXPA 4HR7B 1C0AA 4CJ0B 4R8NA 2DNCA 2XRSD 4DV2Q 3AMUA 2IL8A 1VQ9A 4JI7L 3BVGA 3PIO3 3RMHA 1QCBD 2ALYB 1B70B 3VA5A 5IT9L 3S2HH 1LM0A 4DV3L 5JEAJ 2HD3A 4P71A 4OEMB 3EQLC 4G7HC 1IW7D 3CCEA 5J22A 4XQJA 3S24A 1SNCA 1CKOA 1F2LA 3T1YQ 1SROA 5JVG3 4P72A 1LT4D 1QNUA 3HKSA 3HOZH 4I7AA 4HMJA 4X65L 5C3WA 1A62A 1TQOA 2RHSB 4YY3L 4BY1H 4YWLA 1E1OA 5A2QE 3FKIB 1DM0B 1X9NA 3G6JB 1IBMQ 2JSOA 2MP1A 3ULPA 2B63G 2TSSA 2ZJQA 3KF8A 2NVXH 3T4AC 5GAHC 3NBHB 4ZKBB 4EVOA 1BR9A 2HUGA 4DR3Q 2IT1A 1U0LA 2NBFA 3K81C 2V1CC 5M5XH 1GJXA 4B9WA 2BH2A 5M3MH 2SOBA 1VQOA 3Q24A 4OELB 1F9RA 1JOKA 2RHQB 1YVCA 2F0KA 2Z4IA 3HKZG 4BBSG 2A6ED 1PYSB 1XPUA 4IN3A 2F0FA 3VR3A 3GTLH 1HJPA 2LKVA 4RGNA 4IZ8A 4NMZA 2AMCB 2UUBQ 1LABA 1SE4A 3M4PA 3UDXA 3G71A 2RSOA 2EXZA 1B9NA 5JJKA 1RIPA 3JAMi 3H3VI 4A3CH 4EGVA 1HQRD 2O4XA 3I4NB 4L5QA 4CDCC 2QILA 2AKWB 4MNOA 3MXPA 4CBVA 1EU3A 1UNSA 4L5SA 3F1ZA 4QGUA 2E75C 1F9PA 3OIQA 3CF5A 4DAPA 3OWEB 2PNRC 2TMPA 1PZID 4QCLA 2JA8G 2N49A 1TS2A 3OMCA 4R4CA 2YV5A 3RZDB 3UE1A 2UU9Q 2UXDL 1EQVA 2CH4A 1GXDC 2RA4A 4Y7NH 4OWWB 1VQCA 1PTOC 1SAPA 2VL6A 1XMOQ 1TKWB 1KAAA 4HIOA 4KY7A 4R8IA 1G8ZD 5FO8B 1ASYA 1PRTD 2JN4A 4LF5L 3EFXD 4AQYQ 2E2HB 3BVZA 2NTSA 2WKDA 2ZTCA 1RL2A 4GN3B 2B2TA 2D9UA 3U4ZA 3QOLA 4C3HH 1EQTA 3PO3B 1VQ4A 3A5ZB 2WAQE 5FLXc 4OO1G 1QG7A 5KYLA 1AZPA 2AUKA 5KNCA 3GTMH 4GLVB 3GDEA 4RKBA 3D4DA 3LWUA 4KKUA 1KNAA 4DF7A 3NE5B 5C5MA 2Q8RE 3ONAB 3HG9A 2SEBD 2P5ZX 1U4LA 4RMFA 5GAGC 2F0OA 4A3JG 4IFDI 2N78A 5K36G 3RZOB 1VQJA 4QIWE 4J15A 4KMUC 2MNAA 2HHHL 1VQEA 2UUCQ 2K5VA 4C2MH 3I4OA 4X64Q 1BNZA 3AEVA 1I4QA 2B8GA 2F0TA 2E2IH 1JE5A 3F8TA 1E2VA 3R2TA 4DV0Q 4BBRB 3UI2A 1IZ6A 1EIYB 5CC4A 3BDLA 4PQXA 5J39A 1H95A 1QB5D 1HZBA 3J80c 1VQGA 3RZOH 1KRSA 1SYBA 1SJHD 4KJOA 4I65A 3HP3A 1PH5A 4DR4L 1K0RA 3QO2A 1PTOB 5BN5A 2EE1A 2B39A 5D3IB 2H5XA 2WB1G 5IP9H 4K0KQ 2K7VA 1E2ZA 1TIID 4XQNA 1C7YA 5DAUA 4JBJA 4JI8Q 1MSHA 3P7JA 3EBEA 2EY2A 2CW0D 2DJFC 3HEJA 2WACA 4A3DG 4MHEA 3RLFA 5LHY1 1N32L 1X54A 2DNEA 2V4DA 1TWGB 3MEHA 1HNZQ 4UY8C 2NN6H 4LAAA 3FVQA 3SDZA 1ET6A 4ID6A 4UHVA 4TKOB 2IWHA 3HZXA 4BY7G 4NDXA 1JB3A 1WCMG 5FK9C 4B3SQ 2VUMH 3U9SA 4YHHL 4A76A 2FINB 3P1HA 2JEBI 3NTHA 5I6WA 4IO9A 4DN4M 3SE0A 2L12A 3W2DA 4CJ2C 3NENA 4GNXA 5I2YA 3GTOH 1BO0A 3UDIA 2XWJB 4RWSC 3A54A 1J5EQ 1R9TH 1VF5C 3L7ZC 3Q8DA 3WOEA 3A7AB 3HOVB 4C3IH 4JCVE 2MPMA 4O1NA 3HOXG 1N33L 3CC7A 4RG1A 3T56B 2F0JA 3K5NA 1NAPA 4POGA 3IRBA 5IYDH 3ER0A 1PA6A 1N36L 2CCZA 1UEBA 1STYA 1I4XA 1RODA 2KUMA 4K6DA 5IYBH 2NVTH 3K7UC 4A3MH 1GUTA 2JA5B 2E5LL 1CZWA 1GO3E 3PIPA 1B3QA 3A0JA 1Q1EA 4A3EH 1QVGA 4DA2A 5ELNA 1MI2A 4A93B 3V05A 3S16H 2ZJRA 4DFAA 4JW0A 1HNXL 1EFID 3AQQA 1X3QA 1CSQA 1D1IA 3NUCA 2AQ2B 2L11A 1HR0W 4NXNL 4KHPL 4JI2Q 2K03A 4NXML 2YU9B 4TSSA 2B2VA 2ZXOA 1DD2A 4TVAB 1SLJA 3RD4A 3S15B 2WP8J 4U68A 4LF4Q 4DR6Q 4A75A 1IBLQ 1CQVA 4IPGA 5IP7H 4NP5A 1HXYD 5DNFA 4FXKC 1L1OA 1M4VA 1VCIA 4RGMA 5D3DA 2XVSA 1RD9D 5A2QL 4K2LA 4CKBA 2QGQA 2CH4W 1MJCA 5ELBA 1W2BA 3CMEA 2ATWA 1DZ1A 2IX1A 5CBEE 1Y1VB 2F0EA 3SK6A 1SEBD 4C1NI 1BVSA 4KKTA 3A56A 5I9PA 4KI0A 2O5IC 2Z8LA 3O13A 3CPFA 3BVMA 1AZQA 2GN5A 2A8VA 1CA5A 4LF7Q 4IPDA 1NBWA 3K0XA 3TDQA 5DM73 3H3VC 4FXDA 2A6HD 4X6AH 2R7ZB 1Y1WG 4LFBQ 2BCOA 1DOLA 2QCPX 4DV5Q 4HTHA 3MXUA 1FGBD 3CC4A 4KJNA 1Y1VH 1EY0A 1E7ZA 4OIKA 4GNXB 5M5WB 3PO2H 2OTJA 1KLGD 3C1FA 4A3FG 5F2DA 4C3JB 4ZRZA 4Y52H 2F0VA 1Y8PB 3H0GB 3VA7A 4DV6Q 1PVOA 1CSPA 4P2CB 4Z9CB 3R2IA 1I94Q 1EQQA 4KTAA 4A3IB 1ENAA 1TWHB 1SJED 1EYCA 1IBML 4OX9L 1KRTA 4YCUA 2R93G 5LMUQ 2J4XA 3J7ZC 4QL5A 1STHA 2KHSA 1L0YB 3S1MB 3GO5A 3SEBA 4ZKCB 4DR3L 1S3OA 1I3QB 1RF2D 1EIGA 2HCIA 1GOZA 3RNUA 4C3JH 3U4VA 2MFIA 3F2DA 4IOCA 1X55A 3G48A 5J3BA 4AYBG 4N9TA 1WTOA 1U4MA 1WVLA 1TR5A 1DXMA 5COYA 1TWFB 1C4QA 5KGUA 3I4MH 4NKLA 4B3TQ 3PCOB 2G5DA 2VZAA 4JBWA 3GQBA 3E0EA 4A3GG 5D14A 5BN3A 1O7YA 2JXMB 1KDAA 1VQBA 4DAVA 4G7ZC 3PUYA 3S1RB 2UUBL 5AJ3Q 5TSSA 1TS3A 2OWOA 5C4XB 3QJYA 3DM1A 1WTVA 2JA7G 1PH7A 1B53A 4DV4Q 4BA1I 3KFUA 2PI2E 3H91A 2K5WA 2KJXA 4KHZA 1L1OB 1DOKA 4XYOA 5FLMG 4IUPA 3SXHA 3A8JE 4CDEC 2BE5C 4C56C 2JYOA 1KC8C 2KCTA 4K8JA 1WTPA 1JORA 2ICIA 3A8KE 4LMQD 4BS9A 2ASBA 4BXXG 1U5KA 2B3GA 3A7LA 2XGTA 1ILPA 3J81j 3HOUH 4JI4Q 2Q8TA 3NP8A 5DLQE 3R93A 2RBMA 4JOIA 4DV1L 1JB7A 4LF6L 1O7LA 5EGTA 4V0BA 1I6HB 2K01A 1B2TA 2NN6I 1NJIC 4ZAIA 1NUCA 2A74C 4HIDA 4TRDA 3VYRA 5HURA 1VQKA 1JJ2A 3TZUA 2KEEA 1LTRD 3HOWG 2R92B 3G6EA 2F4IA 3E5SA 4J1MA 4X62Q 3RN5A 3I90A 5L37A 5JJLA 1GUWA 1K83B 1O80A 2JP1A 4ILWA 5CORA 4OWXB 3P75A 4WJ3M 3DEPA 1JWSD 1ZXTA 4UP9A 3OMGA 4MIUA 3GV6A 3CCSA 2RCNA 1Z9FA 5C3EG 5CR3A 1IBKQ 2NVQB 5EKIA 2KBNA 5A35A 1LTAD 1PZKD 1RCVD 1NR2A 2K32A 3DWAA 2R92H 5JEAG 1I50B 4P75A 2G9DA 2AQ1B 2E74C 2XNAC 3NBHA 2O2LD 4M8AA 3J81i 2QW7A 5M3FG 2UUCL 2KCCA 3NBIA 3A5UA 4KD3A 1S72A 4EX5A 1SYEA 1GHKA 5LMNQ 2H1EA 1TS5A 1Q82C 1YJNA 3H15A 1VQFA 5M5YH 1BCPB 1UE7A 3S1QB 3E0JA 5IGBA 2AHOB 5C3XA 2B63B 3SR1A 5CV5A 1OO9B 1MKHA 2K5QA 3NTKA 1H9RA 2NVYH 3BS1A 3HOYH 3VDYA 1SMYC 3QWNA 3MVVA 1EYDA 2N55A 4LF9Q 3Q23A 5GQOA 4JI8L 1T5EA 4CGYB 3T53B 2IJ0A 1KTKA 1STGA 2E2JB 4HAEA 2F52A 1XWEA 1A2UA 5I4DA 2I0QA 1OXSC 1HNZL 1UUPA 2EXDA 1E2WA 3HKZB 4JBMA 4DKAC 4BBSB 5C44H 4GOPC 2UUAL 1Y14B 2K52A 4KD4A 1DOMA 4DV7L 4R4OA 4Q0FA 1A2TA 3T1HQ 2N3SA 1CKMA 1Y69U 1TY2A 1JT8A 2PW7A 4NB3A 2PI2A 1QVFA 3AYHB 4DK6C 1O7ZA 5IGFA 4G7OC 1H9MA 1LT3D 1D6EC 3MAQA 3NHHA 3BDCA 4EQ5A 2EYLA 1WTWA 2XSCA 1ZYRC 4BBSH 3L9AX 4XDXA 3A55A 2JA6G 4QJFA 1XNRQ 1C9OA 2FJ2A 1SYFA 2B2WC 5ELOA 2PPBC 3M3YB 2RDFA 1VQHA 4CKEA 2JA8B 4HJ9A 1AP0A 3MXGA 3W5OA 1W6KA 1PH2A 1VDZA 3I91A 4OWTB 2JA9A 1LACA 1NSNS 2M9VA 2PZWA 1KD1C 4DR7L 2Y0SG 1B1ZA 2R3ZA 2KA7A 2F03A 4XT3B 3KK7A 3M85A 2NYZD 4HCEA 5FKAC 4A3BG 1IXRA 1X32A 4ZQ3A 1STEA 1M90C 2LY7A 4GS3A 4ZUJA 1DCZA 2Z6KC 5KRUA 2EIFA 4JI2L 4FF4A 1YHBA 3WWVA 3M7NA 4O2DA 2A68D 3FKIH 4GOPB 5T1IA 1EY4A 4QUFA 2F0MA 4JI3L 5FJ8H 1FYCA 4K5VA 1D8LA 1HH2P 4LF4L 1Z7TA 3OIPA 4MZ9A 1MSGA 3D31A 4A3JB 4IFDJ 1A0IA 1D5MC 4DUZL 2Q2UA 2LMCB 4AH6A 4B08A 2DUDA 1ENCA 5D65A 2VQEL 1YJWA 4ABNA 4G57A 2K75A 2EJMA 3VR2A 1BF4A 2JE6I 3BYYB 3OHXC 5EPLA 5CV4A 4PMBA 4PZ6A 4X3TA 2RSNA 1I4RA 1PDQA 4JG2A 3R3OA 2EDGA 2WKCA 3HOZG 1K8MA 4WJWA 1MBYA 1OTCA 1CTMA 4OXPA 4LF7L 1PRTF 1KIXA 1T5XD 2BH8A 3PIOA 4JI0L 4HIKA 4L6TB 1EY8A 5K36H 4BY1G 4ZLTF 3PSIA 2SNSA 1DGSA 4GKKQ 1B3AA 1SNPA 2UXCQ 3Q22A 5CMDA 1YHQA 2WB1B 1EY5A 3K7AB 1OXTA 3K5MA 1F2YA 2CWAA 3BDOA 1RJTA 3FHWA 3CC2A 2IY5B 1II3A 2K5HA 5EQ0A 1EFWA 3I4NH 2A69C 4A3DB 4DV6L 2YTYA 5FOBB 4IUTA 1ENFA 1SRUA 1I94L 2EYHA 3KLSA 4QB4A 3TS2A 3KF6A 4A3KB 1IKMA 1PMRA 3AB9A 2FHTA 4H7BA 5M3MG 3C3LA 4CDFC 4BY7B 2KECA 5LMUL 1WCMB 4RCNA 1HHVA 2RVLA 1EY6A 1RHPA 1PZJD 2YTXA 4B3ML 3RZDH 4PV1C 4X3SA 4HCSA 4APVA 4HN7A 1FNUA 3D8GA 5IYCH 2OTLA 1ZKOA 3FMCA 1FNWA 1ICWA 2PNHA 1GUGA 3OSOA 3KLWA 2B29A 2F0PA 2F4VL 1WTXA 1EYAA 4A3KH 4OGQC 4LW1A 2PO4A 3GTGB 1XTCD 1BBXC 1WD1A 5IIFA 1LYLA 2E2HH 4B3TL 2I5HA 2I07B 3STBD 4A3CG 1Q8IA 2OCEA 3PO3H 4LF8Q 1HNWQ 3HOXB 4FNFA 3KLSX 1CI3M 4LWCA 3NXWA 1PH4A 1MIUA 3MXNB 1V1OA 1H9JA 1VS0A 1VQ5A 2NB0A 4RGTA 4LUVA 1Q7YC 1JWUD 3CCUA 1YJ9A 5FLXE 1VQDA 1NCVA 3CW2C 1KLUD 1HA6A 1FNVA 1QNKA 4I7ZC 3J81c 5IWAQ 4QF4A 3CP0A 4K8IA 2ZTDA 3NEMA 4UDUC 1BCPD 4LJZC 1VQLA 1FGUA 2KENA 4YY3Q 1K8AC 3FPPA 4JI4L 1K3RA 1E1TA 2R7FA 1G6ZA 3X3NA 4IQZA 4BBRH 1SSOA 2K4KA 4C3HG 4HSVA 5KNBA 1YBYA 2D5DA 2Z6BA 3SGIA 4IJHA 4LFCQ 1HR0L 4R4IA 1L2FA 1MD2D 2R7DA 4L5RC 1PTOH 2EQSA 3K57A 3J80E 2DY8A 3TS0A 4DAYB 1BXTA 2EY1A 1W3SA 1HA5A 1TWGH 1WJJA 1JQYD 1F9SA 4JI6L 2CKZB 3KF6B 2NTTA 3K6OA 1FJGQ 3I55A 1IBKL 4OHJA 1PH3A 3PUXA 3BG3A 3S2DB 3GTQB 3GTPB 1J9OA 1A3TA 1UEAB 3CKIB 2XTIA 3TRZA 3NQIA 4IURA 1Y1WB 3ICEA 5GROA 1DYQA 5IT9c 4ME5A 2VW9A 4IALA 3BU2A 5CV9A 1X6OA 5ISRA 5J1ZA 5LL6S 3HFZB 1VQPA 2EYJA 4GLAC 3TP6A 1IW7C 2RDHA 2Z4HA 1PHJA 3D4RA 1F9QA 2XN9C 1EIFA 3TP7A 1JE4A 2LSSA 4A3FB 1XPOA 3VYSA 3FP9A 3GP7A 2F0SA 2QDBA 5IP9G 5LMNL 1IHZA 2HQEA 1K0SA 1YNND 3HOVH 2FMMA 1W6JA 2MQHA 5EJWA 3HKZE 2EYPA 3GTJB 2R93B 1X3EA 1X56A 1LV9A 1YNJD 3EROA 3QB3A 3CQZB 1ILQA 4DK1A 2NN6G 2MHVA 1V43A 1SYCA 1I4PA 3I7FA 1SE2A 3URYA 4LF9L 2A73B 3KUPA 4XIGS 1CUKA 2VQFL 4DPGA 1PYWD 2VUMG 4HIMA 3MHBA 1P8LA 2ZM6Q 3K0YA 1YEZA 4RA8A 5H1SE 2JA5H 1QVCA 4JI5Q 1JOOA 1BUVT 4AYBB 1J8IA 1O78A 3BYTB 4DUYL 4A93H 1WOCA 2K04A 2MO0A 4RHSA 2EOTA 2SNMA 4N8FA 4A3GB 3W1BA 3W3AA 4DV2L 2YU9H 2ZXPA 4RH6A 5ELEA 3VR6A 1XPRA 4CJ1B 1EQRA 4FO2A 4QY7A 3T1HL 1YHAA 2JA7B 4X3UA 4C3IG 3S15H 1U4PA 1B7YB 4YWKA 5EKLA 2A6EC 3S17B 3NTIA 2EYOA 4IPHA 1N34Q 1TT2A 2GA4B 3S9WA 3PGZA 1P16A 2MUYA 5IYDG 5LMNW 3T1YL 3SK4A 3VR5A 3E9HA 4ZK9B 5IYBG 4A3GH 3JAMc 4H02A 4O0AA 1TWAB 3KLRA 4A3MG 1LO5D 2M2LA 3TBIB 3U58A 2J7ZA 3TEHB 3C2PA 3EN2A 4A3EG 1NTGA 1LT6D 2JA7H 3M4OB 2KCMA 5IGGA 4GN5A 5C5LA 2IX3A 4V190 3H94A 2KCNA 3DXJC 2R7ZH 5C0XH 3SK5A 2FXQA 2DN8A 1EZ6A 3S14B 3K5LA 2UXDQ 2AWNA 1LTID 3K58A 4HJ5A 2R61A 1AH9A 3HOWB 5IP7G 2JEAI 1ZEQX 1BBWA 4H0LC 5M5WH 4FF3A 2Z9HA 4QQBX 1K8GA 1V8QA 3H0GH 3CCQA 2BA0A 3G7LA 1QZHA 3M4OH 4XXEA 2I5MX 5E4WC 4K5WA 3JAME 4A3IH 1TWHH 2QDLA 1XNQQ 4ME3A 4F7XA 1WFQA 1PRTC 2AUJD 1X3GA 4LUZA 1CHPD 3CCLA 5C3EB 4Q5VA 2K1BA 2E2DC 2PYKA 3OWFA 1EZ8A 1KABA 2NZ1D 5BN4A 3R8BA 4XQQA 3MFGA 3FDTA 3S1MH 3NSWA 1EYGA 1LTSD 3AU7A 4F87A 2ES2A 3NK9A 1EOVA 1I3QH 2LXKA 1SNQA 2WB1E 1PTOF 3FPUB 1SNOA 3DWPA 1XX8A 3KBXA 2N88A 4PMCA 4DNRB 2I46A 4LK1C 2KOLA 1GUSA 2ZJPA 3C46A 1TWFH 1JWMD 4RAUC 1PXUA 3T16A 1AE2A 1VQIA 2F0WA 3PO2G 2IHEA 1IL2A 2A1AA 4UAIA 2HDLA 3KJOA 4A3LH 3EA6A 2B2YC 2K6AA 4BWGB 1AFPA 1O7IA 3S1RH 4GKKL 2EPBA 1TS4A 5C4XH 2L1BA 4QUCA 1PH6A 2UXCL 2XIWA 1WI5A 1PTOD 3PMFA 2UU9L 4GN4B 1F2ZA 1ICFB 2XRQD 2VNUD 4DR4Q 1XMOL 5EPKA 2ZXRA 3OPOA 2F1MA 3J7A5 1Z6HA 3LX0A 5G3LF 1QILA 4DR2Q 3T51B 4AQYL 3K5OA 5FLXL 2CW0C 2RDGA 2K5DA 4R4TA 1YNXA 1JCKB 5JAVA 5JJZA 1Y8NB 3BZDB 5C4JB 1M1KC 1LLRD 2KQ3A 4OONA 4IUNA 4HJ8A 3I4MG 1I6HH 3B6YA 2K05A 1I4GA 2OQKA 1CK1A 1HUMA 3H6MA 1PV4A 1SN8A 1JJGA 1K9MC 3MWYW 2F0IA 1STNA 2QKIC 2KHIA 3PUVA 5G3LD 1HUNA 2D62A 1RTOA 2JA6B 1G291 5CYUA 1K83H 1I5FA 2X6GA 4LF8L 4KV6A 1K28A 2WIIB 4X64L 3I4LA 2VXWA 2KVMA 4OL7A 4DGZA 3VR4A 4GOPA 2WAQG 3J80L 4DV0L 1YITA 3PUWA 2NVQH 3F2BA 2NZHA 1STBA 5BR8Q 3OTOQ 3D0FA 3E6ZX 3HOUG 5C0XJ 2Y0SB 2WINB 4A4IA 1Q90A 1A15A 1I50H 4K2KA 5I6YA 2G9HD 2PQAA 3BZKA 2L55A 4H13C 4K0KL 5JJIA 1QZGA 2LS01 3PV0A 2PW5A 4HJAA 2NUCA 2QEXA 1V1PA 4PZ7A 2BDNA 4JI1Q 1XXGA 1TWCB 1PFNA 4WORA 1X65A 4PMWA 4B3RQ 2K5NA 2Q2TA 2CQAA 4ZCKA 5FO9B 1SYGA 1K3BC 4NXNQ 2L4NA 3S1QH 4KHPQ 1KDBA 1KDCA 2B2WA 5CBAE 1GD7A 2B63H 4C1NK 1FD7D 5KEEA 1EY7A 2EY6A 1S5CD 4JC0A 4IUQA 4B3SL 4KLKA 1GM5A 3CRKC 3S2HB 1T9HA 1JR0D 1AEXA 3C1EA 4L63B 1PFBA 3MFYA 4YIJA 3ND8A 2CQOA 1V1QA 4IFDG 4WFN3 2F0NA 2YTVA 3K80C 3WDNA 4KN7C 2R92G 4IOAA 4B9XA 1K73C 4IUVA 2E2JH 1M8AA 2EYMA 4JBKA 3W1GA 3HOZB 3UDFA 1J5EL 5JPNC 1FJGL 3CD6A 1QUQA 3EVQA 1YZ6A 3VYTA 3QOJA 2IPKD 2Z6KA 3OYYA 2X69A 1NNXA 4BY1B 1QOHA 2Z1CA 1SE8A 3RLOA 5K5PA 3OW2A 1PLFA 5DEHA 2VY3A 5IGEA 2N8NA 5E1FA 2NVXB 2A6HC 1CT1D 2DGYA 1ESFA 2BOSA 5DM63 5C0XI 3HOYG 4H44C 3OOCA 4AYBE 5HGTA 1SFOB 1YI2A 3DUZA 3QG1A 4N9PA 5FO7B 1EIHA 5M5XB 1GUNA 1EEID 2YYZA 5M3MB 4X66Q 5T1GA 1TY0A 3JC66 3M3YH 3CCRA 2JA8H 2HT1A 2A5HA 1SNMA 1Q86C 1JJCB 4OX9Q 2MO1A 3TREA 1B50A 1NMGA 3MXNA 5C44G 3MA2B 3A74A 3CCMA 3GTLB 2UXBQ 1KNEA 5AFWA 4F88A 1SBBB 1IBLL 4DR6L 2VB3X 1IKLA 4YCWA 2ZM6L 1I4HA 1EEFD 4JI5L 4DXFA 1SFOH 3M4QA 1VQ8A 3IKJA 2LXJA 1QWYA 2PQAB 4GLXA 1VMCA 4U673 4ALPA 1D1KA 1B9MA 4F8MA 3F2CA 1V1PB 3TZDA 2CWPA 4FVMA 4OO1H 3S1NB 5E4XA 3HGBA 1HTPA 2RQXA 3CCJA 4K6LA 2OT2A 1EUJA 2QF7A 5EBDA 2BDOA 3PF5A 4JV5Q 1H9SB 1R4QB 3SK8A 1UAPA 2Q8IB 2L15A 2Q2IA 1S5DD 4KN4C 1N34L 4A3JH 2IHFA 3EJIA 3FEWX 3JAML 3CMAA 1G2TA 3P20A 2PCFB 4LFBL 2EJFC 3ULJA 1E22A 1SE3A 4DV5L 1Q3LA 5EAYA 3E9IA 4R4QA 2F0DA 2F3WA 3ULLA 4Y7NB 2LFNA 4DR5Q 1LTGD 3GTQH 2FFKB 3S1NH 2ZT9C 4GZYC 4DAYA 3V2TA 2B8FA 5E7NA 1B4OA 3RUZA 4X3KA 3GV3A 1RKNA 1LT5D 3I2ZA 4DR1Q 5CV6A 1DONA 3CCVA 1SDFA 1NR4A 4C3HB 3LGJA 1AW7A 1PFSA 1QUQB 5C4HA 3TP5A 4LF6Q 4DV1Q 4LUOA 3CU7A 3FKIG 1E24A 3GTMB 1BDOA 3H09A 5FJ8G 1JICA 2MJ8A 3NQTA 3K7AH 1SXTA 4DAMA 3Q0AA 2OQ0A 1Y8OB 4A3DH 1OXXK 2BA1A 4GKJQ 5LL6X 4LFAQ 4HEDA 4DK3C 4ODGA 3PUZA 1G51A 1XNQL 1HFGA 3M4YA 3U9OA 4C2MB 4KY5A 1CFMA 3NELA 1VQMA 2PMZB 1STAA 3OW7A 4BY7H 3KBGA 1WCMH 1BCPF 2E2IB 5HY6A 2SDFA 2CFMA 2L9HA 2OF1A 1PFMA 5KYIA 3CAMA 1BQQT 5AJ3L 4UP7A 5GADC 5JOBA 2R6GA 1VQ6A 3KF8B 2K28A 3J7YW 3D3RA 4DV4L 4S3SA 2K33A 3MEFA 1MJEA 2BE5D 2I5LX 2H4OA 3D6WA 2KEDA 3RN2A 3PIP3 3GTGH 3A8IE 4KK7A 3SHLA 2B2TC 2HIXA 3ZYYX 3HOXH 3I4NG 2HCCA 3Q6SA 1XMQQ 3ITPA 5HGQA 1TVXA 5C4ZA 2VB2X 4DNTB 3AFPA 4ZUIA 3I72A 4BA2I 1QJOA 3TMEA 2HIVA 3L3OC 3LNNA 1JMCA 2VUMB 1RTNA 2KHJA 1X3PA 1B8AA 2QEJC 3I73A 1NE3A 4JVZA 5I2XA 1G91A 1IL8A 5IYCG 5JVH3 5ELCA 1GVPA 1HCZA 4DR2L 1FR3A 1N8RC 4X62L 3GTOB 1HZAA 2F0QA 2F3IA 3J81E 4A3KG 1F77A 1LTLA 2E76C 2NWGA 1R9TB 4MN3A 1BOSA 2UUAQ 4JYAQ 1S4ZA 3ZJYC 1B44D 2L5TA 4C3IB 4DV7Q 1U4RA 3TSSA 3PO3G 3K8AA 4JI7Q 1QE6A 4DV3Q 1ESRA 2Y0SE 3D4WA 2DY7A 1KXLA 2E8GA 3DLLA 1LUZA 3V96A 4NW2A 4NPSA 2NZOA 4EQOA 1MHWC 4K5XA 3IL8A 2NVTB 4A3MB 4HSPA 3IFDA 1VF7A 5EBCA 5NUCA 1GHJA 3HRZC 1LTTD 4XT1B 4A3EB 1KHIA 1WD0A 4RHRA 1HTLD 2WV6D 4P74A 1GUOA 3S16B 2PZUA 4XYQA 4KHVA 4X65Q 5JPMC 4CKCA 5CV7A 3KJPA 5BR8L 3OTOL 1SNDA 3S2DH 3GTPH 2C5CA 1PH9A
chains in the Genus database with same CATH topology
3J7AV 1SMYD 2XWBB 1S5ED 4J6HA 2F0HA 5EKKA 2OEOA 4M1UB 2ID0A 5IGDA 4J8QA 1Q12A 1LTBD 5IT9E 1EOTA 4KKSA 5IOCA 1RDPD 1CHQD 3HS0C 3F2UA 1EY9A 4DXGA 3WOFA 1C48A 4DK0A 4OO1I 2A68C 1WTRA 2MGSA 3IAYA 1ML0D 3LWEA 3FRPB 1VMPA 3IFTA 1ZYRD 4QMGA 4RKLA 3I3CA 3VYUA 1HPCA 1IYUA 1EWCA 1CM9A 2F3VA 5M9OA 3PO2B 2EZVA 5E3FA 4FF2A 1XYIA 3J7AF 1HQMC 3CHBD 1OXVA 2B2VC 4PNYA 1HFNA 3ND9A 1I6VC 2ICEC 4HMIA 4RGOS 3MZ5A 1TU2B 5EPJA 2F0GA 4RFBA 4ULLA 4WRDA 2M00A 1S5BD 1JOQA 4EQPA 4O42A 3MTSA 1WTQA 1MGSA 1EU4A 3I70A 3I4MB 2B2YA 1SYDA 1G2SA 2EYFA 5ELFA 2RKSA 4KY6A 4TQUS 2D2CC 5M3FB 2IW3A 3ERQA 3DHQA 4E6IA 4FF1A 2J0TD 2CHBD 4FYDA 1C8CA 3QIAA 1F2MA 4R9WA 4K14A 3M7GA 1Q1BA 2WAQB 1AN8A 1IYVA 3NPPA 4JK1C 5CV8A 3SVMA 3HOUB 2L0CA 1D5ZC 5JEAH 1H9KA 2PZTA 4IUUA 2HDMA 5C6AA 5IODA 5C0XG 5I9OA 2A69D 4QIWB 2F0LA 3DMUA 3TP8A 5ELDA 2PQEA 4XTCS 3X3MA 3DWQA 5KIXA 1BCPC 4C3JG 1U9RA 1Z47A 3MC0B 1ONLA 1PRTB 3NWTA 3DEOA 3NWSA 3I8ZA 3D6CA 4FP5D 4CHTB 4OIJA 2EY5A 4G4KA 2X6LA 1EWHA 1DJRD 2F0UA 2FMCA 2C9OA 1EL0A 3K59A 5M5YB 3N52A 2B2UA 1A6XA 1A3UA 4IFDH 3N6RA 3GTKB 1HRJA 2NVYB 3J81L 3HOYB 5IGCA 4RCOA 4DU9A 1CA6A 1K8OA 4A3BB 2ENBA 3CRLC 2AQ3B 2O5JC 1JC7A 1R4PB 4EQNA 2AWOA 3GD7A 2IX0A 5C44B 1YNNC 1CQFA 1H9SA 2B2UC 1YNJC 1E0BA 2EJGC 4L8JA 4ZYSA 5CGKA 1ET9A 1D5XC 1S5FD 3TN2A 2EVBA 1OXUA 2CVRA 4FXGC 1D2BA 1A3VA 1L0XB 1CZGA 3T13A 5KNDA 2OXPA 4HR7B 4CJ0B 4R8NA 2DNCA 2XRSD 3AMUA 2IL8A 3BVGA 3PIO3 3RMHA 1QCBD 3VA5A 5IT9L 5JEAJ 4G7HC 3EQLC 1IW7D 5J22A 4XQJA 1SNCA 1F2LA 5JVG3 1LT4D 1QNUA 4HMJA 5C3WA 1TQOA 5A2QE 3FKIB 1DM0B 3G6JB 2JSOA 2MP1A 2TSSA 3KF8A 3T4AC 4ZKBB 4EVOA 1BR9A 2HUGA 2IT1A 2NBFA 1GJXA 4B9WA 2SOBA 3Q24A 1F9RA 1JOKA 2F0KA 2Z4IA 2A6ED 4IN3A 2F0FA 3VR3A 2LKVA 4RGNA 4IZ8A 4NMZA 1LABA 1SE4A 2RSOA 2EXZA 1B9NA 4EGVA 1HQRD 2O4XA 3I4NB 2QILA 3MXPA 4CBVA 1EU3A 1UNSA 2E75C 1F9PA 3OIQA 4DAPA 3OWEB 2PNRC 2TMPA 1PZID 4QCLA 1TS2A 3OMCA 3RZDB 1EQVA 1GXDC 2RA4A 1SAPA 1PTOC 1TKWB 1KAAA 4KY7A 4R8IA 1G8ZD 5FO8B 1PRTD 3EFXD 2E2HB 3BVZA 2NTSA 2WKDA 2B2TA 2D9UA 3QOLA 1EQTA 3PO3B 4OO1G 1QG7A 5KYLA 1AZPA 2AUKA 5KNCA 4RKBA 3D4DA 3LWUA 4KKUA 1KNAA 4DF7A 3NE5B 5C5MA 2Q8RE 3ONAB 3HG9A 2SEBD 1U4LA 2F0OA 4IFDI 5K36G 3RZOB 4KMUC 1BNZA 1I4QA 2B8GA 2F0TA 1E2VA 3R2TA 4BBRB 3UI2A 5CC4A 3BDLA 4PQXA 5J39A 1QB5D 1SYBA 1SJHD 4KJOA 4I65A 3HP3A 3QO2A 1PTOB 5BN5A 2EE1A 2B39A 5D3IB 2K7VA 1E2ZA 1TIID 4XQNA 5DAUA 1MSHA 3P7JA 2EY2A 2CW0D 3HEJA 2WACA 4MHEA 3RLFA 5LHY1 2DNEA 2V4DA 1TWGB 3MEHA 2NN6H 4LAAA 3FVQA 3SDZA 1ET6A 4ID6A 4TKOB 2IWHA 3HZXA 4NDXA 1JB3A 5FK9C 3U9SA 2FINB 3P1HA 2JEBI 3NTHA 5I6WA 4DN4M 3SE0A 2L12A 3W2DA 4CJ2C 5I2YA 1BO0A 2XWJB 4RWSC 3A54A 1VF5C 3L7ZC 3WOEA 3A7AB 3HOVB 2MPMA 4O1NA 3T56B 2F0JA 3K5NA 1NAPA 1STYA 1I4XA 1RODA 2KUMA 4K6DA 1GUTA 2JA5B 1CZWA 1Q1EA 4DA2A 1MI2A 4A93B 3V05A 4DFAA 1EFID 1X3QA 1D1IA 3NUCA 2AQ2B 2L11A 2K03A 2YU9B 4TSSA 2B2VA 2ZXOA 1DD2A 3RD4A 3S15B 2WP8J 4U68A 1CQVA 4NP5A 1HXYD 5DNFA 4FXKC 1M4VA 1VCIA 4RGMA 5D3DA 2XVSA 1RD9D 5A2QL 4K2LA 4CKBA 5ELBA 1DZ1A 2IX1A 5CBEE 1Y1VB 2F0EA 3SK6A 1SEBD 4C1NI 5I9PA 4KKTA 3A56A 4KI0A 2O5IC 2Z8LA 3O13A 3BVMA 1AZQA 1CA5A 3TDQA 5DM73 3H3VC 4FXDA 2A6HD 2R7ZB 2BCOA 1DOLA 2QCPX 4HTHA 3MXUA 1FGBD 4KJNA 1EY0A 4OIKA 5M5WB 1KLGD 3C1FA 5F2DA 4C3JB 4ZRZA 2F0VA 1Y8PB 3H0GB 3VA7A 4P2CB 4Z9CB 3R2IA 4KTAA 4A3IB 1ENAA 1TWHB 1SJED 1EYCA 2J4XA 1STHA 2KHSA 1L0YB 3S1MB 3GO5A 3SEBA 4ZKCB 1I3QB 1RF2D 1EIGA 2HCIA 1GOZA 4N9TA 1WTOA 1U4MA 1WVLA 1TR5A 1DXMA 5COYA 1TWFB 1C4QA 5KGUA 4NKLA 4JBWA 3GQBA 5D14A 5BN3A 1O7YA 2JXMB 1KDAA 4DAVA 4G7ZC 3PUYA 3S1RB 5TSSA 1TS3A 5C4XB 3QJYA 3DM1A 1WTVA 1B53A 4BA1I 3H91A 2K5WA 2KJXA 4KHZA 1DOKA 4XYOA 4IUPA 3SXHA 3A8JE 2BE5C 4C56C 2JYOA 4K8JA 1WTPA 1JORA 2ICIA 3A8KE 4LMQD 4BS9A 3A7LA 1ILPA 2Q8TA 3NP8A 3R93A 2RBMA 1O7LA 5EGTA 4V0BA 1I6HB 2K01A 1B2TA 2NN6I 4ZAIA 1NUCA 2A74C 4TRDA 3VYRA 5HURA 3TZUA 2KEEA 1LTRD 2R92B 2F4IA 3E5SA 4J1MA 3I90A 1GUWA 1K83B 1O80A 2JP1A 4ILWA 5CORA 3P75A 3DEPA 1JWSD 1ZXTA 3OMGA 4MIUA 3GV6A 5CR3A 2NVQB 5EKIA 5A35A 1LTAD 1PZKD 1RCVD 1NR2A 2K32A 3DWAA 5JEAG 1I50B 2G9DA 2AQ1B 2E74C 2XNAC 3NBHA 2O2LD 4M8AA 2KCCA 3NBIA 4KD3A 1SYEA 1GHKA 2H1EA 1TS5A 1BCPB 3S1QB 3E0JA 5IGBA 5C3XA 2B63B 3SR1A 5CV5A 1OO9B 2K5QA 3NTKA 1H9RA 3BS1A 1SMYC 3QWNA 3MVVA 1EYDA 2N55A 3Q23A 4CGYB 1T5EA 3T53B 2IJ0A 1KTKA 1STGA 2E2JB 4HAEA 1XWEA 1A2UA 5I4DA 1OXSC 1UUPA 1E2WA 3HKZB 4BBSB 4KD4A 1DOMA 4Q0FA 1A2TA 1Y69U 1TY2A 2PW7A 1O7ZA 5IGFA 4G7OC 1H9MA 1LT3D 1D6EC 3MAQA 3NHHA 3BDCA 2EYLA 1WTWA 2XSCA 1ZYRC 3L9AX 4XDXA 3A55A 2FJ2A 1SYFA 2B2WC 2PPBC 3M3YB 2RDFA 2JA8B 4CKEA 1AP0A 3MXGA 1W6KA 1VDZA 3I91A 1LACA 1NSNS 2M9VA 2PZWA 1B1ZA 2R3ZA 2KA7A 2F03A 4XT3B 3KK7A 3M85A 2NYZD 4HCEA 5FKAC 1X32A 4ZQ3A 1STEA 2LY7A 4ZUJA 1DCZA 5KRUA 4FF4A 3M7NA 2A68D 5T1IA 1EY4A 4QUFA 2F0MA 1FYCA 4K5VA 1Z7TA 3OIPA 1MSGA 3D31A 4A3JB 4IFDJ 1D5MC 2LMCB 4B08A 1ENCA 5D65A 4ABNA 4G57A 2EJMA 3VR2A 1BF4A 2JE6I 3BYYB 3OHXC 5EPLA 5CV4A 4PMBA 4X3TA 2RSNA 1I4RA 1PDQA 3R3OA 2EDGA 2WKCA 1K8MA 4WJWA 1MBYA 1CTMA 1PRTF 1T5XD 4L6TB 1EY8A 5K36H 4ZLTF 2SNSA 1B3AA 1SNPA 3Q22A 5CMDA 2WB1B 1EY5A 3K7AB 1OXTA 3K5MA 1F2YA 3BDOA 1RJTA 1II3A 5EQ0A 2A69C 4A3DB 5FOBB 4IUTA 1ENFA 2EYHA 3KLSA 4QB4A 4A3KB 1IKMA 1PMRA 3AB9A 2FHTA 4H7BA 3C3LA 4BY7B 2KECA 1WCMB 4RCNA 1HHVA 2RVLA 1EY6A 1RHPA 1PZJD 4PV1C 4X3SA 4HCSA 4HN7A 1FNUA 3D8GA 1ZKOA 3FMCA 1FNWA 1ICWA 1GUGA 3OSOA 2F0PA 1WTXA 1EYAA 4OGQC 2PO4A 3GTGB 1XTCD 1BBXC 1WD1A 5IIFA 2I07B 1Q8IA 3HOXB 4FNFA 3KLSX 1CI3M 3NXWA 1V1OA 1H9JA 2NB0A 4RGTA 1JWUD 5FLXE 1NCVA 1KLUD 1HA6A 1FNVA 1QNKA 4I7ZC 4QF4A 4K8IA 4UDUC 1BCPD 4LJZC 3FPPA 1G6ZA 3X3NA 4IQZA 1SSOA 4C3HG 4HSVA 5KNBA 2D5DA 1MD2D 1PTOH 3K57A 3J80E 2DY8A 1BXTA 2EY1A 1HA5A 1JQYD 1F9SA 2NTTA 3K6OA 4OHJA 3PUXA 3BG3A 3S2DB 3GTQB 3GTPB 1J9OA 1A3TA 1UEAB 3CKIB 3NQIA 4IURA 1Y1WB 1DYQA 4ME5A 4IALA 5CV9A 5ISRA 5J1ZA 5LL6S 2EYJA 3TP6A 1IW7C 2RDHA 2Z4HA 3D4RA 1F9QA 2XN9C 3TP7A 1JE4A 4A3FB 3VYSA 3GP7A 2F0SA 2QDBA 1IHZA 2HQEA 1YNND 2FMMA 1W6JA 5EJWA 3GTJB 2EYPA 2R93B 1LV9A 1YNJD 3EROA 3QB3A 3CQZB 1ILQA 4DK1A 2NN6G 2MHVA 1V43A 1SYCA 1I4PA 1SE2A 3URYA 2A73B 3KUPA 4XIGS 1PYWD 3MHBA 3K0YA 4RA8A 1JOOA 1BUVT 4AYBB 1J8IA 1O78A 3BYTB 2K04A 4RHSA 2EOTA 2SNMA 4A3GB 3W3AA 2ZXPA 4RH6A 5ELEA 3VR6A 4CJ1B 4FO2A 2JA7B 4X3UA 4C3IG 1U4PA 5EKLA 2A6EC 3S17B 3NTIA 2EYOA 1TT2A 2GA4B 3S9WA 2MUYA 3SK4A 3VR5A 4ZK9B 1TWAB 3KLRA 1LO5D 2M2LA 3TBIB 2J7ZA 3C2PA 1LT6D 3M4OB 5IGGA 5C5LA 2IX3A 4V190 3H94A 2KCNA 3DXJC 5C0XH 3SK5A 2DN8A 1EZ6A 3S14B 3K5LA 2AWNA 1LTID 3K58A 2R61A 3HOWB 2JEAI 1ZEQX 4H0LC 4FF3A 1V8QA 2BA0A 3G7LA 4XXEA 5E4WC 4K5WA 3JAME 4F7XA 1PRTC 2AUJD 1CHPD 5C3EB 4Q5VA 2K1BA 2E2DC 2PYKA 3OWFA 1EZ8A 1KABA 2NZ1D 5BN4A 3R8BA 4XQQA 3MFGA 3FDTA 3NSWA 1LTSD 3AU7A 4F87A 3NK9A 1SNQA 1PTOF 3FPUB 1SNOA 3DWPA 1XX8A 3KBXA 4PMCA 4DNRB 2N88A 2I46A 4LK1C 2KOLA 1GUSA 3C46A 1JWMD 4RAUC 1PXUA 3T16A 2F0WA 4UAIA 2HDLA 3EA6A 2B2YC 2K6AA 4BWGB 1AFPA 2EPBA 1TS4A 2L1BA 4QUCA 2XIWA 1PTOD 3PMFA 1F2ZA 2XRQD 2VNUD 5EPKA 2ZXRA 3OPOA 2F1MA 1Z6HA 3LX0A 5G3LF 1QILA 3T51B 3K5OA 5FLXL 2CW0C 2RDGA 2K5DA 1JCKB 5JAVA 5JJZA 1Y8NB 3BZDB 5C4JB 1LLRD 2KQ3A 4IUNA 2K05A 1I4GA 1CK1A 1HUMA 3H6MA 3MWYW 2F0IA 1STNA 2QKIC 5G3LD 3PUVA 1HUNA 2D62A 1RTOA 2JA6B 1G291 5CYUA 2X6GA 4KV6A 2WIIB 3I4LA 2VXWA 2KVMA 4OL7A 4DGZA 3VR4A 3J80L 3PUWA 1STBA 3E6ZX 5C0XJ 2Y0SB 2WINB 1Q90A 1A15A 4K2KA 5I6YA 2G9HD 2L55A 4H13C 2LS01 3PV0A 2PW5A 2NUCA 1V1PA 2BDNA 1XXGA 1TWCB 1PFNA 4WORA 4PMWA 2CQAA 5FO9B 1SYGA 2L4NA 1KDBA 1KDCA 2B2WA 5CBAE 4C1NK 1FD7D 5KEEA 1EY7A 2EY6A 1S5CD 4IUQA 3CRKC 3S2HB 1JR0D 1AEXA 3C1EA 4L63B 1PFBA 3MFYA 4YIJA 3ND8A 4IFDG 4WFN3 2F0NA 3WDNA 4KN7C 4B9XA 4IUVA 1M8AA 2EYMA 3HOZB 5JPNC 3EVQA 3VYTA 3QOJA 2IPKD 2X69A 4BY1B 1QOHA 2Z1CA 5K5PA 1PLFA 5DEHA 5IGEA 5E1FA 2NVXB 2A6HC 1CT1D 1ESFA 2BOSA 5DM63 5C0XI 4H44C 3OOCA 5HGTA 1SFOB 3DUZA 3QG1A 4N9PA 5FO7B 1EIHA 5M5XB 1GUNA 1EEID 2YYZA 5M3MB 5T1GA 1TY0A 2A5HA 1SNMA 1B50A 3MXNA 3MA2B 3GTLB 1KNEA 5AFWA 4F88A 1SBBB 2VB3X 1IKLA 1I4HA 1EEFD 4DXFA 3IKJA 1QWYA 1VMCA 4U673 1D1KA 1B9MA 4F8MA 1V1PB 3TZDA 4FVMA 4OO1H 3S1NB 5E4XA 3HGBA 1HTPA 2RQXA 4K6LA 2OT2A 2QF7A 5EBDA 2BDOA 1H9SB 1R4QB 3SK8A 1UAPA 2Q8IB 1S5DD 4KN4C 3EJIA 3FEWX 3JAML 1G2TA 3P20A 2PCFB 2EJFC 1SE3A 1Q3LA 4Y7NB 2F0DA 2F3WA 2LFNA 1LTGD 2FFKB 2ZT9C 4GZYC 4DAYA 3V2TA 2B8FA 1B4OA 3RUZA 4X3KA 3GV3A 1RKNA 1LT5D 1DONA 5CV6A 1SDFA 1NR4A 4C3HB 1AW7A 5C4HA 3TP5A 3CU7A 3GTMB 1BDOA 3H09A 1JICA 2MJ8A 3NQTA 1SXTA 3Q0AA 1Y8OB 1OXXK 2BA1A 5LL6X 4HEDA 4ODGA 3PUZA 1HFGA 3M4YA 3U9OA 4C2MB 4KY5A 1CFMA 2PMZB 1STAA 3OW7A 3KBGA 1BCPF 2E2IB 2SDFA 2OF1A 2L9HA 1PFMA 5KYIA 1BQQT 5JOBA 2R6GA 3J7YW 2K28A 3D3RA 4S3SA 2K33A 2BE5D 2H4OA 3D6WA 2KEDA 3PIP3 3A8IE 4KK7A 3SHLA 2B2TC 3ZYYX 2HCCA 3Q6SA 3ITPA 1TVXA 5C4ZA 2VB2X 4DNTB 4ZUIA 3I72A 4BA2I 1QJOA 3TMEA 3L3OC 3LNNA 2VUMB 1RTNA 1X3PA 2QEJC 3I73A 5I2XA 1G91A 1IL8A 5JVH3 5ELCA 1HCZA 1FR3A 3GTOB 2F0QA 3J81E 1F77A 2E76C 2NWGA 1R9TB 4MN3A 1BOSA 1S4ZA 1B44D 2L5TA 4C3IB 1U4RA 3TSSA 1QE6A 1ESRA 3D4WA 2DY7A 3V96A 4NW2A 4EQOA 4K5XA 3IL8A 2NVTB 4A3MB 4HSPA 3IFDA 1VF7A 5EBCA 5NUCA 1GHJA 3HRZC 1LTTD 4XT1B 4A3EB 1WD0A 4RHRA 1HTLD 2WV6D 1GUOA 3S16B 2PZUA 4XYQA 4KHVA 5JPMC 4CKCA 5CV7A 1SNDA 2C5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOL A;  4ZAI A;  2EOT A;  2K28 A;  2L12 A;  4CJ2 C;  1G6Z A;  1DOL A;  2B2Y A;  4RAU C;  4R8I A;  1EL0 A;  1BO0 A;  2BDN A;  1SSO A;  3N52 A;  1G2S A;  1VMC A;  3D6W A;  4RWS C;  4OIK A;  4ZLT F;  1PFN A;  2B2U A;  2B2T A;  2D9U A;  2KED A;  1B3A A;  1EQT A;  4HSV A;  4CJ1 B;  2KEE A;  4UAI A;  2HDL A;  5CMD A;  1O7Z A;  4X3U A;  2B2Y C;  3TZD A;  1U4P A;  1QG7 A;  2MP1 A;  1AZP A;  3I90 A;  1HRJ A;  2L4N A;  1GUW A;  5E4X A;  2B2W A;  1EOT A;  2EPB A;  5CBA E;  2MPM A;  1WTW A;  2L1B A;  1RJT A;  1O80 A;  2JP1 A;  2B2T C;  4QUC A;  1KNA A;  4XDX A;  2HCC A;  2XIW A;  5EQ0 A;  5COR A;  3Q6S A;  2DY8 A;  2Q8R E;  4IUQ A;  3DEP A;  3ONA B;  1ZXT A;  4IUT A;  4ZKB B;  1CA6 A;  1NAP A;  1U4L A;  1C8C A;  2HUG A;  3F2U A;  2FJ2 A;  3GV6 A;  2B2W C;  1TVX A;  2N88 A;  4R9W A;  1IKM A;  1PFB A;  4ZK9 B;  5EPK A;  2KUM A;  1ROD A;  2FHT A;  1AP0 A;  5EKI A;  2M2L A;  1F9S A;  2J7Z A;  4ZKC B;  2KEC A;  1G2T A;  1HHV A;  3I91 A;  3SVM A;  1RTN A;  1NR2 A;  2RVL A;  1F9R A;  4IUV A;  1WTR A;  1EIG A;  1Q3L A;  2HCI A;  1RHP A;  1M8A A;  1X3P A;  1BNZ A;  2MGS A;  1ML0 D;  4X3S A;  4HCS A;  3LWE A;  1G91 A;  2FFK B;  4IUU A;  1IL8 A;  2HDM A;  1MI2 A;  2R3Z A;  1J9O A;  2B2U C;  5JJZ A;  1WTO A;  1U4M A;  4XT3 B;  1VMP A;  1ICW A;  1B4O A;  4IUR A;  1WVL A;  1X3Q A;  2NYZ D;  5COY A;  1E0B A;  2L11 A;  4X3K A;  3I3C A;  3GV3 A;  3UI2 A;  2K05 A;  2K03 A;  1DON A;  1X32 A;  2X69 A;  1WTX A;  1CM9 A;  1NR4 A;  1SDF A;  2B2V A;  5D14 A;  1HUM A;  2H1E A;  2NWG A;  3TN2 A;  1O7Y A;  1BBX C;  1F9Q A;  2RSO A;  1WD1 A;  4MN3 A;  1PLF A;  1JE4 A;  1S4Z A;  2CVR A;  4U68 A;  1U4R A;  3HP3 A;  3MWY W;  1XYI A;  5DNF A;  3QO2 A;  5T1I A;  3DM1 A;  2EE1 A;  2B2V C;  4QUF A;  1WTV A;  1JIC A;  1HUN A;  2MJ8 A;  1B53 A;  1RTO A;  3G7L A;  2FMM A;  1QE6 A;  3H91 A;  4CJ0 B;  5E4W C;  1HFN A;  1MSH A;  1ESR A;  3P7J A;  5EJW A;  2IL8 A;  2DY7 A;  1MSG A;  1DOK A;  2X6G A;  4IUP A;  3DEO A;  1LV9 A;  4MHE A;  2N55 A;  1ILQ A;  1F9P A;  4NW2 A;  1DZ1 A;  1EIH A;  2JYO A;  5D65 A;  5CBE E;  4HED A;  2VXW A;  2KVM A;  3IL8 A;  5EPJ A;  1WTP A;  2K1B A;  4LMQ D;  5T1G A;  1NCV A;  3I8Z A;  3IFD A;  1HFG A;  2NZ1 D;  1HA6 A;  1QNK A;  4HAE A;  3KUP A;  1BF4 A;  4XT1 B;  3FDT A;  4OIJ A;  1WD0 A;  1F2L A;  5EPL A;  1AZQ A;  4O42 A;  4RA8 A;  1CA5 A;  1ILP A;  1B50 A;  4X3T A;  2RSN A;  3MTS A;  1PDQ A;  2Q8T A;  2RA4 A;  2X6L A;  2SDF A;  3R93 A;  1A15 A;  1SAP A;  2FIN B;  3FPU B;  1WTQ A;  1KNE A;  1MGS A;  2L9H A;  1J8I A;  1PFM A;  1DOM A;  5AFW A;  4DN4 M;  1IKL A;  1XX8 A;  2K01 A;  3KBX A;  2K04 A;  1B2T A; 
#chains in the Genus database with same CATH topology
 3J7A V;  1SMY D;  2XWB B;  3KOJ A;  1Y1W H;  4YWM A;  4BBR G;  1S5E D;  4J6H A;  2F0H A;  5EKK A;  2OEO A;  4M1U B;  4R1J A;  5IY0 A;  1Q8K A;  2ID0 A;  4PG3 A;  4DR7 Q;  1KQS A;  1UE6 A;  2K14 A;  4GNX C;  1SMX A;  5IGD A;  3AFQ A;  4J8Q A;  1FL0 A;  3EIV A;  4A3F H;  1E3P A;  1Q12 A;  4FDB A;  1IYJ B;  1LTB D;  4JI1 L;  5IT9 E;  1EOT A;  4KKS A;  1YIJ A;  4B3R L;  5IOC A;  1RDP D;  1J6Q A;  3KDF A;  2RF4 A;  1CHQ D;  1GKH A;  5IE8 A;  3HS0 C;  3GTJ H;  3F2U A;  1EY9 A;  4DXG A;  2R93 H;  3WOF A;  3CQZ H;  4P73 A;  1C48 A;  4JI3 Q;  4DK0 A;  4OO1 I;  2A68 C;  1PH1 A;  2C35 B;  4MTN A;  1WTR A;  1EWI A;  2MGS A;  3IAY A;  4DUZ Q;  1ML0 D;  1VQ7 A;  3LWE A;  2VQE Q;  3E3X A;  3FRP B;  1VMP A;  3IFT A;  1ZYR D;  2QA4 A;  4QMG A;  4RKL A;  3RR5 A;  3I3C A;  3TQY A;  1HPC A;  3VYU A;  5GAE C;  3G4S A;  1IYU A;  1EWC A;  1CM9 A;  2F3V A;  5M9O A;  3PO2 B;  1XNR L;  2EZV A;  1A8V A;  5E3F A;  3DM3 A;  1AE3 A;  4FF2 A;  3UDG A;  1XYI A;  3J7A F;  3QR8 A;  1HQM C;  3CHB D;  1OXV A;  2B2V C;  3HOV G;  4JI0 Q;  4PNY A;  2HQL A;  3ERS X;  1HFN A;  3S17 H;  3ND9 A;  1I6V C;  4JPB W;  2JQO A;  2ICE C;  4HMI A;  1L1O C;  5FLM H;  4RGO S;  3MZ5 A;  1TU2 B;  3M9B A;  1VQA A;  5EPJ A;  2F0G A;  4RFB A;  4ULL A;  4WRD A;  1XTD A;  2M00 A;  4BXX H;  1TWA H;  1S5B D;  1JOQ A;  2Q2H A;  4X66 L;  4EQP A;  2JA5 G;  4O42 A;  1NY4 A;  3MTS A;  2A19 A;  1WTQ A;  1MGS A;  1EU4 A;  3I70 A;  4UP8 A;  4LF5 Q;  3I4M B;  4A93 G;  1X3F A;  4YCV A;  4MTK A;  3L0O A;  3I56 A;  2B2Y A;  1NMF A;  2JJQ A;  2Z0S A;  2UXB L;  1A63 A;  3PQI A;  1KL9 A;  1SYD A;  4B3M Q;  1G2S A;  3S14 H;  2EYF A;  3BZC A;  1KAW A;  5ELF A;  1WYD A;  3HOW H;  1PYB A;  2RKS A;  4KY6 A;  4TQU S;  2D2C C;  1WTH A;  2F4V Q;  5M3F B;  2JK8 A;  4IPC A;  3CXC A;  2IW3 A;  3ERQ A;  3DHQ A;  4E6I A;  4FF1 A;  2J0T D;  2CHB D;  4FYD A;  2HHH Q;  1C8C A;  3QIA A;  1F2M A;  4R9W A;  4WJ4 A;  1ASZ A;  3KDF B;  4K14 A;  1Q46 A;  4JV5 L;  3M7G A;  1Y1V G;  1Q1B A;  1PH8 A;  2WAQ B;  1AN8 A;  1IYV A;  5C3E H;  2GVB A;  3NPP A;  3STB C;  4JK1 C;  1Q81 C;  5CV8 A;  3SVM A;  3HOU B;  2L0C A;  1D5Z C;  5JEA H;  1H9K A;  1TXY A;  2PZT A;  4IUU A;  2HDM A;  5C6A A;  3H3V H;  5M3F H;  5IOD A;  1UE1 A;  2R7Z G;  5C0X G;  1CKN A;  5I9O A;  4DR5 L;  2A69 D;  1BKB A;  4QIW B;  2F0L A;  3DMU A;  3PF4 A;  3TP8 A;  5ELD A;  2PQE A;  4XTC S;  3X3M A;  3L2P A;  4DR1 L;  3DWQ A;  5KIX A;  1BCP C;  4C3J G;  3H0G G;  1U9R A;  2VS1 A;  1Z47 A;  1N32 Q;  2PMZ E;  3MC0 B;  4A3I G;  3BJU A;  1ONL A;  1PRT B;  3NWT A;  1UE5 A;  3DEO A;  3UE0 A;  1V9P A;  1BBU A;  1UWV A;  3CPW A;  1HR0 Q;  1L0W A;  3NWS A;  4DNI A;  3I8Z A;  2DJG C;  4YHH Q;  3D6C A;  4FP5 D;  4CHT B;  4OIJ A;  4GKJ L;  4LFA L;  1HZC A;  2EY5 A;  4G4K A;  2X6L A;  1EWH A;  1N9W A;  3U50 C;  1DJR D;  4JI6 Q;  5C4J H;  1HNW L;  2F0U A;  2FMC A;  4JOI C;  2C9O A;  1EL0 A;  3K59 A;  5M5Y B;  3N52 A;  2B2U A;  1A6X A;  1A3U A;  4IFD H;  1N33 Q;  4A3L G;  1XJV A;  3J80 i;  3N6R A;  3GTK B;  1HRJ A;  2NVY B;  3J81 L;  5C4X G;  3HOY B;  2ZTE A;  5IGC A;  4N8X 1;  1N36 Q;  4CDD C;  4RCO A;  4DU9 A;  2JA6 H;  1CA6 A;  1K8O A;  2D0O A;  5IWA L;  4A3B B;  3RLN A;  2ENB A;  3CRL C;  2AQ3 B;  4PZ8 A;  2E5L Q;  2O5J C;  3KYH C;  1JC7 A;  1R4P B;  1XMQ L;  4EQN A;  1G6P A;  2AWO A;  3GD7 A;  2WFW A;  4LNQ A;  4UPA A;  2IX0 A;  1HNX Q;  5C44 B;  2D0P A;  1YNN C;  2RCF A;  1CQF A;  1H9S A;  3GTK H;  1D7Q A;  1HZ9 A;  1SR3 A;  4NXM Q;  2B2U C;  1VQN A;  1YNJ C;  4POF A;  4LFC L;  1S40 A;  1E0B A;  2EJG C;  4L8J A;  2VQF Q;  4ZYS A;  4AIM A;  5CGK A;  4A3B H;  1ET9 A;  1D5X C;  1S5F D;  1FVI A;  2K50 A;  3TN2 A;  1CKN B;  2EVB A;  4IJL A;  4L5T A;  1OXU A;  4DUY Q;  2CVR A;  4FXG C;  1TWC H;  1D2B A;  1A3V A;  1L0X B;  2GVA A;  1CZG A;  3T13 A;  4JYA L;  5KND A;  4HJ7 A;  2OXP A;  4HR7 B;  1C0A A;  4CJ0 B;  4R8N A;  2DNC A;  2XRS D;  4DV2 Q;  3AMU A;  2IL8 A;  1VQ9 A;  4JI7 L;  3BVG A;  3PIO 3;  3RMH A;  1QCB D;  2ALY B;  1B70 B;  3VA5 A;  5IT9 L;  3S2H H;  1LM0 A;  4DV3 L;  5JEA J;  2HD3 A;  4P71 A;  4OEM B;  3EQL C;  4G7H C;  1IW7 D;  3CCE A;  5J22 A;  4XQJ A;  3S24 A;  1SNC A;  1CKO A;  1F2L A;  3T1Y Q;  1SRO A;  5JVG 3;  4P72 A;  1LT4 D;  1QNU A;  3HKS A;  3HOZ H;  4I7A A;  4HMJ A;  4X65 L;  5C3W A;  1A62 A;  1TQO A;  2RHS B;  4YY3 L;  4BY1 H;  4YWL A;  1E1O A;  5A2Q E;  3FKI B;  1DM0 B;  1X9N A;  3G6J B;  1IBM Q;  2JSO A;  2MP1 A;  3ULP A;  2B63 G;  2TSS A;  2ZJQ A;  3KF8 A;  2NVX H;  3T4A C;  5GAH C;  3NBH B;  4ZKB B;  4EVO A;  1BR9 A;  2HUG A;  4DR3 Q;  2IT1 A;  1U0L A;  2NBF A;  3K81 C;  2V1C C;  5M5X H;  1GJX A;  4B9W A;  2BH2 A;  5M3M H;  2SOB A;  1VQO A;  3Q24 A;  4OEL B;  1F9R A;  1JOK A;  2RHQ B;  1YVC A;  2F0K A;  2Z4I A;  3HKZ G;  4BBS G;  2A6E D;  1PYS B;  1XPU A;  4IN3 A;  2F0F A;  3VR3 A;  3GTL H;  1HJP A;  2LKV A;  4RGN A;  4IZ8 A;  4NMZ A;  2AMC B;  2UUB Q;  1LAB A;  1SE4 A;  3M4P A;  3UDX A;  3G71 A;  2RSO A;  2EXZ A;  1B9N A;  5JJK A;  1RIP A;  3JAM i;  3H3V I;  4A3C H;  4EGV A;  1HQR D;  2O4X A;  3I4N B;  4L5Q A;  4CDC C;  2QIL A;  2AKW B;  4MNO A;  3MXP A;  4CBV A;  1EU3 A;  1UNS A;  4L5S A;  3F1Z A;  4QGU A;  2E75 C;  1F9P A;  3OIQ A;  3CF5 A;  4DAP A;  3OWE B;  2PNR C;  2TMP A;  1PZI D;  4QCL A;  2JA8 G;  2N49 A;  1TS2 A;  3OMC A;  4R4C A;  2YV5 A;  3RZD B;  3UE1 A;  2UU9 Q;  2UXD L;  1EQV A;  2CH4 A;  1GXD C;  2RA4 A;  4Y7N H;  4OWW B;  1VQC A;  1PTO C;  1SAP A;  2VL6 A;  1XMO Q;  1TKW B;  1KAA A;  4HIO A;  4KY7 A;  4R8I A;  1G8Z D;  5FO8 B;  1ASY A;  1PRT D;  2JN4 A;  4LF5 L;  3EFX D;  4AQY Q;  2E2H B;  3BVZ A;  2NTS A;  2WKD A;  2ZTC A;  1RL2 A;  4GN3 B;  2B2T A;  2D9U A;  3U4Z A;  3QOL A;  4C3H H;  1EQT A;  3PO3 B;  1VQ4 A;  3A5Z B;  2WAQ E;  5FLX c;  4OO1 G;  1QG7 A;  5KYL A;  1AZP A;  2AUK A;  5KNC A;  3GTM H;  4GLV B;  3GDE A;  4RKB A;  3D4D A;  3LWU A;  4KKU A;  1KNA A;  4DF7 A;  3NE5 B;  5C5M A;  2Q8R E;  3ONA B;  3HG9 A;  2SEB D;  2P5Z X;  1U4L A;  4RMF A;  5GAG C;  2F0O A;  4A3J G;  4IFD I;  2N78 A;  5K36 G;  3RZO B;  1VQJ A;  4QIW E;  4J15 A;  4KMU C;  2MNA A;  2HHH L;  1VQE A;  2UUC Q;  2K5V A;  4C2M H;  3I4O A;  4X64 Q;  1BNZ A;  3AEV A;  1I4Q A;  2B8G A;  2F0T A;  2E2I H;  1JE5 A;  3F8T A;  1E2V A;  3R2T A;  4DV0 Q;  4BBR B;  3UI2 A;  1IZ6 A;  1EIY B;  5CC4 A;  3BDL A;  4PQX A;  5J39 A;  1H95 A;  1QB5 D;  1HZB A;  3J80 c;  1VQG A;  3RZO H;  1KRS A;  1SYB A;  1SJH D;  4KJO A;  4I65 A;  3HP3 A;  1PH5 A;  4DR4 L;  1K0R A;  3QO2 A;  1PTO B;  5BN5 A;  2EE1 A;  2B39 A;  5D3I B;  2H5X A;  2WB1 G;  5IP9 H;  4K0K Q;  2K7V A;  1E2Z A;  1TII D;  4XQN A;  1C7Y A;  5DAU A;  4JBJ A;  4JI8 Q;  1MSH A;  3P7J A;  3EBE A;  2EY2 A;  2CW0 D;  2DJF C;  3HEJ A;  2WAC A;  4A3D G;  4MHE A;  3RLF A;  5LHY 1;  1N32 L;  1X54 A;  2DNE A;  2V4D A;  1TWG B;  3MEH A;  1HNZ Q;  4UY8 C;  2NN6 H;  4LAA A;  3FVQ A;  3SDZ A;  1ET6 A;  4ID6 A;  4UHV A;  4TKO B;  2IWH A;  3HZX A;  4BY7 G;  4NDX A;  1JB3 A;  1WCM G;  5FK9 C;  4B3S Q;  2VUM H;  3U9S A;  4YHH L;  4A76 A;  2FIN B;  3P1H A;  2JEB I;  3NTH A;  5I6W A;  4IO9 A;  4DN4 M;  3SE0 A;  2L12 A;  3W2D A;  4CJ2 C;  3NEN A;  4GNX A;  5I2Y A;  3GTO H;  1BO0 A;  3UDI A;  2XWJ B;  4RWS C;  3A54 A;  1J5E Q;  1R9T H;  1VF5 C;  3L7Z C;  3Q8D A;  3WOE A;  3A7A B;  3HOV B;  4C3I H;  4JCV E;  2MPM A;  4O1N A;  3HOX G;  1N33 L;  3CC7 A;  4RG1 A;  3T56 B;  2F0J A;  3K5N A;  1NAP A;  4POG A;  3IRB A;  5IYD H;  3ER0 A;  1PA6 A;  1N36 L;  2CCZ A;  1UEB A;  1STY A;  1I4X A;  1ROD A;  2KUM A;  4K6D A;  5IYB H;  2NVT H;  3K7U C;  4A3M H;  1GUT A;  2JA5 B;  2E5L L;  1CZW A;  1GO3 E;  3PIP A;  1B3Q A;  3A0J A;  1Q1E A;  4A3E H;  1QVG A;  4DA2 A;  5ELN A;  1MI2 A;  4A93 B;  3V05 A;  3S16 H;  2ZJR A;  4DFA A;  4JW0 A;  1HNX L;  1EFI D;  3AQQ A;  1X3Q A;  1CSQ A;  1D1I A;  3NUC A;  2AQ2 B;  2L11 A;  1HR0 W;  4NXN L;  4KHP L;  4JI2 Q;  2K03 A;  4NXM L;  2YU9 B;  4TSS A;  2B2V A;  2ZXO A;  1DD2 A;  4TVA B;  1SLJ A;  3RD4 A;  3S15 B;  2WP8 J;  4U68 A;  4LF4 Q;  4DR6 Q;  4A75 A;  1IBL Q;  1CQV A;  4IPG A;  5IP7 H;  4NP5 A;  1HXY D;  5DNF A;  4FXK C;  1L1O A;  1M4V A;  1VCI A;  4RGM A;  5D3D A;  2XVS A;  1RD9 D;  5A2Q L;  4K2L A;  4CKB A;  2QGQ A;  2CH4 W;  1MJC A;  5ELB A;  1W2B A;  3CME A;  2ATW A;  1DZ1 A;  2IX1 A;  5CBE E;  1Y1V B;  2F0E A;  3SK6 A;  1SEB D;  4C1N I;  1BVS A;  4KKT A;  3A56 A;  5I9P A;  4KI0 A;  2O5I C;  2Z8L A;  3O13 A;  3CPF A;  3BVM A;  1AZQ A;  2GN5 A;  2A8V A;  1CA5 A;  4LF7 Q;  4IPD A;  1NBW A;  3K0X A;  3TDQ A;  5DM7 3;  3H3V C;  4FXD A;  2A6H D;  4X6A H;  2R7Z B;  1Y1W G;  4LFB Q;  2BCO A;  1DOL A;  2QCP X;  4DV5 Q;  4HTH A;  3MXU A;  1FGB D;  3CC4 A;  4KJN A;  1Y1V H;  1EY0 A;  1E7Z A;  4OIK A;  4GNX B;  5M5W B;  3PO2 H;  2OTJ A;  1KLG D;  3C1F A;  4A3F G;  5F2D A;  4C3J B;  4ZRZ A;  4Y52 H;  2F0V A;  1Y8P B;  3H0G B;  3VA7 A;  4DV6 Q;  1PVO A;  1CSP A;  4P2C B;  4Z9C B;  3R2I A;  1I94 Q;  1EQQ A;  4KTA A;  4A3I B;  1ENA A;  1TWH B;  1SJE D;  1EYC A;  1IBM L;  4OX9 L;  1KRT A;  4YCU A;  2R93 G;  5LMU Q;  2J4X A;  3J7Z C;  4QL5 A;  1STH A;  2KHS A;  1L0Y B;  3S1M B;  3GO5 A;  3SEB A;  4ZKC B;  4DR3 L;  1S3O A;  1I3Q B;  1RF2 D;  1EIG A;  2HCI A;  1GOZ A;  3RNU A;  4C3J H;  3U4V A;  2MFI A;  3F2D A;  4IOC A;  1X55 A;  3G48 A;  5J3B A;  4AYB G;  4N9T A;  1WTO A;  1U4M A;  1WVL A;  1TR5 A;  1DXM A;  5COY A;  1TWF B;  1C4Q A;  5KGU A;  3I4M H;  4NKL A;  4B3T Q;  3PCO B;  2G5D A;  2VZA A;  4JBW A;  3GQB A;  3E0E A;  4A3G G;  5D14 A;  5BN3 A;  1O7Y A;  2JXM B;  1KDA A;  1VQB A;  4DAV A;  4G7Z C;  3PUY A;  3S1R B;  2UUB L;  5AJ3 Q;  5TSS A;  1TS3 A;  2OWO A;  5C4X B;  3QJY A;  3DM1 A;  1WTV A;  2JA7 G;  1PH7 A;  1B53 A;  4DV4 Q;  4BA1 I;  3KFU A;  2PI2 E;  3H91 A;  2K5W A;  2KJX A;  4KHZ A;  1L1O B;  1DOK A;  4XYO A;  5FLM G;  4IUP A;  3SXH A;  3A8J E;  4CDE C;  2BE5 C;  4C56 C;  2JYO A;  1KC8 C;  2KCT A;  4K8J A;  1WTP A;  1JOR A;  2ICI A;  3A8K E;  4LMQ D;  4BS9 A;  2ASB A;  4BXX G;  1U5K A;  2B3G A;  3A7L A;  2XGT A;  1ILP A;  3J81 j;  3HOU H;  4JI4 Q;  2Q8T A;  3NP8 A;  5DLQ E;  3R93 A;  2RBM A;  4JOI A;  4DV1 L;  1JB7 A;  4LF6 L;  1O7L A;  5EGT A;  4V0B A;  1I6H B;  2K01 A;  1B2T A;  2NN6 I;  1NJI C;  4ZAI A;  1NUC A;  2A74 C;  4HID A;  4TRD A;  3VYR A;  5HUR A;  1VQK A;  1JJ2 A;  3TZU A;  2KEE A;  1LTR D;  3HOW G;  2R92 B;  3G6E A;  2F4I A;  3E5S A;  4J1M A;  4X62 Q;  3RN5 A;  3I90 A;  5L37 A;  5JJL A;  1GUW A;  1K83 B;  1O80 A;  2JP1 A;  4ILW A;  5COR A;  4OWX B;  3P75 A;  4WJ3 M;  3DEP A;  1JWS D;  1ZXT A;  4UP9 A;  3OMG A;  4MIU A;  3GV6 A;  3CCS A;  2RCN A;  1Z9F A;  5C3E G;  5CR3 A;  1IBK Q;  2NVQ B;  5EKI A;  2KBN A;  5A35 A;  1LTA D;  1PZK D;  1RCV D;  1NR2 A;  2K32 A;  3DWA A;  2R92 H;  5JEA G;  1I50 B;  4P75 A;  2G9D A;  2AQ1 B;  2E74 C;  2XNA C;  3NBH A;  2O2L D;  4M8A A;  3J81 i;  2QW7 A;  5M3F G;  2UUC L;  2KCC A;  3NBI A;  3A5U A;  4KD3 A;  1S72 A;  4EX5 A;  1SYE A;  1GHK A;  5LMN Q;  2H1E A;  1TS5 A;  1Q82 C;  1YJN A;  3H15 A;  1VQF A;  5M5Y H;  1BCP B;  1UE7 A;  3S1Q B;  3E0J A;  5IGB A;  2AHO B;  5C3X A;  2B63 B;  3SR1 A;  5CV5 A;  1OO9 B;  1MKH A;  2K5Q A;  3NTK A;  1H9R A;  2NVY H;  3BS1 A;  3HOY H;  3VDY A;  1SMY C;  3QWN A;  3MVV A;  1EYD A;  2N55 A;  4LF9 Q;  3Q23 A;  5GQO A;  4JI8 L;  1T5E A;  4CGY B;  3T53 B;  2IJ0 A;  1KTK A;  1STG A;  2E2J B;  4HAE A;  2F52 A;  1XWE A;  1A2U A;  5I4D A;  2I0Q A;  1OXS C;  1HNZ L;  1UUP A;  2EXD A;  1E2W A;  3HKZ B;  4JBM A;  4DKA C;  4BBS B;  5C44 H;  4GOP C;  2UUA L;  1Y14 B;  2K52 A;  4KD4 A;  1DOM A;  4DV7 L;  4R4O A;  4Q0F A;  1A2T A;  3T1H Q;  2N3S A;  1CKM A;  1Y69 U;  1TY2 A;  1JT8 A;  2PW7 A;  4NB3 A;  2PI2 A;  1QVF A;  3AYH B;  4DK6 C;  1O7Z A;  5IGF A;  4G7O C;  1H9M A;  1LT3 D;  1D6E C;  3MAQ A;  3NHH A;  3BDC A;  4EQ5 A;  2EYL A;  1WTW A;  2XSC A;  1ZYR C;  4BBS H;  3L9A X;  4XDX A;  3A55 A;  2JA6 G;  4QJF A;  1XNR Q;  1C9O A;  2FJ2 A;  1SYF A;  2B2W C;  5ELO A;  2PPB C;  3M3Y B;  2RDF A;  1VQH A;  4CKE A;  2JA8 B;  4HJ9 A;  1AP0 A;  3MXG A;  3W5O A;  1W6K A;  1PH2 A;  1VDZ A;  3I91 A;  4OWT B;  2JA9 A;  1LAC A;  1NSN S;  2M9V A;  2PZW A;  1KD1 C;  4DR7 L;  2Y0S G;  1B1Z A;  2R3Z A;  2KA7 A;  2F03 A;  4XT3 B;  3KK7 A;  3M85 A;  2NYZ D;  4HCE A;  5FKA C;  4A3B G;  1IXR A;  1X32 A;  4ZQ3 A;  1STE A;  1M90 C;  2LY7 A;  4GS3 A;  4ZUJ A;  1DCZ A;  2Z6K C;  5KRU A;  2EIF A;  4JI2 L;  4FF4 A;  1YHB A;  3WWV A;  3M7N A;  4O2D A;  2A68 D;  3FKI H;  4GOP B;  5T1I A;  1EY4 A;  4QUF A;  2F0M A;  4JI3 L;  5FJ8 H;  1FYC A;  4K5V A;  1D8L A;  1HH2 P;  4LF4 L;  1Z7T A;  3OIP A;  4MZ9 A;  1MSG A;  3D31 A;  4A3J B;  4IFD J;  1A0I A;  1D5M C;  4DUZ L;  2Q2U A;  2LMC B;  4AH6 A;  4B08 A;  2DUD A;  1ENC A;  5D65 A;  2VQE L;  1YJW A;  4ABN A;  4G57 A;  2K75 A;  2EJM A;  3VR2 A;  1BF4 A;  2JE6 I;  3BYY B;  3OHX C;  5EPL A;  5CV4 A;  4PMB A;  4PZ6 A;  4X3T A;  2RSN A;  1I4R A;  1PDQ A;  4JG2 A;  3R3O A;  2EDG A;  2WKC A;  3HOZ G;  1K8M A;  4WJW A;  1MBY A;  1OTC A;  1CTM A;  4OXP A;  4LF7 L;  1PRT F;  1KIX A;  1T5X D;  2BH8 A;  3PIO A;  4JI0 L;  4HIK A;  4L6T B;  1EY8 A;  5K36 H;  4BY1 G;  4ZLT F;  3PSI A;  2SNS A;  1DGS A;  4GKK Q;  1B3A A;  1SNP A;  2UXC Q;  3Q22 A;  5CMD A;  1YHQ A;  2WB1 B;  1EY5 A;  3K7A B;  1OXT A;  3K5M A;  1F2Y A;  2CWA A;  3BDO A;  1RJT A;  3FHW A;  3CC2 A;  2IY5 B;  1II3 A;  2K5H A;  5EQ0 A;  1EFW A;  3I4N H;  2A69 C;  4A3D B;  4DV6 L;  2YTY A;  5FOB B;  4IUT A;  1ENF A;  1SRU A;  1I94 L;  2EYH A;  3KLS A;  4QB4 A;  3TS2 A;  3KF6 A;  4A3K B;  1IKM A;  1PMR A;  3AB9 A;  2FHT A;  4H7B A;  5M3M G;  3C3L A;  4CDF C;  4BY7 B;  2KEC A;  5LMU L;  1WCM B;  4RCN A;  1HHV A;  2RVL A;  1EY6 A;  1RHP A;  1PZJ D;  2YTX A;  4B3M L;  3RZD H;  4PV1 C;  4X3S A;  4HCS A;  4APV A;  4HN7 A;  1FNU A;  3D8G A;  5IYC H;  2OTL A;  1ZKO A;  3FMC A;  1FNW A;  1ICW A;  2PNH A;  1GUG A;  3OSO A;  3KLW A;  2B29 A;  2F0P A;  2F4V L;  1WTX A;  1EYA A;  4A3K H;  4OGQ C;  4LW1 A;  2PO4 A;  3GTG B;  1XTC D;  1BBX C;  1WD1 A;  5IIF A;  1LYL A;  2E2H H;  4B3T L;  2I5H A;  2I07 B;  3STB D;  4A3C G;  1Q8I A;  2OCE A;  3PO3 H;  4LF8 Q;  1HNW Q;  3HOX B;  4FNF A;  3KLS X;  1CI3 M;  4LWC A;  3NXW A;  1PH4 A;  1MIU A;  3MXN B;  1V1O A;  1H9J A;  1VS0 A;  1VQ5 A;  2NB0 A;  4RGT A;  4LUV A;  1Q7Y C;  1JWU D;  3CCU A;  1YJ9 A;  5FLX E;  1VQD A;  1NCV A;  3CW2 C;  1KLU D;  1HA6 A;  1FNV A;  1QNK A;  4I7Z C;  3J81 c;  5IWA Q;  4QF4 A;  3CP0 A;  4K8I A;  2ZTD A;  3NEM A;  4UDU C;  1BCP D;  4LJZ C;  1VQL A;  1FGU A;  2KEN A;  4YY3 Q;  1K8A C;  3FPP A;  4JI4 L;  1K3R A;  1E1T A;  2R7F A;  1G6Z A;  3X3N A;  4IQZ A;  4BBR H;  1SSO A;  2K4K A;  4C3H G;  4HSV A;  5KNB A;  1YBY A;  2D5D A;  2Z6B A;  3SGI A;  4IJH A;  4LFC Q;  1HR0 L;  4R4I A;  1L2F A;  1MD2 D;  2R7D A;  4L5R C;  1PTO H;  2EQS A;  3K57 A;  3J80 E;  2DY8 A;  3TS0 A;  4DAY B;  1BXT A;  2EY1 A;  1W3S A;  1HA5 A;  1TWG H;  1WJJ A;  1JQY D;  1F9S A;  4JI6 L;  2CKZ B;  3KF6 B;  2NTT A;  3K6O A;  1FJG Q;  3I55 A;  1IBK L;  4OHJ A;  1PH3 A;  3PUX A;  3BG3 A;  3S2D B;  3GTQ B;  3GTP B;  1J9O A;  1A3T A;  1UEA B;  3CKI B;  2XTI A;  3TRZ A;  3NQI A;  4IUR A;  1Y1W B;  3ICE A;  5GRO A;  1DYQ A;  5IT9 c;  4ME5 A;  2VW9 A;  4IAL A;  3BU2 A;  5CV9 A;  1X6O A;  5ISR A;  5J1Z A;  5LL6 S;  3HFZ B;  1VQP A;  2EYJ A;  4GLA C;  3TP6 A;  1IW7 C;  2RDH A;  2Z4H A;  1PHJ A;  3D4R A;  1F9Q A;  2XN9 C;  1EIF A;  3TP7 A;  1JE4 A;  2LSS A;  4A3F B;  1XPO A;  3VYS A;  3FP9 A;  3GP7 A;  2F0S A;  2QDB A;  5IP9 G;  5LMN L;  1IHZ A;  2HQE A;  1K0S A;  1YNN D;  3HOV H;  2FMM A;  1W6J A;  2MQH A;  5EJW A;  3HKZ E;  2EYP A;  3GTJ B;  2R93 B;  1X3E A;  1X56 A;  1LV9 A;  1YNJ D;  3ERO A;  3QB3 A;  3CQZ B;  1ILQ A;  4DK1 A;  2NN6 G;  2MHV A;  1V43 A;  1SYC A;  1I4P A;  3I7F A;  1SE2 A;  3URY A;  4LF9 L;  2A73 B;  3KUP A;  4XIG S;  1CUK A;  2VQF L;  4DPG A;  1PYW D;  2VUM G;  4HIM A;  3MHB A;  1P8L A;  2ZM6 Q;  3K0Y A;  1YEZ A;  4RA8 A;  5H1S E;  2JA5 H;  1QVC A;  4JI5 Q;  1JOO A;  1BUV T;  4AYB B;  1J8I A;  1O78 A;  3BYT B;  4DUY L;  4A93 H;  1WOC A;  2K04 A;  2MO0 A;  4RHS A;  2EOT A;  2SNM A;  4N8F A;  4A3G B;  3W1B A;  3W3A A;  4DV2 L;  2YU9 H;  2ZXP A;  4RH6 A;  5ELE A;  3VR6 A;  1XPR A;  4CJ1 B;  1EQR A;  4FO2 A;  4QY7 A;  3T1H L;  1YHA A;  2JA7 B;  4X3U A;  4C3I G;  3S15 H;  1U4P A;  1B7Y B;  4YWK A;  5EKL A;  2A6E C;  3S17 B;  3NTI A;  2EYO A;  4IPH A;  1N34 Q;  1TT2 A;  2GA4 B;  3S9W A;  3PGZ A;  1P16 A;  2MUY A;  5IYD G;  5LMN W;  3T1Y L;  3SK4 A;  3VR5 A;  3E9H A;  4ZK9 B;  5IYB G;  4A3G H;  3JAM c;  4H02 A;  4O0A A;  1TWA B;  3KLR A;  4A3M G;  1LO5 D;  2M2L A;  3TBI B;  3U58 A;  2J7Z A;  3TEH B;  3C2P A;  3EN2 A;  4A3E G;  1NTG A;  1LT6 D;  2JA7 H;  3M4O B;  2KCM A;  5IGG A;  4GN5 A;  5C5L A;  2IX3 A;  4V19 0;  3H94 A;  2KCN A;  3DXJ C;  2R7Z H;  5C0X H;  3SK5 A;  2FXQ A;  2DN8 A;  1EZ6 A;  3S14 B;  3K5L A;  2UXD Q;  2AWN A;  1LTI D;  3K58 A;  4HJ5 A;  2R61 A;  1AH9 A;  3HOW B;  5IP7 G;  2JEA I;  1ZEQ X;  1BBW A;  4H0L C;  5M5W H;  4FF3 A;  2Z9H A;  4QQB X;  1K8G A;  1V8Q A;  3H0G H;  3CCQ A;  2BA0 A;  3G7L A;  1QZH A;  3M4O H;  4XXE A;  2I5M X;  5E4W C;  4K5W A;  3JAM E;  4A3I H;  1TWH H;  2QDL A;  1XNQ Q;  4ME3 A;  4F7X A;  1WFQ A;  1PRT C;  2AUJ D;  1X3G A;  4LUZ A;  1CHP D;  3CCL A;  5C3E B;  4Q5V A;  2K1B A;  2E2D C;  2PYK A;  3OWF A;  1EZ8 A;  1KAB A;  2NZ1 D;  5BN4 A;  3R8B A;  4XQQ A;  3MFG A;  3FDT A;  3S1M H;  3NSW A;  1EYG A;  1LTS D;  3AU7 A;  4F87 A;  2ES2 A;  3NK9 A;  1EOV A;  1I3Q H;  2LXK A;  1SNQ A;  2WB1 E;  1PTO F;  3FPU B;  1SNO A;  3DWP A;  1XX8 A;  3KBX A;  2N88 A;  4PMC A;  4DNR B;  2I46 A;  4LK1 C;  2KOL A;  1GUS A;  2ZJP A;  3C46 A;  1TWF H;  1JWM D;  4RAU C;  1PXU A;  3T16 A;  1AE2 A;  1VQI A;  2F0W A;  3PO2 G;  2IHE A;  1IL2 A;  2A1A A;  4UAI A;  2HDL A;  3KJO A;  4A3L H;  3EA6 A;  2B2Y C;  2K6A A;  4BWG B;  1AFP A;  1O7I A;  3S1R H;  4GKK L;  2EPB A;  1TS4 A;  5C4X H;  2L1B A;  4QUC A;  1PH6 A;  2UXC L;  2XIW A;  1WI5 A;  1PTO D;  3PMF A;  2UU9 L;  4GN4 B;  1F2Z A;  1ICF B;  2XRQ D;  2VNU D;  4DR4 Q;  1XMO L;  5EPK A;  2ZXR A;  3OPO A;  2F1M A;  3J7A 5;  1Z6H A;  3LX0 A;  5G3L F;  1QIL A;  4DR2 Q;  3T51 B;  4AQY L;  3K5O A;  5FLX L;  2CW0 C;  2RDG A;  2K5D A;  4R4T A;  1YNX A;  1JCK B;  5JAV A;  5JJZ A;  1Y8N B;  3BZD B;  5C4J B;  1M1K C;  1LLR D;  2KQ3 A;  4OON A;  4IUN A;  4HJ8 A;  3I4M G;  1I6H H;  3B6Y A;  2K05 A;  1I4G A;  2OQK A;  1CK1 A;  1HUM A;  3H6M A;  1PV4 A;  1SN8 A;  1JJG A;  1K9M C;  3MWY W;  2F0I A;  1STN A;  2QKI C;  2KHI A;  3PUV A;  5G3L D;  1HUN A;  2D62 A;  1RTO A;  2JA6 B;  1G29 1;  5CYU A;  1K83 H;  1I5F A;  2X6G A;  4LF8 L;  4KV6 A;  1K28 A;  2WII B;  4X64 L;  3I4L A;  2VXW A;  2KVM A;  4OL7 A;  4DGZ A;  3VR4 A;  4GOP A;  2WAQ G;  3J80 L;  4DV0 L;  1YIT A;  3PUW A;  2NVQ H;  3F2B A;  2NZH A;  1STB A;  5BR8 Q;  3OTO Q;  3D0F A;  3E6Z X;  3HOU G;  5C0X J;  2Y0S B;  2WIN B;  4A4I A;  1Q90 A;  1A15 A;  1I50 H;  4K2K A;  5I6Y A;  2G9H D;  2PQA A;  3BZK A;  2L55 A;  4H13 C;  4K0K L;  5JJI A;  1QZG A;  2LS0 1;  3PV0 A;  2PW5 A;  4HJA A;  2NUC A;  2QEX A;  1V1P A;  4PZ7 A;  2BDN A;  4JI1 Q;  1XXG A;  1TWC B;  1PFN A;  4WOR A;  1X65 A;  4PMW A;  4B3R Q;  2K5N A;  2Q2T A;  2CQA A;  4ZCK A;  5FO9 B;  1SYG A;  1K3B C;  4NXN Q;  2L4N A;  3S1Q H;  4KHP Q;  1KDB A;  1KDC A;  2B2W A;  5CBA E;  1GD7 A;  2B63 H;  4C1N K;  1FD7 D;  5KEE A;  1EY7 A;  2EY6 A;  1S5C D;  4JC0 A;  4IUQ A;  4B3S L;  4KLK A;  1GM5 A;  3CRK C;  3S2H B;  1T9H A;  1JR0 D;  1AEX A;  3C1E A;  4L63 B;  1PFB A;  3MFY A;  4YIJ A;  3ND8 A;  2CQO A;  1V1Q A;  4IFD G;  4WFN 3;  2F0N A;  2YTV A;  3K80 C;  3WDN A;  4KN7 C;  2R92 G;  4IOA A;  4B9X A;  1K73 C;  4IUV A;  2E2J H;  1M8A A;  2EYM A;  4JBK A;  3W1G A;  3HOZ B;  3UDF A;  1J5E L;  5JPN C;  1FJG L;  3CD6 A;  1QUQ A;  3EVQ A;  1YZ6 A;  3VYT A;  3QOJ A;  2IPK D;  2Z6K A;  3OYY A;  2X69 A;  1NNX A;  4BY1 B;  1QOH A;  2Z1C A;  1SE8 A;  3RLO A;  5K5P A;  3OW2 A;  1PLF A;  5DEH A;  2VY3 A;  5IGE A;  2N8N A;  5E1F A;  2NVX B;  2A6H C;  1CT1 D;  2DGY A;  1ESF A;  2BOS A;  5DM6 3;  5C0X I;  3HOY G;  4H44 C;  3OOC A;  4AYB E;  5HGT A;  1SFO B;  1YI2 A;  3DUZ A;  3QG1 A;  4N9P A;  5FO7 B;  1EIH A;  5M5X B;  1GUN A;  1EEI D;  2YYZ A;  5M3M B;  4X66 Q;  5T1G A;  1TY0 A;  3JC6 6;  3M3Y H;  3CCR A;  2JA8 H;  2HT1 A;  2A5H A;  1SNM A;  1Q86 C;  1JJC B;  4OX9 Q;  2MO1 A;  3TRE A;  1B50 A;  1NMG A;  3MXN A;  5C44 G;  3MA2 B;  3A74 A;  3CCM A;  3GTL B;  2UXB Q;  1KNE A;  5AFW A;  4F88 A;  1SBB B;  1IBL L;  4DR6 L;  2VB3 X;  1IKL A;  4YCW A;  2ZM6 L;  1I4H A;  1EEF D;  4JI5 L;  4DXF A;  1SFO H;  3M4Q A;  1VQ8 A;  3IKJ A;  2LXJ A;  1QWY A;  2PQA B;  4GLX A;  1VMC A;  4U67 3;  4ALP A;  1D1K A;  1B9M A;  4F8M A;  3F2C A;  1V1P B;  3TZD A;  2CWP A;  4FVM A;  4OO1 H;  3S1N B;  5E4X A;  3HGB A;  1HTP A;  2RQX A;  3CCJ A;  4K6L A;  2OT2 A;  1EUJ A;  2QF7 A;  5EBD A;  2BDO A;  3PF5 A;  4JV5 Q;  1H9S B;  1R4Q B;  3SK8 A;  1UAP A;  2Q8I B;  2L15 A;  2Q2I A;  1S5D D;  4KN4 C;  1N34 L;  4A3J H;  2IHF A;  3EJI A;  3FEW X;  3JAM L;  3CMA A;  1G2T A;  3P20 A;  2PCF B;  4LFB L;  2EJF C;  3ULJ A;  1E22 A;  1SE3 A;  4DV5 L;  1Q3L A;  5EAY A;  3E9I A;  4R4Q A;  2F0D A;  2F3W A;  3ULL A;  4Y7N B;  2LFN A;  4DR5 Q;  1LTG D;  3GTQ H;  2FFK B;  3S1N H;  2ZT9 C;  4GZY C;  4DAY A;  3V2T A;  2B8F A;  5E7N A;  1B4O A;  3RUZ A;  4X3K A;  3GV3 A;  1RKN A;  1LT5 D;  3I2Z A;  4DR1 Q;  5CV6 A;  1DON A;  3CCV A;  1SDF A;  1NR4 A;  4C3H B;  3LGJ A;  1AW7 A;  1PFS A;  1QUQ B;  5C4H A;  3TP5 A;  4LF6 Q;  4DV1 Q;  4LUO A;  3CU7 A;  3FKI G;  1E24 A;  3GTM B;  1BDO A;  3H09 A;  5FJ8 G;  1JIC A;  2MJ8 A;  3NQT A;  3K7A H;  1SXT A;  4DAM A;  3Q0A A;  2OQ0 A;  1Y8O B;  4A3D H;  1OXX K;  2BA1 A;  4GKJ Q;  5LL6 X;  4LFA Q;  4HED A;  4DK3 C;  4ODG A;  3PUZ A;  1G51 A;  1XNQ L;  1HFG A;  3M4Y A;  3U9O A;  4C2M B;  4KY5 A;  1CFM A;  3NEL A;  1VQM A;  2PMZ B;  1STA A;  3OW7 A;  4BY7 H;  3KBG A;  1WCM H;  1BCP F;  2E2I B;  5HY6 A;  2SDF A;  2CFM A;  2L9H A;  2OF1 A;  1PFM A;  5KYI A;  3CAM A;  1BQQ T;  5AJ3 L;  4UP7 A;  5GAD C;  5JOB A;  2R6G A;  1VQ6 A;  3KF8 B;  2K28 A;  3J7Y W;  3D3R A;  4DV4 L;  4S3S A;  2K33 A;  3MEF A;  1MJE A;  2BE5 D;  2I5L X;  2H4O A;  3D6W A;  2KED A;  3RN2 A;  3PIP 3;  3GTG H;  3A8I E;  4KK7 A;  3SHL A;  2B2T C;  2HIX A;  3ZYY X;  3HOX H;  3I4N G;  2HCC A;  3Q6S A;  1XMQ Q;  3ITP A;  5HGQ A;  1TVX A;  5C4Z A;  2VB2 X;  4DNT B;  3AFP A;  4ZUI A;  3I72 A;  4BA2 I;  1QJO A;  3TME A;  2HIV A;  3L3O C;  3LNN A;  1JMC A;  2VUM B;  1RTN A;  2KHJ A;  1X3P A;  1B8A A;  2QEJ C;  3I73 A;  1NE3 A;  4JVZ A;  5I2X A;  1G91 A;  1IL8 A;  5IYC G;  5JVH 3;  5ELC A;  1GVP A;  1HCZ A;  4DR2 L;  1FR3 A;  1N8R C;  4X62 L;  3GTO B;  1HZA A;  2F0Q A;  2F3I A;  3J81 E;  4A3K G;  1F77 A;  1LTL A;  2E76 C;  2NWG A;  1R9T B;  4MN3 A;  1BOS A;  2UUA Q;  4JYA Q;  1S4Z A;  3ZJY C;  1B44 D;  2L5T A;  4C3I B;  4DV7 Q;  1U4R A;  3TSS A;  3PO3 G;  3K8A A;  4JI7 Q;  1QE6 A;  4DV3 Q;  1ESR A;  2Y0S E;  3D4W A;  2DY7 A;  1KXL A;  2E8G A;  3DLL A;  1LUZ A;  3V96 A;  4NW2 A;  4NPS A;  2NZO A;  4EQO A;  1MHW C;  4K5X A;  3IL8 A;  2NVT B;  4A3M B;  4HSP A;  3IFD A;  1VF7 A;  5EBC A;  5NUC A;  1GHJ A;  3HRZ C;  1LTT D;  4XT1 B;  4A3E B;  1KHI A;  1WD0 A;  4RHR A;  1HTL D;  2WV6 D;  4P74 A;  1GUO A;  3S16 B;  2PZU A;  4XYQ A;  4KHV A;  4X65 Q;  5JPM C;  4CKC A;  5CV7 A;  3KJP A;  5BR8 L;  3OTO L;  1SND A;  3S2D H;  3GTP H;  2C5C A;  1PH9 A; 
#chains in the Genus database with same CATH homology
 3J7A V;  1SMY D;  2XWB B;  1S5E D;  4J6H A;  2F0H A;  5EKK A;  2OEO A;  4M1U B;  2ID0 A;  5IGD A;  4J8Q A;  1Q12 A;  1LTB D;  5IT9 E;  1EOT A;  4KKS A;  5IOC A;  1RDP D;  1CHQ D;  3HS0 C;  3F2U A;  1EY9 A;  4DXG A;  3WOF A;  1C48 A;  4DK0 A;  4OO1 I;  2A68 C;  1WTR A;  2MGS A;  3IAY A;  1ML0 D;  3LWE A;  3FRP B;  1VMP A;  3IFT A;  1ZYR D;  4QMG A;  4RKL A;  3I3C A;  3VYU A;  1HPC A;  1IYU A;  1EWC A;  1CM9 A;  2F3V A;  5M9O A;  3PO2 B;  2EZV A;  5E3F A;  4FF2 A;  1XYI A;  3J7A F;  1HQM C;  3CHB D;  1OXV A;  2B2V C;  4PNY A;  1HFN A;  3ND9 A;  1I6V C;  2ICE C;  4HMI A;  4RGO S;  3MZ5 A;  1TU2 B;  5EPJ A;  2F0G A;  4RFB A;  4ULL A;  4WRD A;  2M00 A;  1S5B D;  1JOQ A;  4EQP A;  4O42 A;  3MTS A;  1WTQ A;  1MGS A;  1EU4 A;  3I70 A;  3I4M B;  2B2Y A;  1SYD A;  1G2S A;  2EYF A;  5ELF A;  2RKS A;  4KY6 A;  4TQU S;  2D2C C;  5M3F B;  2IW3 A;  3ERQ A;  3DHQ A;  4E6I A;  4FF1 A;  2J0T D;  2CHB D;  4FYD A;  1C8C A;  3QIA A;  1F2M A;  4R9W A;  4K14 A;  3M7G A;  1Q1B A;  2WAQ B;  1AN8 A;  1IYV A;  3NPP A;  4JK1 C;  5CV8 A;  3SVM A;  3HOU B;  2L0C A;  1D5Z C;  5JEA H;  1H9K A;  2PZT A;  4IUU A;  2HDM A;  5C6A A;  5IOD A;  5C0X G;  5I9O A;  2A69 D;  4QIW B;  2F0L A;  3DMU A;  3TP8 A;  5ELD A;  2PQE A;  4XTC S;  3X3M A;  3DWQ A;  5KIX A;  1BCP C;  4C3J G;  1U9R A;  1Z47 A;  3MC0 B;  1ONL A;  1PRT B;  3NWT A;  3DEO A;  3NWS A;  3I8Z A;  3D6C A;  4FP5 D;  4CHT B;  4OIJ A;  2EY5 A;  4G4K A;  2X6L A;  1EWH A;  1DJR D;  2F0U A;  2FMC A;  2C9O A;  1EL0 A;  3K59 A;  5M5Y B;  3N52 A;  2B2U A;  1A6X A;  1A3U A;  4IFD H;  3N6R A;  3GTK B;  1HRJ A;  2NVY B;  3J81 L;  3HOY B;  5IGC A;  4RCO A;  4DU9 A;  1CA6 A;  1K8O A;  4A3B B;  2ENB A;  3CRL C;  2AQ3 B;  2O5J C;  1JC7 A;  1R4P B;  4EQN A;  2AWO A;  3GD7 A;  2IX0 A;  5C44 B;  1YNN C;  1CQF A;  1H9S A;  2B2U C;  1YNJ C;  1E0B A;  2EJG C;  4L8J A;  4ZYS A;  5CGK A;  1ET9 A;  1D5X C;  1S5F D;  3TN2 A;  2EVB A;  1OXU A;  2CVR A;  4FXG C;  1D2B A;  1A3V A;  1L0X B;  1CZG A;  3T13 A;  5KND A;  2OXP A;  4HR7 B;  4CJ0 B;  4R8N A;  2DNC A;  2XRS D;  3AMU A;  2IL8 A;  3BVG A;  3PIO 3;  3RMH A;  1QCB D;  3VA5 A;  5IT9 L;  5JEA J;  4G7H C;  3EQL C;  1IW7 D;  5J22 A;  4XQJ A;  1SNC A;  1F2L A;  5JVG 3;  1LT4 D;  1QNU A;  4HMJ A;  5C3W A;  1TQO A;  5A2Q E;  3FKI B;  1DM0 B;  3G6J B;  2JSO A;  2MP1 A;  2TSS A;  3KF8 A;  3T4A C;  4ZKB B;  4EVO A;  1BR9 A;  2HUG A;  2IT1 A;  2NBF A;  1GJX A;  4B9W A;  2SOB A;  3Q24 A;  1F9R A;  1JOK A;  2F0K A;  2Z4I A;  2A6E D;  4IN3 A;  2F0F A;  3VR3 A;  2LKV A;  4RGN A;  4IZ8 A;  4NMZ A;  1LAB A;  1SE4 A;  2RSO A;  2EXZ A;  1B9N A;  4EGV A;  1HQR D;  2O4X A;  3I4N B;  2QIL A;  3MXP A;  4CBV A;  1EU3 A;  1UNS A;  2E75 C;  1F9P A;  3OIQ A;  4DAP A;  3OWE B;  2PNR C;  2TMP A;  1PZI D;  4QCL A;  1TS2 A;  3OMC A;  3RZD B;  1EQV A;  1GXD C;  2RA4 A;  1SAP A;  1PTO C;  1TKW B;  1KAA A;  4KY7 A;  4R8I A;  1G8Z D;  5FO8 B;  1PRT D;  3EFX D;  2E2H B;  3BVZ A;  2NTS A;  2WKD A;  2B2T A;  2D9U A;  3QOL A;  1EQT A;  3PO3 B;  4OO1 G;  1QG7 A;  5KYL A;  1AZP A;  2AUK A;  5KNC A;  4RKB A;  3D4D A;  3LWU A;  4KKU A;  1KNA A;  4DF7 A;  3NE5 B;  5C5M A;  2Q8R E;  3ONA B;  3HG9 A;  2SEB D;  1U4L A;  2F0O A;  4IFD I;  5K36 G;  3RZO B;  4KMU C;  1BNZ A;  1I4Q A;  2B8G A;  2F0T A;  1E2V A;  3R2T A;  4BBR B;  3UI2 A;  5CC4 A;  3BDL A;  4PQX A;  5J39 A;  1QB5 D;  1SYB A;  1SJH D;  4KJO A;  4I65 A;  3HP3 A;  3QO2 A;  1PTO B;  5BN5 A;  2EE1 A;  2B39 A;  5D3I B;  2K7V A;  1E2Z A;  1TII D;  4XQN A;  5DAU A;  1MSH A;  3P7J A;  2EY2 A;  2CW0 D;  3HEJ A;  2WAC A;  4MHE A;  3RLF A;  5LHY 1;  2DNE A;  2V4D A;  1TWG B;  3MEH A;  2NN6 H;  4LAA A;  3FVQ A;  3SDZ A;  1ET6 A;  4ID6 A;  4TKO B;  2IWH A;  3HZX A;  4NDX A;  1JB3 A;  5FK9 C;  3U9S A;  2FIN B;  3P1H A;  2JEB I;  3NTH A;  5I6W A;  4DN4 M;  3SE0 A;  2L12 A;  3W2D A;  4CJ2 C;  5I2Y A;  1BO0 A;  2XWJ B;  4RWS C;  3A54 A;  1VF5 C;  3L7Z C;  3WOE A;  3A7A B;  3HOV B;  2MPM A;  4O1N A;  3T56 B;  2F0J A;  3K5N A;  1NAP A;  1STY A;  1I4X A;  1ROD A;  2KUM A;  4K6D A;  1GUT A;  2JA5 B;  1CZW A;  1Q1E A;  4DA2 A;  1MI2 A;  4A93 B;  3V05 A;  4DFA A;  1EFI D;  1X3Q A;  1D1I A;  3NUC A;  2AQ2 B;  2L11 A;  2K03 A;  2YU9 B;  4TSS A;  2B2V A;  2ZXO A;  1DD2 A;  3RD4 A;  3S15 B;  2WP8 J;  4U68 A;  1CQV A;  4NP5 A;  1HXY D;  5DNF A;  4FXK C;  1M4V A;  1VCI A;  4RGM A;  5D3D A;  2XVS A;  1RD9 D;  5A2Q L;  4K2L A;  4CKB A;  5ELB A;  1DZ1 A;  2IX1 A;  5CBE E;  1Y1V B;  2F0E A;  3SK6 A;  1SEB D;  4C1N I;  5I9P A;  4KKT A;  3A56 A;  4KI0 A;  2O5I C;  2Z8L A;  3O13 A;  3BVM A;  1AZQ A;  1CA5 A;  3TDQ A;  5DM7 3;  3H3V C;  4FXD A;  2A6H D;  2R7Z B;  2BCO A;  1DOL A;  2QCP X;  4HTH A;  3MXU A;  1FGB D;  4KJN A;  1EY0 A;  4OIK A;  5M5W B;  1KLG D;  3C1F A;  5F2D A;  4C3J B;  4ZRZ A;  2F0V A;  1Y8P B;  3H0G B;  3VA7 A;  4P2C B;  4Z9C B;  3R2I A;  4KTA A;  4A3I B;  1ENA A;  1TWH B;  1SJE D;  1EYC A;  2J4X A;  1STH A;  2KHS A;  1L0Y B;  3S1M B;  3GO5 A;  3SEB A;  4ZKC B;  1I3Q B;  1RF2 D;  1EIG A;  2HCI A;  1GOZ A;  4N9T A;  1WTO A;  1U4M A;  1WVL A;  1TR5 A;  1DXM A;  5COY A;  1TWF B;  1C4Q A;  5KGU A;  4NKL A;  4JBW A;  3GQB A;  5D14 A;  5BN3 A;  1O7Y A;  2JXM B;  1KDA A;  4DAV A;  4G7Z C;  3PUY A;  3S1R B;  5TSS A;  1TS3 A;  5C4X B;  3QJY A;  3DM1 A;  1WTV A;  1B53 A;  4BA1 I;  3H91 A;  2K5W A;  2KJX A;  4KHZ A;  1DOK A;  4XYO A;  4IUP A;  3SXH A;  3A8J E;  2BE5 C;  4C56 C;  2JYO A;  4K8J A;  1WTP A;  1JOR A;  2ICI A;  3A8K E;  4LMQ D;  4BS9 A;  3A7L A;  1ILP A;  2Q8T A;  3NP8 A;  3R93 A;  2RBM A;  1O7L A;  5EGT A;  4V0B A;  1I6H B;  2K01 A;  1B2T A;  2NN6 I;  4ZAI A;  1NUC A;  2A74 C;  4TRD A;  3VYR A;  5HUR A;  3TZU A;  2KEE A;  1LTR D;  2R92 B;  2F4I A;  3E5S A;  4J1M A;  3I90 A;  1GUW A;  1K83 B;  1O80 A;  2JP1 A;  4ILW A;  5COR A;  3P75 A;  3DEP A;  1JWS D;  1ZXT A;  3OMG A;  4MIU A;  3GV6 A;  5CR3 A;  2NVQ B;  5EKI A;  5A35 A;  1LTA D;  1PZK D;  1RCV D;  1NR2 A;  2K32 A;  3DWA A;  5JEA G;  1I50 B;  2G9D A;  2AQ1 B;  2E74 C;  2XNA C;  3NBH A;  2O2L D;  4M8A A;  2KCC A;  3NBI A;  4KD3 A;  1SYE A;  1GHK A;  2H1E A;  1TS5 A;  1BCP B;  3S1Q B;  3E0J A;  5IGB A;  5C3X A;  2B63 B;  3SR1 A;  5CV5 A;  1OO9 B;  2K5Q A;  3NTK A;  1H9R A;  3BS1 A;  1SMY C;  3QWN A;  3MVV A;  1EYD A;  2N55 A;  3Q23 A;  4CGY B;  1T5E A;  3T53 B;  2IJ0 A;  1KTK A;  1STG A;  2E2J B;  4HAE A;  1XWE A;  1A2U A;  5I4D A;  1OXS C;  1UUP A;  1E2W A;  3HKZ B;  4BBS B;  4KD4 A;  1DOM A;  4Q0F A;  1A2T A;  1Y69 U;  1TY2 A;  2PW7 A;  1O7Z A;  5IGF A;  4G7O C;  1H9M A;  1LT3 D;  1D6E C;  3MAQ A;  3NHH A;  3BDC A;  2EYL A;  1WTW A;  2XSC A;  1ZYR C;  3L9A X;  4XDX A;  3A55 A;  2FJ2 A;  1SYF A;  2B2W C;  2PPB C;  3M3Y B;  2RDF A;  2JA8 B;  4CKE A;  1AP0 A;  3MXG A;  1W6K A;  1VDZ A;  3I91 A;  1LAC A;  1NSN S;  2M9V A;  2PZW A;  1B1Z A;  2R3Z A;  2KA7 A;  2F03 A;  4XT3 B;  3KK7 A;  3M85 A;  2NYZ D;  4HCE A;  5FKA C;  1X32 A;  4ZQ3 A;  1STE A;  2LY7 A;  4ZUJ A;  1DCZ A;  5KRU A;  4FF4 A;  3M7N A;  2A68 D;  5T1I A;  1EY4 A;  4QUF A;  2F0M A;  1FYC A;  4K5V A;  1Z7T A;  3OIP A;  1MSG A;  3D31 A;  4A3J B;  4IFD J;  1D5M C;  2LMC B;  4B08 A;  1ENC A;  5D65 A;  4ABN A;  4G57 A;  2EJM A;  3VR2 A;  1BF4 A;  2JE6 I;  3BYY B;  3OHX C;  5EPL A;  5CV4 A;  4PMB A;  4X3T A;  2RSN A;  1I4R A;  1PDQ A;  3R3O A;  2EDG A;  2WKC A;  1K8M A;  4WJW A;  1MBY A;  1CTM A;  1PRT F;  1T5X D;  4L6T B;  1EY8 A;  5K36 H;  4ZLT F;  2SNS A;  1B3A A;  1SNP A;  3Q22 A;  5CMD A;  2WB1 B;  1EY5 A;  3K7A B;  1OXT A;  3K5M A;  1F2Y A;  3BDO A;  1RJT A;  1II3 A;  5EQ0 A;  2A69 C;  4A3D B;  5FOB B;  4IUT A;  1ENF A;  2EYH A;  3KLS A;  4QB4 A;  4A3K B;  1IKM A;  1PMR A;  3AB9 A;  2FHT A;  4H7B A;  3C3L A;  4BY7 B;  2KEC A;  1WCM B;  4RCN A;  1HHV A;  2RVL A;  1EY6 A;  1RHP A;  1PZJ D;  4PV1 C;  4X3S A;  4HCS A;  4HN7 A;  1FNU A;  3D8G A;  1ZKO A;  3FMC A;  1FNW A;  1ICW A;  1GUG A;  3OSO A;  2F0P A;  1WTX A;  1EYA A;  4OGQ C;  2PO4 A;  3GTG B;  1XTC D;  1BBX C;  1WD1 A;  5IIF A;  2I07 B;  1Q8I A;  3HOX B;  4FNF A;  3KLS X;  1CI3 M;  3NXW A;  1V1O A;  1H9J A;  2NB0 A;  4RGT A;  1JWU D;  5FLX E;  1NCV A;  1KLU D;  1HA6 A;  1FNV A;  1QNK A;  4I7Z C;  4QF4 A;  4K8I A;  4UDU C;  1BCP D;  4LJZ C;  3FPP A;  1G6Z A;  3X3N A;  4IQZ A;  1SSO A;  4C3H G;  4HSV A;  5KNB A;  2D5D A;  1MD2 D;  1PTO H;  3K57 A;  3J80 E;  2DY8 A;  1BXT A;  2EY1 A;  1HA5 A;  1JQY D;  1F9S A;  2NTT A;  3K6O A;  4OHJ A;  3PUX A;  3BG3 A;  3S2D B;  3GTQ B;  3GTP B;  1J9O A;  1A3T A;  1UEA B;  3CKI B;  3NQI A;  4IUR A;  1Y1W B;  1DYQ A;  4ME5 A;  4IAL A;  5CV9 A;  5ISR A;  5J1Z A;  5LL6 S;  2EYJ A;  3TP6 A;  1IW7 C;  2RDH A;  2Z4H A;  3D4R A;  1F9Q A;  2XN9 C;  3TP7 A;  1JE4 A;  4A3F B;  3VYS A;  3GP7 A;  2F0S A;  2QDB A;  1IHZ A;  2HQE A;  1YNN D;  2FMM A;  1W6J A;  5EJW A;  3GTJ B;  2EYP A;  2R93 B;  1LV9 A;  1YNJ D;  3ERO A;  3QB3 A;  3CQZ B;  1ILQ A;  4DK1 A;  2NN6 G;  2MHV A;  1V43 A;  1SYC A;  1I4P A;  1SE2 A;  3URY A;  2A73 B;  3KUP A;  4XIG S;  1PYW D;  3MHB A;  3K0Y A;  4RA8 A;  1JOO A;  1BUV T;  4AYB B;  1J8I A;  1O78 A;  3BYT B;  2K04 A;  4RHS A;  2EOT A;  2SNM A;  4A3G B;  3W3A A;  2ZXP A;  4RH6 A;  5ELE A;  3VR6 A;  4CJ1 B;  4FO2 A;  2JA7 B;  4X3U A;  4C3I G;  1U4P A;  5EKL A;  2A6E C;  3S17 B;  3NTI A;  2EYO A;  1TT2 A;  2GA4 B;  3S9W A;  2MUY A;  3SK4 A;  3VR5 A;  4ZK9 B;  1TWA B;  3KLR A;  1LO5 D;  2M2L A;  3TBI B;  2J7Z A;  3C2P A;  1LT6 D;  3M4O B;  5IGG A;  5C5L A;  2IX3 A;  4V19 0;  3H94 A;  2KCN A;  3DXJ C;  5C0X H;  3SK5 A;  2DN8 A;  1EZ6 A;  3S14 B;  3K5L A;  2AWN A;  1LTI D;  3K58 A;  2R61 A;  3HOW B;  2JEA I;  1ZEQ X;  4H0L C;  4FF3 A;  1V8Q A;  2BA0 A;  3G7L A;  4XXE A;  5E4W C;  4K5W A;  3JAM E;  4F7X A;  1PRT C;  2AUJ D;  1CHP D;  5C3E B;  4Q5V A;  2K1B A;  2E2D C;  2PYK A;  3OWF A;  1EZ8 A;  1KAB A;  2NZ1 D;  5BN4 A;  3R8B A;  4XQQ A;  3MFG A;  3FDT A;  3NSW A;  1LTS D;  3AU7 A;  4F87 A;  3NK9 A;  1SNQ A;  1PTO F;  3FPU B;  1SNO A;  3DWP A;  1XX8 A;  3KBX A;  4PMC A;  4DNR B;  2N88 A;  2I46 A;  4LK1 C;  2KOL A;  1GUS A;  3C46 A;  1JWM D;  4RAU C;  1PXU A;  3T16 A;  2F0W A;  4UAI A;  2HDL A;  3EA6 A;  2B2Y C;  2K6A A;  4BWG B;  1AFP A;  2EPB A;  1TS4 A;  2L1B A;  4QUC A;  2XIW A;  1PTO D;  3PMF A;  1F2Z A;  2XRQ D;  2VNU D;  5EPK A;  2ZXR A;  3OPO A;  2F1M A;  1Z6H A;  3LX0 A;  5G3L F;  1QIL A;  3T51 B;  3K5O A;  5FLX L;  2CW0 C;  2RDG A;  2K5D A;  1JCK B;  5JAV A;  5JJZ A;  1Y8N B;  3BZD B;  5C4J B;  1LLR D;  2KQ3 A;  4IUN A;  2K05 A;  1I4G A;  1CK1 A;  1HUM A;  3H6M A;  3MWY W;  2F0I A;  1STN A;  2QKI C;  5G3L D;  3PUV A;  1HUN A;  2D62 A;  1RTO A;  2JA6 B;  1G29 1;  5CYU A;  2X6G A;  4KV6 A;  2WII B;  3I4L A;  2VXW A;  2KVM A;  4OL7 A;  4DGZ A;  3VR4 A;  3J80 L;  3PUW A;  1STB A;  3E6Z X;  5C0X J;  2Y0S B;  2WIN B;  1Q90 A;  1A15 A;  4K2K A;  5I6Y A;  2G9H D;  2L55 A;  4H13 C;  2LS0 1;  3PV0 A;  2PW5 A;  2NUC A;  1V1P A;  2BDN A;  1XXG A;  1TWC B;  1PFN A;  4WOR A;  4PMW A;  2CQA A;  5FO9 B;  1SYG A;  2L4N A;  1KDB A;  1KDC A;  2B2W A;  5CBA E;  4C1N K;  1FD7 D;  5KEE A;  1EY7 A;  2EY6 A;  1S5C D;  4IUQ A;  3CRK C;  3S2H B;  1JR0 D;  1AEX A;  3C1E A;  4L63 B;  1PFB A;  3MFY A;  4YIJ A;  3ND8 A;  4IFD G;  4WFN 3;  2F0N A;  3WDN A;  4KN7 C;  4B9X A;  4IUV A;  1M8A A;  2EYM A;  3HOZ B;  5JPN C;  3EVQ A;  3VYT A;  3QOJ A;  2IPK D;  2X69 A;  4BY1 B;  1QOH A;  2Z1C A;  5K5P A;  1PLF A;  5DEH A;  5IGE A;  5E1F A;  2NVX B;  2A6H C;  1CT1 D;  1ESF A;  2BOS A;  5DM6 3;  5C0X I;  4H44 C;  3OOC A;  5HGT A;  1SFO B;  3DUZ A;  3QG1 A;  4N9P A;  5FO7 B;  1EIH A;  5M5X B;  1GUN A;  1EEI D;  2YYZ A;  5M3M B;  5T1G A;  1TY0 A;  2A5H A;  1SNM A;  1B50 A;  3MXN A;  3MA2 B;  3GTL B;  1KNE A;  5AFW A;  4F88 A;  1SBB B;  2VB3 X;  1IKL A;  1I4H A;  1EEF D;  4DXF A;  3IKJ A;  1QWY A;  1VMC A;  4U67 3;  1D1K A;  1B9M A;  4F8M A;  1V1P B;  3TZD A;  4FVM A;  4OO1 H;  3S1N B;  5E4X A;  3HGB A;  1HTP A;  2RQX A;  4K6L A;  2OT2 A;  2QF7 A;  5EBD A;  2BDO A;  1H9S B;  1R4Q B;  3SK8 A;  1UAP A;  2Q8I B;  1S5D D;  4KN4 C;  3EJI A;  3FEW X;  3JAM L;  1G2T A;  3P20 A;  2PCF B;  2EJF C;  1SE3 A;  1Q3L A;  4Y7N B;  2F0D A;  2F3W A;  2LFN A;  1LTG D;  2FFK B;  2ZT9 C;  4GZY C;  4DAY A;  3V2T A;  2B8F A;  1B4O A;  3RUZ A;  4X3K A;  3GV3 A;  1RKN A;  1LT5 D;  1DON A;  5CV6 A;  1SDF A;  1NR4 A;  4C3H B;  1AW7 A;  5C4H A;  3TP5 A;  3CU7 A;  3GTM B;  1BDO A;  3H09 A;  1JIC A;  2MJ8 A;  3NQT A;  1SXT A;  3Q0A A;  1Y8O B;  1OXX K;  2BA1 A;  5LL6 X;  4HED A;  4ODG A;  3PUZ A;  1HFG A;  3M4Y A;  3U9O A;  4C2M B;  4KY5 A;  1CFM A;  2PMZ B;  1STA A;  3OW7 A;  3KBG A;  1BCP F;  2E2I B;  2SDF A;  2OF1 A;  2L9H A;  1PFM A;  5KYI A;  1BQQ T;  5JOB A;  2R6G A;  3J7Y W;  2K28 A;  3D3R A;  4S3S A;  2K33 A;  2BE5 D;  2H4O A;  3D6W A;  2KED A;  3PIP 3;  3A8I E;  4KK7 A;  3SHL A;  2B2T C;  3ZYY X;  2HCC A;  3Q6S A;  3ITP A;  1TVX A;  5C4Z A;  2VB2 X;  4DNT B;  4ZUI A;  3I72 A;  4BA2 I;  1QJO A;  3TME A;  3L3O C;  3LNN A;  2VUM B;  1RTN A;  1X3P A;  2QEJ C;  3I73 A;  5I2X A;  1G91 A;  1IL8 A;  5JVH 3;  5ELC A;  1HCZ A;  1FR3 A;  3GTO B;  2F0Q A;  3J81 E;  1F77 A;  2E76 C;  2NWG A;  1R9T B;  4MN3 A;  1BOS A;  1S4Z A;  1B44 D;  2L5T A;  4C3I B;  1U4R A;  3TSS A;  1QE6 A;  1ESR A;  3D4W A;  2DY7 A;  3V96 A;  4NW2 A;  4EQO A;  4K5X A;  3IL8 A;  2NVT B;  4A3M B;  4HSP A;  3IFD A;  1VF7 A;  5EBC A;  5NUC A;  1GHJ A;  3HRZ C;  1LTT D;  4XT1 B;  4A3E B;  1WD0 A;  4RHR A;  1HTL D;  2WV6 D;  1GUO A;  3S16 B;  2PZU A;  4XYQ A;  4KHV A;  5JPM C;  4CKC A;  5CV7 A;  1SND A;  2C5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...