4XT1B

Structure of a nanobody-bound viral gpcr bound to human chemokine cx3cl1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
EHHGVTKCAITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor.
pubmed doi rcsb
source organism Cytomegalovirus
molecule tags Viral protein/signalling protein
molecule keywords G-protein coupled receptor homolog US28
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xt1B00
4ZAIA 1PFNA 1RHPA 1F2LA 1VMCA 3FDTA 3IFDA 1U4PA 4LMQD 4NW2A 2K03A 2HDMA 4HAEA 1RODA 4MHEA 1EOTA 2X69A 1DOLA 1AZPA 2KOLA 3QO2A 4RA8A 1G2SA 3MTSA 3P7JA 2RA4A 4X3UA 1IKMA 1HRJA 2R3ZA 2EE1A 3G7LA 2M2LA 2RSOA 1NCVA 5CBEE 4HSVA 4R9WA 1U4RA 1SSOA 4IURA 2L1BA 1WTVA 4HEDA 5CORA 3I91A 1EIHA 2B2TC 2N88A 3DEPA 1IL8A 2D9UA 2FJ2A 1O7ZA 2B2WC 5EPKA 2FINB 3D6WA 1QG7A 4OIKA 1ILQA 1B3AA 4OIJA 1PDQA 1BO0A 1KNEA 2NZ1D 4XT3B 2HDLA 4RAUC 2Q8TA 1E0BA 3DM1A 1WTOA 1HFNA 5E4WC 4ZLTF 1XX8A 4HCSA 3I90A 3GV6A 4X3TA 1B53A 1WD0A 1MGSA 1QE6A 2B2TA 1NAPA 2MP1A 1DOMA 3DEOA 3R93A 1HUMA 1QNKA 4XT1B 4ZKCB 2KEDA 2B2UC 2L12A 3LWEA 1WTPA 1EIGA 2B2YC 1WTQA 1AP0A 2NWGA 1S4ZA 2KEEA 1BNZA 1RJTA 2N55A 1CA5A 4ZK9B 1ML0D 2DY8A 1X32A 1RTOA 1U4MA 4CJ0B 3I8ZA 5EQ0A 1DZ1A 2JP1A 1O80A 1EQTA 1RTNA 2XIWA 3F2UA 4IUPA 5E4XA 2IL8A 4IUQA 2Q8RE 1WD1A 3SVMA 2K01A 5JJZA 1SAPA 5CBAE 1C8CA 1F9SA 2X6LA 5COYA 1BBXC 1WTXA 2B2WA 1J8IA 1GUWA 2FMMA 1HHVA 5EKIA 2MJ8A 3TZDA 1B50A 2KUMA 3H91A 3UI2A 2K05A 2B2VA 1G2TA 3IL8A 4IUVA 1WTWA 5D65A 1EL0A 1ILPA 2RVLA 1ESRA 4RWSC 2EPBA 1B4OA 1X3PA 2K04A 4IUUA 4QUFA 3KBXA 4X3SA 4CJ1B 4U68A 3MWYW 1XYIA 2J7ZA 1X3QA 2K28A 1B2TA 5EPLA 3TN2A 1Q3LA 1O7YA 2CVRA 2SDFA 1A15A 1JE4A 1JICA 2H1EA 2FHTA 4UAIA 5AFWA 4X3KA 4XDXA 4R8IA 2JYOA 2HCCA 3I3CA 2L11A 1LV9A 1NR4A 2RSNA 1IKLA 3ONAB 1SDFA 2B2YA 4CJ2C 1HA6A 2VXWA 3HP3A 5EJWA 2HUGA 2KVMA 2L4NA 1DONA 1MI2A 2MGSA 1DOKA 1KNAA 3N52A 1BF4A 1PFMA 1HFGA 4O42A 1MSGA 5EPJA 2DY7A 2B2VC 1AZQA 1PLFA 1TVXA 1G91A 1HUNA 2L9HA 2X6GA 3KUPA 2B2UA 3GV3A 1U4LA 5T1GA 1WVLA 3FPUB 1NR2A 4QUCA 2NYZD 3Q6SA 5CMDA 2KECA 5T1IA 1F9PA 1MSHA 1CM9A 4MN3A 1VMPA 2HCIA 1WTRA 5DNFA 1ZXTA 2FFKB 1G6ZA 1F9QA 4ZKBB 2EOTA 2K1BA 1M8AA 1PFBA 2MPMA 1CA6A 4IUTA 5D14A 1J9OA 1ICWA 4DN4M 1F9RA 2BDNA
chains in the Genus database with same CATH superfamily
4DNRB 1STYA 4EQPA 1BDOA 4F8MA 2N3SA 2AQ2B 2A68C 2F0MA 3S2HH 1TIID 3J81i 1QWYA 4R9WA 5C6AA 2F0IA 2AHOB 2BH8A 1SMYC 3MC0B 4ZUIA 2E2HB 5ELOA 1RF2D 2I5MX 3KDFA 4I65A 5CV9A 3U4ZA 3GTKH 4JBJA 4O1NA 1BBWA 1ILQA 4LK1C 4EQ5A 2QKIC 4LW1A 5CGKA 1E0BA 2F4VL 4HJ8A 5E4WC 4B9WA 2NZHA 2SOBA 4DR4L 1QILA 1VQDA 3HKZG 3HKZB 3SXHA 1VQ6A 4LFAQ 1O78A 4DV1L 1S4ZA 4MNOA 1IW7D 3EN2A 5JVH3 5I6WA 1FR3A 3X3NA 1QZGA 4RGTA 4JPBW 4TKOB 4DK6C 1YHBA 2PI2A 2IY5B 1K8AC 5M5XH 2ZXPA 1UE5A 2JA6H 4IUVA 1X3FA 4BA1I 1ZEQX 2AKWB 2XGTA 5FLMH 4WRDA 1XYIA 2PQAA 1UE6A 1K8GA 5A2QE 5IT9E 1Q8KA 1QCBD 2JYOA 2XTIA 4YY3Q 5C3EH 2K50A 4JVZA 2UXBL 2J4XA 3F2BA 3BDOA 3L9AX 3N52A 1PFMA 1XPUA 4DV2L 2DN8A 4O2DA 4DR2Q 1Q46A 1I3QB 5IGFA 1S5ED 3LNNA 3TMEA 4R4IA 4DV6Q 1E3PA 3S1MB 3PUWA 4I7ZC 1I4HA 2XSCA 3C1FA 1I4XA 3NELA 1G6ZA 3A7LA 4ZKBB 5E3FA 3X3MA 3J80c 3MVVA 2XN9C 1O7LA 4AQYL 2K5WA 4A3KH 1VQ8A 5C0XJ 1PTOD 1YNJC 3S14B 2IW3A 1R4QB 4QQBX 2UXDL 4GNXC 2JEBI 1E24A 2KOLA 2F03A 3PIO3 1CFMA 4PMBA 4KMUC 4ZQ3A 1HRJA 4U673 2PPBC 1EUJA 2M2LA 2MHVA 2M00A 2F0GA 4RCOA 1K83H 3NPPA 1SSOA 4ZRZA 1VQGA 2L1BA 4ZUJA 3WDNA 5FLXE 1WTVA 4EX5A 4NB3A 3KFUA 3CCEA 1O7ZA 2VB2X 2MQHA 3L7ZC 4LWCA 2HDLA 1RDPD 4DXGA 1TS4A 4LF9Q 5M5WB 2JA7G 2JA7B 1HFNA 4Y52H 2ZM6L 4Z9CB 4AYBG 4N8FA 4AYBB 4CHTB 2MP1A 1NMFA 3JAMi 4JYAL 3URYA 2QF7A 5D3IB 3UE0A 3EA6A 4GN4B 1X32A 1AH9A 1RTNA 2R61A 1Y1WH 1HXYD 1PZKD 4ILWA 4IUQA 1XMQL 1LTID 4QMGA 3M4OH 2K32A 1CI3M 1QNUA 2G5DA 4C2MH 2B2WA 1WTXA 5IP7H 4UP8A 1S5CD 3KDFB 4GKKL 3G6JB 1TWAH 5J3BA 4A3CG 2B2VA 1X54A 3ER0A 3S14H 3NQIA 3NWTA 1C48A 1A8VA 3DWPA 3BZDB 4JG2A 2PMZE 2J7ZA 2K28A 3S16H 1B2TA 3GTOB 3KJPA 3HGBA 5EBDA 1JE4A 1SE2A 1UEBA 1XNRL 1PV4A 2G9DA 3TSSA 1IBLQ 2ZJPA 1V9PA 3PQIA 2VQFQ 3NBHA 4YWKA 1KNAA 1C0AA 2BA0A 3GQBA 1EY6A 3OYYA 2UUAQ 1GUTA 1HH2P 2GN5A 1TXYA 1EY7A 2K7VA 1U4LA 3VA5A 3FPUB 1KQSA 2A6EC 2IHFA 2HCIA 1Q8IA 1M4VA 3MEFA 1A63A 1QUQB 5FO9B 1KDCA 4LFBL 4DAVA 1EWHA 1YEZA 4QIWE 4DV4Q 2AUKA 3CMEA 1JJCB 1GUNA 4IFDI 4HR7B 3CHBD 4E6IA 3VDYA 1EEID 3ERQA 4HAEA 1RODA 4B3SQ 3C3LA 2MFIA 1JQYD 4GLXA 1W2BA 4LFAL 2H5XA 3P7JA 2A19A 3T1HQ 4BY7G 4BY7B 2BE5D 3CCSA 4DR5Q 2R7DA 2OWOA 3TP5A 2Q2UA 4QCLA 1PH1A 3MA2B 4POFA 3JAMc 1WYDA 1QB5D 3SK6A 4HJ9A 2ZXOA 4LAAA 3CMAA 3CU7A 1PDQA 3A0JA 5ELCA 1B44D 4FVMA 1D7QA 4DK0A 3DM1A 4GLAC 4HCSA 1ZKOA 3VYRA 1YBYA 4NP5A 1B9NA 3K80C 1TWHB 1WTPA 4X66L 1EY5A 2A69D 4HIKA 2E2HH 4WJWA 5GQOA 4V190 5C4XG 5C4XB 4P72A 1EQTA 5IGCA 1PRTB 1FGUA 1KTKA 2UXBQ 2K01A 3L0OA 5CBAE 2I5HA 1GUGA 2VZAA 1YJWA 5NUCA 3K57A 1VQEA 4MTNA 3G6EA 4JBKA 4A3MG 4IUNA 4A3MB 2WAQG 2WAQB 1G2TA 4A3EG 1IYUA 4A3EB 3I7FA 1IBMQ 2A5HA 5D65A 2DGYA 3J7A5 2PZUA 4JI7Q 2XRQD 2E2IB 1VQIA 2IX1A 3T13A 1O7YA 4A3CH 4GS3A 1DJRD 3CCMA 3I3CA 2O5JC 5GAHC 3CCUA 1IKLA 2QW7A 5FKAC 1LO5D 3DWQA 3EFXD 1MI2A 4RG1A 4O42A 2QILA 2IHEA 3S1RB 2C9OA 3I2ZA 1YNJD 2F0KA 1PLFA 3HS0C 1PTOF 4NPSA 3OMGA 4K8JA 2F0NA 3BVMA 4XXEA 2PMZB 3KLWA 4L5QA 1CT1D 3CCLA 1BBUA 4A3GG 2WB1E 4A3GB 3R3OA 3F2CA 2PNHA 2QGQA 4JI5L 1WOCA 1FNUA 1SYFA 2DJFC 4ZAIA 2UUBL 1TY0A 4DU9A 4YWLA 4GOPA 1LYLA 2Z1CA 1PTOB 3CCRA 4JK1C 2HDMA 4IFDH 4A3MH 4YIJA 3HOXG 1MD2D 1SNPA 3HOXB 3G48A 2WB1G 2WB1B 1G2SA 4IZ8A 3T53B 3CW2C 1I50B 2JA9A 2KJXA 1Z6HA 1TS3A 4EQNA 2PO4A 2BH2A 4R1JA 4OEMB 2UXCL 1MIUA 1HTPA 1K28A 1ET9A 3S2DB 3CRKC 1WD0A 1KLUD 3CC7A 1QVFA 2Z6KA 5JEAH 2L12A 2B2YC 5GROA 2C35B 2KEEA 2N49A 3PGZA 5JAVA 4P73A 1PTOC 1VQBA 4V0BA 2R7FA 1RTOA 5M5WH 3S1QB 4KV6A 1XTCD 4DAYA 3QR8A 2AUJD 4DAPA 4FF3A 2F0DA 5EKIA 3RMHA 4KY6A 4C56C 5L37A 5C5MA 1D6EC 1SYEA 1CKNB 1SYCA 2HQLA 3PV0A 3OOCA 4RGNA 5I6YA 1V1PA 1YHQA 4IALA 5IODA 2RDHA 1PHJA 2CVRA 3I73A 1KAAA 1E2VA 4XYQA 2YTVA 1ESFA 4L5TA 2L55A 1X9NA 1E2WA 3S1NB 5LMUL 1Z47A 2K5QA 1FL0A 3NTKA 5EJWA 5BR8L 4JBMA 3D3RA 1LLRD 1IL2A 2OT2A 4DA2A 4R4OA 2WINB 1Y8NB 4MTKA 2IPKD 3PMFA 3UDGA 5EBCA 3VA7A 4JI4Q 4H0LC 4QUCA 2EIFA 1CM9A 3KLSX 1EWCA 1KL9A 4YCWA 2XWJB 1I50H 4DV5Q 4DN4M 4DR3L 1IW7C 5GAEC 5AJ3Q 3T4AC 1FD7D 1YZ6A 1GM5A 4FYDA 3C2PA 4AIMA 5FLXL 5I9OA 4YWMA 3U9OA 2SNSA 4G7ZC 3GTQH 1SYDA 2A73B 1JWUD 1XXGA 2NZOA 1DM0B 4LF6Q 1KXLA 1VQLA 4M8AA 3E6ZX 2B2WC 5I4DA 5H1SE 4RGMA 3VR6A 2A6HC 1BO0A 4APVA 3WOFA 4DK3C 4QL5A 4RFBA 2JA7H 5FOBB 2KENA 4H44C 4OL7A 4RMFA 2CH4A 3OWEB 1DOMA 3R93A 1I94L 3QB3A 4KY5A 4WJ4A 3M4QA 3N6RA 1VQCA 3I70A 1U5KA 2Q2IA 4HJAA 4CJ0B 5C3XA 3V96A 3S15H 1HCZA 1PFSA 2IL8A 1L0WA 3HFZB 1ICFB 3RD4A 1F9SA 3PIOA 1XMOL 1KIXA 3S9WA 1GUWA 2YTXA 4RHSA 3U58A 3DM3A 1I6HB 2JA8H 4RGOS 2ES2A 5IYDG 1EU4A 4DNTB 2RVLA 5J39A 4P71A 4XYOA 4JI4L 4CKCA 5A35A 5M9OA 5LMNW 2SNMA 4KKTA 3NTHA 4H7BA 4A3FG 4A3FB 4B3TQ 4X62Q 2HQEA 4GOPB 4A3JH 1LABA 4L5SA 5C0XH 1L1OC 1HA6A 2RHSB 4KN4C 5DLQE 4DUZL 4QB4A 3GTPH 3FEWX 1HFGA 5CV7A 4DV3L 2B2VC 4FDBA 1SLJA 1G91A 2L0CA 3S1MH 1JC7A 1ZYRD 1N33L 3J80L 5KYLA 2JJQA 5J22A 1NUCA 4CKEA 4MN3A 3K6OA 5ELEA 3M85A 4BXXH 3SDZA 4CDFC 1FYCA 4EGVA 1STAA 5I2YA 1GVPA 1B7YB 5IP9H 5C0XI 3CP0A 2LMCB 3K58A 1E1TA 5HY6A 5C4JB 3C46A 4DR7L 1EZ6A 3M7NA 1DCZA 3MZ5A 5M5XB 4JI2L 3J7YW 4FF1A 2AWOA 3M9BA 1VQAA 1JB7A 4C3HH 4BXXG 5K5PA 3HEJA 4R8NA 2DNCA 3TDQA 1RD9D 1KD1C 3TS0A 3K7AH 1I4RA 3ZJYC 2OEOA 4DNIA 4QF4A 1S5BD 2KCTA 4DR6Q 1JR0D 1Q90A 1F2YA 2K5DA 1N32Q 3SGIA 1WTQA 4LF5Q 4IOCA 1U4MA 3I72A 2R93G 2R93B 1JWMD 3GTOH 5E4XA 4GNXB 2Q8RE 2EYPA 4GKJL 3K7AB 2ZTEA 1BBXC 3CCJA 2PCFB 1W3SA 2YU9H 1GHKA 2Z4IA 2CWAA 2BE5C 3H3VI 1XNRQ 4ME3A 4JI6Q 5JVG3 4A3LG 1L1OA 4F88A 4X66Q 1UUPA 5ELDA 1JOOA 1TS5A 3S1QH 1HR0Q 3DHQA 2NVXB 3NP8A 4DV5L 2KCCA 1T5XD 4OELB 3HP3A 1A3VA 4OXPA 5DM73 1HZCA 4XQJA 5IT9L 4OONA 1BF4A 3QJYA 1WFQA 1VS0A 3H0GH 2LXJA 3A56A 2E74C 2Z9HA 1Q1EA 3ULJA 1O7IA 3KUPA 3A8IE 4IPDA 4HIDA 3HOWH 3HOUG 3HOUB 4JI7L 1QZHA 1HR0W 1D2BA 3H94A 3CQZH 4B3MQ 5LMNL 3DWAA 5DNFA 1K73C 1W6KA 4LUOA 3T56B 4NMZA 4LFCL 4A4IA 2MO1A 5CYUA 4OX9L 3CXCA 4A3EH 1PH2A 4JI0L 4MHEA 4K2LA 4OO1G 1EY9A 2RA4A 3FPPA 4C1NI 4GLVB 2PQAB 3I4LA 1JJ2A 5KGUA 4N9PA 3A74A 2VQEQ 3KF8A 1IBKL 5C4ZA 1D5MC 1OXSC 1STEA 1JE5A 4ULLA 3VR4A 3H09A 2VNUD 1Y8PB 4PNYA 3SK4A 4DUYL 3OWFA 3P75A 5DAUA 3S1RH 2J0TD 1HNXL 3PIPA 3AQQA 2F1MA 4RKBA 1MGSA 3DEOA 3GTLB 1MHWC 2O5IC 5KRUA 1QOHA 2KBNA 3GTLH 1T9HA 1X3GA 4FXKC 3K5LA 1CHPD 1CA5A 3I4NH 4K8IA 4JCVE 1WI5A 1HR0L 1F77A 4JC0A 4ODGA 2JP1A 2XIWA 3F1ZA 4IUPA 4UP7A 4A3IH 2EYJA 1E22A 2I5LX 2F0EA 3RNUA 1C8CA 1N36L 3TP7A 1J8IA 5D3DA 2MJ8A 2F0UA 4C3JG 4C3JB 4JI3L 1HZAA 5F2DA 3S24A 5FJ8G 2LKVA 2F0HA 4FP5D 4NXML 4KHPQ 1MJEA 2EJMA 1OXTA 4UDUC 1XNQL 4EVOA 3IFTA 2XWBB 4UAIA 2K4KA 4XDXA 2V1CC 2JXMB 1JWSD 2EXDA 1TWHH 4IJLA 2JSOA 1PZJD 1SBBB 2ENBA 2PQEA 1B1ZA 1DOKA 1AN8A 2NVYB 2A69C 3J80i 2RDFA 1PYSB 2CQAA 3NQTA 3D31A 1VQ5A 4JI0Q 5JJLA 3ULPA 2A6HD 4FXGC 3NENA 5IGEA 5T1GA 1HNZQ 4JI8Q 1DD2A 3RN5A 3PO3H 4DV0L 3QG1A 1EYAA 1TQOA 1TS2A 1I5FA 3M4YA 2JK8A 2K1BA 3GD7A 1CSPA 1RHPA 2BDOA 1F2LA 5E1FA 1B9MA 3CC2A 2JE6I 5DM63 1EOTA 4C3JH 4GZYC 5JPMC 1N32L 1RL2A 4RA8A 2N8NA 1IKMA 4HJ7A 4HSVA 2RQXA 1BOSA 4QY7A 3MXNB 4HEDA 3TBIB 1VQPA 3FKIH 4DR3Q 1SNQA 4HMJA 4GN3B 1KRTA 2KHIA 2B63G 2PYKA 1I6VC 1QVCA 2B63B 1ONLA 5K36G 1RKNA 1VCIA 2GA4B 2CWPA 2EY6A 1D5XC 1NAPA 4BWGB 4XT1B 1HNWL 4ZKCB 2B2UC 3T1YL 3GTKB 1AP0A 2NVTB 3CKIB 4UY8C 1BNZA 1RJTA 4IPGA 2DY8A 3I8ZA 2RHQB 2OCEA 5IGBA 4IPCA 3I4MH 1SNOA 2LFNA 3RLFA 5IE8A 4Y7NB 1R9TB 3AMUA 4HSPA 1HHVA 4MZ9A 3ND9A 3DUZA 3BYYB 4L6TB 4DFAA 1A3UA 4K14A 3I56A 3SK8A 3OSOA 5IYDH 1STNA 2K52A 4C3IH 5I2XA 1XTDA 3K5OA 4KKUA 3M3YB 4DAMA 4JI8L 4CDDC 4KI0A 3HOXH 2NVQB 1H9RA 4IO9A 5KYIA 5KNCA 4DV4L 5CC4A 3OW7A 5IP9G 3EIVA 3ONAB 5IP7G 3ULLA 3OTOQ 1YJNA 1SYGA 3NXWA 2NTTA 1BCPD 1RIPA 4B3SL 1JJGA 1XMQQ 4PZ6A 4ZCKA 4PMCA 2L9HA 2LS01 3H15A 3U4VA 1WCMH 1WVLA 1IBKQ 1EZ8A 2HD3A 5T1IA 1ET6A 1QJOA 3OMCA 4YY3L 4HMIA 4TVAB 2ATWA 1SN8A 3FDTA 2F0SA 4DV3Q 2OTJA 3U9SA 2E5LL 4FF2A 4DKAC 1RCVD 2KHSA 3RZOH 4F7XA 3DXJC 2R92G 2R92B 2R3ZA 2EY2A 3FRPB 3V05A 3JAME 1B3QA 2IT1A 2K5HA 1EIHA 1N36Q 3PF4A 1IL8A 4M1UB 4KHZA 4BBSG 4BBSB 5IGGA 1R4PB 1M1KC 1CKMA 2F3IA 4DV1Q 1SE4A 5IGDA 1ZYRC 3JAML 3BDCA 3I4MG 3I4MB 1I4PA 1K0RA 4NKLA 1JCKB 4F87A 2KCMA 1EFID 3PUVA 4N8X1 2ICEC 3S1NH 1AE2A 1HA5A 1NJIC 1Y69U 2N55A 3RN2A 2CW0C 2XNAC 1FGBD 3HOZH 4PZ7A 4B3RL 2UUCL 3HOVG 3HOVB 3R8BA 4K5WA 3KF8B 4DV7L 1K8OA 5BR8Q 1I94Q 3TZDA 4JI1Q 5C4JH 5KNDA 1TWAB 3IL8A 5BN3A 1X6OA 2RCFA 4HN7A 5A2QL 3CCVA 2E76C 1ILPA 4KD3A 4ID6A 3EVQA 1PRTF 3J81E 5G3LF 3CAMA 3W3AA 3MWYW 4A3IG 3D0FA 4A3IB 2UU9L 1FNWA 1Q3LA 1P8LA 2SDFA 1S40A 1PZID 1VF7A 4IPHA 1TWCH 1LT6D 1EFWA 1IZ6A 3D6CA 1LTSD 2LXKA 2K5NA 1JB3A 5JJKA 4GKKQ 4A93H 2QA4A 2KVMA 1UEAB 1PH8A 2O2LD 4WFN3 5EPJA 2A74C 2F0JA 3S17B 1AZQA 2A1AA 4KKSA 4YHHL 5GAGC 3PO3G 3PO3B 4OWXB 1CK1A 3GTPB 1OTCA 3GV3A 1HQMC 1PXUA 2UXCQ 4BBSH 1OXUA 2BA1A 5BN5A 5GADC 1CKOA 1ENAA 1VMPA 2WP8J 3S16B 1JORA 4DR1Q 1CA6A 1IYJB 3CF5A 3A55A 2EYMA 4LJZC 4XQQA 2PW5A 5TSSA 3MFGA 1PYWD 1M90C 1Z9FA 4LMQD 4X6AH 4HIMA 2B8FA 1EQRA 1FNVA 3DLLA 1GUSA 4EQOA 1OXXK 3BZKA 5LMUQ 1GO3E 4WORA 4OHJA 4LF9L 3CCQA 4AQYQ 3ICEA 4LF4L 1PH4A 2GVBA 1K3RA 2N88A 1I6HH 3CPFA 3SE0A 3RUZA 2PZTA 4K6LA 3AEVA 3NSWA 1LT4D 5CR3A 3AFPA 2ASBA 5CV8A 2OQ0A 4OX9Q 4LF5L 1NE3A 4JI1L 3RZDH 5C3WA 1A2UA 4X3TA 1B53A 1KLGD 3IRBA 1EU3A 1A3TA 1J5EL 1SNDA 2B63H 2FXQA 2NB0A 3ZYYX 5FLXc 1ASZA 2HHHL 3E0JA 3P1HA 3K81C 3QIAA 3MXUA 4IJHA 2NVQH 4IFDJ 4JOIC 5JJZA 1SAPA 4FO2A 3O13A 4CDEC 3EROA 5LL6X 4BY1H 4P2CB 4A76A 4A3JG 4A3JB 4JYAQ 3H91A 2K05A 1HQRD 3KF6B 1PH9A 1S3OA 3GTQB 3OIQA 4UHVA 1QUQA 4J1MA 3STBC 1CZGA 2UUAL 2OF1A 4C3IG 4C3IB 2R93H 3VR3A 2JA8G 2NN6G 3GP7A 2JA8B 2MNAA 5IT9c 4R8IA 4KJOA 2RBMA 2F0VA 3HOYG 3HOYB 2B2YA 3D4RA 3GDEA 3UDXA 3PCOB 4KTAA 4DGZA 2MO0A 1VQOA 1NSNS 2KHJA 5DEHA 1Q1BA 2FMCA 3DMUA 2UXDQ 2WIIB 4PV1C 3BS1A 1VQ9A 2IWHA 1MSHA 3HG9A 1YNND 2RF4A 2VQFL 2DUDA 1VQNA 1H95A 4LUVA 2E8GA 2ALYB 5D14A 3BVZA 4DR5L 3J80E 1EYDA 3VYSA 3RZOB 1PVOA 1N34L 5C3EG 5C3EB 3FKIG 1SRUA 3FKIB 3I4OA 3WWVA 2K03A 2RDGA 2CKZB 1C4QA 1SJED 1A0IA 1YNXA 2IX0A 1VF5C 3MTSA 5HGTA 4X3UA 1UAPA 4GOPC 1BVSA 3G7LA 2CFMA 3P20A 4QIWB 3K0XA 3A8KE 2F0LA 3UDFA 4IURA 2E2JB 5CV6A 2YU9B 1Q82C 3AB9A 2I0QA 2CHBD 5FO7B 4OIKA 1B3AA 3UE1A 3EQLC 2B39A 4C1NK 4X64Q 1Y1VG 1Y1VB 4PG3A 1HUMA 2E75C 4S3SA 5M3FG 5M3FB 2UU9Q 1EIYB 3AFQA 3PO2G 3PO2B 1D5ZC 1LM0A 2Z0SA 4PQXA 1LT3D 2ID0A 1O80A 3UI2A 4KY7A 1I4GA 1LTLA 4NXMQ 3J7ZC 1SE3A 4DUZQ 2A8VA 5COYA 1XNQQ 2FMMA 1AEXA 1QVGA 2NN6H 2KUMA 2B8GA 2K6AA 4CDCC 1AE3A 1WTWA 1CUKA 2EYHA 1YJ9A 4RWSC 4R4TA 2JA5G 3RR5A 3H3VH 2JA5B 1EYGA 2EPBA 4IUUA 4X3SA 2D0PA 3MFYA 5IY0A 4LF7L 1IHZA 4IFDG 2E2DC 3TP6A 3VYTA 1IBML 2Q8IB 4DXFA 2WACA 1HPCA 2NBFA 1NR4A 1GXDC 3HOUH 3HOWG 3HOWB 2F0QA 3D4DA 4POGA 2HUGA 3M4OB 2MGSA 1GD7A 5ELNA 4JI2Q 4KD4A 3R2IA 1U0LA 4J8QA 1C7YA 3J81c 5EGTA 1PRTD 3CPWA 1STGA 5C0XG 2OTLA 1K3BC 2KECA 3T1HL 2K14A 2ICIA 2F4VQ 3S2DH 1PH3A 1K83B 2CCZA 1VQJA 1PYBA 3ITPA 1XJVA 1SR3A 1STBA 1ICWA 2ZTDA 4CKBA 2EQSA 3KK7A 4FNFA 1LTRD 2AQ1B 3OIPA 3PF5A 5E7NA 2HIXA 2X69A 1MJCA 4HIOA 4JI5Q 4X64L 2EXZA 1YIJA 3E9HA 1MKHA 2EJGC 3S15B 2SEBD 1PMRA 2EY5A 2F3VA 4JW0A 2EYLA 3QOLA 3E0EA 1YVCA 5IIFA 2FJ2A 2CQOA 2ZTCA 3KJOA 4J15A 1BQQT 3KBGA 1D1KA 4X65Q 4K0KL 4XTCS 1SJHD 1WTOA 1A62A 1BCPF 4JI3Q 1XX8A 1TWFB 1YNNC 4LUZA 1SYBA 1WCMG 1WCMB 4CGYB 1HJPA 2JN4A 1EY0A 3SHLA 4LF7Q 1TWCB 3TP8A 2WV6D 1N8RC 1DZ1A 4RCNA 4UPAA 3SK5A 4DR2L 2WKDA 4YCUA 5FK9C 3BZCA 4AYBE 2IJ0A 3JC66 3W2DA 4B08A 3PIP3 1KHIA 2D62A 5C5LA 5KNBA 3IAYA 5I9PA 3SR1A 3MXNA 2PW7A 5CV5A 2VQEL 3J81L 4FF4A 3UDIA 3CRLC 3SEBA 2GVAA 2N78A 2E2IH 3PSIA 4K6DA 3H6MA 1KDBA 1X3PA 5FLMG 3ND8A 2F0WA 4QJFA 4JV5L 4L63B 1E1OA 1X3QA 3K59A 4DPGA 4B3RQ 2R6GA 1Y8OB 2EYFA 2FHTA 2F52A 3KYHC 1SNCA 4RHRA 3LX0A 1UNSA 2L11A 4DK1A 2RSNA 2UUCQ 3TS2A 4AH6A 2VXWA 2WAQE 4K2KA 2F4IA 2EDGA 1DONA 4J6HA 3RLOA 2F3WA 1LTGD 3A8JE 3NTIA 1GUOA 2DY7A 1CQFA 2DJGC 1TT2A 4G57A 1FVIA 1GJXA 3QWNA 2NUCA 5AJ3L 1V8QA 4NXNL 3HOYH 1H9MA 4LF8L 1V1OA 1BUVT 1EOVA 1ZXTA 2AWNA 1AFPA 1F9QA 2R7ZH 5K36H 1J9OA 4P75A 3J7AV 1F9RA 4X65L 4K0KQ 1HNXQ 3K8AA 4YCVA 4NW2A 3W5OA 4YHHQ 1VQKA 4DV2Q 3B6YA 5LL6S 4KK7A 4B9XA 2VW9A 3T1YQ 3BYTB 4KLKA 4XQNA 3LWUA 1YI2A 5FO8B 2JA6G 1BKBA 2JA6B 3HKSA 1S72A 2D9UA 4PMWA 1PH5A 3EJIA 1Y14B 5JEAJ 1LTAD 1QG7A 3HOVH 2EJFC 1FJGL 3M7GA 3RZDB 2I07B 1L0YB 1STHA 3GV6A 5ELBA 5HURA 1JT8A 4GNXA 4ABNA 2LY7A 5JEAG 4DV7Q 1HZBA 1U9RA 3K7UC 2BCOA 2K5VA 2NVXH 1ML0D 1B8AA 2RKSA 3NUCA 1E7ZA 3F2UA 5C44H 4CBVA 4ZYSA 2VS1A 1SXTA 2RCNA 1GOZA 3E5SA 1Z7TA 1LT5D 2X6LA 4BS9A 4DF7A 5IWAL 3GTMH 1G6PA 4H02A 1VQ7A 2G9HD 1L1OB 1SE8A 5LMNQ 4B3TL 1PA6A 1OXVA 2F0OA 3TZUA 2QCPX 1UE7A 4Y7NH 1R9TH 2DNEA 3A7AB 2VL6A 5C44G 5EPLA 5C44B 3R2TA 1CSQA 1H9JA 1JICA 2H1EA 2HCCA 2Z8LA 4H13C 1SFOH 2D0OA 2PNRC 3NBIA 4JBWA 1I3QH 1TKWB 3H3VC 1T5EA 3C1EA 3K5NA 5C4HA 5KIXA 1P16A 1HUNA 2X6GA 2B2UA 3NEMA 4K5VA 3AU7A 2Y0SE 1LACA 1NR2A 2TMPA 5JPNC 1UWVA 2BOSA 3Q6SA 1IXRA 3S17H 4OO1I 1DXMA 3TEHB 3GTJH 4KHVA 1IBLL 4IUTA 4Q0FA 4BY7H 1NTGA 1JOKA 2CH4W 1FJGQ 2BDNA 1SNMA 2JA5H 1N33Q 4HJ5A 1VMCA 1X65A 2KA7A 1H9KA 3MXPA 4UP9A 2M9VA 4O0AA 3Q23A 1GKHA 1VQMA 1XPOA 4R4CA 4DR4Q 2JQOA 4DR1L 3MEHA 2RSOA 3NWSA 1NCVA 1OO9B 5IYCG 3GTJB 5M5YB 5ISRA 2HT1A 1Q12A 1EEFD 1LTTD 2FINB 1X56A 3F8TA 4OIJA 5IYBG 3D8GA 2WFWA 2HHHQ 2NZ1D 3GTGH 1DYQA 2TSSA 2Q8TA 1V1QA 3HKZE 3HOZG 3HOZB 3I90A 1VQHA 3CQZB 2B2TA 2VY3A 2F0TA 4TSSA 2Q2TA 2KEDA 5M3FH 3LWEA 2ZJRA 4HCEA 1SFOB 2E5LQ 1ASYA 3H0GG 3H0GB 5EQ0A 3OHXC 1NY4A 2OQKA 3SVMA 5IYBH 3A54A 2QEJC 3BDLA 2EYOA 3U50C 1WTHA 1TWGB 4FXDA 2D5DA 2A68D 5ELFA 4KN7C 4N9TA 2R92H 4BY1G 4BY1B 1ENCA 1KAWA 3GTMB 2NTSA 4CJ1B 3KBXA 3KLRA 1I4QA 2EVBA 4K5XA 1PH7A 1XPRA 1D1IA 2QEXA 1TWGH 2OXPA 2Z6KC 3BJUA 2L4NA 3G71A 4OWWB 3PUZA 4A3BH 1X55A 4IQZA 4B3ML 3T16A 4HTHA 1CQVA 1TVXA 2YV5A 1B70B 1LUZA 1Q7YC 1IYVA 1N34Q 2H4OA 2B3GA 2XVSA 5CMDA 5KEEA 1NNXA 2ZT9C 4A3DG 4A3DB 4MIUA 1WTRA 1ENFA 1L2FA 4LF4Q 3IKJA 2NVYH 2PZWA 2L15A 3TQYA 4A3FH 1PFBA 2MPMA 4G7HC 3EBEA 1G51A 2PI2E 1GHJA 3IFDA 1U4PA 3ERSX 1G291 2F0PA 5BN4A 1AZPA 1K0SA 3QO2A 5J1ZA 2ZM6Q 2D2CC 3AYHB 4DV0Q 3LGJA 1WJJA 2R7ZG 2R7ZB 1Y1WG 1Y1WB 3E3XA 5C4XH 1KC8C 2L5TA 3PO2H 5CORA 3I91A 3MAQA 3F2DA 1Q86C 3DEPA 1D8LA 3Q0AA 1UE1A 1DGSA 2NVTH 5EPKA 2UUBQ 2NN6I 4R4QA 4A3GH 1L0XB 1JMCA 2ZJQA 4TRDA 4A3BG 4A3BB 4X62L 4RKLA 1QNKA 3V2TA 1EIGA 3A5UA 2NWGA 3KOJA 1KABA 4ZK9B 1II3A 3BVGA 5IOCA 4DR7Q 2B29A 3VR2A 1LTBD 4A3LH 1VDZA 4ME5A 2I46A 3RLNA 1TY2A 1S5FD 4GN5A 1B50A 3I55A 3K0YA 2VUMH 5EAYA 1N9WA 1KDAA 4DAYB 3VYUA 5HGQA 3A5ZB 3T51B 4XIGS 2QDLA 3WOEA 4QUFA 1SMXA 1W6JA 1SROA 4OO1H 1H9SB 2EY1A 3GO5A 3J81j 1CZWA 1A2TA 3KF6A 4G7OC 4LFBQ 3CD6A 5AFWA 1BCPB 2KQ3A 1J5EQ 4KHPL 4JOIA 1LV9A 1SDFA 5CV4A 4A3KG 4A3KB 2AMCB 1KRSA 2Z6BA 4L8JA 3MHBA 4OWTB 4P74A 1TU2B 3FP9A 3NE5B 3TRZA 1XWEA 1NMGA 2CW0D 3NK9A 1X3EA 4LF6L 1EIFA 1PRTC 3FMCA 4BBRG 4BBRB 5M3MH 3FHWA 2K75A 3VR5A 4ALPA 1Y1VH 2NYZD 4BBRH 5M3MG 5M3MB 1G8ZD 1JOQA 2FFKB 1F2ZA 2V4DA 4PZ8A 4A93B 4A93G 3HRZC 1PFNA 1NBWA 2P5ZX 1EWIA 3W1BA 5G3LD 3STBD 4I7AA 1HNZL 1J6QA 1EQQA 2E2JH 4WJ3M 4C3HG 4C3HB 2VUMG 2VUMB 3W1GA 5M5YH 5IYCH 1PTOH 3Q24A 4KJNA 5JJIA 1C9OA 1DOLA 3BU2A 2O4XA 4C2MB 3J7AF 4LNQA 1V43A 3FVQA 4LF8Q 5CBEE 2EE1A 4NXNQ 5FJ8H 4DV6L 4NDXA 1U4RA 3MXGA 1BR9A 2B2TC 2K33A 4L5RC 3D4WA 1CKNA 4Q5VA 3D6WA 1KNEA 1VQFA 1S5DD 4XT3B 1VQ4A 2EZVA 4RAUC 1V1PB 3HZXA 4ZLTF 2Q2HA 4IN3A 1QE6A 5JOBA 1MBYA 3K5MA 3OW2A 4LFCQ 2YTYA 1H9SA 1YITA 2IX3A 2VB3X 3TREA 1TWFH 5EKKA 3NBHB 1WD1A 3GTGB 4A75A 1EYCA 1HNWQ 3M3YH 3E9IA 1PH6A 1YHAA 5LHY1 2ZXRA 2MUYA 1BCPC 3CC4A 3OTOL 2F0FA 1HTLD 1EL0A 1AW7A 3S2HB 1EY8A 1ESRA 3L3OC 4G4KA 3KLSA 3L2PA 2YYZA 2AQ3B 5EKLA 4TQUS 1B4OA 2K04A 2Z4HA 4U68A 1Q81C 3Q22A 1SEBD 2WKCA 3G4SA 3TN2A 1A15A 1K8MA 2A6ED 4IOAA 1A6XA 4X3KA 1EQVA 2LSSA 2JEAI 1F2MA 4QGUA 1CTMA 1XMOQ 4CJ2C 5IWAQ 1TR5A 3BG3A 4BA2I 1SMYD 1EY4A 4GKJQ 3QOJA 1K9MC 1MSGA 4JV5Q 4RH6A 2KCNA 4A3DH 3I4NG 3M4PA 3I4NB 1E2ZA 2QDBA 3PUYA 1HZ9A 3OPOA 1F9PA 3Q8DA 4JI6L 1BXTA 2C5CA 4OGQC 2Y0SB 1CHQD 2Y0SG 2HIVA 4DUYQ 2EOTA 4DR6L 3NHHA 1M8AA 3PUXA 2XRSD
chains in the Genus database with same CATH topology
4DNRB 1STYA 4EQPA 1BDOA 4F8MA 2AQ2B 2A68C 2F0MA 1TIID 1QWYA 4R9WA 5C6AA 2F0IA 1SMYC 3MC0B 4ZUIA 2E2HB 1RF2D 4I65A 5CV9A 4O1NA 1ILQA 4LK1C 2QKIC 5CGKA 1E0BA 5E4WC 4B9WA 2SOBA 1QILA 3HKZB 3SXHA 1O78A 1S4ZA 1IW7D 5JVH3 5I6WA 1FR3A 3X3NA 4RGTA 4TKOB 2ZXPA 4IUVA 4BA1I 1ZEQX 4WRDA 1XYIA 5A2QE 5IT9E 1QCBD 2JYOA 2J4XA 3BDOA 3L9AX 3N52A 1PFMA 2DN8A 1I3QB 5IGFA 1S5ED 3LNNA 3TMEA 3S1MB 3PUWA 4I7ZC 1I4HA 2XSCA 3C1FA 1I4XA 1G6ZA 3A7LA 4ZKBB 5E3FA 3X3MA 3MVVA 2XN9C 1O7LA 2K5WA 5C0XJ 1PTOD 1YNJC 3S14B 2IW3A 1R4QB 2JEBI 2KOLA 2F03A 3PIO3 1CFMA 4PMBA 4KMUC 4ZQ3A 1HRJA 4U673 2PPBC 2M2LA 2MHVA 2M00A 2F0GA 4RCOA 3NPPA 1SSOA 4ZRZA 2L1BA 4ZUJA 3WDNA 5FLXE 1WTVA 1O7ZA 2VB2X 3L7ZC 2HDLA 1RDPD 4DXGA 1TS4A 2JA7B 5M5WB 1HFNA 4Z9CB 4AYBB 4CHTB 2MP1A 3URYA 2QF7A 5D3IB 3EA6A 1X32A 1RTNA 2R61A 1HXYD 1PZKD 4ILWA 4IUQA 1LTID 4QMGA 2K32A 1CI3M 1QNUA 1WTXA 2B2WA 1S5CD 3G6JB 2B2VA 3NQIA 3NWTA 1C48A 3DWPA 3BZDB 2J7ZA 2K28A 1B2TA 3GTOB 3HGBA 5EBDA 1JE4A 1SE2A 2G9DA 3TSSA 3NBHA 1KNAA 2BA0A 3GQBA 1EY6A 1GUTA 1EY7A 2K7VA 1U4LA 3VA5A 3FPUB 2A6EC 2HCIA 1Q8IA 1M4VA 5FO9B 1KDCA 4DAVA 1EWHA 2AUKA 1GUNA 4IFDI 4HR7B 3CHBD 4E6IA 1EEID 3ERQA 4HAEA 1RODA 3C3LA 1JQYD 3P7JA 4BY7B 2BE5D 3TP5A 4QCLA 3MA2B 1QB5D 3SK6A 2ZXOA 4LAAA 3CU7A 1PDQA 5ELCA 1B44D 4FVMA 4DK0A 3DM1A 4HCSA 1ZKOA 3VYRA 4NP5A 1B9NA 1TWHB 1WTPA 1EY5A 2A69D 4WJWA 4V190 5C4XB 1EQTA 5IGCA 1PRTB 1KTKA 2K01A 5CBAE 1GUGA 5NUCA 3K57A 4A3MB 4IUNA 2WAQB 1G2TA 4A3EB 1IYUA 2A5HA 5D65A 2PZUA 2XRQD 2E2IB 2IX1A 3T13A 1O7YA 1DJRD 3I3CA 2O5JC 1IKLA 5FKAC 1LO5D 3DWQA 3EFXD 1MI2A 4O42A 2QILA 3S1RB 2C9OA 1YNJD 2F0KA 1PLFA 3HS0C 1PTOF 3OMGA 4K8JA 2F0NA 3BVMA 4XXEA 2PMZB 1CT1D 4A3GB 3R3OA 1FNUA 1SYFA 4ZAIA 1TY0A 4DU9A 2Z1CA 1PTOB 4JK1C 2HDMA 4IFDH 4YIJA 3HOXB 1MD2D 1SNPA 2WB1B 1G2SA 4IZ8A 3T53B 1I50B 2KJXA 1Z6HA 1TS3A 4EQNA 2PO4A 1HTPA 1ET9A 3S2DB 3CRKC 1WD0A 1KLUD 5JEAH 2L12A 2B2YC 2KEEA 5JAVA 1PTOC 4V0BA 1RTOA 3S1QB 4KV6A 1XTCD 4DAYA 2AUJD 4DAPA 4FF3A 2F0DA 5EKIA 3RMHA 4KY6A 4C56C 5C5MA 1D6EC 1SYEA 1SYCA 3PV0A 3OOCA 4RGNA 5I6YA 1V1PA 4IALA 5IODA 2RDHA 2CVRA 3I73A 1KAAA 1E2VA 4XYQA 1ESFA 2L55A 1E2WA 3S1NB 1Z47A 2K5QA 3NTKA 5EJWA 3D3RA 1LLRD 2OT2A 4DA2A 2WINB 1Y8NB 2IPKD 3PMFA 5EBCA 3VA7A 4H0LC 4QUCA 1CM9A 3KLSX 1EWCA 2XWJB 4DN4M 1IW7C 3T4AC 1FD7D 4FYDA 3C2PA 5FLXL 5I9OA 3U9OA 2SNSA 4G7ZC 1SYDA 2A73B 1JWUD 1XXGA 1DM0B 4M8AA 3E6ZX 2B2WC 5I4DA 4RGMA 3VR6A 2A6HC 1BO0A 3WOFA 4RFBA 5FOBB 4H44C 4OL7A 3OWEB 1DOMA 3R93A 3QB3A 4KY5A 3N6RA 3I70A 4CJ0B 5C3XA 3V96A 1HCZA 2IL8A 3RD4A 1F9SA 3S9WA 1GUWA 4RHSA 1I6HB 4RGOS 1EU4A 4DNTB 2RVLA 5J39A 4XYOA 4CKCA 5A35A 5M9OA 2SNMA 4KKTA 3NTHA 4H7BA 4A3FB 2HQEA 1LABA 5C0XH 1HA6A 4KN4C 4QB4A 3FEWX 1HFGA 5CV7A 2B2VC 1G91A 2L0CA 1JC7A 1ZYRD 3J80L 5KYLA 5J22A 1NUCA 4CKEA 4MN3A 3K6OA 5ELEA 3M85A 3SDZA 1FYCA 4EGVA 1STAA 5I2YA 5C0XI 2LMCB 3K58A 5C4JB 3C46A 1EZ6A 3M7NA 1DCZA 3MZ5A 5M5XB 3J7YW 4FF1A 2AWOA 5K5PA 3HEJA 4R8NA 2DNCA 3TDQA 1RD9D 1I4RA 2OEOA 4QF4A 1S5BD 1JR0D 1Q90A 1F2YA 2K5DA 1WTQA 1U4MA 3I72A 2R93B 1JWMD 5E4XA 2Q8RE 2EYPA 3K7AB 1BBXC 2PCFB 1GHKA 2Z4IA 2BE5C 5JVG3 4F88A 1UUPA 5ELDA 1JOOA 1TS5A 3DHQA 2NVXB 3NP8A 2KCCA 1T5XD 3HP3A 1A3VA 5DM73 4XQJA 5IT9L 1BF4A 3QJYA 3A56A 2E74C 1Q1EA 3KUPA 3A8IE 3HOUB 1D2BA 3H94A 3DWAA 5DNFA 1W6KA 3T56B 4NMZA 5CYUA 4MHEA 4K2LA 4OO1G 1EY9A 2RA4A 3FPPA 4C1NI 3I4LA 5KGUA 4N9PA 3KF8A 5C4ZA 1D5MC 1OXSC 1STEA 4ULLA 3VR4A 3H09A 2VNUD 1Y8PB 4PNYA 3SK4A 3OWFA 3P75A 5DAUA 2J0TD 4RKBA 2F1MA 1MGSA 3DEOA 3GTLB 2O5IC 5KRUA 1QOHA 4FXKC 3K5LA 1CHPD 1CA5A 4K8IA 1F77A 4ODGA 2JP1A 2XIWA 4IUPA 2EYJA 2F0EA 1C8CA 3TP7A 1J8IA 5D3DA 2MJ8A 2F0UA 4C3JG 4C3JB 5F2DA 2LKVA 2F0HA 4FP5D 2EJMA 1OXTA 4UDUC 4EVOA 3IFTA 2XWBB 4UAIA 4XDXA 2JXMB 1JWSD 2JSOA 1PZJD 1SBBB 2ENBA 2PQEA 1B1ZA 1DOKA 1AN8A 2NVYB 2A69C 2RDFA 3D31A 2CQAA 3NQTA 2A6HD 4FXGC 5IGEA 5T1GA 1DD2A 3QG1A 1EYAA 1TQOA 1TS2A 3M4YA 2K1BA 3GD7A 1RHPA 2BDOA 1F2LA 5E1FA 1B9MA 2JE6I 5DM63 1EOTA 4GZYC 5JPMC 4RA8A 1IKMA 4HSVA 2RQXA 1BOSA 3TBIB 4HEDA 1SNQA 4HMJA 2B63B 2PYKA 1I6VC 1ONLA 5K36G 1RKNA 1VCIA 2GA4B 2EY6A 1D5XC 1NAPA 4BWGB 4XT1B 4ZKCB 2B2UC 3GTKB 1AP0A 2NVTB 3CKIB 1BNZA 1RJTA 2DY8A 3I8ZA 5IGBA 1SNOA 2LFNA 3RLFA 4Y7NB 1R9TB 3AMUA 4HSPA 1HHVA 3ND9A 3DUZA 3BYYB 4L6TB 4DFAA 1A3UA 4K14A 3SK8A 3OSOA 1STNA 5I2XA 3K5OA 4KKUA 3M3YB 4KI0A 2NVQB 1H9RA 5KYIA 5KNCA 5CC4A 3OW7A 3ONAB 1SYGA 3NXWA 2NTTA 1BCPD 4PMCA 2L9HA 2LS01 1WVLA 1EZ8A 5T1IA 1ET6A 1QJOA 3OMCA 4HMIA 3FDTA 2F0SA 3U9SA 4FF2A 1RCVD 2KHSA 4F7XA 3DXJC 2R92B 2R3ZA 2EY2A 3FRPB 3V05A 3JAME 2IT1A 1EIHA 1IL8A 4M1UB 4KHZA 4BBSB 5IGGA 1R4PB 1SE4A 5IGDA 1ZYRC 3JAML 3BDCA 3I4MB 1I4PA 4NKLA 1JCKB 4F87A 1EFID 3PUVA 2ICEC 1HA5A 1Y69U 2N55A 2CW0C 2XNAC 1FGBD 3HOVB 3R8BA 4K5WA 1K8OA 3TZDA 5KNDA 1TWAB 3IL8A 5BN3A 4HN7A 5A2QL 2E76C 1ILPA 4KD3A 4ID6A 3EVQA 1PRTF 3J81E 5G3LF 3W3AA 3MWYW 4A3IB 1FNWA 1Q3LA 2SDFA 1PZID 1VF7A 1LT6D 3D6CA 1LTSD 1JB3A 2KVMA 1UEAB 2O2LD 4WFN3 5EPJA 2A74C 2F0JA 3S17B 1AZQA 4KKSA 3PO3B 3GTPB 1CK1A 3GV3A 1HQMC 1PXUA 1OXUA 2BA1A 5BN5A 1ENAA 1VMPA 2WP8J 3S16B 1JORA 1CA6A 3A55A 2EYMA 4LJZC 4XQQA 2PW5A 5TSSA 3MFGA 1PYWD 4LMQD 2B8FA 1FNVA 1GUSA 4EQOA 1OXXK 4WORA 4OHJA 2N88A 3SE0A 3RUZA 2PZTA 4K6LA 3NSWA 1LT4D 5CR3A 5CV8A 5C3WA 1A2UA 4X3TA 1B53A 1KLGD 1EU3A 1A3TA 1SNDA 2NB0A 3ZYYX 3E0JA 3P1HA 3QIAA 3MXUA 4IFDJ 5JJZA 1SAPA 4FO2A 3O13A 3EROA 5LL6X 4P2CB 4A3JB 3H91A 2K05A 1HQRD 3GTQB 3OIQA 4J1MA 1CZGA 2OF1A 4C3IG 4C3IB 3VR3A 2JA8B 2NN6G 3GP7A 3HOYB 4R8IA 4KJOA 2RBMA 2F0VA 2B2YA 3D4RA 4KTAA 4DGZA 1NSNS 5DEHA 1Q1BA 2FMCA 3DMUA 2WIIB 4PV1C 3BS1A 2IWHA 1MSHA 3HG9A 1YNND 5D14A 3BVZA 3J80E 1EYDA 3VYSA 3RZOB 5C3EB 3FKIB 2K03A 2RDGA 1C4QA 1SJED 2IX0A 1VF5C 3MTSA 5HGTA 4X3UA 1UAPA 3G7LA 3P20A 4QIWB 3A8KE 2F0LA 4IURA 2E2JB 5CV6A 2YU9B 3AB9A 2CHBD 5FO7B 4OIKA 1B3AA 3EQLC 2B39A 4C1NK 1Y1VB 1HUMA 2E75C 4S3SA 5M3FB 3PO2B 1D5ZC 4PQXA 1LT3D 2ID0A 1O80A 3UI2A 4KY7A 1I4GA 1SE3A 5COYA 2FMMA 1AEXA 2NN6H 2KUMA 2B8GA 2K6AA 1WTWA 2EYHA 4RWSC 2JA5B 2EPBA 4IUUA 4X3SA 3MFYA 1IHZA 4IFDG 2E2DC 3TP6A 3VYTA 2Q8IB 4DXFA 2WACA 1HPCA 1NR4A 2NBFA 1GXDC 3HOWB 2F0QA 3D4DA 2HUGA 3M4OB 2MGSA 4KD4A 3R2IA 4J8QA 5EGTA 1PRTD 1STGA 5C0XG 2KECA 2ICIA 1K83B 3ITPA 1STBA 1ICWA 4CKBA 3KK7A 4FNFA 1LTRD 2AQ1B 3OIPA 2X69A 2EXZA 2EJGC 3S15B 2SEBD 1PMRA 2EY5A 2F3VA 2EYLA 3QOLA 5IIFA 2FJ2A 1BQQT 3KBGA 1D1KA 4XTCS 1SJHD 1WTOA 1BCPF 1XX8A 1TWFB 1YNNC 1SYBA 1WCMB 4CGYB 1EY0A 3SHLA 1TWCB 3TP8A 2WV6D 1DZ1A 4RCNA 3SK5A 2WKDA 5FK9C 2IJ0A 3W2DA 4B08A 3PIP3 2D62A 5C5LA 5KNBA 3IAYA 5I9PA 3SR1A 3MXNA 2PW7A 5CV5A 3J81L 4FF4A 3CRLC 3SEBA 4K6DA 3H6MA 1KDBA 1X3PA 3ND8A 2F0WA 4L63B 1X3QA 3K59A 2R6GA 1Y8OB 2EYFA 2FHTA 1SNCA 4RHRA 3LX0A 1UNSA 2L11A 4DK1A 2RSNA 2VXWA 4K2KA 2F4IA 2EDGA 1DONA 4J6HA 2F3WA 1LTGD 3A8JE 3NTIA 1GUOA 2DY7A 1CQFA 1TT2A 4G57A 1GJXA 3QWNA 2NUCA 1V8QA 1H9MA 1V1OA 1BUVT 1ZXTA 1AFPA 2AWNA 1F9QA 5K36H 1J9OA 3J7AV 1F9RA 4NW2A 5LL6S 4KK7A 4B9XA 3BYTB 4XQNA 3LWUA 5FO8B 2JA6B 2D9UA 4PMWA 3EJIA 5JEAJ 1LTAD 1QG7A 2EJFC 3M7GA 3RZDB 2I07B 1L0YB 1STHA 3GV6A 5ELBA 5HURA 4ABNA 2LY7A 5JEAG 1U9RA 2BCOA 1ML0D 2RKSA 3NUCA 3F2UA 4CBVA 4ZYSA 1SXTA 1GOZA 3E5SA 1Z7TA 1LT5D 2X6LA 4BS9A 4DF7A 2G9HD 1OXVA 2F0OA 3TZUA 2QCPX 2DNEA 3A7AB 5C44B 5EPLA 3R2TA 1H9JA 1JICA 2H1EA 2HCCA 2Z8LA 4H13C 2PNRC 3NBIA 4JBWA 1TKWB 3H3VC 1T5EA 3C1EA 3K5NA 5C4HA 5KIXA 1HUNA 2X6GA 2B2UA 4K5VA 3AU7A 1LACA 1NR2A 2TMPA 5JPNC 2BOSA 3Q6SA 4OO1I 1DXMA 4KHVA 4IUTA 4Q0FA 1JOKA 2BDNA 1SNMA 1VMCA 2KA7A 1H9KA 3MXPA 2M9VA 3Q23A 3MEHA 2RSOA 3NWSA 1NCVA 1OO9B 5M5YB 3GTJB 5ISRA 1Q12A 1EEFD 1LTTD 2FINB 4OIJA 3D8GA 2NZ1D 1DYQA 2TSSA 2Q8TA 3HOZB 3I90A 3CQZB 2B2TA 2F0TA 4TSSA 2KEDA 3LWEA 4HCEA 1SFOB 3H0GB 5EQ0A 3OHXC 3SVMA 3A54A 2QEJC 3BDLA 2EYOA 1TWGB 4FXDA 2D5DA 2A68D 5ELFA 4KN7C 4N9TA 4BY1B 1ENCA 3GTMB 2NTSA 4CJ1B 3KBXA 3KLRA 1I4QA 2EVBA 4K5XA 1D1IA 2OXPA 2L4NA 3PUZA 4IQZA 3T16A 4HTHA 1CQVA 1TVXA 1IYVA 2H4OA 2XVSA 4A3DB 5CMDA 5KEEA 2ZT9C 4MIUA 1WTRA 1ENFA 3IKJA 2PZWA 1PFBA 2MPMA 4G7HC 1GHJA 3IFDA 1U4PA 1G291 2F0PA 5BN4A 1AZPA 3QO2A 5J1ZA 2D2CC 2R7ZB 1Y1WB 2L5TA 5CORA 3I91A 3MAQA 3DEPA 3Q0AA 5EPKA 2NN6I 1L0XB 4TRDA 4A3BB 4RKLA 1QNKA 3V2TA 1EIGA 2NWGA 1KABA 4ZK9B 1II3A 3BVGA 5IOCA 3VR2A 1LTBD 1VDZA 4ME5A 2I46A 1TY2A 1S5FD 1B50A 3K0YA 1KDAA 3VYUA 3T51B 4XIGS 3WOEA 4QUFA 1W6JA 4OO1H 1H9SB 2EY1A 3GO5A 1CZWA 1A2TA 4G7OC 5AFWA 1BCPB 2KQ3A 1LV9A 1SDFA 5CV4A 4A3KB 4L8JA 3MHBA 1TU2B 3NE5B 1XWEA 2CW0D 3NK9A 3FMCA 1PRTC 4BBRB 3VR5A 2NYZD 5M3MB 1G8ZD 1JOQA 2FFKB 1F2ZA 2V4DA 4A93B 3HRZC 1PFNA 5G3LD 4C3HG 4C3HB 2VUMB 3Q24A 1PTOH 4KJNA 1DOLA 2O4XA 4C2MB 3J7AF 1V43A 3FVQA 5CBEE 2EE1A 4NDXA 1U4RA 3MXGA 1BR9A 2B2TC 2K33A 3D4WA 4Q5VA 3D6WA 1KNEA 2EZVA 1S5DD 4XT3B 4RAUC 1V1PB 3HZXA 4ZLTF 4IN3A 1QE6A 5JOBA 1MBYA 3K5MA 1H9SA 2IX3A 2VB3X 5EKKA 1WD1A 3GTGB 1EYCA 5LHY1 2ZXRA 2MUYA 1BCPC 2F0FA 1HTLD 1EL0A 1AW7A 3S2HB 1EY8A 1ESRA 3L3OC 4G4KA 3KLSA 2YYZA 2AQ3B 5EKLA 4TQUS 1B4OA 2K04A 2Z4HA 4U68A 3Q22A 1SEBD 2WKCA 3TN2A 1A15A 1K8MA 2A6ED 1A6XA 4X3KA 1EQVA 2JEAI 1F2MA 1CTMA 4CJ2C 1TR5A 3BG3A 4BA2I 1SMYD 1EY4A 3QOJA 1MSGA 4RH6A 2KCNA 3I4NB 1E2ZA 2QDBA 3PUYA 3OPOA 1F9PA 1BXTA 2C5CA 4OGQC 1CHQD 2Y0SB 2EOTA 3NHHA 1M8AA 3PUXA 2XRSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZAI A;  1PFN A;  1RHP A;  1F2L A;  1VMC A;  3FDT A;  3IFD A;  1U4P A;  4LMQ D;  4NW2 A;  2K03 A;  2HDM A;  4HAE A;  1ROD A;  4MHE A;  1EOT A;  2X69 A;  1DOL A;  1AZP A;  2KOL A;  3QO2 A;  4RA8 A;  1G2S A;  3MTS A;  3P7J A;  2RA4 A;  4X3U A;  1IKM A;  1HRJ A;  2R3Z A;  2EE1 A;  3G7L A;  2M2L A;  2RSO A;  1NCV A;  5CBE E;  4HSV A;  4R9W A;  1U4R A;  1SSO A;  4IUR A;  2L1B A;  1WTV A;  4HED A;  5COR A;  3I91 A;  1EIH A;  2B2T C;  2N88 A;  3DEP A;  1IL8 A;  2D9U A;  2FJ2 A;  1O7Z A;  2B2W C;  5EPK A;  2FIN B;  3D6W A;  1QG7 A;  4OIK A;  1ILQ A;  1B3A A;  4OIJ A;  1PDQ A;  1BO0 A;  1KNE A;  2NZ1 D;  4XT3 B;  2HDL A;  4RAU C;  2Q8T A;  1E0B A;  3DM1 A;  1WTO A;  1HFN A;  5E4W C;  4ZLT F;  1XX8 A;  4HCS A;  3I90 A;  3GV6 A;  4X3T A;  1B53 A;  1WD0 A;  1MGS A;  1QE6 A;  2B2T A;  1NAP A;  2MP1 A;  1DOM A;  3DEO A;  3R93 A;  1HUM A;  1QNK A;  4XT1 B;  4ZKC B;  2KED A;  2B2U C;  2L12 A;  3LWE A;  1WTP A;  1EIG A;  2B2Y C;  1WTQ A;  1AP0 A;  2NWG A;  1S4Z A;  2KEE A;  1BNZ A;  1RJT A;  2N55 A;  1CA5 A;  4ZK9 B;  1ML0 D;  2DY8 A;  1X32 A;  1RTO A;  1U4M A;  4CJ0 B;  3I8Z A;  5EQ0 A;  1DZ1 A;  2JP1 A;  1O80 A;  1EQT A;  1RTN A;  2XIW A;  3F2U A;  4IUP A;  5E4X A;  2IL8 A;  4IUQ A;  2Q8R E;  1WD1 A;  3SVM A;  2K01 A;  5JJZ A;  1SAP A;  5CBA E;  1C8C A;  1F9S A;  2X6L A;  5COY A;  1BBX C;  1WTX A;  2B2W A;  1J8I A;  1GUW A;  2FMM A;  1HHV A;  5EKI A;  2MJ8 A;  3TZD A;  1B50 A;  2KUM A;  3H91 A;  3UI2 A;  2K05 A;  2B2V A;  1G2T A;  3IL8 A;  4IUV A;  1WTW A;  5D65 A;  1EL0 A;  1ILP A;  2RVL A;  1ESR A;  4RWS C;  2EPB A;  1B4O A;  1X3P A;  2K04 A;  4IUU A;  4QUF A;  3KBX A;  4X3S A;  4CJ1 B;  4U68 A;  3MWY W;  1XYI A;  2J7Z A;  1X3Q A;  2K28 A;  1B2T A;  5EPL A;  3TN2 A;  1Q3L A;  1O7Y A;  2CVR A;  2SDF A;  1A15 A;  1JE4 A;  1JIC A;  2H1E A;  2FHT A;  4UAI A;  5AFW A;  4X3K A;  4XDX A;  4R8I A;  2JYO A;  2HCC A;  3I3C A;  2L11 A;  1LV9 A;  1NR4 A;  2RSN A;  1IKL A;  3ONA B;  1SDF A;  2B2Y A;  4CJ2 C;  1HA6 A;  2VXW A;  3HP3 A;  5EJW A;  2HUG A;  2KVM A;  2L4N A;  1DON A;  1MI2 A;  2MGS A;  1DOK A;  1KNA A;  3N52 A;  1BF4 A;  1PFM A;  1HFG A;  4O42 A;  1MSG A;  5EPJ A;  2DY7 A;  2B2V C;  1AZQ A;  1PLF A;  1TVX A;  1G91 A;  1HUN A;  2L9H A;  2X6G A;  3KUP A;  2B2U A;  3GV3 A;  1U4L A;  5T1G A;  1WVL A;  3FPU B;  1NR2 A;  4QUC A;  2NYZ D;  3Q6S A;  5CMD A;  2KEC A;  5T1I A;  1F9P A;  1MSH A;  1CM9 A;  4MN3 A;  1VMP A;  2HCI A;  1WTR A;  5DNF A;  1ZXT A;  2FFK B;  1G6Z A;  1F9Q A;  4ZKB B;  2EOT A;  2K1B A;  1M8A A;  1PFB A;  2MPM A;  1CA6 A;  4IUT A;  5D14 A;  1J9O A;  1ICW A;  4DN4 M;  1F9R A;  2BDN A; 
#chains in the Genus database with same CATH topology
 4DNR B;  1STY A;  4EQP A;  1BDO A;  4F8M A;  2N3S A;  2AQ2 B;  2A68 C;  2F0M A;  3S2H H;  1TII D;  3J81 i;  1QWY A;  4R9W A;  5C6A A;  2F0I A;  2AHO B;  2BH8 A;  1SMY C;  3MC0 B;  4ZUI A;  2E2H B;  5ELO A;  1RF2 D;  2I5M X;  3KDF A;  4I65 A;  5CV9 A;  3U4Z A;  3GTK H;  4JBJ A;  4O1N A;  1BBW A;  1ILQ A;  4LK1 C;  4EQ5 A;  2QKI C;  4LW1 A;  5CGK A;  1E0B A;  2F4V L;  4HJ8 A;  5E4W C;  4B9W A;  2NZH A;  2SOB A;  4DR4 L;  1QIL A;  1VQD A;  3HKZ G;  3HKZ B;  3SXH A;  1VQ6 A;  4LFA Q;  1O78 A;  4DV1 L;  1S4Z A;  4MNO A;  1IW7 D;  3EN2 A;  5JVH 3;  5I6W A;  1FR3 A;  3X3N A;  1QZG A;  4RGT A;  4JPB W;  4TKO B;  4DK6 C;  1YHB A;  2PI2 A;  2IY5 B;  1K8A C;  5M5X H;  2ZXP A;  1UE5 A;  2JA6 H;  4IUV A;  1X3F A;  4BA1 I;  1ZEQ X;  2AKW B;  2XGT A;  5FLM H;  4WRD A;  1XYI A;  2PQA A;  1UE6 A;  1K8G A;  5A2Q E;  5IT9 E;  1Q8K A;  1QCB D;  2JYO A;  2XTI A;  4YY3 Q;  5C3E H;  2K50 A;  4JVZ A;  2UXB L;  2J4X A;  3F2B A;  3BDO A;  3L9A X;  3N52 A;  1PFM A;  1XPU A;  4DV2 L;  2DN8 A;  4O2D A;  4DR2 Q;  1Q46 A;  1I3Q B;  5IGF A;  1S5E D;  3LNN A;  3TME A;  4R4I A;  4DV6 Q;  1E3P A;  3S1M B;  3PUW A;  4I7Z C;  1I4H A;  2XSC A;  3C1F A;  1I4X A;  3NEL A;  1G6Z A;  3A7L A;  4ZKB B;  5E3F A;  3X3M A;  3J80 c;  3MVV A;  2XN9 C;  1O7L A;  4AQY L;  2K5W A;  4A3K H;  1VQ8 A;  5C0X J;  1PTO D;  1YNJ C;  3S14 B;  2IW3 A;  1R4Q B;  4QQB X;  2UXD L;  4GNX C;  2JEB I;  1E24 A;  2KOL A;  2F03 A;  3PIO 3;  1CFM A;  4PMB A;  4KMU C;  4ZQ3 A;  1HRJ A;  4U67 3;  2PPB C;  1EUJ A;  2M2L A;  2MHV A;  2M00 A;  2F0G A;  4RCO A;  1K83 H;  3NPP A;  1SSO A;  4ZRZ A;  1VQG A;  2L1B A;  4ZUJ A;  3WDN A;  5FLX E;  1WTV A;  4EX5 A;  4NB3 A;  3KFU A;  3CCE A;  1O7Z A;  2VB2 X;  2MQH A;  3L7Z C;  4LWC A;  2HDL A;  1RDP D;  4DXG A;  1TS4 A;  4LF9 Q;  5M5W B;  2JA7 G;  2JA7 B;  1HFN A;  4Y52 H;  2ZM6 L;  4Z9C B;  4AYB G;  4N8F A;  4AYB B;  4CHT B;  2MP1 A;  1NMF A;  3JAM i;  4JYA L;  3URY A;  2QF7 A;  5D3I B;  3UE0 A;  3EA6 A;  4GN4 B;  1X32 A;  1AH9 A;  1RTN A;  2R61 A;  1Y1W H;  1HXY D;  1PZK D;  4ILW A;  4IUQ A;  1XMQ L;  1LTI D;  4QMG A;  3M4O H;  2K32 A;  1CI3 M;  1QNU A;  2G5D A;  4C2M H;  2B2W A;  1WTX A;  5IP7 H;  4UP8 A;  1S5C D;  3KDF B;  4GKK L;  3G6J B;  1TWA H;  5J3B A;  4A3C G;  2B2V A;  1X54 A;  3ER0 A;  3S14 H;  3NQI A;  3NWT A;  1C48 A;  1A8V A;  3DWP A;  3BZD B;  4JG2 A;  2PMZ E;  2J7Z A;  2K28 A;  3S16 H;  1B2T A;  3GTO B;  3KJP A;  3HGB A;  5EBD A;  1JE4 A;  1SE2 A;  1UEB A;  1XNR L;  1PV4 A;  2G9D A;  3TSS A;  1IBL Q;  2ZJP A;  1V9P A;  3PQI A;  2VQF Q;  3NBH A;  4YWK A;  1KNA A;  1C0A A;  2BA0 A;  3GQB A;  1EY6 A;  3OYY A;  2UUA Q;  1GUT A;  1HH2 P;  2GN5 A;  1TXY A;  1EY7 A;  2K7V A;  1U4L A;  3VA5 A;  3FPU B;  1KQS A;  2A6E C;  2IHF A;  2HCI A;  1Q8I A;  1M4V A;  3MEF A;  1A63 A;  1QUQ B;  5FO9 B;  1KDC A;  4LFB L;  4DAV A;  1EWH A;  1YEZ A;  4QIW E;  4DV4 Q;  2AUK A;  3CME A;  1JJC B;  1GUN A;  4IFD I;  4HR7 B;  3CHB D;  4E6I A;  3VDY A;  1EEI D;  3ERQ A;  4HAE A;  1ROD A;  4B3S Q;  3C3L A;  2MFI A;  1JQY D;  4GLX A;  1W2B A;  4LFA L;  2H5X A;  3P7J A;  2A19 A;  3T1H Q;  4BY7 G;  4BY7 B;  2BE5 D;  3CCS A;  4DR5 Q;  2R7D A;  2OWO A;  3TP5 A;  2Q2U A;  4QCL A;  1PH1 A;  3MA2 B;  4POF A;  3JAM c;  1WYD A;  1QB5 D;  3SK6 A;  4HJ9 A;  2ZXO A;  4LAA A;  3CMA A;  3CU7 A;  1PDQ A;  3A0J A;  5ELC A;  1B44 D;  4FVM A;  1D7Q A;  4DK0 A;  3DM1 A;  4GLA C;  4HCS A;  1ZKO A;  3VYR A;  1YBY A;  4NP5 A;  1B9N A;  3K80 C;  1TWH B;  1WTP A;  4X66 L;  1EY5 A;  2A69 D;  4HIK A;  2E2H H;  4WJW A;  5GQO A;  4V19 0;  5C4X G;  5C4X B;  4P72 A;  1EQT A;  5IGC A;  1PRT B;  1FGU A;  1KTK A;  2UXB Q;  2K01 A;  3L0O A;  5CBA E;  2I5H A;  1GUG A;  2VZA A;  1YJW A;  5NUC A;  3K57 A;  1VQE A;  4MTN A;  3G6E A;  4JBK A;  4A3M G;  4IUN A;  4A3M B;  2WAQ G;  2WAQ B;  1G2T A;  4A3E G;  1IYU A;  4A3E B;  3I7F A;  1IBM Q;  2A5H A;  5D65 A;  2DGY A;  3J7A 5;  2PZU A;  4JI7 Q;  2XRQ D;  2E2I B;  1VQI A;  2IX1 A;  3T13 A;  1O7Y A;  4A3C H;  4GS3 A;  1DJR D;  3CCM A;  3I3C A;  2O5J C;  5GAH C;  3CCU A;  1IKL A;  2QW7 A;  5FKA C;  1LO5 D;  3DWQ A;  3EFX D;  1MI2 A;  4RG1 A;  4O42 A;  2QIL A;  2IHE A;  3S1R B;  2C9O A;  3I2Z A;  1YNJ D;  2F0K A;  1PLF A;  3HS0 C;  1PTO F;  4NPS A;  3OMG A;  4K8J A;  2F0N A;  3BVM A;  4XXE A;  2PMZ B;  3KLW A;  4L5Q A;  1CT1 D;  3CCL A;  1BBU A;  4A3G G;  2WB1 E;  4A3G B;  3R3O A;  3F2C A;  2PNH A;  2QGQ A;  4JI5 L;  1WOC A;  1FNU A;  1SYF A;  2DJF C;  4ZAI A;  2UUB L;  1TY0 A;  4DU9 A;  4YWL A;  4GOP A;  1LYL A;  2Z1C A;  1PTO B;  3CCR A;  4JK1 C;  2HDM A;  4IFD H;  4A3M H;  4YIJ A;  3HOX G;  1MD2 D;  1SNP A;  3HOX B;  3G48 A;  2WB1 G;  2WB1 B;  1G2S A;  4IZ8 A;  3T53 B;  3CW2 C;  1I50 B;  2JA9 A;  2KJX A;  1Z6H A;  1TS3 A;  4EQN A;  2PO4 A;  2BH2 A;  4R1J A;  4OEM B;  2UXC L;  1MIU A;  1HTP A;  1K28 A;  1ET9 A;  3S2D B;  3CRK C;  1WD0 A;  1KLU D;  3CC7 A;  1QVF A;  2Z6K A;  5JEA H;  2L12 A;  2B2Y C;  5GRO A;  2C35 B;  2KEE A;  2N49 A;  3PGZ A;  5JAV A;  4P73 A;  1PTO C;  1VQB A;  4V0B A;  2R7F A;  1RTO A;  5M5W H;  3S1Q B;  4KV6 A;  1XTC D;  4DAY A;  3QR8 A;  2AUJ D;  4DAP A;  4FF3 A;  2F0D A;  5EKI A;  3RMH A;  4KY6 A;  4C56 C;  5L37 A;  5C5M A;  1D6E C;  1SYE A;  1CKN B;  1SYC A;  2HQL A;  3PV0 A;  3OOC A;  4RGN A;  5I6Y A;  1V1P A;  1YHQ A;  4IAL A;  5IOD A;  2RDH A;  1PHJ A;  2CVR A;  3I73 A;  1KAA A;  1E2V A;  4XYQ A;  2YTV A;  1ESF A;  4L5T A;  2L55 A;  1X9N A;  1E2W A;  3S1N B;  5LMU L;  1Z47 A;  2K5Q A;  1FL0 A;  3NTK A;  5EJW A;  5BR8 L;  4JBM A;  3D3R A;  1LLR D;  1IL2 A;  2OT2 A;  4DA2 A;  4R4O A;  2WIN B;  1Y8N B;  4MTK A;  2IPK D;  3PMF A;  3UDG A;  5EBC A;  3VA7 A;  4JI4 Q;  4H0L C;  4QUC A;  2EIF A;  1CM9 A;  3KLS X;  1EWC A;  1KL9 A;  4YCW A;  2XWJ B;  1I50 H;  4DV5 Q;  4DN4 M;  4DR3 L;  1IW7 C;  5GAE C;  5AJ3 Q;  3T4A C;  1FD7 D;  1YZ6 A;  1GM5 A;  4FYD A;  3C2P A;  4AIM A;  5FLX L;  5I9O A;  4YWM A;  3U9O A;  2SNS A;  4G7Z C;  3GTQ H;  1SYD A;  2A73 B;  1JWU D;  1XXG A;  2NZO A;  1DM0 B;  4LF6 Q;  1KXL A;  1VQL A;  4M8A A;  3E6Z X;  2B2W C;  5I4D A;  5H1S E;  4RGM A;  3VR6 A;  2A6H C;  1BO0 A;  4APV A;  3WOF A;  4DK3 C;  4QL5 A;  4RFB A;  2JA7 H;  5FOB B;  2KEN A;  4H44 C;  4OL7 A;  4RMF A;  2CH4 A;  3OWE B;  1DOM A;  3R93 A;  1I94 L;  3QB3 A;  4KY5 A;  4WJ4 A;  3M4Q A;  3N6R A;  1VQC A;  3I70 A;  1U5K A;  2Q2I A;  4HJA A;  4CJ0 B;  5C3X A;  3V96 A;  3S15 H;  1HCZ A;  1PFS A;  2IL8 A;  1L0W A;  3HFZ B;  1ICF B;  3RD4 A;  1F9S A;  3PIO A;  1XMO L;  1KIX A;  3S9W A;  1GUW A;  2YTX A;  4RHS A;  3U58 A;  3DM3 A;  1I6H B;  2JA8 H;  4RGO S;  2ES2 A;  5IYD G;  1EU4 A;  4DNT B;  2RVL A;  5J39 A;  4P71 A;  4XYO A;  4JI4 L;  4CKC A;  5A35 A;  5M9O A;  5LMN W;  2SNM A;  4KKT A;  3NTH A;  4H7B A;  4A3F G;  4A3F B;  4B3T Q;  4X62 Q;  2HQE A;  4GOP B;  4A3J H;  1LAB A;  4L5S A;  5C0X H;  1L1O C;  1HA6 A;  2RHS B;  4KN4 C;  5DLQ E;  4DUZ L;  4QB4 A;  3GTP H;  3FEW X;  1HFG A;  5CV7 A;  4DV3 L;  2B2V C;  4FDB A;  1SLJ A;  1G91 A;  2L0C A;  3S1M H;  1JC7 A;  1ZYR D;  1N33 L;  3J80 L;  5KYL A;  2JJQ A;  5J22 A;  1NUC A;  4CKE A;  4MN3 A;  3K6O A;  5ELE A;  3M85 A;  4BXX H;  3SDZ A;  4CDF C;  1FYC A;  4EGV A;  1STA A;  5I2Y A;  1GVP A;  1B7Y B;  5IP9 H;  5C0X I;  3CP0 A;  2LMC B;  3K58 A;  1E1T A;  5HY6 A;  5C4J B;  3C46 A;  4DR7 L;  1EZ6 A;  3M7N A;  1DCZ A;  3MZ5 A;  5M5X B;  4JI2 L;  3J7Y W;  4FF1 A;  2AWO A;  3M9B A;  1VQA A;  1JB7 A;  4C3H H;  4BXX G;  5K5P A;  3HEJ A;  4R8N A;  2DNC A;  3TDQ A;  1RD9 D;  1KD1 C;  3TS0 A;  3K7A H;  1I4R A;  3ZJY C;  2OEO A;  4DNI A;  4QF4 A;  1S5B D;  2KCT A;  4DR6 Q;  1JR0 D;  1Q90 A;  1F2Y A;  2K5D A;  1N32 Q;  3SGI A;  1WTQ A;  4LF5 Q;  4IOC A;  1U4M A;  3I72 A;  2R93 G;  2R93 B;  1JWM D;  3GTO H;  5E4X A;  4GNX B;  2Q8R E;  2EYP A;  4GKJ L;  3K7A B;  2ZTE A;  1BBX C;  3CCJ A;  2PCF B;  1W3S A;  2YU9 H;  1GHK A;  2Z4I A;  2CWA A;  2BE5 C;  3H3V I;  1XNR Q;  4ME3 A;  4JI6 Q;  5JVG 3;  4A3L G;  1L1O A;  4F88 A;  4X66 Q;  1UUP A;  5ELD A;  1JOO A;  1TS5 A;  3S1Q H;  1HR0 Q;  3DHQ A;  2NVX B;  3NP8 A;  4DV5 L;  2KCC A;  1T5X D;  4OEL B;  3HP3 A;  1A3V A;  4OXP A;  5DM7 3;  1HZC A;  4XQJ A;  5IT9 L;  4OON A;  1BF4 A;  3QJY A;  1WFQ A;  1VS0 A;  3H0G H;  2LXJ A;  3A56 A;  2E74 C;  2Z9H A;  1Q1E A;  3ULJ A;  1O7I A;  3KUP A;  3A8I E;  4IPD A;  4HID A;  3HOW H;  3HOU G;  3HOU B;  4JI7 L;  1QZH A;  1HR0 W;  1D2B A;  3H94 A;  3CQZ H;  4B3M Q;  5LMN L;  3DWA A;  5DNF A;  1K73 C;  1W6K A;  4LUO A;  3T56 B;  4NMZ A;  4LFC L;  4A4I A;  2MO1 A;  5CYU A;  4OX9 L;  3CXC A;  4A3E H;  1PH2 A;  4JI0 L;  4MHE A;  4K2L A;  4OO1 G;  1EY9 A;  2RA4 A;  3FPP A;  4C1N I;  4GLV B;  2PQA B;  3I4L A;  1JJ2 A;  5KGU A;  4N9P A;  3A74 A;  2VQE Q;  3KF8 A;  1IBK L;  5C4Z A;  1D5M C;  1OXS C;  1STE A;  1JE5 A;  4ULL A;  3VR4 A;  3H09 A;  2VNU D;  1Y8P B;  4PNY A;  3SK4 A;  4DUY L;  3OWF A;  3P75 A;  5DAU A;  3S1R H;  2J0T D;  1HNX L;  3PIP A;  3AQQ A;  2F1M A;  4RKB A;  1MGS A;  3DEO A;  3GTL B;  1MHW C;  2O5I C;  5KRU A;  1QOH A;  2KBN A;  3GTL H;  1T9H A;  1X3G A;  4FXK C;  3K5L A;  1CHP D;  1CA5 A;  3I4N H;  4K8I A;  4JCV E;  1WI5 A;  1HR0 L;  1F77 A;  4JC0 A;  4ODG A;  2JP1 A;  2XIW A;  3F1Z A;  4IUP A;  4UP7 A;  4A3I H;  2EYJ A;  1E22 A;  2I5L X;  2F0E A;  3RNU A;  1C8C A;  1N36 L;  3TP7 A;  1J8I A;  5D3D A;  2MJ8 A;  2F0U A;  4C3J G;  4C3J B;  4JI3 L;  1HZA A;  5F2D A;  3S24 A;  5FJ8 G;  2LKV A;  2F0H A;  4FP5 D;  4NXM L;  4KHP Q;  1MJE A;  2EJM A;  1OXT A;  4UDU C;  1XNQ L;  4EVO A;  3IFT A;  2XWB B;  4UAI A;  2K4K A;  4XDX A;  2V1C C;  2JXM B;  1JWS D;  2EXD A;  1TWH H;  4IJL A;  2JSO A;  1PZJ D;  1SBB B;  2ENB A;  2PQE A;  1B1Z A;  1DOK A;  1AN8 A;  2NVY B;  2A69 C;  3J80 i;  2RDF A;  1PYS B;  2CQA A;  3NQT A;  3D31 A;  1VQ5 A;  4JI0 Q;  5JJL A;  3ULP A;  2A6H D;  4FXG C;  3NEN A;  5IGE A;  5T1G A;  1HNZ Q;  4JI8 Q;  1DD2 A;  3RN5 A;  3PO3 H;  4DV0 L;  3QG1 A;  1EYA A;  1TQO A;  1TS2 A;  1I5F A;  3M4Y A;  2JK8 A;  2K1B A;  3GD7 A;  1CSP A;  1RHP A;  2BDO A;  1F2L A;  5E1F A;  1B9M A;  3CC2 A;  2JE6 I;  5DM6 3;  1EOT A;  4C3J H;  4GZY C;  5JPM C;  1N32 L;  1RL2 A;  4RA8 A;  2N8N A;  1IKM A;  4HJ7 A;  4HSV A;  2RQX A;  1BOS A;  4QY7 A;  3MXN B;  4HED A;  3TBI B;  1VQP A;  3FKI H;  4DR3 Q;  1SNQ A;  4HMJ A;  4GN3 B;  1KRT A;  2KHI A;  2B63 G;  2PYK A;  1I6V C;  1QVC A;  2B63 B;  1ONL A;  5K36 G;  1RKN A;  1VCI A;  2GA4 B;  2CWP A;  2EY6 A;  1D5X C;  1NAP A;  4BWG B;  4XT1 B;  1HNW L;  4ZKC B;  2B2U C;  3T1Y L;  3GTK B;  1AP0 A;  2NVT B;  3CKI B;  4UY8 C;  1BNZ A;  1RJT A;  4IPG A;  2DY8 A;  3I8Z A;  2RHQ B;  2OCE A;  5IGB A;  4IPC A;  3I4M H;  1SNO A;  2LFN A;  3RLF A;  5IE8 A;  4Y7N B;  1R9T B;  3AMU A;  4HSP A;  1HHV A;  4MZ9 A;  3ND9 A;  3DUZ A;  3BYY B;  4L6T B;  4DFA A;  1A3U A;  4K14 A;  3I56 A;  3SK8 A;  3OSO A;  5IYD H;  1STN A;  2K52 A;  4C3I H;  5I2X A;  1XTD A;  3K5O A;  4KKU A;  3M3Y B;  4DAM A;  4JI8 L;  4CDD C;  4KI0 A;  3HOX H;  2NVQ B;  1H9R A;  4IO9 A;  5KYI A;  5KNC A;  4DV4 L;  5CC4 A;  3OW7 A;  5IP9 G;  3EIV A;  3ONA B;  5IP7 G;  3ULL A;  3OTO Q;  1YJN A;  1SYG A;  3NXW A;  2NTT A;  1BCP D;  1RIP A;  4B3S L;  1JJG A;  1XMQ Q;  4PZ6 A;  4ZCK A;  4PMC A;  2L9H A;  2LS0 1;  3H15 A;  3U4V A;  1WCM H;  1WVL A;  1IBK Q;  1EZ8 A;  2HD3 A;  5T1I A;  1ET6 A;  1QJO A;  3OMC A;  4YY3 L;  4HMI A;  4TVA B;  2ATW A;  1SN8 A;  3FDT A;  2F0S A;  4DV3 Q;  2OTJ A;  3U9S A;  2E5L L;  4FF2 A;  4DKA C;  1RCV D;  2KHS A;  3RZO H;  4F7X A;  3DXJ C;  2R92 G;  2R92 B;  2R3Z A;  2EY2 A;  3FRP B;  3V05 A;  3JAM E;  1B3Q A;  2IT1 A;  2K5H A;  1EIH A;  1N36 Q;  3PF4 A;  1IL8 A;  4M1U B;  4KHZ A;  4BBS G;  4BBS B;  5IGG A;  1R4P B;  1M1K C;  1CKM A;  2F3I A;  4DV1 Q;  1SE4 A;  5IGD A;  1ZYR C;  3JAM L;  3BDC A;  3I4M G;  3I4M B;  1I4P A;  1K0R A;  4NKL A;  1JCK B;  4F87 A;  2KCM A;  1EFI D;  3PUV A;  4N8X 1;  2ICE C;  3S1N H;  1AE2 A;  1HA5 A;  1NJI C;  1Y69 U;  2N55 A;  3RN2 A;  2CW0 C;  2XNA C;  1FGB D;  3HOZ H;  4PZ7 A;  4B3R L;  2UUC L;  3HOV G;  3HOV B;  3R8B A;  4K5W A;  3KF8 B;  4DV7 L;  1K8O A;  5BR8 Q;  1I94 Q;  3TZD A;  4JI1 Q;  5C4J H;  5KND A;  1TWA B;  3IL8 A;  5BN3 A;  1X6O A;  2RCF A;  4HN7 A;  5A2Q L;  3CCV A;  2E76 C;  1ILP A;  4KD3 A;  4ID6 A;  3EVQ A;  1PRT F;  3J81 E;  5G3L F;  3CAM A;  3W3A A;  3MWY W;  4A3I G;  3D0F A;  4A3I B;  2UU9 L;  1FNW A;  1Q3L A;  1P8L A;  2SDF A;  1S40 A;  1PZI D;  1VF7 A;  4IPH A;  1TWC H;  1LT6 D;  1EFW A;  1IZ6 A;  3D6C A;  1LTS D;  2LXK A;  2K5N A;  1JB3 A;  5JJK A;  4GKK Q;  4A93 H;  2QA4 A;  2KVM A;  1UEA B;  1PH8 A;  2O2L D;  4WFN 3;  5EPJ A;  2A74 C;  2F0J A;  3S17 B;  1AZQ A;  2A1A A;  4KKS A;  4YHH L;  5GAG C;  3PO3 G;  3PO3 B;  4OWX B;  1CK1 A;  3GTP B;  1OTC A;  3GV3 A;  1HQM C;  1PXU A;  2UXC Q;  4BBS H;  1OXU A;  2BA1 A;  5BN5 A;  5GAD C;  1CKO A;  1ENA A;  1VMP A;  2WP8 J;  3S16 B;  1JOR A;  4DR1 Q;  1CA6 A;  1IYJ B;  3CF5 A;  3A55 A;  2EYM A;  4LJZ C;  4XQQ A;  2PW5 A;  5TSS A;  3MFG A;  1PYW D;  1M90 C;  1Z9F A;  4LMQ D;  4X6A H;  4HIM A;  2B8F A;  1EQR A;  1FNV A;  3DLL A;  1GUS A;  4EQO A;  1OXX K;  3BZK A;  5LMU Q;  1GO3 E;  4WOR A;  4OHJ A;  4LF9 L;  3CCQ A;  4AQY Q;  3ICE A;  4LF4 L;  1PH4 A;  2GVB A;  1K3R A;  2N88 A;  1I6H H;  3CPF A;  3SE0 A;  3RUZ A;  2PZT A;  4K6L A;  3AEV A;  3NSW A;  1LT4 D;  5CR3 A;  3AFP A;  2ASB A;  5CV8 A;  2OQ0 A;  4OX9 Q;  4LF5 L;  1NE3 A;  4JI1 L;  3RZD H;  5C3W A;  1A2U A;  4X3T A;  1B53 A;  1KLG D;  3IRB A;  1EU3 A;  1A3T A;  1J5E L;  1SND A;  2B63 H;  2FXQ A;  2NB0 A;  3ZYY X;  5FLX c;  1ASZ A;  2HHH L;  3E0J A;  3P1H A;  3K81 C;  3QIA A;  3MXU A;  4IJH A;  2NVQ H;  4IFD J;  4JOI C;  5JJZ A;  1SAP A;  4FO2 A;  3O13 A;  4CDE C;  3ERO A;  5LL6 X;  4BY1 H;  4P2C B;  4A76 A;  4A3J G;  4A3J B;  4JYA Q;  3H91 A;  2K05 A;  1HQR D;  3KF6 B;  1PH9 A;  1S3O A;  3GTQ B;  3OIQ A;  4UHV A;  1QUQ A;  4J1M A;  3STB C;  1CZG A;  2UUA L;  2OF1 A;  4C3I G;  4C3I B;  2R93 H;  3VR3 A;  2JA8 G;  2NN6 G;  3GP7 A;  2JA8 B;  2MNA A;  5IT9 c;  4R8I A;  4KJO A;  2RBM A;  2F0V A;  3HOY G;  3HOY B;  2B2Y A;  3D4R A;  3GDE A;  3UDX A;  3PCO B;  4KTA A;  4DGZ A;  2MO0 A;  1VQO A;  1NSN S;  2KHJ A;  5DEH A;  1Q1B A;  2FMC A;  3DMU A;  2UXD Q;  2WII B;  4PV1 C;  3BS1 A;  1VQ9 A;  2IWH A;  1MSH A;  3HG9 A;  1YNN D;  2RF4 A;  2VQF L;  2DUD A;  1VQN A;  1H95 A;  4LUV A;  2E8G A;  2ALY B;  5D14 A;  3BVZ A;  4DR5 L;  3J80 E;  1EYD A;  3VYS A;  3RZO B;  1PVO A;  1N34 L;  5C3E G;  5C3E B;  3FKI G;  1SRU A;  3FKI B;  3I4O A;  3WWV A;  2K03 A;  2RDG A;  2CKZ B;  1C4Q A;  1SJE D;  1A0I A;  1YNX A;  2IX0 A;  1VF5 C;  3MTS A;  5HGT A;  4X3U A;  1UAP A;  4GOP C;  1BVS A;  3G7L A;  2CFM A;  3P20 A;  4QIW B;  3K0X A;  3A8K E;  2F0L A;  3UDF A;  4IUR A;  2E2J B;  5CV6 A;  2YU9 B;  1Q82 C;  3AB9 A;  2I0Q A;  2CHB D;  5FO7 B;  4OIK A;  1B3A A;  3UE1 A;  3EQL C;  2B39 A;  4C1N K;  4X64 Q;  1Y1V G;  1Y1V B;  4PG3 A;  1HUM A;  2E75 C;  4S3S A;  5M3F G;  5M3F B;  2UU9 Q;  1EIY B;  3AFQ A;  3PO2 G;  3PO2 B;  1D5Z C;  1LM0 A;  2Z0S A;  4PQX A;  1LT3 D;  2ID0 A;  1O80 A;  3UI2 A;  4KY7 A;  1I4G A;  1LTL A;  4NXM Q;  3J7Z C;  1SE3 A;  4DUZ Q;  2A8V A;  5COY A;  1XNQ Q;  2FMM A;  1AEX A;  1QVG A;  2NN6 H;  2KUM A;  2B8G A;  2K6A A;  4CDC C;  1AE3 A;  1WTW A;  1CUK A;  2EYH A;  1YJ9 A;  4RWS C;  4R4T A;  2JA5 G;  3RR5 A;  3H3V H;  2JA5 B;  1EYG A;  2EPB A;  4IUU A;  4X3S A;  2D0P A;  3MFY A;  5IY0 A;  4LF7 L;  1IHZ A;  4IFD G;  2E2D C;  3TP6 A;  3VYT A;  1IBM L;  2Q8I B;  4DXF A;  2WAC A;  1HPC A;  2NBF A;  1NR4 A;  1GXD C;  3HOU H;  3HOW G;  3HOW B;  2F0Q A;  3D4D A;  4POG A;  2HUG A;  3M4O B;  2MGS A;  1GD7 A;  5ELN A;  4JI2 Q;  4KD4 A;  3R2I A;  1U0L A;  4J8Q A;  1C7Y A;  3J81 c;  5EGT A;  1PRT D;  3CPW A;  1STG A;  5C0X G;  2OTL A;  1K3B C;  2KEC A;  3T1H L;  2K14 A;  2ICI A;  2F4V Q;  3S2D H;  1PH3 A;  1K83 B;  2CCZ A;  1VQJ A;  1PYB A;  3ITP A;  1XJV A;  1SR3 A;  1STB A;  1ICW A;  2ZTD A;  4CKB A;  2EQS A;  3KK7 A;  4FNF A;  1LTR D;  2AQ1 B;  3OIP A;  3PF5 A;  5E7N A;  2HIX A;  2X69 A;  1MJC A;  4HIO A;  4JI5 Q;  4X64 L;  2EXZ A;  1YIJ A;  3E9H A;  1MKH A;  2EJG C;  3S15 B;  2SEB D;  1PMR A;  2EY5 A;  2F3V A;  4JW0 A;  2EYL A;  3QOL A;  3E0E A;  1YVC A;  5IIF A;  2FJ2 A;  2CQO A;  2ZTC A;  3KJO A;  4J15 A;  1BQQ T;  3KBG A;  1D1K A;  4X65 Q;  4K0K L;  4XTC S;  1SJH D;  1WTO A;  1A62 A;  1BCP F;  4JI3 Q;  1XX8 A;  1TWF B;  1YNN C;  4LUZ A;  1SYB A;  1WCM G;  1WCM B;  4CGY B;  1HJP A;  2JN4 A;  1EY0 A;  3SHL A;  4LF7 Q;  1TWC B;  3TP8 A;  2WV6 D;  1N8R C;  1DZ1 A;  4RCN A;  4UPA A;  3SK5 A;  4DR2 L;  2WKD A;  4YCU A;  5FK9 C;  3BZC A;  4AYB E;  2IJ0 A;  3JC6 6;  3W2D A;  4B08 A;  3PIP 3;  1KHI A;  2D62 A;  5C5L A;  5KNB A;  3IAY A;  5I9P A;  3SR1 A;  3MXN A;  2PW7 A;  5CV5 A;  2VQE L;  3J81 L;  4FF4 A;  3UDI A;  3CRL C;  3SEB A;  2GVA A;  2N78 A;  2E2I H;  3PSI A;  4K6D A;  3H6M A;  1KDB A;  1X3P A;  5FLM G;  3ND8 A;  2F0W A;  4QJF A;  4JV5 L;  4L63 B;  1E1O A;  1X3Q A;  3K59 A;  4DPG A;  4B3R Q;  2R6G A;  1Y8O B;  2EYF A;  2FHT A;  2F52 A;  3KYH C;  1SNC A;  4RHR A;  3LX0 A;  1UNS A;  2L11 A;  4DK1 A;  2RSN A;  2UUC Q;  3TS2 A;  4AH6 A;  2VXW A;  2WAQ E;  4K2K A;  2F4I A;  2EDG A;  1DON A;  4J6H A;  3RLO A;  2F3W A;  1LTG D;  3A8J E;  3NTI A;  1GUO A;  2DY7 A;  1CQF A;  2DJG C;  1TT2 A;  4G57 A;  1FVI A;  1GJX A;  3QWN A;  2NUC A;  5AJ3 L;  1V8Q A;  4NXN L;  3HOY H;  1H9M A;  4LF8 L;  1V1O A;  1BUV T;  1EOV A;  1ZXT A;  2AWN A;  1AFP A;  1F9Q A;  2R7Z H;  5K36 H;  1J9O A;  4P75 A;  3J7A V;  1F9R A;  4X65 L;  4K0K Q;  1HNX Q;  3K8A A;  4YCV A;  4NW2 A;  3W5O A;  4YHH Q;  1VQK A;  4DV2 Q;  3B6Y A;  5LL6 S;  4KK7 A;  4B9X A;  2VW9 A;  3T1Y Q;  3BYT B;  4KLK A;  4XQN A;  3LWU A;  1YI2 A;  5FO8 B;  2JA6 G;  1BKB A;  2JA6 B;  3HKS A;  1S72 A;  2D9U A;  4PMW A;  1PH5 A;  3EJI A;  1Y14 B;  5JEA J;  1LTA D;  1QG7 A;  3HOV H;  2EJF C;  1FJG L;  3M7G A;  3RZD B;  2I07 B;  1L0Y B;  1STH A;  3GV6 A;  5ELB A;  5HUR A;  1JT8 A;  4GNX A;  4ABN A;  2LY7 A;  5JEA G;  4DV7 Q;  1HZB A;  1U9R A;  3K7U C;  2BCO A;  2K5V A;  2NVX H;  1ML0 D;  1B8A A;  2RKS A;  3NUC A;  1E7Z A;  3F2U A;  5C44 H;  4CBV A;  4ZYS A;  2VS1 A;  1SXT A;  2RCN A;  1GOZ A;  3E5S A;  1Z7T A;  1LT5 D;  2X6L A;  4BS9 A;  4DF7 A;  5IWA L;  3GTM H;  1G6P A;  4H02 A;  1VQ7 A;  2G9H D;  1L1O B;  1SE8 A;  5LMN Q;  4B3T L;  1PA6 A;  1OXV A;  2F0O A;  3TZU A;  2QCP X;  1UE7 A;  4Y7N H;  1R9T H;  2DNE A;  3A7A B;  2VL6 A;  5C44 G;  5EPL A;  5C44 B;  3R2T A;  1CSQ A;  1H9J A;  1JIC A;  2H1E A;  2HCC A;  2Z8L A;  4H13 C;  1SFO H;  2D0O A;  2PNR C;  3NBI A;  4JBW A;  1I3Q H;  1TKW B;  3H3V C;  1T5E A;  3C1E A;  3K5N A;  5C4H A;  5KIX A;  1P16 A;  1HUN A;  2X6G A;  2B2U A;  3NEM A;  4K5V A;  3AU7 A;  2Y0S E;  1LAC A;  1NR2 A;  2TMP A;  5JPN C;  1UWV A;  2BOS A;  3Q6S A;  1IXR A;  3S17 H;  4OO1 I;  1DXM A;  3TEH B;  3GTJ H;  4KHV A;  1IBL L;  4IUT A;  4Q0F A;  4BY7 H;  1NTG A;  1JOK A;  2CH4 W;  1FJG Q;  2BDN A;  1SNM A;  2JA5 H;  1N33 Q;  4HJ5 A;  1VMC A;  1X65 A;  2KA7 A;  1H9K A;  3MXP A;  4UP9 A;  2M9V A;  4O0A A;  3Q23 A;  1GKH A;  1VQM A;  1XPO A;  4R4C A;  4DR4 Q;  2JQO A;  4DR1 L;  3MEH A;  2RSO A;  3NWS A;  1NCV A;  1OO9 B;  5IYC G;  3GTJ B;  5M5Y B;  5ISR A;  2HT1 A;  1Q12 A;  1EEF D;  1LTT D;  2FIN B;  1X56 A;  3F8T A;  4OIJ A;  5IYB G;  3D8G A;  2WFW A;  2HHH Q;  2NZ1 D;  3GTG H;  1DYQ A;  2TSS A;  2Q8T A;  1V1Q A;  3HKZ E;  3HOZ G;  3HOZ B;  3I90 A;  1VQH A;  3CQZ B;  2B2T A;  2VY3 A;  2F0T A;  4TSS A;  2Q2T A;  2KED A;  5M3F H;  3LWE A;  2ZJR A;  4HCE A;  1SFO B;  2E5L Q;  1ASY A;  3H0G G;  3H0G B;  5EQ0 A;  3OHX C;  1NY4 A;  2OQK A;  3SVM A;  5IYB H;  3A54 A;  2QEJ C;  3BDL A;  2EYO A;  3U50 C;  1WTH A;  1TWG B;  4FXD A;  2D5D A;  2A68 D;  5ELF A;  4KN7 C;  4N9T A;  2R92 H;  4BY1 G;  4BY1 B;  1ENC A;  1KAW A;  3GTM B;  2NTS A;  4CJ1 B;  3KBX A;  3KLR A;  1I4Q A;  2EVB A;  4K5X A;  1PH7 A;  1XPR A;  1D1I A;  2QEX A;  1TWG H;  2OXP A;  2Z6K C;  3BJU A;  2L4N A;  3G71 A;  4OWW B;  3PUZ A;  4A3B H;  1X55 A;  4IQZ A;  4B3M L;  3T16 A;  4HTH A;  1CQV A;  1TVX A;  2YV5 A;  1B70 B;  1LUZ A;  1Q7Y C;  1IYV A;  1N34 Q;  2H4O A;  2B3G A;  2XVS A;  5CMD A;  5KEE A;  1NNX A;  2ZT9 C;  4A3D G;  4A3D B;  4MIU A;  1WTR A;  1ENF A;  1L2F A;  4LF4 Q;  3IKJ A;  2NVY H;  2PZW A;  2L15 A;  3TQY A;  4A3F H;  1PFB A;  2MPM A;  4G7H C;  3EBE A;  1G51 A;  2PI2 E;  1GHJ A;  3IFD A;  1U4P A;  3ERS X;  1G29 1;  2F0P A;  5BN4 A;  1AZP A;  1K0S A;  3QO2 A;  5J1Z A;  2ZM6 Q;  2D2C C;  3AYH B;  4DV0 Q;  3LGJ A;  1WJJ A;  2R7Z G;  2R7Z B;  1Y1W G;  1Y1W B;  3E3X A;  5C4X H;  1KC8 C;  2L5T A;  3PO2 H;  5COR A;  3I91 A;  3MAQ A;  3F2D A;  1Q86 C;  3DEP A;  1D8L A;  3Q0A A;  1UE1 A;  1DGS A;  2NVT H;  5EPK A;  2UUB Q;  2NN6 I;  4R4Q A;  4A3G H;  1L0X B;  1JMC A;  2ZJQ A;  4TRD A;  4A3B G;  4A3B B;  4X62 L;  4RKL A;  1QNK A;  3V2T A;  1EIG A;  3A5U A;  2NWG A;  3KOJ A;  1KAB A;  4ZK9 B;  1II3 A;  3BVG A;  5IOC A;  4DR7 Q;  2B29 A;  3VR2 A;  1LTB D;  4A3L H;  1VDZ A;  4ME5 A;  2I46 A;  3RLN A;  1TY2 A;  1S5F D;  4GN5 A;  1B50 A;  3I55 A;  3K0Y A;  2VUM H;  5EAY A;  1N9W A;  1KDA A;  4DAY B;  3VYU A;  5HGQ A;  3A5Z B;  3T51 B;  4XIG S;  2QDL A;  3WOE A;  4QUF A;  1SMX A;  1W6J A;  1SRO A;  4OO1 H;  1H9S B;  2EY1 A;  3GO5 A;  3J81 j;  1CZW A;  1A2T A;  3KF6 A;  4G7O C;  4LFB Q;  3CD6 A;  5AFW A;  1BCP B;  2KQ3 A;  1J5E Q;  4KHP L;  4JOI A;  1LV9 A;  1SDF A;  5CV4 A;  4A3K G;  4A3K B;  2AMC B;  1KRS A;  2Z6B A;  4L8J A;  3MHB A;  4OWT B;  4P74 A;  1TU2 B;  3FP9 A;  3NE5 B;  3TRZ A;  1XWE A;  1NMG A;  2CW0 D;  3NK9 A;  1X3E A;  4LF6 L;  1EIF A;  1PRT C;  3FMC A;  4BBR G;  4BBR B;  5M3M H;  3FHW A;  2K75 A;  3VR5 A;  4ALP A;  1Y1V H;  2NYZ D;  4BBR H;  5M3M G;  5M3M B;  1G8Z D;  1JOQ A;  2FFK B;  1F2Z A;  2V4D A;  4PZ8 A;  4A93 B;  4A93 G;  3HRZ C;  1PFN A;  1NBW A;  2P5Z X;  1EWI A;  3W1B A;  5G3L D;  3STB D;  4I7A A;  1HNZ L;  1J6Q A;  1EQQ A;  2E2J H;  4WJ3 M;  4C3H G;  4C3H B;  2VUM G;  2VUM B;  3W1G A;  5M5Y H;  5IYC H;  1PTO H;  3Q24 A;  4KJN A;  5JJI A;  1C9O A;  1DOL A;  3BU2 A;  2O4X A;  4C2M B;  3J7A F;  4LNQ A;  1V43 A;  3FVQ A;  4LF8 Q;  5CBE E;  2EE1 A;  4NXN Q;  5FJ8 H;  4DV6 L;  4NDX A;  1U4R A;  3MXG A;  1BR9 A;  2B2T C;  2K33 A;  4L5R C;  3D4W A;  1CKN A;  4Q5V A;  3D6W A;  1KNE A;  1VQF A;  1S5D D;  4XT3 B;  1VQ4 A;  2EZV A;  4RAU C;  1V1P B;  3HZX A;  4ZLT F;  2Q2H A;  4IN3 A;  1QE6 A;  5JOB A;  1MBY A;  3K5M A;  3OW2 A;  4LFC Q;  2YTY A;  1H9S A;  1YIT A;  2IX3 A;  2VB3 X;  3TRE A;  1TWF H;  5EKK A;  3NBH B;  1WD1 A;  3GTG B;  4A75 A;  1EYC A;  1HNW Q;  3M3Y H;  3E9I A;  1PH6 A;  1YHA A;  5LHY 1;  2ZXR A;  2MUY A;  1BCP C;  3CC4 A;  3OTO L;  2F0F A;  1HTL D;  1EL0 A;  1AW7 A;  3S2H B;  1EY8 A;  1ESR A;  3L3O C;  4G4K A;  3KLS A;  3L2P A;  2YYZ A;  2AQ3 B;  5EKL A;  4TQU S;  1B4O A;  2K04 A;  2Z4H A;  4U68 A;  1Q81 C;  3Q22 A;  1SEB D;  2WKC A;  3G4S A;  3TN2 A;  1A15 A;  1K8M A;  2A6E D;  4IOA A;  1A6X A;  4X3K A;  1EQV A;  2LSS A;  2JEA I;  1F2M A;  4QGU A;  1CTM A;  1XMO Q;  4CJ2 C;  5IWA Q;  1TR5 A;  3BG3 A;  4BA2 I;  1SMY D;  1EY4 A;  4GKJ Q;  3QOJ A;  1K9M C;  1MSG A;  4JV5 Q;  4RH6 A;  2KCN A;  4A3D H;  3I4N G;  3M4P A;  3I4N B;  1E2Z A;  2QDB A;  3PUY A;  1HZ9 A;  3OPO A;  1F9P A;  3Q8D A;  4JI6 L;  1BXT A;  2C5C A;  4OGQ C;  2Y0S B;  1CHQ D;  2Y0S G;  2HIV A;  4DUY Q;  2EOT A;  4DR6 L;  3NHH A;  1M8A A;  3PUX A;  2XRS D; 
#chains in the Genus database with same CATH homology
 4DNR B;  1STY A;  4EQP A;  1BDO A;  4F8M A;  2AQ2 B;  2A68 C;  2F0M A;  1TII D;  1QWY A;  4R9W A;  5C6A A;  2F0I A;  1SMY C;  3MC0 B;  4ZUI A;  2E2H B;  1RF2 D;  4I65 A;  5CV9 A;  4O1N A;  1ILQ A;  4LK1 C;  2QKI C;  5CGK A;  1E0B A;  5E4W C;  4B9W A;  2SOB A;  1QIL A;  3HKZ B;  3SXH A;  1O78 A;  1S4Z A;  1IW7 D;  5JVH 3;  5I6W A;  1FR3 A;  3X3N A;  4RGT A;  4TKO B;  2ZXP A;  4IUV A;  4BA1 I;  1ZEQ X;  4WRD A;  1XYI A;  5A2Q E;  5IT9 E;  1QCB D;  2JYO A;  2J4X A;  3BDO A;  3L9A X;  3N52 A;  1PFM A;  2DN8 A;  1I3Q B;  5IGF A;  1S5E D;  3LNN A;  3TME A;  3S1M B;  3PUW A;  4I7Z C;  1I4H A;  2XSC A;  3C1F A;  1I4X A;  1G6Z A;  3A7L A;  4ZKB B;  5E3F A;  3X3M A;  3MVV A;  2XN9 C;  1O7L A;  2K5W A;  5C0X J;  1PTO D;  1YNJ C;  3S14 B;  2IW3 A;  1R4Q B;  2JEB I;  2KOL A;  2F03 A;  3PIO 3;  1CFM A;  4PMB A;  4KMU C;  4ZQ3 A;  1HRJ A;  4U67 3;  2PPB C;  2M2L A;  2MHV A;  2M00 A;  2F0G A;  4RCO A;  3NPP A;  1SSO A;  4ZRZ A;  2L1B A;  4ZUJ A;  3WDN A;  5FLX E;  1WTV A;  1O7Z A;  2VB2 X;  3L7Z C;  2HDL A;  1RDP D;  4DXG A;  1TS4 A;  2JA7 B;  5M5W B;  1HFN A;  4Z9C B;  4AYB B;  4CHT B;  2MP1 A;  3URY A;  2QF7 A;  5D3I B;  3EA6 A;  1X32 A;  1RTN A;  2R61 A;  1HXY D;  1PZK D;  4ILW A;  4IUQ A;  1LTI D;  4QMG A;  2K32 A;  1CI3 M;  1QNU A;  1WTX A;  2B2W A;  1S5C D;  3G6J B;  2B2V A;  3NQI A;  3NWT A;  1C48 A;  3DWP A;  3BZD B;  2J7Z A;  2K28 A;  1B2T A;  3GTO B;  3HGB A;  5EBD A;  1JE4 A;  1SE2 A;  2G9D A;  3TSS A;  3NBH A;  1KNA A;  2BA0 A;  3GQB A;  1EY6 A;  1GUT A;  1EY7 A;  2K7V A;  1U4L A;  3VA5 A;  3FPU B;  2A6E C;  2HCI A;  1Q8I A;  1M4V A;  5FO9 B;  1KDC A;  4DAV A;  1EWH A;  2AUK A;  1GUN A;  4IFD I;  4HR7 B;  3CHB D;  4E6I A;  1EEI D;  3ERQ A;  4HAE A;  1ROD A;  3C3L A;  1JQY D;  3P7J A;  4BY7 B;  2BE5 D;  3TP5 A;  4QCL A;  3MA2 B;  1QB5 D;  3SK6 A;  2ZXO A;  4LAA A;  3CU7 A;  1PDQ A;  5ELC A;  1B44 D;  4FVM A;  4DK0 A;  3DM1 A;  4HCS A;  1ZKO A;  3VYR A;  4NP5 A;  1B9N A;  1TWH B;  1WTP A;  1EY5 A;  2A69 D;  4WJW A;  4V19 0;  5C4X B;  1EQT A;  5IGC A;  1PRT B;  1KTK A;  2K01 A;  5CBA E;  1GUG A;  5NUC A;  3K57 A;  4A3M B;  4IUN A;  2WAQ B;  1G2T A;  4A3E B;  1IYU A;  2A5H A;  5D65 A;  2PZU A;  2XRQ D;  2E2I B;  2IX1 A;  3T13 A;  1O7Y A;  1DJR D;  3I3C A;  2O5J C;  1IKL A;  5FKA C;  1LO5 D;  3DWQ A;  3EFX D;  1MI2 A;  4O42 A;  2QIL A;  3S1R B;  2C9O A;  1YNJ D;  2F0K A;  1PLF A;  3HS0 C;  1PTO F;  3OMG A;  4K8J A;  2F0N A;  3BVM A;  4XXE A;  2PMZ B;  1CT1 D;  4A3G B;  3R3O A;  1FNU A;  1SYF A;  4ZAI A;  1TY0 A;  4DU9 A;  2Z1C A;  1PTO B;  4JK1 C;  2HDM A;  4IFD H;  4YIJ A;  3HOX B;  1MD2 D;  1SNP A;  2WB1 B;  1G2S A;  4IZ8 A;  3T53 B;  1I50 B;  2KJX A;  1Z6H A;  1TS3 A;  4EQN A;  2PO4 A;  1HTP A;  1ET9 A;  3S2D B;  3CRK C;  1WD0 A;  1KLU D;  5JEA H;  2L12 A;  2B2Y C;  2KEE A;  5JAV A;  1PTO C;  4V0B A;  1RTO A;  3S1Q B;  4KV6 A;  1XTC D;  4DAY A;  2AUJ D;  4DAP A;  4FF3 A;  2F0D A;  5EKI A;  3RMH A;  4KY6 A;  4C56 C;  5C5M A;  1D6E C;  1SYE A;  1SYC A;  3PV0 A;  3OOC A;  4RGN A;  5I6Y A;  1V1P A;  4IAL A;  5IOD A;  2RDH A;  2CVR A;  3I73 A;  1KAA A;  1E2V A;  4XYQ A;  1ESF A;  2L55 A;  1E2W A;  3S1N B;  1Z47 A;  2K5Q A;  3NTK A;  5EJW A;  3D3R A;  1LLR D;  2OT2 A;  4DA2 A;  2WIN B;  1Y8N B;  2IPK D;  3PMF A;  5EBC A;  3VA7 A;  4H0L C;  4QUC A;  1CM9 A;  3KLS X;  1EWC A;  2XWJ B;  4DN4 M;  1IW7 C;  3T4A C;  1FD7 D;  4FYD A;  3C2P A;  5FLX L;  5I9O A;  3U9O A;  2SNS A;  4G7Z C;  1SYD A;  2A73 B;  1JWU D;  1XXG A;  1DM0 B;  4M8A A;  3E6Z X;  2B2W C;  5I4D A;  4RGM A;  3VR6 A;  2A6H C;  1BO0 A;  3WOF A;  4RFB A;  5FOB B;  4H44 C;  4OL7 A;  3OWE B;  1DOM A;  3R93 A;  3QB3 A;  4KY5 A;  3N6R A;  3I70 A;  4CJ0 B;  5C3X A;  3V96 A;  1HCZ A;  2IL8 A;  3RD4 A;  1F9S A;  3S9W A;  1GUW A;  4RHS A;  1I6H B;  4RGO S;  1EU4 A;  4DNT B;  2RVL A;  5J39 A;  4XYO A;  4CKC A;  5A35 A;  5M9O A;  2SNM A;  4KKT A;  3NTH A;  4H7B A;  4A3F B;  2HQE A;  1LAB A;  5C0X H;  1HA6 A;  4KN4 C;  4QB4 A;  3FEW X;  1HFG A;  5CV7 A;  2B2V C;  1G91 A;  2L0C A;  1JC7 A;  1ZYR D;  3J80 L;  5KYL A;  5J22 A;  1NUC A;  4CKE A;  4MN3 A;  3K6O A;  5ELE A;  3M85 A;  3SDZ A;  1FYC A;  4EGV A;  1STA A;  5I2Y A;  5C0X I;  2LMC B;  3K58 A;  5C4J B;  3C46 A;  1EZ6 A;  3M7N A;  1DCZ A;  3MZ5 A;  5M5X B;  3J7Y W;  4FF1 A;  2AWO A;  5K5P A;  3HEJ A;  4R8N A;  2DNC A;  3TDQ A;  1RD9 D;  1I4R A;  2OEO A;  4QF4 A;  1S5B D;  1JR0 D;  1Q90 A;  1F2Y A;  2K5D A;  1WTQ A;  1U4M A;  3I72 A;  2R93 B;  1JWM D;  5E4X A;  2Q8R E;  2EYP A;  3K7A B;  1BBX C;  2PCF B;  1GHK A;  2Z4I A;  2BE5 C;  5JVG 3;  4F88 A;  1UUP A;  5ELD A;  1JOO A;  1TS5 A;  3DHQ A;  2NVX B;  3NP8 A;  2KCC A;  1T5X D;  3HP3 A;  1A3V A;  5DM7 3;  4XQJ A;  5IT9 L;  1BF4 A;  3QJY A;  3A56 A;  2E74 C;  1Q1E A;  3KUP A;  3A8I E;  3HOU B;  1D2B A;  3H94 A;  3DWA A;  5DNF A;  1W6K A;  3T56 B;  4NMZ A;  5CYU A;  4MHE A;  4K2L A;  4OO1 G;  1EY9 A;  2RA4 A;  3FPP A;  4C1N I;  3I4L A;  5KGU A;  4N9P A;  3KF8 A;  5C4Z A;  1D5M C;  1OXS C;  1STE A;  4ULL A;  3VR4 A;  3H09 A;  2VNU D;  1Y8P B;  4PNY A;  3SK4 A;  3OWF A;  3P75 A;  5DAU A;  2J0T D;  4RKB A;  2F1M A;  1MGS A;  3DEO A;  3GTL B;  2O5I C;  5KRU A;  1QOH A;  4FXK C;  3K5L A;  1CHP D;  1CA5 A;  4K8I A;  1F77 A;  4ODG A;  2JP1 A;  2XIW A;  4IUP A;  2EYJ A;  2F0E A;  1C8C A;  3TP7 A;  1J8I A;  5D3D A;  2MJ8 A;  2F0U A;  4C3J G;  4C3J B;  5F2D A;  2LKV A;  2F0H A;  4FP5 D;  2EJM A;  1OXT A;  4UDU C;  4EVO A;  3IFT A;  2XWB B;  4UAI A;  4XDX A;  2JXM B;  1JWS D;  2JSO A;  1PZJ D;  1SBB B;  2ENB A;  2PQE A;  1B1Z A;  1DOK A;  1AN8 A;  2NVY B;  2A69 C;  2RDF A;  3D31 A;  2CQA A;  3NQT A;  2A6H D;  4FXG C;  5IGE A;  5T1G A;  1DD2 A;  3QG1 A;  1EYA A;  1TQO A;  1TS2 A;  3M4Y A;  2K1B A;  3GD7 A;  1RHP A;  2BDO A;  1F2L A;  5E1F A;  1B9M A;  2JE6 I;  5DM6 3;  1EOT A;  4GZY C;  5JPM C;  4RA8 A;  1IKM A;  4HSV A;  2RQX A;  1BOS A;  3TBI B;  4HED A;  1SNQ A;  4HMJ A;  2B63 B;  2PYK A;  1I6V C;  1ONL A;  5K36 G;  1RKN A;  1VCI A;  2GA4 B;  2EY6 A;  1D5X C;  1NAP A;  4BWG B;  4XT1 B;  4ZKC B;  2B2U C;  3GTK B;  1AP0 A;  2NVT B;  3CKI B;  1BNZ A;  1RJT A;  2DY8 A;  3I8Z A;  5IGB A;  1SNO A;  2LFN A;  3RLF A;  4Y7N B;  1R9T B;  3AMU A;  4HSP A;  1HHV A;  3ND9 A;  3DUZ A;  3BYY B;  4L6T B;  4DFA A;  1A3U A;  4K14 A;  3SK8 A;  3OSO A;  1STN A;  5I2X A;  3K5O A;  4KKU A;  3M3Y B;  4KI0 A;  2NVQ B;  1H9R A;  5KYI A;  5KNC A;  5CC4 A;  3OW7 A;  3ONA B;  1SYG A;  3NXW A;  2NTT A;  1BCP D;  4PMC A;  2L9H A;  2LS0 1;  1WVL A;  1EZ8 A;  5T1I A;  1ET6 A;  1QJO A;  3OMC A;  4HMI A;  3FDT A;  2F0S A;  3U9S A;  4FF2 A;  1RCV D;  2KHS A;  4F7X A;  3DXJ C;  2R92 B;  2R3Z A;  2EY2 A;  3FRP B;  3V05 A;  3JAM E;  2IT1 A;  1EIH A;  1IL8 A;  4M1U B;  4KHZ A;  4BBS B;  5IGG A;  1R4P B;  1SE4 A;  5IGD A;  1ZYR C;  3JAM L;  3BDC A;  3I4M B;  1I4P A;  4NKL A;  1JCK B;  4F87 A;  1EFI D;  3PUV A;  2ICE C;  1HA5 A;  1Y69 U;  2N55 A;  2CW0 C;  2XNA C;  1FGB D;  3HOV B;  3R8B A;  4K5W A;  1K8O A;  3TZD A;  5KND A;  1TWA B;  3IL8 A;  5BN3 A;  4HN7 A;  5A2Q L;  2E76 C;  1ILP A;  4KD3 A;  4ID6 A;  3EVQ A;  1PRT F;  3J81 E;  5G3L F;  3W3A A;  3MWY W;  4A3I B;  1FNW A;  1Q3L A;  2SDF A;  1PZI D;  1VF7 A;  1LT6 D;  3D6C A;  1LTS D;  1JB3 A;  2KVM A;  1UEA B;  2O2L D;  4WFN 3;  5EPJ A;  2A74 C;  2F0J A;  3S17 B;  1AZQ A;  4KKS A;  3PO3 B;  3GTP B;  1CK1 A;  3GV3 A;  1HQM C;  1PXU A;  1OXU A;  2BA1 A;  5BN5 A;  1ENA A;  1VMP A;  2WP8 J;  3S16 B;  1JOR A;  1CA6 A;  3A55 A;  2EYM A;  4LJZ C;  4XQQ A;  2PW5 A;  5TSS A;  3MFG A;  1PYW D;  4LMQ D;  2B8F A;  1FNV A;  1GUS A;  4EQO A;  1OXX K;  4WOR A;  4OHJ A;  2N88 A;  3SE0 A;  3RUZ A;  2PZT A;  4K6L A;  3NSW A;  1LT4 D;  5CR3 A;  5CV8 A;  5C3W A;  1A2U A;  4X3T A;  1B53 A;  1KLG D;  1EU3 A;  1A3T A;  1SND A;  2NB0 A;  3ZYY X;  3E0J A;  3P1H A;  3QIA A;  3MXU A;  4IFD J;  5JJZ A;  1SAP A;  4FO2 A;  3O13 A;  3ERO A;  5LL6 X;  4P2C B;  4A3J B;  3H91 A;  2K05 A;  1HQR D;  3GTQ B;  3OIQ A;  4J1M A;  1CZG A;  2OF1 A;  4C3I G;  4C3I B;  3VR3 A;  2JA8 B;  2NN6 G;  3GP7 A;  3HOY B;  4R8I A;  4KJO A;  2RBM A;  2F0V A;  2B2Y A;  3D4R A;  4KTA A;  4DGZ A;  1NSN S;  5DEH A;  1Q1B A;  2FMC A;  3DMU A;  2WII B;  4PV1 C;  3BS1 A;  2IWH A;  1MSH A;  3HG9 A;  1YNN D;  5D14 A;  3BVZ A;  3J80 E;  1EYD A;  3VYS A;  3RZO B;  5C3E B;  3FKI B;  2K03 A;  2RDG A;  1C4Q A;  1SJE D;  2IX0 A;  1VF5 C;  3MTS A;  5HGT A;  4X3U A;  1UAP A;  3G7L A;  3P20 A;  4QIW B;  3A8K E;  2F0L A;  4IUR A;  2E2J B;  5CV6 A;  2YU9 B;  3AB9 A;  2CHB D;  5FO7 B;  4OIK A;  1B3A A;  3EQL C;  2B39 A;  4C1N K;  1Y1V B;  1HUM A;  2E75 C;  4S3S A;  5M3F B;  3PO2 B;  1D5Z C;  4PQX A;  1LT3 D;  2ID0 A;  1O80 A;  3UI2 A;  4KY7 A;  1I4G A;  1SE3 A;  5COY A;  2FMM A;  1AEX A;  2NN6 H;  2KUM A;  2B8G A;  2K6A A;  1WTW A;  2EYH A;  4RWS C;  2JA5 B;  2EPB A;  4IUU A;  4X3S A;  3MFY A;  1IHZ A;  4IFD G;  2E2D C;  3TP6 A;  3VYT A;  2Q8I B;  4DXF A;  2WAC A;  1HPC A;  1NR4 A;  2NBF A;  1GXD C;  3HOW B;  2F0Q A;  3D4D A;  2HUG A;  3M4O B;  2MGS A;  4KD4 A;  3R2I A;  4J8Q A;  5EGT A;  1PRT D;  1STG A;  5C0X G;  2KEC A;  2ICI A;  1K83 B;  3ITP A;  1STB A;  1ICW A;  4CKB A;  3KK7 A;  4FNF A;  1LTR D;  2AQ1 B;  3OIP A;  2X69 A;  2EXZ A;  2EJG C;  3S15 B;  2SEB D;  1PMR A;  2EY5 A;  2F3V A;  2EYL A;  3QOL A;  5IIF A;  2FJ2 A;  1BQQ T;  3KBG A;  1D1K A;  4XTC S;  1SJH D;  1WTO A;  1BCP F;  1XX8 A;  1TWF B;  1YNN C;  1SYB A;  1WCM B;  4CGY B;  1EY0 A;  3SHL A;  1TWC B;  3TP8 A;  2WV6 D;  1DZ1 A;  4RCN A;  3SK5 A;  2WKD A;  5FK9 C;  2IJ0 A;  3W2D A;  4B08 A;  3PIP 3;  2D62 A;  5C5L A;  5KNB A;  3IAY A;  5I9P A;  3SR1 A;  3MXN A;  2PW7 A;  5CV5 A;  3J81 L;  4FF4 A;  3CRL C;  3SEB A;  4K6D A;  3H6M A;  1KDB A;  1X3P A;  3ND8 A;  2F0W A;  4L63 B;  1X3Q A;  3K59 A;  2R6G A;  1Y8O B;  2EYF A;  2FHT A;  1SNC A;  4RHR A;  3LX0 A;  1UNS A;  2L11 A;  4DK1 A;  2RSN A;  2VXW A;  4K2K A;  2F4I A;  2EDG A;  1DON A;  4J6H A;  2F3W A;  1LTG D;  3A8J E;  3NTI A;  1GUO A;  2DY7 A;  1CQF A;  1TT2 A;  4G57 A;  1GJX A;  3QWN A;  2NUC A;  1V8Q A;  1H9M A;  1V1O A;  1BUV T;  1ZXT A;  1AFP A;  2AWN A;  1F9Q A;  5K36 H;  1J9O A;  3J7A V;  1F9R A;  4NW2 A;  5LL6 S;  4KK7 A;  4B9X A;  3BYT B;  4XQN A;  3LWU A;  5FO8 B;  2JA6 B;  2D9U A;  4PMW A;  3EJI A;  5JEA J;  1LTA D;  1QG7 A;  2EJF C;  3M7G A;  3RZD B;  2I07 B;  1L0Y B;  1STH A;  3GV6 A;  5ELB A;  5HUR A;  4ABN A;  2LY7 A;  5JEA G;  1U9R A;  2BCO A;  1ML0 D;  2RKS A;  3NUC A;  3F2U A;  4CBV A;  4ZYS A;  1SXT A;  1GOZ A;  3E5S A;  1Z7T A;  1LT5 D;  2X6L A;  4BS9 A;  4DF7 A;  2G9H D;  1OXV A;  2F0O A;  3TZU A;  2QCP X;  2DNE A;  3A7A B;  5C44 B;  5EPL A;  3R2T A;  1H9J A;  1JIC A;  2H1E A;  2HCC A;  2Z8L A;  4H13 C;  2PNR C;  3NBI A;  4JBW A;  1TKW B;  3H3V C;  1T5E A;  3C1E A;  3K5N A;  5C4H A;  5KIX A;  1HUN A;  2X6G A;  2B2U A;  4K5V A;  3AU7 A;  1LAC A;  1NR2 A;  2TMP A;  5JPN C;  2BOS A;  3Q6S A;  4OO1 I;  1DXM A;  4KHV A;  4IUT A;  4Q0F A;  1JOK A;  2BDN A;  1SNM A;  1VMC A;  2KA7 A;  1H9K A;  3MXP A;  2M9V A;  3Q23 A;  3MEH A;  2RSO A;  3NWS A;  1NCV A;  1OO9 B;  5M5Y B;  3GTJ B;  5ISR A;  1Q12 A;  1EEF D;  1LTT D;  2FIN B;  4OIJ A;  3D8G A;  2NZ1 D;  1DYQ A;  2TSS A;  2Q8T A;  3HOZ B;  3I90 A;  3CQZ B;  2B2T A;  2F0T A;  4TSS A;  2KED A;  3LWE A;  4HCE A;  1SFO B;  3H0G B;  5EQ0 A;  3OHX C;  3SVM A;  3A54 A;  2QEJ C;  3BDL A;  2EYO A;  1TWG B;  4FXD A;  2D5D A;  2A68 D;  5ELF A;  4KN7 C;  4N9T A;  4BY1 B;  1ENC A;  3GTM B;  2NTS A;  4CJ1 B;  3KBX A;  3KLR A;  1I4Q A;  2EVB A;  4K5X A;  1D1I A;  2OXP A;  2L4N A;  3PUZ A;  4IQZ A;  3T16 A;  4HTH A;  1CQV A;  1TVX A;  1IYV A;  2H4O A;  2XVS A;  4A3D B;  5CMD A;  5KEE A;  2ZT9 C;  4MIU A;  1WTR A;  1ENF A;  3IKJ A;  2PZW A;  1PFB A;  2MPM A;  4G7H C;  1GHJ A;  3IFD A;  1U4P A;  1G29 1;  2F0P A;  5BN4 A;  1AZP A;  3QO2 A;  5J1Z A;  2D2C C;  2R7Z B;  1Y1W B;  2L5T A;  5COR A;  3I91 A;  3MAQ A;  3DEP A;  3Q0A A;  5EPK A;  2NN6 I;  1L0X B;  4TRD A;  4A3B B;  4RKL A;  1QNK A;  3V2T A;  1EIG A;  2NWG A;  1KAB A;  4ZK9 B;  1II3 A;  3BVG A;  5IOC A;  3VR2 A;  1LTB D;  1VDZ A;  4ME5 A;  2I46 A;  1TY2 A;  1S5F D;  1B50 A;  3K0Y A;  1KDA A;  3VYU A;  3T51 B;  4XIG S;  3WOE A;  4QUF A;  1W6J A;  4OO1 H;  1H9S B;  2EY1 A;  3GO5 A;  1CZW A;  1A2T A;  4G7O C;  5AFW A;  1BCP B;  2KQ3 A;  1LV9 A;  1SDF A;  5CV4 A;  4A3K B;  4L8J A;  3MHB A;  1TU2 B;  3NE5 B;  1XWE A;  2CW0 D;  3NK9 A;  3FMC A;  1PRT C;  4BBR B;  3VR5 A;  2NYZ D;  5M3M B;  1G8Z D;  1JOQ A;  2FFK B;  1F2Z A;  2V4D A;  4A93 B;  3HRZ C;  1PFN A;  5G3L D;  4C3H G;  4C3H B;  2VUM B;  3Q24 A;  1PTO H;  4KJN A;  1DOL A;  2O4X A;  4C2M B;  3J7A F;  1V43 A;  3FVQ A;  5CBE E;  2EE1 A;  4NDX A;  1U4R A;  3MXG A;  1BR9 A;  2B2T C;  2K33 A;  3D4W A;  4Q5V A;  3D6W A;  1KNE A;  2EZV A;  1S5D D;  4XT3 B;  4RAU C;  1V1P B;  3HZX A;  4ZLT F;  4IN3 A;  1QE6 A;  5JOB A;  1MBY A;  3K5M A;  1H9S A;  2IX3 A;  2VB3 X;  5EKK A;  1WD1 A;  3GTG B;  1EYC A;  5LHY 1;  2ZXR A;  2MUY A;  1BCP C;  2F0F A;  1HTL D;  1EL0 A;  1AW7 A;  3S2H B;  1EY8 A;  1ESR A;  3L3O C;  4G4K A;  3KLS A;  2YYZ A;  2AQ3 B;  5EKL A;  4TQU S;  1B4O A;  2K04 A;  2Z4H A;  4U68 A;  3Q22 A;  1SEB D;  2WKC A;  3TN2 A;  1A15 A;  1K8M A;  2A6E D;  1A6X A;  4X3K A;  1EQV A;  2JEA I;  1F2M A;  1CTM A;  4CJ2 C;  1TR5 A;  3BG3 A;  4BA2 I;  1SMY D;  1EY4 A;  3QOJ A;  1MSG A;  4RH6 A;  2KCN A;  3I4N B;  1E2Z A;  2QDB A;  3PUY A;  3OPO A;  1F9P A;  1BXT A;  2C5C A;  4OGQ C;  1CHQ D;  2Y0S B;  2EOT A;  3NHH A;  1M8A A;  3PUX A;  2XRS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...