4XT2A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GEFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 27
structure length 116
sequence length 116
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2A00
3LI9A 3P7NA 3ICYA 3A0RA 4L9FA 1P97A 2HV1A 3IBRA 2VV7A 4GW9A 4GS9B 3UE6A 1GSXA 3E4PA 3GDIA 4PKYA 1S1ZA 4I3JA 4KUOA 2A24B 3F1PB 3MR0A 3MXQA 4I3AA 4LLOB 3UMEA 2OWJA 2PYRA 3B33A 2J80A 4JGPA 4LPZA 4EESA 1XFQA 4EQ1A 5AVFA 3SW1A 1T19A 3RH8B 3A0SA 3BWLA 1OJ5A 4HP9A 2INWA 3F1OB 4LRZE 1TS7A 3LIEA 5IU1A 3K3CA 4WUJA 4F3LB 2KDKA 3MJQA 4HH2A 4EEPA 1OT9A 5HD5A 1UWNX 2PYPA 4DJ3A 1D06A 4H6JB 5HWWA 1N9LA 2YKFA 3BY8A 5HD3A 1NWZA 3CAXA 4HJ3A 4RQ9A 1OTDA 4XT2A 1UWPX 3HJIA 3VE3A 5G4YA 4B9OA 1S4RA 4HHDA 2WKPA 5F69A 1GSWA 1DRMA 1S1YA 1T18A 2A24A 3F1PA 4R38A 5DKLA 3MFXA 4NXGA 2WKRA 4GS9A 3H7WA 5G4ZA 5J4EA 1T1BA 3F1OA 4NXBA 1S4SA 3LIFA 1F98A 2W0NA 4WLAA 1DP9A 3C2WA 2R78A 3H9WA 4JGQA 4JGRA 2EA9A 4NXEA 5DKKA 1UGUA 1S67L 1WA9A 2H28A 2K7SA 1OTIA 2ZBBA 3VE4A 3VOLA 4HIAA 1EW0A 3MQOA 4LRYC 5HDDA 2BASA 4HJ4A 4R3AA 1XFNA 4HJ6A 4H6JA 4HY8A 1KOUA 3UMDA 1DP8A 4BBVA 4I39A 2VLGA 3FG8A 3F1NA 3PYPA 4HI4A 3K3DA 3RTYA 1G28A 1OTEA 2PDRA 2QJ5A 5HDCA 2L4RA 1XJ6A 2CMNA 4YWZA 3UB6A 5I5LA 1D7EA 4I5SA 4BBTA 3FC7A 3ZQ5A 1OJGA 3MQQA 2V0UA 4R70A 2VV8A 2L1MA 2V9AA 4GHIA 1LSXA 4HP4A 4KQDA 3EEHA 4K08A 4LRXC 2GJ3A 1GSVA 4EETB 3G6OA 3LUQA 4WN5A 1TS0A 2M1CA 3T50A 4HNBA 4F3LA 3IS2B 2QHKA 2QWSA 4MN6A 2Z6CA 1LSWA 2OWHA 2QJ7A 5TBMB 4I38A 1F9IA 1DP6A 1TS8A 1OTBA 1T1AA 2OOLA 3NJAA 3UB7A 4EXOA 1P0ZA 3LI8A 1TS6A 5HSQA 2JN7A 5HZHA 5TBMA 3NOPC 2Z6DA 2JHEA 2V0WA 3NOUC 1V9ZA 5J3WA 3CLOA 1OT6A 3H82A 3H82B 4MN5A 4I3IA 1ODVA 2ZOIA 1LT0A 2PHYA 3H7WB 5AVEA 4EEUA 2PD7A 5F6AA 2V1AA 3ULFA 2D02A 1Y28A 2L0WA 3PHYA 2V1BA 2WKQA 3LIDA 4R6LA 3OLOA 4GHIB 2VV6A 4L9GA 5DJUA 5F5YA 2W27A 3HJKA 3LIBA 3D72A 3E4OA 2PR5A 4M4XA 1V9YA 3IS2A 3NHQA 1N9OA 3GECA 1JNUA 1XJ3A 4EW7A 1LSVA 3F1NB 2ZOHA 3CWFA 4WL9A 1XJ2A 4PKYG 2D01A 4DJ2A 3BY9A 5A8BA 2B02A 3E4QA 4HH3A 3C8CA 4GCZA 4HOIA 2QKPA 5IS1A 4E04A 1N9NA 2P7JA 2YKHA 4BBUA 1VB6A 4JGOA 4L9EA 1X0OA 3LYXA 3EWKA 4HQAA 5F68A 5HWVA 3LIAA 1XJ4A 1LL8A 2VEAA 3A0VA 3LICA 4EERA 5J7EA 3UB9A 2PR6A 1BYWA 3NOTC 5HDSA 5EFWA 5HWTA 1OTAA 3KX0X 4NXFA 5DJTA 5KIZA 1MZUA 4XT2B 2I9VA 1T1CA 2PD8A 4WF0A 3UB8A 4KUKA 1S66L 2KX6A
chains in the Genus database with same CATH superfamily
4WZ4A 3UDIA 3OPRA 4FUWA 5JYPA 1S1ZA 2XFTA 1PWGA 3O5YA 2QYBA 3BWLA 2C5WB 3C30A 1ES3A 3K3CA 1PNEA 4PHTA 1FQGA 4BENA 2JE5A 4MNRA 1OT9A 1IYPA 4DDSA 1K4EA 2R9WA 3E2LA 3DTIA 3M6BA 5CHMA 3HUNA 4HJ3A 4XT2A 5U47A 2EFUA 1GSWA 3RFBA 4NXGA 4Y17A 1TVFA 3HREA 1S67L 4KZ8A 4QPRA 4Y7PA 3LR0A 1IYSA 1DJAA 3RTYA 1SDEA 3MS6A 3DTKA 5FASA 3TSGA 3HBRA 3MQQA 1NZOA 4KQDA 1G68A 1GSVA 2M1CA 4QJGA 3WS2A 5FAPA 2QWSA 5E2EA 2V20A 4EXOA 3KSIA 5HZHA 3V67A 4DE1A 2Z6DA 3N4IA 3PBOA 3UPNA 5FQ9A 3ZG7B 5TFQA 1LT0A 3HLBA 3O88A 3G31A 1K55C 4KZAA 5FL3A 2WKQA 2OAP1 2H0YA 4PM7A 2UWXA 2JKRM 3ZG8B 2PU4A 2QKPA 5M18A 5A91A 4ZJ2A 3PBRA 1M6KA 4N1HA 3OZHA 4GJ4A 3LO7A 2IWCA 2BLSA 4OOYA 1IKGA 4BLMA 2W3HA 3ITAA 4I3JA 4OONA 1YLZA 4MN7A 3GRJA 2KDKA 1JWVA 1VQQA 4XUXA 3VSLA 5L09A 1NRJA 1PIOA 1ZC2A 2P9VB 2WKRA 5G4ZA 2DMWA 4NXBA 4JF5A 4CLCC 3H9WA 4ZJ3A 1UGUA 1SZVA 4P85A 4KG6A 3Q81A 1KVMA 2WZXA 1OTEA 5HDCA 2L4RA 3ZG0A 4DN0A 2W3DA 5HAIA 2J7VA 1FCNA 3G6OA 4DDYA 1J9MA 3N8SA 1MKMA 3T1SA 2W1TA 1XP4A 2V2FF 2OOLA 4GZBA 5FA7A 1ONGA 1DJBA 4P87A 2VX8A 1VHMA 4BMWA 4QHCA 2VV6A 2J9PA 2FZ0A 3GECA 3S7QA 5CERA 3KYEA 2ZL1A 2B02A 5F1GA 4Q0IA 1KVLA 2WGIA 5HPIA 4KZ3A 2A2LA 3S22A 3PAEA 4OQGA 3C4OA 1VEUB 4DKIA 1S0WA 5FDHA 1PWDA 4UHUA 4L9FA 1GA9A 2VV7A 4GS9B 4C3QA 4KUOA 3MR0A 3UMEA 1ZKJA 4JPMA 2XLNA 4GD6A 4P6ZM 3UE0A 4ZRRA 3PBSA 2B18A 3VP4A 4WUJA 1CQAA 2WAEA 1FR6A 3S1YA 3MXRA 2E8IA 1FOFA 2EX8A 3R4KA 2KOIA 5EUAA 3B47A 1YLWA 2Y4AA 5HX9A 1SKOA 2R78A 4S2NA 4OOLA 2EXBA 3MBZA 2Q0OA 4H6JA 3UN7A 5IHVA 3OOVA 4AFIA 1L0FA 3BJNA 4PPRA 1D7EA 4I5SA 1O7EA 2L1MA 3GMWA 4Y3IA 5GL9A 5EM1A 2ZQ8A 1P9WA 1WYCA 3IS2B 5CGXA 1PW8A 3C4PA 2A49A 1TS8A 1ZG4A 4B4ZA 3PBNA 4U3TA 2V8CA 5E43A 4I3IA 1L2SA 3MMHA 2PD7A 1PYYA 4GHIB 4Y0UA 3S7PA 1IKIA 3DAVA 1XJ3A 4WL9A 3C7UA 1YSPA 1KDWA 4BQMA 4FTXA 3DTEA 3V3SA 4C6YA 1VB6A 1EI5A 3W4PA 3PXPA 3RJUA 1YLTA 2G2UA 3G2ZA 3MFDA 1K0KA 3VOYA 1RP5A 3FPVA 1T1CA 1CEGA 3HLEA 2HV1A 1VETA 4OPYA 3E4PA 1QMEA 3AGDA 3MQ0A 2JBFA 3T4JA 3EGDC 3JVVA 3AGFA 3CITA 4ME4A 5F1FA 1L0GA 5CGSA 2Y2GA 3R7WA 4GD8A 2ZM2A 4EBNA 3QHYA 1XPBA 2W0NA 4JGRA 4NETA 4DF6A 4HJ4A 4HJ6A 3CUEC 2Y2LA 1Y54A 3EQVA 4OVDA 1XJ6A 3ZDJA 3FC7A 3CUEA 2OAQ1 3IXDA 3SOIA 3T4TA 4IUKA 1W5DA 4UA6A 2HF6A 4HNBA 3U4LP 3ZHHA 4MLLA 3MSHA 2XR0A 1F9IA 1P0ZA 1WYBA 3LI8A 4LV3A 4Y0OA 2V0WA 4S2MA 1NRFA 5M1AA 3H82B 3HVFA 4BJPA 2PHYA 1MBLA 2EWWA 4MBKA 5LBRA 3LIDA 5F5YA 2W1TB 3MZEA 5E2HA 3NI9A 4OPQA 1XJ2A 1XX2A 4YINA 2VZWA 3UNWA 4P6ZS 4G3WA 1LHYA 3T1RA 4JGOA 3EWKA 2XH9A 4X69A 3UY6A 1CI9A 1K6RA 1PZPA 4EESA 3NECA 4WM9A 3IBRA 3BLSA 2GDNA 3GDIA 3IX3A 4OH0A 1W79A 2V8FA 2WGVA 2INWA 2JC7A 3A3FA 2WUQA 3T12B 3MJQA 2XDMA 1ERMA 1OTDA 3QNCA 1IEMA 4Q0HA 1W7FA 1T1BA 3GSGA 4YOFA 3WRTA 4IHQA 1SDNA 3BLMA 1K38A 4QWOA 2XRNA 4ETZA 4HY8A 1P9RA 5C5KA 1YPRA 4Q8IA 2HDSA 5GHYA 3DWKA 2NUTC 4IUHA 3RXXA 3LUQA 1JTGA 4F3LA 3UE3A 2WZZA 4EU0A 2QJ7A 5AJGA 4CLCE 5GHXA 1ZTUA 2X01A 4U0XA 4RX2A 5DF8A 3H7WB 2UV0E 4R4SA 5KZHA 4S2LA 5J4EA 1JVJA 1SCWA 3F1NB 4KQQA 3L9KA 3JPUA 1QMFA 1VM1A 4EUVA 5DTSA 3TRCA 5HWTA 1C3BA 3GVBA 2KX6A 4E3LA 2XA7S 2IA2A 3G34A 5IT5A 3CMZA 4LPZA 3SW1A 3IF6B 5F83A 5FQQA 3FKVA 4X56A 2EX9A 4Y0TA 5F82A 4L0LA 2ZM8A 3CHWP 4B9OA 1BSGA 4EQIA 3WWXA 1H3QA 4R38A 3G30A 5EVEA 3TJZC 1S4SA 2WKIA 1KE0A 1AXBA 1GHPA 1BLHA 1HLUP 4JXWA 4X1MA 1TD5A 3FG8A 3F1NA 2PAVP 3P09A 4YWZA 4A5RA 1OJGA 2V9AA 4WBGA 1CI8A 4K08A 2HP6A 4WN5A 3MXSA 4B88A 1K56A 1T1AA 3T4QA 5HPFA 2AVXA 1FILA 5DTTA 1FIKA 4E3KA 3H82A 3QP5A 3RXWA 5GLCA 3HL9A 2L0WA 2HZ5A 5FATA 2W27A 3A3IA 5MC7A 3D4FA 4JBFA 4K0WA 3SS5A 5EPHA 3M2JA 5HL1A 3OBFA 3Q82A 1YKDA 3IWIA 1TEMA 4EUZA 2XROA 4BBUA 4X25A 4S2JA 1BUEA 3NBLA 1MWSA 3KO6A 1NXYA 3Q07A 3UB9A 3D9YA 5E2GA 3IQAA 5KIZA 2O99A 3BQ8A 4WF0A 4JLFA 3KSHA 4GW9A 1HVBA 2OWJA 2PYRA 3B33A 5GLDA 2VGLM 4OQHA 4Z9QA 3A0SA 3LIEA 3EEAA 3ZVTA 2HP9A 2W3FA 1D06A 1MPLA 1NZUA 1K54C 1DRMA 1YLPA 1H8ZA 1VETB 4BWIA 1BULA 4PM5A 4GDBA 5GHZA 1K54A 4MBFA 3NDEA 2EA9A 2VGLS 5HAPA 4HIAA 5FQIA 1EW0A 3ZVWA 1GCEA 4BBVA 2WYXA 1CF0A 1F5MA 3UMDA 2ZMAA 2JKRI 3IH8A 2VV8A 4DMZA 3E2KA 4CQHA 3FZCA 4IVIA 2A3UA 4R23A 2PT7A 4NK3A 3VP1A 3NOUC 2XD5A 3C7VA 4LCLA 3LR3A 4R6LA 5CEDA 2VGJA 3IHAA 3LR5A 2R9XA 1VEUA 3LR4A 4NKPA 2HGVA 3VSKA 2W1RA 3VP2A 4OPRA 3ZNTA 2DRWA 4GCZA 2P7JA 5L8MA 2ZL1B 1YM1A 4QY6A 3WS0A 4NXFA 1NYYA 4XT2B 4HH2A 2Y91A 3LI9A 4HBTA 3W4OA 4WMCA 1W63Q 4LV1A 5FQMA 4LLOB 4LV0A 1SKFA 4ZBEA 5DF9A 3F1OB 3ZFZA 4XUZA 1ALQA 4BD1A 2PYPA 3Q7ZA 4K0XA 1KE4A 4S2KA 3IF5A 1S4RA 4HHDA 2B5RA 3CPTA 4GS9A 1L0EA 5EVIC 1K4FA 1NYMA 3IXBA 4KQOA 3U2AA 3SH9A 4I39A 3V3RA 3E0YA 3OPLA 2CMNA 3IF6C 1LLBA 4ETXA 1I2WA 5CRFA 3HLGA 4CLCB 4Q0JA 5TR7A 1OTBA 2JKTM 1K25A 4JXVA 1K57A 2BG1A 4BD0A 1PI5A 4KZ4A 2QZ6A 3T1QB 4MN5A 4N1XA 5KMWA 4JKTA 3NCKA 3HJKA 4DE3A 4X55A 3C5AA 2WKHA 1IELA 4RVAA 1Y4OA 4EV4A 1X0OA 3LYXA 1BLSA 1M40A 3BYDA 1XJ4A 4DRTA 4EERA 4R3JA 1MKIA 2Y2OA 5DJTA 3S4XA 2JKFA 2J8YA 2XD1A 5CXWA 3UB8A 4E3IA 3A3EA 3P7NA 1HTZA 4Z1WA 3IHBA 4QB8A 3MXQA 4MDZA 4EQ1A 1T19A 2Y2JA 1OJ5A 4ARZA 2HP5A 1PW1A 1XGIA 1MY8A 5HL6A 4P0MA 3PBQA 5HWWA 2ZQ7A 4KZ7A 2VGKA 1JTDA 4KZ9A 5EVIB 4WLAA 4ZJ1A 4JGQA 5BOHA 1ONHA 1WA9A 3V39A 2ZBBA 1MXOA 3CJMA 3GTCA 5I5LA 1SHVA 5DF7A 3EEHA 3A3DA 4CJNA 3WRZA 5GLBA 3NJAA 3N6IA 3FWLA 4X1LA 4B93A 3BQAA 3ZNYA 2IWBA 1Q2PA 1ODVA 1N4OA 2Y2HA 4EEUA 4WEJA 2FH5A 4S2OA 1JWZA 2XQZA 3QP6A 3R7WB 4IEDA 4HH3A 4X6TA 1O07A 1ES2A 5HWVA 2ZMVA 3UPPA 3A0VA 2IWDA 2Y79A 2ZC5B 1FR1A 1F2KA 1MZUA 2G2WA 4IBRA 1KE3A 3HLCA 1CEFA 1CK3A 1NLZA 2H0TA 4PKYA 4JGPA 3O86A 1XFQA 2X71A 4DE2A 4JXSA 2Y2QA 3ZYTA 4ESPA 3S7OA 3CG5A 1H5XA 4R4RA 3MKEA 3L7HA 1A0KA 4ZAMA 3VE3A 2ZC3B 1EWZA 3GQZA 2OSUA 3MFXA 4KG5A 3H7WA 4NXEA 5DKKA 2H10A 5CTMA 3WS4A 2BASA 1XFNA 4RYEA 4UA9A 5CECA 5EVLA 1S66L 1E3UD 2GZAA 1GA0A 2VJWA 5AQAA 3WS1A 4K91A 1YMXA 3KYQA 4WYYA 4D2OA 2QHKA 4MN6A 1W8QA 1YLYA 3MF0A 2HDRA 1PRQA 3BRMA 2JN7A 3TG9A 4GB7A 5J3WA 2ZC4B 3CLOA 4O8GA 3UDXA 4MEZA 3CPTB 3E98A 3E4OA 4M4XA 4DXBA 3SH8A 1FSWA 3AGEA 3LEQA 4GLQA 3E4QA 4KG2A 2CC1A 4KENB 1ES5A 5F68A 4NEED 1MWTA 1YT4A 2VEAA 3NC8A 1XXMA 3DBAA 3TW8A 3VMAA 3W2ZA 2PBDP 1K6SA 5EVID 3B42A 5DKLA 3BFFA 2EXAA 3MZDA 1IYQA 3UE6A 1NY0A 1PZOA 2A24B 2HPBA 5DVAA 3BM6A 3GV9A 4LRZE 2Y2IA 3IXHA 4JF6A 1BLPA 4E6WA 4CLCD 4EEPA 5TJJA 4X53A 4DJ3A 1AWIA 1N9LA 3BEBA 4RQ9A 3UPOA 5G4YA 4BL3A 3IX8A 1FCMA 4P6BA 3IBJA 5F69A 1T18A 4ZDXA 1K56D 1F98A 1KDSA 1XA1A 2ZLYA 3P98A 1HD8A 1LL5A 2J3TC 5HDDA 2XK1A 3G35A 1KOUA 4CPKA 5AQ7A 3T1XA 5FQJA 3ZQ5A 4R70A 4F94A 3B3XA 4KQRA 1JWPA 4S2IA 4O7DA 3DWZA 5EOOA 1YSQA 2ZMFA 4G3VA 3GR2A 4WZ5C 4E3MA 4UAAA 4FOFA 1TDGA 1IOUA 3VFHA 3SS4A 4CLCA 3IWQA 5KSCA 2HDUA 3W4QA 4C75A 2W3GA 1ESUA 4O01A 4O0PA 1EROA 4L9EA 3G4PA 3OCLA 5L10A 4Y13A 3UO9A 1OTAA 3SZTA 4KUKA 2ZD8A 4WEKA 1MC0A 2PBYA 4HBUA 4WMCD 1KGFA 3N8RA 1ZG6A 2WK0A 4R0QA 4F3LB 1FSYA 2GX5A 4M3KA 2WKEA 1ES4A 1BT5A 5HD3A 3LGOA 4FH4A 4LCMA 2M7UA 4LGWA 4N92A 2BTFP 4KZ5A 5FSRA 4EBPA 1W8YA 3VOLA 4LRYC 4II7A 4U0TA 1RCJA 1YQSA 1DP8A 2VLGA 2PDRA 2ZC6B 4BBTA 4FD8A 3QP8A 4GHIA 5A90A 1W63M 4EETB 2Y2NA 1SKOB 1TS0A 3BFDA 5HARA 1GHMA 5HFOA 2XEPA 3T4SA 2Z6CA 3ZCZA 1LSWA 5TBMB 5EE8A 3IWOA 4LFUA 5CX7A 3SH7A 1E3UA 4KZBA 1K55A 5FQKA 3HLWA 1S6RA 3CI6A 2ZOIA 1YAXA 2EX2A 2V1BA 3I7JA 2V1ZA 4JXGA 3IH9A 4N9LA 4UEYA 2J3WA 2DNSA 2JCHA 4S2NC 2D01A 3VP0A 2YKHA 3NIAA 3IF6A 1LL8A 4FCFA 3HUMA 1KGGA 1BZAA 3C38A 3IXGA 4IVKA 3DW0A 3W8KA 5AQBA 1BYWA 2XA7M 4MMNA 5A93A 4UQIM 5CTNA 2W3EA 4OLDA 2WAFA 4B4XA 3UB7A 1DJCA 5AVFA 1STZA 1TS7A 4WELA 3FKWA 1BLCA 5AQ9A 1UWNX 5JYOA 2ZQ9A 4ID4A 3KSFA 4ZTKA 3ITBA 3F1PA 2LB9A 4GKUA 2RCXA 2Z2MB 5HW3A 4PMAA 2K7SA 3MQOA 4R3AA 3PYPA 3EQUA 2FFYA 3K3DA 3QP4A 4OLGA 5DFXA 4GDNA 4JF4A 4HP4A 5FDSA 3UDFA 1I2SA 3Q7VA 3LY3A 2ZM0A 1Z6FA 1Q2QA 1LI0A 2ZQCA 4HESA 4EBLA 4I38A 4R1GA 5GLAA 2H5SA 3PBTA 5HSQA 2Y2MA 4OQ0A 1NJ4A 3A3JA 1G6OA 2OLUA 1MWUA 2K2NA 2JKGA 2ZJ9A 1DY6A 2Z2LB 3MKFA 3OLOA 5HAQA 2XFSA 2PR5A 4OP8A 3VP3A 1RGZA 1N9OA 3OC2A 4XXRA 4PKYG 3BY9A 4Y15A 2Q9MA 3C8CA 4HOIA 4OQIA 4OOMA 1N9NA 5DTKA 2QPNA 3LIAA 3IT9A 3LICA 5J7EA 2C6WB 4N9KA 3WS5A 2PD8A 2WGWA 1P97A 3UB5P 1U60A 5DFYA 1GSXA 3F1PB 4OKPA 2XSSA 4GN2A 2J80A 3RH8B 1ACFA 2VA0A 3FPWA 2EX6A 1D1JA 2YKFA 3ISGA 1CJFA 5TGFA 2QMIA 1S1YA 4MCWA 4NG2A 5FI6A 4X68A 5A92A 3F1OA 3KSGA 3C2WA 3FV7A 4KZ6A 3KYZA 2B95A 3G32A 3BECA 1MWRA 2V0UA 3ZG5A 2HDQA 3MZFA 4QU3A 5L07A 5FEGA 3VOZA 1TDLA 4IBXA 3LY4A 2EFXA 4WZ5A 4GNUA 2LB5A 3TOIA 3DTMA 3NOPC 1V9ZA 2NUPC 1OT6A 2DCFA 1L3LA 1LL9A 5CEBA 2D02A 1Y28A 2J3TD 5EFWA 5D3OA 3JYIA 3D72A 5I94A 3BW6A 1PFLA 1ESIA 1NLYA 3M6HA 5A8BA 3T4LA 3N8LA 3NDGA 1ZHHB 4QD4A 2PR6A 1G5UA 3NOTC 2I72A 2ZC7A 2ZQDA 1OMEA 5EOEA 2I9VA 4YFMA 2GNXA 3P01A 3NULA 1ERQA 3A0RA 3UE1A 3QP1A 3EGXC 3Q7VB 4I3AA 1Z09A 2Y2PA 3O87A 2PU2A 1H8YA 4MBHA 3IX4A 4PAUA 4E6XA 1YMSA 5FI2A 2WGWB 3PTEA 2OV5A 4D60A 2WKPA 3K2NA 2XGNA 2J9OA 4E3OA 3V5MA 3T4KA 3LIFA 1DP9A 2JKTI 3CZDA 3Q1FA 3LFVA 1OTIA 3PR6A 3VE4A 3LCEA 5KSHA 5CHUA 1KGEA 2G7UA 3ZGAB 4HI4A 4QY5A 3UB6A 4UQIS 2ZQAA 2HJ9C 1PWCA 2RL3A 1LSXA 2VKSA 1YLJA 4LRXC 2Y59A 5CHJA 3T50A 3T4OA 1TF1A 5J8XA 1IYOA 4YNRA 4FSFA 3ZG9B 1DP6A 1BTLA 2M7VA 1RGYA 3N7WA 1LI9A 5TBMA 2JHEA 4GOGA 1E25A 5F6AA 3S7NA 3M2KA 4OP5A 3VV4A 4L9GA 4RA7A 2O9CA 3LIBA 3HLDA 1V9YA 3NHQA 1JNUA 3FYZA 3O3VA 1LSVA 3V50A 4PM9A 2FFFB 2P9VA 2Y8HA 2P04A 5IS1A 2WADA 3VFFA 4HQAA 5E2FA 3D3OA 5HDSA 1FCOA 3BFCA 2Y2KA 4PM8A 1XKZA 3EOIA 4FH2A 3ICYA 1PI4A 3SS3A 4Y2FA 3PAGA 2P74A 3OPPA 2K31A 3BFEA 1L0DA 2EWVA 4HP9A 4LV2A 4EWFA 5IU1A 3QP2A 5HD5A 4E3JA 5FI7A 1HZOA 4H6JB 2P08A 3BY8A 1NWZA 3CAXA 2O9AA 4IJGA 5K5BA 1UWPX 3HJIA 2HJEA 1G6AA 5EVIA 2MJ6A 2A24A 3TE8A 3HCYA 4ARZB 4BL2A 1H8MA 3OCNA 1XGJA 2H28A 3OPHA 4Y5FA 3NY4A 4UA7A 1IFQA 4DE0A 4R3BA 4G3KA 2Y55A 5EECA 2KLIA 1G28A 2QJ5A 4S2PA 5EM0A 5L2FA 2GJ3A 3HUOA 2O0YA 4H8RA 1I5QA 1K57C 5M19A 2OWHA 3G2YA 5FEFA 5G18A 2OLVA 1E4DA 1TS6A 5CGWA 4RX3A 4E3NA 4LENA 1OPXA 2PRFA 5AVEA 3ULFA 1XA7A 2V1AA 3PHYA 5DJUA 1WE4A 5EV0A 4DXCA 2XF3A 4PM6A 3IS2A 5FAOA 1N9BA 4EW7A 2E8JA 2ZOHA 3CWFA 1H0MA 4DJ2A 2VK3A 4E04A 3QNBA 1GHIA 2X02A 3HLFA 5FAQA 3JVUA 4HEFA 3BFGA 3LEZA 4OPZA 3KX0X 2ACGA 2Q9NA 2O9BA 1J3WA
chains in the Genus database with same CATH topology
3P7NA 3IBRA 4Z1WA 3GDIA 3UB7A 1S1ZA 3MXQA 4MDZA 4EQ1A 3O5YA 2QYBA 5AVFA 1T19A 3BWLA 1OJ5A 1STZA 4ARZA 2INWA 3C30A 1TS7A 4WELA 3K3CA 4PHTA 3MJQA 1OT9A 5HL6A 1UWNX 3PBQA 5HWWA 4HJ3A 4XT2A 1OTDA 3KSFA 4Q0HA 1GSWA 3F1PA 3RFBA 2LB9A 4NXGA 1T1BA 4YOFA 4IHQA 4WLAA 4JGQA 1S67L 1WA9A 4QPRA 2K7SA 2ZBBA 3MQOA 3LR0A 2XRNA 4R3AA 4ETZA 4HY8A 1P9RA 5C5KA 3PYPA 3RTYA 3EQUA 3K3DA 5DFXA 5I5LA 3MQQA 4HP4A 4KQDA 2NUTC 4IUHA 3EEHA 1GSVA 3LUQA 2M1CA 4F3LA 3UE3A 2QWSA 4EU0A 2QJ7A 5AJGA 4CLCE 4I38A 3NJAA 4EXOA 1ZTUA 4B93A 3KSIA 3PBTA 5HSQA 5HZHA 3V67A 2Z6DA 3BQAA 3PBOA 1ODVA 1G6OA 1LT0A 3H7WB 4EEUA 4WEJA 2K2NA 2FH5A 5FL3A 2WKQA 3OLOA 5J4EA 2PR5A 2OAP1 1N9OA 3OC2A 3F1NB 4PKYG 3R7WB 3BY9A 2JKRM 4HH3A 3C8CA 4HOIA 2QKPA 4OOMA 1N9NA 5HWVA 2ZMVA 4EUVA 3LIAA 3PBRA 3A0VA 3LICA 5J7EA 2Y79A 3TRCA 5HWTA 4GJ4A 1MZUA 2PD8A 2KX6A 2XA7S 1P97A 2IA2A 5DFYA 1NLZA 1GSXA 2W3HA 4PKYA 4I3JA 3F1PB 2XSSA 5IT5A 2J80A 4JGPA 4LPZA 3SW1A 1XFQA 3RH8B 2VA0A 3FPWA 4MN7A 2KDKA 3ZYTA 3S7OA 4L0LA 2YKFA 4B9OA 3VE3A 1NRJA 1S1YA 4MCWA 1H3QA 4R38A 3MFXA 2WKRA 5G4ZA 3H7WA 2DMWA 3F1OA 4NXBA 1S4SA 3KSGA 3TJZC 4CLCC 3H9WA 3C2WA 3KYZA 4NXEA 5DKKA 1UGUA 2BASA 1XFNA 1TD5A 3FG8A 3F1NA 1OTEA 5HDCA 2L4RA 4YWZA 4DN0A 2W3DA 2GZAA 1OJGA 2V0UA 2V9AA 2VJWA 4K08A 3G6OA 4WN5A 3KYQA 1MKMA 2QHKA 4MN6A 2W1TA 3MF0A 1T1AA 2OOLA 2LB5A 3T4QA 5HPFA 2JN7A 3NOPC 1V9ZA 5J3WA 3CLOA 1OT6A 3H82A 4O8GA 2NUPC 2VX8A 1VHMA 4BMWA 2D02A 1Y28A 2L0WA 2J3TD 5EFWA 2VV6A 2W27A 3E98A 3D72A 3E4OA 4M4XA 5MC7A 3BW6A 2FZ0A 3GECA 3S7QA 4GLQA 3OBFA 1NLYA 5A8BA 2B02A 1YKDA 3E4QA 4Q0IA 3T4LA 5HPIA 2XROA 4BBUA 5F68A 4NEED 2A2LA 1ZHHB 2VEAA 3KO6A 3UB9A 2PR6A 3DBAA 3TW8A 3NOTC 3W2ZA 5KIZA 2I9VA 2O99A 3BQ8A 4WF0A 3B42A 2GNXA 3P01A 5DKLA 4L9FA 3A0RA 3KSHA 2VV7A 4GW9A 4GS9B 3EGXC 3UE6A 4KUOA 2A24B 4I3AA 3MR0A 3UMEA 2OWJA 2PYRA 3B33A 2VGLM 3A0SA 4P6ZM 4LRZE 3LIEA 4ZRRA 3EEAA 3PBSA 2B18A 4PAUA 4WUJA 4CLCD 4EEPA 2W3FA 5TJJA 4DJ3A 1D06A 1N9LA 4RQ9A 5G4YA 3R4KA 2KOIA 2WKPA 3IBJA 5F69A 1DRMA 1T18A 3K2NA 3B47A 4BWIA 3T4KA 3LIFA 1F98A 1DP9A 2JKTI 2R78A 3LFVA 2EA9A 2VGLS 4OOLA 1OTIA 3PR6A 3VE4A 4HIAA 1EW0A 5HDDA 2J3TC 5KSHA 4H6JA 1KOUA 3UMDA 4BBVA 1F5MA 2G7UA 4HI4A 3OOVA 4AFIA 3UB6A 3BJNA 1D7EA 2JKRI 4I5SA 3ZQ5A 4R70A 4UQIS 2HJ9C 2L1MA 2VKSA 2VV8A 1LSXA 4DMZA 4Y3IA 4CQHA 4LRXC 1P9WA 3T50A 3IS2B 3T4OA 1TF1A 4YNRA 4FSFA 1DP6A 1TS8A 2M7VA 3PBNA 1YSQA 2PT7A 2ZMFA 4G3VA 5TBMA 2JHEA 3NOUC 4I3IA 3MMHA 2PD7A 3LR3A 5F6AA 3S7NA 4R6LA 4FOFA 3VV4A 4L9GA 4GHIB 3LR5A 1IOUA 3LIBA 2O9CA 3S7PA 1V9YA 3LR4A 4CLCA 3NHQA 4NKPA 1JNUA 2HGVA 1XJ3A 2W1RA 1LSVA 2W3GA 4WL9A 1YSPA 2Y8HA 4O01A 2P04A 4GCZA 4O0PA 5IS1A 2P7JA 5L8MA 1VB6A 4L9EA 4HQAA 3PXPA 3OCLA 3D3OA 5HDSA 1OTAA 4NXFA 4XT2B 3FPVA 1T1CA 3EOIA 4KUKA 4HH2A 4WEKA 3LI9A 3ICYA 1MC0A 2HV1A 4Y2FA 3E4PA 1W63Q 4LLOB 2K31A 3MQ0A 2EWVA 5DF9A 4HP9A 3F1OB 3T4JA 5IU1A 4F3LB 3EGDC 2GX5A 5HD5A 3JVVA 2PYPA 4H6JB 2P08A 5HD3A 3BY8A 1NWZA 3CAXA 2O9AA 3CITA 4IJGA 4ME4A 1UWPX 3HJIA 5K5BA 2HJEA 1S4RA 4HHDA 2M7UA 3R7WA 2MJ6A 2A24A 3TE8A 4GS9A 3HCYA 4ARZB 2W0NA 4JGRA 4KQOA 1H8MA 3OCNA 2H28A 3U2AA 3VOLA 4Y5FA 4LRYC 1IFQA 4HJ4A 4II7A 4HJ6A 3CUEC 1DP8A 4I39A 2VLGA 4G3KA 3E0YA 3EQVA 2KLIA 1G28A 2PDRA 2QJ5A 1XJ6A 2CMNA 4BBTA 3FC7A 3CUEA 4GHIA 2OAQ1 4ETXA 3T4TA 1W63M 2GJ3A 4EETB 4IUKA 1TS0A 2O0YA 2HF6A 4HNBA 3T4SA 4CLCB 2Z6CA 4Q0JA 1LSWA 2OWHA 5TBMB 1F9IA 1OTBA 2JKTM 1P0ZA 5CX7A 3LI8A 1TS6A 2V0WA 3H82B 1OPXA 4MN5A 3CI6A 2ZOIA 4BJPA 2PHYA 5AVEA 3ULFA 2V1AA 2EWWA 1YAXA 5LBRA 3PHYA 5DJUA 2V1BA 3LIDA 5F5YA 3HJKA 2W1TB 3IS2A 4UEYA 2J3WA 4EW7A 2ZOHA 3CWFA 1XJ2A 2D01A 2VZWA 4DJ2A 4P6ZS 4G3WA 4E04A 2YKHA 4JGOA 1X0OA 3LYXA 3EWKA 1XJ4A 1LL8A 3JVUA 4EERA 3C38A 1BYWA 2XA7M 4MMNA 3KX0X 5DJTA 4UQIM 3UB8A 2O9BA 2W3EA 1S66L 4EESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI9 A;  3P7N A;  3ICY A;  3A0R A;  4L9F A;  1P97 A;  2HV1 A;  3IBR A;  2VV7 A;  4GW9 A;  4GS9 B;  3UE6 A;  1GSX A;  3E4P A;  3GDI A;  4PKY A;  1S1Z A;  4I3J A;  4KUO A;  2A24 B;  3F1P B;  3MR0 A;  3MXQ A;  4I3A A;  4LLO B;  3UME A;  2OWJ A;  2PYR A;  3B33 A;  2J80 A;  4JGP A;  4LPZ A;  4EES A;  1XFQ A;  4EQ1 A;  5AVF A;  3SW1 A;  1T19 A;  3RH8 B;  3A0S A;  3BWL A;  1OJ5 A;  4HP9 A;  2INW A;  3F1O B;  4LRZ E;  1TS7 A;  3LIE A;  5IU1 A;  3K3C A;  4WUJ A;  4F3L B;  2KDK A;  3MJQ A;  4HH2 A;  4EEP A;  1OT9 A;  5HD5 A;  1UWN X;  2PYP A;  4DJ3 A;  1D06 A;  4H6J B;  5HWW A;  1N9L A;  2YKF A;  3BY8 A;  5HD3 A;  1NWZ A;  3CAX A;  4HJ3 A;  4RQ9 A;  1OTD A;  4XT2 A;  1UWP X;  3HJI A;  3VE3 A;  5G4Y A;  4B9O A;  1S4R A;  4HHD A;  2WKP A;  5F69 A;  1GSW A;  1DRM A;  1S1Y A;  1T18 A;  2A24 A;  3F1P A;  4R38 A;  5DKL A;  3MFX A;  4NXG A;  2WKR A;  4GS9 A;  3H7W A;  5G4Z A;  5J4E A;  1T1B A;  3F1O A;  4NXB A;  1S4S A;  3LIF A;  1F98 A;  2W0N A;  4WLA A;  1DP9 A;  3C2W A;  2R78 A;  3H9W A;  4JGQ A;  4JGR A;  2EA9 A;  4NXE A;  5DKK A;  1UGU A;  1S67 L;  1WA9 A;  2H28 A;  2K7S A;  1OTI A;  2ZBB A;  3VE4 A;  3VOL A;  4HIA A;  1EW0 A;  3MQO A;  4LRY C;  5HDD A;  2BAS A;  4HJ4 A;  4R3A A;  1XFN A;  4HJ6 A;  4H6J A;  4HY8 A;  1KOU A;  3UMD A;  1DP8 A;  4BBV A;  4I39 A;  2VLG A;  3FG8 A;  3F1N A;  3PYP A;  4HI4 A;  3K3D A;  3RTY A;  1G28 A;  1OTE A;  2PDR A;  2QJ5 A;  5HDC A;  2L4R A;  1XJ6 A;  2CMN A;  4YWZ A;  3UB6 A;  5I5L A;  1D7E A;  4I5S A;  4BBT A;  3FC7 A;  3ZQ5 A;  1OJG A;  3MQQ A;  2V0U A;  4R70 A;  2VV8 A;  2L1M A;  2V9A A;  4GHI A;  1LSX A;  4HP4 A;  4KQD A;  3EEH A;  4K08 A;  4LRX C;  2GJ3 A;  1GSV A;  4EET B;  3G6O A;  3LUQ A;  4WN5 A;  1TS0 A;  2M1C A;  3T50 A;  4HNB A;  4F3L A;  3IS2 B;  2QHK A;  2QWS A;  4MN6 A;  2Z6C A;  1LSW A;  2OWH A;  2QJ7 A;  5TBM B;  4I38 A;  1F9I A;  1DP6 A;  1TS8 A;  1OTB A;  1T1A A;  2OOL A;  3NJA A;  3UB7 A;  4EXO A;  1P0Z A;  3LI8 A;  1TS6 A;  5HSQ A;  2JN7 A;  5HZH A;  5TBM A;  3NOP C;  2Z6D A;  2JHE A;  2V0W A;  3NOU C;  1V9Z A;  5J3W A;  3CLO A;  1OT6 A;  3H82 A;  3H82 B;  4MN5 A;  4I3I A;  1ODV A;  2ZOI A;  1LT0 A;  2PHY A;  3H7W B;  5AVE A;  4EEU A;  2PD7 A;  5F6A A;  2V1A A;  3ULF A;  2D02 A;  1Y28 A;  2L0W A;  3PHY A;  2V1B A;  2WKQ A;  3LID A;  4R6L A;  3OLO A;  4GHI B;  2VV6 A;  4L9G A;  5DJU A;  5F5Y A;  2W27 A;  3HJK A;  3LIB A;  3D72 A;  3E4O A;  2PR5 A;  4M4X A;  1V9Y A;  3IS2 A;  3NHQ A;  1N9O A;  3GEC A;  1JNU A;  1XJ3 A;  4EW7 A;  1LSV A;  3F1N B;  2ZOH A;  3CWF A;  4WL9 A;  1XJ2 A;  4PKY G;  2D01 A;  4DJ2 A;  3BY9 A;  5A8B A;  2B02 A;  3E4Q A;  4HH3 A;  3C8C A;  4GCZ A;  4HOI A;  2QKP A;  5IS1 A;  4E04 A;  1N9N A;  2P7J A;  2YKH A;  4BBU A;  1VB6 A;  4JGO A;  4L9E A;  1X0O A;  3LYX A;  3EWK A;  4HQA A;  5F68 A;  5HWV A;  3LIA A;  1XJ4 A;  1LL8 A;  2VEA A;  3A0V A;  3LIC A;  4EER A;  5J7E A;  3UB9 A;  2PR6 A;  1BYW A;  3NOT C;  5HDS A;  5EFW A;  5HWT A;  1OTA A;  3KX0 X;  4NXF A;  5DJT A;  5KIZ A;  1MZU A;  4XT2 B;  2I9V A;  1T1C A;  2PD8 A;  4WF0 A;  3UB8 A;  4KUK A;  1S66 L;  2KX6 A; 
#chains in the Genus database with same CATH topology
 4WZ4 A;  3UDI A;  3OPR A;  4FUW A;  5JYP A;  1S1Z A;  2XFT A;  1PWG A;  3O5Y A;  2QYB A;  3BWL A;  2C5W B;  3C30 A;  1ES3 A;  3K3C A;  1PNE A;  4PHT A;  1FQG A;  4BEN A;  2JE5 A;  4MNR A;  1OT9 A;  1IYP A;  4DDS A;  1K4E A;  2R9W A;  3E2L A;  3DTI A;  3M6B A;  5CHM A;  3HUN A;  4HJ3 A;  4XT2 A;  5U47 A;  2EFU A;  1GSW A;  3RFB A;  4NXG A;  4Y17 A;  1TVF A;  3HRE A;  1S67 L;  4KZ8 A;  4QPR A;  4Y7P A;  3LR0 A;  1IYS A;  1DJA A;  3RTY A;  1SDE A;  3MS6 A;  3DTK A;  5FAS A;  3TSG A;  3HBR A;  3MQQ A;  1NZO A;  4KQD A;  1G68 A;  1GSV A;  2M1C A;  4QJG A;  3WS2 A;  5FAP A;  2QWS A;  5E2E A;  2V20 A;  4EXO A;  3KSI A;  5HZH A;  3V67 A;  4DE1 A;  2Z6D A;  3N4I A;  3PBO A;  3UPN A;  5FQ9 A;  3ZG7 B;  5TFQ A;  1LT0 A;  3HLB A;  3O88 A;  3G31 A;  1K55 C;  4KZA A;  5FL3 A;  2WKQ A;  2OAP 1;  2H0Y A;  4PM7 A;  2UWX A;  2JKR M;  3ZG8 B;  2PU4 A;  2QKP A;  5M18 A;  5A91 A;  4ZJ2 A;  3PBR A;  1M6K A;  4N1H A;  3OZH A;  4GJ4 A;  3LO7 A;  2IWC A;  2BLS A;  4OOY A;  1IKG A;  4BLM A;  2W3H A;  3ITA A;  4I3J A;  4OON A;  1YLZ A;  4MN7 A;  3GRJ A;  2KDK A;  1JWV A;  1VQQ A;  4XUX A;  3VSL A;  5L09 A;  1NRJ A;  1PIO A;  1ZC2 A;  2P9V B;  2WKR A;  5G4Z A;  2DMW A;  4NXB A;  4JF5 A;  4CLC C;  3H9W A;  4ZJ3 A;  1UGU A;  1SZV A;  4P85 A;  4KG6 A;  3Q81 A;  1KVM A;  2WZX A;  1OTE A;  5HDC A;  2L4R A;  3ZG0 A;  4DN0 A;  2W3D A;  5HAI A;  2J7V A;  1FCN A;  3G6O A;  4DDY A;  1J9M A;  3N8S A;  1MKM A;  3T1S A;  2W1T A;  1XP4 A;  2V2F F;  2OOL A;  4GZB A;  5FA7 A;  1ONG A;  1DJB A;  4P87 A;  2VX8 A;  1VHM A;  4BMW A;  4QHC A;  2VV6 A;  2J9P A;  2FZ0 A;  3GEC A;  3S7Q A;  5CER A;  3KYE A;  2ZL1 A;  2B02 A;  5F1G A;  4Q0I A;  1KVL A;  2WGI A;  5HPI A;  4KZ3 A;  2A2L A;  3S22 A;  3PAE A;  4OQG A;  3C4O A;  1VEU B;  4DKI A;  1S0W A;  5FDH A;  1PWD A;  4UHU A;  4L9F A;  1GA9 A;  2VV7 A;  4GS9 B;  4C3Q A;  4KUO A;  3MR0 A;  3UME A;  1ZKJ A;  4JPM A;  2XLN A;  4GD6 A;  4P6Z M;  3UE0 A;  4ZRR A;  3PBS A;  2B18 A;  3VP4 A;  4WUJ A;  1CQA A;  2WAE A;  1FR6 A;  3S1Y A;  3MXR A;  2E8I A;  1FOF A;  2EX8 A;  3R4K A;  2KOI A;  5EUA A;  3B47 A;  1YLW A;  2Y4A A;  5HX9 A;  1SKO A;  2R78 A;  4S2N A;  4OOL A;  2EXB A;  3MBZ A;  2Q0O A;  4H6J A;  3UN7 A;  5IHV A;  3OOV A;  4AFI A;  1L0F A;  3BJN A;  4PPR A;  1D7E A;  4I5S A;  1O7E A;  2L1M A;  3GMW A;  4Y3I A;  5GL9 A;  5EM1 A;  2ZQ8 A;  1P9W A;  1WYC A;  3IS2 B;  5CGX A;  1PW8 A;  3C4P A;  2A49 A;  1TS8 A;  1ZG4 A;  4B4Z A;  3PBN A;  4U3T A;  2V8C A;  5E43 A;  4I3I A;  1L2S A;  3MMH A;  2PD7 A;  1PYY A;  4GHI B;  4Y0U A;  3S7P A;  1IKI A;  3DAV A;  1XJ3 A;  4WL9 A;  3C7U A;  1YSP A;  1KDW A;  4BQM A;  4FTX A;  3DTE A;  3V3S A;  4C6Y A;  1VB6 A;  1EI5 A;  3W4P A;  3PXP A;  3RJU A;  1YLT A;  2G2U A;  3G2Z A;  3MFD A;  1K0K A;  3VOY A;  1RP5 A;  3FPV A;  1T1C A;  1CEG A;  3HLE A;  2HV1 A;  1VET A;  4OPY A;  3E4P A;  1QME A;  3AGD A;  3MQ0 A;  2JBF A;  3T4J A;  3EGD C;  3JVV A;  3AGF A;  3CIT A;  4ME4 A;  5F1F A;  1L0G A;  5CGS A;  2Y2G A;  3R7W A;  4GD8 A;  2ZM2 A;  4EBN A;  3QHY A;  1XPB A;  2W0N A;  4JGR A;  4NET A;  4DF6 A;  4HJ4 A;  4HJ6 A;  3CUE C;  2Y2L A;  1Y54 A;  3EQV A;  4OVD A;  1XJ6 A;  3ZDJ A;  3FC7 A;  3CUE A;  2OAQ 1;  3IXD A;  3SOI A;  3T4T A;  4IUK A;  1W5D A;  4UA6 A;  2HF6 A;  4HNB A;  3U4L P;  3ZHH A;  4MLL A;  3MSH A;  2XR0 A;  1F9I A;  1P0Z A;  1WYB A;  3LI8 A;  4LV3 A;  4Y0O A;  2V0W A;  4S2M A;  1NRF A;  5M1A A;  3H82 B;  3HVF A;  4BJP A;  2PHY A;  1MBL A;  2EWW A;  4MBK A;  5LBR A;  3LID A;  5F5Y A;  2W1T B;  3MZE A;  5E2H A;  3NI9 A;  4OPQ A;  1XJ2 A;  1XX2 A;  4YIN A;  2VZW A;  3UNW A;  4P6Z S;  4G3W A;  1LHY A;  3T1R A;  4JGO A;  3EWK A;  2XH9 A;  4X69 A;  3UY6 A;  1CI9 A;  1K6R A;  1PZP A;  4EES A;  3NEC A;  4WM9 A;  3IBR A;  3BLS A;  2GDN A;  3GDI A;  3IX3 A;  4OH0 A;  1W79 A;  2V8F A;  2WGV A;  2INW A;  2JC7 A;  3A3F A;  2WUQ A;  3T12 B;  3MJQ A;  2XDM A;  1ERM A;  1OTD A;  3QNC A;  1IEM A;  4Q0H A;  1W7F A;  1T1B A;  3GSG A;  4YOF A;  3WRT A;  4IHQ A;  1SDN A;  3BLM A;  1K38 A;  4QWO A;  2XRN A;  4ETZ A;  4HY8 A;  1P9R A;  5C5K A;  1YPR A;  4Q8I A;  2HDS A;  5GHY A;  3DWK A;  2NUT C;  4IUH A;  3RXX A;  3LUQ A;  1JTG A;  4F3L A;  3UE3 A;  2WZZ A;  4EU0 A;  2QJ7 A;  5AJG A;  4CLC E;  5GHX A;  1ZTU A;  2X01 A;  4U0X A;  4RX2 A;  5DF8 A;  3H7W B;  2UV0 E;  4R4S A;  5KZH A;  4S2L A;  5J4E A;  1JVJ A;  1SCW A;  3F1N B;  4KQQ A;  3L9K A;  3JPU A;  1QMF A;  1VM1 A;  4EUV A;  5DTS A;  3TRC A;  5HWT A;  1C3B A;  3GVB A;  2KX6 A;  4E3L A;  2XA7 S;  2IA2 A;  3G34 A;  5IT5 A;  3CMZ A;  4LPZ A;  3SW1 A;  3IF6 B;  5F83 A;  5FQQ A;  3FKV A;  4X56 A;  2EX9 A;  4Y0T A;  5F82 A;  4L0L A;  2ZM8 A;  3CHW P;  4B9O A;  1BSG A;  4EQI A;  3WWX A;  1H3Q A;  4R38 A;  3G30 A;  5EVE A;  3TJZ C;  1S4S A;  2WKI A;  1KE0 A;  1AXB A;  1GHP A;  1BLH A;  1HLU P;  4JXW A;  4X1M A;  1TD5 A;  3FG8 A;  3F1N A;  2PAV P;  3P09 A;  4YWZ A;  4A5R A;  1OJG A;  2V9A A;  4WBG A;  1CI8 A;  4K08 A;  2HP6 A;  4WN5 A;  3MXS A;  4B88 A;  1K56 A;  1T1A A;  3T4Q A;  5HPF A;  2AVX A;  1FIL A;  5DTT A;  1FIK A;  4E3K A;  3H82 A;  3QP5 A;  3RXW A;  5GLC A;  3HL9 A;  2L0W A;  2HZ5 A;  5FAT A;  2W27 A;  3A3I A;  5MC7 A;  3D4F A;  4JBF A;  4K0W A;  3SS5 A;  5EPH A;  3M2J A;  5HL1 A;  3OBF A;  3Q82 A;  1YKD A;  3IWI A;  1TEM A;  4EUZ A;  2XRO A;  4BBU A;  4X25 A;  4S2J A;  1BUE A;  3NBL A;  1MWS A;  3KO6 A;  1NXY A;  3Q07 A;  3UB9 A;  3D9Y A;  5E2G A;  3IQA A;  5KIZ A;  2O99 A;  3BQ8 A;  4WF0 A;  4JLF A;  3KSH A;  4GW9 A;  1HVB A;  2OWJ A;  2PYR A;  3B33 A;  5GLD A;  2VGL M;  4OQH A;  4Z9Q A;  3A0S A;  3LIE A;  3EEA A;  3ZVT A;  2HP9 A;  2W3F A;  1D06 A;  1MPL A;  1NZU A;  1K54 C;  1DRM A;  1YLP A;  1H8Z A;  1VET B;  4BWI A;  1BUL A;  4PM5 A;  4GDB A;  5GHZ A;  1K54 A;  4MBF A;  3NDE A;  2EA9 A;  2VGL S;  5HAP A;  4HIA A;  5FQI A;  1EW0 A;  3ZVW A;  1GCE A;  4BBV A;  2WYX A;  1CF0 A;  1F5M A;  3UMD A;  2ZMA A;  2JKR I;  3IH8 A;  2VV8 A;  4DMZ A;  3E2K A;  4CQH A;  3FZC A;  4IVI A;  2A3U A;  4R23 A;  2PT7 A;  4NK3 A;  3VP1 A;  3NOU C;  2XD5 A;  3C7V A;  4LCL A;  3LR3 A;  4R6L A;  5CED A;  2VGJ A;  3IHA A;  3LR5 A;  2R9X A;  1VEU A;  3LR4 A;  4NKP A;  2HGV A;  3VSK A;  2W1R A;  3VP2 A;  4OPR A;  3ZNT A;  2DRW A;  4GCZ A;  2P7J A;  5L8M A;  2ZL1 B;  1YM1 A;  4QY6 A;  3WS0 A;  4NXF A;  1NYY A;  4XT2 B;  4HH2 A;  2Y91 A;  3LI9 A;  4HBT A;  3W4O A;  4WMC A;  1W63 Q;  4LV1 A;  5FQM A;  4LLO B;  4LV0 A;  1SKF A;  4ZBE A;  5DF9 A;  3F1O B;  3ZFZ A;  4XUZ A;  1ALQ A;  4BD1 A;  2PYP A;  3Q7Z A;  4K0X A;  1KE4 A;  4S2K A;  3IF5 A;  1S4R A;  4HHD A;  2B5R A;  3CPT A;  4GS9 A;  1L0E A;  5EVI C;  1K4F A;  1NYM A;  3IXB A;  4KQO A;  3U2A A;  3SH9 A;  4I39 A;  3V3R A;  3E0Y A;  3OPL A;  2CMN A;  3IF6 C;  1LLB A;  4ETX A;  1I2W A;  5CRF A;  3HLG A;  4CLC B;  4Q0J A;  5TR7 A;  1OTB A;  2JKT M;  1K25 A;  4JXV A;  1K57 A;  2BG1 A;  4BD0 A;  1PI5 A;  4KZ4 A;  2QZ6 A;  3T1Q B;  4MN5 A;  4N1X A;  5KMW A;  4JKT A;  3NCK A;  3HJK A;  4DE3 A;  4X55 A;  3C5A A;  2WKH A;  1IEL A;  4RVA A;  1Y4O A;  4EV4 A;  1X0O A;  3LYX A;  1BLS A;  1M40 A;  3BYD A;  1XJ4 A;  4DRT A;  4EER A;  4R3J A;  1MKI A;  2Y2O A;  5DJT A;  3S4X A;  2JKF A;  2J8Y A;  2XD1 A;  5CXW A;  3UB8 A;  4E3I A;  3A3E A;  3P7N A;  1HTZ A;  4Z1W A;  3IHB A;  4QB8 A;  3MXQ A;  4MDZ A;  4EQ1 A;  1T19 A;  2Y2J A;  1OJ5 A;  4ARZ A;  2HP5 A;  1PW1 A;  1XGI A;  1MY8 A;  5HL6 A;  4P0M A;  3PBQ A;  5HWW A;  2ZQ7 A;  4KZ7 A;  2VGK A;  1JTD A;  4KZ9 A;  5EVI B;  4WLA A;  4ZJ1 A;  4JGQ A;  5BOH A;  1ONH A;  1WA9 A;  3V39 A;  2ZBB A;  1MXO A;  3CJM A;  3GTC A;  5I5L A;  1SHV A;  5DF7 A;  3EEH A;  3A3D A;  4CJN A;  3WRZ A;  5GLB A;  3NJA A;  3N6I A;  3FWL A;  4X1L A;  4B93 A;  3BQA A;  3ZNY A;  2IWB A;  1Q2P A;  1ODV A;  1N4O A;  2Y2H A;  4EEU A;  4WEJ A;  2FH5 A;  4S2O A;  1JWZ A;  2XQZ A;  3QP6 A;  3R7W B;  4IED A;  4HH3 A;  4X6T A;  1O07 A;  1ES2 A;  5HWV A;  2ZMV A;  3UPP A;  3A0V A;  2IWD A;  2Y79 A;  2ZC5 B;  1FR1 A;  1F2K A;  1MZU A;  2G2W A;  4IBR A;  1KE3 A;  3HLC A;  1CEF A;  1CK3 A;  1NLZ A;  2H0T A;  4PKY A;  4JGP A;  3O86 A;  1XFQ A;  2X71 A;  4DE2 A;  4JXS A;  2Y2Q A;  3ZYT A;  4ESP A;  3S7O A;  3CG5 A;  1H5X A;  4R4R A;  3MKE A;  3L7H A;  1A0K A;  4ZAM A;  3VE3 A;  2ZC3 B;  1EWZ A;  3GQZ A;  2OSU A;  3MFX A;  4KG5 A;  3H7W A;  4NXE A;  5DKK A;  2H10 A;  5CTM A;  3WS4 A;  2BAS A;  1XFN A;  4RYE A;  4UA9 A;  5CEC A;  5EVL A;  1S66 L;  1E3U D;  2GZA A;  1GA0 A;  2VJW A;  5AQA A;  3WS1 A;  4K91 A;  1YMX A;  3KYQ A;  4WYY A;  4D2O A;  2QHK A;  4MN6 A;  1W8Q A;  1YLY A;  3MF0 A;  2HDR A;  1PRQ A;  3BRM A;  2JN7 A;  3TG9 A;  4GB7 A;  5J3W A;  2ZC4 B;  3CLO A;  4O8G A;  3UDX A;  4MEZ A;  3CPT B;  3E98 A;  3E4O A;  4M4X A;  4DXB A;  3SH8 A;  1FSW A;  3AGE A;  3LEQ A;  4GLQ A;  3E4Q A;  4KG2 A;  2CC1 A;  4KEN B;  1ES5 A;  5F68 A;  4NEE D;  1MWT A;  1YT4 A;  2VEA A;  3NC8 A;  1XXM A;  3DBA A;  3TW8 A;  3VMA A;  3W2Z A;  2PBD P;  1K6S A;  5EVI D;  3B42 A;  5DKL A;  3BFF A;  2EXA A;  3MZD A;  1IYQ A;  3UE6 A;  1NY0 A;  1PZO A;  2A24 B;  2HPB A;  5DVA A;  3BM6 A;  3GV9 A;  4LRZ E;  2Y2I A;  3IXH A;  4JF6 A;  1BLP A;  4E6W A;  4CLC D;  4EEP A;  5TJJ A;  4X53 A;  4DJ3 A;  1AWI A;  1N9L A;  3BEB A;  4RQ9 A;  3UPO A;  5G4Y A;  4BL3 A;  3IX8 A;  1FCM A;  4P6B A;  3IBJ A;  5F69 A;  1T18 A;  4ZDX A;  1K56 D;  1F98 A;  1KDS A;  1XA1 A;  2ZLY A;  3P98 A;  1HD8 A;  1LL5 A;  2J3T C;  5HDD A;  2XK1 A;  3G35 A;  1KOU A;  4CPK A;  5AQ7 A;  3T1X A;  5FQJ A;  3ZQ5 A;  4R70 A;  4F94 A;  3B3X A;  4KQR A;  1JWP A;  4S2I A;  4O7D A;  3DWZ A;  5EOO A;  1YSQ A;  2ZMF A;  4G3V A;  3GR2 A;  4WZ5 C;  4E3M A;  4UAA A;  4FOF A;  1TDG A;  1IOU A;  3VFH A;  3SS4 A;  4CLC A;  3IWQ A;  5KSC A;  2HDU A;  3W4Q A;  4C75 A;  2W3G A;  1ESU A;  4O01 A;  4O0P A;  1ERO A;  4L9E A;  3G4P A;  3OCL A;  5L10 A;  4Y13 A;  3UO9 A;  1OTA A;  3SZT A;  4KUK A;  2ZD8 A;  4WEK A;  1MC0 A;  2PBY A;  4HBU A;  4WMC D;  1KGF A;  3N8R A;  1ZG6 A;  2WK0 A;  4R0Q A;  4F3L B;  1FSY A;  2GX5 A;  4M3K A;  2WKE A;  1ES4 A;  1BT5 A;  5HD3 A;  3LGO A;  4FH4 A;  4LCM A;  2M7U A;  4LGW A;  4N92 A;  2BTF P;  4KZ5 A;  5FSR A;  4EBP A;  1W8Y A;  3VOL A;  4LRY C;  4II7 A;  4U0T A;  1RCJ A;  1YQS A;  1DP8 A;  2VLG A;  2PDR A;  2ZC6 B;  4BBT A;  4FD8 A;  3QP8 A;  4GHI A;  5A90 A;  1W63 M;  4EET B;  2Y2N A;  1SKO B;  1TS0 A;  3BFD A;  5HAR A;  1GHM A;  5HFO A;  2XEP A;  3T4S A;  2Z6C A;  3ZCZ A;  1LSW A;  5TBM B;  5EE8 A;  3IWO A;  4LFU A;  5CX7 A;  3SH7 A;  1E3U A;  4KZB A;  1K55 A;  5FQK A;  3HLW A;  1S6R A;  3CI6 A;  2ZOI A;  1YAX A;  2EX2 A;  2V1B A;  3I7J A;  2V1Z A;  4JXG A;  3IH9 A;  4N9L A;  4UEY A;  2J3W A;  2DNS A;  2JCH A;  4S2N C;  2D01 A;  3VP0 A;  2YKH A;  3NIA A;  3IF6 A;  1LL8 A;  4FCF A;  3HUM A;  1KGG A;  1BZA A;  3C38 A;  3IXG A;  4IVK A;  3DW0 A;  3W8K A;  5AQB A;  1BYW A;  2XA7 M;  4MMN A;  5A93 A;  4UQI M;  5CTN A;  2W3E A;  4OLD A;  2WAF A;  4B4X A;  3UB7 A;  1DJC A;  5AVF A;  1STZ A;  1TS7 A;  4WEL A;  3FKW A;  1BLC A;  5AQ9 A;  1UWN X;  5JYO A;  2ZQ9 A;  4ID4 A;  3KSF A;  4ZTK A;  3ITB A;  3F1P A;  2LB9 A;  4GKU A;  2RCX A;  2Z2M B;  5HW3 A;  4PMA A;  2K7S A;  3MQO A;  4R3A A;  3PYP A;  3EQU A;  2FFY A;  3K3D A;  3QP4 A;  4OLG A;  5DFX A;  4GDN A;  4JF4 A;  4HP4 A;  5FDS A;  3UDF A;  1I2S A;  3Q7V A;  3LY3 A;  2ZM0 A;  1Z6F A;  1Q2Q A;  1LI0 A;  2ZQC A;  4HES A;  4EBL A;  4I38 A;  4R1G A;  5GLA A;  2H5S A;  3PBT A;  5HSQ A;  2Y2M A;  4OQ0 A;  1NJ4 A;  3A3J A;  1G6O A;  2OLU A;  1MWU A;  2K2N A;  2JKG A;  2ZJ9 A;  1DY6 A;  2Z2L B;  3MKF A;  3OLO A;  5HAQ A;  2XFS A;  2PR5 A;  4OP8 A;  3VP3 A;  1RGZ A;  1N9O A;  3OC2 A;  4XXR A;  4PKY G;  3BY9 A;  4Y15 A;  2Q9M A;  3C8C A;  4HOI A;  4OQI A;  4OOM A;  1N9N A;  5DTK A;  2QPN A;  3LIA A;  3IT9 A;  3LIC A;  5J7E A;  2C6W B;  4N9K A;  3WS5 A;  2PD8 A;  2WGW A;  1P97 A;  3UB5 P;  1U60 A;  5DFY A;  1GSX A;  3F1P B;  4OKP A;  2XSS A;  4GN2 A;  2J80 A;  3RH8 B;  1ACF A;  2VA0 A;  3FPW A;  2EX6 A;  1D1J A;  2YKF A;  3ISG A;  1CJF A;  5TGF A;  2QMI A;  1S1Y A;  4MCW A;  4NG2 A;  5FI6 A;  4X68 A;  5A92 A;  3F1O A;  3KSG A;  3C2W A;  3FV7 A;  4KZ6 A;  3KYZ A;  2B95 A;  3G32 A;  3BEC A;  1MWR A;  2V0U A;  3ZG5 A;  2HDQ A;  3MZF A;  4QU3 A;  5L07 A;  5FEG A;  3VOZ A;  1TDL A;  4IBX A;  3LY4 A;  2EFX A;  4WZ5 A;  4GNU A;  2LB5 A;  3TOI A;  3DTM A;  3NOP C;  1V9Z A;  2NUP C;  1OT6 A;  2DCF A;  1L3L A;  1LL9 A;  5CEB A;  2D02 A;  1Y28 A;  2J3T D;  5EFW A;  5D3O A;  3JYI A;  3D72 A;  5I94 A;  3BW6 A;  1PFL A;  1ESI A;  1NLY A;  3M6H A;  5A8B A;  3T4L A;  3N8L A;  3NDG A;  1ZHH B;  4QD4 A;  2PR6 A;  1G5U A;  3NOT C;  2I72 A;  2ZC7 A;  2ZQD A;  1OME A;  5EOE A;  2I9V A;  4YFM A;  2GNX A;  3P01 A;  3NUL A;  1ERQ A;  3A0R A;  3UE1 A;  3QP1 A;  3EGX C;  3Q7V B;  4I3A A;  1Z09 A;  2Y2P A;  3O87 A;  2PU2 A;  1H8Y A;  4MBH A;  3IX4 A;  4PAU A;  4E6X A;  1YMS A;  5FI2 A;  2WGW B;  3PTE A;  2OV5 A;  4D60 A;  2WKP A;  3K2N A;  2XGN A;  2J9O A;  4E3O A;  3V5M A;  3T4K A;  3LIF A;  1DP9 A;  2JKT I;  3CZD A;  3Q1F A;  3LFV A;  1OTI A;  3PR6 A;  3VE4 A;  3LCE A;  5KSH A;  5CHU A;  1KGE A;  2G7U A;  3ZGA B;  4HI4 A;  4QY5 A;  3UB6 A;  4UQI S;  2ZQA A;  2HJ9 C;  1PWC A;  2RL3 A;  1LSX A;  2VKS A;  1YLJ A;  4LRX C;  2Y59 A;  5CHJ A;  3T50 A;  3T4O A;  1TF1 A;  5J8X A;  1IYO A;  4YNR A;  4FSF A;  3ZG9 B;  1DP6 A;  1BTL A;  2M7V A;  1RGY A;  3N7W A;  1LI9 A;  5TBM A;  2JHE A;  4GOG A;  1E25 A;  5F6A A;  3S7N A;  3M2K A;  4OP5 A;  3VV4 A;  4L9G A;  4RA7 A;  2O9C A;  3LIB A;  3HLD A;  1V9Y A;  3NHQ A;  1JNU A;  3FYZ A;  3O3V A;  1LSV A;  3V50 A;  4PM9 A;  2FFF B;  2P9V A;  2Y8H A;  2P04 A;  5IS1 A;  2WAD A;  3VFF A;  4HQA A;  5E2F A;  3D3O A;  5HDS A;  1FCO A;  3BFC A;  2Y2K A;  4PM8 A;  1XKZ A;  3EOI A;  4FH2 A;  3ICY A;  1PI4 A;  3SS3 A;  4Y2F A;  3PAG A;  2P74 A;  3OPP A;  2K31 A;  3BFE A;  1L0D A;  2EWV A;  4HP9 A;  4LV2 A;  4EWF A;  5IU1 A;  3QP2 A;  5HD5 A;  4E3J A;  5FI7 A;  1HZO A;  4H6J B;  2P08 A;  3BY8 A;  1NWZ A;  3CAX A;  2O9A A;  4IJG A;  5K5B A;  1UWP X;  3HJI A;  2HJE A;  1G6A A;  5EVI A;  2MJ6 A;  2A24 A;  3TE8 A;  3HCY A;  4ARZ B;  4BL2 A;  1H8M A;  3OCN A;  1XGJ A;  2H28 A;  3OPH A;  4Y5F A;  3NY4 A;  4UA7 A;  1IFQ A;  4DE0 A;  4R3B A;  4G3K A;  2Y55 A;  5EEC A;  2KLI A;  1G28 A;  2QJ5 A;  4S2P A;  5EM0 A;  5L2F A;  2GJ3 A;  3HUO A;  2O0Y A;  4H8R A;  1I5Q A;  1K57 C;  5M19 A;  2OWH A;  3G2Y A;  5FEF A;  5G18 A;  2OLV A;  1E4D A;  1TS6 A;  5CGW A;  4RX3 A;  4E3N A;  4LEN A;  1OPX A;  2PRF A;  5AVE A;  3ULF A;  1XA7 A;  2V1A A;  3PHY A;  5DJU A;  1WE4 A;  5EV0 A;  4DXC A;  2XF3 A;  4PM6 A;  3IS2 A;  5FAO A;  1N9B A;  4EW7 A;  2E8J A;  2ZOH A;  3CWF A;  1H0M A;  4DJ2 A;  2VK3 A;  4E04 A;  3QNB A;  1GHI A;  2X02 A;  3HLF A;  5FAQ A;  3JVU A;  4HEF A;  3BFG A;  3LEZ A;  4OPZ A;  3KX0 X;  2ACG A;  2Q9N A;  2O9B A;  1J3W A; 
#chains in the Genus database with same CATH homology
 3P7N A;  3IBR A;  4Z1W A;  3GDI A;  3UB7 A;  1S1Z A;  3MXQ A;  4MDZ A;  4EQ1 A;  3O5Y A;  2QYB A;  5AVF A;  1T19 A;  3BWL A;  1OJ5 A;  1STZ A;  4ARZ A;  2INW A;  3C30 A;  1TS7 A;  4WEL A;  3K3C A;  4PHT A;  3MJQ A;  1OT9 A;  5HL6 A;  1UWN X;  3PBQ A;  5HWW A;  4HJ3 A;  4XT2 A;  1OTD A;  3KSF A;  4Q0H A;  1GSW A;  3F1P A;  3RFB A;  2LB9 A;  4NXG A;  1T1B A;  4YOF A;  4IHQ A;  4WLA A;  4JGQ A;  1S67 L;  1WA9 A;  4QPR A;  2K7S A;  2ZBB A;  3MQO A;  3LR0 A;  2XRN A;  4R3A A;  4ETZ A;  4HY8 A;  1P9R A;  5C5K A;  3PYP A;  3RTY A;  3EQU A;  3K3D A;  5DFX A;  5I5L A;  3MQQ A;  4HP4 A;  4KQD A;  2NUT C;  4IUH A;  3EEH A;  1GSV A;  3LUQ A;  2M1C A;  4F3L A;  3UE3 A;  2QWS A;  4EU0 A;  2QJ7 A;  5AJG A;  4CLC E;  4I38 A;  3NJA A;  4EXO A;  1ZTU A;  4B93 A;  3KSI A;  3PBT A;  5HSQ A;  5HZH A;  3V67 A;  2Z6D A;  3BQA A;  3PBO A;  1ODV A;  1G6O A;  1LT0 A;  3H7W B;  4EEU A;  4WEJ A;  2K2N A;  2FH5 A;  5FL3 A;  2WKQ A;  3OLO A;  5J4E A;  2PR5 A;  2OAP 1;  1N9O A;  3OC2 A;  3F1N B;  4PKY G;  3R7W B;  3BY9 A;  2JKR M;  4HH3 A;  3C8C A;  4HOI A;  2QKP A;  4OOM A;  1N9N A;  5HWV A;  2ZMV A;  4EUV A;  3LIA A;  3PBR A;  3A0V A;  3LIC A;  5J7E A;  2Y79 A;  3TRC A;  5HWT A;  4GJ4 A;  1MZU A;  2PD8 A;  2KX6 A;  2XA7 S;  1P97 A;  2IA2 A;  5DFY A;  1NLZ A;  1GSX A;  2W3H A;  4PKY A;  4I3J A;  3F1P B;  2XSS A;  5IT5 A;  2J80 A;  4JGP A;  4LPZ A;  3SW1 A;  1XFQ A;  3RH8 B;  2VA0 A;  3FPW A;  4MN7 A;  2KDK A;  3ZYT A;  3S7O A;  4L0L A;  2YKF A;  4B9O A;  3VE3 A;  1NRJ A;  1S1Y A;  4MCW A;  1H3Q A;  4R38 A;  3MFX A;  2WKR A;  5G4Z A;  3H7W A;  2DMW A;  3F1O A;  4NXB A;  1S4S A;  3KSG A;  3TJZ C;  4CLC C;  3H9W A;  3C2W A;  3KYZ A;  4NXE A;  5DKK A;  1UGU A;  2BAS A;  1XFN A;  1TD5 A;  3FG8 A;  3F1N A;  1OTE A;  5HDC A;  2L4R A;  4YWZ A;  4DN0 A;  2W3D A;  2GZA A;  1OJG A;  2V0U A;  2V9A A;  2VJW A;  4K08 A;  3G6O A;  4WN5 A;  3KYQ A;  1MKM A;  2QHK A;  4MN6 A;  2W1T A;  3MF0 A;  1T1A A;  2OOL A;  2LB5 A;  3T4Q A;  5HPF A;  2JN7 A;  3NOP C;  1V9Z A;  5J3W A;  3CLO A;  1OT6 A;  3H82 A;  4O8G A;  2NUP C;  2VX8 A;  1VHM A;  4BMW A;  2D02 A;  1Y28 A;  2L0W A;  2J3T D;  5EFW A;  2VV6 A;  2W27 A;  3E98 A;  3D72 A;  3E4O A;  4M4X A;  5MC7 A;  3BW6 A;  2FZ0 A;  3GEC A;  3S7Q A;  4GLQ A;  3OBF A;  1NLY A;  5A8B A;  2B02 A;  1YKD A;  3E4Q A;  4Q0I A;  3T4L A;  5HPI A;  2XRO A;  4BBU A;  5F68 A;  4NEE D;  2A2L A;  1ZHH B;  2VEA A;  3KO6 A;  3UB9 A;  2PR6 A;  3DBA A;  3TW8 A;  3NOT C;  3W2Z A;  5KIZ A;  2I9V A;  2O99 A;  3BQ8 A;  4WF0 A;  3B42 A;  2GNX A;  3P01 A;  5DKL A;  4L9F A;  3A0R A;  3KSH A;  2VV7 A;  4GW9 A;  4GS9 B;  3EGX C;  3UE6 A;  4KUO A;  2A24 B;  4I3A A;  3MR0 A;  3UME A;  2OWJ A;  2PYR A;  3B33 A;  2VGL M;  3A0S A;  4P6Z M;  4LRZ E;  3LIE A;  4ZRR A;  3EEA A;  3PBS A;  2B18 A;  4PAU A;  4WUJ A;  4CLC D;  4EEP A;  2W3F A;  5TJJ A;  4DJ3 A;  1D06 A;  1N9L A;  4RQ9 A;  5G4Y A;  3R4K A;  2KOI A;  2WKP A;  3IBJ A;  5F69 A;  1DRM A;  1T18 A;  3K2N A;  3B47 A;  4BWI A;  3T4K A;  3LIF A;  1F98 A;  1DP9 A;  2JKT I;  2R78 A;  3LFV A;  2EA9 A;  2VGL S;  4OOL A;  1OTI A;  3PR6 A;  3VE4 A;  4HIA A;  1EW0 A;  5HDD A;  2J3T C;  5KSH A;  4H6J A;  1KOU A;  3UMD A;  4BBV A;  1F5M A;  2G7U A;  4HI4 A;  3OOV A;  4AFI A;  3UB6 A;  3BJN A;  1D7E A;  2JKR I;  4I5S A;  3ZQ5 A;  4R70 A;  4UQI S;  2HJ9 C;  2L1M A;  2VKS A;  2VV8 A;  1LSX A;  4DMZ A;  4Y3I A;  4CQH A;  4LRX C;  1P9W A;  3T50 A;  3IS2 B;  3T4O A;  1TF1 A;  4YNR A;  4FSF A;  1DP6 A;  1TS8 A;  2M7V A;  3PBN A;  1YSQ A;  2PT7 A;  2ZMF A;  4G3V A;  5TBM A;  2JHE A;  3NOU C;  4I3I A;  3MMH A;  2PD7 A;  3LR3 A;  5F6A A;  3S7N A;  4R6L A;  4FOF A;  3VV4 A;  4L9G A;  4GHI B;  3LR5 A;  1IOU A;  3LIB A;  2O9C A;  3S7P A;  1V9Y A;  3LR4 A;  4CLC A;  3NHQ A;  4NKP A;  1JNU A;  2HGV A;  1XJ3 A;  2W1R A;  1LSV A;  2W3G A;  4WL9 A;  1YSP A;  2Y8H A;  4O01 A;  2P04 A;  4GCZ A;  4O0P A;  5IS1 A;  2P7J A;  5L8M A;  1VB6 A;  4L9E A;  4HQA A;  3PXP A;  3OCL A;  3D3O A;  5HDS A;  1OTA A;  4NXF A;  4XT2 B;  3FPV A;  1T1C A;  3EOI A;  4KUK A;  4HH2 A;  4WEK A;  3LI9 A;  3ICY A;  1MC0 A;  2HV1 A;  4Y2F A;  3E4P A;  1W63 Q;  4LLO B;  2K31 A;  3MQ0 A;  2EWV A;  5DF9 A;  4HP9 A;  3F1O B;  3T4J A;  5IU1 A;  4F3L B;  3EGD C;  2GX5 A;  5HD5 A;  3JVV A;  2PYP A;  4H6J B;  2P08 A;  5HD3 A;  3BY8 A;  1NWZ A;  3CAX A;  2O9A A;  3CIT A;  4IJG A;  4ME4 A;  1UWP X;  3HJI A;  5K5B A;  2HJE A;  1S4R A;  4HHD A;  2M7U A;  3R7W A;  2MJ6 A;  2A24 A;  3TE8 A;  4GS9 A;  3HCY A;  4ARZ B;  2W0N A;  4JGR A;  4KQO A;  1H8M A;  3OCN A;  2H28 A;  3U2A A;  3VOL A;  4Y5F A;  4LRY C;  1IFQ A;  4HJ4 A;  4II7 A;  4HJ6 A;  3CUE C;  1DP8 A;  4I39 A;  2VLG A;  4G3K A;  3E0Y A;  3EQV A;  2KLI A;  1G28 A;  2PDR A;  2QJ5 A;  1XJ6 A;  2CMN A;  4BBT A;  3FC7 A;  3CUE A;  4GHI A;  2OAQ 1;  4ETX A;  3T4T A;  1W63 M;  2GJ3 A;  4EET B;  4IUK A;  1TS0 A;  2O0Y A;  2HF6 A;  4HNB A;  3T4S A;  4CLC B;  2Z6C A;  4Q0J A;  1LSW A;  2OWH A;  5TBM B;  1F9I A;  1OTB A;  2JKT M;  1P0Z A;  5CX7 A;  3LI8 A;  1TS6 A;  2V0W A;  3H82 B;  1OPX A;  4MN5 A;  3CI6 A;  2ZOI A;  4BJP A;  2PHY A;  5AVE A;  3ULF A;  2V1A A;  2EWW A;  1YAX A;  5LBR A;  3PHY A;  5DJU A;  2V1B A;  3LID A;  5F5Y A;  3HJK A;  2W1T B;  3IS2 A;  4UEY A;  2J3W A;  4EW7 A;  2ZOH A;  3CWF A;  1XJ2 A;  2D01 A;  2VZW A;  4DJ2 A;  4P6Z S;  4G3W A;  4E04 A;  2YKH A;  4JGO A;  1X0O A;  3LYX A;  3EWK A;  1XJ4 A;  1LL8 A;  3JVU A;  4EER A;  3C38 A;  1BYW A;  2XA7 M;  4MMN A;  3KX0 X;  5DJT A;  4UQI M;  3UB8 A;  2O9B A;  2W3E A;  1S66 L;  4EES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...