4XT2A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GEFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 116
sequence length 116
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2A00
3RTYA 4EQ1A 3PYPA 4HOIA 5HDDA 2QWSA 2ZBBA 4I3JA 3NOTC 3FC7A 5F68A 3UMDA 2V9AA 3IBRA 1EW0A 4GHIB 2QJ5A 3CWFA 2V1BA 1V9ZA 3F1PA 4WN5A 1UWNX 2PR6A 3H82B 1OTEA 1MZUA 2I9VA 2A24A 2D02A 3A0SA 4PKYA 1XFNA 4B9OA 1BYWA 2VV7A 5AVFA 3UB9A 3LIDA 2CMNA 3F1OB 3H7WA 4WF0A 3T50A 3SW1A 1TS6A 5TBMB 1Y28A 4HP9A 1LSWA 3F1NB 1OT6A 4L9GA 3B33A 1JNUA 4PKYG 3A0RA 3C8CA 3UMEA 3VOLA 3ZQ5A 2VLGA 3D72A 4GCZA 1XJ2A 2GJ3A 1OJGA 2B02A 4DJ2A 5I5LA 4F3LB 2JHEA 4BBVA 3IS2B 3MJQA 3VE3A 4LLOB 2KDKA 2PD8A 1LSVA 3EWKA 4HI4A 1GSWA 3HJKA 2VV6A 4HH2A 4EERA 1G28A 5HDCA 4R3AA 1F98A 2OWHA 4JGPA 3LICA 3A0VA 1T1CA 5IU1A 4H6JB 3C2WA 3MXQA 1XJ4A 3ULFA 4GHIA 4I38A 1T1BA 1OTIA 2OWJA 1T19A 2VV8A 5A8BA 3H9WA 4GW9A 1S1ZA 5HZHA 5DJTA 2PYPA 2EA9A 3NHQA 4GS9B 1OT9A 5DKKA 1S1YA 1DP8A 1DRMA 2BASA 4R6LA 5HD5A 1GSVA 4JGRA 5AVEA 5J7EA 5HDSA 3F1OA 5F6AA 3OLOA 5HWTA 1T1AA 2PDRA 3PHYA 3E4QA 1NWZA 3K3CA 4LPZA 3UB8A 1TS7A 3F1NA 2K7SA 3EEHA 3GDIA 4KQDA 4XT2B 4HJ3A 4HNBA 4JGOA 4NXBA 2D01A 1DP9A 2INWA 5HSQA 4NXGA 5J4EA 3LI9A 1S4SA 3MQQA 2PR5A 1T18A 4R38A 1P0ZA 2QKPA 4MN5A 3IS2A 1XFQA 4YWZA 5J3WA 3BY8A 3LI8A 2YKFA 4EEPA 3LUQA 2KX6A 2V1AA 2L1MA 1V9YA 5KIZA 3LIFA 4K08A 1KOUA 1S66L 1UWPX 5DJUA 3CAXA 5HWWA 5EFWA 5F69A 4H6JA 1S67L 3BWLA 1LT0A 4EESA 2YKHA 4EW7A 4R70A 4HH3A 3LYXA 4HJ6A 5HD3A 4HHDA 3UE6A 2L4RA 4NXFA 4EETB 1WA9A 2OOLA 5F5YA 2HV1A 4GS9A 1ODVA 3H82A 3HJIA 2PD7A 1OTDA 2V0WA 2JN7A 3MQOA 1LSXA 4WLAA 3UB6A 1TS8A 2VEAA 4EXOA 4JGQA 4LRXC 2PHYA 4RQ9A 2L0WA 3K3DA 3FG8A 4LRYC 1OTBA 1D7EA 1LL8A 4L9EA 4XT2A 4HIAA 2Z6DA 5TBMA 1OTAA 2H28A 4L9FA 3GECA 4EEUA 3UB7A 1TS0A 3VE4A 3F1PB 5HWVA 4MN6A 3RH8B 3P7NA 4BBUA 4I3AA 2WKPA 2ZOHA 2W0NA 4HJ4A 3LIBA 2ZOIA 2A24B 2J80A 1S4RA 1P97A 2V0UA 3MFXA 3NOUC 3LIAA 2WKRA 2PYRA 1XJ3A 1VB6A 2R78A 4F3LA 1UGUA 4LRZE 1X0OA 1OJ5A 3NOPC 3CLOA 3ICYA 1N9NA 3H7WB 4WL9A 1N9LA 3E4PA 3G6OA 4WUJA 2M1CA 2QHKA 1N9OA 3E4OA 3LIEA 3BY9A 4HY8A 2QJ7A 4BBTA 2W27A 1F9IA 5G4ZA 4HQAA 4I39A 4NXEA 2WKQA 3KX0X 4HP4A 4KUOA 3NJAA 1XJ6A 4I3IA 4DJ3A 3MR0A 4E04A 4KUKA 5IS1A 4M4XA 5DKLA 1GSXA 2P7JA 2Z6CA 1D06A 1DP6A 4I5SA 5G4YA
chains in the Genus database with same CATH superfamily
4NKPA 3RTYA 4EQ1A 3Q07A 4N92A 4BD0A 1ZTUA 5FQIA 3CPTA 5HL6A 2C6WB 3UMDA 4QHCA 3VP0A 4OQ0A 4AFIA 1EW0A 4ZDXA 2QJ5A 1NZUA 2V1BA 4EV4A 1V9ZA 3QP6A 2JKFA 3MSHA 1P9RA 2KOIA 1H5XA 3FYZA 2RL3A 2XFTA 1I2WA 5A93A 1ZG6A 4G3VA 5AJGA 2GNXA 3S1YA 2Y4AA 1K0KA 3CZDA 1MY8A 3LIDA 3F1OB 3H7WA 2EX6A 3NC8A 3SW1A 5I94A 1G6OA 2Q0OA 5TBMB 1Y28A 5FSRA 4HP9A 2XH9A 5JYPA 1DY6A 1KE3A 2EXBA 4L9GA 3IT9A 1PNEA 5CTNA 3BFCA 5HAIA 1JNUA 4PKYG 3OC2A 3ZQ5A 3SH8A 3PBRA 3WRTA 4ZJ3A 2H0YA 1RP5A 5EV0A 1PWGA 3HLDA 4R3JA 5A91A 2JE5A 4KZ5A 2XLNA 2DMWA 1ERMA 1FCNA 5TGFA 3R7WB 3TRCA 3IXGA 3MJQA 4WBGA 4D2OA 3VP4A 5KSCA 3EWKA 4HI4A 4N1XA 3KSHA 3T1XA 2VV6A 1BULA 2ZC6B 4Y2FA 5EVEA 4N1HA 4BLMA 5HDCA 1MKMA 1GHMA 3A3EA 1F98A 4CLCC 3SS3A 3N8RA 4QD4A 4H8RA 5IU1A 3O86A 3ZYTA 1KE0A 2Q9MA 4BL2A 1QMEA 4R3BA 3DTMA 1IEMA 3G30A 4E3KA 1Y4OA 3TW8A 1BSGA 2ZQ9A 1ES2A 4JXGA 2Y2NA 4X25A 1BLPA 2NUPC 5FDHA 3G4PA 4G3KA 1S1ZA 5DJTA 4K0WA 3IF6A 4HEFA 5CTMA 4FTXA 1MWTA 2V2FF 4O7DA 1FR6A 4JF6A 3BEBA 1GSVA 5AVEA 3IWQA 1JWPA 3C7VA 3T1RA 4JKTA 2JC7A 5FDSA 2J3TD 1FSWA 3PHYA 4UHUA 1KVLA 4RYEA 3E4QA 1NWZA 3K3CA 2PBYA 3UB8A 3MBZA 1TS7A 2WGIA 3MS6A 2K7SA 5CHJA 1MC0A 4MN7A 5M18A 3N7WA 3LCEA 2VX8A 1L0FA 2EFXA 3EQVA 2RCXA 4HNBA 5FASA 4LV3A 5HW3A 5HSQA 4OPQA 2WZXA 3LI9A 2CC1A 3MXRA 1CQAA 4CLCD 1A0KA 5FQJA 2XSSA 1YQSA 4NK3A 3IX3A 3O87A 3IS2A 3BY8A 3LI8A 2ZQ7A 4ID4A 3LUQA 5CECA 3TJZC 1F5MA 4BD1A 1ES5A 4X1MA 1E3UD 4WZ4A 1RGZA 5U47A 2L1MA 3HUMA 4GDNA 4UQIS 3PBQA 3ZNYA 4R1GA 1KGFA 2O0YA 3C7UA 4X69A 5EFWA 4DF6A 1ESUA 4WEKA 2IWDA 3BWLA 1LT0A 4EW7A 2EWVA 2PAVP 5FA7A 1NJ4A 3HBRA 3K2NA 3LYXA 3IX4A 1Z6FA 1YM1A 4FUWA 4JF5A 2ZQ8A 4NXFA 4EETB 3PXPA 1YLYA 1VEUA 3O88A 3NIAA 4GJ4A 1PYYA 4WMCD 4ETXA 3H82A 3HJIA 4RVAA 1OTDA 3LR3A 3SOIA 4OPYA 4S2LA 4WLAA 3GMWA 3PTEA 3CG5A 4B4ZA 4EBPA 3G34A 3CI6A 3D9YA 1MKIA 1MWRA 5CGSA 2L0WA 1AWIA 3N8SA 3FG8A 4LRYC 4E3OA 1OTBA 4L9EA 2XD1A 3EQUA 3LGOA 5JYOA 1W63M 4KZ6A 4IHQA 4PM7A 1ACFA 4GNUA 3ZDJA 3VMAA 3OBFA 5HWVA 4MN6A 4HESA 2HP5A 4BBUA 2W0NA 3VOYA 5E2HA 2Y79A 4ARZA 5FI6A 2V0UA 3BLSA 3NOUC 1PIOA 2EX9A 3T4KA 1IYOA 3LIAA 1K25A 5FI7A 2VGLS 1VB6A 1MXOA 4F3LA 4IBRA 2DNSA 4BQMA 2XDMA 2JCHA 3ICYA 1PWDA 1G68A 2Y2MA 4PPRA 3G6OA 5HAPA 2PRFA 3LIEA 3NULA 3EGDC 2H10A 3LO7A 4HY8A 2V8FA 2QJ7A 4BBTA 3T4SA 4P6ZS 1SDEA 5E2EA 3BQAA 3OPRA 4HQAA 4NXEA 4A5RA 5FEFA 3NJAA 3U2AA 4F94A 3V3RA 3ITBA 4E3IA 4Q0HA 3MR0A 4E04A 3O3VA 3N6IA 3L7HA 1BTLA 5HL1A 1IKGA 3CMZA 2PU2A 5FL3A 3NBLA 4EUZA 4UQIM 2W1TA 3EGXC 1K57A 4FSFA 5HDDA 4DRTA 1NRJA 4RX2A 3KSGA 4I3JA 2K31A 3NOTC 3FC7A 1EI5A 4MEZA 4S2JA 3ZCZA 4KZ4A 3IBRA 4GHIB 3CWFA 2Y2IA 4Y0UA 3ZFZA 3M2KA 3DTIA 3F1PA 2VZWA 5AQBA 2Y2KA 4WN5A 3WS4A 4HBUA 1OTEA 1MZUA 2JKTI 2I9VA 4OPRA 2ZQDA 2A24A 4CLCB 1J9MA 4GD6A 5E2GA 2D02A 4PKYA 2EFUA 3AGFA 1BYWA 2ZL1B 4WYYA 5AVFA 4S2MA 3B3XA 2CMNA 5EVLA 3T50A 3MF0A 3NDGA 3OOVA 1W5DA 1HLUP 4OOMA 3KYQA 4EU0A 3IH8A 5HAQA 4ZJ2A 4X1LA 3UY6A 1YMSA 2HGVA 3F1NB 1L3LA 1OT6A 3E2LA 3MFDA 3MZFA 2K2NA 4FCFA 3GTCA 1MWSA 1WE4A 2ACGA 1W8YA 3C8CA 2C5WB 4CJNA 3QP2A 5DFXA 1XJ2A 1TVFA 2JBFA 3MXSA 3LEZA 2HP6A 1K4EA 2ZMAA 3ZG0A 3BJNA 3CUEC 2JHEA 4BBVA 4IVIA 2QMIA 2KDKA 2VGLM 2PD8A 3T1QB 2BLSA 3LFVA 4WELA 4R4SA 4S2IA 1K56D 2OWHA 3G35A 3SH9A 3M6HA 1BLCA 2OV5A 1CF0A 1NZOA 4H6JB 5M1AA 5C5KA 4S2KA 1ERQA 1XJ4A 1PI5A 1TDGA 4JBFA 4P6ZM 1OTIA 3OPPA 2EWWA 3MQ0A 3VP3A 3P01A 4ZJ1A 4GW9A 3V5MA 2PYPA 1LHYA 3GSGA 3NHQA 4QB8A 4GS9B 2Z2MB 4MDZA 4YINA 3UO9A 1XA1A 5DKKA 4FD8A 3IWIA 2BASA 1MBLA 1J3WA 3HLBA 4IBXA 5J7EA 4OOYA 4WZ5A 5GLDA 3F1OA 5DVAA 5F6AA 3W4PA 1HTZA 3OLOA 4OLGA 3NY4A 4LPZA 3ZG8B 3VP2A 4R0QA 3EEHA 3OPLA 4KQDA 5KZHA 3JVUA 4XT2B 4HJ3A 3A3FA 1GA0A 4JGOA 2D01A 4LENA 3R4KA 2INWA 1IYSA 2WGWA 4NXGA 3T4OA 5J4EA 4NEED 5E2FA 2ZLYA 3E0YA 2J3TC 5CXWA 1T18A 4Y0TA 4GZBA 3VSKA 4BL3A 2B18A 5CHMA 3A3IA 1YPRA 4YWZA 2YKFA 2ZC5B 3V39A 3PR6A 2Y2JA 1VQQA 2ZJ9A 2WZZA 2M7VA 1K4FA 2X02A 1ZC2A 3FKWA 4JF4A 1CI8A 1KOUA 1S66L 1YLWA 1XGJA 3E2KA 2V8CA 5EVIC 4CQHA 5F69A 1S67L 1ONGA 1K57C 5EPHA 5F83A 4RX3A 4EESA 4KZBA 2XRNA 1XPBA 4OQIA 1NRFA 1LL5A 4Y0OA 4OPZA 4MLLA 1SDNA 1DJCA 2KLIA 5HD3A 1S6RA 2L4RA 4PMAA 2M7UA 4IUKA 1WA9A 3QNCA 4X56A 5F5YA 3KO6A 1ES3A 2HV1A 4R23A 3HUNA 1O07A 3BYDA 1PWCA 3BFEA 3HLWA 3OZHA 4MNRA 4LV2A 5CHUA 3IHBA 5FQKA 2V0WA 2JN7A 1LSXA 4R4RA 4PAUA 2G7UA 2VEAA 4YOFA 3TSGA 4EXOA 3T4TA 4KG5A 4KZ7A 2PU4A 2HDRA 3T4JA 3VV4A 4BMWA 4OP8A 4RA7A 3IQAA 5CRFA 4UAAA 1JWZA 5L09A 2ZMVA 2WYXA 1PZOA 1GA9A 4HBTA 3ITAA 1GHPA 3QP1A 1L0GA 4EEUA 5TJJA 4WM9A 3VE4A 2OLUA 3A3JA 3RH8B 2X71A 3NDEA 1XKZA 2P9VA 3EOIA 5CGXA 4IVKA 2WKPA 4JXVA 3VFFA 2JKRM 5DTSA 2J80A 2H5SA 1HD8A 4II7A 3MFXA 5EVID 1MPLA 2WKRA 1YSPA 1XP4A 5G18A 5FQMA 4LV0A 1K38A 1X0OA 1W63Q 3NOPC 5TFQA 4WL9A 1OMEA 3LR4A 1CJFA 2M1CA 5CGWA 1BLSA 1HVBA 2QHKA 1SZVA 5GHYA 4ZAMA 4OQGA 3W8KA 4C6YA 3DAVA 4EBNA 3KYZA 4DE0A 4QY6A 4Q0IA 3CJMA 4EQIA 1Y54A 1XJ6A 1H8YA 3MMHA 4UA9A 5EM1A 3FKVA 3P09A 3E98A 2W3GA 4GOGA 4DJ3A 5IS1A 4DXBA 4M4XA 4KENB 2ZMFA 3V3SA 5EOEA 1KDSA 4O0PA 1GSXA 1XGIA 4K0XA 2R9XA 4GB7A 3PBOA 2Z6CA 1JTDA 3VSLA 5G4YA 2A2LA 4ZRRA 3PYPA 4HOIA 2QWSA 1CEGA 1VHMA 5GLAA 3DBAA 1C3BA 5F68A 1U60A 2WAEA 5DTTA 2A49A 5A92A 4QPRA 2W3DA 1BT5A 3Q1FA 3VP1A 3G2YA 4MBHA 1YKDA 3H82B 3SH7A 3Q7ZA 3BW6A 1GHIA 4X55A 3FV7A 3RXWA 3TOIA 5BOHA 3S7PA 4O8GA 1FCOA 3GVBA 5DF7A 4FOFA 3SS4A 5AQ9A 3U4LP 2P74A 4DMZA 4JXWA 1XFNA 3Q81A 1Q2PA 4B9OA 2VV7A 3KSIA 3S4XA 1D1JA 3Q7VB 2HDQA 4EBLA 2G2WA 4QY5A 4WF0A 1G5UA 4BJPA 2BTFP 4GN2A 1F2KA 1LSWA 4KQRA 3HUOA 1NY0A 3JPUA 3I7JA 5DF8A 4D60A 5HPIA 3IBJA 4KG2A 4OP5A 5FQQA 4DE1A 4GDBA 1IKIA 2VLGA 3D72A 1PZPA 4GCZA 4IEDA 4G3WA 1K55A 1OJGA 1E25A 4DJ2A 5I5LA 4F3LB 5IHVA 4E6XA 5AQAA 2J9OA 2PT7A 4E3JA 2GX5A 2FH5A 1LSVA 3LR5A 4B88A 1GSWA 4X6TA 1H8ZA 3HJKA 3S7NA 3FPVA 4HH2A 4BENA 4EERA 5EE8A 3QNBA 2Y2PA 4U3TA 4Y3IA 1LI0A 1IOUA 3LEQA 2Y8HA 3IF6C 5E43A 5CEDA 3T12B 4P6BA 4CPKA 1T1CA 3D4FA 1CEFA 2JKGA 1YLPA 5FATA 2EX2A 1FILA 5GL9A 1IYQA 3C2WA 3ULFA 4GHIA 4I38A 2P08A 2UWXA 2VV8A 3BLMA 4WEJA 4S2OA 5A8BA 5L07A 2FFFB 5FQ9A 1K6RA 5HZHA 2QZ6A 2Y2OA 4CLCA 2EA9A 4IUHA 1OT9A 1IELA 4ZBEA 5EVIB 5FAPA 2WUQA 4ME4A 2QYBA 1STZA 4R6LA 1DP8A 1DRMA 2W1TB 5F1FA 4JGRA 5HARA 1E3UA 5EECA 5GLBA 5HWTA 1T1AA 1CK3A 5F82A 2HJ9C 1ES4A 1I5QA 5HPFA 3PAGA 3F1NA 2WK0A 4Y15A 4KZ3A 4X53A 4PM9A 1ZKJA 4S2PA 2E8IA 2ZC3B 1YT4A 3HL9A 3G32A 4EWFA 5CX7A 1H3QA 5HX9A 2WADA 3T4QA 4GD8A 2OAP1 1L0DA 1S4SA 3UDXA 3ZNTA 1JWVA 2PR5A 4R38A 1E4DA 1VETB 3HCYA 4LFUA 3HREA 1JVJA 4WMCA 2QKPA 4MN5A 4Y17A 1W7FA 5J3WA 4BWIA 2KX6A 1JTGA 3Q82A 2V1AA 4U0TA 2HZ5A 3N8LA 4DE3A 1XXMA 3UPPA 3W4OA 3RFBA 5DTKA 1SKOB 4YFMA 3CAXA 4H6JA 3WS0A 1W8QA 2YKHA 4R70A 4B93A 3TE8A 1SKFA 4QWOA 3IWOA 2E8JA 3UB5P 3GQZA 3UDIA 3IXDA 3DWZA 3WS1A 4DN0A 2Q9NA 3QHYA 2OOLA 4Y13A 1KGEA 4GS9A 3VOZA 1S0WA 5EM0A 3RJUA 2V20A 2PD7A 3W2ZA 1DJBA 1NXYA 3MQOA 4OQHA 2J7VA 2XK1A 3UB6A 3ZG5A 4JGQA 4PHTA 4LRXC 2XQZA 2W1RA 3SZTA 2DCFA 2J8YA 3K3DA 5FAQA 2B5RA 5FAOA 1LLBA 3CPTB 1LL8A 2VA0A 4XT2A 4HIAA 2A3UA 3V50A 1FR1A 4X68A 5TBMA 3AGDA 4L9FA 1I2SA 5KSHA 2Z2LB 3NECA 1K54A 4JPMA 2OAQ1 3JYIA 2VGKA 3P7NA 4KZ9A 3ZG7B 2ZOHA 2XA7S 3FWLA 3LIBA 3LR0A 2ZOIA 3HVFA 1S4RA 2VGJA 1P97A 2W3EA 1PI4A 1K55C 4PM5A 1KE4A 2R78A 4K91A 3R7WA 2Y2HA 1CI9A 1OJ5A 3CLOA 1N9NA 3H7WB 1N9LA 3HLCA 2PBDP 3BFFA 3HLFA 3E4PA 4WUJA 4OLDA 5M19A 3W4QA 5L2FA 2VJWA 1N9OA 4LGWA 1H0MA 3FPWA 3CITA 1RCJA 3ZVTA 4DE2A 3BY9A 3ZHHA 4NETA 2W27A 3QP8A 2WGWB 4KG6A 4KQQA 2XEPA 3MKFA 1TEMA 3VFHA 5A90A 3IF5A 3L9KA 3BFGA 2O9CA 3GV9A 2WKQA 2Y55A 3WWXA 4LV1A 3NI9A 4KUOA 4EUVA 1RGYA 3MKEA 2JKRI 4I3IA 2OSUA 1W79A 4UEYA 1YAXA 2HDUA 4FH2A 4KZ8A 3G31A 5EOOA 3QP5A 1FQGA 1HZOA 1KDWA 4S2NA 3UE0A 3KSFA 2ZBBA 2DRWA 2ZQCA 3S7OA 1TDLA 1EROA 5DF9A 4O01A 5GLCA 3UE3A 3M2JA 4FH4A 2V9AA 2HDSA 3ZG9B 2J3WA 1N4OA 2LB5A 3WS5A 2O99A 1UWNX 2PR6A 2ZQAA 5J8XA 1Z09A 5CERA 2H0TA 3C30A 2GDNA 3IF6B 3SS5A 4CLCE 3N4IA 4MMNA 3A0SA 1LL9A 3UB9A 1NYMA 2Y2QA 1O7EA 2J9PA 2XF3A 4GLQA 4UA7A 3O5YA 2G2UA 1L2SA 1K56A 2ZM8A 4P87A 1PRQA 1TS6A 1VM1A 4YNRA 2EXAA 1YSQA 4MBFA 2XR0A 3IHAA 3B33A 3NCKA 3DW0A 3UDFA 2FFYA 3B47A 3B42A 4JLFA 4E6WA 3JVVA 2P9VB 3A0RA 1FSYA 1BZAA 3UMEA 3VOLA 1N9BA 2IWCA 1BUEA 2ZM0A 2GJ3A 3UE1A 3HLEA 2W3HA 2B02A 3DWKA 2NUTC 3GR2A 1Q2QA 1M6KA 2XA7M 3P98A 3T1SA 3IS2B 2Y91A 3CHWP 1YLZA 3VE3A 1NYYA 2EX8A 4LLOB 2Y2GA 3BFDA 1FIKA 1P9WA 1BLHA 1FCMA 4OKPA 3T4LA 1G28A 3C4PA 4R3AA 2IA2A 4JGPA 3LICA 1IYPA 4Q8IA 3A0VA 1ZHHB 3WRZA 3A3DA 2X01A 3IX8A 1ZG4A 2XD5A 3C38A 3MXQA 4PM8A 3CUEA 4WZ5C 1T1BA 2OWJA 3FZCA 1T19A 1NLYA 3C5AA 2MJ6A 3G2ZA 4E3MA 2Y59A 2HPBA 3H9WA 2HJEA 3PBSA 1VEUB 1K6SA 2ZC7A 1K54C 2ZM2A 3AGEA 4Q0JA 1TF1A 4OH0A 4MCWA 5GHXA 1S1YA 3BM6A 5HD5A 2WKEA 3BECA 5HDSA 1KVMA 3Q7VA 2QPNA 5HFOA 3KYEA 2PDRA 1YLTA 3HLGA 3OCLA 3BQ8A 4U0XA 4XUZA 3IXHA 1XX2A 5DFYA 4N9LA 3GDIA 2WKHA 4GKUA 4NXBA 4OOLA 3QP4A 3C4OA 1AXBA 1DP9A 3EEAA 2P04A 3MZDA 2HF6A 4Y5FA 5CEBA 2ZD8A 3MQQA 2LB9A 2XFSA 3IH9A 1P0ZA 4ARZB 4ETZA 1XFQA 2VK3A 4EEPA 2XGNA 1SHVA 1XA7A 1PW8A 4XXRA 1MWUA 3PBTA 4B4XA 3S22A 1OPXA 1V9YA 2UV0E 3ISGA 3UN7A 5KIZA 3LIFA 4Y7PA 4K08A 4OVDA 1UWPX 5DJUA 2V1ZA 3TG9A 5HWWA 4S2NC 1ESIA 2XROA 4DXCA 4DDSA 4HH3A 1H8MA 1NLZA 3LY3A 4QJGA 2WKIA 3OCNA 4N9KA 3BRMA 2I72A 1FOFA 4HJ6A 5K5BA 1L0EA 3OPHA 4HHDA 3UE6A 4XUXA 4P0MA 3UPNA 3PAEA 3UPOA 1ODVA 2Y2LA 4P85A 5EVIA 4MBKA 1TS8A 2W3FA 1G6AA 2WAFA 2PHYA 4RQ9A 1TD5A 2ZL1A 5KMWA 4L0LA 1SCWA 1D7EA 5FI2A 3WS2A 2Z6DA 1OTAA 1EWZA 2H28A 5L10A 3GECA 5GHZA 4C3QA 4KZAA 2HP9A 3UB7A 3D3OA 1WYBA 1TS0A 3F1PB 4OONA 1ALQA 4JXSA 3GRJA 1GCEA 5IT5A 4I3AA 3RXXA 1VETA 4HJ4A 4PM6A 3S7QA 4LCLA 2A24B 1PFLA 1YMXA 3M6BA 2PYRA 1XJ3A 4IJGA 1YLJA 4KQOA 3PBNA 2R9WA 3V67A 3ZGAB 5EUAA 1UGUA 4LRZE 1KGGA 2ZC4B 1DJAA 4C75A 5TR7A 1IFQA 5FEGA 4NG2A 4QU3A 3DTKA 4M3KA 1SKOA 3E4OA 2B95A 2AVXA 2VKSA 5MC7A 4ZTKA 1F9IA 1PW1A 3UNWA 5G4ZA 2O9AA 3LY4A 2WGVA 3IXBA 4UA6A 4I39A 3MZEA 2IWBA 4Z1WA 3KX0X 4HP4A 2FZ0A 5F1GA 5L8MA 5LBRA 4E3NA 2OLVA 2GZAA 4ESPA 2JKTM 1WYCA 5D3OA 1LI9A 4KUKA 2BG1A 1QMFA 2O9BA 4DKIA 5AQ7A 3ZVWA 4DDYA 1M40A 5DKLA 1ONHA 2P7JA 1D06A 4LCMA 4E3LA 4Z9QA 1DP6A 4I5SA 3DTEA
chains in the Genus database with same CATH topology
2W1TA 4NKPA 2A2LA 3EGXC 4ZRRA 3RTYA 4EQ1A 3PYPA 4FSFA 4HOIA 5HDDA 2QWSA 1NRJA 3KSFA 1ZTUA 2ZBBA 3KSGA 4I3JA 1VHMA 2K31A 3S7OA 5DF9A 4O01A 5HL6A 3UE3A 3NOTC 3DBAA 3FC7A 5F68A 3UMDA 2V9AA 3IBRA 4AFIA 1EW0A 4GHIB 2QJ5A 3CWFA 2V1BA 4QPRA 1V9ZA 2J3WA 3F1PA 2VZWA 2W3DA 2LB5A 4WN5A 1P9RA 2KOIA 2O99A 1UWNX 2PR6A 1YKDA 3H82B 1OTEA 3BW6A 1MZUA 2JKTI 2I9VA 3C30A 3S7PA 4O8GA 2A24A 4CLCB 4CLCE 4FOFA 2D02A 3A0SA 4MMNA 4PKYA 4G3VA 4DMZA 5AJGA 1XFNA 4B9OA 1BYWA 2VV7A 2GNXA 5AVFA 3UB9A 3KSIA 3LIDA 4GLQA 2CMNA 3F1OB 3O5YA 3H7WA 4WF0A 3T50A 4BJPA 3MF0A 3SW1A 3OOVA 1G6OA 1TS6A 4OOMA 4YNRA 3KYQA 4EU0A 5TBMB 1Y28A 4HP9A 1LSWA 1YSQA 2HGVA 3F1NB 1OT6A 4L9GA 3B33A 2K2NA 5HPIA 3IBJA 3B47A 3B42A 3JVVA 1JNUA 4PKYG 3A0RA 3C8CA 3UMEA 3OC2A 3VOLA 3ZQ5A 2VLGA 3D72A 3PBRA 4GCZA 5DFXA 1XJ2A 4G3WA 2GJ3A 2W3HA 1OJGA 2B02A 2DMWA 2NUTC 2XA7M 3R7WB 5I5LA 3BJNA 3CUEC 3TRCA 4DJ2A 4F3LB 2JHEA 4BBVA 3IS2B 3MJQA 2PT7A 3VE3A 4LLOB 2KDKA 2GX5A 2VGLM 2PD8A 2FH5A 1LSVA 3EWKA 3LR5A 4HI4A 1P9WA 1GSWA 3KSHA 3LFVA 4WELA 3HJKA 3S7NA 3FPVA 2VV6A 4Y2FA 4HH2A 4EERA 3T4LA 1G28A 5HDCA 4Y3IA 1IOUA 1MKMA 4R3AA 1F98A 2OWHA 2Y8HA 4CLCC 2IA2A 4JGPA 3LICA 3A0VA 1T1CA 1ZHHB 5IU1A 3ZYTA 4H6JB 3C2WA 5C5KA 3C38A 3MXQA 3CUEA 1XJ4A 3ULFA 4GHIA 4I38A 1T1BA 3TW8A 4P6ZM 2P08A 1OTIA 2OWJA 1T19A 2VV8A 4WEJA 1NLYA 2MJ6A 5A8BA 2EWWA 3MQ0A 2NUPC 3P01A 3H9WA 2HJEA 4GW9A 3PBSA 4G3KA 1S1ZA 5HZHA 5DJTA 2PYPA 4CLCA 2EA9A 3NHQA 4IUHA 4Q0JA 1TF1A 4GS9B 1OT9A 4MCWA 4MDZA 5DKKA 1S1YA 4ME4A 2QYBA 1STZA 1DP8A 1DRMA 2BASA 2W1TB 4R6LA 5HD5A 1GSVA 4JGRA 5AVEA 5J7EA 5HDSA 3F1OA 5F6AA 2J3TD 3OLOA 5HWTA 1T1AA 2PDRA 3PHYA 2HJ9C 3E4QA 3OCLA 1NWZA 3BQ8A 3K3CA 4LPZA 3UB8A 5HPFA 1TS7A 3F1NA 2K7SA 3EEHA 5DFYA 1MC0A 3GDIA 4KQDA 4MN7A 3JVUA 4XT2B 4HJ3A 2VX8A 3EQVA 4HNBA 4JGOA 4NXBA 2D01A 4OOLA 3R4KA 1DP9A 3EEAA 2INWA 5CX7A 1H3QA 2P04A 3T4QA 5HSQA 4NXGA 3T4OA 2HF6A 4Y5FA 5J4EA 4NEED 3LI9A 2OAP1 3E0YA 2J3TC 1S4SA 3MQQA 2LB9A 2PR5A 1T18A 4CLCD 4R38A 1P0ZA 3HCYA 2XSSA 2B18A 2QKPA 4ARZB 4MN5A 4ETZA 3IS2A 1XFQA 4YWZA 5J3WA 3BY8A 3LI8A 2YKFA 4EEPA 4BWIA 3LUQA 2KX6A 3TJZC 1F5MA 2V1AA 3PBTA 3PR6A 1OPXA 2L1MA 1V9YA 2M7VA 4UQIS 3PBQA 5KIZA 3LIFA 4K08A 3RFBA 1KOUA 1S66L 1UWPX 5DJUA 2O0YA 3CAXA 5HWWA 5EFWA 4CQHA 5F69A 4H6JA 1S67L 2XROA 4WEKA 3BWLA 1LT0A 4EESA 2YKHA 4EW7A 2XRNA 2EWVA 4R70A 4HH3A 4B93A 1H8MA 3TE8A 1NLZA 3K2NA 3LYXA 3OCNA 4HJ6A 2KLIA 5K5BA 5HD3A 4HHDA 3UE6A 2L4RA 4NXFA 2M7UA 4EETB 3PXPA 4DN0A 4IUKA 1WA9A 2OOLA 5F5YA 3KO6A 4GJ4A 2HV1A 4GS9A 4ETXA 1ODVA 3H82A 3HJIA 2PD7A 1OTDA 3LR3A 3W2ZA 2V0WA 2JN7A 3MQOA 1LSXA 4WLAA 3UB6A 1TS8A 4PAUA 2G7UA 2W3FA 2VEAA 4YOFA 4EXOA 4JGQA 3T4TA 4PHTA 3CI6A 4LRXC 2PHYA 4RQ9A 1TD5A 2W1RA 3T4JA 2L0WA 3VV4A 4BMWA 3K3DA 3FG8A 4LRYC 4L0LA 1OTBA 1D7EA 2ZMVA 1LL8A 2VA0A 4L9EA 4XT2A 3EQUA 4HIAA 2Z6DA 5TBMA 1OTAA 2H28A 4L9FA 3GECA 1W63M 4EEUA 3UB7A 5KSHA 3D3OA 5TJJA 4IHQA 1TS0A 3VE4A 3F1PB 5HWVA 3OBFA 2OAQ1 4MN6A 3RH8B 3P7NA 4BBUA 3EOIA 5IT5A 4I3AA 2WKPA 2ZOHA 2W0NA 2XA7S 4HJ4A 3LIBA 3LR0A 2ZOIA 3S7QA 2Y79A 4ARZA 2A24B 2JKRM 2J80A 1S4RA 1P97A 2V0UA 4II7A 3MFXA 3NOUC 3T4KA 3LIAA 2W3EA 2WKRA 1YSPA 2PYRA 2VGLS 1XJ3A 4IJGA 4KQOA 3PBNA 1VB6A 2R78A 3R7WA 4F3LA 3V67A 1UGUA 4LRZE 1X0OA 1W63Q 1OJ5A 3NOPC 3CLOA 3ICYA 1N9NA 3H7WB 4WL9A 1N9LA 3E4PA 3LR4A 1IFQA 3G6OA 4WUJA 2M1CA 2VJWA 2QHKA 1N9OA 3E4OA 3FPWA 3LIEA 3EGDC 3CITA 2VKSA 3BY9A 4HY8A 2QJ7A 5MC7A 4BBTA 2W27A 1F9IA 3T4SA 4P6ZS 5G4ZA 2O9AA 3BQAA 4HQAA 4I39A 4NXEA 3KYZA 2O9CA 4Q0IA 2WKQA 4Z1WA 3KX0X 4HP4A 2FZ0A 5L8MA 4KUOA 5LBRA 4EUVA 3NJAA 3U2AA 1XJ6A 2JKRI 2GZAA 3MMHA 2JKTM 4I3IA 3E98A 2W3GA 4Q0HA 3MR0A 4DJ3A 4E04A 4KUKA 4UEYA 5IS1A 1YAXA 4M4XA 2O9BA 2ZMFA 4O0PA 5DKLA 1GSXA 2P7JA 3PBOA 2Z6CA 1D06A 5FL3A 1DP6A 4I5SA 5G4YA 4UQIM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTY A;  4EQ1 A;  3PYP A;  4HOI A;  5HDD A;  2QWS A;  2ZBB A;  4I3J A;  3NOT C;  3FC7 A;  5F68 A;  3UMD A;  2V9A A;  3IBR A;  1EW0 A;  4GHI B;  2QJ5 A;  3CWF A;  2V1B A;  1V9Z A;  3F1P A;  4WN5 A;  1UWN X;  2PR6 A;  3H82 B;  1OTE A;  1MZU A;  2I9V A;  2A24 A;  2D02 A;  3A0S A;  4PKY A;  1XFN A;  4B9O A;  1BYW A;  2VV7 A;  5AVF A;  3UB9 A;  3LID A;  2CMN A;  3F1O B;  3H7W A;  4WF0 A;  3T50 A;  3SW1 A;  1TS6 A;  5TBM B;  1Y28 A;  4HP9 A;  1LSW A;  3F1N B;  1OT6 A;  4L9G A;  3B33 A;  1JNU A;  4PKY G;  3A0R A;  3C8C A;  3UME A;  3VOL A;  3ZQ5 A;  2VLG A;  3D72 A;  4GCZ A;  1XJ2 A;  2GJ3 A;  1OJG A;  2B02 A;  4DJ2 A;  5I5L A;  4F3L B;  2JHE A;  4BBV A;  3IS2 B;  3MJQ A;  3VE3 A;  4LLO B;  2KDK A;  2PD8 A;  1LSV A;  3EWK A;  4HI4 A;  1GSW A;  3HJK A;  2VV6 A;  4HH2 A;  4EER A;  1G28 A;  5HDC A;  4R3A A;  1F98 A;  2OWH A;  4JGP A;  3LIC A;  3A0V A;  1T1C A;  5IU1 A;  4H6J B;  3C2W A;  3MXQ A;  1XJ4 A;  3ULF A;  4GHI A;  4I38 A;  1T1B A;  1OTI A;  2OWJ A;  1T19 A;  2VV8 A;  5A8B A;  3H9W A;  4GW9 A;  1S1Z A;  5HZH A;  5DJT A;  2PYP A;  2EA9 A;  3NHQ A;  4GS9 B;  1OT9 A;  5DKK A;  1S1Y A;  1DP8 A;  1DRM A;  2BAS A;  4R6L A;  5HD5 A;  1GSV A;  4JGR A;  5AVE A;  5J7E A;  5HDS A;  3F1O A;  5F6A A;  3OLO A;  5HWT A;  1T1A A;  2PDR A;  3PHY A;  3E4Q A;  1NWZ A;  3K3C A;  4LPZ A;  3UB8 A;  1TS7 A;  3F1N A;  2K7S A;  3EEH A;  3GDI A;  4KQD A;  4XT2 B;  4HJ3 A;  4HNB A;  4JGO A;  4NXB A;  2D01 A;  1DP9 A;  2INW A;  5HSQ A;  4NXG A;  5J4E A;  3LI9 A;  1S4S A;  3MQQ A;  2PR5 A;  1T18 A;  4R38 A;  1P0Z A;  2QKP A;  4MN5 A;  3IS2 A;  1XFQ A;  4YWZ A;  5J3W A;  3BY8 A;  3LI8 A;  2YKF A;  4EEP A;  3LUQ A;  2KX6 A;  2V1A A;  2L1M A;  1V9Y A;  5KIZ A;  3LIF A;  4K08 A;  1KOU A;  1S66 L;  1UWP X;  5DJU A;  3CAX A;  5HWW A;  5EFW A;  5F69 A;  4H6J A;  1S67 L;  3BWL A;  1LT0 A;  4EES A;  2YKH A;  4EW7 A;  4R70 A;  4HH3 A;  3LYX A;  4HJ6 A;  5HD3 A;  4HHD A;  3UE6 A;  2L4R A;  4NXF A;  4EET B;  1WA9 A;  2OOL A;  5F5Y A;  2HV1 A;  4GS9 A;  1ODV A;  3H82 A;  3HJI A;  2PD7 A;  1OTD A;  2V0W A;  2JN7 A;  3MQO A;  1LSX A;  4WLA A;  3UB6 A;  1TS8 A;  2VEA A;  4EXO A;  4JGQ A;  4LRX C;  2PHY A;  4RQ9 A;  2L0W A;  3K3D A;  3FG8 A;  4LRY C;  1OTB A;  1D7E A;  1LL8 A;  4L9E A;  4XT2 A;  4HIA A;  2Z6D A;  5TBM A;  1OTA A;  2H28 A;  4L9F A;  3GEC A;  4EEU A;  3UB7 A;  1TS0 A;  3VE4 A;  3F1P B;  5HWV A;  4MN6 A;  3RH8 B;  3P7N A;  4BBU A;  4I3A A;  2WKP A;  2ZOH A;  2W0N A;  4HJ4 A;  3LIB A;  2ZOI A;  2A24 B;  2J80 A;  1S4R A;  1P97 A;  2V0U A;  3MFX A;  3NOU C;  3LIA A;  2WKR A;  2PYR A;  1XJ3 A;  1VB6 A;  2R78 A;  4F3L A;  1UGU A;  4LRZ E;  1X0O A;  1OJ5 A;  3NOP C;  3CLO A;  3ICY A;  1N9N A;  3H7W B;  4WL9 A;  1N9L A;  3E4P A;  3G6O A;  4WUJ A;  2M1C A;  2QHK A;  1N9O A;  3E4O A;  3LIE A;  3BY9 A;  4HY8 A;  2QJ7 A;  4BBT A;  2W27 A;  1F9I A;  5G4Z A;  4HQA A;  4I39 A;  4NXE A;  2WKQ A;  3KX0 X;  4HP4 A;  4KUO A;  3NJA A;  1XJ6 A;  4I3I A;  4DJ3 A;  3MR0 A;  4E04 A;  4KUK A;  5IS1 A;  4M4X A;  5DKL A;  1GSX A;  2P7J A;  2Z6C A;  1D06 A;  1DP6 A;  4I5S A;  5G4Y A; 
#chains in the Genus database with same CATH topology
 4NKP A;  3RTY A;  4EQ1 A;  3Q07 A;  4N92 A;  4BD0 A;  1ZTU A;  5FQI A;  3CPT A;  5HL6 A;  2C6W B;  3UMD A;  4QHC A;  3VP0 A;  4OQ0 A;  4AFI A;  1EW0 A;  4ZDX A;  2QJ5 A;  1NZU A;  2V1B A;  4EV4 A;  1V9Z A;  3QP6 A;  2JKF A;  3MSH A;  1P9R A;  2KOI A;  1H5X A;  3FYZ A;  2RL3 A;  2XFT A;  1I2W A;  5A93 A;  1ZG6 A;  4G3V A;  5AJG A;  2GNX A;  3S1Y A;  2Y4A A;  1K0K A;  3CZD A;  1MY8 A;  3LID A;  3F1O B;  3H7W A;  2EX6 A;  3NC8 A;  3SW1 A;  5I94 A;  1G6O A;  2Q0O A;  5TBM B;  1Y28 A;  5FSR A;  4HP9 A;  2XH9 A;  5JYP A;  1DY6 A;  1KE3 A;  2EXB A;  4L9G A;  3IT9 A;  1PNE A;  5CTN A;  3BFC A;  5HAI A;  1JNU A;  4PKY G;  3OC2 A;  3ZQ5 A;  3SH8 A;  3PBR A;  3WRT A;  4ZJ3 A;  2H0Y A;  1RP5 A;  5EV0 A;  1PWG A;  3HLD A;  4R3J A;  5A91 A;  2JE5 A;  4KZ5 A;  2XLN A;  2DMW A;  1ERM A;  1FCN A;  5TGF A;  3R7W B;  3TRC A;  3IXG A;  3MJQ A;  4WBG A;  4D2O A;  3VP4 A;  5KSC A;  3EWK A;  4HI4 A;  4N1X A;  3KSH A;  3T1X A;  2VV6 A;  1BUL A;  2ZC6 B;  4Y2F A;  5EVE A;  4N1H A;  4BLM A;  5HDC A;  1MKM A;  1GHM A;  3A3E A;  1F98 A;  4CLC C;  3SS3 A;  3N8R A;  4QD4 A;  4H8R A;  5IU1 A;  3O86 A;  3ZYT A;  1KE0 A;  2Q9M A;  4BL2 A;  1QME A;  4R3B A;  3DTM A;  1IEM A;  3G30 A;  4E3K A;  1Y4O A;  3TW8 A;  1BSG A;  2ZQ9 A;  1ES2 A;  4JXG A;  2Y2N A;  4X25 A;  1BLP A;  2NUP C;  5FDH A;  3G4P A;  4G3K A;  1S1Z A;  5DJT A;  4K0W A;  3IF6 A;  4HEF A;  5CTM A;  4FTX A;  1MWT A;  2V2F F;  4O7D A;  1FR6 A;  4JF6 A;  3BEB A;  1GSV A;  5AVE A;  3IWQ A;  1JWP A;  3C7V A;  3T1R A;  4JKT A;  2JC7 A;  5FDS A;  2J3T D;  1FSW A;  3PHY A;  4UHU A;  1KVL A;  4RYE A;  3E4Q A;  1NWZ A;  3K3C A;  2PBY A;  3UB8 A;  3MBZ A;  1TS7 A;  2WGI A;  3MS6 A;  2K7S A;  5CHJ A;  1MC0 A;  4MN7 A;  5M18 A;  3N7W A;  3LCE A;  2VX8 A;  1L0F A;  2EFX A;  3EQV A;  2RCX A;  4HNB A;  5FAS A;  4LV3 A;  5HW3 A;  5HSQ A;  4OPQ A;  2WZX A;  3LI9 A;  2CC1 A;  3MXR A;  1CQA A;  4CLC D;  1A0K A;  5FQJ A;  2XSS A;  1YQS A;  4NK3 A;  3IX3 A;  3O87 A;  3IS2 A;  3BY8 A;  3LI8 A;  2ZQ7 A;  4ID4 A;  3LUQ A;  5CEC A;  3TJZ C;  1F5M A;  4BD1 A;  1ES5 A;  4X1M A;  1E3U D;  4WZ4 A;  1RGZ A;  5U47 A;  2L1M A;  3HUM A;  4GDN A;  4UQI S;  3PBQ A;  3ZNY A;  4R1G A;  1KGF A;  2O0Y A;  3C7U A;  4X69 A;  5EFW A;  4DF6 A;  1ESU A;  4WEK A;  2IWD A;  3BWL A;  1LT0 A;  4EW7 A;  2EWV A;  2PAV P;  5FA7 A;  1NJ4 A;  3HBR A;  3K2N A;  3LYX A;  3IX4 A;  1Z6F A;  1YM1 A;  4FUW A;  4JF5 A;  2ZQ8 A;  4NXF A;  4EET B;  3PXP A;  1YLY A;  1VEU A;  3O88 A;  3NIA A;  4GJ4 A;  1PYY A;  4WMC D;  4ETX A;  3H82 A;  3HJI A;  4RVA A;  1OTD A;  3LR3 A;  3SOI A;  4OPY A;  4S2L A;  4WLA A;  3GMW A;  3PTE A;  3CG5 A;  4B4Z A;  4EBP A;  3G34 A;  3CI6 A;  3D9Y A;  1MKI A;  1MWR A;  5CGS A;  2L0W A;  1AWI A;  3N8S A;  3FG8 A;  4LRY C;  4E3O A;  1OTB A;  4L9E A;  2XD1 A;  3EQU A;  3LGO A;  5JYO A;  1W63 M;  4KZ6 A;  4IHQ A;  4PM7 A;  1ACF A;  4GNU A;  3ZDJ A;  3VMA A;  3OBF A;  5HWV A;  4MN6 A;  4HES A;  2HP5 A;  4BBU A;  2W0N A;  3VOY A;  5E2H A;  2Y79 A;  4ARZ A;  5FI6 A;  2V0U A;  3BLS A;  3NOU C;  1PIO A;  2EX9 A;  3T4K A;  1IYO A;  3LIA A;  1K25 A;  5FI7 A;  2VGL S;  1VB6 A;  1MXO A;  4F3L A;  4IBR A;  2DNS A;  4BQM A;  2XDM A;  2JCH A;  3ICY A;  1PWD A;  1G68 A;  2Y2M A;  4PPR A;  3G6O A;  5HAP A;  2PRF A;  3LIE A;  3NUL A;  3EGD C;  2H10 A;  3LO7 A;  4HY8 A;  2V8F A;  2QJ7 A;  4BBT A;  3T4S A;  4P6Z S;  1SDE A;  5E2E A;  3BQA A;  3OPR A;  4HQA A;  4NXE A;  4A5R A;  5FEF A;  3NJA A;  3U2A A;  4F94 A;  3V3R A;  3ITB A;  4E3I A;  4Q0H A;  3MR0 A;  4E04 A;  3O3V A;  3N6I A;  3L7H A;  1BTL A;  5HL1 A;  1IKG A;  3CMZ A;  2PU2 A;  5FL3 A;  3NBL A;  4EUZ A;  4UQI M;  2W1T A;  3EGX C;  1K57 A;  4FSF A;  5HDD A;  4DRT A;  1NRJ A;  4RX2 A;  3KSG A;  4I3J A;  2K31 A;  3NOT C;  3FC7 A;  1EI5 A;  4MEZ A;  4S2J A;  3ZCZ A;  4KZ4 A;  3IBR A;  4GHI B;  3CWF A;  2Y2I A;  4Y0U A;  3ZFZ A;  3M2K A;  3DTI A;  3F1P A;  2VZW A;  5AQB A;  2Y2K A;  4WN5 A;  3WS4 A;  4HBU A;  1OTE A;  1MZU A;  2JKT I;  2I9V A;  4OPR A;  2ZQD A;  2A24 A;  4CLC B;  1J9M A;  4GD6 A;  5E2G A;  2D02 A;  4PKY A;  2EFU A;  3AGF A;  1BYW A;  2ZL1 B;  4WYY A;  5AVF A;  4S2M A;  3B3X A;  2CMN A;  5EVL A;  3T50 A;  3MF0 A;  3NDG A;  3OOV A;  1W5D A;  1HLU P;  4OOM A;  3KYQ A;  4EU0 A;  3IH8 A;  5HAQ A;  4ZJ2 A;  4X1L A;  3UY6 A;  1YMS A;  2HGV A;  3F1N B;  1L3L A;  1OT6 A;  3E2L A;  3MFD A;  3MZF A;  2K2N A;  4FCF A;  3GTC A;  1MWS A;  1WE4 A;  2ACG A;  1W8Y A;  3C8C A;  2C5W B;  4CJN A;  3QP2 A;  5DFX A;  1XJ2 A;  1TVF A;  2JBF A;  3MXS A;  3LEZ A;  2HP6 A;  1K4E A;  2ZMA A;  3ZG0 A;  3BJN A;  3CUE C;  2JHE A;  4BBV A;  4IVI A;  2QMI A;  2KDK A;  2VGL M;  2PD8 A;  3T1Q B;  2BLS A;  3LFV A;  4WEL A;  4R4S A;  4S2I A;  1K56 D;  2OWH A;  3G35 A;  3SH9 A;  3M6H A;  1BLC A;  2OV5 A;  1CF0 A;  1NZO A;  4H6J B;  5M1A A;  5C5K A;  4S2K A;  1ERQ A;  1XJ4 A;  1PI5 A;  1TDG A;  4JBF A;  4P6Z M;  1OTI A;  3OPP A;  2EWW A;  3MQ0 A;  3VP3 A;  3P01 A;  4ZJ1 A;  4GW9 A;  3V5M A;  2PYP A;  1LHY A;  3GSG A;  3NHQ A;  4QB8 A;  4GS9 B;  2Z2M B;  4MDZ A;  4YIN A;  3UO9 A;  1XA1 A;  5DKK A;  4FD8 A;  3IWI A;  2BAS A;  1MBL A;  1J3W A;  3HLB A;  4IBX A;  5J7E A;  4OOY A;  4WZ5 A;  5GLD A;  3F1O A;  5DVA A;  5F6A A;  3W4P A;  1HTZ A;  3OLO A;  4OLG A;  3NY4 A;  4LPZ A;  3ZG8 B;  3VP2 A;  4R0Q A;  3EEH A;  3OPL A;  4KQD A;  5KZH A;  3JVU A;  4XT2 B;  4HJ3 A;  3A3F A;  1GA0 A;  4JGO A;  2D01 A;  4LEN A;  3R4K A;  2INW A;  1IYS A;  2WGW A;  4NXG A;  3T4O A;  5J4E A;  4NEE D;  5E2F A;  2ZLY A;  3E0Y A;  2J3T C;  5CXW A;  1T18 A;  4Y0T A;  4GZB A;  3VSK A;  4BL3 A;  2B18 A;  5CHM A;  3A3I A;  1YPR A;  4YWZ A;  2YKF A;  2ZC5 B;  3V39 A;  3PR6 A;  2Y2J A;  1VQQ A;  2ZJ9 A;  2WZZ A;  2M7V A;  1K4F A;  2X02 A;  1ZC2 A;  3FKW A;  4JF4 A;  1CI8 A;  1KOU A;  1S66 L;  1YLW A;  1XGJ A;  3E2K A;  2V8C A;  5EVI C;  4CQH A;  5F69 A;  1S67 L;  1ONG A;  1K57 C;  5EPH A;  5F83 A;  4RX3 A;  4EES A;  4KZB A;  2XRN A;  1XPB A;  4OQI A;  1NRF A;  1LL5 A;  4Y0O A;  4OPZ A;  4MLL A;  1SDN A;  1DJC A;  2KLI A;  5HD3 A;  1S6R A;  2L4R A;  4PMA A;  2M7U A;  4IUK A;  1WA9 A;  3QNC A;  4X56 A;  5F5Y A;  3KO6 A;  1ES3 A;  2HV1 A;  4R23 A;  3HUN A;  1O07 A;  3BYD A;  1PWC A;  3BFE A;  3HLW A;  3OZH A;  4MNR A;  4LV2 A;  5CHU A;  3IHB A;  5FQK A;  2V0W A;  2JN7 A;  1LSX A;  4R4R A;  4PAU A;  2G7U A;  2VEA A;  4YOF A;  3TSG A;  4EXO A;  3T4T A;  4KG5 A;  4KZ7 A;  2PU4 A;  2HDR A;  3T4J A;  3VV4 A;  4BMW A;  4OP8 A;  4RA7 A;  3IQA A;  5CRF A;  4UAA A;  1JWZ A;  5L09 A;  2ZMV A;  2WYX A;  1PZO A;  1GA9 A;  4HBT A;  3ITA A;  1GHP A;  3QP1 A;  1L0G A;  4EEU A;  5TJJ A;  4WM9 A;  3VE4 A;  2OLU A;  3A3J A;  3RH8 B;  2X71 A;  3NDE A;  1XKZ A;  2P9V A;  3EOI A;  5CGX A;  4IVK A;  2WKP A;  4JXV A;  3VFF A;  2JKR M;  5DTS A;  2J80 A;  2H5S A;  1HD8 A;  4II7 A;  3MFX A;  5EVI D;  1MPL A;  2WKR A;  1YSP A;  1XP4 A;  5G18 A;  5FQM A;  4LV0 A;  1K38 A;  1X0O A;  1W63 Q;  3NOP C;  5TFQ A;  4WL9 A;  1OME A;  3LR4 A;  1CJF A;  2M1C A;  5CGW A;  1BLS A;  1HVB A;  2QHK A;  1SZV A;  5GHY A;  4ZAM A;  4OQG A;  3W8K A;  4C6Y A;  3DAV A;  4EBN A;  3KYZ A;  4DE0 A;  4QY6 A;  4Q0I A;  3CJM A;  4EQI A;  1Y54 A;  1XJ6 A;  1H8Y A;  3MMH A;  4UA9 A;  5EM1 A;  3FKV A;  3P09 A;  3E98 A;  2W3G A;  4GOG A;  4DJ3 A;  5IS1 A;  4DXB A;  4M4X A;  4KEN B;  2ZMF A;  3V3S A;  5EOE A;  1KDS A;  4O0P A;  1GSX A;  1XGI A;  4K0X A;  2R9X A;  4GB7 A;  3PBO A;  2Z6C A;  1JTD A;  3VSL A;  5G4Y A;  2A2L A;  4ZRR A;  3PYP A;  4HOI A;  2QWS A;  1CEG A;  1VHM A;  5GLA A;  3DBA A;  1C3B A;  5F68 A;  1U60 A;  2WAE A;  5DTT A;  2A49 A;  5A92 A;  4QPR A;  2W3D A;  1BT5 A;  3Q1F A;  3VP1 A;  3G2Y A;  4MBH A;  1YKD A;  3H82 B;  3SH7 A;  3Q7Z A;  3BW6 A;  1GHI A;  4X55 A;  3FV7 A;  3RXW A;  3TOI A;  5BOH A;  3S7P A;  4O8G A;  1FCO A;  3GVB A;  5DF7 A;  4FOF A;  3SS4 A;  5AQ9 A;  3U4L P;  2P74 A;  4DMZ A;  4JXW A;  1XFN A;  3Q81 A;  1Q2P A;  4B9O A;  2VV7 A;  3KSI A;  3S4X A;  1D1J A;  3Q7V B;  2HDQ A;  4EBL A;  2G2W A;  4QY5 A;  4WF0 A;  1G5U A;  4BJP A;  2BTF P;  4GN2 A;  1F2K A;  1LSW A;  4KQR A;  3HUO A;  1NY0 A;  3JPU A;  3I7J A;  5DF8 A;  4D60 A;  5HPI A;  3IBJ A;  4KG2 A;  4OP5 A;  5FQQ A;  4DE1 A;  4GDB A;  1IKI A;  2VLG A;  3D72 A;  1PZP A;  4GCZ A;  4IED A;  4G3W A;  1K55 A;  1OJG A;  1E25 A;  4DJ2 A;  5I5L A;  4F3L B;  5IHV A;  4E6X A;  5AQA A;  2J9O A;  2PT7 A;  4E3J A;  2GX5 A;  2FH5 A;  1LSV A;  3LR5 A;  4B88 A;  1GSW A;  4X6T A;  1H8Z A;  3HJK A;  3S7N A;  3FPV A;  4HH2 A;  4BEN A;  4EER A;  5EE8 A;  3QNB A;  2Y2P A;  4U3T A;  4Y3I A;  1LI0 A;  1IOU A;  3LEQ A;  2Y8H A;  3IF6 C;  5E43 A;  5CED A;  3T12 B;  4P6B A;  4CPK A;  1T1C A;  3D4F A;  1CEF A;  2JKG A;  1YLP A;  5FAT A;  2EX2 A;  1FIL A;  5GL9 A;  1IYQ A;  3C2W A;  3ULF A;  4GHI A;  4I38 A;  2P08 A;  2UWX A;  2VV8 A;  3BLM A;  4WEJ A;  4S2O A;  5A8B A;  5L07 A;  2FFF B;  5FQ9 A;  1K6R A;  5HZH A;  2QZ6 A;  2Y2O A;  4CLC A;  2EA9 A;  4IUH A;  1OT9 A;  1IEL A;  4ZBE A;  5EVI B;  5FAP A;  2WUQ A;  4ME4 A;  2QYB A;  1STZ A;  4R6L A;  1DP8 A;  1DRM A;  2W1T B;  5F1F A;  4JGR A;  5HAR A;  1E3U A;  5EEC A;  5GLB A;  5HWT A;  1T1A A;  1CK3 A;  5F82 A;  2HJ9 C;  1ES4 A;  1I5Q A;  5HPF A;  3PAG A;  3F1N A;  2WK0 A;  4Y15 A;  4KZ3 A;  4X53 A;  4PM9 A;  1ZKJ A;  4S2P A;  2E8I A;  2ZC3 B;  1YT4 A;  3HL9 A;  3G32 A;  4EWF A;  5CX7 A;  1H3Q A;  5HX9 A;  2WAD A;  3T4Q A;  4GD8 A;  2OAP 1;  1L0D A;  1S4S A;  3UDX A;  3ZNT A;  1JWV A;  2PR5 A;  4R38 A;  1E4D A;  1VET B;  3HCY A;  4LFU A;  3HRE A;  1JVJ A;  4WMC A;  2QKP A;  4MN5 A;  4Y17 A;  1W7F A;  5J3W A;  4BWI A;  2KX6 A;  1JTG A;  3Q82 A;  2V1A A;  4U0T A;  2HZ5 A;  3N8L A;  4DE3 A;  1XXM A;  3UPP A;  3W4O A;  3RFB A;  5DTK A;  1SKO B;  4YFM A;  3CAX A;  4H6J A;  3WS0 A;  1W8Q A;  2YKH A;  4R70 A;  4B93 A;  3TE8 A;  1SKF A;  4QWO A;  3IWO A;  2E8J A;  3UB5 P;  3GQZ A;  3UDI A;  3IXD A;  3DWZ A;  3WS1 A;  4DN0 A;  2Q9N A;  3QHY A;  2OOL A;  4Y13 A;  1KGE A;  4GS9 A;  3VOZ A;  1S0W A;  5EM0 A;  3RJU A;  2V20 A;  2PD7 A;  3W2Z A;  1DJB A;  1NXY A;  3MQO A;  4OQH A;  2J7V A;  2XK1 A;  3UB6 A;  3ZG5 A;  4JGQ A;  4PHT A;  4LRX C;  2XQZ A;  2W1R A;  3SZT A;  2DCF A;  2J8Y A;  3K3D A;  5FAQ A;  2B5R A;  5FAO A;  1LLB A;  3CPT B;  1LL8 A;  2VA0 A;  4XT2 A;  4HIA A;  2A3U A;  3V50 A;  1FR1 A;  4X68 A;  5TBM A;  3AGD A;  4L9F A;  1I2S A;  5KSH A;  2Z2L B;  3NEC A;  1K54 A;  4JPM A;  2OAQ 1;  3JYI A;  2VGK A;  3P7N A;  4KZ9 A;  3ZG7 B;  2ZOH A;  2XA7 S;  3FWL A;  3LIB A;  3LR0 A;  2ZOI A;  3HVF A;  1S4R A;  2VGJ A;  1P97 A;  2W3E A;  1PI4 A;  1K55 C;  4PM5 A;  1KE4 A;  2R78 A;  4K91 A;  3R7W A;  2Y2H A;  1CI9 A;  1OJ5 A;  3CLO A;  1N9N A;  3H7W B;  1N9L A;  3HLC A;  2PBD P;  3BFF A;  3HLF A;  3E4P A;  4WUJ A;  4OLD A;  5M19 A;  3W4Q A;  5L2F A;  2VJW A;  1N9O A;  4LGW A;  1H0M A;  3FPW A;  3CIT A;  1RCJ A;  3ZVT A;  4DE2 A;  3BY9 A;  3ZHH A;  4NET A;  2W27 A;  3QP8 A;  2WGW B;  4KG6 A;  4KQQ A;  2XEP A;  3MKF A;  1TEM A;  3VFH A;  5A90 A;  3IF5 A;  3L9K A;  3BFG A;  2O9C A;  3GV9 A;  2WKQ A;  2Y55 A;  3WWX A;  4LV1 A;  3NI9 A;  4KUO A;  4EUV A;  1RGY A;  3MKE A;  2JKR I;  4I3I A;  2OSU A;  1W79 A;  4UEY A;  1YAX A;  2HDU A;  4FH2 A;  4KZ8 A;  3G31 A;  5EOO A;  3QP5 A;  1FQG A;  1HZO A;  1KDW A;  4S2N A;  3UE0 A;  3KSF A;  2ZBB A;  2DRW A;  2ZQC A;  3S7O A;  1TDL A;  1ERO A;  5DF9 A;  4O01 A;  5GLC A;  3UE3 A;  3M2J A;  4FH4 A;  2V9A A;  2HDS A;  3ZG9 B;  2J3W A;  1N4O A;  2LB5 A;  3WS5 A;  2O99 A;  1UWN X;  2PR6 A;  2ZQA A;  5J8X A;  1Z09 A;  5CER A;  2H0T A;  3C30 A;  2GDN A;  3IF6 B;  3SS5 A;  4CLC E;  3N4I A;  4MMN A;  3A0S A;  1LL9 A;  3UB9 A;  1NYM A;  2Y2Q A;  1O7E A;  2J9P A;  2XF3 A;  4GLQ A;  4UA7 A;  3O5Y A;  2G2U A;  1L2S A;  1K56 A;  2ZM8 A;  4P87 A;  1PRQ A;  1TS6 A;  1VM1 A;  4YNR A;  2EXA A;  1YSQ A;  4MBF A;  2XR0 A;  3IHA A;  3B33 A;  3NCK A;  3DW0 A;  3UDF A;  2FFY A;  3B47 A;  3B42 A;  4JLF A;  4E6W A;  3JVV A;  2P9V B;  3A0R A;  1FSY A;  1BZA A;  3UME A;  3VOL A;  1N9B A;  2IWC A;  1BUE A;  2ZM0 A;  2GJ3 A;  3UE1 A;  3HLE A;  2W3H A;  2B02 A;  3DWK A;  2NUT C;  3GR2 A;  1Q2Q A;  1M6K A;  2XA7 M;  3P98 A;  3T1S A;  3IS2 B;  2Y91 A;  3CHW P;  1YLZ A;  3VE3 A;  1NYY A;  2EX8 A;  4LLO B;  2Y2G A;  3BFD A;  1FIK A;  1P9W A;  1BLH A;  1FCM A;  4OKP A;  3T4L A;  1G28 A;  3C4P A;  4R3A A;  2IA2 A;  4JGP A;  3LIC A;  1IYP A;  4Q8I A;  3A0V A;  1ZHH B;  3WRZ A;  3A3D A;  2X01 A;  3IX8 A;  1ZG4 A;  2XD5 A;  3C38 A;  3MXQ A;  4PM8 A;  3CUE A;  4WZ5 C;  1T1B A;  2OWJ A;  3FZC A;  1T19 A;  1NLY A;  3C5A A;  2MJ6 A;  3G2Z A;  4E3M A;  2Y59 A;  2HPB A;  3H9W A;  2HJE A;  3PBS A;  1VEU B;  1K6S A;  2ZC7 A;  1K54 C;  2ZM2 A;  3AGE A;  4Q0J A;  1TF1 A;  4OH0 A;  4MCW A;  5GHX A;  1S1Y A;  3BM6 A;  5HD5 A;  2WKE A;  3BEC A;  5HDS A;  1KVM A;  3Q7V A;  2QPN A;  5HFO A;  3KYE A;  2PDR A;  1YLT A;  3HLG A;  3OCL A;  3BQ8 A;  4U0X A;  4XUZ A;  3IXH A;  1XX2 A;  5DFY A;  4N9L A;  3GDI A;  2WKH A;  4GKU A;  4NXB A;  4OOL A;  3QP4 A;  3C4O A;  1AXB A;  1DP9 A;  3EEA A;  2P04 A;  3MZD A;  2HF6 A;  4Y5F A;  5CEB A;  2ZD8 A;  3MQQ A;  2LB9 A;  2XFS A;  3IH9 A;  1P0Z A;  4ARZ B;  4ETZ A;  1XFQ A;  2VK3 A;  4EEP A;  2XGN A;  1SHV A;  1XA7 A;  1PW8 A;  4XXR A;  1MWU A;  3PBT A;  4B4X A;  3S22 A;  1OPX A;  1V9Y A;  2UV0 E;  3ISG A;  3UN7 A;  5KIZ A;  3LIF A;  4Y7P A;  4K08 A;  4OVD A;  1UWP X;  5DJU A;  2V1Z A;  3TG9 A;  5HWW A;  4S2N C;  1ESI A;  2XRO A;  4DXC A;  4DDS A;  4HH3 A;  1H8M A;  1NLZ A;  3LY3 A;  4QJG A;  2WKI A;  3OCN A;  4N9K A;  3BRM A;  2I72 A;  1FOF A;  4HJ6 A;  5K5B A;  1L0E A;  3OPH A;  4HHD A;  3UE6 A;  4XUX A;  4P0M A;  3UPN A;  3PAE A;  3UPO A;  1ODV A;  2Y2L A;  4P85 A;  5EVI A;  4MBK A;  1TS8 A;  2W3F A;  1G6A A;  2WAF A;  2PHY A;  4RQ9 A;  1TD5 A;  2ZL1 A;  5KMW A;  4L0L A;  1SCW A;  1D7E A;  5FI2 A;  3WS2 A;  2Z6D A;  1OTA A;  1EWZ A;  2H28 A;  5L10 A;  3GEC A;  5GHZ A;  4C3Q A;  4KZA A;  2HP9 A;  3UB7 A;  3D3O A;  1WYB A;  1TS0 A;  3F1P B;  4OON A;  1ALQ A;  4JXS A;  3GRJ A;  1GCE A;  5IT5 A;  4I3A A;  3RXX A;  1VET A;  4HJ4 A;  4PM6 A;  3S7Q A;  4LCL A;  2A24 B;  1PFL A;  1YMX A;  3M6B A;  2PYR A;  1XJ3 A;  4IJG A;  1YLJ A;  4KQO A;  3PBN A;  2R9W A;  3V67 A;  3ZGA B;  5EUA A;  1UGU A;  4LRZ E;  1KGG A;  2ZC4 B;  1DJA A;  4C75 A;  5TR7 A;  1IFQ A;  5FEG A;  4NG2 A;  4QU3 A;  3DTK A;  4M3K A;  1SKO A;  3E4O A;  2B95 A;  2AVX A;  2VKS A;  5MC7 A;  4ZTK A;  1F9I A;  1PW1 A;  3UNW A;  5G4Z A;  2O9A A;  3LY4 A;  2WGV A;  3IXB A;  4UA6 A;  4I39 A;  3MZE A;  2IWB A;  4Z1W A;  3KX0 X;  4HP4 A;  2FZ0 A;  5F1G A;  5L8M A;  5LBR A;  4E3N A;  2OLV A;  2GZA A;  4ESP A;  2JKT M;  1WYC A;  5D3O A;  1LI9 A;  4KUK A;  2BG1 A;  1QMF A;  2O9B A;  4DKI A;  5AQ7 A;  3ZVW A;  4DDY A;  1M40 A;  5DKL A;  1ONH A;  2P7J A;  1D06 A;  4LCM A;  4E3L A;  4Z9Q A;  1DP6 A;  4I5S A;  3DTE A; 
#chains in the Genus database with same CATH homology
 2W1T A;  4NKP A;  2A2L A;  3EGX C;  4ZRR A;  3RTY A;  4EQ1 A;  3PYP A;  4FSF A;  4HOI A;  5HDD A;  2QWS A;  1NRJ A;  3KSF A;  1ZTU A;  2ZBB A;  3KSG A;  4I3J A;  1VHM A;  2K31 A;  3S7O A;  5DF9 A;  4O01 A;  5HL6 A;  3UE3 A;  3NOT C;  3DBA A;  3FC7 A;  5F68 A;  3UMD A;  2V9A A;  3IBR A;  4AFI A;  1EW0 A;  4GHI B;  2QJ5 A;  3CWF A;  2V1B A;  4QPR A;  1V9Z A;  2J3W A;  3F1P A;  2VZW A;  2W3D A;  2LB5 A;  4WN5 A;  1P9R A;  2KOI A;  2O99 A;  1UWN X;  2PR6 A;  1YKD A;  3H82 B;  1OTE A;  3BW6 A;  1MZU A;  2JKT I;  2I9V A;  3C30 A;  3S7P A;  4O8G A;  2A24 A;  4CLC B;  4CLC E;  4FOF A;  2D02 A;  3A0S A;  4MMN A;  4PKY A;  4G3V A;  4DMZ A;  5AJG A;  1XFN A;  4B9O A;  1BYW A;  2VV7 A;  2GNX A;  5AVF A;  3UB9 A;  3KSI A;  3LID A;  4GLQ A;  2CMN A;  3F1O B;  3O5Y A;  3H7W A;  4WF0 A;  3T50 A;  4BJP A;  3MF0 A;  3SW1 A;  3OOV A;  1G6O A;  1TS6 A;  4OOM A;  4YNR A;  3KYQ A;  4EU0 A;  5TBM B;  1Y28 A;  4HP9 A;  1LSW A;  1YSQ A;  2HGV A;  3F1N B;  1OT6 A;  4L9G A;  3B33 A;  2K2N A;  5HPI A;  3IBJ A;  3B47 A;  3B42 A;  3JVV A;  1JNU A;  4PKY G;  3A0R A;  3C8C A;  3UME A;  3OC2 A;  3VOL A;  3ZQ5 A;  2VLG A;  3D72 A;  3PBR A;  4GCZ A;  5DFX A;  1XJ2 A;  4G3W A;  2GJ3 A;  2W3H A;  1OJG A;  2B02 A;  2DMW A;  2NUT C;  2XA7 M;  3R7W B;  5I5L A;  3BJN A;  3CUE C;  3TRC A;  4DJ2 A;  4F3L B;  2JHE A;  4BBV A;  3IS2 B;  3MJQ A;  2PT7 A;  3VE3 A;  4LLO B;  2KDK A;  2GX5 A;  2VGL M;  2PD8 A;  2FH5 A;  1LSV A;  3EWK A;  3LR5 A;  4HI4 A;  1P9W A;  1GSW A;  3KSH A;  3LFV A;  4WEL A;  3HJK A;  3S7N A;  3FPV A;  2VV6 A;  4Y2F A;  4HH2 A;  4EER A;  3T4L A;  1G28 A;  5HDC A;  4Y3I A;  1IOU A;  1MKM A;  4R3A A;  1F98 A;  2OWH A;  2Y8H A;  4CLC C;  2IA2 A;  4JGP A;  3LIC A;  3A0V A;  1T1C A;  1ZHH B;  5IU1 A;  3ZYT A;  4H6J B;  3C2W A;  5C5K A;  3C38 A;  3MXQ A;  3CUE A;  1XJ4 A;  3ULF A;  4GHI A;  4I38 A;  1T1B A;  3TW8 A;  4P6Z M;  2P08 A;  1OTI A;  2OWJ A;  1T19 A;  2VV8 A;  4WEJ A;  1NLY A;  2MJ6 A;  5A8B A;  2EWW A;  3MQ0 A;  2NUP C;  3P01 A;  3H9W A;  2HJE A;  4GW9 A;  3PBS A;  4G3K A;  1S1Z A;  5HZH A;  5DJT A;  2PYP A;  4CLC A;  2EA9 A;  3NHQ A;  4IUH A;  4Q0J A;  1TF1 A;  4GS9 B;  1OT9 A;  4MCW A;  4MDZ A;  5DKK A;  1S1Y A;  4ME4 A;  2QYB A;  1STZ A;  1DP8 A;  1DRM A;  2BAS A;  2W1T B;  4R6L A;  5HD5 A;  1GSV A;  4JGR A;  5AVE A;  5J7E A;  5HDS A;  3F1O A;  5F6A A;  2J3T D;  3OLO A;  5HWT A;  1T1A A;  2PDR A;  3PHY A;  2HJ9 C;  3E4Q A;  3OCL A;  1NWZ A;  3BQ8 A;  3K3C A;  4LPZ A;  3UB8 A;  5HPF A;  1TS7 A;  3F1N A;  2K7S A;  3EEH A;  5DFY A;  1MC0 A;  3GDI A;  4KQD A;  4MN7 A;  3JVU A;  4XT2 B;  4HJ3 A;  2VX8 A;  3EQV A;  4HNB A;  4JGO A;  4NXB A;  2D01 A;  4OOL A;  3R4K A;  1DP9 A;  3EEA A;  2INW A;  5CX7 A;  1H3Q A;  2P04 A;  3T4Q A;  5HSQ A;  4NXG A;  3T4O A;  2HF6 A;  4Y5F A;  5J4E A;  4NEE D;  3LI9 A;  2OAP 1;  3E0Y A;  2J3T C;  1S4S A;  3MQQ A;  2LB9 A;  2PR5 A;  1T18 A;  4CLC D;  4R38 A;  1P0Z A;  3HCY A;  2XSS A;  2B18 A;  2QKP A;  4ARZ B;  4MN5 A;  4ETZ A;  3IS2 A;  1XFQ A;  4YWZ A;  5J3W A;  3BY8 A;  3LI8 A;  2YKF A;  4EEP A;  4BWI A;  3LUQ A;  2KX6 A;  3TJZ C;  1F5M A;  2V1A A;  3PBT A;  3PR6 A;  1OPX A;  2L1M A;  1V9Y A;  2M7V A;  4UQI S;  3PBQ A;  5KIZ A;  3LIF A;  4K08 A;  3RFB A;  1KOU A;  1S66 L;  1UWP X;  5DJU A;  2O0Y A;  3CAX A;  5HWW A;  5EFW A;  4CQH A;  5F69 A;  4H6J A;  1S67 L;  2XRO A;  4WEK A;  3BWL A;  1LT0 A;  4EES A;  2YKH A;  4EW7 A;  2XRN A;  2EWV A;  4R70 A;  4HH3 A;  4B93 A;  1H8M A;  3TE8 A;  1NLZ A;  3K2N A;  3LYX A;  3OCN A;  4HJ6 A;  2KLI A;  5K5B A;  5HD3 A;  4HHD A;  3UE6 A;  2L4R A;  4NXF A;  2M7U A;  4EET B;  3PXP A;  4DN0 A;  4IUK A;  1WA9 A;  2OOL A;  5F5Y A;  3KO6 A;  4GJ4 A;  2HV1 A;  4GS9 A;  4ETX A;  1ODV A;  3H82 A;  3HJI A;  2PD7 A;  1OTD A;  3LR3 A;  3W2Z A;  2V0W A;  2JN7 A;  3MQO A;  1LSX A;  4WLA A;  3UB6 A;  1TS8 A;  4PAU A;  2G7U A;  2W3F A;  2VEA A;  4YOF A;  4EXO A;  4JGQ A;  3T4T A;  4PHT A;  3CI6 A;  4LRX C;  2PHY A;  4RQ9 A;  1TD5 A;  2W1R A;  3T4J A;  2L0W A;  3VV4 A;  4BMW A;  3K3D A;  3FG8 A;  4LRY C;  4L0L A;  1OTB A;  1D7E A;  2ZMV A;  1LL8 A;  2VA0 A;  4L9E A;  4XT2 A;  3EQU A;  4HIA A;  2Z6D A;  5TBM A;  1OTA A;  2H28 A;  4L9F A;  3GEC A;  1W63 M;  4EEU A;  3UB7 A;  5KSH A;  3D3O A;  5TJJ A;  4IHQ A;  1TS0 A;  3VE4 A;  3F1P B;  5HWV A;  3OBF A;  2OAQ 1;  4MN6 A;  3RH8 B;  3P7N A;  4BBU A;  3EOI A;  5IT5 A;  4I3A A;  2WKP A;  2ZOH A;  2W0N A;  2XA7 S;  4HJ4 A;  3LIB A;  3LR0 A;  2ZOI A;  3S7Q A;  2Y79 A;  4ARZ A;  2A24 B;  2JKR M;  2J80 A;  1S4R A;  1P97 A;  2V0U A;  4II7 A;  3MFX A;  3NOU C;  3T4K A;  3LIA A;  2W3E A;  2WKR A;  1YSP A;  2PYR A;  2VGL S;  1XJ3 A;  4IJG A;  4KQO A;  3PBN A;  1VB6 A;  2R78 A;  3R7W A;  4F3L A;  3V67 A;  1UGU A;  4LRZ E;  1X0O A;  1W63 Q;  1OJ5 A;  3NOP C;  3CLO A;  3ICY A;  1N9N A;  3H7W B;  4WL9 A;  1N9L A;  3E4P A;  3LR4 A;  1IFQ A;  3G6O A;  4WUJ A;  2M1C A;  2VJW A;  2QHK A;  1N9O A;  3E4O A;  3FPW A;  3LIE A;  3EGD C;  3CIT A;  2VKS A;  3BY9 A;  4HY8 A;  2QJ7 A;  5MC7 A;  4BBT A;  2W27 A;  1F9I A;  3T4S A;  4P6Z S;  5G4Z A;  2O9A A;  3BQA A;  4HQA A;  4I39 A;  4NXE A;  3KYZ A;  2O9C A;  4Q0I A;  2WKQ A;  4Z1W A;  3KX0 X;  4HP4 A;  2FZ0 A;  5L8M A;  4KUO A;  5LBR A;  4EUV A;  3NJA A;  3U2A A;  1XJ6 A;  2JKR I;  2GZA A;  3MMH A;  2JKT M;  4I3I A;  3E98 A;  2W3G A;  4Q0H A;  3MR0 A;  4DJ3 A;  4E04 A;  4KUK A;  4UEY A;  5IS1 A;  1YAX A;  4M4X A;  2O9B A;  2ZMF A;  4O0P A;  5DKL A;  1GSX A;  2P7J A;  3PBO A;  2Z6C A;  1D06 A;  5FL3 A;  1DP6 A;  4I5S A;  5G4Y A;  4UQI M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...