4XT2A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GEFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 116
sequence length 116
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2A00
1XJ3A 3A0VA 2YKFA 4HJ3A 4WL9A 3LI9A 2INWA 3T50A 3H7WB 5F5YA 1ODVA 2K7SA 2V1BA 2WKRA 5HDSA 5DKKA 2OOLA 5F6AA 2H28A 3UB9A 5G4ZA 4HJ4A 3E4PA 3FG8A 5IU1A 2I9VA 2L4RA 3B33A 4I5SA 1XFNA 3D72A 2A24B 4NXBA 4B9OA 1LL8A 5EFWA 3HJKA 5DJTA 5HD3A 3MJQA 4EW7A 4WLAA 2QWSA 5HDCA 3KX0X 3F1OA 2D02A 4KUOA 4F3LB 4WF0A 3VE4A 5DJUA 4I38A 1OJ5A 2KDKA 3K3DA 1P0ZA 4R70A 2Z6DA 1G28A 4EETB 3PYPA 2QKPA 1DP6A 4YWZA 2PYPA 3IS2A 4GHIA 3F1NA 4HOIA 2ZOIA 4JGRA 2CMNA 5F68A 3SW1A 3E4QA 3LI8A 1UWPX 1T1BA 1T19A 3GDIA 1DRMA 2P7JA 4K08A 2QHKA 4NXGA 5HSQA 1DP8A 1S67L 1D7EA 3LIDA 1N9LA 2D01A 4I3JA 5I5LA 4H6JB 2JN7A 3ZQ5A 4HH3A 5AVEA 4GS9B 1UWNX 3LIFA 3UMDA 4GCZA 3UB6A 4R38A 2PHYA 1TS7A 4JGOA 3FC7A 5J3WA 5HWTA 4HP9A 4HIAA 1TS8A 1XJ2A 3EWKA 3HJIA 1LSVA 4BBUA 4EEUA 3UB7A 4EERA 3UMEA 3H9WA 2L1MA 5F69A 1TS6A 1DP9A 1TS0A 4E04A 5G4YA 2WKPA 1JNUA 4I3AA 1BYWA 3G6OA 3P7NA 3NHQA 4DJ3A 4HI4A 2V0UA 2M1CA 4DJ2A 2R78A 4NXFA 2A24A 5TBMB 4L9EA 1OT6A 4KUKA 1UGUA 1S1YA 2ZOHA 2QJ5A 3LIBA 1MZUA 4HP4A 2VLGA 4PKYG 1GSXA 2OWHA 5J4EA 4L9GA 1GSWA 4XT2B 2PYRA 1T18A 5KIZA 4EESA 3NOUC 4LRZE 4HJ6A 3VOLA 1T1CA 1NWZA 3F1PB 3ULFA 4M4XA 4EQ1A 3LUQA 2L0WA 1LT0A 4HH2A 1S4RA 3K3CA 2WKQA 1VB6A 3LIEA 4JGQA 3UB8A 3BY8A 3LIAA 1S66L 2V1AA 5HZHA 1OTAA 3RH8B 2EA9A 1XJ4A 3LICA 1X0OA 3LYXA 2QJ7A 2ZBBA 5IS1A 3E4OA 3CAXA 4WN5A 2PD8A 3H82A 3CLOA 3EEHA 4H6JA 5DKLA 1OTDA 1OTBA 1V9ZA 4KQDA 3MFXA 5HWWA 4GS9A 3H7WA 3A0RA 3MR0A 4MN5A 1Y28A 4BBVA 4R3AA 4EEPA 2PDRA 3CWFA 3GECA 2VV8A 1F98A 3BY9A 1N9NA 4HHDA 3OLOA 4PKYA 4HQAA 2J80A 3F1OB 2PR5A 1XJ6A 1S1ZA 3MXQA 1OTIA 1P97A 2V9AA 2V0WA 1OJGA 3IBRA 3MQOA 3BWLA 3NJAA 2W0NA 3PHYA 2W27A 1F9IA 5TBMA 2BASA 5AVFA 4I3IA 4LPZA 5HDDA 4R6LA 3IS2B 4F3LA 5HD5A 4BBTA 2Z6CA 3ICYA 4GHIB 3F1NB 4I39A 1V9YA 3RTYA 5J7EA 2VV7A 1OTEA 1EW0A 2HV1A 1KOUA 2VV6A 4GW9A 1LSWA 4MN6A 4XT2A 1XFQA 2B02A 4EXOA 3MQQA 4JGPA 4LRYC 2PR6A 4HNBA 2PD7A 2JHEA 1S4SA 4RQ9A 2VEAA 3VE3A 3UE6A 1N9OA 3F1PA 4L9FA 4LRXC 2KX6A 2YKHA 2OWJA 5HWVA 1LSXA 3C2WA 1WA9A 1T1AA 4HY8A 3NOPC 1GSVA 3C8CA 5A8BA 2GJ3A 3NOTC 4NXEA 3A0SA 1OT9A 3H82B 4LLOB 1D06A 4WUJA
chains in the Genus database with same CATH superfamily
1SHVA 4OPRA 3A0VA 2YKFA 1F2KA 3EOIA 4WELA 4E3NA 2INWA 3KYZA 3HLWA 3GQZA 5EVID 5JYPA 2XGNA 5HDSA 2OAP1 5DKKA 2OOLA 4JXGA 3V5MA 4LFUA 3V67A 2DNSA 3PBNA 4MLLA 2ACGA 4UEYA 4HJ4A 3FG8A 4Y0TA 2I9VA 2V1ZA 4I5SA 1PW8A 1Q2QA 4DF6A 2A24B 4NXBA 5EOEA 1LL8A 2ZLYA 3DTIA 2J3TC 1WYCA 2PU2A 3BFDA 3E0YA 2X01A 1IYSA 3MF0A 3MJQA 5FQ9A 2Y8HA 3IX4A 4WLAA 4X6TA 2QWSA 3IF6A 5DFYA 3KX0X 3SS4A 1ESUA 1LHYA 3F1OA 5FEFA 3G31A 1JWZA 2BG1A 3T4OA 3VMAA 2D02A 4KUOA 4WF0A 5HPFA 4OKPA 2JCHA 3JYIA 4RX3A 2KDKA 4JLFA 2Y79A 4ZAMA 4DE2A 4GJ4A 3WWXA 1H8MA 2Z6DA 1G28A 2WKHA 3C4PA 5GHZA 3PYPA 1DP6A 3IS2A 2ZOIA 1LLBA 4NETA 1EWZA 1YPRA 2CMNA 4GOGA 4JGRA 3JPUA 3P09A 1Z6FA 5TJJA 3CITA 1T1BA 1CEGA 2VZWA 1QMFA 5CERA 2Q0OA 1FCMA 2ZM0A 4JXSA 5E2EA 3AGDA 1PZOA 1MXOA 1K54A 2K31A 1N9LA 3BECA 3N6IA 3LR0A 2EX2A 2O9BA 2XFTA 1YAXA 3LR4A 4HH3A 1PI4A 1UWNX 2OSUA 3TSGA 3S22A 3LIFA 3PBRA 3CUEA 1LL5A 3UB6A 3Q1FA 3FKWA 1IYQA 1P9WA 3FC7A 1OMEA 5TFQA 3I7JA 4KZ6A 1BZAA 3CUEC 3MXRA 3DW0A 1DJCA 4EEUA 1SDEA 5FAPA 5F69A 4EWFA 2X71A 5IT5A 3BFFA 1JNUA 5K5BA 1YLYA 4Q8IA 4FOFA 4BD0A 4X68A 4HI4A 4Y2FA 3VSKA 5GLAA 3GR2A 5KMWA 1VETA 4R3JA 5AQ7A 2R78A 3P01A 4P85A 1AXBA 4BMWA 2J3TD 5CHUA 3VP3A 5GHYA 4BD1A 4WZ5A 1M6KA 4M3KA 2ZQAA 3ITBA 5HAQA 4S2MA 2EX9A 2JE5A 1VQQA 3HVFA 4UQIM 3UDFA 3A3DA 1YLTA 4Q0JA 2OWHA 4Y7PA 2Y2QA 1BLCA 1CF0A 3UPPA 3E2KA 3FPWA 4YINA 1XKZA 2PYRA 1SZVA 3S4XA 3C7UA 4IEDA 4ZJ2A 2CC1A 4R4SA 4HJ6A 5DTKA 4M4XA 4FSFA 3LUQA 4UA7A 2L0WA 4DXCA 1BLHA 4XXRA 1S4RA 3KO6A 3DTKA 4KQOA 5DFXA 3NECA 1KE3A 4JGQA 5DF7A 3BY8A 3DBAA 1TEMA 3NULA 4CLCC 3S7PA 5C5KA 3BEBA 3IWQA 4EQIA 2V1AA 4Q0HA 3IH8A 4HBUA 5HZHA 3WRZA 1OTAA 4E6XA 2GX5A 5EUAA 3LYXA 4EUZA 3UE0A 5FATA 4R0QA 1YMSA 2ZBBA 3Q07A 2P04A 2W1TB 4S2NC 3E4OA 2W3GA 3HUNA 5M1AA 4R3BA 4H6JA 2EX8A 2Y55A 3Q81A 4CLCE 5HX9A 1OTBA 4IBXA 4GS9A 4HESA 3H7WA 4JXWA 4BBVA 3V50A 1Y28A 4LGWA 3T4TA 4ZDXA 1JTDA 4EEPA 2VV8A 1SKOB 1DY6A 3LR3A 3BLSA 1ONGA 1VHMA 3BY9A 4HQAA 5CTMA 1PYYA 2PR5A 2Z2LB 3Q82A 2DRWA 3IHBA 1IKIA 3HLCA 4OQIA 1S1ZA 3C4OA 4GB7A 1ZKJA 3CZDA 5AQ9A 3IBRA 4JKTA 3HLDA 3NJAA 5HFOA 4WBGA 2W27A 3KSGA 4AFIA 1F9IA 4GNUA 5CTNA 1PW1A 4Y3IA 5HDDA 4F3LA 5HD5A 1W7FA 3AGFA 2Z6CA 2VGLS 1E3UD 3ICYA 3UDIA 1YT4A 4BBTA 4GHIB 4E3JA 3GV9A 4I39A 4OQHA 1IEMA 1NLZA 4JF6A 3ZVTA 4CJNA 3WS0A 2FFFB 3TJZC 4CLCB 3IX3A 4GW9A 3FZCA 2WAEA 2UV0E 4MN6A 2QMIA 3ZG7B 1XA1A 5KSHA 4S2PA 5HPIA 4B88A 4HNBA 2ZMAA 5FQIA 4PMAA 1ES2A 2VEAA 3VE3A 2WGIA 3QP5A 4D2OA 1N9OA 2HP9A 3F1PA 4JF5A 4L9FA 2KX6A 2YKHA 2OWJA 1K0KA 4KG6A 5HAIA 1I2WA 4JBFA 1LSXA 3TG9A 5E2FA 1MBLA 4HY8A 3IT9A 3T4JA 2Y2KA 1CEFA 2AVXA 4GD6A 3ZGAB 1K4EA 1PNEA 4RYEA 1L0EA 2H10A 3MZEA 1FSWA 5A90A 1YSPA 4HEFA 4ESPA 4NXEA 4JXVA 4CLCD 3HL9A 1IKGA 3HLGA 4LLOB 1YLPA 4PM6A 3QP8A 1XP4A 2ZQDA 3C30A 4HJ3A 3V3RA 3LI9A 1LI9A 1SKFA 3H7WB 5F5YA 4QPRA 2V1BA 2PRFA 4O7DA 4EU0A 3FV7A 4PM9A 4K0WA 4GN2A 3BRMA 3EEAA 3UB9A 5LBRA 5G4ZA 2O9CA 4H8RA 5IU1A 4KG5A 4OOYA 2L4RA 2EWVA 3LCEA 3CPTA 2Y59A 1PIOA 3VP1A 5DF9A 3Q7VB 2J8YA 1ACFA 3SH9A 4EW7A 4K0XA 3U2AA 3ZG8B 1H8YA 4JPMA 5FAQA 4F3LB 2C5WB 3VE4A 1ONHA 3R4KA 5DJUA 4PHTA 3C38A 1FCOA 3M2KA 1YLJA 5EVEA 2VGLM 4JF4A 3N7WA 4KZBA 1K6RA 4R70A 4ETXA 3QP6A 4G3KA 1RGYA 1K55C 4UHUA 5EM0A 1KVMA 3NI9A 2KLIA 4K91A 4QU3A 4QWOA 2VKSA 2ZC6B 3BFEA 2P74A 1K56A 1ZG4A 3RXXA 4N9LA 2EWWA 3GDIA 4ID4A 4F94A 3NC8A 2P7JA 3MS6A 4Q0IA 5CGSA 2PT7A 2VA0A 2QHKA 3NDEA 5DTSA 4O01A 3NY4A 1DP8A 2GZAA 3LIDA 3C5AA 4I3JA 2OAQ1 1E25A 2QZ6A 4BWIA 2JN7A 4X25A 5AVEA 2ZD8A 3MBZA 4Y17A 2VX8A 4P6ZS 2QYBA 4GCZA 1QMEA 4JGOA 5A92A 4X55A 3HLEA 1RCJA 5GLDA 3RJUA 4HP9A 3VV4A 4HIAA 2NUPC 5U47A 1XJ2A 1TVFA 1XPBA 3KSHA 1XGIA 3ITAA 4EERA 1ZHHB 2K2NA 3FYZA 2WYXA 3FPVA 2J3WA 1DP9A 2FFYA 1LL9A 1TS0A 5L09A 4I3AA 3NBLA 5F82A 5CEDA 1J9MA 1BYWA 3G6OA 3NHQA 4DJ3A 1HD8A 2H0YA 3VP0A 3OOVA 3T1RA 4DJ2A 2ZMVA 3PXPA 4OP5A 3IXBA 3UPNA 1MY8A 2P9VB 1ZC2A 1FSYA 1CI9A 3MXSA 3IBJA 1UGUA 2W3DA 1XX2A 3E98A 1EROA 5L07A 3IF6C 2QJ5A 4L0LA 3LIBA 1MZUA 5G18A 4EUVA 1FILA 1GSXA 1D1JA 1Z09A 3IHAA 3S7NA 4XT2B 5DF8A 5FL3A 1W8YA 3OPHA 3W2ZA 4BQMA 1TF1A 2XK1A 3NOUC 1YMXA 1FR6A 4LRZE 2XDMA 1S0WA 2FH5A 2W3FA 1NRFA 4EQ1A 4OH0A 1W63M 4HH2A 1K4FA 2WZXA 3GSGA 5E2HA 1GHIA 5GL9A 4KZ3A 5EECA 5GHXA 4G3WA 3BQAA 5AQAA 2XD5A 5EV0A 1S66L 4QJGA 4OLDA 3VP4A 4FH2A 2IA2A 1ES4A 4KQRA 4YFMA 1BLSA 1K54C 2UWXA 3G2YA 4C3QA 3PR6A 3CG5A 3FKVA 1KE0A 3DAVA 5IS1A 4MNRA 4P6ZM 2LB9A 1IFQA 2PD8A 3H82A 2EFUA 1C3BA 3ZVWA 2R9XA 1HVBA 4E3IA 5DKLA 1IYOA 1V9ZA 3PAEA 4KQDA 5HWWA 4MEZA 2EXBA 3A0RA 3PBQA 3BYDA 3MQ0A 4R3AA 4OOLA 2M7UA 3ZG5A 3SS3A 2WUQA 4FH4A 4P0MA 3KSFA 3GECA 3LEZA 2B18A 3QP2A 1F98A 2JC7A 3N4IA 1NZUA 1N9NA 3OLOA 2J80A 3IF6B 3PBSA 3BJNA 3F1OB 1FIKA 5EE8A 1P9RA 3UN7A 3CMZA 1IELA 3D9YA 1ES5A 1MPLA 2VGJA 4KG2A 5FQKA 1OPXA 2V9AA 1TD5A 4OVDA 2W3EA 3UPOA 3G32A 3W8KA 1NXYA 4OONA 1KE4A 3TE8A 5TBMA 4WZ5C 4I3IA 4LPZA 3T4QA 2Y2JA 5CECA 3IS2B 3PBTA 3IH9A 4EBNA 4PM5A 1V9YA 3RTYA 5TGFA 3W4PA 5J7EA 3L9KA 2VV7A 1K57A 1EW0A 4IVIA 1KOUA 1VEUA 1LSWA 3K2NA 3HUOA 3ZG9B 4WZ4A 4EXOA 3MQQA 5FDSA 2WGWA 2PR6A 3EQUA 2BLSA 4C75A 5DVAA 4ZTKA 5TR7A 5AJGA 2HDUA 4DN0A 1NLYA 2Y2NA 1JWPA 2ZM8A 3OPRA 1GSVA 4DDYA 4RVAA 1RP5A 3WS5A 2G7UA 5CX7A 2O0YA 4ZJ3A 4Z9QA 2E8IA 3A0SA 3T12B 3H82B 2ZC4B 4WUJA 1STZA 3G4PA 3HUMA 4WL9A 1IOUA 2WKEA 1BUEA 3T50A 5I94A 3RXWA 4S2LA 2JKRI 1EI5A 1ODVA 2WKRA 5M19A 3W4OA 3NIAA 3O88A 5FA7A 5F6AA 2H28A 5CGXA 2X02A 4Y15A 2XFSA 1GA0A 3EQVA 2ZC5B 1J3WA 1E4DA 4ARZA 1M40A 1VETB 3SZTA 1FR1A 1NRJA 3D72A 4OQ0A 1W8QA 3BQ8A 4GLQA 4DDSA 5EFWA 3DTEA 4QHCA 4IBRA 5CGWA 4YNRA 3IWOA 2PBDP 4N92A 4KENB 4OPYA 1YM1A 4X53A 3BW6A 2XEPA 4OOMA 4X1MA 2HGVA 4MMNA 1ES3A 3R7WA 3WS2A 1XXMA 3BFGA 5F1FA 4IJGA 2O9AA 4DRTA 2G2UA 1KGFA 1IYPA 4I38A 1OJ5A 3B47A 2V20A 1P0ZA 4E3MA 1FOFA 3DWZA 5HARA 4QD4A 1W63Q 2QKPA 3ZCZA 2PYPA 4FCFA 3IXGA 3LY3A 4EBPA 3O86A 3SOIA 1L0DA 3F1NA 2HDRA 4FD8A 3LO7A 2IWDA 5F68A 1AWIA 3SW1A 1YSQA 2PU4A 3LI8A 1UWPX 2E8JA 3G34A 4NK3A 2Y91A 2WKIA 3MKEA 2B95A 1MWSA 1U60A 5FSRA 4BLMA 2QPNA 4QB8A 3ZNTA 4NXGA 2JKRM 4MBKA 1S67L 1JTGA 3M2JA 2D01A 5EVLA 3G2ZA 2XRNA 1O07A 4H6JB 2XQZA 2ZQ9A 4PAUA 5CHJA 2XF3A 2Y2OA 4GS9B 1G5UA 3UMDA 3FWLA 3L7HA 4R38A 4BL2A 2HPBA 4DKIA 1BT5A 2V8CA 1XGJA 3RFBA 2XSSA 3EWKA 3ZFZA 4ARZB 5BOHA 3SH7A 4LENA 4QY6A 3T1SA 3UB7A 3MMHA 4IUHA 1NY0A 3UMEA 3H9WA 1KDSA 2J9PA 4XUZA 2FZ0A 2L1MA 2HJ9C 1GHPA 1TS6A 1DJBA 2IWCA 3IQAA 3S1YA 2WKPA 1Y4OA 3OCNA 5HL6A 3TW8A 1MWRA 2EX6A 2V0UA 3HLFA 5FQJA 2M1CA 4R4RA 4NXFA 2A24A 2JKFA 4L9EA 1OT6A 4KUKA 4KZ7A 1HLUP 3UE3A 3ZNYA 1S1YA 4ME4A 4LV1A 4X69A 5FEGA 3OPLA 3G35A 3LY4A 4WM9A 4L9GA 1GSWA 1L0FA 4N1HA 1T18A 3GTCA 4GZBA 2HP5A 4EESA 3ZDJA 4IVKA 3VOLA 3OC2A 3F1PB 4KZ4A 3QP4A 3K3CA 2WKQA 2Y2MA 1CQAA 1VB6A 4CPKA 5FI7A 1W79A 3LIEA 3UB8A 2VJWA 2R9WA 4MBHA 2Y2PA 1K38A 4ZRRA 2MJ6A 3VP2A 3WRTA 4U0XA 2Z2MB 3VFHA 4KQQA 5L8MA 5FASA 3RH8B 1XJ4A 4QY5A 4Y0OA 3ZYTA 4N1XA 2J7VA 2G2WA 2QJ7A 3M6BA 5A91A 1BTLA 1JWVA 4O0PA 4X1LA 1OTDA 1ALQA 3MFXA 3CPTB 2XH9A 3UDXA 3MR0A 4MN5A 2P08A 4DE3A 2OV5A 2ZJ9A 4KZ9A 1KGGA 3BM6A 2PDRA 1G6AA 5CXWA 5D3OA 4PKYA 4PPRA 4KZAA 4YOFA 4DE1A 1FQGA 1DJAA 3GVBA 2Q9NA 2ZM2A 4GDBA 3LFVA 5CRFA 3MXQA 4OPZA 4S2JA 2V0WA 4D60A 3MQOA 1ZTUA 3BWLA 4LCMA 2ZL1A 2W0NA 3N8SA 3U4LP 4S2OA 3ZG0A 3E2LA 5FI2A 1PWGA 4RA7A 5AVFA 4II7A 4UQIS 5A93A 3QP1A 3VSLA 1H8ZA 2WK0A 3S7QA 4G3VA 5IHVA 4U0TA 2A2LA 1YQSA 3MZDA 1OTEA 1TDGA 3WS4A 2A3UA 2B02A 4JGPA 5L10A 5HW3A 2PD7A 1S4SA 4ETZA 2J9OA 3IXHA 1CK3A 2Y2LA 3HCYA 4LRXC 3P98A 4GDNA 5HWVA 1WA9A 1PWCA 1L0GA 3LEQA 3O87A 3NOPC 4MN7A 1Q2PA 4MDZA 2GJ3A 3NOTC 4LV3A 2HJEA 4O8GA 1WE4A 3GRJA 2NUTC 1K56D 2EXAA 5FQQA 1MWUA 1XJ3A 5DTTA 1L3LA 2K7SA 2XA7S 5AQBA 1PRQA 4EV4A 1PI5A 2W1TA 2XLNA 2ZQCA 3CJMA 4WMCA 3E4PA 4BL3A 1GA9A 1XA7A 2Y2GA 1KGEA 3QNCA 1MWTA 3B33A 4E6WA 1XFNA 3HBRA 4B4XA 4B9OA 5HL1A 5L2FA 3Q7ZA 1MKIA 4X56A 5KSCA 3HJKA 5DJTA 3BFCA 1SKOA 5HD3A 3S7OA 1E3UA 2ZL1B 3V3SA 2C6WB 3OZHA 5HDCA 5M18A 5F83A 1CJFA 2EFXA 2Y4AA 5EM1A 1WYBA 1K6SA 3T1QB 1S6RA 5GLCA 1MC0A 2A49A 2KOIA 4P6BA 3K3DA 3KYEA 2ZMFA 5FDHA 4EETB 3O5YA 4YWZA 4KZ5A 2PAVP 4GHIA 1K57C 1BSGA 3V39A 4HOIA 5HAPA 1JVJA 3MZFA 3OBFA 1NJ4A 3E4QA 3SS5A 3MSHA 4CLCA 3PTEA 3JVVA 4LV0A 4B4ZA 1SDNA 1T19A 2ZQ7A 5CEBA 3T4KA 2Y2HA 4IUKA 3A3EA 1DRMA 4K08A 3B3XA 3CHWP 5HSQA 1ERQA 3D3OA 3KSIA 3VFFA 3HLBA 1D7EA 2DCFA 4Y0UA 4CQHA 4S2NA 5I5LA 4OLGA 4OP8A 3ZQ5A 3M6HA 3MKFA 2ZC7A 5MC7A 2BTFP 3SH8A 2DMWA 3AGEA 3BLMA 2PHYA 1TS7A 2JBFA 5J3WA 4S2KA 2XA7M 5HWTA 4KZ8A 4BJPA 3LR5A 4GKUA 1LI0A 1PZPA 1TS8A 5GLBA 3T4SA 3VOYA 3HJIA 3UE1A 3CI6A 1LSVA 4MBFA 4BBUA 2W1RA 2WAFA 2M7VA 4E3LA 3VOZA 4B93A 3A3IA 4E04A 5G4YA 4FTXA 3ISGA 4RX2A 3P7NA 1NZOA 3D4FA 1A0KA 2W3HA 3IWIA 3A3JA 1KVLA 1ZG6A 5CHMA 2HZ5A 2WZZA 5TBMB 4OPQA 1G6OA 1N9BA 4WMCD 3PBOA 3Q7VA 4NEED 4IHQA 1CI8A 3B42A 2B5RA 1K25A 2ZOHA 1KDWA 2I72A 2VLGA 4HP4A 4PKYG 5JYOA 4UAAA 4PM8A 4XUXA 1VEUB 2HP6A 2JKTI 1H0MA 3UNWA 1TDLA 1YLWA 3HREA 5J4EA 2VGKA 1BLPA 2WGWB 2OLVA 5KIZA 4DXBA 4WEKA 4ZBEA 1YLZA 4LCLA 4ZJ1A 5FI6A 2RL3A 5FQMA 3IXDA 1NWZA 1T1CA 3ULFA 5J8XA 3G30A 3DTMA 1LT0A 3KYQA 4WYYA 1BULA 3EGDC 4MCWA 3IX8A 3NCKA 4EBLA 3TRCA 3LIAA 3O3VA 5EOOA 1I2SA 4GD8A 1NYYA 4UA6A 5EVIA 1Y54A 3QNBA 1G68A 1L2SA 5FAOA 2EA9A 3LICA 2H5SA 5EVIC 1X0OA 2V8FA 3GMWA 5KZHA 4S2IA 1PFLA 3NDGA 4Y13A 1VM1A 1SCWA 3CAXA 4WN5A 4A5RA 2H0TA 3OCLA 4HBTA 3CLOA 3EEHA 4Z1WA 2V2FF 3UY6A 1ERMA 2Q9MA 5E2GA 1W5DA 4N9KA 4UA9A 5E43A 3CWFA 2GNXA 1RGZA 3MFDA 3QHYA 5EPHA 3EGXC 4HHDA 3JVUA 2XROA 2OLUA 4DMZA 3R7WB 1FCNA 2JKGA 3OPPA 4P87A 4PM7A 2ZC3B 4BENA 1HZOA 5F1GA 2JKTM 1NYMA 1XJ6A 2WGVA 3C7VA 2WADA 3LGOA 4U3TA 1OTIA 1P97A 4NG2A 3IF5A 1I5QA 3ZHHA 1OJGA 1MKMA 2HDQA 1ESIA 3PHYA 2HF6A 2Y2IA 3DWKA 1GCEA 4FUWA 3T1XA 2BASA 2IWBA 4DE0A 2ZQ8A 4R6LA 1K55A 4OQGA 2PBYA 2P9VA 3TOIA 3F1NB 1HTZA 2XR0A 4LV2A 1O7EA 2HV1A 2LB5A 2VV6A 3N8RA 4E3KA 3W4QA 4R23A 4XT2A 1XFQA 3UO9A 3WS1A 4R1GA 4LRYC 1N4OA 3N8LA 2JHEA 1PWDA 2O99A 5EVIB 4RQ9A 3UE6A 4C6YA 1GHMA 4E3OA 3T4LA 3UB5P 2RCXA 4NKPA 2VK3A 3C2WA 1T1AA 1H5XA 3A3FA 2GDNA 4WEJA 1H3QA 3PAGA 3C8CA 5A8BA 1F5MA 4Y5FA 1OT9A 2XD1A 2HDSA 1D06A 1YKDA
chains in the Genus database with same CATH topology
1XJ3A 3A0VA 2YKFA 3C30A 3EOIA 4HJ3A 4WL9A 4WELA 3LI9A 1IOUA 2INWA 3T50A 3KYZA 3H7WB 2JKRI 5F5YA 1ODVA 2K7SA 4QPRA 2V1BA 2WKRA 2XA7S 5HDSA 2OAP1 4EU0A 5DKKA 2OOLA 5F6AA 2W1TA 2H28A 3V67A 3PBNA 3EEAA 3UB9A 5LBRA 4UEYA 5G4ZA 2O9CA 4HJ4A 3E4PA 3EQVA 3FG8A 5IU1A 2I9VA 4ARZA 2L4RA 2EWVA 3B33A 4I5SA 1XFNA 1NRJA 3D72A 2A24B 3BQ8A 4GLQA 4NXBA 4B9OA 1LL8A 5DF9A 2J3TC 5EFWA 3E0YA 3HJKA 5DJTA 4YNRA 3BW6A 5HD3A 3MF0A 3S7OA 3MJQA 4OOMA 4EW7A 2Y8HA 3U2AA 4WLAA 2HGVA 4MMNA 2QWSA 5HDCA 5DFYA 3R7WA 3KX0X 3F1OA 3T4OA 2D02A 4KUOA 4F3LB 4IJGA 4WF0A 3VE4A 3R4KA 2O9AA 5HPFA 5DJUA 4PHTA 3C38A 4I38A 1MC0A 1OJ5A 2KDKA 3B47A 2VGLM 2KOIA 2Y79A 3K3DA 4GJ4A 1P0ZA 2ZMFA 4R70A 4ETXA 1H8MA 2Z6DA 1G28A 4G3KA 1W63Q 4EETB 3O5YA 3PYPA 2QKPA 1DP6A 4YWZA 2PYPA 3IS2A 2KLIA 4GHIA 3F1NA 4HOIA 2ZOIA 3OBFA 2CMNA 4JGRA 5F68A 3SW1A 1YSQA 2VKSA 3E4QA 3LI8A 5TJJA 4CLCA 1UWPX 3JVVA 3CITA 1T1BA 1T19A 3T4KA 2VZWA 2EWWA 3GDIA 4IUKA 1DRMA 2P7JA 4K08A 4Q0IA 2PT7A 2VA0A 2QHKA 4O01A 4NXGA 2JKRM 5HSQA 2K31A 1DP8A 3D3OA 1S67L 3KSIA 2GZAA 1D7EA 3LIDA 1N9LA 2D01A 4I3JA 2OAQ1 4CQHA 5I5LA 2XRNA 3LR0A 4H6JB 2O9BA 4PAUA 4BWIA 2JN7A 1YAXA 3LR4A 3ZQ5A 4HH3A 5AVEA 4GS9B 1UWNX 5MC7A 2VX8A 4P6ZS 3LIFA 2QYBA 3PBRA 3UMDA 4GCZA 3CUEA 3UB6A 2DMWA 4R38A 2PHYA 1TS7A 4JGOA 1P9WA 3FC7A 5J3WA 2XA7M 5HWTA 4HP9A 4BJPA 3VV4A 4HIAA 3LR5A 2NUPC 3RFBA 1TS8A 1XJ2A 3KSHA 2XSSA 3T4SA 3EWKA 3CUEC 4ARZB 3HJIA 3CI6A 1LSVA 4BBUA 2W1RA 4EEUA 3UB7A 3MMHA 4EERA 4IUHA 3UMEA 1ZHHB 3H9WA 2K2NA 2M7VA 3FPVA 2FZ0A 2L1MA 5F69A 2HJ9C 1TS6A 2J3WA 1DP9A 5IT5A 4B93A 1TS0A 4E04A 5G4YA 2WKPA 1JNUA 4I3AA 5K5BA 1BYWA 3G6OA 3OCNA 3P7NA 5HL6A 3NHQA 4DJ3A 3TW8A 4FOFA 4HI4A 4Y2FA 2W3HA 2V0UA 3OOVA 2M1CA 4DJ2A 2R78A 2ZMVA 3P01A 3PXPA 4NXFA 2A24A 5TBMB 1G6OA 4BMWA 2J3TD 3PBOA 4L9EA 1OT6A 4KUKA 4NEED 4IHQA 3B42A 3IBJA 1UGUA 2W3DA 3UE3A 1S1YA 2ZOHA 3E98A 4ME4A 2QJ5A 4L0LA 3LIBA 1MZUA 4HP4A 2VLGA 4PKYG 4EUVA 4UQIM 1GSXA 2JKTI 2OWHA 4Q0JA 3S7NA 5J4EA 4L9GA 1GSWA 3FPWA 4XT2B 2PYRA 5FL3A 1T18A 5KIZA 3W2ZA 4WEKA 1TF1A 4EESA 3NOUC 4LRZE 4HJ6A 3VOLA 3OC2A 1T1CA 1NWZA 2FH5A 3F1PB 2W3FA 3ULFA 4M4XA 4EQ1A 4FSFA 3LUQA 2L0WA 1LT0A 3KYQA 1W63M 4HH2A 1S4RA 3K3CA 2WKQA 3EGDC 3KO6A 1VB6A 4MCWA 4KQOA 5DFXA 3LIEA 4JGQA 3UB8A 3BY8A 3TRCA 3LIAA 3DBAA 2VJWA 4G3WA 4CLCC 3BQAA 3S7PA 5C5KA 4ZRRA 2MJ6A 1S66L 2V1AA 4Q0HA 2IA2A 5L8MA 5HZHA 1OTAA 3RH8B 2EA9A 2GX5A 1XJ4A 3LICA 1X0OA 3LYXA 3PR6A 3ZYTA 2QJ7A 2ZBBA 5IS1A 2P04A 2W1TB 3E4OA 2W3GA 4P6ZM 3CAXA 2LB9A 1IFQA 4WN5A 2PD8A 4O0PA 3H82A 3OCLA 3CLOA 3EEHA 4H6JA 5DKLA 4Z1WA 4CLCE 1OTDA 1OTBA 1V9ZA 4KQDA 3MFXA 5HWWA 4GS9A 3H7WA 3A0RA 3PBQA 3MQ0A 3MR0A 4MN5A 1Y28A 4BBVA 4R3AA 2P08A 3T4TA 4OOLA 2M7UA 4EEPA 2PDRA 3KSFA 3CWFA 3GECA 2VV8A 2B18A 1F98A 3LR3A 2GNXA 1VHMA 3BY9A 3EGXC 1N9NA 4HHDA 3OLOA 4PKYA 4HQAA 3JVUA 2J80A 2XROA 4DMZA 3R7WB 3PBSA 4YOFA 3BJNA 3F1OB 2PR5A 1P9RA 2JKTM 1XJ6A 3LFVA 1S1ZA 3MXQA 1OTIA 1P97A 1OPXA 2V9AA 1TD5A 1OJGA 2V0WA 3IBRA 2W3EA 3MQOA 1MKMA 1ZTUA 3BWLA 3NJAA 2W0NA 3PHYA 2HF6A 2W27A 3KSGA 4AFIA 1F9IA 3TE8A 5TBMA 2BASA 5AVFA 4I3IA 4LPZA 4II7A 4UQIS 4Y3IA 5HDDA 4R6LA 3IS2B 3T4QA 5HD5A 4F3LA 4BBTA 2Z6CA 2VGLS 3ICYA 3PBTA 4GHIB 3F1NB 3S7QA 4I39A 1V9YA 4G3VA 3RTYA 2A2LA 1NLZA 5J7EA 2VV7A 1OTEA 1EW0A 2HV1A 1KOUA 2LB5A 2VV6A 3TJZC 4CLCB 4GW9A 1LSWA 3K2NA 4MN6A 4XT2A 1XFQA 2B02A 4EXOA 3MQQA 4JGPA 4LRYC 5KSHA 5HPIA 2PR6A 3EQUA 4HNBA 2PD7A 2JHEA 2O99A 1S4SA 4ETZA 4RQ9A 2VEAA 3VE3A 3UE6A 1N9OA 5AJGA 3F1PA 3HCYA 4L9FA 4LRXC 2KX6A 3T4LA 2YKHA 2OWJA 4NKPA 4DN0A 1NLYA 5HWVA 1LSXA 3C2WA 1WA9A 1T1AA 4HY8A 4WEJA 3NOPC 3T4JA 1H3QA 1GSVA 4MN7A 3C8CA 5A8BA 1F5MA 2G7UA 4MDZA 1YSPA 2GJ3A 3NOTC 5CX7A 2HJEA 4O8GA 4Y5FA 2O0YA 4NXEA 2NUTC 3A0SA 4CLCD 1OT9A 3H82B 4LLOB 1D06A 1YKDA 4WUJA 1STZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ3 A;  3A0V A;  2YKF A;  4HJ3 A;  4WL9 A;  3LI9 A;  2INW A;  3T50 A;  3H7W B;  5F5Y A;  1ODV A;  2K7S A;  2V1B A;  2WKR A;  5HDS A;  5DKK A;  2OOL A;  5F6A A;  2H28 A;  3UB9 A;  5G4Z A;  4HJ4 A;  3E4P A;  3FG8 A;  5IU1 A;  2I9V A;  2L4R A;  3B33 A;  4I5S A;  1XFN A;  3D72 A;  2A24 B;  4NXB A;  4B9O A;  1LL8 A;  5EFW A;  3HJK A;  5DJT A;  5HD3 A;  3MJQ A;  4EW7 A;  4WLA A;  2QWS A;  5HDC A;  3KX0 X;  3F1O A;  2D02 A;  4KUO A;  4F3L B;  4WF0 A;  3VE4 A;  5DJU A;  4I38 A;  1OJ5 A;  2KDK A;  3K3D A;  1P0Z A;  4R70 A;  2Z6D A;  1G28 A;  4EET B;  3PYP A;  2QKP A;  1DP6 A;  4YWZ A;  2PYP A;  3IS2 A;  4GHI A;  3F1N A;  4HOI A;  2ZOI A;  4JGR A;  2CMN A;  5F68 A;  3SW1 A;  3E4Q A;  3LI8 A;  1UWP X;  1T1B A;  1T19 A;  3GDI A;  1DRM A;  2P7J A;  4K08 A;  2QHK A;  4NXG A;  5HSQ A;  1DP8 A;  1S67 L;  1D7E A;  3LID A;  1N9L A;  2D01 A;  4I3J A;  5I5L A;  4H6J B;  2JN7 A;  3ZQ5 A;  4HH3 A;  5AVE A;  4GS9 B;  1UWN X;  3LIF A;  3UMD A;  4GCZ A;  3UB6 A;  4R38 A;  2PHY A;  1TS7 A;  4JGO A;  3FC7 A;  5J3W A;  5HWT A;  4HP9 A;  4HIA A;  1TS8 A;  1XJ2 A;  3EWK A;  3HJI A;  1LSV A;  4BBU A;  4EEU A;  3UB7 A;  4EER A;  3UME A;  3H9W A;  2L1M A;  5F69 A;  1TS6 A;  1DP9 A;  1TS0 A;  4E04 A;  5G4Y A;  2WKP A;  1JNU A;  4I3A A;  1BYW A;  3G6O A;  3P7N A;  3NHQ A;  4DJ3 A;  4HI4 A;  2V0U A;  2M1C A;  4DJ2 A;  2R78 A;  4NXF A;  2A24 A;  5TBM B;  4L9E A;  1OT6 A;  4KUK A;  1UGU A;  1S1Y A;  2ZOH A;  2QJ5 A;  3LIB A;  1MZU A;  4HP4 A;  2VLG A;  4PKY G;  1GSX A;  2OWH A;  5J4E A;  4L9G A;  1GSW A;  4XT2 B;  2PYR A;  1T18 A;  5KIZ A;  4EES A;  3NOU C;  4LRZ E;  4HJ6 A;  3VOL A;  1T1C A;  1NWZ A;  3F1P B;  3ULF A;  4M4X A;  4EQ1 A;  3LUQ A;  2L0W A;  1LT0 A;  4HH2 A;  1S4R A;  3K3C A;  2WKQ A;  1VB6 A;  3LIE A;  4JGQ A;  3UB8 A;  3BY8 A;  3LIA A;  1S66 L;  2V1A A;  5HZH A;  1OTA A;  3RH8 B;  2EA9 A;  1XJ4 A;  3LIC A;  1X0O A;  3LYX A;  2QJ7 A;  2ZBB A;  5IS1 A;  3E4O A;  3CAX A;  4WN5 A;  2PD8 A;  3H82 A;  3CLO A;  3EEH A;  4H6J A;  5DKL A;  1OTD A;  1OTB A;  1V9Z A;  4KQD A;  3MFX A;  5HWW A;  4GS9 A;  3H7W A;  3A0R A;  3MR0 A;  4MN5 A;  1Y28 A;  4BBV A;  4R3A A;  4EEP A;  2PDR A;  3CWF A;  3GEC A;  2VV8 A;  1F98 A;  3BY9 A;  1N9N A;  4HHD A;  3OLO A;  4PKY A;  4HQA A;  2J80 A;  3F1O B;  2PR5 A;  1XJ6 A;  1S1Z A;  3MXQ A;  1OTI A;  1P97 A;  2V9A A;  2V0W A;  1OJG A;  3IBR A;  3MQO A;  3BWL A;  3NJA A;  2W0N A;  3PHY A;  2W27 A;  1F9I A;  5TBM A;  2BAS A;  5AVF A;  4I3I A;  4LPZ A;  5HDD A;  4R6L A;  3IS2 B;  4F3L A;  5HD5 A;  4BBT A;  2Z6C A;  3ICY A;  4GHI B;  3F1N B;  4I39 A;  1V9Y A;  3RTY A;  5J7E A;  2VV7 A;  1OTE A;  1EW0 A;  2HV1 A;  1KOU A;  2VV6 A;  4GW9 A;  1LSW A;  4MN6 A;  4XT2 A;  1XFQ A;  2B02 A;  4EXO A;  3MQQ A;  4JGP A;  4LRY C;  2PR6 A;  4HNB A;  2PD7 A;  2JHE A;  1S4S A;  4RQ9 A;  2VEA A;  3VE3 A;  3UE6 A;  1N9O A;  3F1P A;  4L9F A;  4LRX C;  2KX6 A;  2YKH A;  2OWJ A;  5HWV A;  1LSX A;  3C2W A;  1WA9 A;  1T1A A;  4HY8 A;  3NOP C;  1GSV A;  3C8C A;  5A8B A;  2GJ3 A;  3NOT C;  4NXE A;  3A0S A;  1OT9 A;  3H82 B;  4LLO B;  1D06 A;  4WUJ A; 
#chains in the Genus database with same CATH topology
 1SHV A;  4OPR A;  3A0V A;  2YKF A;  1F2K A;  3EOI A;  4WEL A;  4E3N A;  2INW A;  3KYZ A;  3HLW A;  3GQZ A;  5EVI D;  5JYP A;  2XGN A;  5HDS A;  2OAP 1;  5DKK A;  2OOL A;  4JXG A;  3V5M A;  4LFU A;  3V67 A;  2DNS A;  3PBN A;  4MLL A;  2ACG A;  4UEY A;  4HJ4 A;  3FG8 A;  4Y0T A;  2I9V A;  2V1Z A;  4I5S A;  1PW8 A;  1Q2Q A;  4DF6 A;  2A24 B;  4NXB A;  5EOE A;  1LL8 A;  2ZLY A;  3DTI A;  2J3T C;  1WYC A;  2PU2 A;  3BFD A;  3E0Y A;  2X01 A;  1IYS A;  3MF0 A;  3MJQ A;  5FQ9 A;  2Y8H A;  3IX4 A;  4WLA A;  4X6T A;  2QWS A;  3IF6 A;  5DFY A;  3KX0 X;  3SS4 A;  1ESU A;  1LHY A;  3F1O A;  5FEF A;  3G31 A;  1JWZ A;  2BG1 A;  3T4O A;  3VMA A;  2D02 A;  4KUO A;  4WF0 A;  5HPF A;  4OKP A;  2JCH A;  3JYI A;  4RX3 A;  2KDK A;  4JLF A;  2Y79 A;  4ZAM A;  4DE2 A;  4GJ4 A;  3WWX A;  1H8M A;  2Z6D A;  1G28 A;  2WKH A;  3C4P A;  5GHZ A;  3PYP A;  1DP6 A;  3IS2 A;  2ZOI A;  1LLB A;  4NET A;  1EWZ A;  1YPR A;  2CMN A;  4GOG A;  4JGR A;  3JPU A;  3P09 A;  1Z6F A;  5TJJ A;  3CIT A;  1T1B A;  1CEG A;  2VZW A;  1QMF A;  5CER A;  2Q0O A;  1FCM A;  2ZM0 A;  4JXS A;  5E2E A;  3AGD A;  1PZO A;  1MXO A;  1K54 A;  2K31 A;  1N9L A;  3BEC A;  3N6I A;  3LR0 A;  2EX2 A;  2O9B A;  2XFT A;  1YAX A;  3LR4 A;  4HH3 A;  1PI4 A;  1UWN X;  2OSU A;  3TSG A;  3S22 A;  3LIF A;  3PBR A;  3CUE A;  1LL5 A;  3UB6 A;  3Q1F A;  3FKW A;  1IYQ A;  1P9W A;  3FC7 A;  1OME A;  5TFQ A;  3I7J A;  4KZ6 A;  1BZA A;  3CUE C;  3MXR A;  3DW0 A;  1DJC A;  4EEU A;  1SDE A;  5FAP A;  5F69 A;  4EWF A;  2X71 A;  5IT5 A;  3BFF A;  1JNU A;  5K5B A;  1YLY A;  4Q8I A;  4FOF A;  4BD0 A;  4X68 A;  4HI4 A;  4Y2F A;  3VSK A;  5GLA A;  3GR2 A;  5KMW A;  1VET A;  4R3J A;  5AQ7 A;  2R78 A;  3P01 A;  4P85 A;  1AXB A;  4BMW A;  2J3T D;  5CHU A;  3VP3 A;  5GHY A;  4BD1 A;  4WZ5 A;  1M6K A;  4M3K A;  2ZQA A;  3ITB A;  5HAQ A;  4S2M A;  2EX9 A;  2JE5 A;  1VQQ A;  3HVF A;  4UQI M;  3UDF A;  3A3D A;  1YLT A;  4Q0J A;  2OWH A;  4Y7P A;  2Y2Q A;  1BLC A;  1CF0 A;  3UPP A;  3E2K A;  3FPW A;  4YIN A;  1XKZ A;  2PYR A;  1SZV A;  3S4X A;  3C7U A;  4IED A;  4ZJ2 A;  2CC1 A;  4R4S A;  4HJ6 A;  5DTK A;  4M4X A;  4FSF A;  3LUQ A;  4UA7 A;  2L0W A;  4DXC A;  1BLH A;  4XXR A;  1S4R A;  3KO6 A;  3DTK A;  4KQO A;  5DFX A;  3NEC A;  1KE3 A;  4JGQ A;  5DF7 A;  3BY8 A;  3DBA A;  1TEM A;  3NUL A;  4CLC C;  3S7P A;  5C5K A;  3BEB A;  3IWQ A;  4EQI A;  2V1A A;  4Q0H A;  3IH8 A;  4HBU A;  5HZH A;  3WRZ A;  1OTA A;  4E6X A;  2GX5 A;  5EUA A;  3LYX A;  4EUZ A;  3UE0 A;  5FAT A;  4R0Q A;  1YMS A;  2ZBB A;  3Q07 A;  2P04 A;  2W1T B;  4S2N C;  3E4O A;  2W3G A;  3HUN A;  5M1A A;  4R3B A;  4H6J A;  2EX8 A;  2Y55 A;  3Q81 A;  4CLC E;  5HX9 A;  1OTB A;  4IBX A;  4GS9 A;  4HES A;  3H7W A;  4JXW A;  4BBV A;  3V50 A;  1Y28 A;  4LGW A;  3T4T A;  4ZDX A;  1JTD A;  4EEP A;  2VV8 A;  1SKO B;  1DY6 A;  3LR3 A;  3BLS A;  1ONG A;  1VHM A;  3BY9 A;  4HQA A;  5CTM A;  1PYY A;  2PR5 A;  2Z2L B;  3Q82 A;  2DRW A;  3IHB A;  1IKI A;  3HLC A;  4OQI A;  1S1Z A;  3C4O A;  4GB7 A;  1ZKJ A;  3CZD A;  5AQ9 A;  3IBR A;  4JKT A;  3HLD A;  3NJA A;  5HFO A;  4WBG A;  2W27 A;  3KSG A;  4AFI A;  1F9I A;  4GNU A;  5CTN A;  1PW1 A;  4Y3I A;  5HDD A;  4F3L A;  5HD5 A;  1W7F A;  3AGF A;  2Z6C A;  2VGL S;  1E3U D;  3ICY A;  3UDI A;  1YT4 A;  4BBT A;  4GHI B;  4E3J A;  3GV9 A;  4I39 A;  4OQH A;  1IEM A;  1NLZ A;  4JF6 A;  3ZVT A;  4CJN A;  3WS0 A;  2FFF B;  3TJZ C;  4CLC B;  3IX3 A;  4GW9 A;  3FZC A;  2WAE A;  2UV0 E;  4MN6 A;  2QMI A;  3ZG7 B;  1XA1 A;  5KSH A;  4S2P A;  5HPI A;  4B88 A;  4HNB A;  2ZMA A;  5FQI A;  4PMA A;  1ES2 A;  2VEA A;  3VE3 A;  2WGI A;  3QP5 A;  4D2O A;  1N9O A;  2HP9 A;  3F1P A;  4JF5 A;  4L9F A;  2KX6 A;  2YKH A;  2OWJ A;  1K0K A;  4KG6 A;  5HAI A;  1I2W A;  4JBF A;  1LSX A;  3TG9 A;  5E2F A;  1MBL A;  4HY8 A;  3IT9 A;  3T4J A;  2Y2K A;  1CEF A;  2AVX A;  4GD6 A;  3ZGA B;  1K4E A;  1PNE A;  4RYE A;  1L0E A;  2H10 A;  3MZE A;  1FSW A;  5A90 A;  1YSP A;  4HEF A;  4ESP A;  4NXE A;  4JXV A;  4CLC D;  3HL9 A;  1IKG A;  3HLG A;  4LLO B;  1YLP A;  4PM6 A;  3QP8 A;  1XP4 A;  2ZQD A;  3C30 A;  4HJ3 A;  3V3R A;  3LI9 A;  1LI9 A;  1SKF A;  3H7W B;  5F5Y A;  4QPR A;  2V1B A;  2PRF A;  4O7D A;  4EU0 A;  3FV7 A;  4PM9 A;  4K0W A;  4GN2 A;  3BRM A;  3EEA A;  3UB9 A;  5LBR A;  5G4Z A;  2O9C A;  4H8R A;  5IU1 A;  4KG5 A;  4OOY A;  2L4R A;  2EWV A;  3LCE A;  3CPT A;  2Y59 A;  1PIO A;  3VP1 A;  5DF9 A;  3Q7V B;  2J8Y A;  1ACF A;  3SH9 A;  4EW7 A;  4K0X A;  3U2A A;  3ZG8 B;  1H8Y A;  4JPM A;  5FAQ A;  4F3L B;  2C5W B;  3VE4 A;  1ONH A;  3R4K A;  5DJU A;  4PHT A;  3C38 A;  1FCO A;  3M2K A;  1YLJ A;  5EVE A;  2VGL M;  4JF4 A;  3N7W A;  4KZB A;  1K6R A;  4R70 A;  4ETX A;  3QP6 A;  4G3K A;  1RGY A;  1K55 C;  4UHU A;  5EM0 A;  1KVM A;  3NI9 A;  2KLI A;  4K91 A;  4QU3 A;  4QWO A;  2VKS A;  2ZC6 B;  3BFE A;  2P74 A;  1K56 A;  1ZG4 A;  3RXX A;  4N9L A;  2EWW A;  3GDI A;  4ID4 A;  4F94 A;  3NC8 A;  2P7J A;  3MS6 A;  4Q0I A;  5CGS A;  2PT7 A;  2VA0 A;  2QHK A;  3NDE A;  5DTS A;  4O01 A;  3NY4 A;  1DP8 A;  2GZA A;  3LID A;  3C5A A;  4I3J A;  2OAQ 1;  1E25 A;  2QZ6 A;  4BWI A;  2JN7 A;  4X25 A;  5AVE A;  2ZD8 A;  3MBZ A;  4Y17 A;  2VX8 A;  4P6Z S;  2QYB A;  4GCZ A;  1QME A;  4JGO A;  5A92 A;  4X55 A;  3HLE A;  1RCJ A;  5GLD A;  3RJU A;  4HP9 A;  3VV4 A;  4HIA A;  2NUP C;  5U47 A;  1XJ2 A;  1TVF A;  1XPB A;  3KSH A;  1XGI A;  3ITA A;  4EER A;  1ZHH B;  2K2N A;  3FYZ A;  2WYX A;  3FPV A;  2J3W A;  1DP9 A;  2FFY A;  1LL9 A;  1TS0 A;  5L09 A;  4I3A A;  3NBL A;  5F82 A;  5CED A;  1J9M A;  1BYW A;  3G6O A;  3NHQ A;  4DJ3 A;  1HD8 A;  2H0Y A;  3VP0 A;  3OOV A;  3T1R A;  4DJ2 A;  2ZMV A;  3PXP A;  4OP5 A;  3IXB A;  3UPN A;  1MY8 A;  2P9V B;  1ZC2 A;  1FSY A;  1CI9 A;  3MXS A;  3IBJ A;  1UGU A;  2W3D A;  1XX2 A;  3E98 A;  1ERO A;  5L07 A;  3IF6 C;  2QJ5 A;  4L0L A;  3LIB A;  1MZU A;  5G18 A;  4EUV A;  1FIL A;  1GSX A;  1D1J A;  1Z09 A;  3IHA A;  3S7N A;  4XT2 B;  5DF8 A;  5FL3 A;  1W8Y A;  3OPH A;  3W2Z A;  4BQM A;  1TF1 A;  2XK1 A;  3NOU C;  1YMX A;  1FR6 A;  4LRZ E;  2XDM A;  1S0W A;  2FH5 A;  2W3F A;  1NRF A;  4EQ1 A;  4OH0 A;  1W63 M;  4HH2 A;  1K4F A;  2WZX A;  3GSG A;  5E2H A;  1GHI A;  5GL9 A;  4KZ3 A;  5EEC A;  5GHX A;  4G3W A;  3BQA A;  5AQA A;  2XD5 A;  5EV0 A;  1S66 L;  4QJG A;  4OLD A;  3VP4 A;  4FH2 A;  2IA2 A;  1ES4 A;  4KQR A;  4YFM A;  1BLS A;  1K54 C;  2UWX A;  3G2Y A;  4C3Q A;  3PR6 A;  3CG5 A;  3FKV A;  1KE0 A;  3DAV A;  5IS1 A;  4MNR A;  4P6Z M;  2LB9 A;  1IFQ A;  2PD8 A;  3H82 A;  2EFU A;  1C3B A;  3ZVW A;  2R9X A;  1HVB A;  4E3I A;  5DKL A;  1IYO A;  1V9Z A;  3PAE A;  4KQD A;  5HWW A;  4MEZ A;  2EXB A;  3A0R A;  3PBQ A;  3BYD A;  3MQ0 A;  4R3A A;  4OOL A;  2M7U A;  3ZG5 A;  3SS3 A;  2WUQ A;  4FH4 A;  4P0M A;  3KSF A;  3GEC A;  3LEZ A;  2B18 A;  3QP2 A;  1F98 A;  2JC7 A;  3N4I A;  1NZU A;  1N9N A;  3OLO A;  2J80 A;  3IF6 B;  3PBS A;  3BJN A;  3F1O B;  1FIK A;  5EE8 A;  1P9R A;  3UN7 A;  3CMZ A;  1IEL A;  3D9Y A;  1ES5 A;  1MPL A;  2VGJ A;  4KG2 A;  5FQK A;  1OPX A;  2V9A A;  1TD5 A;  4OVD A;  2W3E A;  3UPO A;  3G32 A;  3W8K A;  1NXY A;  4OON A;  1KE4 A;  3TE8 A;  5TBM A;  4WZ5 C;  4I3I A;  4LPZ A;  3T4Q A;  2Y2J A;  5CEC A;  3IS2 B;  3PBT A;  3IH9 A;  4EBN A;  4PM5 A;  1V9Y A;  3RTY A;  5TGF A;  3W4P A;  5J7E A;  3L9K A;  2VV7 A;  1K57 A;  1EW0 A;  4IVI A;  1KOU A;  1VEU A;  1LSW A;  3K2N A;  3HUO A;  3ZG9 B;  4WZ4 A;  4EXO A;  3MQQ A;  5FDS A;  2WGW A;  2PR6 A;  3EQU A;  2BLS A;  4C75 A;  5DVA A;  4ZTK A;  5TR7 A;  5AJG A;  2HDU A;  4DN0 A;  1NLY A;  2Y2N A;  1JWP A;  2ZM8 A;  3OPR A;  1GSV A;  4DDY A;  4RVA A;  1RP5 A;  3WS5 A;  2G7U A;  5CX7 A;  2O0Y A;  4ZJ3 A;  4Z9Q A;  2E8I A;  3A0S A;  3T12 B;  3H82 B;  2ZC4 B;  4WUJ A;  1STZ A;  3G4P A;  3HUM A;  4WL9 A;  1IOU A;  2WKE A;  1BUE A;  3T50 A;  5I94 A;  3RXW A;  4S2L A;  2JKR I;  1EI5 A;  1ODV A;  2WKR A;  5M19 A;  3W4O A;  3NIA A;  3O88 A;  5FA7 A;  5F6A A;  2H28 A;  5CGX A;  2X02 A;  4Y15 A;  2XFS A;  1GA0 A;  3EQV A;  2ZC5 B;  1J3W A;  1E4D A;  4ARZ A;  1M40 A;  1VET B;  3SZT A;  1FR1 A;  1NRJ A;  3D72 A;  4OQ0 A;  1W8Q A;  3BQ8 A;  4GLQ A;  4DDS A;  5EFW A;  3DTE A;  4QHC A;  4IBR A;  5CGW A;  4YNR A;  3IWO A;  2PBD P;  4N92 A;  4KEN B;  4OPY A;  1YM1 A;  4X53 A;  3BW6 A;  2XEP A;  4OOM A;  4X1M A;  2HGV A;  4MMN A;  1ES3 A;  3R7W A;  3WS2 A;  1XXM A;  3BFG A;  5F1F A;  4IJG A;  2O9A A;  4DRT A;  2G2U A;  1KGF A;  1IYP A;  4I38 A;  1OJ5 A;  3B47 A;  2V20 A;  1P0Z A;  4E3M A;  1FOF A;  3DWZ A;  5HAR A;  4QD4 A;  1W63 Q;  2QKP A;  3ZCZ A;  2PYP A;  4FCF A;  3IXG A;  3LY3 A;  4EBP A;  3O86 A;  3SOI A;  1L0D A;  3F1N A;  2HDR A;  4FD8 A;  3LO7 A;  2IWD A;  5F68 A;  1AWI A;  3SW1 A;  1YSQ A;  2PU4 A;  3LI8 A;  1UWP X;  2E8J A;  3G34 A;  4NK3 A;  2Y91 A;  2WKI A;  3MKE A;  2B95 A;  1MWS A;  1U60 A;  5FSR A;  4BLM A;  2QPN A;  4QB8 A;  3ZNT A;  4NXG A;  2JKR M;  4MBK A;  1S67 L;  1JTG A;  3M2J A;  2D01 A;  5EVL A;  3G2Z A;  2XRN A;  1O07 A;  4H6J B;  2XQZ A;  2ZQ9 A;  4PAU A;  5CHJ A;  2XF3 A;  2Y2O A;  4GS9 B;  1G5U A;  3UMD A;  3FWL A;  3L7H A;  4R38 A;  4BL2 A;  2HPB A;  4DKI A;  1BT5 A;  2V8C A;  1XGJ A;  3RFB A;  2XSS A;  3EWK A;  3ZFZ A;  4ARZ B;  5BOH A;  3SH7 A;  4LEN A;  4QY6 A;  3T1S A;  3UB7 A;  3MMH A;  4IUH A;  1NY0 A;  3UME A;  3H9W A;  1KDS A;  2J9P A;  4XUZ A;  2FZ0 A;  2L1M A;  2HJ9 C;  1GHP A;  1TS6 A;  1DJB A;  2IWC A;  3IQA A;  3S1Y A;  2WKP A;  1Y4O A;  3OCN A;  5HL6 A;  3TW8 A;  1MWR A;  2EX6 A;  2V0U A;  3HLF A;  5FQJ A;  2M1C A;  4R4R A;  4NXF A;  2A24 A;  2JKF A;  4L9E A;  1OT6 A;  4KUK A;  4KZ7 A;  1HLU P;  3UE3 A;  3ZNY A;  1S1Y A;  4ME4 A;  4LV1 A;  4X69 A;  5FEG A;  3OPL A;  3G35 A;  3LY4 A;  4WM9 A;  4L9G A;  1GSW A;  1L0F A;  4N1H A;  1T18 A;  3GTC A;  4GZB A;  2HP5 A;  4EES A;  3ZDJ A;  4IVK A;  3VOL A;  3OC2 A;  3F1P B;  4KZ4 A;  3QP4 A;  3K3C A;  2WKQ A;  2Y2M A;  1CQA A;  1VB6 A;  4CPK A;  5FI7 A;  1W79 A;  3LIE A;  3UB8 A;  2VJW A;  2R9W A;  4MBH A;  2Y2P A;  1K38 A;  4ZRR A;  2MJ6 A;  3VP2 A;  3WRT A;  4U0X A;  2Z2M B;  3VFH A;  4KQQ A;  5L8M A;  5FAS A;  3RH8 B;  1XJ4 A;  4QY5 A;  4Y0O A;  3ZYT A;  4N1X A;  2J7V A;  2G2W A;  2QJ7 A;  3M6B A;  5A91 A;  1BTL A;  1JWV A;  4O0P A;  4X1L A;  1OTD A;  1ALQ A;  3MFX A;  3CPT B;  2XH9 A;  3UDX A;  3MR0 A;  4MN5 A;  2P08 A;  4DE3 A;  2OV5 A;  2ZJ9 A;  4KZ9 A;  1KGG A;  3BM6 A;  2PDR A;  1G6A A;  5CXW A;  5D3O A;  4PKY A;  4PPR A;  4KZA A;  4YOF A;  4DE1 A;  1FQG A;  1DJA A;  3GVB A;  2Q9N A;  2ZM2 A;  4GDB A;  3LFV A;  5CRF A;  3MXQ A;  4OPZ A;  4S2J A;  2V0W A;  4D60 A;  3MQO A;  1ZTU A;  3BWL A;  4LCM A;  2ZL1 A;  2W0N A;  3N8S A;  3U4L P;  4S2O A;  3ZG0 A;  3E2L A;  5FI2 A;  1PWG A;  4RA7 A;  5AVF A;  4II7 A;  4UQI S;  5A93 A;  3QP1 A;  3VSL A;  1H8Z A;  2WK0 A;  3S7Q A;  4G3V A;  5IHV A;  4U0T A;  2A2L A;  1YQS A;  3MZD A;  1OTE A;  1TDG A;  3WS4 A;  2A3U A;  2B02 A;  4JGP A;  5L10 A;  5HW3 A;  2PD7 A;  1S4S A;  4ETZ A;  2J9O A;  3IXH A;  1CK3 A;  2Y2L A;  3HCY A;  4LRX C;  3P98 A;  4GDN A;  5HWV A;  1WA9 A;  1PWC A;  1L0G A;  3LEQ A;  3O87 A;  3NOP C;  4MN7 A;  1Q2P A;  4MDZ A;  2GJ3 A;  3NOT C;  4LV3 A;  2HJE A;  4O8G A;  1WE4 A;  3GRJ A;  2NUT C;  1K56 D;  2EXA A;  5FQQ A;  1MWU A;  1XJ3 A;  5DTT A;  1L3L A;  2K7S A;  2XA7 S;  5AQB A;  1PRQ A;  4EV4 A;  1PI5 A;  2W1T A;  2XLN A;  2ZQC A;  3CJM A;  4WMC A;  3E4P A;  4BL3 A;  1GA9 A;  1XA7 A;  2Y2G A;  1KGE A;  3QNC A;  1MWT A;  3B33 A;  4E6W A;  1XFN A;  3HBR A;  4B4X A;  4B9O A;  5HL1 A;  5L2F A;  3Q7Z A;  1MKI A;  4X56 A;  5KSC A;  3HJK A;  5DJT A;  3BFC A;  1SKO A;  5HD3 A;  3S7O A;  1E3U A;  2ZL1 B;  3V3S A;  2C6W B;  3OZH A;  5HDC A;  5M18 A;  5F83 A;  1CJF A;  2EFX A;  2Y4A A;  5EM1 A;  1WYB A;  1K6S A;  3T1Q B;  1S6R A;  5GLC A;  1MC0 A;  2A49 A;  2KOI A;  4P6B A;  3K3D A;  3KYE A;  2ZMF A;  5FDH A;  4EET B;  3O5Y A;  4YWZ A;  4KZ5 A;  2PAV P;  4GHI A;  1K57 C;  1BSG A;  3V39 A;  4HOI A;  5HAP A;  1JVJ A;  3MZF A;  3OBF A;  1NJ4 A;  3E4Q A;  3SS5 A;  3MSH A;  4CLC A;  3PTE A;  3JVV A;  4LV0 A;  4B4Z A;  1SDN A;  1T19 A;  2ZQ7 A;  5CEB A;  3T4K A;  2Y2H A;  4IUK A;  3A3E A;  1DRM A;  4K08 A;  3B3X A;  3CHW P;  5HSQ A;  1ERQ A;  3D3O A;  3KSI A;  3VFF A;  3HLB A;  1D7E A;  2DCF A;  4Y0U A;  4CQH A;  4S2N A;  5I5L A;  4OLG A;  4OP8 A;  3ZQ5 A;  3M6H A;  3MKF A;  2ZC7 A;  5MC7 A;  2BTF P;  3SH8 A;  2DMW A;  3AGE A;  3BLM A;  2PHY A;  1TS7 A;  2JBF A;  5J3W A;  4S2K A;  2XA7 M;  5HWT A;  4KZ8 A;  4BJP A;  3LR5 A;  4GKU A;  1LI0 A;  1PZP A;  1TS8 A;  5GLB A;  3T4S A;  3VOY A;  3HJI A;  3UE1 A;  3CI6 A;  1LSV A;  4MBF A;  4BBU A;  2W1R A;  2WAF A;  2M7V A;  4E3L A;  3VOZ A;  4B93 A;  3A3I A;  4E04 A;  5G4Y A;  4FTX A;  3ISG A;  4RX2 A;  3P7N A;  1NZO A;  3D4F A;  1A0K A;  2W3H A;  3IWI A;  3A3J A;  1KVL A;  1ZG6 A;  5CHM A;  2HZ5 A;  2WZZ A;  5TBM B;  4OPQ A;  1G6O A;  1N9B A;  4WMC D;  3PBO A;  3Q7V A;  4NEE D;  4IHQ A;  1CI8 A;  3B42 A;  2B5R A;  1K25 A;  2ZOH A;  1KDW A;  2I72 A;  2VLG A;  4HP4 A;  4PKY G;  5JYO A;  4UAA A;  4PM8 A;  4XUX A;  1VEU B;  2HP6 A;  2JKT I;  1H0M A;  3UNW A;  1TDL A;  1YLW A;  3HRE A;  5J4E A;  2VGK A;  1BLP A;  2WGW B;  2OLV A;  5KIZ A;  4DXB A;  4WEK A;  4ZBE A;  1YLZ A;  4LCL A;  4ZJ1 A;  5FI6 A;  2RL3 A;  5FQM A;  3IXD A;  1NWZ A;  1T1C A;  3ULF A;  5J8X A;  3G30 A;  3DTM A;  1LT0 A;  3KYQ A;  4WYY A;  1BUL A;  3EGD C;  4MCW A;  3IX8 A;  3NCK A;  4EBL A;  3TRC A;  3LIA A;  3O3V A;  5EOO A;  1I2S A;  4GD8 A;  1NYY A;  4UA6 A;  5EVI A;  1Y54 A;  3QNB A;  1G68 A;  1L2S A;  5FAO A;  2EA9 A;  3LIC A;  2H5S A;  5EVI C;  1X0O A;  2V8F A;  3GMW A;  5KZH A;  4S2I A;  1PFL A;  3NDG A;  4Y13 A;  1VM1 A;  1SCW A;  3CAX A;  4WN5 A;  4A5R A;  2H0T A;  3OCL A;  4HBT A;  3CLO A;  3EEH A;  4Z1W A;  2V2F F;  3UY6 A;  1ERM A;  2Q9M A;  5E2G A;  1W5D A;  4N9K A;  4UA9 A;  5E43 A;  3CWF A;  2GNX A;  1RGZ A;  3MFD A;  3QHY A;  5EPH A;  3EGX C;  4HHD A;  3JVU A;  2XRO A;  2OLU A;  4DMZ A;  3R7W B;  1FCN A;  2JKG A;  3OPP A;  4P87 A;  4PM7 A;  2ZC3 B;  4BEN A;  1HZO A;  5F1G A;  2JKT M;  1NYM A;  1XJ6 A;  2WGV A;  3C7V A;  2WAD A;  3LGO A;  4U3T A;  1OTI A;  1P97 A;  4NG2 A;  3IF5 A;  1I5Q A;  3ZHH A;  1OJG A;  1MKM A;  2HDQ A;  1ESI A;  3PHY A;  2HF6 A;  2Y2I A;  3DWK A;  1GCE A;  4FUW A;  3T1X A;  2BAS A;  2IWB A;  4DE0 A;  2ZQ8 A;  4R6L A;  1K55 A;  4OQG A;  2PBY A;  2P9V A;  3TOI A;  3F1N B;  1HTZ A;  2XR0 A;  4LV2 A;  1O7E A;  2HV1 A;  2LB5 A;  2VV6 A;  3N8R A;  4E3K A;  3W4Q A;  4R23 A;  4XT2 A;  1XFQ A;  3UO9 A;  3WS1 A;  4R1G A;  4LRY C;  1N4O A;  3N8L A;  2JHE A;  1PWD A;  2O99 A;  5EVI B;  4RQ9 A;  3UE6 A;  4C6Y A;  1GHM A;  4E3O A;  3T4L A;  3UB5 P;  2RCX A;  4NKP A;  2VK3 A;  3C2W A;  1T1A A;  1H5X A;  3A3F A;  2GDN A;  4WEJ A;  1H3Q A;  3PAG A;  3C8C A;  5A8B A;  1F5M A;  4Y5F A;  1OT9 A;  2XD1 A;  2HDS A;  1D06 A;  1YKD A; 
#chains in the Genus database with same CATH homology
 1XJ3 A;  3A0V A;  2YKF A;  3C30 A;  3EOI A;  4HJ3 A;  4WL9 A;  4WEL A;  3LI9 A;  1IOU A;  2INW A;  3T50 A;  3KYZ A;  3H7W B;  2JKR I;  5F5Y A;  1ODV A;  2K7S A;  4QPR A;  2V1B A;  2WKR A;  2XA7 S;  5HDS A;  2OAP 1;  4EU0 A;  5DKK A;  2OOL A;  5F6A A;  2W1T A;  2H28 A;  3V67 A;  3PBN A;  3EEA A;  3UB9 A;  5LBR A;  4UEY A;  5G4Z A;  2O9C A;  4HJ4 A;  3E4P A;  3EQV A;  3FG8 A;  5IU1 A;  2I9V A;  4ARZ A;  2L4R A;  2EWV A;  3B33 A;  4I5S A;  1XFN A;  1NRJ A;  3D72 A;  2A24 B;  3BQ8 A;  4GLQ A;  4NXB A;  4B9O A;  1LL8 A;  5DF9 A;  2J3T C;  5EFW A;  3E0Y A;  3HJK A;  5DJT A;  4YNR A;  3BW6 A;  5HD3 A;  3MF0 A;  3S7O A;  3MJQ A;  4OOM A;  4EW7 A;  2Y8H A;  3U2A A;  4WLA A;  2HGV A;  4MMN A;  2QWS A;  5HDC A;  5DFY A;  3R7W A;  3KX0 X;  3F1O A;  3T4O A;  2D02 A;  4KUO A;  4F3L B;  4IJG A;  4WF0 A;  3VE4 A;  3R4K A;  2O9A A;  5HPF A;  5DJU A;  4PHT A;  3C38 A;  4I38 A;  1MC0 A;  1OJ5 A;  2KDK A;  3B47 A;  2VGL M;  2KOI A;  2Y79 A;  3K3D A;  4GJ4 A;  1P0Z A;  2ZMF A;  4R70 A;  4ETX A;  1H8M A;  2Z6D A;  1G28 A;  4G3K A;  1W63 Q;  4EET B;  3O5Y A;  3PYP A;  2QKP A;  1DP6 A;  4YWZ A;  2PYP A;  3IS2 A;  2KLI A;  4GHI A;  3F1N A;  4HOI A;  2ZOI A;  3OBF A;  2CMN A;  4JGR A;  5F68 A;  3SW1 A;  1YSQ A;  2VKS A;  3E4Q A;  3LI8 A;  5TJJ A;  4CLC A;  1UWP X;  3JVV A;  3CIT A;  1T1B A;  1T19 A;  3T4K A;  2VZW A;  2EWW A;  3GDI A;  4IUK A;  1DRM A;  2P7J A;  4K08 A;  4Q0I A;  2PT7 A;  2VA0 A;  2QHK A;  4O01 A;  4NXG A;  2JKR M;  5HSQ A;  2K31 A;  1DP8 A;  3D3O A;  1S67 L;  3KSI A;  2GZA A;  1D7E A;  3LID A;  1N9L A;  2D01 A;  4I3J A;  2OAQ 1;  4CQH A;  5I5L A;  2XRN A;  3LR0 A;  4H6J B;  2O9B A;  4PAU A;  4BWI A;  2JN7 A;  1YAX A;  3LR4 A;  3ZQ5 A;  4HH3 A;  5AVE A;  4GS9 B;  1UWN X;  5MC7 A;  2VX8 A;  4P6Z S;  3LIF A;  2QYB A;  3PBR A;  3UMD A;  4GCZ A;  3CUE A;  3UB6 A;  2DMW A;  4R38 A;  2PHY A;  1TS7 A;  4JGO A;  1P9W A;  3FC7 A;  5J3W A;  2XA7 M;  5HWT A;  4HP9 A;  4BJP A;  3VV4 A;  4HIA A;  3LR5 A;  2NUP C;  3RFB A;  1TS8 A;  1XJ2 A;  3KSH A;  2XSS A;  3T4S A;  3EWK A;  3CUE C;  4ARZ B;  3HJI A;  3CI6 A;  1LSV A;  4BBU A;  2W1R A;  4EEU A;  3UB7 A;  3MMH A;  4EER A;  4IUH A;  3UME A;  1ZHH B;  3H9W A;  2K2N A;  2M7V A;  3FPV A;  2FZ0 A;  2L1M A;  5F69 A;  2HJ9 C;  1TS6 A;  2J3W A;  1DP9 A;  5IT5 A;  4B93 A;  1TS0 A;  4E04 A;  5G4Y A;  2WKP A;  1JNU A;  4I3A A;  5K5B A;  1BYW A;  3G6O A;  3OCN A;  3P7N A;  5HL6 A;  3NHQ A;  4DJ3 A;  3TW8 A;  4FOF A;  4HI4 A;  4Y2F A;  2W3H A;  2V0U A;  3OOV A;  2M1C A;  4DJ2 A;  2R78 A;  2ZMV A;  3P01 A;  3PXP A;  4NXF A;  2A24 A;  5TBM B;  1G6O A;  4BMW A;  2J3T D;  3PBO A;  4L9E A;  1OT6 A;  4KUK A;  4NEE D;  4IHQ A;  3B42 A;  3IBJ A;  1UGU A;  2W3D A;  3UE3 A;  1S1Y A;  2ZOH A;  3E98 A;  4ME4 A;  2QJ5 A;  4L0L A;  3LIB A;  1MZU A;  4HP4 A;  2VLG A;  4PKY G;  4EUV A;  4UQI M;  1GSX A;  2JKT I;  2OWH A;  4Q0J A;  3S7N A;  5J4E A;  4L9G A;  1GSW A;  3FPW A;  4XT2 B;  2PYR A;  5FL3 A;  1T18 A;  5KIZ A;  3W2Z A;  4WEK A;  1TF1 A;  4EES A;  3NOU C;  4LRZ E;  4HJ6 A;  3VOL A;  3OC2 A;  1T1C A;  1NWZ A;  2FH5 A;  3F1P B;  2W3F A;  3ULF A;  4M4X A;  4EQ1 A;  4FSF A;  3LUQ A;  2L0W A;  1LT0 A;  3KYQ A;  1W63 M;  4HH2 A;  1S4R A;  3K3C A;  2WKQ A;  3EGD C;  3KO6 A;  1VB6 A;  4MCW A;  4KQO A;  5DFX A;  3LIE A;  4JGQ A;  3UB8 A;  3BY8 A;  3TRC A;  3LIA A;  3DBA A;  2VJW A;  4G3W A;  4CLC C;  3BQA A;  3S7P A;  5C5K A;  4ZRR A;  2MJ6 A;  1S66 L;  2V1A A;  4Q0H A;  2IA2 A;  5L8M A;  5HZH A;  1OTA A;  3RH8 B;  2EA9 A;  2GX5 A;  1XJ4 A;  3LIC A;  1X0O A;  3LYX A;  3PR6 A;  3ZYT A;  2QJ7 A;  2ZBB A;  5IS1 A;  2P04 A;  2W1T B;  3E4O A;  2W3G A;  4P6Z M;  3CAX A;  2LB9 A;  1IFQ A;  4WN5 A;  2PD8 A;  4O0P A;  3H82 A;  3OCL A;  3CLO A;  3EEH A;  4H6J A;  5DKL A;  4Z1W A;  4CLC E;  1OTD A;  1OTB A;  1V9Z A;  4KQD A;  3MFX A;  5HWW A;  4GS9 A;  3H7W A;  3A0R A;  3PBQ A;  3MQ0 A;  3MR0 A;  4MN5 A;  1Y28 A;  4BBV A;  4R3A A;  2P08 A;  3T4T A;  4OOL A;  2M7U A;  4EEP A;  2PDR A;  3KSF A;  3CWF A;  3GEC A;  2VV8 A;  2B18 A;  1F98 A;  3LR3 A;  2GNX A;  1VHM A;  3BY9 A;  3EGX C;  1N9N A;  4HHD A;  3OLO A;  4PKY A;  4HQA A;  3JVU A;  2J80 A;  2XRO A;  4DMZ A;  3R7W B;  3PBS A;  4YOF A;  3BJN A;  3F1O B;  2PR5 A;  1P9R A;  2JKT M;  1XJ6 A;  3LFV A;  1S1Z A;  3MXQ A;  1OTI A;  1P97 A;  1OPX A;  2V9A A;  1TD5 A;  1OJG A;  2V0W A;  3IBR A;  2W3E A;  3MQO A;  1MKM A;  1ZTU A;  3BWL A;  3NJA A;  2W0N A;  3PHY A;  2HF6 A;  2W27 A;  3KSG A;  4AFI A;  1F9I A;  3TE8 A;  5TBM A;  2BAS A;  5AVF A;  4I3I A;  4LPZ A;  4II7 A;  4UQI S;  4Y3I A;  5HDD A;  4R6L A;  3IS2 B;  3T4Q A;  5HD5 A;  4F3L A;  4BBT A;  2Z6C A;  2VGL S;  3ICY A;  3PBT A;  4GHI B;  3F1N B;  3S7Q A;  4I39 A;  1V9Y A;  4G3V A;  3RTY A;  2A2L A;  1NLZ A;  5J7E A;  2VV7 A;  1OTE A;  1EW0 A;  2HV1 A;  1KOU A;  2LB5 A;  2VV6 A;  3TJZ C;  4CLC B;  4GW9 A;  1LSW A;  3K2N A;  4MN6 A;  4XT2 A;  1XFQ A;  2B02 A;  4EXO A;  3MQQ A;  4JGP A;  4LRY C;  5KSH A;  5HPI A;  2PR6 A;  3EQU A;  4HNB A;  2PD7 A;  2JHE A;  2O99 A;  1S4S A;  4ETZ A;  4RQ9 A;  2VEA A;  3VE3 A;  3UE6 A;  1N9O A;  5AJG A;  3F1P A;  3HCY A;  4L9F A;  4LRX C;  2KX6 A;  3T4L A;  2YKH A;  2OWJ A;  4NKP A;  4DN0 A;  1NLY A;  5HWV A;  1LSX A;  3C2W A;  1WA9 A;  1T1A A;  4HY8 A;  4WEJ A;  3NOP C;  3T4J A;  1H3Q A;  1GSV A;  4MN7 A;  3C8C A;  5A8B A;  1F5M A;  2G7U A;  4MDZ A;  1YSP A;  2GJ3 A;  3NOT C;  5CX7 A;  2HJE A;  4O8G A;  4Y5F A;  2O0Y A;  4NXE A;  2NUT C;  3A0S A;  4CLC D;  1OT9 A;  3H82 B;  4LLO B;  1D06 A;  1YKD A;  4WUJ A;  1STZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...