4XT4A

Crystal structure of rv2671 from mycobacteirum tuberculosis in complex with dihydropteridine ring of dihydropteroic acid
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
246
structure length
246
Chain Sequence
PLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSGAMAGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQSEVPQLAIVTRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVSQLAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRCAHVLTDDSGYLYTRYVKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Mycobacterium tuberculosis Rv2671 Protein as a Dihydrofolate Reductase Functional Analogue Contributing to para-Aminosalicylic Acid Resistance.
pubmed doi rcsb
molecule keywords Rv2671
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 83
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4xt4A00
4LAGX 1DR5A 4PSTA 4P68A 1DR7A 4FGHA 1RB3A 4QLEA 2AZNA 5JG0X 1CD2A 1RX6A 3ZPGA 3NXYA 5ECXA 1DRAA 1VJ3A 2L28A 4EIGA 4EIZA 2BLAA 4I13A 1JOMA 3F0QX 4PTHA 1RX1A 2CIGA 3NXOA 3FYWX 1J3JA 1RX7A 4QLFA 1QZFA 1IA1A 1DHFA 1HFQA 3F8YA 2DHFA 2W3BA 3GI2A 1YHOA 1HFPA 1PDBA 4KL9A 4XT8A 3I3RA 3GHCA 4KYAA 3EEJA 4FGGA 5DXVA 3SH2A 5HF0X 3EEMA 2HXVA 4PDJA 1DRFA 5HF2X 3JWFA 1RX3A 3DG8A 3NXTA 3EX8A 3TD8A 1RG7A 1AO8A 3NRRA 3GHWA 3SA1A 1S3YA 2FZHA 4PSSA 1DR2A 1MVTA 5HSRA 3NU0A 4KM0A 4XECX 2KGKA 4QHVA 3R33A 4XRBA 3TQAA 3KY8A 3SRRX 2H2QA 4KY4A 4HA9A 3FQVA 1RE7A 5U26A 3JWMA 1LY4A 3CD2A 5CCCA 4M6LA 3NXVA 2LF1A 1SEJA 4CD2A 1RA8A 4H95A 4XT5A 4G8ZX 3QFXA 2C2TA 5E8QA 4ELHA 4IXGX 3NZ6X 2W9GA 4OR7A 4I1NA 3ZPCA 2B3ZA 3JW5A 4IXED 3SR5X 4EILA 2JYBA 1RX9A 4ECKA 3S3VA 5U27A 3TQ8A 3EIGA 4DPHA 4H96A 3KGYA 3IRNA 3CLBA 5HT5A 4Q0EA 4LEKX 1KMSA 3HJ3A 4X5IA 2C2SA 4G95A 1CZ3A 1RX2A 3FQFA 3IA4A 5HI6A 5HT4A 2W3VA 1J3IA 2BLBA 4Q6AA 8DFRA 3IX9A 3HBBA 1RC4A 1E26A 4PTJA 1DG5A 1DREA 4KBNA 3F0XX 3QLYA 5ECCA 4NX7A 3UM8A 3SQYX 3DATA 1VDRA 4ELFA 3FY8X 2FZIA 1RA1A 7DFRA 1JOLA 4HA7A 3TQBA 1S3WA 4H98A 4KD7A 2HQPA 2ANQA 3JVXA 1MVSA 2O7PA 3IROA 3S7AA 3JSUA 3RO9A 3CSEA 3F0VX 2INQA 4QJZD 2D5NA 3FQ0A 1BZFA 3SRSX 4KJJA 1DYJA 3UM6A 3S9UA 3SRWX 2D0KA 1RF7A 1M78A 1RA9A 4P66A 1DRBA 2W9TA 4KM2A 3F8ZA 3CL9A 1HFRA 3NZBX 4OSGA 1DF7A 1KLKA 1RX8A 1DRHA 4ELBA 3QL3A 4G3MA 4QJCA 5CC9A 1DLSA 3Q1HA 1ZDRA 4X5GA 4ELGA 3F91A 3FRDX 1RB2A 4HOEA 4Q0DA 3FY9X 3FS6A 1DDRA 2W3AA 2ZZAA 4NX6A 3QLRA 1DR6A 1IA2A 1RA2A 4HOFA 4LAHX 3OCHA 4X5HA 2OIPA 4M6JA 3SA2A 2ANOA 2W9SA 4XT4A 1DLRA 2OBCA 1AI9A 1JUVA 3RG9A 1DG7A 1RX4A 2ITHA 3F0BX 4QI9A 5HVBA 1DYHA 3SGYA 3NTZA 4X5FA 3N0HA 3UM5A 4KLXA 3NXXA 4ELEA 4H97A 5HUIA 1BOZA 3FQOA 1DDSA 4QLGA 1DIUA 1DR3A 4PSYA 2FZJA 1DISA 3K47A 3QL0A 1DHIA 2W9HA 3K2HA 1S3VA 1KMVA 4KY8A 1M79A 3D80A 3QLZA 3JWCA 3SRUX 3NZAX 3DRCA 3NZ9X 1TDRA 5JA3A 3LG4A 4KFJA 1DYIA 1DR1A 1D1GA 3FL8A 3QG2A 3K74A 3FRBX 2QK8A 3VCOA 4TU5X 3JWKA 1IA3A 1RA3A 4KNEA 4KJLA 3FREX 3QYLA 1OHJA 3M09A 3KFYA 1U70A 4KEBA 4EJ1A 3QLXA 3SRQX 4FHBA 4DFRA 1DR4A 4XT6A 3FYVX 3GHVA 3NXRA 5DFRA 3ROAA 2BLCA 3DL6A 1AOEA 4DP3A 3EELA 2HM9A 2G6VA 4XT7A 1DYRA 3E0BA 4X5JA 3IA5A 4IXFX 5HQZA 4DDRA 3D84X 3KJRA 3QLSA 1DG8A 2P4GA 4Q67A 1LUDA 4DPDA 2DRCA 4M7VA 1RH3A 2W3WA 1RX5A 2CD2A 1PD9A 1M7AA 5HVEA 1PD8A 3FL9A 3F0UX 1DAJA 3FRFX 5EAJA 4P3QA 4KJKA 3F0SX 3DGAA 4KAKA 4HOGA 3L3RA 5HQYA 2BL9A 3FRAX 3NZCX 5HSUA 3OAFA 3M08A 3FQCA 1OHKA 3QYOA 4RGCA 4XE6X 3DL5A 3FQZA 4LAEX 1LY3A 4P3RA 1U72A 3IRMA 2GD9A 5FDAA 3QGTA 3JW3A 5HPBA 4M6KA 3GYFA 4M7UA 3K45A 3QLWA 3TQ9A 2XW7A 1DHJA 3DFRA 3DAUA 2W3MA 1S3UA 1J3KA 1RD7A 4GH8A 3KJSA 6DFRA 1IA4A 3NZDA 3SAIA 3I8AX 1U71A 3INVA 3EEKA 3JTWA 4M2XA
chains in the Genus database with same CATH superfamily
4LAGX 1DR5A 4PSTA 4P68A 1DR7A 4FGHA 1RB3A 4QLEA 2AZNA 5JG0X 1CD2A 1RX6A 3ZPGA 3NXYA 5ECXA 1DRAA 1VJ3A 2L28A 4EIGA 4EIZA 2BLAA 4I13A 1JOMA 3F0QX 4PTHA 1RX1A 2CIGA 3NXOA 3FYWX 1J3JA 1RX7A 4QLFA 1QZFA 1IA1A 1DHFA 1HFQA 3F8YA 2DHFA 2W3BA 3GI2A 1YHOA 1HFPA 1PDBA 4KL9A 4XT8A 3I3RA 3GHCA 4KYAA 3EEJA 4FGGA 5DXVA 3SH2A 5HF0X 3EEMA 2HXVA 4PDJA 1DRFA 5HF2X 3JWFA 1RX3A 3DG8A 3NXTA 3EX8A 3TD8A 1RG7A 1AO8A 3NRRA 3GHWA 3SA1A 1S3YA 2FZHA 4PSSA 1DR2A 1MVTA 5HSRA 3NU0A 4KM0A 4XECX 2KGKA 4QHVA 3R33A 4XRBA 3TQAA 3KY8A 3SRRX 2H2QA 4KY4A 4HA9A 3FQVA 1RE7A 5U26A 3JWMA 1LY4A 3CD2A 5CCCA 4M6LA 3NXVA 2LF1A 1SEJA 4CD2A 1RA8A 4H95A 4XT5A 4G8ZX 3QFXA 2C2TA 5E8QA 4ELHA 4IXGX 3NZ6X 2W9GA 4OR7A 4I1NA 3ZPCA 2B3ZA 3JW5A 4IXED 3SR5X 4EILA 2JYBA 1RX9A 4ECKA 3S3VA 5U27A 3TQ8A 3EIGA 4DPHA 4H96A 3KGYA 3IRNA 3CLBA 5HT5A 4Q0EA 4LEKX 1KMSA 3HJ3A 4X5IA 2C2SA 4G95A 1CZ3A 1RX2A 3FQFA 3IA4A 5HI6A 5HT4A 2W3VA 1J3IA 2BLBA 4Q6AA 8DFRA 3IX9A 3HBBA 1RC4A 1E26A 4PTJA 1DG5A 1DREA 4KBNA 3F0XX 3QLYA 5ECCA 4NX7A 3UM8A 3SQYX 3DATA 1VDRA 4ELFA 3FY8X 2FZIA 1RA1A 7DFRA 1JOLA 4HA7A 3TQBA 1S3WA 4H98A 4KD7A 2HQPA 2ANQA 3JVXA 1MVSA 2O7PA 3IROA 3S7AA 3JSUA 3RO9A 3CSEA 3F0VX 2INQA 4QJZD 2D5NA 3FQ0A 1BZFA 3SRSX 4KJJA 1DYJA 3UM6A 3S9UA 3SRWX 2D0KA 1RF7A 1M78A 1RA9A 4P66A 1DRBA 2W9TA 4KM2A 3F8ZA 3CL9A 1HFRA 3NZBX 4OSGA 1DF7A 1KLKA 1RX8A 1DRHA 4ELBA 3QL3A 4G3MA 4QJCA 5CC9A 1DLSA 3Q1HA 1ZDRA 4X5GA 4ELGA 3F91A 3FRDX 1RB2A 4HOEA 4Q0DA 3FY9X 3FS6A 1DDRA 2W3AA 2ZZAA 4NX6A 3QLRA 1DR6A 1IA2A 1RA2A 4HOFA 4LAHX 3OCHA 4X5HA 2OIPA 4M6JA 3SA2A 2ANOA 2W9SA 4XT4A 1DLRA 2OBCA 1AI9A 1JUVA 3RG9A 1DG7A 1RX4A 2ITHA 3F0BX 4QI9A 5HVBA 1DYHA 3SGYA 3NTZA 4X5FA 3N0HA 3UM5A 4KLXA 3NXXA 4ELEA 4H97A 5HUIA 1BOZA 3FQOA 1DDSA 4QLGA 1DIUA 1DR3A 4PSYA 2FZJA 1DISA 3K47A 3QL0A 1DHIA 2W9HA 3K2HA 1S3VA 1KMVA 4KY8A 1M79A 3D80A 3QLZA 3JWCA 3SRUX 3NZAX 3DRCA 3NZ9X 1TDRA 5JA3A 3LG4A 4KFJA 1DYIA 1DR1A 1D1GA 3FL8A 3QG2A 3K74A 3FRBX 2QK8A 3VCOA 4TU5X 3JWKA 1IA3A 1RA3A 4KNEA 4KJLA 3FREX 3QYLA 1OHJA 3M09A 3KFYA 1U70A 4KEBA 4EJ1A 3QLXA 3SRQX 4FHBA 4DFRA 1DR4A 4XT6A 3FYVX 3GHVA 3NXRA 5DFRA 3ROAA 2BLCA 3DL6A 1AOEA 4DP3A 3EELA 2HM9A 2G6VA 4XT7A 1DYRA 3E0BA 4X5JA 3IA5A 4IXFX 5HQZA 4DDRA 3D84X 3KJRA 3QLSA 1DG8A 2P4GA 4Q67A 1LUDA 4DPDA 2DRCA 4M7VA 1RH3A 2W3WA 1RX5A 2CD2A 1PD9A 1M7AA 5HVEA 1PD8A 3FL9A 3F0UX 1DAJA 3FRFX 5EAJA 4P3QA 4KJKA 3F0SX 3DGAA 4KAKA 4HOGA 3L3RA 5HQYA 2BL9A 3FRAX 3NZCX 5HSUA 3OAFA 3M08A 3FQCA 1OHKA 3QYOA 4RGCA 4XE6X 3DL5A 3FQZA 4LAEX 1LY3A 4P3RA 1U72A 3IRMA 2GD9A 5FDAA 3QGTA 3JW3A 5HPBA 4M6KA 3GYFA 4M7UA 3K45A 3QLWA 3TQ9A 2XW7A 1DHJA 3DFRA 3DAUA 2W3MA 1S3UA 1J3KA 1RD7A 4GH8A 3KJSA 6DFRA 1IA4A 3NZDA 3SAIA 3I8AX 1U71A 3INVA 3EEKA 3JTWA 4M2XA
chains in the Genus database with same CATH topology
4LAGX 1DR5A 4PSTA 4P68A 1DR7A 4FGHA 1RB3A 4QLEA 2AZNA 5JG0X 1CD2A 1RX6A 3ZPGA 3NXYA 5ECXA 1DRAA 1VJ3A 2L28A 4EIGA 4EIZA 2BLAA 4I13A 1JOMA 3F0QX 4PTHA 1RX1A 2CIGA 3NXOA 3FYWX 1J3JA 1RX7A 4QLFA 1QZFA 1IA1A 1DHFA 1HFQA 3F8YA 2DHFA 2W3BA 3GI2A 1YHOA 1HFPA 1PDBA 4KL9A 4XT8A 3I3RA 3GHCA 4KYAA 3EEJA 4FGGA 5DXVA 3SH2A 5HF0X 3EEMA 2HXVA 4PDJA 1DRFA 5HF2X 3JWFA 1RX3A 3DG8A 3NXTA 3EX8A 3TD8A 1RG7A 1AO8A 3NRRA 3GHWA 3SA1A 1S3YA 2FZHA 4PSSA 1DR2A 1MVTA 5HSRA 3NU0A 4KM0A 4XECX 2KGKA 4QHVA 3R33A 4XRBA 3TQAA 3KY8A 3SRRX 2H2QA 4KY4A 4HA9A 3FQVA 1RE7A 5U26A 3JWMA 1LY4A 3CD2A 5CCCA 4M6LA 3NXVA 2LF1A 1SEJA 4CD2A 1RA8A 4H95A 4XT5A 4G8ZX 3QFXA 2C2TA 5E8QA 4ELHA 4IXGX 3NZ6X 2W9GA 4OR7A 4I1NA 3ZPCA 2B3ZA 3JW5A 4IXED 3SR5X 4EILA 2JYBA 1RX9A 4ECKA 3S3VA 5U27A 3TQ8A 3EIGA 4DPHA 4H96A 3KGYA 3IRNA 3CLBA 5HT5A 4Q0EA 4LEKX 1KMSA 3HJ3A 4X5IA 2C2SA 4G95A 1CZ3A 1RX2A 3FQFA 3IA4A 5HI6A 5HT4A 2W3VA 1J3IA 2BLBA 4Q6AA 8DFRA 3IX9A 3HBBA 1RC4A 1E26A 4PTJA 1DG5A 1DREA 4KBNA 3F0XX 3QLYA 5ECCA 4NX7A 3UM8A 3SQYX 3DATA 1VDRA 4ELFA 3FY8X 2FZIA 1RA1A 7DFRA 1JOLA 4HA7A 3TQBA 1S3WA 4H98A 4KD7A 2HQPA 2ANQA 3JVXA 1MVSA 2O7PA 3IROA 3S7AA 3JSUA 3RO9A 3CSEA 3F0VX 2INQA 4QJZD 2D5NA 3FQ0A 1BZFA 3SRSX 4KJJA 1DYJA 3UM6A 3S9UA 3SRWX 2D0KA 1RF7A 1M78A 1RA9A 4P66A 1DRBA 2W9TA 4KM2A 3F8ZA 3CL9A 1HFRA 3NZBX 4OSGA 1DF7A 1KLKA 1RX8A 1DRHA 4ELBA 3QL3A 4G3MA 4QJCA 5CC9A 1DLSA 3Q1HA 1ZDRA 4X5GA 4ELGA 3F91A 3FRDX 1RB2A 4HOEA 4Q0DA 3FY9X 3FS6A 1DDRA 2W3AA 2ZZAA 4NX6A 3QLRA 1DR6A 1IA2A 1RA2A 4HOFA 4LAHX 3OCHA 4X5HA 2OIPA 4M6JA 3SA2A 2ANOA 2W9SA 4XT4A 1DLRA 2OBCA 1AI9A 1JUVA 3RG9A 1DG7A 1RX4A 2ITHA 3F0BX 4QI9A 5HVBA 1DYHA 3SGYA 3NTZA 4X5FA 3N0HA 3UM5A 4KLXA 3NXXA 4ELEA 4H97A 5HUIA 1BOZA 3FQOA 1DDSA 4QLGA 1DIUA 1DR3A 4PSYA 2FZJA 1DISA 3K47A 3QL0A 1DHIA 2W9HA 3K2HA 1S3VA 1KMVA 4KY8A 1M79A 3D80A 3QLZA 3JWCA 3SRUX 3NZAX 3DRCA 3NZ9X 1TDRA 5JA3A 3LG4A 4KFJA 1DYIA 1DR1A 1D1GA 3FL8A 3QG2A 3K74A 3FRBX 2QK8A 3VCOA 4TU5X 3JWKA 1IA3A 1RA3A 4KNEA 4KJLA 3FREX 3QYLA 1OHJA 3M09A 3KFYA 1U70A 4KEBA 4EJ1A 3QLXA 3SRQX 4FHBA 4DFRA 1DR4A 4XT6A 3FYVX 3GHVA 3NXRA 5DFRA 3ROAA 2BLCA 3DL6A 1AOEA 4DP3A 3EELA 2HM9A 2G6VA 4XT7A 1DYRA 3E0BA 4X5JA 3IA5A 4IXFX 5HQZA 4DDRA 3D84X 3KJRA 3QLSA 1DG8A 2P4GA 4Q67A 1LUDA 4DPDA 2DRCA 4M7VA 1RH3A 2W3WA 1RX5A 2CD2A 1PD9A 1M7AA 5HVEA 1PD8A 3FL9A 3F0UX 1DAJA 3FRFX 5EAJA 4P3QA 4KJKA 3F0SX 3DGAA 4KAKA 4HOGA 3L3RA 5HQYA 2BL9A 3FRAX 3NZCX 5HSUA 3OAFA 3M08A 3FQCA 1OHKA 3QYOA 4RGCA 4XE6X 3DL5A 3FQZA 4LAEX 1LY3A 4P3RA 1U72A 3IRMA 2GD9A 5FDAA 3QGTA 3JW3A 5HPBA 4M6KA 3GYFA 4M7UA 3K45A 3QLWA 3TQ9A 2XW7A 1DHJA 3DFRA 3DAUA 2W3MA 1S3UA 1J3KA 1RD7A 4GH8A 3KJSA 6DFRA 1IA4A 3NZDA 3SAIA 3I8AX 1U71A 3INVA 3EEKA 3JTWA 4M2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAG X;  1DR5 A;  4PST A;  4P68 A;  1DR7 A;  4FGH A;  1RB3 A;  4QLE A;  2AZN A;  5JG0 X;  1CD2 A;  1RX6 A;  3ZPG A;  3NXY A;  5ECX A;  1DRA A;  1VJ3 A;  2L28 A;  4EIG A;  4EIZ A;  2BLA A;  4I13 A;  1JOM A;  3F0Q X;  4PTH A;  1RX1 A;  2CIG A;  3NXO A;  3FYW X;  1J3J A;  1RX7 A;  4QLF A;  1QZF A;  1IA1 A;  1DHF A;  1HFQ A;  3F8Y A;  2DHF A;  2W3B A;  3GI2 A;  1YHO A;  1HFP A;  1PDB A;  4KL9 A;  4XT8 A;  3I3R A;  3GHC A;  4KYA A;  3EEJ A;  4FGG A;  5DXV A;  3SH2 A;  5HF0 X;  3EEM A;  2HXV A;  4PDJ A;  1DRF A;  5HF2 X;  3JWF A;  1RX3 A;  3DG8 A;  3NXT A;  3EX8 A;  3TD8 A;  1RG7 A;  1AO8 A;  3NRR A;  3GHW A;  3SA1 A;  1S3Y A;  2FZH A;  4PSS A;  1DR2 A;  1MVT A;  5HSR A;  3NU0 A;  4KM0 A;  4XEC X;  2KGK A;  4QHV A;  3R33 A;  4XRB A;  3TQA A;  3KY8 A;  3SRR X;  2H2Q A;  4KY4 A;  4HA9 A;  3FQV A;  1RE7 A;  5U26 A;  3JWM A;  1LY4 A;  3CD2 A;  5CCC A;  4M6L A;  3NXV A;  2LF1 A;  1SEJ A;  4CD2 A;  1RA8 A;  4H95 A;  4XT5 A;  4G8Z X;  3QFX A;  2C2T A;  5E8Q A;  4ELH A;  4IXG X;  3NZ6 X;  2W9G A;  4OR7 A;  4I1N A;  3ZPC A;  2B3Z A;  3JW5 A;  4IXE D;  3SR5 X;  4EIL A;  2JYB A;  1RX9 A;  4ECK A;  3S3V A;  5U27 A;  3TQ8 A;  3EIG A;  4DPH A;  4H96 A;  3KGY A;  3IRN A;  3CLB A;  5HT5 A;  4Q0E A;  4LEK X;  1KMS A;  3HJ3 A;  4X5I A;  2C2S A;  4G95 A;  1CZ3 A;  1RX2 A;  3FQF A;  3IA4 A;  5HI6 A;  5HT4 A;  2W3V A;  1J3I A;  2BLB A;  4Q6A A;  8DFR A;  3IX9 A;  3HBB A;  1RC4 A;  1E26 A;  4PTJ A;  1DG5 A;  1DRE A;  4KBN A;  3F0X X;  3QLY A;  5ECC A;  4NX7 A;  3UM8 A;  3SQY X;  3DAT A;  1VDR A;  4ELF A;  3FY8 X;  2FZI A;  1RA1 A;  7DFR A;  1JOL A;  4HA7 A;  3TQB A;  1S3W A;  4H98 A;  4KD7 A;  2HQP A;  2ANQ A;  3JVX A;  1MVS A;  2O7P A;  3IRO A;  3S7A A;  3JSU A;  3RO9 A;  3CSE A;  3F0V X;  2INQ A;  4QJZ D;  2D5N A;  3FQ0 A;  1BZF A;  3SRS X;  4KJJ A;  1DYJ A;  3UM6 A;  3S9U A;  3SRW X;  2D0K A;  1RF7 A;  1M78 A;  1RA9 A;  4P66 A;  1DRB A;  2W9T A;  4KM2 A;  3F8Z A;  3CL9 A;  1HFR A;  3NZB X;  4OSG A;  1DF7 A;  1KLK A;  1RX8 A;  1DRH A;  4ELB A;  3QL3 A;  4G3M A;  4QJC A;  5CC9 A;  1DLS A;  3Q1H A;  1ZDR A;  4X5G A;  4ELG A;  3F91 A;  3FRD X;  1RB2 A;  4HOE A;  4Q0D A;  3FY9 X;  3FS6 A;  1DDR A;  2W3A A;  2ZZA A;  4NX6 A;  3QLR A;  1DR6 A;  1IA2 A;  1RA2 A;  4HOF A;  4LAH X;  3OCH A;  4X5H A;  2OIP A;  4M6J A;  3SA2 A;  2ANO A;  2W9S A;  4XT4 A;  1DLR A;  2OBC A;  1AI9 A;  1JUV A;  3RG9 A;  1DG7 A;  1RX4 A;  2ITH A;  3F0B X;  4QI9 A;  5HVB A;  1DYH A;  3SGY A;  3NTZ A;  4X5F A;  3N0H A;  3UM5 A;  4KLX A;  3NXX A;  4ELE A;  4H97 A;  5HUI A;  1BOZ A;  3FQO A;  1DDS A;  4QLG A;  1DIU A;  1DR3 A;  4PSY A;  2FZJ A;  1DIS A;  3K47 A;  3QL0 A;  1DHI A;  2W9H A;  3K2H A;  1S3V A;  1KMV A;  4KY8 A;  1M79 A;  3D80 A;  3QLZ A;  3JWC A;  3SRU X;  3NZA X;  3DRC A;  3NZ9 X;  1TDR A;  5JA3 A;  3LG4 A;  4KFJ A;  1DYI A;  1DR1 A;  1D1G A;  3FL8 A;  3QG2 A;  3K74 A;  3FRB X;  2QK8 A;  3VCO A;  4TU5 X;  3JWK A;  1IA3 A;  1RA3 A;  4KNE A;  4KJL A;  3FRE X;  3QYL A;  1OHJ A;  3M09 A;  3KFY A;  1U70 A;  4KEB A;  4EJ1 A;  3QLX A;  3SRQ X;  4FHB A;  4DFR A;  1DR4 A;  4XT6 A;  3FYV X;  3GHV A;  3NXR A;  5DFR A;  3ROA A;  2BLC A;  3DL6 A;  1AOE A;  4DP3 A;  3EEL A;  2HM9 A;  2G6V A;  4XT7 A;  1DYR A;  3E0B A;  4X5J A;  3IA5 A;  4IXF X;  5HQZ A;  4DDR A;  3D84 X;  3KJR A;  3QLS A;  1DG8 A;  2P4G A;  4Q67 A;  1LUD A;  4DPD A;  2DRC A;  4M7V A;  1RH3 A;  2W3W A;  1RX5 A;  2CD2 A;  1PD9 A;  1M7A A;  5HVE A;  1PD8 A;  3FL9 A;  3F0U X;  1DAJ A;  3FRF X;  5EAJ A;  4P3Q A;  4KJK A;  3F0S X;  3DGA A;  4KAK A;  4HOG A;  3L3R A;  5HQY A;  2BL9 A;  3FRA X;  3NZC X;  5HSU A;  3OAF A;  3M08 A;  3FQC A;  1OHK A;  3QYO A;  4RGC A;  4XE6 X;  3DL5 A;  3FQZ A;  4LAE X;  1LY3 A;  4P3R A;  1U72 A;  3IRM A;  2GD9 A;  5FDA A;  3QGT A;  3JW3 A;  5HPB A;  4M6K A;  3GYF A;  4M7U A;  3K45 A;  3QLW A;  3TQ9 A;  2XW7 A;  1DHJ A;  3DFR A;  3DAU A;  2W3M A;  1S3U A;  1J3K A;  1RD7 A;  4GH8 A;  3KJS A;  6DFR A;  1IA4 A;  3NZD A;  3SAI A;  3I8A X;  1U71 A;  3INV A;  3EEK A;  3JTW A;  4M2X A; 
#chains in the Genus database with same CATH topology
 4LAG X;  1DR5 A;  4PST A;  4P68 A;  1DR7 A;  4FGH A;  1RB3 A;  4QLE A;  2AZN A;  5JG0 X;  1CD2 A;  1RX6 A;  3ZPG A;  3NXY A;  5ECX A;  1DRA A;  1VJ3 A;  2L28 A;  4EIG A;  4EIZ A;  2BLA A;  4I13 A;  1JOM A;  3F0Q X;  4PTH A;  1RX1 A;  2CIG A;  3NXO A;  3FYW X;  1J3J A;  1RX7 A;  4QLF A;  1QZF A;  1IA1 A;  1DHF A;  1HFQ A;  3F8Y A;  2DHF A;  2W3B A;  3GI2 A;  1YHO A;  1HFP A;  1PDB A;  4KL9 A;  4XT8 A;  3I3R A;  3GHC A;  4KYA A;  3EEJ A;  4FGG A;  5DXV A;  3SH2 A;  5HF0 X;  3EEM A;  2HXV A;  4PDJ A;  1DRF A;  5HF2 X;  3JWF A;  1RX3 A;  3DG8 A;  3NXT A;  3EX8 A;  3TD8 A;  1RG7 A;  1AO8 A;  3NRR A;  3GHW A;  3SA1 A;  1S3Y A;  2FZH A;  4PSS A;  1DR2 A;  1MVT A;  5HSR A;  3NU0 A;  4KM0 A;  4XEC X;  2KGK A;  4QHV A;  3R33 A;  4XRB A;  3TQA A;  3KY8 A;  3SRR X;  2H2Q A;  4KY4 A;  4HA9 A;  3FQV A;  1RE7 A;  5U26 A;  3JWM A;  1LY4 A;  3CD2 A;  5CCC A;  4M6L A;  3NXV A;  2LF1 A;  1SEJ A;  4CD2 A;  1RA8 A;  4H95 A;  4XT5 A;  4G8Z X;  3QFX A;  2C2T A;  5E8Q A;  4ELH A;  4IXG X;  3NZ6 X;  2W9G A;  4OR7 A;  4I1N A;  3ZPC A;  2B3Z A;  3JW5 A;  4IXE D;  3SR5 X;  4EIL A;  2JYB A;  1RX9 A;  4ECK A;  3S3V A;  5U27 A;  3TQ8 A;  3EIG A;  4DPH A;  4H96 A;  3KGY A;  3IRN A;  3CLB A;  5HT5 A;  4Q0E A;  4LEK X;  1KMS A;  3HJ3 A;  4X5I A;  2C2S A;  4G95 A;  1CZ3 A;  1RX2 A;  3FQF A;  3IA4 A;  5HI6 A;  5HT4 A;  2W3V A;  1J3I A;  2BLB A;  4Q6A A;  8DFR A;  3IX9 A;  3HBB A;  1RC4 A;  1E26 A;  4PTJ A;  1DG5 A;  1DRE A;  4KBN A;  3F0X X;  3QLY A;  5ECC A;  4NX7 A;  3UM8 A;  3SQY X;  3DAT A;  1VDR A;  4ELF A;  3FY8 X;  2FZI A;  1RA1 A;  7DFR A;  1JOL A;  4HA7 A;  3TQB A;  1S3W A;  4H98 A;  4KD7 A;  2HQP A;  2ANQ A;  3JVX A;  1MVS A;  2O7P A;  3IRO A;  3S7A A;  3JSU A;  3RO9 A;  3CSE A;  3F0V X;  2INQ A;  4QJZ D;  2D5N A;  3FQ0 A;  1BZF A;  3SRS X;  4KJJ A;  1DYJ A;  3UM6 A;  3S9U A;  3SRW X;  2D0K A;  1RF7 A;  1M78 A;  1RA9 A;  4P66 A;  1DRB A;  2W9T A;  4KM2 A;  3F8Z A;  3CL9 A;  1HFR A;  3NZB X;  4OSG A;  1DF7 A;  1KLK A;  1RX8 A;  1DRH A;  4ELB A;  3QL3 A;  4G3M A;  4QJC A;  5CC9 A;  1DLS A;  3Q1H A;  1ZDR A;  4X5G A;  4ELG A;  3F91 A;  3FRD X;  1RB2 A;  4HOE A;  4Q0D A;  3FY9 X;  3FS6 A;  1DDR A;  2W3A A;  2ZZA A;  4NX6 A;  3QLR A;  1DR6 A;  1IA2 A;  1RA2 A;  4HOF A;  4LAH X;  3OCH A;  4X5H A;  2OIP A;  4M6J A;  3SA2 A;  2ANO A;  2W9S A;  4XT4 A;  1DLR A;  2OBC A;  1AI9 A;  1JUV A;  3RG9 A;  1DG7 A;  1RX4 A;  2ITH A;  3F0B X;  4QI9 A;  5HVB A;  1DYH A;  3SGY A;  3NTZ A;  4X5F A;  3N0H A;  3UM5 A;  4KLX A;  3NXX A;  4ELE A;  4H97 A;  5HUI A;  1BOZ A;  3FQO A;  1DDS A;  4QLG A;  1DIU A;  1DR3 A;  4PSY A;  2FZJ A;  1DIS A;  3K47 A;  3QL0 A;  1DHI A;  2W9H A;  3K2H A;  1S3V A;  1KMV A;  4KY8 A;  1M79 A;  3D80 A;  3QLZ A;  3JWC A;  3SRU X;  3NZA X;  3DRC A;  3NZ9 X;  1TDR A;  5JA3 A;  3LG4 A;  4KFJ A;  1DYI A;  1DR1 A;  1D1G A;  3FL8 A;  3QG2 A;  3K74 A;  3FRB X;  2QK8 A;  3VCO A;  4TU5 X;  3JWK A;  1IA3 A;  1RA3 A;  4KNE A;  4KJL A;  3FRE X;  3QYL A;  1OHJ A;  3M09 A;  3KFY A;  1U70 A;  4KEB A;  4EJ1 A;  3QLX A;  3SRQ X;  4FHB A;  4DFR A;  1DR4 A;  4XT6 A;  3FYV X;  3GHV A;  3NXR A;  5DFR A;  3ROA A;  2BLC A;  3DL6 A;  1AOE A;  4DP3 A;  3EEL A;  2HM9 A;  2G6V A;  4XT7 A;  1DYR A;  3E0B A;  4X5J A;  3IA5 A;  4IXF X;  5HQZ A;  4DDR A;  3D84 X;  3KJR A;  3QLS A;  1DG8 A;  2P4G A;  4Q67 A;  1LUD A;  4DPD A;  2DRC A;  4M7V A;  1RH3 A;  2W3W A;  1RX5 A;  2CD2 A;  1PD9 A;  1M7A A;  5HVE A;  1PD8 A;  3FL9 A;  3F0U X;  1DAJ A;  3FRF X;  5EAJ A;  4P3Q A;  4KJK A;  3F0S X;  3DGA A;  4KAK A;  4HOG A;  3L3R A;  5HQY A;  2BL9 A;  3FRA X;  3NZC X;  5HSU A;  3OAF A;  3M08 A;  3FQC A;  1OHK A;  3QYO A;  4RGC A;  4XE6 X;  3DL5 A;  3FQZ A;  4LAE X;  1LY3 A;  4P3R A;  1U72 A;  3IRM A;  2GD9 A;  5FDA A;  3QGT A;  3JW3 A;  5HPB A;  4M6K A;  3GYF A;  4M7U A;  3K45 A;  3QLW A;  3TQ9 A;  2XW7 A;  1DHJ A;  3DFR A;  3DAU A;  2W3M A;  1S3U A;  1J3K A;  1RD7 A;  4GH8 A;  3KJS A;  6DFR A;  1IA4 A;  3NZD A;  3SAI A;  3I8A X;  1U71 A;  3INV A;  3EEK A;  3JTW A;  4M2X A; 
#chains in the Genus database with same CATH homology
 4LAG X;  1DR5 A;  4PST A;  4P68 A;  1DR7 A;  4FGH A;  1RB3 A;  4QLE A;  2AZN A;  5JG0 X;  1CD2 A;  1RX6 A;  3ZPG A;  3NXY A;  5ECX A;  1DRA A;  1VJ3 A;  2L28 A;  4EIG A;  4EIZ A;  2BLA A;  4I13 A;  1JOM A;  3F0Q X;  4PTH A;  1RX1 A;  2CIG A;  3NXO A;  3FYW X;  1J3J A;  1RX7 A;  4QLF A;  1QZF A;  1IA1 A;  1DHF A;  1HFQ A;  3F8Y A;  2DHF A;  2W3B A;  3GI2 A;  1YHO A;  1HFP A;  1PDB A;  4KL9 A;  4XT8 A;  3I3R A;  3GHC A;  4KYA A;  3EEJ A;  4FGG A;  5DXV A;  3SH2 A;  5HF0 X;  3EEM A;  2HXV A;  4PDJ A;  1DRF A;  5HF2 X;  3JWF A;  1RX3 A;  3DG8 A;  3NXT A;  3EX8 A;  3TD8 A;  1RG7 A;  1AO8 A;  3NRR A;  3GHW A;  3SA1 A;  1S3Y A;  2FZH A;  4PSS A;  1DR2 A;  1MVT A;  5HSR A;  3NU0 A;  4KM0 A;  4XEC X;  2KGK A;  4QHV A;  3R33 A;  4XRB A;  3TQA A;  3KY8 A;  3SRR X;  2H2Q A;  4KY4 A;  4HA9 A;  3FQV A;  1RE7 A;  5U26 A;  3JWM A;  1LY4 A;  3CD2 A;  5CCC A;  4M6L A;  3NXV A;  2LF1 A;  1SEJ A;  4CD2 A;  1RA8 A;  4H95 A;  4XT5 A;  4G8Z X;  3QFX A;  2C2T A;  5E8Q A;  4ELH A;  4IXG X;  3NZ6 X;  2W9G A;  4OR7 A;  4I1N A;  3ZPC A;  2B3Z A;  3JW5 A;  4IXE D;  3SR5 X;  4EIL A;  2JYB A;  1RX9 A;  4ECK A;  3S3V A;  5U27 A;  3TQ8 A;  3EIG A;  4DPH A;  4H96 A;  3KGY A;  3IRN A;  3CLB A;  5HT5 A;  4Q0E A;  4LEK X;  1KMS A;  3HJ3 A;  4X5I A;  2C2S A;  4G95 A;  1CZ3 A;  1RX2 A;  3FQF A;  3IA4 A;  5HI6 A;  5HT4 A;  2W3V A;  1J3I A;  2BLB A;  4Q6A A;  8DFR A;  3IX9 A;  3HBB A;  1RC4 A;  1E26 A;  4PTJ A;  1DG5 A;  1DRE A;  4KBN A;  3F0X X;  3QLY A;  5ECC A;  4NX7 A;  3UM8 A;  3SQY X;  3DAT A;  1VDR A;  4ELF A;  3FY8 X;  2FZI A;  1RA1 A;  7DFR A;  1JOL A;  4HA7 A;  3TQB A;  1S3W A;  4H98 A;  4KD7 A;  2HQP A;  2ANQ A;  3JVX A;  1MVS A;  2O7P A;  3IRO A;  3S7A A;  3JSU A;  3RO9 A;  3CSE A;  3F0V X;  2INQ A;  4QJZ D;  2D5N A;  3FQ0 A;  1BZF A;  3SRS X;  4KJJ A;  1DYJ A;  3UM6 A;  3S9U A;  3SRW X;  2D0K A;  1RF7 A;  1M78 A;  1RA9 A;  4P66 A;  1DRB A;  2W9T A;  4KM2 A;  3F8Z A;  3CL9 A;  1HFR A;  3NZB X;  4OSG A;  1DF7 A;  1KLK A;  1RX8 A;  1DRH A;  4ELB A;  3QL3 A;  4G3M A;  4QJC A;  5CC9 A;  1DLS A;  3Q1H A;  1ZDR A;  4X5G A;  4ELG A;  3F91 A;  3FRD X;  1RB2 A;  4HOE A;  4Q0D A;  3FY9 X;  3FS6 A;  1DDR A;  2W3A A;  2ZZA A;  4NX6 A;  3QLR A;  1DR6 A;  1IA2 A;  1RA2 A;  4HOF A;  4LAH X;  3OCH A;  4X5H A;  2OIP A;  4M6J A;  3SA2 A;  2ANO A;  2W9S A;  4XT4 A;  1DLR A;  2OBC A;  1AI9 A;  1JUV A;  3RG9 A;  1DG7 A;  1RX4 A;  2ITH A;  3F0B X;  4QI9 A;  5HVB A;  1DYH A;  3SGY A;  3NTZ A;  4X5F A;  3N0H A;  3UM5 A;  4KLX A;  3NXX A;  4ELE A;  4H97 A;  5HUI A;  1BOZ A;  3FQO A;  1DDS A;  4QLG A;  1DIU A;  1DR3 A;  4PSY A;  2FZJ A;  1DIS A;  3K47 A;  3QL0 A;  1DHI A;  2W9H A;  3K2H A;  1S3V A;  1KMV A;  4KY8 A;  1M79 A;  3D80 A;  3QLZ A;  3JWC A;  3SRU X;  3NZA X;  3DRC A;  3NZ9 X;  1TDR A;  5JA3 A;  3LG4 A;  4KFJ A;  1DYI A;  1DR1 A;  1D1G A;  3FL8 A;  3QG2 A;  3K74 A;  3FRB X;  2QK8 A;  3VCO A;  4TU5 X;  3JWK A;  1IA3 A;  1RA3 A;  4KNE A;  4KJL A;  3FRE X;  3QYL A;  1OHJ A;  3M09 A;  3KFY A;  1U70 A;  4KEB A;  4EJ1 A;  3QLX A;  3SRQ X;  4FHB A;  4DFR A;  1DR4 A;  4XT6 A;  3FYV X;  3GHV A;  3NXR A;  5DFR A;  3ROA A;  2BLC A;  3DL6 A;  1AOE A;  4DP3 A;  3EEL A;  2HM9 A;  2G6V A;  4XT7 A;  1DYR A;  3E0B A;  4X5J A;  3IA5 A;  4IXF X;  5HQZ A;  4DDR A;  3D84 X;  3KJR A;  3QLS A;  1DG8 A;  2P4G A;  4Q67 A;  1LUD A;  4DPD A;  2DRC A;  4M7V A;  1RH3 A;  2W3W A;  1RX5 A;  2CD2 A;  1PD9 A;  1M7A A;  5HVE A;  1PD8 A;  3FL9 A;  3F0U X;  1DAJ A;  3FRF X;  5EAJ A;  4P3Q A;  4KJK A;  3F0S X;  3DGA A;  4KAK A;  4HOG A;  3L3R A;  5HQY A;  2BL9 A;  3FRA X;  3NZC X;  5HSU A;  3OAF A;  3M08 A;  3FQC A;  1OHK A;  3QYO A;  4RGC A;  4XE6 X;  3DL5 A;  3FQZ A;  4LAE X;  1LY3 A;  4P3R A;  1U72 A;  3IRM A;  2GD9 A;  5FDA A;  3QGT A;  3JW3 A;  5HPB A;  4M6K A;  3GYF A;  4M7U A;  3K45 A;  3QLW A;  3TQ9 A;  2XW7 A;  1DHJ A;  3DFR A;  3DAU A;  2W3M A;  1S3U A;  1J3K A;  1RD7 A;  4GH8 A;  3KJS A;  6DFR A;  1IA4 A;  3NZD A;  3SAI A;  3I8A X;  1U71 A;  3INV A;  3EEK A;  3JTW A;  4M2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...