4XTRC

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
217
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNLYYYSIHWVRQAPGKGLEWVASISPYSSSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGRWYRRALDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 43
structure length 217
sequence length 222
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xtrC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xtrC01
4MNQD 3TIDA 3VFMB 3NH7H 3FT2A 4RMVA 4XNZC 1MFEL 4ODSH 5GGUB 5D5MF 3QBTB 2H32H 1T0PB 3FQUB 2H6PB 2Q86A 3GHBH 3UEZA 3IDXL 4XPAH 5CCKL 5C09B 4HIHB 1WTGT 2X89A 2QSVA 4XAWL 5FO8A 3NTCL 3ES6A 5F7MC 3T09A 1SHMA 4P9HC 1FORH 4P9MH 1IEAA 4PRAB 1KCSH 1RHFA 4YFLF 2B2XL 2DBLH 4QY8A 3BH8A 3UPCA 3EGSA 3MRHB 3QUMA 5BV7H 4E41D 3ARDA 4ZS6C 3NFNB 3BD3A 1K8DB 3EZJB 3C08L 2D7OA 1VGKB 5JIHA 1PAMA 2PYED 4JZOA 4NT6A 4OCWL 5F21B 5SWQB 3DO3A 4FQJL 1Q1JL 5D7LE 1KELL 2R2EB 4EIGB 1IQDB 1G0YR 4KTEH 4PJCA 1TJHL 1MFCL 1BMGA 3C2SA 1MJ7H 2PW1A 1EHXA 1NCWH 4JEGB 5DMIL 1AGEA 5I1EL 1M05B 3PGCB 4U3XA 2XN9A 3D39B 4FQ2H 3TO2B 3WFDL 3QJHA 5HD8C 1F4WH 3SDDA 1E4KC 4QYOB 1XCTB 5HGBA 4DKDC 5FV2A 3TYGL 2KZWA 1NCAL 2VXVL 5JHDB 1VGEH 4KI5F 3FZUC 4MXQC 4PRDB 3GBNL 4ZQKB 4GG6B 2E27L 2F53E 3GFUA 4IOSD 1HILB 1FHGA 2NYYD 2OR8A 2APXA 2CXKA 4HKXB 4OF0A 5KS9B 5ISZB 3S4SA 3X3FH 1OAYH 4O51B 2JCCF 2WUCL 5EU6A 3IDNA 1W72L 4ODWB 5AYUL 2C26A 2BNRA 2AXFA 1PFCA 3UYPA 1EGJA 4MLIA 5IV2B 4N8CH 4PRHE 3RIAK 4ZFZA 5KVFL 4MNHB 1DBAL 5DK2A 5JLZA 2PW2B 3MV9E 3O3EB 3OQ3B 1CIDA 1OL0A 3S9DB 1WK0A 4MJ6B 1ND0B 2IMMA 1IAOB 1MVUA 4R2GC 3CSYB 4LPWA 3RTQC 3T0XA 4KK8C 2W9EL 3PWJB 1FO0H 1YEDA 3ECBB 3TF7C 3MJ9L 3SE8L 4S0TD 5EDXA 2NXYD 3WXWH 1JGLL 4NQED 1S9WA 3WS3A 4H1LG 1K8IA 3NACH 5IBLD 5FYJH 4JQXC 2BSED 2QQLL 4HUMB 5E5UB 4Y5YB 5J11B 1JWUA 4K7PL 5KSAD 2EE9A 4XP9H 4HWNA 2AXGA 2J5LC 2YPLB 4LNRA 5D96C 4AIOA 2OK0L 3IFLL 4ZTPL 3X17A 3C6LA 5E8OB 3T0BA 4XBPB 3RJQB 2X05A 1U58B 4YNYB 1LE9B 3VD4A 1CCZA 3L3KA 3HUJF 2BRRH 2B4CL 4LARL 5TH2A 5F8RC 5D72L 1LO4L 4QOKA 1I9JH 4K2UH 5DR5H 3WJJA 1EEZA 5FM8A 3WUWG 3ESUF 1T2JA 1FNAA 2HP4A 5EOCL 2YD9A 1YUHA 3KPSB 5CIPH 1DBBH 5F7KC 1N7ML 2JIXB 4NP4H 3MLSH 2VB5A 1FN4B 2XWBA 1F4YH 5JMOC 2VXTH 1CI5A 4UTAH 2D7TH 1DTUA 4D0BA 4JO4H 3Q6FA 3V4UL 2XN9D 4LDEB 3DTXA 2XPGA 3ZE0F 4QHMA 3QISA 1IAII 1XGRA 3SDDD 3VI3F 1V7NL 5DEGB 3RHWK 1MNUH 1BX2A 3HKFA 3QQ4B 5CSZA 1Z5LB 5GZOC 2A9NL 1SMOA 3BZDA 1BD2D 1C5BL 1SVCP 1NEZG 3DPBA 3VRIA 5HYEA 2Q7YA 1A7BA 1LNUA 5ANMB 3WHE1 1RK0A 4NNXA 3MRQB 5EU6D 5TDPB 4QHUA 5CHNB 5CAYB 3EOBA 4RAUA 1NL0H 2F53A 4YAQA 4ONFL 1LWRA 2FH8A 2R15A 4PJXF 5DK0A 1L6ZA 5F93C 3U46B 3RA7H 5CZXD 1G9EA 1SBSH 5F3BA 2ICWI 1S7XA 1CD0A 1IM9B 5T1KA 3U2SA 3BZEA 5IW3A 2VR4A 4HS8L 4B7IA 5C7XL 1A6VL 4PLNC 5I18L 4LASL 4WHYH 1NGPL 4ODUA 5EPMB 3IU3A 4PRHA 2DQUL 2NY2B 1BWMA 4P5KA 1KB9J 1U8LA 4NNYB 4EUPH 5IB4B 2GJZA 2R69H 4XPHH 3NIFF 4OLZH 5GS3A 5HHXL 3FL7A 3CXHJ 2IFFL 1DVFA 1CGWA 1ZWIA 4Y19B 1M4KA 1EERB 3CH1B 1VFBA 2NY2C 3AMLA 4PGCB 2NY3D 4HFUL 3NA4A 5HYJE 3KYKL 1A14H 2ZNWA 3ROOB 5EWIH 1WC7B 1GGIL 3UYRL 5HHQA 2YC1A 3G6JE 4DZBB 1N0XH 1ZSDB 3X3GL 2ZCHL 5HGDA 3B5GA 3BUYA 3D0LA 3S7GA 4XNQB 1JBJA 2OZ4H 5ICXA 4JFED 3KWWA 4M93B 1C7TA 4QXTB 1KGCE 3JV5A 3WD5L 3C6LD 4KTDH 3PGFL 5H35B 1RULL 2GFBB 4WFED 2P47B 2FCBA 1N59A 3MJGX 4LLMB 3PNWB 5IFHH 1S7WB 3BO8A 4JJHA 4M93C 3W2DL 2F74A 1T03L 1KPUB 1H5BA 1UM6H 1LEKA 4U1MA 4RGOH 5A2IH 3F62A 4M4RA 4JPVL 3HNVL 5C0RH 3RVXC 4XZUA 5HVFB 3O4OB 2VLJB 3WIIL 1T7ZA 2Z91B 4TUOA 1U3HD 3D48R 3SKNA 2VDQH 3QDGA 2MSPA 3ARFC 1YNLL 4K3GA 1FL5B 3IS1X 3O4OC 3F7YB 4QRRA 3H6JA 4ZSOB 4HF5L 4FFVD 4P4RB 5JW5A 1SBBA 5IHZB 4R90H 1MI5B 1FNEB 3CPLA 3SCMA 5J7CC 1RZ7L 1L9MA 2ZSVA 3O6ML 3DX6A 1BFVL 2ZCKH 2IBZX 1NGWB 2VQUA 3HAEG 5E9DE 3OAYK 3B3IA 4A6YB 4F57H 3GIZH 5T3ZD 2FYYA 3FO2B 3LEVH 4JFOB 3WN5C 1AR1C 1R24A 1JPGB 5IW6A 4H26A 4OCXL 2DQGL 4MCZA 1U6AH 2B20A 5FF6B 3UTOA 32C2B 3H9SD 5F3HA 1A5FH 2X42A 4BA8A 1UB5B 5F1KC 2AEQH 3UTTA 4Y1AB 4X7SL 1CDHA 3OB0H 1WBZB 4LSTH 3REWB 3VFOA 4ZXBA 2HMIC 5BS0B 3RDTD 3E3QC 4QF1A 3FMGH 3DXAE 4O9HL 2X4NB 2IG2H 2XZCL 3FOLA 3L9RB 1G7JA 1YMMB 2Y06H 4ZFGL 4TPRL 4TYUA 4JRXB 4YHIA 5E2UH 2GY5A 1BVZA 3K81A 5BRZD 3QYCA 3C8HA 4M48L 1S7VA 2QKIA 3D5OF 5E8EB 3ZYIA 1I3GH 4XVSH 4XGZA 1IBGH 2W38A 3CVHB 1PSKL 4HMEA 4XCYB 2Q6WA 5DHXB 4L8CB 5C70A 3MNVB 3EYSH 3SDAA 1S5HB 3VGAC 4NQSB 1IGML 2QLVB 5IG7B 1H0DB 4NOFA 3GZKA 1QRND 1F5WA 3L5JA 5CZVH 5C9KA 5GS0H 4PJ7A 3IVKA 1GZQB 4U0QB 2EH7L 4EN3A 5HYJA 1T7XA 2H32B 4KY1L 1B4JL 2ZSWA 1J86A 1RMFL 3CGTA 4F58H 5D1ZA 4Q6IB 3CLFH 3O9WB 3CDFA 3BEVA 3QP3A 4EI5A 2X4PA 3UTPE 1H3VA 4PREB 1I1YB 4TVPE 1QBML 3OSKA 1QLEL 2PR4H 4L4TB 2IAND 2AERT 4M6OL 1MCOL 5DJAA 3ZTNL 3O9WC 1P9MA 5F6IB 3AU1A 3X11A 5HHVL 5BV7B 2A74A 4GXUN 1OTTD 5C0JB 3TC9A 3RBSA 4JN2A 2PETA 3TZVD 3BUTA 3O2VH 4DVBB 3QWQB 3GM8A 3VJ6A 5F6IC 1OAQH 4AEHH 2P43B 5BV7C 3P0GB 4AG4H 4YHLL 4MHHG 4G8GE 1CIUA 5CWSA 2H9GA 1AKJA 1VFMA 3SCMD 3IGAB 2E6PA 4X6CB 1T80A 5TDNA 1NKRA 4M3JA 1BP3B 3INUH 3BP7B 2XA3A 2I5YH 1J8HB 3RWCB 1Y18B 1LK3H 1ZT1A 2C3HA 2DQFB 3LMJL 2UZIL 4NKIH 3S35L 4APQA 2RCSH 2P24A 2Q8BL 5F7YC 3LKQA 3BKJH 3WLWD 4BZ1L 3PV6B 3TN0C 1JHTA 3G6DH 1J0HA 3EDJA 1ORSB 1KN4H 4HKBA 1T04A 3OKOA 5DRNB 5LJYH 5D7IB 3UTTD 1CF8H 5DC4B 2MTPA 3DROB 4ZXBD 3D18A 4UQ3A 4PJ5A 2HKHH 3RZWA 1DFBH 1KJ3L 4UB0L 5DUBA 4LSQH 1MWAH 2E9BA 1U9KA 5GGVH 4MXWH 3STZB 3QUZB 2CRIA 2DYPA 2Y1VA 1JZ4A 4XVJL 4N8VG 1RVFL 1T89A 4ORZC 3MRPB 4PGBB 2CIIB 5F7NC 3VD3A 2FJGB 4YDKH 3RWGB 1FO0B 4U1SB 3PP4L 3EJJX 4UDUB 2F9BT 1RURL 1OTUC 4PJHB 5ALCL 2HVKB 4Z78B 3RY4A 1T83A 3B9DA 4LVNB 2HTKC 1ZXQA 4PRIE 1MCWW 2C1PA 1HZHL 5DEZA 4RBPK 3BH9B 3QXDB 1D5BB 2MWCA 3MXWH 2R56L 3SY0B 3F7PC 3LKPB 2CMRH 5ENWA 3VXRE 1UM4L 1HDMA 5IM7B 4LVNC 4B0MM 3OXRA 4EN3D 1I7UB 1Y6KR 3TIEA 3S96A 2ZUYA 5BVJA 5JXED 1WCQA 5IB1A 4LLUB 3I9GL 1K6QL 2BCKB 43C9B 1FYTE 2KQMA 4HC1H 3CZFA 3ARYA 4U1KA 4UZGA 4EI5D 1QR1B 3IDYB 1C5DA 1CFTB 2FB4L 4V1DB 1PLGH 3FQTB 3ARWA 2IH3B 4HT1L 1E6JL 3O45B 4G6KH 4XI5C 4UV7H 2VQ1A 3OXSA 1OGAA 3HR6A 4PRBB 4ETQB 1O7SA 4M9OA 5BO1L 1A7QL 4H8WL 4I3RL 1OGTA 4EBQL 1U42A 5CIPB 4I48B 3QXVA 1IC7H 4H88H 2GI7A 3WFHA 5D2NB 3UBXA 1J12A 1X5YA 2BVYA 1AKJD 1X4YA 4FG6C 1BGXH 3T3PF 3PL6B 2JJWA 4L4VB 3G6AA 3QEHB 4RIRA 3H7LA 5FYKU 3B2VL 4K9EC 2AJYL 3C09B 1JNLH 1EEUA 1IKNC 1IAIM 3ZDXF 1NC4D 4TQEH 3LS4H 2X4UA 4P3DA 4Q97A 5IMLA 1DR9A 3S34H 4GW1A 43CAB 2X6MA 3C09C 2X4RA 5F72S 2ARJA 3BZ4A 3U7WH 4N0CC 5ACZA 4D9QD 5I17A 4G8FA 2GT9B 1SY6A 3LN4A 3K4DA 1KIPB 3O11B 4PJ5D 2FD6H 3MGTA 3EZ8A 1OW0C 1D3CA 3EDKA 1UACL 4PJ9A 4GRMB 1KXTB 3GRWH 5DJ2A 4ZDHA 2D03H 5ITFA 1NCBH 5T1LD 5FA4B 2DYPD 4HBQA 3KXFA 3AAZB 1E4XL 1CFQA 4YK4B 2O5YL 1ZVYA 4EUPB 1JTOA 3H7BB 5D7KE 3TWCL 3AVEA 4PJ8B 5EN2A 3T8XA 2H8PB 5GRUH 1E28A 1AQKH 3OB8A 4KFZC 1DBJL 1XGUB 2H3NB 4YK4C 3QEQA 5HYSA 3OAUH 1EFXA 2NX5E 5HI4C 3NA9H 4UBDC 1VEOA 5I15L 4DW2H 1WBYA 4AL8H 4DGYH 1CLZH 2NW2A 1PG7W 4OUOA 4P3WA 3QDJE 3V4PH 3KNBB 2YD4A 3EUUA 4Y4KA 3QIWA 3K2UH 1RFDH 2DQHH 4OF3A 2Y7QA 3QIUA 1XF3A 4LQFH 4ZUVA 4GH7B 2NY6D 4Z7UA 5E6IA 4MA8H 1EUUA 4RFEB 2V5MA 5D71H 4BSVB 4YX2H 4FQ1L 2HN7A 2H26A 1A6UL 3LV3A 3CFBA 4JVWA 3U0PA 4XMLL 3RWIA 5D4QA 1YC8A 4LPXA 1F6AA 5J56B 4M7ZB 4PJGB 4Y5XB 6FABH 3QH3A 5ESAB 1T1YB 4U1LB 5FA3B 4X4ZA 5LWYH 3SO5A 4MAYA 4JKWA 2AGJH 2N1KA 1J0JA 1WWCA 5JHDE 3SGEH 1U0QA 4J3UA 5CBAB 4M7ZC 3JTSB 3D85A 4Y5XC 1NGYA 2P8MA 1FSKB 5I1AA 5KS9E 3TBSA 5ISZE 4DZ8B 1X5LA 4TSCH 4CDHA 3TPUA 4GKSB 1FSKC 2ESVA 3QQNA 3VFUA 2HTLC 1U8HB 3KGRA 1KPRB 3K4ZA 1MEXH 1JYVA 1ZLSH 3QNYB 3D2UB 2QHRL 4JQIL 3LIZH 5FFLA 4QGYA 4K3HA 1WAAE 2ATPB 4GG8A 3AS0A 4UNUA 3DGGB 1MJ8L 2NMSA 1QSFB 4DKFL 1IC5H 3HMXA 4LLVB 2KKQA 3UZVB 3F65A 3Q3GA 1BZ7B 3I75B 3GSUB 3UX9B 5F7WC 4LCWE 3WFBL 1P4BL 4TUKL 1I9IH 2EE3A 2VXSH 3DIFB 5CSBA 5IB5A 4LSSH 2CLRB 3TA3D 4RAHA 1OAUL 4ODTL 1MREL 3PUCA 3CVIL 1XR9B 1U8KA 4L8BA 5C0ND 4YFLI 3VRLE 1J0IA 3VFMA 5ILTL 2BY2A 1YNKL 2X4TB 4M6ML 4WHCA 1INQB 1ZVHA 1MIML 3QEQD 3U0TB 4PLKC 1GYAA 4MNQE 5GGUA 1NANI 1EFXD 2J88H 2MFNA 2D0GA 1R3JB 3FQUA 2H6PA 3EKCA 4HXAH 5E56A 3T2QA 5JNYB 5C09A 4HIHA 4JZJB 4ZPVA 4Y4KD 2MPAL 1F8TL 3QIWD 3U82B 1H3PH 1VHPA 4PRAA 2P5WE 5CEXB 3QIUD 3LHPH 4JZJC 4TVSa 1RUML 2DLFH 3MRHA 4O02L 1FIGL 3NFNA 2AABH 5HGGS 5SWSE 1K8DA 1XT5A 4IRJB 3VH8G 1K2DB 5E24E 3IB4A 3VD5A 5SWQA 4X8JB 4E41E 1JRHI 1NAKL 2AXJA 4U7KA 4YO0B 2R2EA 1IQDA 2BFVH 1RZFH 3P9MB 4C56E 2OTPA 2PYEE 2HKFL 5ICYB 3V52L 5IB3B 5JR1L 4OV5B 5I9QB 3EYFB 1M05A 4O5LH 3PGCA 4NCC2 3D39A 3D85D 3TO2A 4XPFL 1MH5B 2DJUA 2O5XH 4QYOA 1XCTA 1EX0A 1KOAA 2VABB 3Q48A 5IF0B 1WTLA 1TQCC 4H0HB 5KJRL 5I9QC 3LB6D 5JHDA 2W60A 4Q9BA 4ZQKA 4PRDA 3SOBL 3PV7A 5IESH 1VENA 3MGOB 3BP4B 3EYQD 5IVXE 4GG6A 1HILA 4HKXA 1CL7L 5KS9A 5ISZA 5FGSA 4ZFFB 1X5JA 4O51A 5CGTA 5I2IB 4U31A 3HI5L 5BW7C 1N64H 3HE7A 1YN7B 3RP1A 3IAQA 4ODWA 1BBDL 2NZ9D 3MOBL 1J18A 4U4BA 1MY7A 3V6BR 5IV2A 1KCVH 4DEPC 1RZJH 3SKMB 35C8L 3WFEH 2CDEB 4MNHA 2FJFB 2PW2A 4MAUL 1G7LB 3O3EA 4I0PB 2XWTB 3BKYL 2WINB 3IDXH 4MJ6A 5CCKH 1ND0A 1IAOA 4I18B 3IFPB 2J8UB 3BZFB 5I1JL 3N9GL 3PWJA 1MWAB 4XAWH 4HIJB 1KTLB 3NTCH 4AMKL 3QXUA 1Z2KA 3QHTC 1JZ8A 3ECBA 4I0PC 5HDOA 4I18C 1CS6A 2B2XH 3CFCL 2BY1A 3QHFH 4JHAH 2FGWL 4ZOBA 3QFDB 4Y5YA 2ICWB 1L4IA 5KSBB 5C08B 4MZ2A 1RV6X 5E00B 3G6JF 4OCWH 4NQEE 3L3OB 1Q1JH 5HHOB 2OMBA 4NBZB 2H1PL 1MFCH 1INEH 1I9RH 5C09D 5GSVB 3JWDC 5DMIH 5E8OA 2DN7A 4XBPA 3VWKC 1Z3GH 5KVEL 4MJ2A 3JWOL 4FXKB 3WFDH 3OKKB 1U58A 1MCNA 3HFML 4OZIE 2VR5A 1LE9A 3OBAA 1MUJB 1YJDH 3TYGH 2Z31C 4XNMB 5DRWA 2VXVH 3O3AB 5AAWA 3QXAB 3X13B 1DUZB 1CICB 3GBNH 1FYHB 4X9BA 1CGTA 4X98B 4MQXC 3KPSA 2OJZH 3QDAA 2JIXA 2WUCH 5BXFB 5HD8D 1CICC 2PNDA 1FN4A 3N1MC 3KJ6H 1LMKA 2Y36L 4U7SA 1NMAL 1PZ5B 5L9DL 3V7AG 2I27N 3HTLX 2C4FU 4GKNB 3FZUD 4MXQD 5KVFH 5FDYA 1HOCB 1F00I 4C56A 1GZPB 1S7TB 5DEGA 3IRPX 3QQ4A 1Z5LA 4XBEH 3LKSB 1R5WB 3G04B 4ZUTB 2DKMA 5GQBA 1FGNH 5I74B 3QFJB 4OI8A 3OKDB 5ANMA 3ARTA 1F13A 2BERA 3SE8H 1BD2E 2W65B 3SGKC 4GAYB 2G60L 4S11A 3MRQA 4U1NA 5FM4A 5TDPA 5CHNA 4NRXB 3KLAA 3P4NB 2YA0A 4KDTC 1A9EB 4ONGL 2IJ0C 1OP9A 4R2GD 1K85A 3RTQD 4K7PH 1IM9A 1BEYH 4FNLH 4GKZB 3QA3B 5HPMB 4QXGH 2OK0H 1GXEA 3OJVC 3V2AR 4ZTPH 1CXIA 5EPMA 1JV5B 4OLUL 5J4MA 2CUMA 2IPTL 3BJ91 4NNYA 3DURB 5IB4A 2WM0A 2EIBA 3O4LE 1JGVH 4XWGH 5C9JB 2B4CH 1N5AB 1RUPH 4Y19A 5HYIA 4B41A 5D72H 3CH1A 1LO4H 1IQWH 5FYKL 1F2XK 4PGCA 3ROOA 4WTZA 4R4NC 2C5DC 3MLVL 1WC7A 2EIEA 4U3CA 4JKPL 4DZBA 3SGDI 1ZSDA 2YPLD 4BQCA 1KB5H 2BMKB 4XNQA 1KN2L 2HFFB 3LH2H 3VGEA 2CLZB 5ETUB 4QXTA 5E2WH 3JUYA 4L4TE 4UU9B 5H35A 2GFBA 4JFEE 4LLMA 2BZDA 1B9ZA 4FMFA 2YPKB 3PNWA 1GVIA 1ES0B 1S7WA 3MV7E 3HRPA 1KPUA 1L7TH 4WFEE 4P2RB 5EUOB 1U41A 2A9NH 2BNQB 1NANH 2GTZB 2EYTB 1FNSL 4G6FB 4MGXA 4DCQA 3QQ9C 4MS8C 1C5BH 3P0VH 4J1UB 4LEXH 3K8KA 1QFOA 4OZIA 4OIAA 2CLVB 2VLJA 1YEJH 4GRLB 3VW3L 2Z91A 3KPSD 1BFOB 3I3DA 1WWWX 1I4FB 3HAEH 3KPNB 5MHSE 2JIXD 4X6CE 3BIKB 2BX5A 3IAPA 2XWJB 1FL5A 3QUKB 3G5YB 1OAKL 3F7YA 1KEML 3NFPB 4ZSOA 2AW2A 4GRLC 3QXWA 5GZOD 4P4RA 2ADFL 5IHZA 3PABA 1EBAA 4OCNC 1MI5A 1FNEA 4Q6YA 1UENA 3CX5K 5HPOA 2AJXL 3LRHA 1LD9B 2FSEB 3QRGL 4M1GH 1NGWA 5KSVB 1JRHH 4CMMB 5E8PB 2NY5C 1FFPB 4A6YA 5EO0A 3FO2A 4OM1L 4JFOA 1JPGA 2IMNA 2J4WL 4M9PA 3VG0H 1ETZB 4BK5A 2NTFB 3B8YA 5FF6A 32C2A 5T3ZE 4KVCL 3ZL4L 1ADQL 1UB5A 4HFUH 2VZOA 4CL7A 4Y1AA 1L7IL 3ZT6A 3N85L 1X3DA 1WBZA 3GNMH 3OX8B 3REWA 3WFZA 1JWMB 2GITA 4LLDB 5BS0A 3T2OA 4MB3A 2DQDL 4N0UB 3X3GH 2R23B 1S5IL 1WQVT 4QRTB 2AAVA 2FX8H 1ZEAL 4EDXA 5ABDE 2IQ9L 1A7NH 3L9RA 1YMMA 2F5AL 4JDZB 3TNMB 2F58H 4JRXA 4YIQB 2V2WB 3WD5H 2VLKB 2CPCA 5T5NF 2NY2D 3QIBB 4CAGA 2H45A 5FYJE 4BFIB 4DKEH 4WW2F 3IJYB 5E8EA 3K1KC 2LU7A 1MF2L 2G5RA 3KPRE 5BRZE 1W0WB 2OXGA 5GIRB 5T3XH 4L8CA 3JV4B 3MNVA 1S5HA 1L0XA 3G9AB 3H3PL 2FX9L 4LCCA 4NQSA 5IMMB 3WIIH 1PVHA 5IG7A 1H0DA 4YHKL 1TNNA 2A6KB 3TNNB 3I50L 3GMOB 2Z8WC 3QZWG 3E2HC 5B4MC 5GJSL 2H32A 4YBQC 1QRNE 2PTUA 2VZVA 4LHUB 4Q6IA 3UJTL 2R2CA 3L7EB 3VFGL 1I8IB 3RVXD 3NCYS 2DLIA 3O6MH 3I02B 2E6JA 4PREA 3OB0K 1I1YA 2R9HC 5CLWA 4L4TA 3ZE2E 1EPFA 4Z8FL 4JG0L 3VXUB 5CKGA 3ARFD 3LN9A 3D87B 5CLTA 4I4WB 2LV4A 2VLJD 4PGZA 1X5AA 5C0JA 3NGBB 5D2NE 4OCXH 2DQGH 3BAEH 5ADPL 1CDGA 4DVBA 3TH2T 4HPYL 3O8XB 1NCDL 1XGPB 1E4XI 2UYLB 4OCRL 3IFNL 2ZJSL 3NGBC 5KANG 1AO7B 4HLZG 2CH8A 4LEOB 1DQTA 5C0AB 3IGAA 4X6CA 3DYOA 1I1AB 4POZC 5FIEA 3O8XC 4O9HH 5EZJB 3BP7A 4OLXL 1AR1D 1SYVB 1J8HA 2XZCH 4WI8A 3RWCA 1Y18A 1F58L 1F97A 3I84A 4P0DA 1YEEH 5HVHB 2QADB 2DQFA 3P0YL 5D6DC 4WO4A 4HZAA 2HMID 4LHQB 3PV6A 2IGFL 2Q8AL 5HVHC 4BSWB 5CEZD 2J6EH 2QADC 4XP1L 3I2CL 5HHNB 5DRNA 1A7OL 1EO5A 1OB1B 5JTWA 1I3UA 5LBSL 1WIOA 3DROA 4QXUH 1F3DH 4HGWB 5DMKB 2CUIA 4OJFL 3UZQA 5DJZB 3TBYB 4JO3L 4JGJA 1KCRL 1T0MA 5BVPL 1EUTA 3BE1L 1OWRM 3TESA 3LKOB 2Z8VC 4DN4H 1YMMD 4KAQL 1UCBL 2BVOB 2YWZA 3BDYL 1B4JH 4M62H 3U0WH 4JRXD 3STZA 2BY3A 3QUZA 3DMMB 3MLXL 5E08H 1RZJC 4PGBA 3MRPA 5IBTH 2CIIA 1UKTA 3IJHB 5L7XL 2FJGA 4OZHE 3R1GL 3RWGA 1FO0A 4U1SA 4UDUA 1R3LB 1QBMH 4PJHA 2ORBH 3DMMC 4M6OH 1MCOH 2HVKA 4Z78A 5B39G 2NY0B 5SX4I 5HHVH 3OR6B 1M7IA 2FEEL 4XNYL 4FMKA 1CTOA 4LIQL 3BH9A 3FHQA 1J05B 4NJAH 1D5BA 4HQQH 3LEXB 3SY0A 3LKPA 3KPRA 5F96H 3VFWA 4D8PB 5IM7A 3WXVH 2QQKL 4C58B 1I7UA 3WO4C 2E9WA 4YHLH 1DSFL 5E6YA 1L9NA 3TFKC 4X6FB 1UXSB 3WUWB 1Q94B 3O9WD 4LLUA 1J10A 2BCKA 43C9A 1TJIL 4KPHH 1MRFH 1QR1A 4PJGE 4V1DA 1FV1B 1WWBX 2RBLA 3FQTA 1DQDL 3RVTD 5EIIB 1A6AB 2IH3A 3QQ3B 5LQBH 2YD6A 3SGDH 3O45A 2EH8H 4F33B 3DETC 4ZPTB 2UZIH 4YXHL 3UO1L 4PRBA 4ETQA 2XACC 1T6WA 5C0BD 3U48A 4H0IA 2VDKL 4NKMB 3WFCL 4BZ1H 2X9YA 3EFDL 1EAPA 1UH2A 5DT1L 2OM5A 5C0EB 5CIPA 4I48A 3GBML 1BZ9B 4X4ME 4LFHD 1Q0XL 4QGTA 4P4KB 3O41B 3ZKSD 1HINL 4NSKB 5D2NA 4NGHL 4Q9RL 5AG8A 1A0QL 3PL6A 3RAJL 1BQUA 4L4VA 3QEHA 4UOJA 1J8HD 4P59L 5TE4L 4P4KC 3TN0D 3VDAA 4JO1L 2NTSP 4Z7VB 2C1OB 1P6FA 1T1ZB 1RVFH 3SDXE 3MX0A 5AD0B 2Q7NA 43CAA 1OQXA 3KPPB 3PP4H 5C0CE 1RURH 1WAAF 2PXYB 4E5XB 2BNUB 1ZE3C 5EU7E 2YKLL 3P11L 3O6FB 4K23H 3EHBD 4DFIA 1KIPA 4YR6B 3O11A 1PQZA 5GISL 2R56H 4O00A 3ZKNC 4BJLA 4WHDA 5FKPB 3RPKA 3HMXL 3VXPB 4MXVE 4DOHE 3O6FC 4DUXA 1CD1B 4GRMA 5EU4A 1OTUD 3PWVB 5FA4A 1R5IA 1T7VA 4G9DB 4UV4L 3OGCB 3I9GH 5EBWB 2HLAB 3AAZA 1K6QH 2HTKD 1A7PL 2WW8A 2VLRB 4EUPA 2YUXA 3LQMA 4G5ZH 3H7BA 2DWEB 1G6RH 4PJ8A 5T5NG 4JFDB 4DGIL 3WDIA 4LBEB 1XGUA 2H3NA 4Z7OF 5D5MB 3OPZL 2C7UB 2P5EB 3ULUL 2XTJE 5BO1H 1A7QH 1X5GA 4OZHA 3P40A 1I7TB 5IIEB 2B4CC 4LSUL 5C8JB 2O93L 4U05A 4YC2C 3M07A 3KNBA 1GGUA 1CL7I 4KRLB 4PRPB 5DRZB 1KB5B 2OZ4A 1DBKL 5H2BB 1SEQH 1TZIB 5KTEL 4XI5D 1JF5A 5JIPA 1Q72H 4QEGA 1XAUA 4RFEA 4LGSB 5MP6L 4BSVA 4V1DD 4NM4H 4WFFE 1G9MH 5F7EL 2AJYH 5MERB 3KPMB 2P44B 5JORB 5TQ0H 5BJTB 1J8KA 4PJGA 4Y5XA 1AGCB 5ESAA 5CBEB 1T1YA 4U1LA 5FA3A 4BH7B 1QPXA 4U3HA 4FZ8H 1EBPA 4FG6D 4AZ8A 4FXGB 5I0DA 1MRCL 3H3KA 3HAEB 3Q6GL 5CBAA 3JTSA 4NHCL 4FQXC 4BM7A 3W0WB 1LE5B 3AC0A 4WTXA 4LRNL 2K9UA 4L4VD 4DZ8A 3GB7B 5IVXF 4JRYB 2CK2A 4X7TB 2VJXA 4U6VL 3E1F1 3OAZH 3LKRB 1MCSA 3EJYC 2BJML 4N0CD 1TTUA 3RIFK 5TQ2L 3FN0H 1U8HA 2JCCB 3S5LG 1A3RL 1QO3A 3TWCH 3QNYA 3D2UA 4AM0B 4PTUB 2K1MA 1E6OL 1DBJH 1XZ0B 4WEBH 1NLDH 2ATPA 3VD7A 1NCCL 3DGGA 4YE4L 1QSFA 4R96B 1NSNL 5ALBL 5DQ9B 2FR4B 3I75A 3GSUA 5I15H 1NUGA 3EYVB 3HR5B 2P8PB 4NKOB 4CVXB 1OLZA 5C3LD 2CLRA 3OKYA 4QRSB 5C6PB 3D9AL 5KSBE 5C08E 3HZYA 5D2LE 5E4EC 3IFOB 1XR9A 4G7VH 3GSVB 2RAMA 1RU9L 5HI4D 4UBDD 1GGBL 3HA0A 1XGYL 4NC1E 2X4TA 1INQA 1JNNL 3U0TA 4F2MB 5E5MB 1JGUH 3TJEL 1F4AA 3LN5B 4GO6B 9CGTA 5I73B 4AT6B 5GRJL 4D9RD 1R3JA 5DVMA 3WNMA 3MXVL 5JNYA 4JZJA 4U7MA 4ZD3H 5F9OL 5CEYB 1FLTX 3KPOB 1FQ9C 4OZIF 5I73C 1TLKA 4WUUB 5C07B 3C9NB 3LPWA 3RGVB 3VXSE 3U4AA 5CEXA 7CGTA 1JZ2A 3HUJB 3S98A 5SX4H 5EU3B 3MBEB 2V7NB 3HG1B 4UINL 5B38B 1ZGLM 4PGEB 2GJJA 4IRJA 3RGVC 1KYOK 1K2DA 3O2WL 1TNMA 3DV6B 1NBYB 4X8JA 3QEGL 3QCVL 5A2JH 3MBEC 5JOPD 2GKIA 2SEBB 4YO0A 4NJ9L 1YQVL 1J5OH 4EJ1C 4U6YB 3LD8B 3FFDB 5FECB 1TITA 1EMTL 1X5XA 4IBLT 4HIIB 3S3SA 4KQ3L 5IB3A 4OZGF 1JTTA 4YDLB 5B22A 4OV5A 3QCUL 3EYFA 5GGSB 4CBPA 1BHGA 1MJ8H 3MRLB 3HZVA 1RI8A 2EEBA 3LD8C 1MH5A 4OM0H 2XG4A 4PJBE 4HGKC 5I1IH 4ELME 4XP6L 3WFBH 2ZOLB 2VABA 4TUJB 4TUKH 5IF0A 1I8LA 2HTLD 3VGFA 5CJ8A 2UV3A 4LVHC 1VERA 3CMOH 1MQ8A 3MGOA 2B5IB 3BP4A 5IT2L 1OAUH 4ODTH 2DTMH 1UWEL 5I2IA 1N5YL 2HT2C 4OFIA 3RX7A 2D31A 1QNZH 2VITB 4W68A 4G43B 1YN7A 4I0CC 5I30L 3D2UD 4AIZB 4PJXB 1YNKH 4M6MH 5T33H 5IFJA 4M6AA 3PQYD 4N8PA 3SKMA 5DVOA 1FDLH 1F90L 1QSFD 2ED8A 1MIEH 1MHPL 2FJFA 3VFNA 4JN1H 5IQ7L 3D69B 1BZQK 4W4OA 4XPBL 1G7LA 5FYLH 1RZIB 1T1XB 4I0PA 2XWTA 3S8WA 2WINA 1P4LB 3MRFB 4I18A 1KIQB 4PLJD 3IFPA 2J8UA 3BZFA 2RFXB 4QXWA 1MWAA 4HIJA 2VN7A 1KTLA 2MPAH 1F8TH 5D93C 4PJDE 1CXKA 2KH2B 3OGOE 3OTTA 5CS7A 4IRZL 2YBRB 4PLKD 2GK2A 5CJXA 3I6LD 5LGJB 4O02H 1FIGH 3ZSTA 2KUTA 1H8NA 3QFDA 2ICWA 2GAZB 5C08A 5BMFL 5KSBA 4MA7H 5E00A 5LCVL 4XCCL 3T2NH 1MQKL 3L3OA 2VH5H 4BYHA 5HHOA 2Z35B 5KANI 1AI1H 3ARPA 3KPLB 4WFGE 2AP2A 3H9HB 2RJMA 1BVLB 4FFYH 5E2VH 3OF6D 1LO0H 3V52H 5EUOE 1S7UB 5GSVA 3NPSB 5HY9B 4FA8A 4J12A 3PHSA 1KENL 4FXKA 5ACLA 3OKKA 5GRZA 4YEFA 3CU1A 2GHWB 4PBWD 4JFXB 2P45B 4BKLB 2FX7L 4RX4D 4H20H 1MUJA 1GC1H 4XNMA 4WGWB 3O3AA 4HC1A 5FM5O 3QXAA 3X13A 1DUZA 3T0EC 3LOWA 4YHYC 3CIQA 5I1KL 4O2FB 2VNCA 1D5XB 3SDCB 4X98A 2WK2A 1BBDH 1J1XL 5IKCB 5TDOB 1PZ5A 2VQTA 3MOQA 4GKNA 2JELL 35C8H 1OD7A 1T6VN 3FFCD 1HOCA 4U6XA 1GZPA 1HHHB 1S7TA 2E8ZA 4FP8L 2ZUTA 3LKSA 1R5WA 2DM3A 4MJ4A 5IK3B 3G04A 3TT1H 4ZUTA 1NGXB 5E2JA 4CU7A 3QFJA 3OKDA 1U8OB 2JJVA 3PWUB 2V6HA 3FRPG 4UIMB 4RGNB 2R0ZL 2W65A 4A6YL 4GAYA 1FE8H 1FGVL 2IC2A 3CFCH 4NRXA 3P4NA 4OLWL 4ZUWB 1A9EA 2CR3A 3CFKB 3ARVA 5SX5H 2EE2A 5JQ6L 2OYPA 2VLME 4I3GA 4QT5B 4XP5L 1JNJA 1RIVL 4GKZA 3QA3A 1MCCA 5HPMA 2MMXA 4I0PD 5JOFB 4WI2A 3A6BL 3JUZA 1QSEB 1JPSL 1JV5A 5F70A 2DQCH 3ZKXB 4L8SB 3VRJB 3JWOH 3V8CA 3DURA 5EBMB 1CE6B 1JCKA 5IJKC 5CILL 1X5IA 3GRWA 3LRGA 5IMKB 4LHJB 5C9JA 2EIDA 1JHKH 1N5AA 3FAWA 1AH1A 3SJVB 1U8NA 2Z8SA 1FL3B 3HI6L 4L8SC 4KH2A 1G6RB 1KC5L 5FHAL 3HZKB 3D25B 4UOW0 1JFQL 2IWGA 5HHOD 3M1BA 3VWKD 4XHJC 2BMKA 3NH7L 2HFFA 2CLZA 2APWA 4GW4A 5ETUA 2Y36H 3RWEB 1NMAH 2Z31D 4UU9A 4G9FD 2W0LA 3OJDB 3MTRA 2AJSH 3VXUE 3VGDA 4Q58C 3M17B 3GGWA 4MD0B 2VERN 2YPKA 3BPOC 1ES0A 1L0YA 4H8WC 4XPAL 2PTVA 3ZE2F 4PBXA 4MQXD 4P2RA 5EUOA 4J3SA 2BNQA 2GTZA 1WBXB 2EYTA 2VC2L 2VN4A 1JIBA 4J1UA 4W4NA 5J06A 1CICD 4P99A 3R8QA 1FORL 4P9ML 2CLVA 1KCSL 2ICCA 3MCG1 2YZ1A 1BFOA 1IGYB 4I0KA 3KPNA 4L3CB 5BV7L 1UGNA 3BIKA 4IMKC 1U93B 2XWJA 3QUKA 1G9MC 3G5YA 3NFPA 2KDGA 1HHGB 4LPTA 3W9DB 3HNSH 4RMRA 3N1QC 3A6CH 4JFFD 4KTEL 4JY5H 1MJ7L 1LD9A 2FSEA 2O26U 1Z6JT 3CX5J 1NCWL 5KSVA 4CMMA 1B3JA 5E8PA 4ZO7A 3QFJD 2XT1B 4HWZB 4R7DB 3SE4A 3HNTL 4IRSD 3MYJB 4GBXB 3ET9F 4X7EC 1ETZA 2NTFA 2GW5A 1OPGH 2ZOKB 4M7LT 1EA9C 4F8QA 3K80A 2W1NA 4JFHE 4OF6A 3OX8A 1I7ZB 1JWMA 3X3FL 4KJPC 3MLVH 1YEHL 1OT2A 4QKXB 4YXLL 4JKPH 2LU4A 2R23A 4QRTA 4PJIE 1KN2H 2QQNL 1VEPA 1C08B 1CXLA 4JDZA 1H9VA 5EZOL 1WFTA 4G80B 3TNMA 1GHFH 5GGTL 4YIQA 1KFAH 4ZTOH 4N8CL 2AI0L 4H0GA 1NMCB 4WW1B 3QIBA 4OZHF 1KEGH 5JO5B 4BFIA 5JDJA 3FAXA 1EAJA 3IJYA 4R4ND 2DQEH 2XZQH 2ED9A 4LSVH 2AV7B 1W0WA 1NMCC 3ES6B 5ECJE 5GIRA 1KF9B 3DYPA 3JV4A 1SVZA 3Q5TA 3TH3T 1S9KC 5IMMA 2A6KA 3WXWL 4F7PB 3TNNA 3NACL 5FYJL 3GMOA 3RL2B 1ROWA 4GQPH 4ERSL 3MZGB 1G7IB 2XFXB 1LK2B 4U1HB 2ADFH 4LHUA 3KYOB 4XP9L 3VH8B 1NBVH 2XI9A 3QQ9D 4MS8D 1HXYA 3ARDC 3L7EA 1I8IA 3QI9B 3MRJB 3I02A 2PW1B 3QRGH 4P2RD 2DD8H 1U2CA 4JE4B 4TNVF 1AGEB 4HLZH 2WBKA 4G6FD 5SWZD 3F7RA 5DC9B 3VXUA 1F4HA 4U6TA 3QI9C 4I4WA 4GRLD 4R0LB 2BRRL 4AEIH 4NN5B 4LPVA 4P5TB 5DR5L 3O8XA 4KVCH 1XGPA 1ADQH 3RUGE 4LMQE 1QVOB 2DM7A 1AO7A 4LEOA 5EC1B 4HUWB 4NN5C 3VD9A 1DQJB 2YUWA 1AQDB 5C0AA 4IJ3B 5ICZB 3GMPB 4NP4L 1I1AA 3MLSL 4Q7DA 2MOVA 1KCUL 1S5IH 5EZJA 1ZEAH 3T0DA 2IQ9H 1FG9C 1SYVA 1F4YL 2VXTL 4ZODA 3WHXA 4UTAL 4JO4L 3BDBA 2XV6B 5AZ2H 3SDXF 4NFBA 5B3NA 1CU4H 5HVWA 3U9UB 1HI6B 4HSQA 3PF2A 3QPXH 5HVGB 3IU4L 2YA2A 4BSWA 5HHNA 1F3JB 1G84A 1OB1A 4N90E 3TBTB 1YEDB 3H3PH 5DMKA 3CCHB 3TBYA 3P30H 4YHKH 4Q0XL 4MXVF 5DJ6B 3WS3B 3K8MA 1BQLL 1NL0L 3LKOA 2BVOA 3HC0B 3RA7L 1JWUB 4X4YB 3RWJB 5J3HC 1SBSL 2VLKD 3I6KB 3DMMA 3WSQH 3UJTH 2XKUA 3CH8A 1GOFA 3BWAB 3EW3B 3IJHA 5KAQF 5FGCE 1A1NB 5E99H 1R3LA 1V05A 4NC0B 4JG0H 5B4MD 4PRPE 1IT9L 3OR6A 3O3DB 1T2QH 4YBQD 1SM3L 4OLZL 2YN3A 3KPQB 1J05A 2YMXL 3TVMB 1VPOH 3LEXA 2K3TA 3CSPA 4MA1B 1GGTA 3GJFH 3U4BH 3U83A 1IGCL 2X1WL 3DNKA 1NCDH 1EEZB 3KYMB 1A14L 4OCRH 3IFNH 4TVPH 1CFVH 5I8KH 2R9HD 4X6FA 2Q3ZA 4LHUD 1PEWA 1UXSA 3WUWA 2QQQA 1Q94A 1N0XL 5EU5A 2HRPL 2HH0L 1FV1A 3D3VB 1U3ZA 5EIIA 1F58H 1A6AA 3QQ3A 2OS7A 4D0BB 1HHKB 2VDMH 3Q6FB 4CADB 4ZG1A 4F33A 5D7LB 4FTVD 4ZPTA 2H41A 2CQVA 2OP4L 1LQSR 4RGOL 3JV6B 2X41A 2Q8AH 5C0EA 4POZD 5D9SB 1JF6A 4XP1H 1BZ9A 3B4NA 1A7OH 4ZAKB 2DMBA 4KI5E 4FZEL 2EDLA 4P4KA 1LILA 3O41A 5LBSH 4NSKA 4DKAA 2WBWB 3P4LA 4OJFH 1YEGH 5C0AD 1VESA 2N56A 4CU6A 1GGCH 2ICWJ 4M61B 5DD3H 1YMHB 3DUSB 5DK0B 1LEIB 4X7CC 2OLDA 4R90L 4Z7VA 2C1OA 3MLXH 2Z9TA 2QADD 1MFNA 1T1ZA 4ISVB 5AD0A 3MV8D 5L7XH 5EA0H 3THML 4HPOH 3PE9A 3KPPA 5FKAA 2J12B 2PXYA 4E5XA 2BNUA 1TZGH 1QFWH 3WYRA 4FQIH 3ULVE 3QR2A 4GRWE 3B5TA 3LEVL 3MV9B 3FKUS 3O6FA 1DEEB 3LKNB 4OGZA 4YR6A 1CYGA 5HDLA 1WZMA 4Y4HB 2COQA 3V5DB 5AG9A 2MJWA 1A5FL 5FKPA 2QQKH 3VXPA 1SJVA 5T5FL 1CD1A 2DQTL 1OHQA 3BI9X 4LSTL 1DSFH 5D2LF 4U1JB 3PWVA 3DMMD 4Y4HC 4G9DA 1KXQE 3OGCA 5EBWA 2HLAA 3FMGL 3J8F7 1FRGH 3GM0A 3D0LB 1QKZH 2VLRA 3UTQA 2DI9A 4G8EB 3DVGB 4N1HB 2V9TA 2DWEA 1TQBB 4JDTL 4JFDA 1IZKA 4LBEA 1A47A 4K94L 3D0VA 5C0IB 5D5MA 4YXHH 2C7UA 2P5EA 3JWOC 4KV5E 4XVSL 3TFKD 4K3JL 2OSLB 3EFDH 1I7TA 2ID5A 4U1MB 4KK9C 5IIEA 5C8JA 4Q74A 4GAFB 5HDQH 3GBMH 4PRPA 1TCMA 5DRZA 4MMZC 2OI9B 1KB5A 3EYSL 4PTTB 5TGBB 5TF0A 1FZMB 3BRFA 3MGAA 4KKNA 4HIEB 1TZIA 1H5BC 4TUOB 4NQDE 5CZVL 3CD4A 3DETD 1A0QH 2NY7L 5GS0L 4OB5L 2BC4B 3RAJH 5JW4N 1WFOA 1X7QA 4TRPL 3VMPA 5TE4H 5MERA 5C92A 3KPMA 5JORA 3CLFL 4JO1H 1IMHC 4WCYL 5BJTA 3LAFA 1AGCA 4UT9H 5CBEA 4BH7A 5KBNC 1QA9B 2QSTA 5TFSL 2N4IA 5I8OL 4HJJH 4FXGA 5E2TL 3HAEA 2YKLH 1IGJB 3P11H 4FFZH 4OFYD 4P4KD 1RJLB 4PJBF 5DVLA 4ELMF 2OTUB 3F5WB 3EYUL 3W0WA 1LE5A 3QJFA 5GISH 3O2VL 5CP7B 2WSKA 1G1CA 3GB7A 4JRYA 4AG4L 1OP3H 4NN7C 4X7TA 1C8PA 1UZ8B 2OXHA 3LKRA 3MUZ1 1YY9C 3INUL 2JCCA 4PB0H 5A43C 1FCGA 4X9GA 2I5YL 3E8UL 1T2XA 5CD5C 5F7LB 4AM0A 1VA9A 4PTUA 2P48B 4DGIH 3ZKND 3WS6C 4Y2OA 3UTZA 4NKIL 2HWZL 2YN5A 2RCSL 4YBLC 1UWXK 3O6FD 3OPZH 4L3ED 4R96A 1YY8B 3BKJL 5DQ9A 1WIPA 3R8BB 2FR4A 3NIFE 3G6DL 4N0FB 3EYVA 1KN4L 3HR5A 2P8PA 4NKOA 4LSUH 4CRPA 2BVQB 2BXZA 2BHZA 4CVXA 4PJDF 2MCPL 1IGTA 4QRSA 1DBKH 4KZEL 2F54E 3IFOA 3GSVA 1AHWB 4LSQL 4WFHE 1BJ1J 1BREA 5INDA 1JZ7A 5MP6H 4HZLB 3SDAC 5F7EH 1N6QL 4JFDD 1A3QA 5FGRA 3IAGC 3G6JB 2PYFB 3GI9L 3BGFB 4F2MA 5E5MA 3TBVA 2P5ED 5BOPA 3LN5A 3SGKA 2X4PB 4AT6A 4WEMB 1D5MB 3ELAT 4EVNB 3OAZK 1LO2H 5D1ZC 5MEND 4RNRB 1G7MB 3V4VH 5CEYA 3E6HB 4P2OB 2BK8A 3KPOA 1MOEA 2EDJA 2R2BB 3Q6GH 4M5ZH 5C07A 3C9NA 3MXWL 3RGVA 2VDRH 1QR4A 5L8JB 2A6DB 2CMRL 4LRNH 5EU3A 1P9MC 3ARXA 3BP5B 3MBEA 2LAAA 4Z77B 4UOW1 3HG1A 4P2OC 1WUNT 2B7DT 5B38A 2IAMB 4PGEA 3DX7B 5CWSB 4D2NA 4JRWA 4HX1B 4NQDA 1PJ9A 3Q5OA 2BJMH 4HC1L 3DV6A 1NBYA 5ID0B 1A3RH 1KYOJ 2SEBA 4FQXD 1KCKA 4U6YA 5FECA 3FFDA 1JP5A 3UZEA 5EOTA 4HIIA 3VGHA 4UV7L 5JOPE 1AIFB 3ZLQC 5HYFA 5GGSA 4HKZB 4APQB 3L3IB 1EEQA 1NDGB 2IPKB 4YE4H 3MRLA 1NSNH 5DGRA 1OM3H 4ZNEE 3EJYD 5E9DB 1QSVA 2BDNL 3T08A 2ZOLA 4TUJA 1JK8A 4R7NB 1T04B 4R6UA 3RL1A 4G6MH 4JRYD 4APQC 4KK5C 3LY6A 1DQQB 3D9AH 1BGXL 5DUBB 3DI3B 1IGIL 1MELA 2DJSA 3P73B 2VITA 4G43A 1RU9H 3G5VA 4K55A 2ZPKH 4AIZA 4PJXA 3AREA 3FCTB 1YYMH 1AE6H 4HKJB 4TQEL 3DXAB 4CKVX 2J6EA 3BOVA 2NXZB 4N8VA 5GRJH 3D69A 1RZIA 1T1XA 1JMXA 3BPNB 2YK1H 2Q3AA 2V7HB 3PQYE 5L8LB 1P4LA 3MRFA 1KIQA 5GPRA 4HIXL 1OY3B 5F9OH 2GUOB 1T89C 2RFXA 1LEGB 5B39B 3GSRB 1CFBA 3ZE1E 1NCNA 3ZO0A 1B4RA 2FD6L 4CN6A 4DQOH 2NW3B 3BPNC 3QG7H 3CAFA 1T83C 2YBRA 3ISWA 2FATL 5LGJA 4UINH 3VWJB 4GKOA 3GRWL 1PX4A 2D03L 3S96B 1BOGB 2GAZA 2F54A 3B83A 2CRZA 3O2WH 3EFFB 4M8VA 3VFRA 5F6HI 3QEGH 1A6WH 2RB8A 1RK1B 3QCVH 2Z35A 2JB5H 5T3XD 2ADIB 1C5DB 3SE3A 3KPLA 3H9HA 3CUPA 3BD4A 4GW5A 5GRUL 1QACA 15C8L 1AQKL 4KQ3H 1S7UA 3GJFB 1JYNA 3V6ZB 4BZYA 1RZGA 1I9EA 4WUUD 4HWEL 3NA9L 5FO7B 5C07D 2A0LC 3RGVD 4DW2L 4LU5H 1CLZL 4JFXA 4QTIH 5EOQH 4BKLA 4B50A 4XP6H 2VDLH 3V4PL 1I1FB 3MBED 2AK4D 3L7FB 3PDDA 3MSPA 3DARA 1QUNA 1RUAH 1NJ9B 4F80A 4EI6B 5K9KB 2DQHL 1A2YB 3W5NA 4O2FA 2BVPB 4LQFL 1D5XA 3SDCA 5IT2H 1ED3B 1V3MA 5HHPB 2F8VA 3U1SH 1N5YH 3QSKB 5D71L 3CJJA 3BWUC 4G8GB 5L88L 5IKCA 5TDOA 4MB5A 1L6XA 5ADOH 3KJ4B 2E7LA 4WI5A 4S0SD 1EFQA 1MHPH 6FABL 2IPUK 2X4OB 5AAMA 5LWYL 1HHHA 3QWRA 4NZRL 2C4XA 2X9WA 5L2JB 2HT2D 2AGJL 2GY7B 2F15A 3KJ4C 4H25B 5DJ0B 5IK3A 2VIRB 3FFCE 2G75B 1W2KT 4JREC 1QSZA 1NAMH 1U8OA 3PWUA 4IRZH 4L1HA 4PB9H 4ZNEA 1RUQH 4NO3B 4UIMA 1NFDE 3B9KB 4TSCL 4PJ9B 1P7QB 4ZUWA 5DJ2B 4ZDHB 4U1GC 3CFKA 3IS0X 3OJMB 2D3VA 1CFQB 1DLHB 4RRPG 1MQKH 5K9QG 4PJIF 4QT5A 4PJ9C 4NKDB 1ZLWH 5JOFA 3LIZL 4MJIE 3QDHA 1KBGL 1QSEA 3WEXA 5HYSB 5DXWA 5F9AC 1IC5L 3NABH 4L8SA 3VRJA 5EBMA 2X4QB 1CE6A 3U30C 3A0OA 4WW2B 1YEKL 3G9VA 5IMKA 3WNNA 2MQCA 2FX7H 2NW2B 1I9IL 4YFEA 3ZZ1A 3DHJA 4HS6B 3SJVA 1FL3A 4PRIB 5GSRB 2C3VB 1XGTB 4WW2C 1G6RA 1MJUL 3HZKA 4CMHB 3GMQB 1DJSA 2P46B 3D25A 4M4PA 3VXRB 2EDKA 2L7UA 4NQCE 1JL8A 4NRZB 4J23A 3F6IA 4GS7B 2GJ6D 3SE9H 3RWEA 3LQZA 1FYTB 2P1YA 3OJDA 5E6IC 3G5XB 2JELH 3T0ED 3MR9A 1DN0B 1TTGA 2FWOA 3SKJL 4HXAL 4MD0A 1JZ3A 4P2QD 4LCUA 4GS7C 4J3XA 5SX5K 3T2PA 3VXTB 3UTSE 1WBXA 3NIGF 4IMKA 1R3KB 3ZDZF 4FFWC 1QLRB 5I1AB 4MAYC 3MRIB 1HQRB 1IGYA 1RZKL 1RY7B 2R0ZH 4TSBL 2AK1L 1MFAL 4LLWB 2DLFL 4J8RA 4L3CA 1KSRA 1FGVH 3RUGF 1U93A 1N8ZB 3GIVB 5DVNA 1KNOB 1HHGA 1J11A 3W9DA 3BQUB 1U95B 1X9QA 1U2HA 1RZFL 2BFVL 2Y4SA 1HYRC 5CP3H 3S5LB 2I07B 5IR1B 3Q1SH 3QWRD 4M7KH 4K3EH 2AJZB 1PYWB 2ICEB 2HJFB 3BQUC 4O5LL 4JFFE 4M6NH 4M00A 4R7DA 4HWZA 4JVUA 4KRMB 3MYJA 4GBXA 4OZFH 3OKEA 4U33A 2ZOKA 3QDME 4YHZH 4ZMAT 4Z7QE 3HI6H 1FNFA 3EDFA 2X1QA 1P7HL 3ARZA 2VR9A 2YD8A 3CU7A 1FVDB 5FYLE 1I7ZA 1CVSC 2CKNA 1ZHNA 5DJ8B 1N64L 2HJLB 4P46A 1C08A 4AEFA 5C0FB 1JNHB 4G80A 5JIIA 2LE9A 5L2KD 1QSED 1KCVL 2E9JA 1RZJL 3WFEL 5HHMB 3C5SB 4KU1A 1MHEB 4WW1A 5JO5A 3V95A 2X70B 5FGBA 3ULUC 3WL9B 4D0DB 2AV7A 3AY4A 4ZPVB 4XHJD 2VC2H 3BD5A 2OTWB 4Z7NE 4Z7WE 2NX5B 2EDFA 3O81A 5L0QB 1WVZA 2GSGB 3QDJB 2RQ8A 4WEUD 4ZOAA 4F7PA 4IS6B 1UH4A 4N9OB 3QHFL 4JHAL 3GSNH 3F6LA 3RL2A 4LPUA 3D3VE 3I3BA 2EYRB 4P57B 3S36H 1G7IA 2XFXA 1LK2A 4U1HA 3KYOA 3VH8A 4XBGB 4ONHB 4O58H 4YHPB 5DYOB 1FP5A 3V7AE 4NN6B 4RQQA 5DUPL 4JM2F 3QI9A 1HE7A 3MRJA 2WZPD 2X10A 1IGFH 1BBJB 1IEBB 1INEL 1I9RL 4WRLA 2H2SC 1V3LA 1HH6B 5IGXL 4Z6AT 1W0VB 1TZHB 1Z3GL 2CD0A 4BQ6A 4URTB 2FHBA 3HNTH 4OKDA 4R0LA 1LP9E 1YJDL 4HUUB 5SWZE 2W60B 4P5TA 4ELKB 3AGVA 1CBVH 5AUMB 1QVOA 3AM8C 1U3YA 5EC1A 2OJZL 4HUWA 1DQJA 1N6VA 1AQDA 1CFNB 1YEHH 4WY7L 2OJEB 5ICZA 3GMPA 4YXLH 1U92B 3HE7B 2EC9T 2OQJB 1O7VA 1YN6B 3HRZA 3MLWL 3R0NA 2QQNH 3KJ6L 1I8MA 5EZOH 3ARQA 2Z93B 1OP5K 5GGTH 5T3ZH 2PTTB 1H3UA 2AI0H 3BN3B 4F9PA 4PV9B 3HE7C 3N06B 3FB7A 3U9UA 5KZCB 1HI6A 2VLLB 3QNXB 3HC4L 3HB3C 4KJPD 4XBEL 3NCBB 3ULVF 1ITBB 4GRWF 1FGNL 1Q9KA 1F3JA 4I9WD 1YEFH 3TBTA 3BKMH 4LCWB 3JZ7A 1MAML 4X0KA 3SDYL 5D7JB 2YR3A 3CCHA 3BPLB 3P9LB 1B2WL 5DJ6A 3PHQB 2FZ3B 5EZIH 4HW6A 1WWAX 4HXBH 1WEJH 4ERSH 1W0YT 3HC0A 3L6FB 4X4YA 3RWJA 1OWWA 3MBXL 3I6KA 1BEYL 4FNLL 3BPLC 2Q20A 2HJKB 5DJXB 3BWAA 1EJOH 3AS2A 4QXGL 3VI4E 2JJSA 1GAFL 2NQCA 3M8OH 4Y5YC 2PKDA 5J11C 3GDBA 4LLQB 1UADC 1A1NA 3K2MC 3T04D 2X89D 4MSWB 4LPCA 3MRRB 4KI1A 4OLVL 4MNQB 3RKPA 4CVUA 4KV5F 3O3DA 1U8JB 5JA8B 5H94B 1JGVL 3KPQA 1GH7A 4XWGL 3TVMA 4CVZB 1RUPL 1P4IH 4GAJL 5DRWB 1IQWL 3ARDD 1ZA6B 4HCRH 3KYMA 3KAAA 4HDIA 4RDQF 2P5WB 4MDIB 3MRCB 4WV1A 4QRPE 3FT4A 4UAOB 3U9PH 2W9DH 3CMGA 2QSQA 2VXQH 1KB5L 3QI9D 1KCUH 3LH2L 5SWSB 3D3VA 4FQCL 3RKDC 3FONB 1NMBL 5E2WL 5DHYB 1LGVA 2CKBA 3ARGA 2W0KA 5C0GB 1JGDB 1HHKA 3L3DB 4E41B 2R8SL 4CADA 5ACMA 5D7LA 3B2UC 5DZLA 1F3DJ 5DURB 5ITBL 2YXMA 4C56B 1HYSC 4NO5A 2PYEB 4HV8B 3NPZB 1L7TL 2WQ8A 1KACB 3IU4H 4QNPE 3JV6A 4BELD 4AJ0A 1MCHA 4QRUB 3P0VL 4U49A 5D9SA 4LEXL 1KPVB 3QG6B 1FH5L 2R0LH 4ZAKA 4ETYA 2PCPB 1YEJL 4JCMA 5FXCH 2QEJA 4U1NB 2EC8A 1T20B 2IQAB 4Q0XH 3HI1B 3KLAB 4LPYA 4M61A 1BQLH 5IVXB 5LKNA 4D3CH 1YMHA 2BNRD 5EFIB 1X5FA 2LU3A 3DUSA 3S97C 1LEIA 1UQSB 5DD0H 2EDRA 1BPVA 4PJAE 3GJFK 4U2ZA 3V6OE 4ISVA 4Y8AA 1XIWB 1A6PA 4DUWA 1Z9MA 4R3SB 3OKLB 1NAMB 4M1GL 3NCJL 3B9EA 3PG2A 4UI2A 1JRHL 2R0WL 2ADJB 3SN6N 5DEFB 4X9FA 1ZT7B 1AD0B 1IT9H 1XIWC 3MV9A 4O2CA 4RCAA 5KOVC 1DEEA 1SM3H 5DMJB 3UCRA 3LKNA 3VG0L 5J3HD 2YMXH 3EOYG 4RGMB 4Y4HA 4Y8DC 3V5DA 4WGVB 4XT1C 1IGCH 4DJMA 3GNML 4EQ2A 1QHOA 1C5CL 1CK0H 4U1JA 2D4FA 1FVCA 3ULVL 2FX8L 2HRPH 2R4RL 1IAMA 1A7NL 2E3VA 4X5LA 4G8EA 3DVGA 2HH0H 2F58L 2NXYB 1E0OB 5IQ9B 3WNLA 2EDWA 4NQEB 3CDGB 1AY1L 4J6RH 5TPWH 5JXAH 2EKSB 5C0IA 5LVEA 4DKEL 3GMLB 3JSSA 4K07A 2OP4H 2I60L 5KSAB 2OSLA 3C5ZB 1HEZB 5L6YH 5I8CB 4QOKD 4DCQB 3VXME 2B1HH 1JPTL 4L4JA 1GIGH 5T3XL 4RFNB 1FLRH 4HLJA 3JTTB 4PTTA 5TGBA 4OZIB 1FZMA 4FZEH 4LSRH 5FB8B 4GMTH 2EDQA 4HIEA 5EH1A 5KSAC 3C5ZC 4J3VA 2PO6B 1S3KL 1OARH 3L5XH 2BC4A 5DMGC 1OAXH 1GGYA 1P1ZB 1OAZL 1CGYA 3V0WH 1D9KB 4PJFE 3NVQA 3PABB 4KHTH 2PO6C 5D7LD 5HI3C 2APFA 1IAKB 3HE6B 4NYLB 3THMH 3SKUD 5K9QI 1U8MB 1MY5A 1QA9A 1D9KC 4OZGB 2HT4D 25C8L 1IGJA 3UXFA 1OT1A 3FN3A 5DFVD 5EO0B 3HE6C 4OUUB 1RJLA 4QCIB 2OTUA 3F5WA 4XVUC 3RVWC 3BAEL 5CP7A 3PWPE 4E42B 3WNOA 3KLDA 5GS2H 5FOBB 4XCNB 1I1RA 2F53D 2ZG1A 4MZ3A 4S1RL 5T5FH 2DQTH 1UZ8A 2GITB 4LFHG 1FNHA 1BD2B 5T1KD 3WS6A 1ULVA 3OL2A 4L29B 4FXLA 5DLMH 2P4AB 4EDXB 2XQYK 1O5DT 1TTFA 2HLFC 5FDWB 4OZFB 2ZP0T 2FHCA 1YEEL 4JDTH 2VO5A 4PRHD 4PJAA 4W6YB 2RR3A 2EDTA 1V3JA 3GEWB 4K94H 3MV9D 3ZTJG 4HG4K 4MD4B 1YY8A 3K3QA 1DVFD 1G7QB 4K3JH 4JANB 1P84K 4N0FA 4Y4HD 3RX8A 4XTRC 2J6EL 5D6CB 2BVQA 3ZE1F 1TJGH 4E9LA 3RNQB 4LDLB 2V9QA 4NUGL 3O4LB 3PWNB 4LCCB 4QXUL 4Z95H 4AH2B 1EHAA 5TF1L 4OIIL 3CK0H 4F15B 2NY7H 1AHWA 4OB5H 3K4AA 4PUBH 5LXGH 2Q1EA 5J89A 3SBWA 4DN4L 4TRPH 4HZLA 1CDBA 3QZWA 4LCCC 4M62L 3U0WL 3W11C 3OR7B 4RFOL 4KK9D 1EO7A 5E08L 3G6JA 1GSMA 2CGRL 2PYFA 4F15C 4MNGE 1ACYH 4WCYH 3KG5A 5IBTL 1OSPL 1OP3K 2XQBL 3UMTA 1D5MA 4GT7A 3SGEI 1AXIB 1G0XA 4EVNA 1IE5A 1UJTA 2ORBL 5TFSH 4Q6IC 5I8OH 4XAKD 4RNRA 4E0RB 5E2TH 1G7MA 2AJUH 4JFEB 3E6HA 4P2OA 2R2BA 3GSNB 5FV1L 3HC3L 2A83B 4NJAL 3KHOA 3MV7B 5EO1B 3UJJL 4HQQL 2FHFA 4TNWF 3EYUH 4NCC1 4XCEB 4OF7A 2A6DA 5DD6B 1CN4A 5F96L 3VXMA 3QDGD 3BP5A 3WXVL 1BQHG 5IBUG 4QWWC 3RX5A 4Z77A 4RDQG 3MNZB 3S37H 5JDSB 3H8NA 1EDQA 4QRRD 2IAMA 4V2CB 3DX7A 4HX1A 2VWEE 3S3JA 1DP0A 5ID0A 1HIMH 4KPHL 1MRFL 2FIRT 3E8UH 2P7TB 5LQBL 4R97B 2EH8L 1AIFA 1ZKAA 5JMRA 2HWZH 2XNAB 4HKZA 3L3IA 1NDGA 4L9DA 2CR6A 2IPKA 4YEEA 1ADQA 4WO4B 3MLZH 3MREB 5E8NB 3MJ6A 1AXSB 3RVVC 4R97C 5E9DA 4R7NA 3EO0B 1YY9D 5I1HH 2MCPH 4WO4C 5CD5D 5HYQB 1DQQA 4C59B 4RA3A 1NFDF 1Y6NR 4S1SL 4KZEH 1HSAB 1T0MB 2OR9L 3MODH 4NCDA 3P73A 1N6QH 1AGBB 3FCTA 4WTWA 4HKJA 3GI9H 3DXAA 3VFPB 4GXVH 5FYKD 3IDMB 2OX5A 2IF7A 1CGVA 2WP3O 3FB8A 1N6UA 3RDTB 3CXDH 4I5BB 4ALAL 3QUZC 2V7HA 4MYWB 5DA0B 5EIVA 2BSRB 1ZVSB 4HH9B 5GJTL 2GUOA 1LEGA 1M7IB 5B39A 3GSRA 4K23L 4BQ8A 3SDAD 4YDIH 2VAAB 5D1XA 1VDGA 3ZSSA 2GIYA 4BSJA 1CD9B 2JKXA 2NW3A 3KPRB 5BRZB 5M94B 3VFWB 2B39A 2I26N 1Q0YL 3QULB 3NAAL 5HYJD 3O0RH 3VWJA 1A9BB 4N9GB 1BOGA 4R9HA 5D1ZD 4ENEC 3FRUB 4NKQB 3EFFA 4JY6B 4BK4A 4WHYG 4OFVA 4OF8A 1RK1A 5DRXA 4DGVH 2ADIA 4G5ZL 4PGDB 2DRUA 1G6RL 1QRNB 3CLEL 1KGCD 3V7MA 2VDPL 4OGYH 4UT7H 2EO9A 4XPTL 1K4CB 1RIHH 4N0YH 3GJFA 4L9LB 3V6ZA 4P2OD 4JHZA 2XOTA 3N1PC 3IDYC 3HN3A 5FO7A 4X83A 1NEUA 1BIHA 1BJ8A 1EAPB 2EDXA 2BDNH 4M02A 1I1FA 3L7FA 5F1NB 1NJ9A 4OFDA 1A02N 4EI6A 5K9KA 1SEQL 3RNKB 1A2YA 2IANB 3UYOD 1ONQB 3P77B 1A1MB 2BVPA 2AK4E 1ED3A 5HHPA 1Q72L 1TENA 5B8CB 4XCFL 2QR0B 2X2YA 1IGIH 2VYRE 5AYQA 4NM4L 1CLYH 1G9ML 2I24N 3T0VA 4G8GA 5D2NC 4XNXL 5TQ0L 3PL6C 3HPJB 3QCTL 4APQD 4AEEA 4KK5D 3WKML 5EB9A 2X4OA 1IKFL 4FZ8L 5FHBH 1NGQL 5E9DD 3SGJC 5L2JA 4H25A 5DJ0A 2QTEA 1PKOA 1BVKB 4HIXH 5T1DL 1DQML 2VIRA 1ZMYA 2G75A 1E4WH 1HH9B 3RY5A 3IDIB 4F3FB 4KK6C 1PQZB 5I71B 4OD3L 4RMTA 4NO3A 4Z7QF 5IOPB 3B9KA 4Y16B 2FATH 1P7QA 3SHSA 5EU4B 3D1MC 1R5VB 3X12B 3MACH 5I71C 1R5IB 2J8OA 1AC0A 1EXUB 1DLHA 3FN0L 3DXAD 1HKLH 5HHME 1FFNB 4Y16C 2D7NA 2WBJA 2ZUWA 3MLRL 4NKDA 3RZCB 5FCUH 1OD9A 4WUKL 1FC1A 4ZFOB 4KRPB 15C8H 3KS0H 5DD5H 4WEBL 1NLDL 4UNVA 1A4KB 2DMKA 2AJVH 5DD1L 4OZHB 2X4QA 4HWEH 3RZCC 4PJ8C 2YRPA 3H42L 4WW2A 3SQBA 4KRPC 3HZMB 2NLJB 1CGSH 4HS6A 4Z7NF 4Z7WF 4PRIA 5GSRA 1TVDA 2C3GA 3WLBB 2C3VA 1XGTA 1Y0LB 5GZNC 3Q0HA 3QRFM 3GMQA 4G7VL 3VXRA 3TV3L 4YDVB 1ZANH 1LHZA 2FIKB 2E7HA 3DUHA 2A0LD 1IZJA 4RAVA 4RMUA 4NRZA 1FIEA 4YPGB 5L88H 1BLNA 1T7YA 2XIDA 4LMQI 2KZ1B 2HG5A 1FYTA 1OGAD 4DN3H 1JGUL 3G5XA 3TO4B 4KUZH 1DN0A 3UTPD 4TVPD 5IHUH 2GJ6E 1FL6B 2A77L 2VZTA 4NZRH 4NZUH 4ZD3L 3VXTA 4IIQB 3V5HB 4M1CC 4IOIB 3AS1A 3TO4C 4I2XE 4PS4H 1R3KA 5CINL 2ATKB 5D1QB 1LP9F 1ZLWK 1QLRA 2XXMB 3ZDYE 3MRIA 1HQRA 4LLWA 2MKLC 3NCCB 4JQVA 1B6DA 3Q5YA 5FCSH 1N8ZA 3GIVA 1RHHB 5JPNB 5D1QC 1XCQB 1KNOA 5DVKA 2IBBA 2D9QB 3X14B 1T3FB 5EUKB 2D2OA 1QYGL 4KJQD 5DTFB 3BQUA 1MCDA 3LDBB 1U95A 1J5OL 1QO3B 4KJWC 4EQ3A 2RHEA 3S5LA 2I07A 5IR1A 4Y2DB 4YHNB 2FL5A 4WI6A 1JI1A 2AJZA 1PYWA 1KBGH 2O61B 3F58H 2ICEA 2HJFA 1VADB 4RBPH 1DQLH 3SDXB 1DL7L 4OM0L 3FQRA 3B9AA 5C0CB 5I1IL 1YEKH 4Y2DC 1NC4B 1CXFA 1S7SA 1UWGH 2XA8H 4ODVL 3CMOL 3L3JB 5GGQH 2ITDA 2EECA 4PJ9D 2EE6A 1P7QD 4LVOB 1WGOA 5I8EA 3VFSB 1HHIB 1FVDA 1MJUH 3HZYB 4JG1H 2DTML 3KXFD 5EU7C 1T4KB 5DJ8A 5C6TH 2HJLA 1QNZL 1UCTA 4DOHB 3BHBA 4K8RL 4ODHH 4LOUC 4UTBH 5C0FA 3GSOA 1JNHA 1TPXB 2FNBA 4FQHB 2AEPL 4YPJA 4JJ5B 5T33L 5K9JH 4JAMB 2I9TB 1FDLL 1MIEL 3C5SA 1MHEA 3VI4F 4K94C 4Z7OE 4JN1L 3SKJH 4NQTA 5T1LB 2X70A 1XMWA 3C60A 5FYLL 5HI5C 3WL9A 5L2KE 1U8IB 4X6DE 4D0DA 2O5ZL 5A2KH 4HJ0C 4UILL 2OTWA 2XTJB 2WUBL 2NX5A 1SYSB 2E9IA 4JM4H 3D6GA 4GQ9L 2GSGA 1IL1B 1IJ9A 1H15B 3QB7C 5E6ID 3QDJA 3VXRD 1RZKH 4TSBH 1ZLVK 2AK1H 1MFAH 4GSDH 5GS0C 4IS6A 2YSSB 1ODAA 1TFHA 2XTJC 3CFJB 2AXHA 2EYRA 4P57A 4MA7L 5KVMC 3KVQA 3T2NL 3S3PA 1CR9L 2DM2A 1FYTD 5I1CH 1T22B 2VH5L 5B3JE 1PY9A 4XBGA 4ONHA 4YHPA 4KGJA 1AI1L 1QBBA 5DYOA 4FFWD 1F6FB 4FFYL 5E2VL 1IEBA 1BBJA 3K74B 4IRJC 4MAYD 1LO0L 1HH6A 1W0VA 1KUMA 1TZHA 2R1WB 3KYNB 3T4AB 2NZIA 3HZVB 3TLRA 4RZCB 2CKBL 3F7VB 3ZHDA 5FEBA 4QNPF 3AM8A 4H20L 4LAJH 4LNVA 1TETH 1GC1L 3MCKB 4HUUA 4H5SB 4LGRB 1G0DA 3RJDA 1VFAA 4ELKA 1PEZA 5AUMA 5KG9B 1D6VH 1FBIH 2ESVD 2A6JB 4CGTA 1QFHA 2XY1A 4UDTB 2AS5M 1I8LC 3BQUD 3FQNB 4G6JL 4NNPH 1CFNA 2ADGB 2OJEA 2D31B 1U92A 2Z8RA 4HUXB 2OQJA 1YN6A 4W81A 3U36A 5CZKA 2UWEB 2Z93A 3GKWL 4PJAF 1AFVH 5F7FA 1AR2A 5IFJB 2PTTA 3WUZA 1ORQB 1MJJB 4PV9A 3VMNA 3VFNB 3IXTB 4PGJA 4H1LH 5JUEH 2VLLA 3QNXA 5CKAA 2DL9A 1WAAA 5C71A 4M43H 3TT1L 3MRMB 4KQ4H 1H8OA 2LABA 4FQLH 5DI8B 1J1OH 4OCSH 3C6SB 4W4OC 4XC3H 4YGAB 4LCWA 4Q9CA 5D7JA 5A16B 3P9LA 1FE8L 2OCFD 3PHQA 1UA6H 2FZ3A 2Z92B 3W5MA 2JLLA 3ULUD 3MFGB 2UZYB 3L6FA 5F89B 5D2LB 2FBOJ 3O6KL 5EC2B 5CJXC 4MHHI 1QEWA 2HJKA 4C54A 4MVBC 3HMWL 5DJXA 3TA3B 5DUPH 5D7KD 2ERJB 3RI5F 1DANT 4LLQA 1Q38A 4MSWA 3MRRA 2DQCL 5IGXH 4HBCL 2WWKO 4MNQA 3BW9B 4Y89A 4ZS6D 1U8JA 1REIA 5H94A 4NC1C 3BRGC 1JHKL 4M7JH 1DEDA 3QDJD 4CVZA 4XXDB 3KDMB 3FJTA 4K71B 1ZA6A 2V5YA 4ORGB 2P5WA 5IUSA 4MDIA 3MRCA 3VXSB 2H2SD 4Z5RB 3MRNB 1SJXA 5KVDH 4AY0A 4WY7H 2BHYA 4OQTH 3K7UA 4LRIA 2ZKHH 4WI9A 5SWSA 5E7FA 3MLWH 4RMWA 3ZYOA 5GS1B 4PJFF 4DAGH 4Q9QL 4YDJB 3FONA 5DHYA 4CN1A 5C0GA 1JGDA 2YPVH 3L3DA 4OZGE 4E41A 4I13B 3PDOB 2AJSL 3D39D 1F3RB 3AS3A 2JE8A 3V9FA 4U6XB 5GS1C 2PYEA 4HV8A 3HC4H 4RA0C 2XN9E 5JHDD 3H9ZA 4QRUA 1KPVA 4OCMC 1ZOXA 3QG6A 3BDXA 2PCPA 4PJBB 4ELMB 1MAMH 3EOTL 4YHOH 5FUOH 5ISZD 3SDYH 1RIUH 1X5KA 4XX1G 2L7JA 1B2WH 1T20A 2IQAA 3CX2A 3HE7D 3HI1A 5IVZB 5I74C 2Y6SC 5IVXA 4HHAB 1VB9A 5J1TC 3HB3D 5EFIA 1CXEA 1I7RB 1KJVB 2XRAH 1UQSA 3MBXH 5EU6E 3VDBA 2G5BB 2EDYA 3HNSL 4KK8D 1MFBH 1CGUA 5C3TA 3A6CL 3ILPB 3QEUB 3NIDE 5SV4A 1XIWA 4JY5L 2BNRE 5KZCD 2MKWA 3GK8H 2QSCH 4R3SA 1GAFH 3OKLA 1NAMA 1UM5L 3G5ZB 1UKSA 2ADJA 3EO9H 4OLVH 5DEFA 3GKZA 1ZT7A 1AD0A 1JUFB 4AIXA 2UUDH 4ZOEA 4LCWD 1OPGL 4M5YH 5ID1B 3BYTA 4GAJH 1U8NB 3A67H 5JQHC 4PJDB 5IWLC 3DO7B 5DDHB 4AYFA 5JW3H 4PBVC 2J1KA 3M1BB 4ONOA 3W9EB 3RGHA 2VZ3A 4XNZB 4I3SH 4GW4B 5CJQH 4FQCH 1R3HB 2GEEA 4G6AC 1GHFL 1NMBH 1KFAL 2V9RA 4ZTOL 5IQ9A 5IMOB 4NQEA 3CDGA 2R8SH 2DTSA 8FABB 4YH6A 2EKSA 1KEGL 3GGWB 4DWHA 5ITBH 3GMLA 2DQEL 3MA9H 3STLB 5KSAA 3C5ZA 1HEZA 2XZQL 4LSVL 4LL9A 5I8CA 1PKQB 4JPWH 4JR9L 4WVRA 1XF2B 1FH5H 3JTTA 2P5WD 2X1PA 3RWFB 5FB8A 1FCCA 2EZ0C 3RKDD 1UXWB 4QOKE 3T0WA 4DK6A 2JJTC 4J2XA 3UP1A 2PO6A 3B2UD 1A1OB 3WV0A 3AB0B 4NWTH 5SWSD 1P1ZA 1HYSD 3S88L 2CIKB 1JVKA 1D9KA 4XH2B 1NBVL 1IAKA 4KDVA 2UVFA 4LHUG 5DURD 3AB0C 1JJUA 3HE6A 1N0LA 4C56D 2Z4QA 4NYLA 1UJ3B 4I77H 1U8MA 1WF5A 2JB6B 3NCJH 2DD8L 5TE6L 1EHNA 1FAIH 2IADB 2R0WH 1VKXB 4PFEA 4OZGA 4RWYH 4JPKH 2OL3L 4QLRA 1R0AH 3WNPA 4OUUA 1UJ3C 4QCIA 1J0YA 4AEIL 4UT6L 4EIZC 4E42A 5TE7H 3BN9C 4KUCF 4JFQB 5FOBA 1HK6A 4XCNA 4MCYB 1MCRA 3SE4C 5CP3A 3ZTJH 4PRNB 1Z0NA 4OD2A 1C5CH 1PGRB 5FAAA 3H9SE 3MFFB 1IM9D 1BD2A 4GMSL 3MA7B 3BGMB 3ULVH 4L29A 4GRWH 5I16B 5AWNH 1XIWD 2R4RH 1GPOH 4G42B 4J3TA 5FDWA 4OZFA 7FABH 3UPAA 1G6VK 3MMEB 4HWBA 3IDGA 2DM4A 5HDBE 4TNVK 5AZ2L 1FZOB 1AY1H 1CU4L 2PUQT 1KTDB 2W59A 3ORJA 2AJ3B 4MD4A 5JPMB 3QPXL 4R2GB 2I60H 3RTQB 1G7QA 4JANA 4HG4J 4Y19D 2I25N 2J7LA 5KW9H 5D6CA 5K59E 1FG2B 5DFWH 1JPTH 1NUNB 1P84J 3QIBC 4NWUL 4D94A 1I1CA 3NFSL 3FT3B 3RNQA 4OSUL 4N1CA 3O4LA 3PWNA 4AH2A 3VGGA 1K5NB 3P30L 4Y0GA 2FBJH 3HHRB 4IDJH 2X4SB 1S3KH 4P3CL 4NRYB 1OAZH 5D70L 2A73B 3OR7A 3RY6A 3WSQL 5CFHA 2J5LB 4OV6F 1HXYB 5D96B 3U79A 1FNGB 2R29H 5E99L 3C5ZD 3CZJA 1FZJB 4U1IB 2DLTA 4NFCA 5DMGD 4E0RA 4JFEA 25C8H 1T2QL 1G7HB 3GSNA 3TBWB 2A83A 4FN0A 2M2DA 1VPOL 2IANE 3MV7A 4WI7A 5EO1A 4XCEA 1OCWH 3HPLB 4XAKE 2PO6D 5EORH 5DD6A 5HI3D 3U4BL 2Q76B 1RZKC 3LCYA 3MNZA 5JDSA 4S1RH 4TVPL 1CFVL 2G2RA 5I8KL 2BSSB 1D9KD 2E7CA 1HQ4B 3P4OB 5ELIA 3MUHL 3QDGE 1MI5D 3DX8A 3EYOB 4LCYB 4M8QA 3BRDA 4ZO9A 4QRRE 3HE6D 2DL2A 3WHXB 4XVUD 5E4IA 3RVWD 2P7TA 3ZHLA 4NIKB 1U3HA 2VDML 4K9EH 5K33A 1I1AC 3O2DH 3CFEB 2XNAA 3M45A 3PJSB 4OI9A 5IW1B 5E8NA 3MREA 1AXSA 3MUY1 2WLZA 2ZWLT 3EO0A 4KTYA 2IEPA 1HHJB 4HULB 4POYA 4Y1AD 2HLFD 3L5HA 1CFSB 1CT8B 1II4E 4NUGH 5HYQA 4X5XB 3GMRB 5BS0D 5TF1H 1YEGL 2DICA 4OIIH 5GGTA 1HSAA 1A22B 4PY7B 1QQDB 1GGCL 5DC0A 3UTTE 4LKXA 2EXWC 3CFIC 5DD3L 4K3DH 4H1LB 3FO0H 2NY4B 1T5WB 3H9SA 4RFOH 1AGBA 3T65B 4XTRD 4DTGL 5I0ZA 4LP5A 3IETB 2CGRH 3VFPA 4PJIB 1NBZB 3IDMA 3L5IA 4XC1H 4ACPA 5EA0L 1OSPH 4RISL 2EIZB 2XQBH 3EJZC 4HPOL 3VCLB 1C7SA 2XKNA 3RDTA 4Z76B 4I5BA 2NY4C 1TZGL 1QFWL 4FQIL 5FYKE 2EYSB 2BSRA 1ZVSA 4HH9A 1SMAA 1YZZA 3HC3H 3O4LD 2VAAA 3W11D 4PY8I 2YD3A 3ALPA 3UJJH 1ZA3B 5IJVB 5BRZA 4LSDA 2NY0C 3QULA 5FUCE 4J4PC 1UYWH 1A9BA 4N9GA 1EO8H 3OG4B 3OZ9H 3FRUA 1CDYA 4MDJB 5C2UB 4PJ7E 4JY6A 1FRGL 5EU5B 3BMVA 3MC0A 2VKXA 4XVTH 1QKZL 3DBXB 5MI0B 1JI2A 2BOCB 2NNAB 1OQOA 4PGDA 4F7MB 2C3XA 4CJ1A 1NC2B 2Z0BA 1QRNA 2DJ4A 4L4TD 1PG7X 3MRBB 4X6BB 2ARJQ 4EEEA 1YECH 1K4CA 3LZFH 1KTRL 2FLBT 4L9LA 3WIFB 4QWWD 3ROLB 2A38A 3BKCH 5MI0C 4HCRA 3MV7D 1XGQB 1TXKA 4NUJB 1UT9A 4J7RA 5HJ3B 2KQNA 1T66C 1CWVA 1YJDC 3ZKMC 4LKCA 5HDQL 5F1NA 1INDH 3GMMB 1XR8B 1EHLH 3RNKA 1Z9SA 2VXUH 4YZFE 3ZDYF 2IANA 1NEZB 1ONQA 3P77A 1A1MA 4S1SH 5MHSD 1ZHKB 3ARFB 5B8CA 1J7VR 2OR9H 2QR0A 4S2SB 2DF3A 1ZLUH 3DV4B 3RUGB 5DUMH 3S36X 4OLEA 3RVVD 3TZVA 2VL5B 3SGJA 2WP3T 4IOFC 4LGPB 2ILLA 2BXYA 5E8DH 5ESQB 1ZK9A 3HPJA 5FOJA 2EDDA 4MD5B 4WO4D 3MJ7B 4UT9L 3N1GC 1MCIA 5FKAB 3OMZA 4XMPL 4ALAH 3MOAL 4HJJL 4HWUA 3JV0A 1PY4A 2A1WL 3TPKA 3WN5B 2VZSA 5GJTH 1BVKA 1MSPA 1H3WM 4FFZL 2VE6B 1HH9A 3MO1B 3IDIA 2UY6A 4F3FA 1CG9B 1IFHL 1BFTA 4U2YA 2F8XC 4KHXH 2PXYC 1MPAL 4JY4B 4D9QE 3LPGA 5IOPA 1A3LL 1WCBB 4Y16A 1Q0YH 3NAAH 4JO2H 2NY1B 1RSFA 4PJ5E 2R2HB 1R5VA 5IVOA 3X12A 3UPRB 3QUZD 2VSCA 4L3AA 1FFRA 3PHOB 4ZYKB 1Z0MA 1HCFX 2WIIB 1EXUA 5I1LB 4PB0L 1FFNA 4OGAC 1C16B 3UTQB 4XNUH 2NY1C 4GAGH 3RZCA 1P5UA 3CLEH 3NZHL 4QHLB 3MZTA 3RU8L 5CJOH 2VDPH 4ZFOA 1LDPL 4IDLA 3MV11 4XPTH 5DZNA 5FM5M 3D0VB 1A4KA 5FYJD 5FGCB 3MJ8B 5CGYC 4X6DF 4ENED 4JLRB 4OD1H 3KPRD 3HZMA 3T3MF 2NLJA 2CO6B 3VGAB 3O6LL 3EAKA 2XICA 3WLBA 1Y0LA 4CNIB 3V5KB 3LEYH 4XCFH 3DJ9A 4YDVA 1X7QB 1QRKA 2FO4B 2FIKA 2ZNXA 4WI4A 4YPGA 1I3RB 5DS8B 5B3JF 2RIKA 4XNXH 5I76B 3QCTH 3TO4A 2E7MA 3PXJA 3WKMH 4JM2B 3MYZA 5JXEA 1IKFH 1FL6A 1LO2L 3MRDB 1NGQH 3PDGA 1U91B 1OGAE 4QRQB 1F11B 2IH1B 3V4VL 4IIQA 3V5HA 4IOIA 4M5ZL 1DQMH 1KJMB 5T1DH 4JM2C 3K8LA 2ATKA 4KKAC 5D1QA 2VDRL 3DSFH 1DUYB 2IBGA 3QJFB 3MUGB 2FEDC 5C6WH 3EDEA 4OD3H 2NPLX 3PL6D 2VAJA 4X4MA 5C0BB 1X6LA 3RVTC 5I1DB 2R4SH 5JPNA