4XTUA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (n-({[(1r,2s,3r,4r)-4-(6-amino-9h-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtuA01
1EVLA 5GAN4 1WLEA 3RF1A 1E24A 3MEYA 4UP9A 2I4NA 2YHTA 4F7UF 3LSSA 4DQ2A 4P74A 3FIFA 3HFZB 4TVAA 3E9HA 4P75C 3A74A 4EMKA 4BWAA 3HFNA 4M77A 5LJ5e 1KMMA 2ALYA 1I8FA 2QHTA 1NNHA 3UFGA 3V8LA 3IALA 4HA8A 2ZGWA 1EQRA 1GGMA 3RGLA 2QHSA 12ASA 2ZZFA 3DSQA 4TTVA 4DPGA 2CGHA 1YB3A 4YPFA 3L4GA 4M7AD 4M7AG 3NENA 4C92D 4C92G 4HT9A 1B70B 1N9SA 5GAOr 1M5Q1 2IY5A 1G5HA 4P71C 2ZT5A 4L87A 4F7UG 3A7RA 1X55A 1NJ1A 1ADYA 2Q7HA 4C8QE 4M7DB 5LJ3h 1JJCA 4CS4A 2ZNJA 3BJUA 4EX5A 4M7DC 4N0AC 4MMLA 4H2XB 1G5IA 2DTHA 5GMKi 4YYEA 1EIYB 4WI1A 1JBMA 3A7AA 3HFVA 2DU5A 3JCMf 5GAN5 1B7YA 2ODRC 1WYDA 2RB6A 3LSQA 3NETA 4C8QF 3JCMQ 3JB9I 1N9RA 1H4VB 4EMKB 4XTYA 4M77B 5GAMf 1SERA 1YFTA 3VQYA 5GMKl 2DQ3A 3JCMe 4EMKC 5ELOA 1RIQA 4M77C 2AMCB 3HFZA 1EVKA 1TH7A 5GAOq 4UP8A 2C7IA 3RUXA 5GANg 4UPAA 3RIRA 3JCMd 3QHSA 4OP0A 2E1HA 1HC7A 1NJ2A 2DZCA 4YRSA 3A5ZA 2IY5B 4RCBA 1B8AA 1PYSB 5GAN8 4E51A 1MGQA 5GMKj 3KFUA 2EAYA 2XTIA 4P71A 1B70A 2Q5HA 4H2VA 4YRFA 3JCMV 3REXA 4J6WA 4YRGA 4C8QD 4C8QG 4YRLA 4CS3A 2EJGA 1M8VA 4X5OA 5C51B 4M77E 1B34B 4XTVA 1NYRA 5GAMj 2YLCA 4X9DA 4M7DA 4N0AA 1VQZA 3JCMW 2Q7GA 4M75B 3TEHB 4G84A 4HWSA 4H2XA 2ZXFA 2ZT6A 4M75C 2J3MA 3JB9F 5LJ5f 1EIYA 3V7SA 3NEMA 1KMNA 4PJOB 4WJ4A 1X54A 5GAOn 3ERRA 1E1TA 3BFMA 1U1TA 3EFSA 4PJOC 4H2WA 3A31A 4M77F 2JN0A 5GANh 2QTXA 2P0LA 3LC0A 4M78B 1BBUA 4YRRA 3JCMJ 5LJ3e 4KR2A 3RL6A 4P3PA 5GAN2 1FYFA 3G1ZA 4M78C 3JCMc 4ZIBA 2AMCA 3JCMP 3V7CA 3JCMb 3JB9H 4CH3A 4M7DD 3BDUA 5LJ5d 3JCMX 4RDXA 5LJ3d 4A54A 5DY9A 4MMKA 5GAN3 2Y90A 3HXYA 5GAOl 4XEMA 3SWNB 4QVCA 4RQEA 1H4QA 4EO4A 3A5YA 2ZR2A 2ZTGA 1QF6A 3HY1A 3SWNC 4PHCA 3VQVA 3P8TA 1H4TA 3JB9D 5LJ5j 4NOYA 4JRIA 4TQFA 3IKMB 4J6XA 1PYSA 1JRIA 1U1SA 1SETA 3V7RA 3P8VA 4WJ3M 5GAN7 3TEGA 4M77D 4M77G 4AH6A 4P73C 4J15A 4CS2A 1I4K1 4K87A 4XTXA 1EOVA 4XTZA 1B34A 2QHUA 3NELA 4XTUA 11ASA 3M4PA 3V8JA 2ZINA 1H4SA 3VQWA 3L1AA 1YCYA 4M75A 3TEHA 1B76A 2ARTA 3A32A 2J3LA 1WQ7A 2DEQA 2G4CA 3ICAA 4HT8A 2PMFA 4PG3A 4KR3A 4PJOA 3IG2A 5I21A 3V8KA 3INZA 4KQEA 4H2TA 2CJAA 4M7AB 4H2SA 4EMHA 4C92B 1YFSA 2ZZGA 1YFRA 2VC8A 2E5AA 1NJ6A 4M78A 4M7AC 1NJ8A 1G51A 3RESA 4C92C 4K86A 1HXDA 3QTCA 1Z7NA 4M7DE 3TUPA 3GIBA 1X01A 5GAMg 4YRJA 3MF2A 2I2LA 1J5WA 1KOGA 1BBWA 4PNOA 1I5LA 4RQFA 4M75D 2DTOA 1HTTA 3L2ZA 3HXZA 3M4GA 4XU1A 2PMEA 3SWNA 4ZTUB 4JUVA 2CIMA 2DXTA 2ZT7A 4XU3A 4TVYA 5GANe 2ZNIA 1NYQA 5CAIA 4YRQA 3QUIA 2DQ0A 3HXUA 1I81A 3RERA 1ATIA 4M7DF 5F5WA 2EL9A 2RHSA 3QSUA 4P73A 2ZCEA 3M4QA 2EJFA 5GANd 5GAOm 2VXFA 1C0AA 3HRIA 4M78D 3PCOB 2VXEA 4EMGA 3W3SA 5E3IA 5K1PA 5HGQA 4YREA 4HVCA 1EFWA 3SB2A 3PGGA 2AKWA 2ZZEA 3I7FA 5LJ3f 1Y96B 4YRTA 5GMKh 3RKXA 2XGTA 3HTZA 3HRKA 2Q7EA 3JB9J 4K88A 4YRCA 1USYA 4A53A 4X9CA 4CH4A 4XTWA 2RM4A 2QHVA 1L0WA 5GAMh 5LJ5g 2DJZA 4M7AA 2E64A 4NL2A 4YRMA 4C92A 4TVWA 4WF2A 4YCVA 1WPYA 4M7DG 4YP0A 4C8QB 4OLFA 4YCWA 1YGBA 3QNEA 4YDQA 4F7UA 1SESA 3REUA 3UH0A 1D3BB 4Q6GA 4C8QC 2RA2A 4M75E 4XQ3A 2ODRD 1ASYA 5GMKm 2K57A 2ZT8A 4G85A 4HWTA 1LNXA 4J5YA 3BY7A 3UGTA 1Z7MA 3JB9G 1LYLA 2DTIA 3VU3C 5LJ3j 4HWOA 4XU0A 1WU7A 4YROA 4PJOE 1LOJA 4RCCA 4Q15A 2RHSB 1KQ2A 2E65A 1LJOA 1SRYA 2I4LA 4H2YA 3QO3A 2DU7A 4Y91A 4RMFA 2DKGA 5KNNA 3CMQA 4XEOA 4JRKA 4M78E 4M75F 2RHQB 2AKWB 3BW1A 4ZTZB 3PCOA 3VBBA 3HXVA 2DVEA 2Q5IA 4YCUA 2RD1A 4PJOF 1H641 4HWRA 3HFOA 5LJ5h 1Y96A 4NCXA 3RKYA 4P3NA 4JLIA 2CJ9A 3VQXA 3OD1A 4LNSA 1USYC 2I4MA 3IKLA 4P72C 3QO8A 2CJBA 1ADJA 3JCMg 4H2UA 2EWNA 4M78F 3HXXA 2EJ9A 2P5IA 1QE0A 4HWPA 1N9WA 1BIAA 2C8MA 3HSBA 3R07A 4BW9A 4O2DA 4F7UB 3QO5A 3RKWA 2YLBA 1NJ5A 2FYKA 5GANf 2ARSA 4TVAB 5C52B 3HXWA 4TQDA 3FB9A 3WQZA 2ALYB 2E3CA 4P74C 4C8QA 1WNLA 4M75G 4P75A 3RACA 4YRNA 2I4OA 5GMKe 2FB7A 5GAN6 1D3BA 4CH5A 3MF1A 4QVDA 4TWAA 2ZIOA 4YRKA 4XU2A 4PJOD 4PJOG 5K1XA 1ASZA 2ZIMA 1IL2A 2DXUA 1X56A 4J6YA 1X2HA 3AHUA 5GAMe 1E22A 3L4GB 4V2SA 4H02A 4CH6A 2E10A 5C53B 4P3OA 1HK9A 1X2GA 3P8YA 2DZ9A 2ARUA 2DDZA 4M7AE 4M78G 4UP7A 3EFRA 5GAMd 4C92E 2E41A 3E9IA 5ELNA 4NL3A 4YRPA 3QO7A 2RHQA 2HNIA 3UGQA 1JJCB 4F7UE 1BIBA 3JCMh 5GANj 1KQ1A 3A7UA 5GAOp 1E1OA 3PZCA 3HY0A 1W66A 3FJPA 2ZR3A 4YRIA 4P72A 1WQWA 4M7AF 1B7YB 5LJ3g 4C92F
chains in the Genus database with same CATH superfamily
2YUQA 1UJYA 2L3RA 5GAN4 1UHCA 3UWNA 1E24A 1NZ9A 4UP9A 1OPLA 3EFOA 2XU8A 1M8MA 1VQ4A 4L6V5 4AT1B 5KYWA 4PLIA 2F1LA 1YHQQ 1P92A 2GNCA 3HRSA 4BI4A 4C5HA 1PNJA 1WI7A 3CQTA 4BWAA 3PNWC 1KMMA 1UGVA 5GJWB 1RLQC 2P0QA 3CCEA 3OYJA 2H3JA 3TEEA 3VYGA 2ZGWA 3M0RA 1UG1A 4KULA 2ZZFA 3DSQA 4TTVA 5FRMA 2YDLA 1SEMA 1G2BA 4M7AD 4M7AG 2RHIA 3H9NA 4HT9A 4FT2A 5GAOr 2E5QA 4P71C 1PRLC 2JUFA 2MAMA 3HTRA 4L87A 1K9MR 1NJ1A 1JJCA 4C0ZA 1KD1C 2QAZA 3BJUA 1NJIR 2DYBA 4M7DC 1V29B 4QW2A 2ZPFB 5KE3A 1EIYB 1UFFA 1JBMA 2DMOA 3HFVA 4ZTJA 5GAN5 2RJDA 4O5VA 1EFNA 3PTAA 2HSPA 2GCXA 2EKHA 3M5AA 2RB6A 3CC7Q 3JCMQ 3JB9I 1K0XA 1TUCA 4X34A 2FZKB 2RNAA 3JCMe 5FLXE 1EVKA 2RQTA 1M4ZA 3MPUB 4UP8A 5GANg 3CCVA 3JCMd 2LX7A 2LDMA 2CP5A 3J80E 2AK5A 1HC7A 5D6XA 2LCLA 3ZEHA 2DZCA 4DEXA 3A5ZA 1KC8R 2IY5B 4RCBA 3OYDA 2HCKA 5IHNA 1SSFA 3KFUA 2XTIA 4Q5WA 1B70A 2FEIA 2ENMA 4Y92A 2DL8A 1YHQT 4C8QD 4C8QG 4YRLA 2O2OA 1B34B 5GAMj 2EYQA 4N0AA 3TQ7P 3JCMW 3C95A 2KYBA 1TUDA 3TEHB 1UUEA 1LVKA 3M0SA 5AT1B 3CCJA 4J9FA 2FPDA 4H2XA 2MIOA 2QGFB 3OYNA 3ZL7C 1OU8A 1Q82U 2HD0A 4FSXA 4BB7A 1BB9A 1FMVA 4PJOB 1WFWA 1BKBA 1X27A 1V1CA 3BFMA 3CPWS 2PQWA 4A63B 4H2WA 4R0KA 3NFCA 4BE0A 4JDSA 1OQKA 5C0MA 5DLQE 5IT9E 3REBB 2JMAA 3G7ZA 4M78B 4KR2A 3RL6A 1TG0A 2C06A 2LNVA 2H8HA 5GAN2 3V7CA 3JB9H 4M7DD 3BDUA 1KJWA 1WHHA 1SRMA 5GAOl 1RI0A 1VYUA 2P84A 5FU7B 2LC4A 4EO4A 5A0DA 1QF6A 3JRZA 4PHCA 3X20B 2OTLA 2A0FB 4NS5A 4TQFA 3PVLA 3CCUA 3IKMB 3CC7T 4J6XA 1YJWQ 1PYSA 1JRIA 2CP2A 3VYHB 3LWIA 1SETA 1U06A 1GCQA 5C6SA 2PVGB 1AZEA 4FL6A 3TEGA 1WJQA 4AH6A 1UE9A 4P73C 1CSKA 4J15A 4CS2A 3A8MB 5IAYA 2QHUA 4PFOA 3OYKA 2A37A 3LX7A 2DL4A 2ZINA 1MV0B 3OYEA 3VQWA 4M75A 3LGLA 1MUZA 1WQ7A 2DEQA 2KXDA 1BCMA 4GY5A 1WXTA 1M2VB 3CD6A 2JNGA 4KR3A 1R8OB 4JZ3A 1MV3A 4F16A 3NTIA 5I21A 3V8KA 4LVIA 1S1NA 5DM7R 2DERA 4M7AB 4JJCA 1K73C 3QXEB 2PZ1A 2ZZGA 4OB2B 2VC8A 1YFRA 2E5AA 1Y71A 1NJ8A 3RESA 2ZPIB 2SEMA 2DF6A 1RAGB 3MO8A 5GAMg 4YRJA 3MKDA 3CCLQ 1KOGA 2I2LA 1ABQA 1VQLQ 1I5LA 2DTOA 3M4GA 4ZTUB 3C94A 2O88A 9ATCB 1OU9A 2QGGA 4LDYA 1NPRA 2YUPA 1Q95G 3OMGA 4XU3A 1VQ7Q 4DOVA 1K8AU 2ZNIA 5CAIA 3QUIA 2DQ0A 3HXUA 1QVPA 2ED0A 1GCQC 4ZGDB 4IUVA 4RUGA 2EL9A 4LVLA 4OB1B 2ZCEA 1VQOA 3SFMA 4J83A 2CYZB 1YBYA 1KIKA 3PCOB 4EMGA 1RL2A 3CEYA 1AVZC 2P0KA 2K5LA 3A8HB 3S3NA 4HVCA 1EFWA 2GQIA 1XOVA 3SB2A 2EKOA 3CBMA 2ZCFB 2AKWA 4K11A 4A4EA 3I7FA 1XQHA 2JTMA 4E7LA 1VIFA 3UATA 2XGTA 2HZYA 3CPWA 1I0CA 1MMDA 3M57A 1YI2A 2EGAA 4GLMA 2EYWA 4LUDA 4A53A 5KE2A 4XTWA 5CR2A 2QHVA 1YJWT 2K5FA 5J3BA 2P0PA 2E64A 1S72A 4C92A 1QWEA 3H6ZA 4TVWA 4IURA 4C8QB 4OLFA 1PRMC 2KYMA 4LVJA 1I1JA 2RA2A 4XAXB 1GRIA 4E7KA 4A4HA 2ZT8A 3OS2A 2CP0A 3BY7A 1AWWA 3UGTA 1K4US 4E7ZA 2AT1B 4RTUA 1LOJA 3N5BB 2EYYA 2RHSB 1KQ2A 1I5OB 1GFCA 2OTJA 1VA7A 1WHLA 2DLPA 4H2YA 2DU7A 4Y91A 1VUBA 4RMFA 2ED1A 2KQWA 4XEOA 4KUIA 1IHVA 1UGSB 2CS7A 4J9BA 2RHQB 1X69A 3BW1A 4ESRA 4HCCA 3G4SQ 4CC4B 1NEGA 3TU4K 3OBWA 3C12A 8AT1B 1YITQ 3CCLT 1Y7XA 2A8EA 2YUOA 1VQLT 1UEBA 3OS5A 3UPUA 4CC7A 1Y96A 2EW3A 1PD1A 1UGRB 2LJ3A 4LE9A 3VQXA 2DK3A 4LXCA 4LNSA 2FZGB 3IKLA 4RKUE 1VQ7T 2CJBA 4JZ4A 2B8AA 1T3SA 4R55A 2QQAA 2RJEA 1M90U 2C8MA 1BIAA 2BZYA 3HSBA 4F7UB 1YWPA 3QO5A 2DL7A 4QKUA 5L23A 1ZUYA 2KAFA 2DVJA 1VQ9Q 2KK4A 1PG5B 3WQZA 1OOTA 1QW1A 4M75G 1DJ7B 1JJ2S 1D1BA 1IRXA 4RTZA 4TWAA 1W2BS 1RUWA 1WIEA 4ELZC 3X25B 5K1XA 3M53A 1X56A 3CBOA 5CQXA 1W70A 1RADB 3AHUA 1X2HA 1E22A 4HKEA 3EG3A 2KBTA 2E10A 1HK9A 5KYXA 3I56Q 3RNJA 4II1A 2COYA 1QKWA 2F2WA 3EFRA 3CMEA 4FU6A 2MK5A 2E41A 2QQ9A 1VQ8Q 2DM1A 1Q81U 2MCNA 3S6WA 2NS6A 1JJCB 4F7UE 2XD0A 3I55A 4IUUA 2F5TX 3EGDA 1FWZA 1N5ZA 3MHXA 2A08A 2L89A 3FJPA 2CP7A 4YRIA 2C0OA 2OAUA 1ZQ1A 1Q82C 4KRTA 1VQKQ 2KY9A 3CPWP 3F70A 4FW1A 2YSQA 2I4NA 1VQ6Q 1M2OA 3ME9A 3OW2S 3LW5E 3TSWA 4F7UF 1SF9A 1ZBJA 4RTYA 1H8KA 1RAHB 4CRIA 4P74A 3G4ST 4TVAA 3HFNA 1LPLA 1YITT 2ALYA 3M9QA 2CSIA 5J26A 1NNHA 2QEXQ 3V8LA 1WXBA 1VQ5A 1EQRA 1OI1A 3TVTA 3RGLA 4XK8E 4OMQA 2CGHA 1YB3A 2JOYA 4RG2A 4YPFA 2EBPA 2CSQA 1IXDA 3A8GB 4C92D 4C92G 3HPWA 1B70B 1N9SA 1M5Q1 5HK0A 2JM9A 2ZPBB 2LZ6B 3PIPA 1SG5A 2DXCA 2JS0A 2K7AA 4J8OA 1N8RR 1VQ9T 1ADYA 3HHTB 2NLUA 2ZNJA 5EC7A 3OBYA 2KXCA 1C1AA 1YP5A 1KSWA 4MMLA 4H2XB 2O01E 4RTVA 3G71Q 1G8XA 4QT7A 4M4ZA 5GMKi 4E6RA 2GFUA 3TCJA 5IHKA 3DKMA 1Q7YU 4FT4A 4O6JA 1FX7A 5A2QE 2Y4XA 4MDXA 1Q86R 2CUDA 3I56T 3OQ5A 3NETA 3GF5A 4EMKB 4M77B 2WSFE 1VQ8T 1YFNA 3L42A 1ZUUA 1G5VA 1JJ2A 2CH4A 2XK0A 2YRVA 3CCSQ 3HFZA 2LMJA 4DBQA 1NLPC 1W2BA 1ZA2B 3RUXA 2OAWA 2BZ8A 4UPAA 1IHWA 1M1KR 1Z9QA 4OP0A 3M54A 2E1HA 3QYHB 1IGQA 1QCOA 1YJ9Q 3OS1A 1YJNQ 1VQKT 3X26B 1AOJA 1K8AC 1M1GA 1FXXA 1PYSB 1VQ6T 4DBRA 1MGQA 3CXCS 5I22A 4P71A 2Q5HA 2DETA 4C0DB 3G6EA 5FROA 4L59A 3JCMV 4BDZA 4J6WA 3VS5A 4YRGA 2FO0A 1WJRA 4TVRA 4X5OA 4CS3A 2DPPB 1YCSB 4M77E 1NYRA 1QCNA 1X6GA 1SHGA 4D8KA 4M7DA 2BKDN 3H0IA 1B3QA 2FG0A 2QEXT 4M75B 2BIVA 4VUBA 2ZXFA 1HSQA 4HCKA 5LJ5f 3V7SA 5KYUA 2FRYA 3OW2A 5CKHA 4AFUC 1X54A 1E1TA 3EFSA 2FZCB 4Z8AA 5AYFA 1RACB 4M77F 2JN0A 4L5GA 4OGEA 5FWCA 4D8DA 3OYLA 4AG1C 8ATCB 3OYHA 5LL6S 1I07A 2X51A 3RR6A 4P3PA 3VUBA 1FYFA 3JCMc 2AMCA 4CH3A 4CI0C 3JAME 1U3OA 3G71T 5GAN3 1PKTA 2DYIA 4RTWA 4XEMA 2D9TA 1R0BG 4RQEA 2HKQB 1H4QA 3A5YA 2L3QA 3SWNC 3QDFA 3CC2Q 4IUPA 1H4TA 3JB9D 1ZSZA 2JTFA 2FVUA 1U1SA 2M16A 3EG2A 3URGA 3P8VA 2VYTA 2QXFA 5GAN7 1K1ZA 3OYGA 1Y57A 2DL3A 3UDCA 2LNHB 3CCST 1KHIA 3FRNA 1PSFA 4FW2A 4XTUA 1H3ZA 3V8JA 1QKXA 4Z02A 1YCYA 2Y4YA 7AT1B 1ZA1B 4JJDA 2QA4Q 4HT8A 4LDWA 2PMFA 5HCKA 1YJ9T 1YJNT 1ZSGA 3JV3A 3IG2A 2PTKA 2QQBA 3INZA 3G1JA 1UGPB 2CDTA 1M90C 2KVQG 2AKKA 3VS1A 3WXMB 1OPKA 2CJAA 4H2SA 1KFZA 4C92B 1ABOA 5KCHA 3QWYA 2HBPA 2CUBA 1G51A 1B7TA 4X1VA 4FM4B 2KE9A 1JJ2P 3GIBA 2E5KA 4BDYA 4J9CA 1X01A 2EYXA 3VS0A 2E70A 1W2BP 1D0YA 1PM3A 4RQFA 2LRQA 2IG0A 1YHQA 2A28A 1BK2A 3E1SA 3CC4Q 2DXTA 3HL8A 1ZSZC 2QI2A 3CXCA 1VQPA 1QWFA 3MEWA 2K79A 2HMAA 3L2QA 2DRMA 2JS2A 2D8HA 2BUDA 3RERA 3EAEA 4P73A 2GBQA 3M4QA 1OULA 3QJYA 5GAOm 2VXFA 3HRIA 2E6ZA 5KYYA 1Q81C 2VXEA 5E3IA 2EVRA 1X2QA 4QQDA 1NJIU 1BBZA 3PGGA 1RLPC 5LJ3f 1Y96B 2RHZA 1G83A 3S3OA 5GMKh 2DBMA 2RHYA 2CT3A 3HRKA 2ROLA 1QVFS 3CC2T 4YRCA 3OSSC 1UB4A 2GF7A 3H0FA 1D0XA 2RQVA 4RMOA 2RM4A 1L0WA 1TOVA 1G3WA 2XDDA 2MOXA 5M9OA 3OB9A 1W4SA 2LCSA 4WTOB 4YCVA 4BUGA 3OYMA 4M7DG 2L2PA 4HVUA 4QQGA 1YIJQ 4YCWA 4YDQA 2JMCA 2G6FX 3EH2A 3REUA 3DB4A 4Q6GA 2JW4A 5GMKm 3OYBA 3OMCA 4G85A 4J5YA 3ZFJA 3SDZA 1VQMQ 1Z7MA 2QA4T 1LYLA 3VU3C 1PHTA 1WU7A 4PJOE 1KC8U 1GL5A 4RCCA 2J6FA 5KYXB 4JLGA 1SRYA 3PMIA 3QO3A 3CCMQ 1VIEA 4E2FB 2DKGA 3CMQA 4M78E 3EGXA 1PSEA 2R5MA 2HQHA 2DILA 4Y28E 2JM8A 1NM7A 3CPFA 3HXVA 1IO6A 5FWBA 3BDLA 3EGDB 2COWA 1WX6A 2O9VA 2ZPEB 4PJOF 4HWRA 5LJ5h 2LQ8A 4NCXA 3CC4T 5A0LA 1YN8A 2A3LA 2I4MA 3FEOA 1G3TA 1Q7YC 3JCMg 4M78F 4PJMA 1WZOA 2P5IA 5DLOA 4HWPA 3MCAB 2D8JA 4BW9A 1OX9A 4YTLA 2QK0A 4OMMA 5GANf 4JS4A 2ARSA 4TVAB 1X75C 2HSEB 2ZZDA 3HXWA 4LUEA 2V8JA 2ALYB 2E3CA 4P75A 3EHQA 3RACA 4YRNA 2LT1A 5GMKe 2FB7A 5GAN6 4CH5A 4J7FA 3LYIA 4QVDA 2ZIOA 2DD4A 4YRKA 2CZ7B 2GFAA 2KI7A 2DXUA 4J9IA 4BY6C 1BI1A 4BE1A 2M1HA 4H02A 4JRQA 3CXCP 2XDBA 1MMAA 4P3OA 2HQXA 4MDWA 4J9GA 3HRUA 3P8YA 2DDZA 4M7AE 2K9GA 2J05A 2YRCA 3ASKA 3E9IA 2WACA 1VQNQ 5FU6B 5ELNA 3I35A 1RAIB 3LWHA 2RHXA 2M9UA 2DRKA 2HNIA 3UGQA 1YIJT 2HKNA 2M0OA 1AWXA 1BIBA 1YJWA 1KQ1A 2X35A 5GAOp 3GOXA 1KD1R 2X3WD 3PZCA 2X4JA 5FRNA 2VKNA 1QVFA 4F17A 1VQMT 4WCIA 2ZR3A 4KGXB 2HEQA 1X6OA 1WQWA 1GBQA 2KRSA 4M7AF 2EPDA 4J9EA 1AT1B 1C0MA 2IPOB 3RF1A 1YNZA 3MEYA 3CCMT 1PC0A 2YHTA 3IQLA 2BE9B 2JT4A 4A4FA 4DBHA 1KQSS 2XKOC 3J81E 1Y07A 3HFZB 4DOWA 3E9HA 4P75C 2KDSA 5LJ5e 3EHRA 1I8FA 1ZUKA 1UTIA 2B86A 2KGTA 3UFGA 1MHNA 4HA8A 3WVEB 1GXIE 1TTHB 4PJLA 2LQNA 3M58A 3L4GA 3CCLA 1VQLA 3NENA 2PNIA 1WHMA 3AT1B 5I2MA 5KYNA 2IY5A 2KR3A 1G5HA 1OYXA 1VQ7A 3DB3A 4C8QE 2F5KA 4N4GA 1G3SA 4M7DB 5LJ3h 1JXMA 3QZ5B 2O4XA 1NBEB 3CCQQ 4CS4A 2SRCA 2V1QA 1MNEA 2EYZA 4EX5A 1QLYA 1G5IA 4BD3A 3VJPA 3A7AA 2E3HA 2NYSA 5KYUB 3EFOB 3JCMf 2BE7D 2L3SA 1B7YA 4PK4A 5KYWB 2ODRC 1F1BB 1WYDA 2V8IA 3MJXA 4FCYA 2VGNA 2PVDB 4C8QF 3LSQA 3FLGA 2LQWA 1N9RA 4XTYA 1ZLMA 1VQNT 5GAMf 3M55A 1SERA 3VQYA 2DQ3A 4ZTFA 2W10A 1SRLA 5CKDA 5ELOA 1RIQA 5IXBA 2AMCB 1K9AA 2K3YA 1OEBA 1K76A 2C7IA 3C4SA 2FPEA 1CKAA 2KT1A 3QHSA 3L2WA 3QIIA 5D6YA 3EGUA 1NJ2A 4YRSA 1QQJA 2E3IA 2DXBA 4JS5A 5GAN8 3OYIA 3RMQA 2LTOA 3VS6A 3REXA 2KROA 3QDRB 5IN1A 2KEAA 1ACMB 1EX4A 2EJGA 5C51B 4HVVA 1QVGS 4XTVA 2JXBA 2YLCA 3CMAQ 3SHWA 2R58A 1NJIC 5KCOA 1W6XA 3A98A 4AG2C 1U5SA 4G84A 4A4KA 4HWSA 3NPFA 1QVFP 1AWOA 2ZT6A 2J3MA 3G4SA 3NEMA 3HP9A 2FHDA 2VASA 2RK1A 1IREB 1YITA 5GAOn 3ERRA 3CCRQ 1U1TA 3MP6A 4PJOC 1KQSA 3U23A 4PL6A 4PFPA 5GANh 2QTXA 3M56A 1PD0A 5CIUA 2OJ2A 1K73R 5FW9A 1BBUA 5LJ3e 4B9XA 2J06A 4JPBW 1TS9A 1WHKA 3EG1A 3G1ZA 4M78C 4ZIBA 3M0PA 3CCQT 3JCMb 4E7JA 3JCMX 3R6OA 3LH5A 5LJ3d 1AHJB 4A54A 5DY9A 4MMKA 2Y90A 4ME7A 3A5ZB 3HXYA 4QVCA 2K2MA 3VRYA 3QG1A 2GQVA 1KC8C 3M0TA 5FU7C 1Z9ZA 3DLLA 4LDVA 3VQVA 3MEVA 2DO3A 2LVMA 2MPXC 2DL5A 1MMNA 1GBRA 2FPFA 3V7RA 2IVWA 1BCOA 3A1PA 1I4K1 2W0ZA 4XTZA 3E19A 3EH1A 2RF0A 3E9FA 11ASA 3I56A 3M4PA 2CH4W 1H4SA 3PIOA 2ROTA 3H8ZA 2ARTA 3A32A 1VQ8A 1VQ4Q 2G4CA 1BI3A 3LH0A 2YRDA 4N4HA 1D09B 1X2KA 1BI2A 2XG8D 4KQEA 2WSCE 4H2TA 1B07A 3CCEQ 4CC3A 2YUNA 2XDPA 2XIDA 4M7AC 1VQKA 2QASA 4BI3A 3UA6A 3NMZC 4K86A 1XTDA 2L0AA 3CMAT 1YWOA 1Z7NA 3OYCA 4IUTA 1VQ6A 3MF2A 1J5WA 2YT6A 3T9NA 4A4GA 2CKKA 3HXZA 3I9QA 3GBQA 3SWNA 2LP5A 2RI5A 4DBFA 1FMKA 2BZXA 5GANe 1BYMA 1H3HA 3CCRT 4C0FA 1C6VX 4YRQA 1BU1A 1I81A 2CT4A 3LGFA 2RHSA 1QVGA 2DD5A 2EJFA 1LCKA 5GANd 1N8RU 1JEGA 4M78D 2PUKB 2O31A 4GBQA 2ZAEA 5HGQA 4YREA 4LVMA 3QBYA 4UC4A 1AEYA 2PU9B 3E2UA 3J7AF 3OYFA 3HTZA 2Q7EA 3JB9J 4K88A 3H0HA 3GP8A 2D6FA 1Q86U 1OZ3A 4CH4A 5GAMh 3G71A 1KQSP 2K2VA 3CCVQ 4IIOA 4YRMA 3UT1A 1CKBA 3M0QA 3KFVA 1WPYA 3NGPA 4YP0A 1OZ2A 4E7HA 3QNEA 5ECAA 4F7UA 1SESA 3UH0A 4C8QC 4M75E 1M1KU 3VS2A 4PLLA 2K57A 1VQPQ 1LNXA 3UF4A 1VQ4T 1VYVA 1RAEB 3JB9G 4KGVB 3CCSA 4FIBA 2DTIA 4XU0A 4YROA 2BTTA 3OYYA 4OMPA 3PMTA 3I5RA 2E65A 4LNPA 2DJQA 4LDXA 2I4LA 3CCET 5I11A 1OV3A 1PWTA 5KNNA 2E12A 3RMSA 1VYTA 1QCFA 4JRKA 3CCJQ 2EFIA 1YJ9A 1YJNA 2FRWA 2EGCA 4M75F 4ANJA 5HK3A 2AKWB 1WHGA 2L3PA 4LDUA 4ZTZB 1K0SA 5A0GA 1G3YA 4EPCA 3VBBA 2ECZA 3C0CA 3X24B 1JB0E 5GJVB 4AFQC 4YCUA 2RD1A 3PE0A 3EG9A 2G3RA 2NUPA 2K6DA 3QKJA 3RKYA 4P5NA 2CJ9A 2EQMA 3OD1A 3TSZA 4P72C 4J9DA 2FL7A 4J7IA 2CZ6B 5HKCA 1Q82R 3QO8A 4H2UA 3HXXA 2MYSA 3H41A 4O2DA 5J39A 2X9HA 3GNGA 3RKWA 2IIMA 3TREA 1NJ5A 2FYKA 1EZZB 2J7IA 4C5IA 5D6WA 4OMNA 4TQDA 4HVWA 3FB9A 2GGRA 4AFZC 1E6HA 2OTLQ 2I4OA 1TUGB 1D3BA 4ELYC 3OYAA 4IKFA 3MF1A 4ZN1A 2D1XA 4BI8B 3CCUQ 4BACA 2O9SA 4ORZA 4QQ6A 4XU2A 3MEUA 1ASZA 1M3CA 2ZIMA 5CQYA 1IL2A 2MWOA 1D1AA 4J6YA 1JXOA 5GAMe 3L4GB 4CH6A 2EQJA 2RH2A 2NUTA 1K9MU 2RHUA 4RG8A 2DZ9A 3CCVT 2QTVA 1W1FA 2K4YA 4UP7A 3RBBB 5GAMd 4C92E 1QVGP 1MNDA 3CC2A 3QO7A 2AIRB 2DBKA 3L2UA 3CD6Q 2O4XB 2YWWA 4OGCA 3A7UA 4C5GA 2VWFA 1E1OA 3ULRB 1VQPT 4MZTA 3HY0A 1M1FA 4OMLA 1QP3A 1OX8A 2DIQA 3OW2P 2RO0A 2EQKA 1TWBA 1B7YB 2JZ2A 5L8RE 4C92F 2F2XA 1EVLA 3X28B 1WLEA 1M27C 2DAQA 2ZPHB 4LD6A 4LVKA 3LSSA 5CVIA 1WHJA 2QA4A 3CCJT 4DQ2A 3CC7A 3FIFA 1NE8A 2RI3A 3A74A 4EMKA 1ZBXA 4M77A 2JJ9A 3VUZA 2QHTA 2EIFA 4PKCC 5D7UA 3IALA 3M4YA 1WA7A 1GGMA 2QHSA 3D7SB 1NYGA 12ASA 1VQOQ 4QVZA 4DPGA 4OB3B 2C0TA 1RAFB 4HCZA 2MWPA 4MZPA 2E6NA 1K8AR 2QQRA 4DEYA 4IIMA 3QPHA 2P4RA 3NTKA 2DNUA 3THKA 1RAAB 2QDLA 3CC4A 2P4TA 2ZT5A 4F7UG 3A7RA 2AKLA 2K3XA 1X55A 2Q7HA 2DIGA 3LLRA 2F2VA 2OTLT 2HDAA 3VS4A 1YI2Q 1KHCA 3CCUT 4B9WA 4N0AC 2DTHA 4ATOA 4YYEA 4WI1A 1S72Q 2D0NA 2RJCA 2DU5A 4KH1B 2VUBA 3P8BB 1AZGB 2LX9A 4B6MA 2EQIA 4OF1A 3EG0A 1H4VB 2RQUA 4GLKA 1YFTA 4OB0B 5GMKl 3KUFA 2RQRA 4PFZA 4EMKC 4M77C 2EQUA 2LT4A 2QQSA 3FJ5A 1HJDA 3CD6T 1TH7A 5GAOq 3UA7A 2COZA 2OTJQ 1IB8A 5IH2A 3RIRA 2X4WA 6AT1B 1WXUA 3MP1A 2J6OA 1T3LA 4EIKA 1YIJA 3Q1JA 1B8AA 3M59A 2MMPA 4E51A 2DX1A 5GMKj 2EAYA 3QYGB 2CP3A 5I2SA 1VQMA 4H2VA 4YRFA 2M51A 4MZMA 4C5EA 1ZX6A 1GFDA 1KG1A 1N8RC 3QJ6A 1M8VA 4C0DC 2HL5C 1X6BA 1WDXA 1HD3A 2X3XD 2GTOA 4X9DA 3FDRA 4ZGEB 1VQZA 3CCMA 2L8DA 2Q7GA 4CC2A 3GPLA 1E7OA 3CBPA 4M75C 3O8VA 1VQOT 5CCAA 3JB9F 1EIYA 1KMNA 2KSSA 4KT0E 1NYFA 3NHNA 1WYXA 3SD4A 1Q86C 2XI9A 3I5SA 1Y0MA 1D1CA 4WJ4A 1N27A 1SHFA 1IZ6A 4PJNA 3A31A 1QMCA 2C0IA 1M90R 2P0LA 2CZ0B 1D0ZA 1A0NB 3LC0A 4YRRA 3JCMJ 1NG2A 3FC3A 1M9SA 3HRTA 3JCMP 2J6KA 2KNBB 1YI2T 3VKIA 5LJ5d 4RDXA 3MEAA 1RABB 1M1KC 4LD9K 3SWNB 3CMEQ 1S72T 2RK2A 2Z0WA 2K3BA 2ZR2A 2LJ0A 4OVAA 2ZTGA 3HY1A 1AWJA 1JU5C 3NTHA 1HYOA 3P8TA 2DA9A 5LJ5j 4NOYA 4JRIA 4R56A 3I55Q 1TXQA 4WJ3M 3HKSA 5EG2A 3KXTA 1M3BA 4M77D 4M77G 3L2VA 1NEBA 4K87A 2OX7A 4XTXA 3M0UA 1EOVA 1Q81R 1B34A 3NELA 4EDUA 1KD1U 1WLPB 2OTJT 2NUZA 2JVVA 3L1AA 3QZ9B 1WGSA 3TEHA 1VQNA 1B76A 2HAXA 1RI9A 4FYXB 4KH0B 2J3LA 1SPKA 5HY6A 3ICAA 4PG3A 1O75A 3VRZA 4PJOA 5CKBA 4ZN3A 3A8LB 2RI2A 4RTTA 1E6GA 2CREA 1SKUB 4EMHA 1YFSA 2WSEE 1VQ5Q 1NJ6A 4M78A 2MF2A 1QP2A 4AFSC 2XHCA 4C92C 1NLOC 1HXDA 2R57A 3QTCA 4FYVB 4M7DE 4C0GA 3TUPA 3BE3A 2HL3A 2F69A 1GCPA 1N6AA 4JJBA 2CP6A 5IHIA 1BBWA 4PNOA 1XJWB 2LQKA 5IXFA 4M75D 1HTTA 1ZSZB 3L2ZA 4E47A 4XU1A 2PMEA 4JUVA 1FMWA 2PUOB 5KH6A 2CIMA 2ZT7A 4OMFB 4OMOA 4KUDK 2RPNA 4TVYA 2ESWA 3REAB 2ABLA 4FSSA 1NYQA 2KRNA 1K9MC 1AD5A 1ATIA 3SEMA 2DE0X 4M7DF 5F5WA 4PJJA 3RDVA 3VS7A 3QSUA 3PT9A 5CKEA 1T0JA 2VVKA 1C0AA 4FYWB 1KK7A 4JJNK 4HT4A 4ZNXA 3W3SA 5K1PA 4JRPA 4LN2A 4N4IA 3EG9B 2ZZEA 2AZSA 4BE2A 4E7IA 1UHFA 2NUPB 2E4HA 1M30A 4YRTA 3CMET 2RMOA 2AHJB 3RKXA 3OY9A 1UGQB 2VV5A 3A8OB 4HCBA 2DEUA 1M2VA 4Z89A 1USYA 3CCQA 3MP8A 2JTEA 4FYYB 4X9CA 1Q7YR 1SSHA 4IUQA 1UECA 2X4YA 5LJ5g 2NWMA 3I55T 1J3TA 1M3AA 3E9GA 2DJZA 4M7AA 4NL2A 3PFSA 4WF2A 4DA4A 2H3EB 2I0NA 1YGBA 1JO8A 1D3BB 1T0HA 1ZHIA 1BI0A 4XQ3A 2ODRD 1ASYA 1VQ9A 4HWTA 3KBGA 2VGMA 3G6EQ 4F04B 5LJ3j 4HWOA 3GNFB 2M0YA 4Q15A 2ATCB 2NUTB 2R5AA 2LJ1A 1LJOA 1V76A 3L2RA 5KYYB 2KT8A 1VQ5T 4KGZB 3VS3A 3PCOA 4RTXA 2KMTA 3R6NA 1TU0B 2QDYB 2DVEA 2QYZA 5CO7A 2Q5IA 2A7YA 2MI6A 1H641 1IGUA 1UDLA 3HFOA 1WJSA 4D6WA 4P3NA 2LCCA 4JLIA 2A36A 1EIFA 1ARKA 1PKSA 1USYC 3ZBDA 3PVQA 3CMAA 1UJ0A 2GTJA 1ADJA 2EWNA 2EJ9A 2RQWA 3O5ZA 1QE0A 2KRMA 3OS0A 1TSFA 2XMFA 1N9WA 2V8KA 3DLMA 3R07A 1XNIA 1K73U 2YLBA 2HQEA 1PCXA 5C52B 2CZ1B 4J9HA 3QWXX 2L5QA 3CCRA 2RN8A 4P74C 4C8QA 1WNLA 2D0QB 2QG9B 4AMCA 4E7SA 1VOMA 4BY6B 3WVDB 2OI3A 3GLXA 4PJOD 4PJOG 1H92A 3S3MA 2QEXA 1R0CB 2XICA 1R77A 2VB6A 2V1RA 3META 5CK9A 2HBWA 4V2SA 4HXJA 3OA6A 3JSCA 5C53B 3EGXB 3OSVA 3P8HA 2YXYA 3P8DA 5CKFA 1X2GA 3ER0A 2ARUA 4M78G 2RJFA 2PVOB 3MQZA 1JQQA 1O9SA 2V26A 2ZPGB 4NL3A 4YRPA 2EGEA 2RHQA 2AZVA 5FU6C 1NPPA 3JCMh 5GANj 3VV0A 1X43A 4F14A 2DFUA 2M02A 1FYNA 4KBMB 1U8RA 4ZGJB 1W66A 3G6ET 2X4XA 4P72A 1MMGA 4Z88A 2K5IA 5LJ3g
chains in the Genus database with same CATH topology
2L3RA 5GAN4 3UWNA 1E24A 1NZ9A 4UP9A 2XU8A 1VQ4A 4L6V5 4PLIA 1P92A 3HRSA 4BI4A 4C5HA 4BWAA 3PNWC 1KMMA 2P0QA 3CCEA 3OYJA 2H3JA 3TEEA 3VYGA 2ZGWA 4KULA 2ZZFA 3DSQA 4TTVA 5FRMA 4M7AD 4M7AG 2RHIA 4HT9A 4FT2A 5GAOr 2E5QA 4P71C 2JUFA 2MAMA 4L87A 1NJ1A 1JJCA 4C0ZA 1KD1C 3BJUA 4M7DC 1V29B 4QW2A 2ZPFB 5KE3A 1EIYB 1JBMA 3HFVA 4ZTJA 5GAN5 2RJDA 4O5VA 3PTAA 2GCXA 3M5AA 2RB6A 3JCMQ 3JB9I 4X34A 3JCMe 5FLXE 1EVKA 1M4ZA 4UP8A 5GANg 3CCVA 3JCMd 2LDMA 3J80E 1HC7A 5D6XA 2LCLA 3ZEHA 2DZCA 3A5ZA 2IY5B 4RCBA 3OYDA 1SSFA 3KFUA 2XTIA 4Q5WA 1B70A 1YHQT 4C8QD 4C8QG 4YRLA 1B34B 5GAMj 2EYQA 4N0AA 3JCMW 3C95A 3TEHB 3CCJA 4H2XA 3OYNA 1Q82U 2HD0A 4FSXA 4BB7A 4PJOB 1BKBA 3BFMA 3CPWS 2PQWA 4H2WA 3NFCA 4BE0A 4JDSA 5C0MA 5DLQE 5IT9E 3G7ZA 4M78B 4KR2A 3RL6A 2C06A 2LNVA 5GAN2 3V7CA 3JB9H 4M7DD 3BDUA 5GAOl 1RI0A 5FU7B 2LC4A 4EO4A 5A0DA 1QF6A 3JRZA 4PHCA 3X20B 2OTLA 4NS5A 4TQFA 3CCUA 3IKMB 3CC7T 4J6XA 1PYSA 1JRIA 3VYHB 3LWIA 1SETA 5C6SA 2PVGB 4FL6A 3TEGA 1WJQA 4AH6A 4P73C 4J15A 4CS2A 3A8MB 5IAYA 2QHUA 3OYKA 3LX7A 2ZINA 3OYEA 3VQWA 4M75A 3LGLA 1WQ7A 2DEQA 4GY5A 3CD6A 2JNGA 4KR3A 1R8OB 3NTIA 5I21A 3V8KA 4LVIA 5DM7R 4M7AB 1K73C 3QXEB 2ZZGA 4OB2B 2VC8A 1YFRA 2E5AA 1Y71A 1NJ8A 3RESA 2ZPIB 3MO8A 5GAMg 4YRJA 1KOGA 2I2LA 1I5LA 2DTOA 3M4GA 4ZTUB 3C94A 4LDYA 1NPRA 3OMGA 4XU3A 4DOVA 1K8AU 2ZNIA 5CAIA 3QUIA 2DQ0A 3HXUA 1QVPA 4ZGDB 4IUVA 2EL9A 4LVLA 4OB1B 2ZCEA 1VQOA 3SFMA 4J83A 2CYZB 1YBYA 3PCOB 4EMGA 1RL2A 3CEYA 2P0KA 2K5LA 3A8HB 3S3NA 4HVCA 1EFWA 1XOVA 3SB2A 2EKOA 3CBMA 2ZCFB 2AKWA 4A4EA 3I7FA 1XQHA 2JTMA 4E7LA 1VIFA 2XGTA 3CPWA 3M57A 1YI2A 4A53A 5KE2A 4XTWA 5CR2A 2QHVA 1YJWT 2K5FA 5J3BA 2P0PA 2E64A 1S72A 4C92A 3H6ZA 4TVWA 4IURA 4C8QB 4OLFA 4LVJA 2RA2A 4XAXB 4E7KA 4A4HA 2ZT8A 3OS2A 3BY7A 3UGTA 1LOJA 3N5BB 2RHSB 1KQ2A 2OTJA 4H2YA 2DU7A 4Y91A 1VUBA 4RMFA 2KQWA 4XEOA 4KUIA 1UGSB 2CS7A 2RHQB 3BW1A 4HCCA 3TU4K 3OBWA 3C12A 3CCLT 1Y7XA 2A8EA 1VQLT 1UEBA 3OS5A 3UPUA 1Y96A 1UGRB 3VQXA 2DK3A 4LNSA 3IKLA 4RKUE 1VQ7T 2CJBA 2B8AA 4R55A 2QQAA 2RJEA 1M90U 2C8MA 1BIAA 3HSBA 4F7UB 3QO5A 2KAFA 2KK4A 3WQZA 1QW1A 4M75G 1DJ7B 1JJ2S 4TWAA 1W2BS 4ELZC 3X25B 5K1XA 3M53A 1X56A 3CBOA 5CQXA 1X2HA 3AHUA 1E22A 4HKEA 2E10A 1HK9A 4II1A 3CMEA 3EFRA 4FU6A 2E41A 2QQ9A 1Q81U 3S6WA 2NS6A 1JJCB 4F7UE 2XD0A 3I55A 4IUUA 2F5TX 1FWZA 3MHXA 2L89A 3FJPA 4YRIA 2OAUA 1ZQ1A 1Q82C 2KY9A 3F70A 2I4NA 3OW2S 3ME9A 3LW5E 4F7UF 4CRIA 4P74A 3G4ST 4TVAA 3HFNA 1YITT 2ALYA 3M9QA 5J26A 1NNHA 3V8LA 1VQ5A 1EQRA 1OI1A 3RGLA 4XK8E 2CGHA 1YB3A 2JOYA 4RG2A 4YPFA 3A8GB 4C92D 4C92G 3HPWA 1B70B 1N9SA 1M5Q1 5HK0A 2ZPBB 3PIPA 2DXCA 4J8OA 1VQ9T 1ADYA 3HHTB 2NLUA 2ZNJA 3OBYA 4MMLA 4H2XB 2O01E 5GMKi 2GFUA 3TCJA 3DKMA 1Q7YU 4FT4A 4O6JA 1FX7A 5A2QE 2Y4XA 4MDXA 3I56T 3OQ5A 3NETA 3GF5A 4EMKB 4M77B 2WSFE 1VQ8T 3L42A 1G5VA 1JJ2A 2XK0A 2YRVA 3HFZA 1W2BA 3RUXA 4UPAA 4OP0A 3M54A 2E1HA 3QYHB 3OS1A 1VQKT 3X26B 1K8AC 1M1GA 1FXXA 1PYSB 1VQ6T 3CXCS 1MGQA 4P71A 2Q5HA 4C0DB 3G6EA 5FROA 4L59A 3JCMV 4BDZA 4J6WA 4YRGA 1WJRA 4TVRA 4X5OA 4CS3A 2DPPB 4M77E 1NYRA 4M7DA 2BKDN 2QEXT 4M75B 2BIVA 4VUBA 2ZXFA 5LJ5f 3V7SA 3OW2A 5CKHA 1X54A 1E1TA 3EFSA 5AYFA 4M77F 2JN0A 4L5GA 4OGEA 3OYLA 3OYHA 5LL6S 4P3PA 3VUBA 1FYFA 3JCMc 2AMCA 4CH3A 4CI0C 3JAME 3G71T 5GAN3 4XEMA 2D9TA 4RQEA 1H4QA 3A5YA 3SWNC 4IUPA 1H4TA 3JB9D 2JTFA 2FVUA 1U1SA 2M16A 3URGA 3P8VA 2VYTA 2QXFA 5GAN7 3OYGA 3UDCA 3CCST 1KHIA 3FRNA 1PSFA 4XTUA 1H3ZA 3V8JA 4Z02A 1YCYA 2Y4YA 4HT8A 4LDWA 2PMFA 1YJ9T 1YJNT 3IG2A 2QQBA 3INZA 1UGPB 1M90C 2KVQG 2CJAA 3WXMB 4H2SA 4C92B 5KCHA 2HBPA 1G51A 4FM4B 3GIBA 4BDYA 1X01A 2E70A 4RQFA 2LRQA 2IG0A 1YHQA 3E1SA 2DXTA 3HL8A 2QI2A 1VQPA 3CXCA 3MEWA 3L2QA 2BUDA 3RERA 3EAEA 4P73A 3M4QA 3QJYA 5GAOm 2VXFA 3HRIA 2E6ZA 1Q81C 2VXEA 5E3IA 4QQDA 1NJIU 3PGGA 5LJ3f 1Y96B 2RHZA 3S3OA 5GMKh 2RHYA 3HRKA 1QVFS 3CC2T 4YRCA 3OSSC 1UB4A 2GF7A 4RMOA 2RM4A 1L0WA 1G3WA 2XDDA 5M9OA 3OB9A 1W4SA 4YCVA 4BUGA 3OYMA 4M7DG 4QQGA 4YCWA 4YDQA 3REUA 3DB4A 4Q6GA 5GMKm 3OYBA 3OMCA 4G85A 4J5YA 3ZFJA 3SDZA 1Z7MA 2QA4T 1LYLA 3VU3C 1WU7A 4PJOE 1KC8U 4RCCA 4JLGA 1SRYA 3PMIA 3QO3A 1VIEA 2DKGA 3CMQA 4M78E 1PSEA 2R5MA 4Y28E 3CPFA 3HXVA 3BDLA 2ZPEB 4PJOF 4HWRA 5LJ5h 2LQ8A 4NCXA 3CC4T 5A0LA 2A3LA 2I4MA 3FEOA 1G3TA 1Q7YC 3JCMg 4M78F 2P5IA 5DLOA 4HWPA 3MCAB 4BW9A 4YTLA 4JS4A 5GANf 2ARSA 4TVAB 1X75C 2ZZDA 3HXWA 2V8JA 2ALYB 2E3CA 4P75A 3RACA 4YRNA 2LT1A 5GMKe 2FB7A 5GAN6 4CH5A 4J7FA 3LYIA 4QVDA 2ZIOA 2DD4A 4YRKA 2CZ7B 2GFAA 2DXUA 4BY6C 1BI1A 4BE1A 2M1HA 4H02A 4JRQA 2XDBA 4P3OA 2HQXA 4MDWA 3HRUA 3P8YA 2DDZA 4M7AE 3ASKA 3E9IA 2WACA 5FU6B 5ELNA 3LWHA 2RHXA 2M9UA 2HNIA 3UGQA 1YIJT 2M0OA 1BIBA 1YJWA 1KQ1A 2X35A 5GAOp 3GOXA 3PZCA 2X4JA 5FRNA 1QVFA 1VQMT 2ZR3A 1X6OA 1WQWA 4M7AF 3RF1A 3MEYA 3CCMT 2YHTA 4A4FA 1KQSS 2XKOC 3J81E 1Y07A 3HFZB 4DOWA 3E9HA 4P75C 2KDSA 5LJ5e 1I8FA 3UFGA 1MHNA 4HA8A 3WVEB 1GXIE 3M58A 3L4GA 3CCLA 1VQLA 3NENA 5I2MA 2IY5A 1G5HA 1OYXA 1VQ7A 3DB3A 4C8QE 2F5KA 4N4GA 1G3SA 4M7DB 5LJ3h 3QZ5B 2O4XA 4CS4A 4EX5A 1G5IA 4BD3A 3VJPA 3A7AA 3JCMf 2ODRC 1B7YA 1WYDA 2V8IA 3LSQA 2VGNA 2PVDB 4C8QF 3FLGA 1N9RA 4XTYA 1VQNT 5GAMf 3M55A 1SERA 3VQYA 2DQ3A 4ZTFA 5CKDA 5ELOA 1RIQA 2AMCB 2K3YA 2C7IA 3C4SA 3QHSA 3L2WA 3QIIA 5D6YA 1NJ2A 4YRSA 2DXBA 4JS5A 5GAN8 3OYIA 3RMQA 2LTOA 3REXA 5IN1A 3QDRB 2EJGA 5C51B 1QVGS 4XTVA 2YLCA 2R58A 1NJIC 5KCOA 4G84A 4A4KA 4HWSA 2ZT6A 2J3MA 3G4SA 3NEMA 3HP9A 2FHDA 2RK1A 1IREB 1YITA 5GAOn 3ERRA 1U1TA 3MP6A 4PJOC 1KQSA 4PL6A 5GANh 2QTXA 3M56A 5CIUA 1BBUA 5LJ3e 4B9XA 3G1ZA 4M78C 4ZIBA 3CCQT 3JCMb 4E7JA 3JCMX 3R6OA 5LJ3d 1AHJB 4A54A 5DY9A 4MMKA 2Y90A 4ME7A 3A5ZB 3HXYA 4QVCA 3QG1A 2GQVA 1KC8C 3VQVA 5FU7C 3DLLA 4LDVA 3MEVA 2DO3A 2LVMA 3V7RA 2IVWA 1I4K1 4XTZA 3E19A 3E9FA 11ASA 3I56A 3M4PA 1H4SA 3PIOA 3H8ZA 2ARTA 3A32A 1VQ8A 2G4CA 1BI3A 3LH0A 4N4HA 2XG8D 1BI2A 4KQEA 2WSCE 4H2TA 2XDPA 2XIDA 4M7AC 1VQKA 4BI3A 4K86A 1XTDA 3CMAT 1Z7NA 3OYCA 4IUTA 1VQ6A 3MF2A 1J5WA 3T9NA 4A4GA 2CKKA 3HXZA 3SWNA 2RI5A 5GANe 1BYMA 3CCRT 4C0FA 4YRQA 1I81A 3LGFA 2RHSA 1QVGA 2DD5A 2EJFA 5GANd 1N8RU 4M78D 2PUKB 5HGQA 4YREA 4LVMA 3QBYA 4UC4A 2PU9B 3J7AF 3OYFA 3HTZA 2Q7EA 3JB9J 4K88A 3GP8A 2D6FA 1Q86U 1OZ3A 4CH4A 5GAMh 3G71A 2K2VA 4YRMA 3UT1A 1WPYA 4YP0A 1OZ2A 4E7HA 3QNEA 4F7UA 1SESA 3UH0A 4C8QC 4M75E 1M1KU 4PLLA 2K57A 1LNXA 1VQ4T 3JB9G 3CCSA 4FIBA 2DTIA 4XU0A 4YROA 3OYYA 3PMTA 2E65A 4LDXA 2I4LA 3CCET 5KNNA 2E12A 3RMSA 4JRKA 2EFIA 1YJ9A 1YJNA 4M75F 5HK3A 2AKWB 4LDUA 4ZTZB 5A0GA 1G3YA 4EPCA 3VBBA 3X24B 1JB0E 4YCUA 2RD1A 2G3RA 3QKJA 3RKYA 4P5NA 2CJ9A 2EQMA 3OD1A 4P72C 5HKCA 2FL7A 4J7IA 2CZ6B 3QO8A 4H2UA 3HXXA 4O2DA 5J39A 3GNGA 3RKWA 3TREA 1NJ5A 2FYKA 4C5IA 5D6WA 4TQDA 3FB9A 2I4OA 1D3BA 4ELYC 3OYAA 4IKFA 3MF1A 4ZN1A 4BI8B 4BACA 4QQ6A 4XU2A 3MEUA 1ASZA 2ZIMA 5CQYA 1IL2A 2MWOA 4J6YA 5GAMe 3L4GB 4CH6A 2EQJA 2RH2A 1K9MU 2RHUA 4RG8A 2DZ9A 3CCVT 2K4YA 4UP7A 5GAMd 4C92E 3CC2A 3QO7A 3L2UA 2O4XB 4OGCA 3A7UA 4C5GA 1E1OA 1VQPT 4MZTA 3HY0A 1M1FA 1QP3A 2DIQA 2RO0A 2EQKA 1B7YB 5L8RE 2JZ2A 4C92F 1EVLA 3X28B 1WLEA 2DAQA 2ZPHB 4LD6A 4LVKA 3LSSA 5CVIA 2QA4A 3CCJT 4DQ2A 3CC7A 3FIFA 1NE8A 2RI3A 3A74A 4EMKA 1ZBXA 4M77A 3VUZA 2QHTA 2EIFA 4PKCC 3IALA 3M4YA 1GGMA 2QHSA 12ASA 4QVZA 4DPGA 4OB3B 4HCZA 2MWPA 4MZPA 2E6NA 2QQRA 3QPHA 3NTKA 3CC4A 2P4TA 2ZT5A 4F7UG 3A7RA 2K3XA 1X55A 2Q7HA 2DIGA 3LLRA 2OTLT 1KHCA 3CCUT 4B9WA 4N0AC 2DTHA 4ATOA 4YYEA 4WI1A 2RJCA 2DU5A 2VUBA 3P8BB 2LX9A 4OF1A 1H4VB 4GLKA 1YFTA 4OB0B 5GMKl 3KUFA 4EMKC 4M77C 2EQUA 2LT4A 2QQSA 3CD6T 1TH7A 5GAOq 3RIRA 2X4WA 3MP1A 1YIJA 3Q1JA 1B8AA 3M59A 2MMPA 4E51A 5GMKj 2EAYA 3QYGB 5I2SA 1VQMA 4H2VA 4YRFA 4MZMA 4C5EA 1KG1A 1N8RC 3QJ6A 1M8VA 4C0DC 4X9DA 3FDRA 4ZGEB 1VQZA 3CCMA 2L8DA 2Q7GA 3GPLA 3CBPA 4M75C 3O8VA 1VQOT 5CCAA 3JB9F 1EIYA 1KMNA 2KSSA 4KT0E 3SD4A 1Q86C 2XI9A 4WJ4A 1N27A 1IZ6A 3A31A 2P0LA 2CZ0B 3LC0A 4YRRA 3JCMJ 3FC3A 1M9SA 3HRTA 3JCMP 1YI2T 3VKIA 5LJ5d 4RDXA 3MEAA 1M1KC 4LD9K 3SWNB 1S72T 2RK2A 2ZR2A 4OVAA 2ZTGA 3HY1A 3NTHA 3P8TA 5LJ5j 4NOYA 4JRIA 4R56A 4WJ3M 3HKSA 5EG2A 3KXTA 4M77D 4M77G 3L2VA 4K87A 4XTXA 1EOVA 1B34A 3NELA 4EDUA 1KD1U 2OTJT 2JVVA 3L1AA 3QZ9B 1WGSA 3TEHA 1VQNA 1B76A 2HAXA 2J3LA 3ICAA 5HY6A 4PG3A 1O75A 4PJOA 5CKBA 4ZN3A 3A8LB 2RI2A 4EMHA 1YFSA 2WSEE 1NJ6A 4M78A 2MF2A 1QP2A 2XHCA 4C92C 1HXDA 2R57A 3QTCA 4M7DE 4C0GA 3TUPA 2F69A 1N6AA 1BBWA 4PNOA 2LQKA 4M75D 1HTTA 3L2ZA 4E47A 4XU1A 2PMEA 4JUVA 2PUOB 5KH6A 2CIMA 2ZT7A 4OMFB 4KUDK 4TVYA 1NYQA 1K9MC 1ATIA 4M7DF 5F5WA 3QSUA 3PT9A 5CKEA 1C0AA 4HT4A 4JJNK 3W3SA 5K1PA 4JRPA 4N4IA 2ZZEA 4E7IA 4BE2A 4YRTA 3CMET 3RKXA 2AHJB 3OY9A 1UGQB 2VV5A 3A8OB 4HCBA 1USYA 3CCQA 3MP8A 4X9CA 4IUQA 2X4YA 5LJ5g 3I55T 3E9GA 2DJZA 4M7AA 4NL2A 3PFSA 4WF2A 4DA4A 1YGBA 1D3BB 1ZHIA 1BI0A 4XQ3A 2ODRD 1ASYA 1VQ9A 4HWTA 3KBGA 2VGMA 5LJ3j 4HWOA 3GNFB 4Q15A 2R5AA 1LJOA 3L2RA 1VQ5T 3PCOA 2KMTA 2QDYB 5CO7A 2DVEA 2Q5IA 2A7YA 2MI6A 1H641 3HFOA 1WJSA 4D6WA 4P3NA 2LCCA 4JLIA 1EIFA 1USYC 3ZBDA 3CMAA 1ADJA 2EWNA 2EJ9A 1QE0A 3OS0A 1N9WA 2V8KA 3DLMA 3R07A 1XNIA 1K73U 2YLBA 2HQEA 5C52B 2CZ1B 2L5QA 3CCRA 4P74C 4C8QA 1WNLA 2D0QB 4BY6B 3WVDB 3GLXA 4PJOD 4PJOG 3S3MA 2QEXA 2XICA 3META 5CK9A 4V2SA 3OA6A 3JSCA 5C53B 3OSVA 3P8HA 3P8DA 1X2GA 5CKFA 3ER0A 2ARUA 4M78G 2RJFA 2PVOB 3MQZA 1O9SA 2ZPGB 4NL3A 4YRPA 2RHQA 5FU6C 1NPPA 3JCMh 5GANj 3VV0A 4KBMB 1U8RA 4ZGJB 1W66A 3G6ET 2X4XA 4P72A 2K5IA 5LJ3g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVL A;  5GAN 4;  1WLE A;  3RF1 A;  1E24 A;  3MEY A;  4UP9 A;  2I4N A;  2YHT A;  4F7U F;  3LSS A;  4DQ2 A;  4P74 A;  3FIF A;  3HFZ B;  4TVA A;  3E9H A;  4P75 C;  3A74 A;  4EMK A;  4BWA A;  3HFN A;  4M77 A;  5LJ5 e;  1KMM A;  2ALY A;  1I8F A;  2QHT A;  1NNH A;  3UFG A;  3V8L A;  3IAL A;  4HA8 A;  2ZGW A;  1EQR A;  1GGM A;  3RGL A;  2QHS A;  12AS A;  2ZZF A;  3DSQ A;  4TTV A;  4DPG A;  2CGH A;  1YB3 A;  4YPF A;  3L4G A;  4M7A D;  4M7A G;  3NEN A;  4C92 D;  4C92 G;  4HT9 A;  1B70 B;  1N9S A;  5GAO r;  1M5Q 1;  2IY5 A;  1G5H A;  4P71 C;  2ZT5 A;  4L87 A;  4F7U G;  3A7R A;  1X55 A;  1NJ1 A;  1ADY A;  2Q7H A;  4C8Q E;  4M7D B;  5LJ3 h;  1JJC A;  4CS4 A;  2ZNJ A;  3BJU A;  4EX5 A;  4M7D C;  4N0A C;  4MML A;  4H2X B;  1G5I A;  2DTH A;  5GMK i;  4YYE A;  1EIY B;  4WI1 A;  1JBM A;  3A7A A;  3HFV A;  2DU5 A;  3JCM f;  5GAN 5;  1B7Y A;  2ODR C;  1WYD A;  2RB6 A;  3LSQ A;  3NET A;  4C8Q F;  3JCM Q;  3JB9 I;  1N9R A;  1H4V B;  4EMK B;  4XTY A;  4M77 B;  5GAM f;  1SER A;  1YFT A;  3VQY A;  5GMK l;  2DQ3 A;  3JCM e;  4EMK C;  5ELO A;  1RIQ A;  4M77 C;  2AMC B;  3HFZ A;  1EVK A;  1TH7 A;  5GAO q;  4UP8 A;  2C7I A;  3RUX A;  5GAN g;  4UPA A;  3RIR A;  3JCM d;  3QHS A;  4OP0 A;  2E1H A;  1HC7 A;  1NJ2 A;  2DZC A;  4YRS A;  3A5Z A;  2IY5 B;  4RCB A;  1B8A A;  1PYS B;  5GAN 8;  4E51 A;  1MGQ A;  5GMK j;  3KFU A;  2EAY A;  2XTI A;  4P71 A;  1B70 A;  2Q5H A;  4H2V A;  4YRF A;  3JCM V;  3REX A;  4J6W A;  4YRG A;  4C8Q D;  4C8Q G;  4YRL A;  4CS3 A;  2EJG A;  1M8V A;  4X5O A;  5C51 B;  4M77 E;  1B34 B;  4XTV A;  1NYR A;  5GAM j;  2YLC A;  4X9D A;  4M7D A;  4N0A A;  1VQZ A;  3JCM W;  2Q7G A;  4M75 B;  3TEH B;  4G84 A;  4HWS A;  4H2X A;  2ZXF A;  2ZT6 A;  4M75 C;  2J3M A;  3JB9 F;  5LJ5 f;  1EIY A;  3V7S A;  3NEM A;  1KMN A;  4PJO B;  4WJ4 A;  1X54 A;  5GAO n;  3ERR A;  1E1T A;  3BFM A;  1U1T A;  3EFS A;  4PJO C;  4H2W A;  3A31 A;  4M77 F;  2JN0 A;  5GAN h;  2QTX A;  2P0L A;  3LC0 A;  4M78 B;  1BBU A;  4YRR A;  3JCM J;  5LJ3 e;  4KR2 A;  3RL6 A;  4P3P A;  5GAN 2;  1FYF A;  3G1Z A;  4M78 C;  3JCM c;  4ZIB A;  2AMC A;  3JCM P;  3V7C A;  3JCM b;  3JB9 H;  4CH3 A;  4M7D D;  3BDU A;  5LJ5 d;  3JCM X;  4RDX A;  5LJ3 d;  4A54 A;  5DY9 A;  4MMK A;  5GAN 3;  2Y90 A;  3HXY A;  5GAO l;  4XEM A;  3SWN B;  4QVC A;  4RQE A;  1H4Q A;  4EO4 A;  3A5Y A;  2ZR2 A;  2ZTG A;  1QF6 A;  3HY1 A;  3SWN C;  4PHC A;  3VQV A;  3P8T A;  1H4T A;  3JB9 D;  5LJ5 j;  4NOY A;  4JRI A;  4TQF A;  3IKM B;  4J6X A;  1PYS A;  1JRI A;  1U1S A;  1SET A;  3V7R A;  3P8V A;  4WJ3 M;  5GAN 7;  3TEG A;  4M77 D;  4M77 G;  4AH6 A;  4P73 C;  4J15 A;  4CS2 A;  1I4K 1;  4K87 A;  4XTX A;  1EOV A;  4XTZ A;  1B34 A;  2QHU A;  3NEL A;  4XTU A;  11AS A;  3M4P A;  3V8J A;  2ZIN A;  1H4S A;  3VQW A;  3L1A A;  1YCY A;  4M75 A;  3TEH A;  1B76 A;  2ART A;  3A32 A;  2J3L A;  1WQ7 A;  2DEQ A;  2G4C A;  3ICA A;  4HT8 A;  2PMF A;  4PG3 A;  4KR3 A;  4PJO A;  3IG2 A;  5I21 A;  3V8K A;  3INZ A;  4KQE A;  4H2T A;  2CJA A;  4M7A B;  4H2S A;  4EMH A;  4C92 B;  1YFS A;  2ZZG A;  1YFR A;  2VC8 A;  2E5A A;  1NJ6 A;  4M78 A;  4M7A C;  1NJ8 A;  1G51 A;  3RES A;  4C92 C;  4K86 A;  1HXD A;  3QTC A;  1Z7N A;  4M7D E;  3TUP A;  3GIB A;  1X01 A;  5GAM g;  4YRJ A;  3MF2 A;  2I2L A;  1J5W A;  1KOG A;  1BBW A;  4PNO A;  1I5L A;  4RQF A;  4M75 D;  2DTO A;  1HTT A;  3L2Z A;  3HXZ A;  3M4G A;  4XU1 A;  2PME A;  3SWN A;  4ZTU B;  4JUV A;  2CIM A;  2DXT A;  2ZT7 A;  4XU3 A;  4TVY A;  5GAN e;  2ZNI A;  1NYQ A;  5CAI A;  4YRQ A;  3QUI A;  2DQ0 A;  3HXU A;  1I81 A;  3RER A;  1ATI A;  4M7D F;  5F5W A;  2EL9 A;  2RHS A;  3QSU A;  4P73 A;  2ZCE A;  3M4Q A;  2EJF A;  5GAN d;  5GAO m;  2VXF A;  1C0A A;  3HRI A;  4M78 D;  3PCO B;  2VXE A;  4EMG A;  3W3S A;  5E3I A;  5K1P A;  5HGQ A;  4YRE A;  4HVC A;  1EFW A;  3SB2 A;  3PGG A;  2AKW A;  2ZZE A;  3I7F A;  5LJ3 f;  1Y96 B;  4YRT A;  5GMK h;  3RKX A;  2XGT A;  3HTZ A;  3HRK A;  2Q7E A;  3JB9 J;  4K88 A;  4YRC A;  1USY A;  4A53 A;  4X9C A;  4CH4 A;  4XTW A;  2RM4 A;  2QHV A;  1L0W A;  5GAM h;  5LJ5 g;  2DJZ A;  4M7A A;  2E64 A;  4NL2 A;  4YRM A;  4C92 A;  4TVW A;  4WF2 A;  4YCV A;  1WPY A;  4M7D G;  4YP0 A;  4C8Q B;  4OLF A;  4YCW A;  1YGB A;  3QNE A;  4YDQ A;  4F7U A;  1SES A;  3REU A;  3UH0 A;  1D3B B;  4Q6G A;  4C8Q C;  2RA2 A;  4M75 E;  4XQ3 A;  2ODR D;  1ASY A;  5GMK m;  2K57 A;  2ZT8 A;  4G85 A;  4HWT A;  1LNX A;  4J5Y A;  3BY7 A;  3UGT A;  1Z7M A;  3JB9 G;  1LYL A;  2DTI A;  3VU3 C;  5LJ3 j;  4HWO A;  4XU0 A;  1WU7 A;  4YRO A;  4PJO E;  1LOJ A;  4RCC A;  4Q15 A;  2RHS B;  1KQ2 A;  2E65 A;  1LJO A;  1SRY A;  2I4L A;  4H2Y A;  3QO3 A;  2DU7 A;  4Y91 A;  4RMF A;  2DKG A;  5KNN A;  3CMQ A;  4XEO A;  4JRK A;  4M78 E;  4M75 F;  2RHQ B;  2AKW B;  3BW1 A;  4ZTZ B;  3PCO A;  3VBB A;  3HXV A;  2DVE A;  2Q5I A;  4YCU A;  2RD1 A;  4PJO F;  1H64 1;  4HWR A;  3HFO A;  5LJ5 h;  1Y96 A;  4NCX A;  3RKY A;  4P3N A;  4JLI A;  2CJ9 A;  3VQX A;  3OD1 A;  4LNS A;  1USY C;  2I4M A;  3IKL A;  4P72 C;  3QO8 A;  2CJB A;  1ADJ A;  3JCM g;  4H2U A;  2EWN A;  4M78 F;  3HXX A;  2EJ9 A;  2P5I A;  1QE0 A;  4HWP A;  1N9W A;  1BIA A;  2C8M A;  3HSB A;  3R07 A;  4BW9 A;  4O2D A;  4F7U B;  3QO5 A;  3RKW A;  2YLB A;  1NJ5 A;  2FYK A;  5GAN f;  2ARS A;  4TVA B;  5C52 B;  3HXW A;  4TQD A;  3FB9 A;  3WQZ A;  2ALY B;  2E3C A;  4P74 C;  4C8Q A;  1WNL A;  4M75 G;  4P75 A;  3RAC A;  4YRN A;  2I4O A;  5GMK e;  2FB7 A;  5GAN 6;  1D3B A;  4CH5 A;  3MF1 A;  4QVD A;  4TWA A;  2ZIO A;  4YRK A;  4XU2 A;  4PJO D;  4PJO G;  5K1X A;  1ASZ A;  2ZIM A;  1IL2 A;  2DXU A;  1X56 A;  4J6Y A;  1X2H A;  3AHU A;  5GAM e;  1E22 A;  3L4G B;  4V2S A;  4H02 A;  4CH6 A;  2E10 A;  5C53 B;  4P3O A;  1HK9 A;  1X2G A;  3P8Y A;  2DZ9 A;  2ARU A;  2DDZ A;  4M7A E;  4M78 G;  4UP7 A;  3EFR A;  5GAM d;  4C92 E;  2E41 A;  3E9I A;  5ELN A;  4NL3 A;  4YRP A;  3QO7 A;  2RHQ A;  2HNI A;  3UGQ A;  1JJC B;  4F7U E;  1BIB A;  3JCM h;  5GAN j;  1KQ1 A;  3A7U A;  5GAO p;  1E1O A;  3PZC A;  3HY0 A;  1W66 A;  3FJP A;  2ZR3 A;  4YRI A;  4P72 A;  1WQW A;  4M7A F;  1B7Y B;  5LJ3 g;  4C92 F; 
#chains in the Genus database with same CATH topology
 2YUQ A;  1UJY A;  2L3R A;  5GAN 4;  1UHC A;  3UWN A;  1E24 A;  1NZ9 A;  4UP9 A;  1OPL A;  3EFO A;  2XU8 A;  1M8M A;  1VQ4 A;  4L6V 5;  4AT1 B;  5KYW A;  4PLI A;  2F1L A;  1YHQ Q;  1P92 A;  2GNC A;  3HRS A;  4BI4 A;  4C5H A;  1PNJ A;  1WI7 A;  3CQT A;  4BWA A;  3PNW C;  1KMM A;  1UGV A;  5GJW B;  1RLQ C;  2P0Q A;  3CCE A;  3OYJ A;  2H3J A;  3TEE A;  3VYG A;  2ZGW A;  3M0R A;  1UG1 A;  4KUL A;  2ZZF A;  3DSQ A;  4TTV A;  5FRM A;  2YDL A;  1SEM A;  1G2B A;  4M7A D;  4M7A G;  2RHI A;  3H9N A;  4HT9 A;  4FT2 A;  5GAO r;  2E5Q A;  4P71 C;  1PRL C;  2JUF A;  2MAM A;  3HTR A;  4L87 A;  1K9M R;  1NJ1 A;  1JJC A;  4C0Z A;  1KD1 C;  2QAZ A;  3BJU A;  1NJI R;  2DYB A;  4M7D C;  1V29 B;  4QW2 A;  2ZPF B;  5KE3 A;  1EIY B;  1UFF A;  1JBM A;  2DMO A;  3HFV A;  4ZTJ A;  5GAN 5;  2RJD A;  4O5V A;  1EFN A;  3PTA A;  2HSP A;  2GCX A;  2EKH A;  3M5A A;  2RB6 A;  3CC7 Q;  3JCM Q;  3JB9 I;  1K0X A;  1TUC A;  4X34 A;  2FZK B;  2RNA A;  3JCM e;  5FLX E;  1EVK A;  2RQT A;  1M4Z A;  3MPU B;  4UP8 A;  5GAN g;  3CCV A;  3JCM d;  2LX7 A;  2LDM A;  2CP5 A;  3J80 E;  2AK5 A;  1HC7 A;  5D6X A;  2LCL A;  3ZEH A;  2DZC A;  4DEX A;  3A5Z A;  1KC8 R;  2IY5 B;  4RCB A;  3OYD A;  2HCK A;  5IHN A;  1SSF A;  3KFU A;  2XTI A;  4Q5W A;  1B70 A;  2FEI A;  2ENM A;  4Y92 A;  2DL8 A;  1YHQ T;  4C8Q D;  4C8Q G;  4YRL A;  2O2O A;  1B34 B;  5GAM j;  2EYQ A;  4N0A A;  3TQ7 P;  3JCM W;  3C95 A;  2KYB A;  1TUD A;  3TEH B;  1UUE A;  1LVK A;  3M0S A;  5AT1 B;  3CCJ A;  4J9F A;  2FPD A;  4H2X A;  2MIO A;  2QGF B;  3OYN A;  3ZL7 C;  1OU8 A;  1Q82 U;  2HD0 A;  4FSX A;  4BB7 A;  1BB9 A;  1FMV A;  4PJO B;  1WFW A;  1BKB A;  1X27 A;  1V1C A;  3BFM A;  3CPW S;  2PQW A;  4A63 B;  4H2W A;  4R0K A;  3NFC A;  4BE0 A;  4JDS A;  1OQK A;  5C0M A;  5DLQ E;  5IT9 E;  3REB B;  2JMA A;  3G7Z A;  4M78 B;  4KR2 A;  3RL6 A;  1TG0 A;  2C06 A;  2LNV A;  2H8H A;  5GAN 2;  3V7C A;  3JB9 H;  4M7D D;  3BDU A;  1KJW A;  1WHH A;  1SRM A;  5GAO l;  1RI0 A;  1VYU A;  2P84 A;  5FU7 B;  2LC4 A;  4EO4 A;  5A0D A;  1QF6 A;  3JRZ A;  4PHC A;  3X20 B;  2OTL A;  2A0F B;  4NS5 A;  4TQF A;  3PVL A;  3CCU A;  3IKM B;  3CC7 T;  4J6X A;  1YJW Q;  1PYS A;  1JRI A;  2CP2 A;  3VYH B;  3LWI A;  1SET A;  1U06 A;  1GCQ A;  5C6S A;  2PVG B;  1AZE A;  4FL6 A;  3TEG A;  1WJQ A;  4AH6 A;  1UE9 A;  4P73 C;  1CSK A;  4J15 A;  4CS2 A;  3A8M B;  5IAY A;  2QHU A;  4PFO A;  3OYK A;  2A37 A;  3LX7 A;  2DL4 A;  2ZIN A;  1MV0 B;  3OYE A;  3VQW A;  4M75 A;  3LGL A;  1MUZ A;  1WQ7 A;  2DEQ A;  2KXD A;  1BCM A;  4GY5 A;  1WXT A;  1M2V B;  3CD6 A;  2JNG A;  4KR3 A;  1R8O B;  4JZ3 A;  1MV3 A;  4F16 A;  3NTI A;  5I21 A;  3V8K A;  4LVI A;  1S1N A;  5DM7 R;  2DER A;  4M7A B;  4JJC A;  1K73 C;  3QXE B;  2PZ1 A;  2ZZG A;  4OB2 B;  2VC8 A;  1YFR A;  2E5A A;  1Y71 A;  1NJ8 A;  3RES A;  2ZPI B;  2SEM A;  2DF6 A;  1RAG B;  3MO8 A;  5GAM g;  4YRJ A;  3MKD A;  3CCL Q;  1KOG A;  2I2L A;  1ABQ A;  1VQL Q;  1I5L A;  2DTO A;  3M4G A;  4ZTU B;  3C94 A;  2O88 A;  9ATC B;  1OU9 A;  2QGG A;  4LDY A;  1NPR A;  2YUP A;  1Q95 G;  3OMG A;  4XU3 A;  1VQ7 Q;  4DOV A;  1K8A U;  2ZNI A;  5CAI A;  3QUI A;  2DQ0 A;  3HXU A;  1QVP A;  2ED0 A;  1GCQ C;  4ZGD B;  4IUV A;  4RUG A;  2EL9 A;  4LVL A;  4OB1 B;  2ZCE A;  1VQO A;  3SFM A;  4J83 A;  2CYZ B;  1YBY A;  1KIK A;  3PCO B;  4EMG A;  1RL2 A;  3CEY A;  1AVZ C;  2P0K A;  2K5L A;  3A8H B;  3S3N A;  4HVC A;  1EFW A;  2GQI A;  1XOV A;  3SB2 A;  2EKO A;  3CBM A;  2ZCF B;  2AKW A;  4K11 A;  4A4E A;  3I7F A;  1XQH A;  2JTM A;  4E7L A;  1VIF A;  3UAT A;  2XGT A;  2HZY A;  3CPW A;  1I0C A;  1MMD A;  3M57 A;  1YI2 A;  2EGA A;  4GLM A;  2EYW A;  4LUD A;  4A53 A;  5KE2 A;  4XTW A;  5CR2 A;  2QHV A;  1YJW T;  2K5F A;  5J3B A;  2P0P A;  2E64 A;  1S72 A;  4C92 A;  1QWE A;  3H6Z A;  4TVW A;  4IUR A;  4C8Q B;  4OLF A;  1PRM C;  2KYM A;  4LVJ A;  1I1J A;  2RA2 A;  4XAX B;  1GRI A;  4E7K A;  4A4H A;  2ZT8 A;  3OS2 A;  2CP0 A;  3BY7 A;  1AWW A;  3UGT A;  1K4U S;  4E7Z A;  2AT1 B;  4RTU A;  1LOJ A;  3N5B B;  2EYY A;  2RHS B;  1KQ2 A;  1I5O B;  1GFC A;  2OTJ A;  1VA7 A;  1WHL A;  2DLP A;  4H2Y A;  2DU7 A;  4Y91 A;  1VUB A;  4RMF A;  2ED1 A;  2KQW A;  4XEO A;  4KUI A;  1IHV A;  1UGS B;  2CS7 A;  4J9B A;  2RHQ B;  1X69 A;  3BW1 A;  4ESR A;  4HCC A;  3G4S Q;  4CC4 B;  1NEG A;  3TU4 K;  3OBW A;  3C12 A;  8AT1 B;  1YIT Q;  3CCL T;  1Y7X A;  2A8E A;  2YUO A;  1VQL T;  1UEB A;  3OS5 A;  3UPU A;  4CC7 A;  1Y96 A;  2EW3 A;  1PD1 A;  1UGR B;  2LJ3 A;  4LE9 A;  3VQX A;  2DK3 A;  4LXC A;  4LNS A;  2FZG B;  3IKL A;  4RKU E;  1VQ7 T;  2CJB A;  4JZ4 A;  2B8A A;  1T3S A;  4R55 A;  2QQA A;  2RJE A;  1M90 U;  2C8M A;  1BIA A;  2BZY A;  3HSB A;  4F7U B;  1YWP A;  3QO5 A;  2DL7 A;  4QKU A;  5L23 A;  1ZUY A;  2KAF A;  2DVJ A;  1VQ9 Q;  2KK4 A;  1PG5 B;  3WQZ A;  1OOT A;  1QW1 A;  4M75 G;  1DJ7 B;  1JJ2 S;  1D1B A;  1IRX A;  4RTZ A;  4TWA A;  1W2B S;  1RUW A;  1WIE A;  4ELZ C;  3X25 B;  5K1X A;  3M53 A;  1X56 A;  3CBO A;  5CQX A;  1W70 A;  1RAD B;  3AHU A;  1X2H A;  1E22 A;  4HKE A;  3EG3 A;  2KBT A;  2E10 A;  1HK9 A;  5KYX A;  3I56 Q;  3RNJ A;  4II1 A;  2COY A;  1QKW A;  2F2W A;  3EFR A;  3CME A;  4FU6 A;  2MK5 A;  2E41 A;  2QQ9 A;  1VQ8 Q;  2DM1 A;  1Q81 U;  2MCN A;  3S6W A;  2NS6 A;  1JJC B;  4F7U E;  2XD0 A;  3I55 A;  4IUU A;  2F5T X;  3EGD A;  1FWZ A;  1N5Z A;  3MHX A;  2A08 A;  2L89 A;  3FJP A;  2CP7 A;  4YRI A;  2C0O A;  2OAU A;  1ZQ1 A;  1Q82 C;  4KRT A;  1VQK Q;  2KY9 A;  3CPW P;  3F70 A;  4FW1 A;  2YSQ A;  2I4N A;  1VQ6 Q;  1M2O A;  3ME9 A;  3OW2 S;  3LW5 E;  3TSW A;  4F7U F;  1SF9 A;  1ZBJ A;  4RTY A;  1H8K A;  1RAH B;  4CRI A;  4P74 A;  3G4S T;  4TVA A;  3HFN A;  1LPL A;  1YIT T;  2ALY A;  3M9Q A;  2CSI A;  5J26 A;  1NNH A;  2QEX Q;  3V8L A;  1WXB A;  1VQ5 A;  1EQR A;  1OI1 A;  3TVT A;  3RGL A;  4XK8 E;  4OMQ A;  2CGH A;  1YB3 A;  2JOY A;  4RG2 A;  4YPF A;  2EBP A;  2CSQ A;  1IXD A;  3A8G B;  4C92 D;  4C92 G;  3HPW A;  1B70 B;  1N9S A;  1M5Q 1;  5HK0 A;  2JM9 A;  2ZPB B;  2LZ6 B;  3PIP A;  1SG5 A;  2DXC A;  2JS0 A;  2K7A A;  4J8O A;  1N8R R;  1VQ9 T;  1ADY A;  3HHT B;  2NLU A;  2ZNJ A;  5EC7 A;  3OBY A;  2KXC A;  1C1A A;  1YP5 A;  1KSW A;  4MML A;  4H2X B;  2O01 E;  4RTV A;  3G71 Q;  1G8X A;  4QT7 A;  4M4Z A;  5GMK i;  4E6R A;  2GFU A;  3TCJ A;  5IHK A;  3DKM A;  1Q7Y U;  4FT4 A;  4O6J A;  1FX7 A;  5A2Q E;  2Y4X A;  4MDX A;  1Q86 R;  2CUD A;  3I56 T;  3OQ5 A;  3NET A;  3GF5 A;  4EMK B;  4M77 B;  2WSF E;  1VQ8 T;  1YFN A;  3L42 A;  1ZUU A;  1G5V A;  1JJ2 A;  2CH4 A;  2XK0 A;  2YRV A;  3CCS Q;  3HFZ A;  2LMJ A;  4DBQ A;  1NLP C;  1W2B A;  1ZA2 B;  3RUX A;  2OAW A;  2BZ8 A;  4UPA A;  1IHW A;  1M1K R;  1Z9Q A;  4OP0 A;  3M54 A;  2E1H A;  3QYH B;  1IGQ A;  1QCO A;  1YJ9 Q;  3OS1 A;  1YJN Q;  1VQK T;  3X26 B;  1AOJ A;  1K8A C;  1M1G A;  1FXX A;  1PYS B;  1VQ6 T;  4DBR A;  1MGQ A;  3CXC S;  5I22 A;  4P71 A;  2Q5H A;  2DET A;  4C0D B;  3G6E A;  5FRO A;  4L59 A;  3JCM V;  4BDZ A;  4J6W A;  3VS5 A;  4YRG A;  2FO0 A;  1WJR A;  4TVR A;  4X5O A;  4CS3 A;  2DPP B;  1YCS B;  4M77 E;  1NYR A;  1QCN A;  1X6G A;  1SHG A;  4D8K A;  4M7D A;  2BKD N;  3H0I A;  1B3Q A;  2FG0 A;  2QEX T;  4M75 B;  2BIV A;  4VUB A;  2ZXF A;  1HSQ A;  4HCK A;  5LJ5 f;  3V7S A;  5KYU A;  2FRY A;  3OW2 A;  5CKH A;  4AFU C;  1X54 A;  1E1T A;  3EFS A;  2FZC B;  4Z8A A;  5AYF A;  1RAC B;  4M77 F;  2JN0 A;  4L5G A;  4OGE A;  5FWC A;  4D8D A;  3OYL A;  4AG1 C;  8ATC B;  3OYH A;  5LL6 S;  1I07 A;  2X51 A;  3RR6 A;  4P3P A;  3VUB A;  1FYF A;  3JCM c;  2AMC A;  4CH3 A;  4CI0 C;  3JAM E;  1U3O A;  3G71 T;  5GAN 3;  1PKT A;  2DYI A;  4RTW A;  4XEM A;  2D9T A;  1R0B G;  4RQE A;  2HKQ B;  1H4Q A;  3A5Y A;  2L3Q A;  3SWN C;  3QDF A;  3CC2 Q;  4IUP A;  1H4T A;  3JB9 D;  1ZSZ A;  2JTF A;  2FVU A;  1U1S A;  2M16 A;  3EG2 A;  3URG A;  3P8V A;  2VYT A;  2QXF A;  5GAN 7;  1K1Z A;  3OYG A;  1Y57 A;  2DL3 A;  3UDC A;  2LNH B;  3CCS T;  1KHI A;  3FRN A;  1PSF A;  4FW2 A;  4XTU A;  1H3Z A;  3V8J A;  1QKX A;  4Z02 A;  1YCY A;  2Y4Y A;  7AT1 B;  1ZA1 B;  4JJD A;  2QA4 Q;  4HT8 A;  4LDW A;  2PMF A;  5HCK A;  1YJ9 T;  1YJN T;  1ZSG A;  3JV3 A;  3IG2 A;  2PTK A;  2QQB A;  3INZ A;  3G1J A;  1UGP B;  2CDT A;  1M90 C;  2KVQ G;  2AKK A;  3VS1 A;  3WXM B;  1OPK A;  2CJA A;  4H2S A;  1KFZ A;  4C92 B;  1ABO A;  5KCH A;  3QWY A;  2HBP A;  2CUB A;  1G51 A;  1B7T A;  4X1V A;  4FM4 B;  2KE9 A;  1JJ2 P;  3GIB A;  2E5K A;  4BDY A;  4J9C A;  1X01 A;  2EYX A;  3VS0 A;  2E70 A;  1W2B P;  1D0Y A;  1PM3 A;  4RQF A;  2LRQ A;  2IG0 A;  1YHQ A;  2A28 A;  1BK2 A;  3E1S A;  3CC4 Q;  2DXT A;  3HL8 A;  1ZSZ C;  2QI2 A;  3CXC A;  1VQP A;  1QWF A;  3MEW A;  2K79 A;  2HMA A;  3L2Q A;  2DRM A;  2JS2 A;  2D8H A;  2BUD A;  3RER A;  3EAE A;  4P73 A;  2GBQ A;  3M4Q A;  1OUL A;  3QJY A;  5GAO m;  2VXF A;  3HRI A;  2E6Z A;  5KYY A;  1Q81 C;  2VXE A;  5E3I A;  2EVR A;  1X2Q A;  4QQD A;  1NJI U;  1BBZ A;  3PGG A;  1RLP C;  5LJ3 f;  1Y96 B;  2RHZ A;  1G83 A;  3S3O A;  5GMK h;  2DBM A;  2RHY A;  2CT3 A;  3HRK A;  2ROL A;  1QVF S;  3CC2 T;  4YRC A;  3OSS C;  1UB4 A;  2GF7 A;  3H0F A;  1D0X A;  2RQV A;  4RMO A;  2RM4 A;  1L0W A;  1TOV A;  1G3W A;  2XDD A;  2MOX A;  5M9O A;  3OB9 A;  1W4S A;  2LCS A;  4WTO B;  4YCV A;  4BUG A;  3OYM A;  4M7D G;  2L2P A;  4HVU A;  4QQG A;  1YIJ Q;  4YCW A;  4YDQ A;  2JMC A;  2G6F X;  3EH2 A;  3REU A;  3DB4 A;  4Q6G A;  2JW4 A;  5GMK m;  3OYB A;  3OMC A;  4G85 A;  4J5Y A;  3ZFJ A;  3SDZ A;  1VQM Q;  1Z7M A;  2QA4 T;  1LYL A;  3VU3 C;  1PHT A;  1WU7 A;  4PJO E;  1KC8 U;  1GL5 A;  4RCC A;  2J6F A;  5KYX B;  4JLG A;  1SRY A;  3PMI A;  3QO3 A;  3CCM Q;  1VIE A;  4E2F B;  2DKG A;  3CMQ A;  4M78 E;  3EGX A;  1PSE A;  2R5M A;  2HQH A;  2DIL A;  4Y28 E;  2JM8 A;  1NM7 A;  3CPF A;  3HXV A;  1IO6 A;  5FWB A;  3BDL A;  3EGD B;  2COW A;  1WX6 A;  2O9V A;  2ZPE B;  4PJO F;  4HWR A;  5LJ5 h;  2LQ8 A;  4NCX A;  3CC4 T;  5A0L A;  1YN8 A;  2A3L A;  2I4M A;  3FEO A;  1G3T A;  1Q7Y C;  3JCM g;  4M78 F;  4PJM A;  1WZO A;  2P5I A;  5DLO A;  4HWP A;  3MCA B;  2D8J A;  4BW9 A;  1OX9 A;  4YTL A;  2QK0 A;  4OMM A;  5GAN f;  4JS4 A;  2ARS A;  4TVA B;  1X75 C;  2HSE B;  2ZZD A;  3HXW A;  4LUE A;  2V8J A;  2ALY B;  2E3C A;  4P75 A;  3EHQ A;  3RAC A;  4YRN A;  2LT1 A;  5GMK e;  2FB7 A;  5GAN 6;  4CH5 A;  4J7F A;  3LYI A;  4QVD A;  2ZIO A;  2DD4 A;  4YRK A;  2CZ7 B;  2GFA A;  2KI7 A;  2DXU A;  4J9I A;  4BY6 C;  1BI1 A;  4BE1 A;  2M1H A;  4H02 A;  4JRQ A;  3CXC P;  2XDB A;  1MMA A;  4P3O A;  2HQX A;  4MDW A;  4J9G A;  3HRU A;  3P8Y A;  2DDZ A;  4M7A E;  2K9G A;  2J05 A;  2YRC A;  3ASK A;  3E9I A;  2WAC A;  1VQN Q;  5FU6 B;  5ELN A;  3I35 A;  1RAI B;  3LWH A;  2RHX A;  2M9U A;  2DRK A;  2HNI A;  3UGQ A;  1YIJ T;  2HKN A;  2M0O A;  1AWX A;  1BIB A;  1YJW A;  1KQ1 A;  2X35 A;  5GAO p;  3GOX A;  1KD1 R;  2X3W D;  3PZC A;  2X4J A;  5FRN A;  2VKN A;  1QVF A;  4F17 A;  1VQM T;  4WCI A;  2ZR3 A;  4KGX B;  2HEQ A;  1X6O A;  1WQW A;  1GBQ A;  2KRS A;  4M7A F;  2EPD A;  4J9E A;  1AT1 B;  1C0M A;  2IPO B;  3RF1 A;  1YNZ A;  3MEY A;  3CCM T;  1PC0 A;  2YHT A;  3IQL A;  2BE9 B;  2JT4 A;  4A4F A;  4DBH A;  1KQS S;  2XKO C;  3J81 E;  1Y07 A;  3HFZ B;  4DOW A;  3E9H A;  4P75 C;  2KDS A;  5LJ5 e;  3EHR A;  1I8F A;  1ZUK A;  1UTI A;  2B86 A;  2KGT A;  3UFG A;  1MHN A;  4HA8 A;  3WVE B;  1GXI E;  1TTH B;  4PJL A;  2LQN A;  3M58 A;  3L4G A;  3CCL A;  1VQL A;  3NEN A;  2PNI A;  1WHM A;  3AT1 B;  5I2M A;  5KYN A;  2IY5 A;  2KR3 A;  1G5H A;  1OYX A;  1VQ7 A;  3DB3 A;  4C8Q E;  2F5K A;  4N4G A;  1G3S A;  4M7D B;  5LJ3 h;  1JXM A;  3QZ5 B;  2O4X A;  1NBE B;  3CCQ Q;  4CS4 A;  2SRC A;  2V1Q A;  1MNE A;  2EYZ A;  4EX5 A;  1QLY A;  1G5I A;  4BD3 A;  3VJP A;  3A7A A;  2E3H A;  2NYS A;  5KYU B;  3EFO B;  3JCM f;  2BE7 D;  2L3S A;  1B7Y A;  4PK4 A;  5KYW B;  2ODR C;  1F1B B;  1WYD A;  2V8I A;  3MJX A;  4FCY A;  2VGN A;  2PVD B;  4C8Q F;  3LSQ A;  3FLG A;  2LQW A;  1N9R A;  4XTY A;  1ZLM A;  1VQN T;  5GAM f;  3M55 A;  1SER A;  3VQY A;  2DQ3 A;  4ZTF A;  2W10 A;  1SRL A;  5CKD A;  5ELO A;  1RIQ A;  5IXB A;  2AMC B;  1K9A A;  2K3Y A;  1OEB A;  1K76 A;  2C7I A;  3C4S A;  2FPE A;  1CKA A;  2KT1 A;  3QHS A;  3L2W A;  3QII A;  5D6Y A;  3EGU A;  1NJ2 A;  4YRS A;  1QQJ A;  2E3I A;  2DXB A;  4JS5 A;  5GAN 8;  3OYI A;  3RMQ A;  2LTO A;  3VS6 A;  3REX A;  2KRO A;  3QDR B;  5IN1 A;  2KEA A;  1ACM B;  1EX4 A;  2EJG A;  5C51 B;  4HVV A;  1QVG S;  4XTV A;  2JXB A;  2YLC A;  3CMA Q;  3SHW A;  2R58 A;  1NJI C;  5KCO A;  1W6X A;  3A98 A;  4AG2 C;  1U5S A;  4G84 A;  4A4K A;  4HWS A;  3NPF A;  1QVF P;  1AWO A;  2ZT6 A;  2J3M A;  3G4S A;  3NEM A;  3HP9 A;  2FHD A;  2VAS A;  2RK1 A;  1IRE B;  1YIT A;  5GAO n;  3ERR A;  3CCR Q;  1U1T A;  3MP6 A;  4PJO C;  1KQS A;  3U23 A;  4PL6 A;  4PFP A;  5GAN h;  2QTX A;  3M56 A;  1PD0 A;  5CIU A;  2OJ2 A;  1K73 R;  5FW9 A;  1BBU A;  5LJ3 e;  4B9X A;  2J06 A;  4JPB W;  1TS9 A;  1WHK A;  3EG1 A;  3G1Z A;  4M78 C;  4ZIB A;  3M0P A;  3CCQ T;  3JCM b;  4E7J A;  3JCM X;  3R6O A;  3LH5 A;  5LJ3 d;  1AHJ B;  4A54 A;  5DY9 A;  4MMK A;  2Y90 A;  4ME7 A;  3A5Z B;  3HXY A;  4QVC A;  2K2M A;  3VRY A;  3QG1 A;  2GQV A;  1KC8 C;  3M0T A;  5FU7 C;  1Z9Z A;  3DLL A;  4LDV A;  3VQV A;  3MEV A;  2DO3 A;  2LVM A;  2MPX C;  2DL5 A;  1MMN A;  1GBR A;  2FPF A;  3V7R A;  2IVW A;  1BCO A;  3A1P A;  1I4K 1;  2W0Z A;  4XTZ A;  3E19 A;  3EH1 A;  2RF0 A;  3E9F A;  11AS A;  3I56 A;  3M4P A;  2CH4 W;  1H4S A;  3PIO A;  2ROT A;  3H8Z A;  2ART A;  3A32 A;  1VQ8 A;  1VQ4 Q;  2G4C A;  1BI3 A;  3LH0 A;  2YRD A;  4N4H A;  1D09 B;  1X2K A;  1BI2 A;  2XG8 D;  4KQE A;  2WSC E;  4H2T A;  1B07 A;  3CCE Q;  4CC3 A;  2YUN A;  2XDP A;  2XID A;  4M7A C;  1VQK A;  2QAS A;  4BI3 A;  3UA6 A;  3NMZ C;  4K86 A;  1XTD A;  2L0A A;  3CMA T;  1YWO A;  1Z7N A;  3OYC A;  4IUT A;  1VQ6 A;  3MF2 A;  1J5W A;  2YT6 A;  3T9N A;  4A4G A;  2CKK A;  3HXZ A;  3I9Q A;  3GBQ A;  3SWN A;  2LP5 A;  2RI5 A;  4DBF A;  1FMK A;  2BZX A;  5GAN e;  1BYM A;  1H3H A;  3CCR T;  4C0F A;  1C6V X;  4YRQ A;  1BU1 A;  1I81 A;  2CT4 A;  3LGF A;  2RHS A;  1QVG A;  2DD5 A;  2EJF A;  1LCK A;  5GAN d;  1N8R U;  1JEG A;  4M78 D;  2PUK B;  2O31 A;  4GBQ A;  2ZAE A;  5HGQ A;  4YRE A;  4LVM A;  3QBY A;  4UC4 A;  1AEY A;  2PU9 B;  3E2U A;  3J7A F;  3OYF A;  3HTZ A;  2Q7E A;  3JB9 J;  4K88 A;  3H0H A;  3GP8 A;  2D6F A;  1Q86 U;  1OZ3 A;  4CH4 A;  5GAM h;  3G71 A;  1KQS P;  2K2V A;  3CCV Q;  4IIO A;  4YRM A;  3UT1 A;  1CKB A;  3M0Q A;  3KFV A;  1WPY A;  3NGP A;  4YP0 A;  1OZ2 A;  4E7H A;  3QNE A;  5ECA A;  4F7U A;  1SES A;  3UH0 A;  4C8Q C;  4M75 E;  1M1K U;  3VS2 A;  4PLL A;  2K57 A;  1VQP Q;  1LNX A;  3UF4 A;  1VQ4 T;  1VYV A;  1RAE B;  3JB9 G;  4KGV B;  3CCS A;  4FIB A;  2DTI A;  4XU0 A;  4YRO A;  2BTT A;  3OYY A;  4OMP A;  3PMT A;  3I5R A;  2E65 A;  4LNP A;  2DJQ A;  4LDX A;  2I4L A;  3CCE T;  5I11 A;  1OV3 A;  1PWT A;  5KNN A;  2E12 A;  3RMS A;  1VYT A;  1QCF A;  4JRK A;  3CCJ Q;  2EFI A;  1YJ9 A;  1YJN A;  2FRW A;  2EGC A;  4M75 F;  4ANJ A;  5HK3 A;  2AKW B;  1WHG A;  2L3P A;  4LDU A;  4ZTZ B;  1K0S A;  5A0G A;  1G3Y A;  4EPC A;  3VBB A;  2ECZ A;  3C0C A;  3X24 B;  1JB0 E;  5GJV B;  4AFQ C;  4YCU A;  2RD1 A;  3PE0 A;  3EG9 A;  2G3R A;  2NUP A;  2K6D A;  3QKJ A;  3RKY A;  4P5N A;  2CJ9 A;  2EQM A;  3OD1 A;  3TSZ A;  4P72 C;  4J9D A;  2FL7 A;  4J7I A;  2CZ6 B;  5HKC A;  1Q82 R;  3QO8 A;  4H2U A;  3HXX A;  2MYS A;  3H41 A;  4O2D A;  5J39 A;  2X9H A;  3GNG A;  3RKW A;  2IIM A;  3TRE A;  1NJ5 A;  2FYK A;  1EZZ B;  2J7I A;  4C5I A;  5D6W A;  4OMN A;  4TQD A;  4HVW A;  3FB9 A;  2GGR A;  4AFZ C;  1E6H A;  2OTL Q;  2I4O A;  1TUG B;  1D3B A;  4ELY C;  3OYA A;  4IKF A;  3MF1 A;  4ZN1 A;  2D1X A;  4BI8 B;  3CCU Q;  4BAC A;  2O9S A;  4ORZ A;  4QQ6 A;  4XU2 A;  3MEU A;  1ASZ A;  1M3C A;  2ZIM A;  5CQY A;  1IL2 A;  2MWO A;  1D1A A;  4J6Y A;  1JXO A;  5GAM e;  3L4G B;  4CH6 A;  2EQJ A;  2RH2 A;  2NUT A;  1K9M U;  2RHU A;  4RG8 A;  2DZ9 A;  3CCV T;  2QTV A;  1W1F A;  2K4Y A;  4UP7 A;  3RBB B;  5GAM d;  4C92 E;  1QVG P;  1MND A;  3CC2 A;  3QO7 A;  2AIR B;  2DBK A;  3L2U A;  3CD6 Q;  2O4X B;  2YWW A;  4OGC A;  3A7U A;  4C5G A;  2VWF A;  1E1O A;  3ULR B;  1VQP T;  4MZT A;  3HY0 A;  1M1F A;  4OML A;  1QP3 A;  1OX8 A;  2DIQ A;  3OW2 P;  2RO0 A;  2EQK A;  1TWB A;  1B7Y B;  2JZ2 A;  5L8R E;  4C92 F;  2F2X A;  1EVL A;  3X28 B;  1WLE A;  1M27 C;  2DAQ A;  2ZPH B;  4LD6 A;  4LVK A;  3LSS A;  5CVI A;  1WHJ A;  2QA4 A;  3CCJ T;  4DQ2 A;  3CC7 A;  3FIF A;  1NE8 A;  2RI3 A;  3A74 A;  4EMK A;  1ZBX A;  4M77 A;  2JJ9 A;  3VUZ A;  2QHT A;  2EIF A;  4PKC C;  5D7U A;  3IAL A;  3M4Y A;  1WA7 A;  1GGM A;  2QHS A;  3D7S B;  1NYG A;  12AS A;  1VQO Q;  4QVZ A;  4DPG A;  4OB3 B;  2C0T A;  1RAF B;  4HCZ A;  2MWP A;  4MZP A;  2E6N A;  1K8A R;  2QQR A;  4DEY A;  4IIM A;  3QPH A;  2P4R A;  3NTK A;  2DNU A;  3THK A;  1RAA B;  2QDL A;  3CC4 A;  2P4T A;  2ZT5 A;  4F7U G;  3A7R A;  2AKL A;  2K3X A;  1X55 A;  2Q7H A;  2DIG A;  3LLR A;  2F2V A;  2OTL T;  2HDA A;  3VS4 A;  1YI2 Q;  1KHC A;  3CCU T;  4B9W A;  4N0A C;  2DTH A;  4ATO A;  4YYE A;  4WI1 A;  1S72 Q;  2D0N A;  2RJC A;  2DU5 A;  4KH1 B;  2VUB A;  3P8B B;  1AZG B;  2LX9 A;  4B6M A;  2EQI A;  4OF1 A;  3EG0 A;  1H4V B;  2RQU A;  4GLK A;  1YFT A;  4OB0 B;  5GMK l;  3KUF A;  2RQR A;  4PFZ A;  4EMK C;  4M77 C;  2EQU A;  2LT4 A;  2QQS A;  3FJ5 A;  1HJD A;  3CD6 T;  1TH7 A;  5GAO q;  3UA7 A;  2COZ A;  2OTJ Q;  1IB8 A;  5IH2 A;  3RIR A;  2X4W A;  6AT1 B;  1WXU A;  3MP1 A;  2J6O A;  1T3L A;  4EIK A;  1YIJ A;  3Q1J A;  1B8A A;  3M59 A;  2MMP A;  4E51 A;  2DX1 A;  5GMK j;  2EAY A;  3QYG B;  2CP3 A;  5I2S A;  1VQM A;  4H2V A;  4YRF A;  2M51 A;  4MZM A;  4C5E A;  1ZX6 A;  1GFD A;  1KG1 A;  1N8R C;  3QJ6 A;  1M8V A;  4C0D C;  2HL5 C;  1X6B A;  1WDX A;  1HD3 A;  2X3X D;  2GTO A;  4X9D A;  3FDR A;  4ZGE B;  1VQZ A;  3CCM A;  2L8D A;  2Q7G A;  4CC2 A;  3GPL A;  1E7O A;  3CBP A;  4M75 C;  3O8V A;  1VQO T;  5CCA A;  3JB9 F;  1EIY A;  1KMN A;  2KSS A;  4KT0 E;  1NYF A;  3NHN A;  1WYX A;  3SD4 A;  1Q86 C;  2XI9 A;  3I5S A;  1Y0M A;  1D1C A;  4WJ4 A;  1N27 A;  1SHF A;  1IZ6 A;  4PJN A;  3A31 A;  1QMC A;  2C0I A;  1M90 R;  2P0L A;  2CZ0 B;  1D0Z A;  1A0N B;  3LC0 A;  4YRR A;  3JCM J;  1NG2 A;  3FC3 A;  1M9S A;  3HRT A;  3JCM P;  2J6K A;  2KNB B;  1YI2 T;  3VKI A;  5LJ5 d;  4RDX A;  3MEA A;  1RAB B;  1M1K C;  4LD9 K;  3SWN B;  3CME Q;  1S72 T;  2RK2 A;  2Z0W A;  2K3B A;  2ZR2 A;  2LJ0 A;  4OVA A;  2ZTG A;  3HY1 A;  1AWJ A;  1JU5 C;  3NTH A;  1HYO A;  3P8T A;  2DA9 A;  5LJ5 j;  4NOY A;  4JRI A;  4R56 A;  3I55 Q;  1TXQ A;  4WJ3 M;  3HKS A;  5EG2 A;  3KXT A;  1M3B A;  4M77 D;  4M77 G;  3L2V A;  1NEB A;  4K87 A;  2OX7 A;  4XTX A;  3M0U A;  1EOV A;  1Q81 R;  1B34 A;  3NEL A;  4EDU A;  1KD1 U;  1WLP B;  2OTJ T;  2NUZ A;  2JVV A;  3L1A A;  3QZ9 B;  1WGS A;  3TEH A;  1VQN A;  1B76 A;  2HAX A;  1RI9 A;  4FYX B;  4KH0 B;  2J3L A;  1SPK A;  5HY6 A;  3ICA A;  4PG3 A;  1O75 A;  3VRZ A;  4PJO A;  5CKB A;  4ZN3 A;  3A8L B;  2RI2 A;  4RTT A;  1E6G A;  2CRE A;  1SKU B;  4EMH A;  1YFS A;  2WSE E;  1VQ5 Q;  1NJ6 A;  4M78 A;  2MF2 A;  1QP2 A;  4AFS C;  2XHC A;  4C92 C;  1NLO C;  1HXD A;  2R57 A;  3QTC A;  4FYV B;  4M7D E;  4C0G A;  3TUP A;  3BE3 A;  2HL3 A;  2F69 A;  1GCP A;  1N6A A;  4JJB A;  2CP6 A;  5IHI A;  1BBW A;  4PNO A;  1XJW B;  2LQK A;  5IXF A;  4M75 D;  1HTT A;  1ZSZ B;  3L2Z A;  4E47 A;  4XU1 A;  2PME A;  4JUV A;  1FMW A;  2PUO B;  5KH6 A;  2CIM A;  2ZT7 A;  4OMF B;  4OMO A;  4KUD K;  2RPN A;  4TVY A;  2ESW A;  3REA B;  2ABL A;  4FSS A;  1NYQ A;  2KRN A;  1K9M C;  1AD5 A;  1ATI A;  3SEM A;  2DE0 X;  4M7D F;  5F5W A;  4PJJ A;  3RDV A;  3VS7 A;  3QSU A;  3PT9 A;  5CKE A;  1T0J A;  2VVK A;  1C0A A;  4FYW B;  1KK7 A;  4JJN K;  4HT4 A;  4ZNX A;  3W3S A;  5K1P A;  4JRP A;  4LN2 A;  4N4I A;  3EG9 B;  2ZZE A;  2AZS A;  4BE2 A;  4E7I A;  1UHF A;  2NUP B;  2E4H A;  1M30 A;  4YRT A;  3CME T;  2RMO A;  2AHJ B;  3RKX A;  3OY9 A;  1UGQ B;  2VV5 A;  3A8O B;  4HCB A;  2DEU A;  1M2V A;  4Z89 A;  1USY A;  3CCQ A;  3MP8 A;  2JTE A;  4FYY B;  4X9C A;  1Q7Y R;  1SSH A;  4IUQ A;  1UEC A;  2X4Y A;  5LJ5 g;  2NWM A;  3I55 T;  1J3T A;  1M3A A;  3E9G A;  2DJZ A;  4M7A A;  4NL2 A;  3PFS A;  4WF2 A;  4DA4 A;  2H3E B;  2I0N A;  1YGB A;  1JO8 A;  1D3B B;  1T0H A;  1ZHI A;  1BI0 A;  4XQ3 A;  2ODR D;  1ASY A;  1VQ9 A;  4HWT A;  3KBG A;  2VGM A;  3G6E Q;  4F04 B;  5LJ3 j;  4HWO A;  3GNF B;  2M0Y A;  4Q15 A;  2ATC B;  2NUT B;  2R5A A;  2LJ1 A;  1LJO A;  1V76 A;  3L2R A;  5KYY B;  2KT8 A;  1VQ5 T;  4KGZ B;  3VS3 A;  3PCO A;  4RTX A;  2KMT A;  3R6N A;  1TU0 B;  2QDY B;  2DVE A;  2QYZ A;  5CO7 A;  2Q5I A;  2A7Y A;  2MI6 A;  1H64 1;  1IGU A;  1UDL A;  3HFO A;  1WJS A;  4D6W A;  4P3N A;  2LCC A;  4JLI A;  2A36 A;  1EIF A;  1ARK A;  1PKS A;  1USY C;  3ZBD A;  3PVQ A;  3CMA A;  1UJ0 A;  2GTJ A;  1ADJ A;  2EWN A;  2EJ9 A;  2RQW A;  3O5Z A;  1QE0 A;  2KRM A;  3OS0 A;  1TSF A;  2XMF A;  1N9W A;  2V8K A;  3DLM A;  3R07 A;  1XNI A;  1K73 U;  2YLB A;  2HQE A;  1PCX A;  5C52 B;  2CZ1 B;  4J9H A;  3QWX X;  2L5Q A;  3CCR A;  2RN8 A;  4P74 C;  4C8Q A;  1WNL A;  2D0Q B;  2QG9 B;  4AMC A;  4E7S A;  1VOM A;  4BY6 B;  3WVD B;  2OI3 A;  3GLX A;  4PJO D;  4PJO G;  1H92 A;  3S3M A;  2QEX A;  1R0C B;  2XIC A;  1R77 A;  2VB6 A;  2V1R A;  3MET A;  5CK9 A;  2HBW A;  4V2S A;  4HXJ A;  3OA6 A;  3JSC A;  5C53 B;  3EGX B;  3OSV A;  3P8H A;  2YXY A;  3P8D A;  5CKF A;  1X2G A;  3ER0 A;  2ARU A;  4M78 G;  2RJF A;  2PVO B;  3MQZ A;  1JQQ A;  1O9S A;  2V26 A;  2ZPG B;  4NL3 A;  4YRP A;  2EGE A;  2RHQ A;  2AZV A;  5FU6 C;  1NPP A;  3JCM h;  5GAN j;  3VV0 A;  1X43 A;  4F14 A;  2DFU A;  2M02 A;  1FYN A;  4KBM B;  1U8R A;  4ZGJ B;  1W66 A;  3G6E T;  2X4X A;  4P72 A;  1MMG A;  4Z88 A;  2K5I A;  5LJ3 g; 
#chains in the Genus database with same CATH homology
 2L3R A;  5GAN 4;  3UWN A;  1E24 A;  1NZ9 A;  4UP9 A;  2XU8 A;  1VQ4 A;  4L6V 5;  4PLI A;  1P92 A;  3HRS A;  4BI4 A;  4C5H A;  4BWA A;  3PNW C;  1KMM A;  2P0Q A;  3CCE A;  3OYJ A;  2H3J A;  3TEE A;  3VYG A;  2ZGW A;  4KUL A;  2ZZF A;  3DSQ A;  4TTV A;  5FRM A;  4M7A D;  4M7A G;  2RHI A;  4HT9 A;  4FT2 A;  5GAO r;  2E5Q A;  4P71 C;  2JUF A;  2MAM A;  4L87 A;  1NJ1 A;  1JJC A;  4C0Z A;  1KD1 C;  3BJU A;  4M7D C;  1V29 B;  4QW2 A;  2ZPF B;  5KE3 A;  1EIY B;  1JBM A;  3HFV A;  4ZTJ A;  5GAN 5;  2RJD A;  4O5V A;  3PTA A;  2GCX A;  3M5A A;  2RB6 A;  3JCM Q;  3JB9 I;  4X34 A;  3JCM e;  5FLX E;  1EVK A;  1M4Z A;  4UP8 A;  5GAN g;  3CCV A;  3JCM d;  2LDM A;  3J80 E;  1HC7 A;  5D6X A;  2LCL A;  3ZEH A;  2DZC A;  3A5Z A;  2IY5 B;  4RCB A;  3OYD A;  1SSF A;  3KFU A;  2XTI A;  4Q5W A;  1B70 A;  1YHQ T;  4C8Q D;  4C8Q G;  4YRL A;  1B34 B;  5GAM j;  2EYQ A;  4N0A A;  3JCM W;  3C95 A;  3TEH B;  3CCJ A;  4H2X A;  3OYN A;  1Q82 U;  2HD0 A;  4FSX A;  4BB7 A;  4PJO B;  1BKB A;  3BFM A;  3CPW S;  2PQW A;  4H2W A;  3NFC A;  4BE0 A;  4JDS A;  5C0M A;  5DLQ E;  5IT9 E;  3G7Z A;  4M78 B;  4KR2 A;  3RL6 A;  2C06 A;  2LNV A;  5GAN 2;  3V7C A;  3JB9 H;  4M7D D;  3BDU A;  5GAO l;  1RI0 A;  5FU7 B;  2LC4 A;  4EO4 A;  5A0D A;  1QF6 A;  3JRZ A;  4PHC A;  3X20 B;  2OTL A;  4NS5 A;  4TQF A;  3CCU A;  3IKM B;  3CC7 T;  4J6X A;  1PYS A;  1JRI A;  3VYH B;  3LWI A;  1SET A;  5C6S A;  2PVG B;  4FL6 A;  3TEG A;  1WJQ A;  4AH6 A;  4P73 C;  4J15 A;  4CS2 A;  3A8M B;  5IAY A;  2QHU A;  3OYK A;  3LX7 A;  2ZIN A;  3OYE A;  3VQW A;  4M75 A;  3LGL A;  1WQ7 A;  2DEQ A;  4GY5 A;  3CD6 A;  2JNG A;  4KR3 A;  1R8O B;  3NTI A;  5I21 A;  3V8K A;  4LVI A;  5DM7 R;  4M7A B;  1K73 C;  3QXE B;  2ZZG A;  4OB2 B;  2VC8 A;  1YFR A;  2E5A A;  1Y71 A;  1NJ8 A;  3RES A;  2ZPI B;  3MO8 A;  5GAM g;  4YRJ A;  1KOG A;  2I2L A;  1I5L A;  2DTO A;  3M4G A;  4ZTU B;  3C94 A;  4LDY A;  1NPR A;  3OMG A;  4XU3 A;  4DOV A;  1K8A U;  2ZNI A;  5CAI A;  3QUI A;  2DQ0 A;  3HXU A;  1QVP A;  4ZGD B;  4IUV A;  2EL9 A;  4LVL A;  4OB1 B;  2ZCE A;  1VQO A;  3SFM A;  4J83 A;  2CYZ B;  1YBY A;  3PCO B;  4EMG A;  1RL2 A;  3CEY A;  2P0K A;  2K5L A;  3A8H B;  3S3N A;  4HVC A;  1EFW A;  1XOV A;  3SB2 A;  2EKO A;  3CBM A;  2ZCF B;  2AKW A;  4A4E A;  3I7F A;  1XQH A;  2JTM A;  4E7L A;  1VIF A;  2XGT A;  3CPW A;  3M57 A;  1YI2 A;  4A53 A;  5KE2 A;  4XTW A;  5CR2 A;  2QHV A;  1YJW T;  2K5F A;  5J3B A;  2P0P A;  2E64 A;  1S72 A;  4C92 A;  3H6Z A;  4TVW A;  4IUR A;  4C8Q B;  4OLF A;  4LVJ A;  2RA2 A;  4XAX B;  4E7K A;  4A4H A;  2ZT8 A;  3OS2 A;  3BY7 A;  3UGT A;  1LOJ A;  3N5B B;  2RHS B;  1KQ2 A;  2OTJ A;  4H2Y A;  2DU7 A;  4Y91 A;  1VUB A;  4RMF A;  2KQW A;  4XEO A;  4KUI A;  1UGS B;  2CS7 A;  2RHQ B;  3BW1 A;  4HCC A;  3TU4 K;  3OBW A;  3C12 A;  3CCL T;  1Y7X A;  2A8E A;  1VQL T;  1UEB A;  3OS5 A;  3UPU A;  1Y96 A;  1UGR B;  3VQX A;  2DK3 A;  4LNS A;  3IKL A;  4RKU E;  1VQ7 T;  2CJB A;  2B8A A;  4R55 A;  2QQA A;  2RJE A;  1M90 U;  2C8M A;  1BIA A;  3HSB A;  4F7U B;  3QO5 A;  2KAF A;  2KK4 A;  3WQZ A;  1QW1 A;  4M75 G;  1DJ7 B;  1JJ2 S;  4TWA A;  1W2B S;  4ELZ C;  3X25 B;  5K1X A;  3M53 A;  1X56 A;  3CBO A;  5CQX A;  1X2H A;  3AHU A;  1E22 A;  4HKE A;  2E10 A;  1HK9 A;  4II1 A;  3CME A;  3EFR A;  4FU6 A;  2E41 A;  2QQ9 A;  1Q81 U;  3S6W A;  2NS6 A;  1JJC B;  4F7U E;  2XD0 A;  3I55 A;  4IUU A;  2F5T X;  1FWZ A;  3MHX A;  2L89 A;  3FJP A;  4YRI A;  2OAU A;  1ZQ1 A;  1Q82 C;  2KY9 A;  3F70 A;  2I4N A;  3OW2 S;  3ME9 A;  3LW5 E;  4F7U F;  4CRI A;  4P74 A;  3G4S T;  4TVA A;  3HFN A;  1YIT T;  2ALY A;  3M9Q A;  5J26 A;  1NNH A;  3V8L A;  1VQ5 A;  1EQR A;  1OI1 A;  3RGL A;  4XK8 E;  2CGH A;  1YB3 A;  2JOY A;  4RG2 A;  4YPF A;  3A8G B;  4C92 D;  4C92 G;  3HPW A;  1B70 B;  1N9S A;  1M5Q 1;  5HK0 A;  2ZPB B;  3PIP A;  2DXC A;  4J8O A;  1VQ9 T;  1ADY A;  3HHT B;  2NLU A;  2ZNJ A;  3OBY A;  4MML A;  4H2X B;  2O01 E;  5GMK i;  2GFU A;  3TCJ A;  3DKM A;  1Q7Y U;  4FT4 A;  4O6J A;  1FX7 A;  5A2Q E;  2Y4X A;  4MDX A;  3I56 T;  3OQ5 A;  3NET A;  3GF5 A;  4EMK B;  4M77 B;  2WSF E;  1VQ8 T;  3L42 A;  1G5V A;  1JJ2 A;  2XK0 A;  2YRV A;  3HFZ A;  1W2B A;  3RUX A;  4UPA A;  4OP0 A;  3M54 A;  2E1H A;  3QYH B;  3OS1 A;  1VQK T;  3X26 B;  1K8A C;  1M1G A;  1FXX A;  1PYS B;  1VQ6 T;  3CXC S;  1MGQ A;  4P71 A;  2Q5H A;  4C0D B;  3G6E A;  5FRO A;  4L59 A;  3JCM V;  4BDZ A;  4J6W A;  4YRG A;  1WJR A;  4TVR A;  4X5O A;  4CS3 A;  2DPP B;  4M77 E;  1NYR A;  4M7D A;  2BKD N;  2QEX T;  4M75 B;  2BIV A;  4VUB A;  2ZXF A;  5LJ5 f;  3V7S A;  3OW2 A;  5CKH A;  1X54 A;  1E1T A;  3EFS A;  5AYF A;  4M77 F;  2JN0 A;  4L5G A;  4OGE A;  3OYL A;  3OYH A;  5LL6 S;  4P3P A;  3VUB A;  1FYF A;  3JCM c;  2AMC A;  4CH3 A;  4CI0 C;  3JAM E;  3G71 T;  5GAN 3;  4XEM A;  2D9T A;  4RQE A;  1H4Q A;  3A5Y A;  3SWN C;  4IUP A;  1H4T A;  3JB9 D;  2JTF A;  2FVU A;  1U1S A;  2M16 A;  3URG A;  3P8V A;  2VYT A;  2QXF A;  5GAN 7;  3OYG A;  3UDC A;  3CCS T;  1KHI A;  3FRN A;  1PSF A;  4XTU A;  1H3Z A;  3V8J A;  4Z02 A;  1YCY A;  2Y4Y A;  4HT8 A;  4LDW A;  2PMF A;  1YJ9 T;  1YJN T;  3IG2 A;  2QQB A;  3INZ A;  1UGP B;  1M90 C;  2KVQ G;  2CJA A;  3WXM B;  4H2S A;  4C92 B;  5KCH A;  2HBP A;  1G51 A;  4FM4 B;  3GIB A;  4BDY A;  1X01 A;  2E70 A;  4RQF A;  2LRQ A;  2IG0 A;  1YHQ A;  3E1S A;  2DXT A;  3HL8 A;  2QI2 A;  1VQP A;  3CXC A;  3MEW A;  3L2Q A;  2BUD A;  3RER A;  3EAE A;  4P73 A;  3M4Q A;  3QJY A;  5GAO m;  2VXF A;  3HRI A;  2E6Z A;  1Q81 C;  2VXE A;  5E3I A;  4QQD A;  1NJI U;  3PGG A;  5LJ3 f;  1Y96 B;  2RHZ A;  3S3O A;  5GMK h;  2RHY A;  3HRK A;  1QVF S;  3CC2 T;  4YRC A;  3OSS C;  1UB4 A;  2GF7 A;  4RMO A;  2RM4 A;  1L0W A;  1G3W A;  2XDD A;  5M9O A;  3OB9 A;  1W4S A;  4YCV A;  4BUG A;  3OYM A;  4M7D G;  4QQG A;  4YCW A;  4YDQ A;  3REU A;  3DB4 A;  4Q6G A;  5GMK m;  3OYB A;  3OMC A;  4G85 A;  4J5Y A;  3ZFJ A;  3SDZ A;  1Z7M A;  2QA4 T;  1LYL A;  3VU3 C;  1WU7 A;  4PJO E;  1KC8 U;  4RCC A;  4JLG A;  1SRY A;  3PMI A;  3QO3 A;  1VIE A;  2DKG A;  3CMQ A;  4M78 E;  1PSE A;  2R5M A;  4Y28 E;  3CPF A;  3HXV A;  3BDL A;  2ZPE B;  4PJO F;  4HWR A;  5LJ5 h;  2LQ8 A;  4NCX A;  3CC4 T;  5A0L A;  2A3L A;  2I4M A;  3FEO A;  1G3T A;  1Q7Y C;  3JCM g;  4M78 F;  2P5I A;  5DLO A;  4HWP A;  3MCA B;  4BW9 A;  4YTL A;  4JS4 A;  5GAN f;  2ARS A;  4TVA B;  1X75 C;  2ZZD A;  3HXW A;  2V8J A;  2ALY B;  2E3C A;  4P75 A;  3RAC A;  4YRN A;  2LT1 A;  5GMK e;  2FB7 A;  5GAN 6;  4CH5 A;  4J7F A;  3LYI A;  4QVD A;  2ZIO A;  2DD4 A;  4YRK A;  2CZ7 B;  2GFA A;  2DXU A;  4BY6 C;  1BI1 A;  4BE1 A;  2M1H A;  4H02 A;  4JRQ A;  2XDB A;  4P3O A;  2HQX A;  4MDW A;  3HRU A;  3P8Y A;  2DDZ A;  4M7A E;  3ASK A;  3E9I A;  2WAC A;  5FU6 B;  5ELN A;  3LWH A;  2RHX A;  2M9U A;  2HNI A;  3UGQ A;  1YIJ T;  2M0O A;  1BIB A;  1YJW A;  1KQ1 A;  2X35 A;  5GAO p;  3GOX A;  3PZC A;  2X4J A;  5FRN A;  1QVF A;  1VQM T;  2ZR3 A;  1X6O A;  1WQW A;  4M7A F;  3RF1 A;  3MEY A;  3CCM T;  2YHT A;  4A4F A;  1KQS S;  2XKO C;  3J81 E;  1Y07 A;  3HFZ B;  4DOW A;  3E9H A;  4P75 C;  2KDS A;  5LJ5 e;  1I8F A;  3UFG A;  1MHN A;  4HA8 A;  3WVE B;  1GXI E;  3M58 A;  3L4G A;  3CCL A;  1VQL A;  3NEN A;  5I2M A;  2IY5 A;  1G5H A;  1OYX A;  1VQ7 A;  3DB3 A;  4C8Q E;  2F5K A;  4N4G A;  1G3S A;  4M7D B;  5LJ3 h;  3QZ5 B;  2O4X A;  4CS4 A;  4EX5 A;  1G5I A;  4BD3 A;  3VJP A;  3A7A A;  3JCM f;  2ODR C;  1B7Y A;  1WYD A;  2V8I A;  3LSQ A;  2VGN A;  2PVD B;  4C8Q F;  3FLG A;  1N9R A;  4XTY A;  1VQN T;  5GAM f;  3M55 A;  1SER A;  3VQY A;  2DQ3 A;  4ZTF A;  5CKD A;  5ELO A;  1RIQ A;  2AMC B;  2K3Y A;  2C7I A;  3C4S A;  3QHS A;  3L2W A;  3QII A;  5D6Y A;  1NJ2 A;  4YRS A;  2DXB A;  4JS5 A;  5GAN 8;  3OYI A;  3RMQ A;  2LTO A;  3REX A;  5IN1 A;  3QDR B;  2EJG A;  5C51 B;  1QVG S;  4XTV A;  2YLC A;  2R58 A;  1NJI C;  5KCO A;  4G84 A;  4A4K A;  4HWS A;  2ZT6 A;  2J3M A;  3G4S A;  3NEM A;  3HP9 A;  2FHD A;  2RK1 A;  1IRE B;  1YIT A;  5GAO n;  3ERR A;  1U1T A;  3MP6 A;  4PJO C;  1KQS A;  4PL6 A;  5GAN h;  2QTX A;  3M56 A;  5CIU A;  1BBU A;  5LJ3 e;  4B9X A;  3G1Z A;  4M78 C;  4ZIB A;  3CCQ T;  3JCM b;  4E7J A;  3JCM X;  3R6O A;  5LJ3 d;  1AHJ B;  4A54 A;  5DY9 A;  4MMK A;  2Y90 A;  4ME7 A;  3A5Z B;  3HXY A;  4QVC A;  3QG1 A;  2GQV A;  1KC8 C;  3VQV A;  5FU7 C;  3DLL A;  4LDV A;  3MEV A;  2DO3 A;  2LVM A;  3V7R A;  2IVW A;  1I4K 1;  4XTZ A;  3E19 A;  3E9F A;  11AS A;  3I56 A;  3M4P A;  1H4S A;  3PIO A;  3H8Z A;  2ART A;  3A32 A;  1VQ8 A;  2G4C A;  1BI3 A;  3LH0 A;  4N4H A;  2XG8 D;  1BI2 A;  4KQE A;  2WSC E;  4H2T A;  2XDP A;  2XID A;  4M7A C;  1VQK A;  4BI3 A;  4K86 A;  1XTD A;  3CMA T;  1Z7N A;  3OYC A;  4IUT A;  1VQ6 A;  3MF2 A;  1J5W A;  3T9N A;  4A4G A;  2CKK A;  3HXZ A;  3SWN A;  2RI5 A;  5GAN e;  1BYM A;  3CCR T;  4C0F A;  4YRQ A;  1I81 A;  3LGF A;  2RHS A;  1QVG A;  2DD5 A;  2EJF A;  5GAN d;  1N8R U;  4M78 D;  2PUK B;  5HGQ A;  4YRE A;  4LVM A;  3QBY A;  4UC4 A;  2PU9 B;  3J7A F;  3OYF A;  3HTZ A;  2Q7E A;  3JB9 J;  4K88 A;  3GP8 A;  2D6F A;  1Q86 U;  1OZ3 A;  4CH4 A;  5GAM h;  3G71 A;  2K2V A;  4YRM A;  3UT1 A;  1WPY A;  4YP0 A;  1OZ2 A;  4E7H A;  3QNE A;  4F7U A;  1SES A;  3UH0 A;  4C8Q C;  4M75 E;  1M1K U;  4PLL A;  2K57 A;  1LNX A;  1VQ4 T;  3JB9 G;  3CCS A;  4FIB A;  2DTI A;  4XU0 A;  4YRO A;  3OYY A;  3PMT A;  2E65 A;  4LDX A;  2I4L A;  3CCE T;  5KNN A;  2E12 A;  3RMS A;  4JRK A;  2EFI A;  1YJ9 A;  1YJN A;  4M75 F;  5HK3 A;  2AKW B;  4LDU A;  4ZTZ B;  5A0G A;  1G3Y A;  4EPC A;  3VBB A;  3X24 B;  1JB0 E;  4YCU A;  2RD1 A;  2G3R A;  3QKJ A;  3RKY A;  4P5N A;  2CJ9 A;  2EQM A;  3OD1 A;  4P72 C;  5HKC A;  2FL7 A;  4J7I A;  2CZ6 B;  3QO8 A;  4H2U A;  3HXX A;  4O2D A;  5J39 A;  3GNG A;  3RKW A;  3TRE A;  1NJ5 A;  2FYK A;  4C5I A;  5D6W A;  4TQD A;  3FB9 A;  2I4O A;  1D3B A;  4ELY C;  3OYA A;  4IKF A;  3MF1 A;  4ZN1 A;  4BI8 B;  4BAC A;  4QQ6 A;  4XU2 A;  3MEU A;  1ASZ A;  2ZIM A;  5CQY A;  1IL2 A;  2MWO A;  4J6Y A;  5GAM e;  3L4G B;  4CH6 A;  2EQJ A;  2RH2 A;  1K9M U;  2RHU A;  4RG8 A;  2DZ9 A;  3CCV T;  2K4Y A;  4UP7 A;  5GAM d;  4C92 E;  3CC2 A;  3QO7 A;  3L2U A;  2O4X B;  4OGC A;  3A7U A;  4C5G A;  1E1O A;  1VQP T;  4MZT A;  3HY0 A;  1M1F A;  1QP3 A;  2DIQ A;  2RO0 A;  2EQK A;  1B7Y B;  5L8R E;  2JZ2 A;  4C92 F;  1EVL A;  3X28 B;  1WLE A;  2DAQ A;  2ZPH B;  4LD6 A;  4LVK A;  3LSS A;  5CVI A;  2QA4 A;  3CCJ T;  4DQ2 A;  3CC7 A;  3FIF A;  1NE8 A;  2RI3 A;  3A74 A;  4EMK A;  1ZBX A;  4M77 A;  3VUZ A;  2QHT A;  2EIF A;  4PKC C;  3IAL A;  3M4Y A;  1GGM A;  2QHS A;  12AS A;  4QVZ A;  4DPG A;  4OB3 B;  4HCZ A;  2MWP A;  4MZP A;  2E6N A;  2QQR A;  3QPH A;  3NTK A;  3CC4 A;  2P4T A;  2ZT5 A;  4F7U G;  3A7R A;  2K3X A;  1X55 A;  2Q7H A;  2DIG A;  3LLR A;  2OTL T;  1KHC A;  3CCU T;  4B9W A;  4N0A C;  2DTH A;  4ATO A;  4YYE A;  4WI1 A;  2RJC A;  2DU5 A;  2VUB A;  3P8B B;  2LX9 A;  4OF1 A;  1H4V B;  4GLK A;  1YFT A;  4OB0 B;  5GMK l;  3KUF A;  4EMK C;  4M77 C;  2EQU A;  2LT4 A;  2QQS A;  3CD6 T;  1TH7 A;  5GAO q;  3RIR A;  2X4W A;  3MP1 A;  1YIJ A;  3Q1J A;  1B8A A;  3M59 A;  2MMP A;  4E51 A;  5GMK j;  2EAY A;  3QYG B;  5I2S A;  1VQM A;  4H2V A;  4YRF A;  4MZM A;  4C5E A;  1KG1 A;  1N8R C;  3QJ6 A;  1M8V A;  4C0D C;  4X9D A;  3FDR A;  4ZGE B;  1VQZ A;  3CCM A;  2L8D A;  2Q7G A;  3GPL A;  3CBP A;  4M75 C;  3O8V A;  1VQO T;  5CCA A;  3JB9 F;  1EIY A;  1KMN A;  2KSS A;  4KT0 E;  3SD4 A;  1Q86 C;  2XI9 A;  4WJ4 A;  1N27 A;  1IZ6 A;  3A31 A;  2P0L A;  2CZ0 B;  3LC0 A;  4YRR A;  3JCM J;  3FC3 A;  1M9S A;  3HRT A;  3JCM P;  1YI2 T;  3VKI A;  5LJ5 d;  4RDX A;  3MEA A;  1M1K C;  4LD9 K;  3SWN B;  1S72 T;  2RK2 A;  2ZR2 A;  4OVA A;  2ZTG A;  3HY1 A;  3NTH A;  3P8T A;  5LJ5 j;  4NOY A;  4JRI A;  4R56 A;  4WJ3 M;  3HKS A;  5EG2 A;  3KXT A;  4M77 D;  4M77 G;  3L2V A;  4K87 A;  4XTX A;  1EOV A;  1B34 A;  3NEL A;  4EDU A;  1KD1 U;  2OTJ T;  2JVV A;  3L1A A;  3QZ9 B;  1WGS A;  3TEH A;  1VQN A;  1B76 A;  2HAX A;  2J3L A;  3ICA A;  5HY6 A;  4PG3 A;  1O75 A;  4PJO A;  5CKB A;  4ZN3 A;  3A8L B;  2RI2 A;  4EMH A;  1YFS A;  2WSE E;  1NJ6 A;  4M78 A;  2MF2 A;  1QP2 A;  2XHC A;  4C92 C;  1HXD A;  2R57 A;  3QTC A;  4M7D E;  4C0G A;  3TUP A;  2F69 A;  1N6A A;  1BBW A;  4PNO A;  2LQK A;  4M75 D;  1HTT A;  3L2Z A;  4E47 A;  4XU1 A;  2PME A;  4JUV A;  2PUO B;  5KH6 A;  2CIM A;  2ZT7 A;  4OMF B;  4KUD K;  4TVY A;  1NYQ A;  1K9M C;  1ATI A;  4M7D F;  5F5W A;  3QSU A;  3PT9 A;  5CKE A;  1C0A A;  4HT4 A;  4JJN K;  3W3S A;  5K1P A;  4JRP A;  4N4I A;  2ZZE A;  4E7I A;  4BE2 A;  4YRT A;  3CME T;  3RKX A;  2AHJ B;  3OY9 A;  1UGQ B;  2VV5 A;  3A8O B;  4HCB A;  1USY A;  3CCQ A;  3MP8 A;  4X9C A;  4IUQ A;  2X4Y A;  5LJ5 g;  3I55 T;  3E9G A;  2DJZ A;  4M7A A;  4NL2 A;  3PFS A;  4WF2 A;  4DA4 A;  1YGB A;  1D3B B;  1ZHI A;  1BI0 A;  4XQ3 A;  2ODR D;  1ASY A;  1VQ9 A;  4HWT A;  3KBG A;  2VGM A;  5LJ3 j;  4HWO A;  3GNF B;  4Q15 A;  2R5A A;  1LJO A;  3L2R A;  1VQ5 T;  3PCO A;  2KMT A;  2QDY B;  5CO7 A;  2DVE A;  2Q5I A;  2A7Y A;  2MI6 A;  1H64 1;  3HFO A;  1WJS A;  4D6W A;  4P3N A;  2LCC A;  4JLI A;  1EIF A;  1USY C;  3ZBD A;  3CMA A;  1ADJ A;  2EWN A;  2EJ9 A;  1QE0 A;  3OS0 A;  1N9W A;  2V8K A;  3DLM A;  3R07 A;  1XNI A;  1K73 U;  2YLB A;  2HQE A;  5C52 B;  2CZ1 B;  2L5Q A;  3CCR A;  4P74 C;  4C8Q A;  1WNL A;  2D0Q B;  4BY6 B;  3WVD B;  3GLX A;  4PJO D;  4PJO G;  3S3M A;  2QEX A;  2XIC A;  3MET A;  5CK9 A;  4V2S A;  3OA6 A;  3JSC A;  5C53 B;  3OSV A;  3P8H A;  3P8D A;  1X2G A;  5CKF A;  3ER0 A;  2ARU A;  4M78 G;  2RJF A;  2PVO B;  3MQZ A;  1O9S A;  2ZPG B;  4NL3 A;  4YRP A;  2RHQ A;  5FU6 C;  1NPP A;  3JCM h;  5GAN j;  3VV0 A;  4KBM B;  1U8R A;  4ZGJ B;  1W66 A;  3G6E T;  2X4X A;  4P72 A;  2K5I A;  5LJ3 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...