4XTUA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (n-({[(1r,2s,3r,4r)-4-(6-amino-9h-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtuA01
4EMKC 4HWOA 1EQRA 5GAN3 1LOJA 1PYSB 3SWNB 4PNOA 4M78F 3W3SA 2I2LA 3JCMQ 4ZTUB 1HC7A 2ARTA 1BBWA 4HWSA 3JB9I 3RL6A 1BIBA 1LYLA 4O2DA 4K86A 3QO7A 4M7DA 4YDQA 5GMKi 4H2SA 5GMKl 1SETA 2RA2A 4P3NA 4TQFA 4PJOD 1Y96A 4M7AC 4YRNA 4J15A 4M7DE 1I4K1 4J5YA 1D3BA 2ZT6A 2EJ9A 2ZZEA 4K87A 2RB6A 3VBBA 4M7DB 5HGQA 4YRKA 4M77C 3NELA 1BBUA 2Q7GA 2DQ3A 2DKGA 2J3LA 5GAN6 3A7UA 4YCVA 4ZTZB 2ZTGA 3SWNC 1E22A 4XU2A 1KOGA 4XTYA 5GAN8 5GAOl 3FJPA 1I81A 3JB9H 1EVKA 1NJ1A 3QO5A 1ASYA 5ELOA 1YB3A 4PJOA 1U1SA 2E64A 4YRFA 1RIQA 3HXZA 4XU3A 2CJAA 1WYDA 4C92A 4WJ3M 3UFGA 1YFTA 4PJOE 2DDZA 3A74A 1J5WA 4DPGA 4KR2A 1WLEA 2I4MA 4P75A 1WQ7A 2YHTA 4N0AC 3QSUA 4C92E 4PJOB 2Q7EA 2ODRC 3MEYA 4M7DC 3V7SA 4C92B 4NL2A 2ZIOA 2IY5B 3HXWA 3JCMP 4H2UA 11ASA 4XEMA 4P74C 2Q5HA 4X9CA 3BY7A 3PCOB 4YRLA 4CS4A 4P71C 3V8LA 3TUPA 2FB7A 1NYRA 3QHSA 4J6WA 2YLBA 2CJBA 3FIFA 3JCMd 4KQEA 1I8FA 5GANe 2DEQA 4M7AG 2AMCA 4NCXA 4RDXA 2ZZFA 4RMFA 2E65A 5GMKm 4P73A 3RGLA 2YLCA 1L0WA 2DZCA 4MMKA 3UH0A 4PJOC 3HXVA 2I4NA 4JLIA 2DQ0A 2ZGWA 3L1AA 4P72C 4C92C 4M77G 3HTZA 1W66A 5GANg 4AH6A 2AMCB 5I21A 2EJFA 2ZXFA 5LJ5h 1USYA 4NOYA 2DJZA 3MF2A 2RHQB 3L4GA 2RHSA 4HWTA 1N9RA 5GAOm 3RERA 3FB9A 2DU7A 1KQ2A 4RCCA 4J6YA 5GAN4 3A31A 4M7AF 1B7YA 1B70B 5F5WA 4OLFA 4XU1A 3VQVA 3AHUA 3IALA 5GMKe 3UGTA 4CH5A 4EO4A 1E1OA 2ZCEA 2XGTA 4TTVA 3HRKA 4H2WA 4M77F 2I4OA 3CMQA 4H2XA 4M7DG 1KQ1A 3JCMV 3HSBA 4Q6GA 5GAMg 1B7YB 3QNEA 2ZT8A 5C51B 4XEOA 3JB9J 4H2TA 5GAN5 3P8VA 4F7UA 2G4CA 5GMKh 4WJ4A 4HWPA 3BJUA 3HFZA 4HVCA 4YRMA 1WNLA 1ASZA 4WI1A 3OD1A 4KR3A 4F7UE 3HFOA 4TQDA 4M75D 5C53B 2JN0A 4X9DA 3V7CA 2ZZGA 3VQXA 4A53A 1FYFA 1Y96B 4QVCA 1USYC 3HFZB 1D3BB 4XTWA 4M7DF 4PJOG 5E3IA 3A7RA 1X2HA 2PMFA 1M5Q1 4EMHA 4C92G 2ARSA 3NEMA 1HXDA 4TVWA 1G51A 2Q7HA 4CS3A 1B34A 5GAN2 1HK9A 4YROA 4YCWA 4UP9A 4E51A 3HFNA 3V7RA 4M75A 1EIYA 3TEHA 3QO3A 1MGQA 1X55A 4TVAA 1H4SA 3L2ZA 1JRIA 2PMEA 5LJ5j 2ARUA 4QVDA 4M75E 4Y91A 5CAIA 5ELNA 3TEGA 4HT8A 4MMLA 3HXXA 2P0LA 3BFMA 4M75B 4JRIA 1G5HA 3TEHB 1SERA 3P8YA 3ERRA 1NYQA 4TVAB 4PJOF 2J3MA 3JCMb 1H4VB 2ZIMA 4Q15A 2C8MA 1YFSA 3PGGA 4C92F 4RQEA 3HY1A 1Z7MA 2ALYA 1EVLA 4C8QD 3HY0A 4YREA 1JBMA 3REXA 1X54A 4HT9A 4UP8A 4K88A 4EX5A 1BIAA 4M7AD 2DZ9A 5LJ5d 1EOVA 2DXTA 4YRSA 3RKXA 3M4QA 1H4QA 4BWAA 3P8TA 2ZINA 5GANf 4PHCA 1IL2A 4M78D 4EMKA 4UP7A 5GMKj 4M77D 3A5YA 4G84A 1X56A 3IG2A 2DTIA 2VC8A 4M75C 1Z7NA 4C8QA 4JRKA 4NL3A 4P75C 1NJ5A 5GANh 2ZNIA 3JCMe 4UPAA 2DU5A 2VXFA 1N9WA 4C8QE 4M7AA 4RQFA 3MF1A 3QO8A 2C7IA 2QHTA 4YRPA 3LSSA 4C8QB 5LJ3e 4M78A 3BW1A 5DY9A 3JCMX 5GAMe 3RESA 3JCMg 4XTUA 5LJ3f 4LNSA 4M77A 5GAMf 1YGBA 4OP0A 3L4GB 4WF2A 4M78E 3RIRA 1I5LA 2ODRD 4YRGA 2RHSB 4M7DD 1PYSA 12ASA 2ZT7A 2I4LA 1G5IA 4ZIBA 5LJ3g 4X5OA 4M78B 4A54A 2QHSA 4F7UG 4XTZA 1ATIA 1X2GA 1YFRA 3IKMB 5KNNA 1ADJA 4P73C 3M4PA 3HFVA 3JB9G 2CIMA 4H2XB 1M8VA 2E5AA 2CGHA 2EWNA 2ZNJA 4N0AA 1N9SA 2DTHA 3VU3C 3G1ZA 3VQYA 5GAN7 4C8QC 4F7UB 2Y90A 2E10A 2QHUA 3I7FA 1B76A 2VXEA 1LNXA 1VQZA 2E1HA 4P74A 5C52B 3RUXA 3BDUA 4YCUA 4C92D 5GAOr 4YRJA 4F7UF 3A5ZA 5K1XA 4M78C 4PG3A 1NJ8A 3JCMJ 1JJCA 4P71A 2HNIA 3NETA 3RF1A 4M75G 1SESA 4YPFA 4JUVA 3JB9F 2XTIA 4XTVA 3NENA 3HRIA 2QTXA 3HXYA 3A7AA 4XU0A 5GANj 2DTOA 4EMGA 2RD1A 4DQ2A 3RKWA 3E9HA 4XQ3A 3V8KA 1JJCB 1QE0A 2ZR3A 3RACA 3IKLA 1B34B 2DXUA 4P3OA 3JCMW 2K57A 1E24A 4P72A 1EIYB 1TH7A 2IY5A 4CH4A 1EFWA 4XTXA 4L87A 4YRRA 1SRYA 1E1TA 3EFRA 4G85A 1KMMA 3E9IA 3PCOA 2EJGA 1NNHA 2EL9A 4M75F 4H2VA 3DSQA 4H02A 1X01A 4HWRA 4RCBA 5GANd 3LSQA 5GAOn 3JCMc 3GIBA 5GAOq 5LJ3j 1NJ6A 3UGQA 4YP0A 3RKYA 5GAMj 2ALYB 2E3CA 3VQWA 1H641 4YRCA 3V8JA 3A32A 2EAYA 4C8QG 1WQWA 3PZCA 4TWAA 3KFUA 4BW9A 4CS2A 2ZT5A 4HA8A 4EMKB 3QTCA 2FYKA 5LJ5e 1KMNA 2QHVA 3JCMf 3EFSA 2E41A 5LJ5f 1QF6A 3REUA 4TVYA 3INZA 4YYEA 4M78G 5GAOp 2RHQA 5LJ3d 3WQZA 5GAMd 4M7AE 1HTTA 3M4GA 1H4TA 5LJ5g 2ZR2A 4YRIA 2DVEA 3R07A 4J6XA 1ADYA 1B70A 4CH3A 5K1PA 2AKWA 3JCMh 4M7AB 4YRTA 3QUIA 4V2SA 3SB2A 2CJ9A 2Q5IA 3SWNA 3LC0A 1WPYA 3ICAA 4M77E 4C8QF 1U1TA 3HXUA 4P3PA 2RM4A 2P5IA 4YRQA 1GGMA 1NJ2A 1C0AA 4M77B 5LJ3h 4H2YA 1B8AA 4CH6A 1LJOA 1YCYA 5GAMh 1WU7A 3JB9D 2AKWB
chains in the Genus database with same CATH superfamily
4EMKC 1GFDA 2M0YA 3SWNB 1ZX6A 4M78F 1VQMQ 1AWXA 3FRNA 1P92A 2QDYB 2CZ7B 3EG1A 1HC7A 2RHYA 1BBWA 4HWSA 1XTDA 3RL6A 2QA4A 2KYMA 5GMKl 1SETA 3OYAA 4PJOD 3CCQA 4M7AC 3HP9A 1K73C 3I55A 2DVJA 1Q7YC 2RB6A 2K3YA 2XDPA 3OYBA 2K79A 2IG0A 4M7DB 1M90U 2DK3A 3RDVA 4YRKA 2KR3A 4M77C 5I11A 2FL7A 1BBUA 3NELA 2A3LA 1M8MA 2DKGA 2LMJA 3M0TA 3OYJA 5GAN6 3VYHB 1YJNA 3CCJT 1E22A 1NYGA 4XTYA 5GAOl 1Y7XA 1I81A 2DBMA 3PMTA 1VIEA 4LDVA 4JRQA 2CDTA 1NJ1A 4KH1B 1ASYA 2O01E 2JMAA 2PVDB 4FYVB 4LD6A 1U1SA 4PJJA 2CJAA 4J7FA 1IHWA 1YFTA 1G3TA 4FSSA 2K6DA 2OI3A 4J9GA 1J3TA 2X4JA 2X3WD 2MI6A 2DILA 2ODRC 3MEYA 3V7SA 2K7AA 4H2UA 1KG1A 3UATA 2HZYA 2BZ8A 3S3OA 1ZUUA 1OU8A 3FJ5A 1R8OB 5I22A 1YJ9T 1G3WA 1VQKQ 1QQJA 2FB7A 3DKMA 1ZA1B 1GCPA 2LP5A 3HRSA 3M5AA 1VQNT 1I8FA 4BE0A 2AMCA 4OGCA 4P73A 5KE3A 2YLCA 2RHIA 3UH0A 3C94A 3CCSA 4PJOC 3HXVA 2CZ1B 1IHVA 2FRWA 5IHKA 2DQ0A 2K5IA 4P72C 2HBWA 4IIOA 3HTZA 1YN8A 2MK5A 4BD3A 2D9TA 2K2MA 1PSFA 2Y4XA 1BI3A 2JT4A 2JUFA 4AH6A 2ZZDA 1X6OA 4OMMA 2ZXFA 2X3XD 1WDXA 4FL6A 4NOYA 2CP5A 2DF6A 1XNIA 3MF2A 1UTIA 2EQKA 3OYNA 4PFZA 1ZA2B 4ZNXA 5L8RE 3CMAT 2RHSA 2XU8A 3RERA 2DU7A 5KYXB 4RCCA 6AT1B 1Q81U 3C12A 3MJXA 1BI1A 2M02A 3M55A 4OLFA 3AHUA 1K9MU 3UGTA 4CH5A 1TU0B 1NLOC 2ZCEA 2F2VA 4ANJA 1M1KC 3TREA 1X27A 4Q6GA 3DB3A 1B7YB 2KDSA 4R56A 2MMPA 2PU9B 1OULA 3JB9J 1TOVA 2XG8D 3SDZA 4PL6A 5GMKh 5EG2A 4HWPA 4WJ4A 3O8VA 5HCKA 1FMVA 3TQ7P 4RTWA 2JTEA 2J06A 1WYXA 2DMOA 3V7CA 3VQXA 4B9WA 1FYFA 3SFMA 2LCCA 4PK4A 2RK1A 1VQ7T 4RG2A 2ZAEA 2GTOA 4E7ZA 3VS1A 4PFPA 4FT4A 2VKNA 4M7DF 1LVKA 1VYUA 3CBPA 4BI3A 5DLQE 2RF0A 1V29B 2DYIA 3CBOA 2FHDA 4II1A 1M2VA 3VS0A 2LZ6B 1W70A 1MGQA 1X55A 4TVAA 4VUBA 2MF2A 3CPWP 2D0NA 4RTUA 2ARUA 4E7SA 5CAIA 2E4HA 1ACMB 4HT8A 3HXXA 3G1JA 2JXBA 2YWWA 3M0RA 1WHGA 1G5HA 3ERRA 2V1QA 2EIFA 4JLGA 3ZBDA 3AT1B 4Q15A 1YFSA 4YTLA 3EGXB 4A4KA 1V76A 1BCOA 4C8QD 3NHNA 4OB3B 1Q86C 4HT9A 2DFUA 5CIUA 1G3SA 1O9SA 3OW2A 1YJWT 3RKXA 2EGAA 2RK2A 2LNHB 3EAEA 1YHQA 4UP7A 1TSFA 1NLPC 1VQ8T 3P8BB 2DTIA 2E12A 2GGRA 5CCAA 2YRDA 1LCKA 5IXBA 4UPAA 1VQOQ 2VXFA 2DIGA 1N9WA 5IHIA 4E2FB 4MDWA 4DOWA 1ZHIA 5CQXA 3CC2T 2QHTA 3LSSA 1YIJQ 3ER0A 2JTMA 4M78A 3BW1A 5DY9A 5L23A 2B8AA 4LNSA 5FU6C 4PFOA 3G71Q 5GAMf 1YGBA 4OP0A 2VWFA 1B07A 2LNVA 1KFZA 4WF2A 4M78E 1PRMC 2RHSB 4M7DD 1BCMA 2E5KA 1AZEA 4EIKA 2DIQA 4D8KA 2QHSA 4EDUA 1ZQ1A 4XTZA 1ADJA 3C0CA 1VQ6T 3HKSA 3JB9G 3VUZA 3LH0A 2NLUA 1OZ2A 1VQ5A 2YUQA 4JS5A 1M8VA 3ME9A 4BI8B 1XJWB 1YIJA 1N9SA 2D8HA 4KULA 2CP2A 4C8QC 3G71A 2QHUA 2QTVA 1M1FA 5KYWB 4AG2C 3RUXA 1N6AA 2FO0A 3EH1A 3M4YA 3A8GB 1NJ8A 2HNIA 4A4HA 4Q5WA 1KD1R 2KEAA 5FU7B 1VQ4Q 4JUVA 2D0QB 2XTIA 4XTVA 3NPFA 1FMKA 2JS0A 1OX8A 3THKA 3A7AA 4LVMA 1KJWA 2Z0WA 3Q1JA 1X43A 2DAQA 3V8KA 2DEUA 1JJCB 3IKLA 1EFNA 4BE2A 3JCMW 3MHXA 4QW2A 5FWCA 1MUZA 4GY5A 2D6FA 2IY5A 1JU5C 5CKFA 4CH4A 1SHFA 4FIBA 3A8HB 4L87A 2QASA 1E1TA 1PC0A 3NFCA 1VQPT 1QKWA 3PCOA 2GQVA 3G6EQ 3OYLA 2KT1A 1VQ4A 1X01A 4HWRA 3JSCA 2P4RA 2DE0X 2LTOA 5GAOq 1NJ6A 2J6OA 2AHJB 3RKYA 4B6MA 2FG0A 4A4FA 2O31A 3UPUA 4YRCA 2RHZA 1NPPA 1O75A 3BDLA 2LT1A 2EAYA 4OF1A 3H0IA 2CUBA 2FPDA 1YITQ 3PTAA 2KRNA 3CCLQ 3VV0A 1JJ2A 1YNZA 3HTRA 1WHKA 2QHVA 3G6EA 3JCMf 4J9FA 2R5AA 4ATOA 2CP3A 4M78G 3M54A 1X2KA 5LJ3d 3G4ST 1K8AC 3DLLA 2ED0A 3M4GA 4HT4A 3QBYA 4YRIA 5CKHA 1Z9QA 1FMWA 4YRTA 3CCVQ 5KCOA 4ELZC 3OS2A 3SWNA 3ICAA 3QWXX 3VJPA 1IGUA 4FYYB 1GGMA 3FC3A 1NM7A 4J8OA 1SEMA 1I07A 1C0AA 4H2YA 2V8IA 1LJOA 2EYWA 1EQRA 5GAN3 4J9IA 1MMAA 2LQWA 5A0GA 1OYXA 4F17A 4GBQA 3JCMQ 3DLMA 3ASKA 4ZTUB 1QVFS 2ARTA 4RTXA 5I2SA 1D0YA 1BIBA 2K2VA 4E7HA 4LD9K 4M7DA 4Y28E 2OAWA 3CCVA 2RPNA 4N4IA 1Y96A 2XD0A 4X34A 4M7DE 1I4K1 2ZZEA 1QMCA 2G6FX 3VBBA 1AZGB 4N4GA 2EQJA 4HCZA 2DXCA 2DETA 2ED1A 5IHNA 5HGQA 4R0KA 2MOXA 3CMET 2M9UA 1HYOA 2J3LA 1N8RR 3H41A 2CH4W 4XU2A 1KOGA 1R0CB 3JB9H 1GCQC 3I56T 1EVKA 2P0QA 3QO5A 4DEYA 1T0JA 3CC7T 1RIQA 2EQIA 2X4YA 4E7LA 2J7IA 3VUBA 4Z02A 5IN1A 2LC4A 1JJ2S 4DPGA 1J5WA 1PG5B 3A8MB 4P75A 3H0HA 3QSUA 2OTJQ 2EBPA 2EVRA 2NUTB 5D7UA 1M1GA 4HCBA 1H8KA 3NTKA 1Y71A 3MP1A 2O2OA 4C92B 2IY5B 2AK5A 3MEAA 1YWOA 5AT1B 3X26B 4RTZA 4XEMA 1GBQA 1PNJA 4P74C 3LWHA 2L3RA 4OGEA 4HCKA 3RR6A 3PCOB 2CP0A 4YRLA 2EQUA 1U3OA 4K11A 1NYRA 4J6WA 2AKKA 4L59A 1QP3A 3FIFA 1JQQA 2B86A 3U23A 1KHCA 1K73R 2OTJA 3MQZA 2ZPHB 1Q7YR 3CCRT 4RMFA 3IQLA 2L0AA 5IAYA 4ZTFA 5KYYB 1RAHB 1QKXA 1Q82U 2I4NA 2ZGWA 1WHJA 2L5QA 1W66A 1Z9ZA 3X24B 5KYXA 4M4ZA 2KGTA 1R0BG 5FW9A 2H8HA 3UDCA 1MV3A 2YDLA 2EJFA 3GLXA 2VVKA 4J9HA 1USYA 3S3NA 2DJZA 3NTHA 4ME7A 1PHTA 2BTTA 3MEUA 1UGQB 3I55Q 2MYSA 3CCUT 3LH5A 4J6YA 2DL8A 4PLIA 5GAN4 2PUKB 3TSWA 1Y07A 3QZ5B 3C95A 4KGVB 2IPOB 1B7YA 5F5WA 2E6ZA 3MEVA 1G3YA 2ROLA 4DBQA 1OU9A 3VQVA 4OMQA 5GMKe 2EPDA 2F5KA 1YJNQ 1RL2A 3HRKA 4H2WA 4C0ZA 3OS1A 2I4OA 1UB4A 4L6V5 4M7DG 3SEMA 1FWZA 5GAMg 5A2QE 3URGA 4BY6B 2E5QA 1ZBJA 2QQSA 4R55A 1TXQA 1N8RU 3OYYA 4HVCA 3OD1A 1D1AA 2VV5A 3VS3A 3HFOA 1KQSP 4TQDA 1HSQA 1X75C 1MNEA 2SEMA 2ZZGA 1CSKA 4A53A 1ZSZA 1Y96B 2BE9B 3HFZB 3OMCA 4J7IA 5E3IA 1OQKA 1M5Q1 1QLYA 5C6SA 1B7TA 2KXDA 3ZL7C 1YJ9A 2O4XB 4QQDA 1RACB 2KQWA 3EG0A 3T9NA 3V7RA 1CKBA 5FRNA 1H4SA 4LDYA 2QA4T 3LX7A 1QP2A 4RUGA 3X28B 1N5ZA 2KRSA 2NUPB 4QVDA 3EGXA 4Y91A 2HL5C 3CCSQ 3TU4K 4KT0E 2RO0A 1OPKA 2P0LA 3BFMA 1UDLA 5KYNA 1N27A 3CCQT 2RJEA 4M75B 4JRIA 1YP5A 1NG2A 1M27C 4FYXB 2MCNA 1G83A 2J3MA 4AG1C 3JCMb 1ZBXA 4A63B 3GP8A 1K73U 1M1KR 1D1BA 1YI2T 1M2OA 4C92F 1RLQC 4RQEA 4X1VA 3HY1A 1IGQA 2L3QA 1WHMA 2VGNA 1RI9A 4YREA 2AT1B 2A28A 2O88A 1JBMA 1X54A 4UP8A 1VQMT 3CMAA 4IUPA 1Q81C 2HDAA 2W10A 3P8TA 1VA7A 5GANf 4KGXB 3KFVA 1K9MC 4JJCA 4M78D 4EMKA 4AT1B 1YBYA 1D0XA 5KYUB 5GMKj 4BDYA 1IXDA 1PSEA 1X56A 4OB0B 3IG2A 1UGVA 4IUUA 4KGZB 1EZZB 4CI0C 2KBTA 1K1ZA 3JCMe 2MAMA 2RI3A 3CC4Q 1XQHA 4M7AA 2GNCA 1E6GA 3MF1A 1M4ZA 3QO8A 2C7IA 1ZSGA 3KBGA 4DBHA 3VS6A 2VGMA 1E7OA 5LJ3e 2DRKA 1GL5A 1K4US 1KSWA 1NPRA 2DO3A 3JCMg 4XTUA 1MMNA 3OBYA 4M77A 3D7SB 4J9CA 4E7KA 2YT6A 3M59A 2ESWA 2LCLA 1I5LA 1W2BP 1AT1B 1KIKA 2FZKB 1WI7A 1PYSA 1T3LA 2ZT7A 2I4LA 4ZIBA 3OY9A 1WFWA 5LJ3g 3M0PA 2QYZA 4Z8AA 5HKCA 5KNNA 3LLRA 1YFRA 3IKMB 2YSQA 3PE0A 2DD4A 1KC8C 1UJYA 3M4PA 1UG1A 4JJDA 3EGUA 3CC4A 3L2WA 5CKDA 2EYQA 4FW1A 3UT1A 3CXCP 1LPLA 3TEEA 1QVGP 9ATCB 1B3QA 2E5AA 2CGHA 5KYWA 1RADB 2DTHA 4LUDA 1Q86R 4IUQA 2AKLA 2P4TA 1D09B 1UHFA 1WX6A 2E10A 1AEYA 1VQKT 1RAGB 4E7JA 3GNGA 3EG2A 1B76A 2LJ1A 5J26A 2VXEA 1LNXA 4CC2A 2E1HA 4LDUA 4C0DB 5C52B 2R5MA 4YCUA 2QI2A 4C92D 2D8JA 3UA6A 4YRJA 4JS4A 4F7UF 3A5ZA 2DD5A 5K1XA 4M78C 1ZSZB 2ROTA 1JJCA 3M57A 3QZ9B 3CD6Q 1JO8A 1UEBA 1S72A 1VUBA 4ZN3A 3NENA 3HRIA 2QTXA 5A0DA 2PVGB 3HXYA 5CR2A 2RHUA 3OYFA 4EMGA 1M1KU 2ZPEB 2FEIA 3E9HA 1I0CA 1YHQQ 2X4WA 4C0GA 2DXUA 4ELYC 2OJ2A 1YWPA 4P72A 1OI1A 2GFAA 2EYYA 2JZ2A 4XTXA 2ECZA 3EFRA 3QXEB 2LX9A 2EJGA 1AWOA 1NNHA 4M75F 3CD6A 3DSQA 4H02A 2YRCA 2CZ6B 2RI2A 1GXIE 1S1NA 4Z88A 2BZYA 3E2UA 4J9DA 3CC2A 2KMTA 3JCMc 5LJ3j 1QVFP 2QEXA 2OTLQ 2AZVA 1RUWA 3V8JA 1VQ9Q 1VQLQ 5DLOA 3KFUA 5ECAA 4BW9A 4KH0B 2E6NA 4EMKB 3GF5A 4MZTA 5LJ5e 3GBQA 2HL3A 2A37A 1KMNA 3L2UA 2E41A 2P0KA 1QF6A 3INZA 1VQ6A 1VQ5Q 4RTTA 1UHCA 3WQZA 3PMIA 5GAMd 2GBQA 1HTTA 2KNBB 5LJ5g 4DA4A 2JS2A 2OTLA 2NUZA 1MMGA 3FLGA 3M0SA 2RQUA 4M7AB 3JCMh 2QQBA 4IUTA 1MNDA 1VQ9A 1VQLA 3LC0A 1C0MA 1TUDA 2RM4A 3HXUA 2XMFA 1RAIB 3OYDA 1Q86U 4M77B 5LJ3h 1B8AA 1WU7A 3VS5A 1LOJA 1PYSB 4PNOA 3OYKA 3W3SA 5KCHA 5FWBA 2KI7A 3PNWC 4O2DA 4K86A 5LL6S 3QO7A 2C0TA 2CT3A 3X20B 2QQRA 2MIOA 5GMKi 1SG5A 4H2SA 4P3NA 1NJIC 1NYFA 4J9EA 4D8DA 3P8HA 2ZT6A 2EJ9A 3EG9A 1AD5A 4WCIA 3E1SA 2P0PA 2QK0A 3QG1A 2RJDA 3H9NA 4BE1A 1UGSB 3QJ6A 3CPWA 2Q7GA 4PKCC 3OW2S 4LVLA 2F1LA 4YCVA 2K3BA 4ZTZB 5HK3A 2ZTGA 3SWNC 2DLPA 5GAN8 3A5ZB 3FJPA 2NUTA 5ELOA 1K8AR 1YB3A 1WZOA 3GOXA 4YRFA 2O9SA 4QKUA 1VQOT 3HXZA 4XU3A 1WYDA 4C92A 4WJ3M 2CSIA 2XI9A 2H3JA 3HL8A 2WSFE 1RI0A 2GFUA 3RBBB 2YHTA 4N0AC 1YIJT 4C92E 1VIFA 4PJOB 4KBMB 2Q7EA 3G71T 2QQ9A 4M7DC 4HVWA 4NL2A 3HXWA 3JCMP 11ASA 2LVMA 3QKJA 3G4SA 2Q5HA 4X9CA 3R6NA 5M9OA 3BY7A 3VRYA 2ABLA 3SHWA 2COWA 4FU6A 1NZ9A 4P71C 3JV3A 3TUPA 5KYYA 4LVJA 4IIMA 2NS6A 2CZ0B 2CJBA 2J05A 3JCMd 3BE3A 4AFQC 2HBPA 5GANe 5C0MA 4AFSC 4NCXA 4RDXA 1WLPB 3J80E 2ZZFA 2E65A 5GMKm 3KXTA 3RGLA 1L0WA 4MMKA 2CT4A 2DNUA 3J7AF 3L1AA 2G3RA 3F70A 1Y0MA 1KK7A 5GANg 2L8DA 2MPXC 1TWBA 2LQ8A 1C1AA 4D6WA 5LJ5h 2BKDN 2BUDA 3HHTB 1IZ6A 1FXXA 3ULRB 1VQ4T 2O9VA 3L4GA 2EKHA 5GAOm 3FB9A 4E47A 1KQ2A 2RMOA 3OYGA 5A0LA 3A31A 1WJQA 2M51A 4M7AF 5CO7A 1MMDA 3CCMQ 2CUDA 3HPWA 4XU1A 4P5NA 1E1OA 3EHRA 3CBMA 1G2BA 4M77F 4H2XA 4RG8A 1KQ1A 3QPHA 3HSBA 1TUCA 3E19A 2DERA 1PWTA 3I56A 2QXFA 2ZT8A 3MP6A 1KD1U 3G6ET 2QGGA 3P8VA 4F7UA 2G4CA 2VB6A 3WXMB 1VOMA 3HFZA 4F14A 1QVPA 4WI1A 5CKBA 4F7UE 5C53B 3FEOA 3CCMA 3CCEQ 2EW3A 3LGLA 1PRLC 4ZGDB 4QVZA 1GFCA 2O4XA 4QVCA 1USYC 2R57A 3JRZA 3OYIA 1SRMA 3EG9B 4IUVA 1YITT 1BBZA 4O6JA 3A7RA 3CPFA 1X2HA 2PMFA 3CCLT 2P84A 4DEXA 4C92G 3NEMA 3OYEA 1HXDA 4DOVA 2NUPA 2LT4A 4TVWA 1G51A 4TVRA 2Q7HA 4CS3A 1B34A 2ENMA 4IURA 4YROA 2HKNA 3HFNA 4M75A 1EIYA 3QO3A 3EGDA 2RJCA 4JZ3A 1IRXA 3CCEA 4M75E 4GLKA 1M90R 1Q82C 2LQNA 2XIDA 4MZMA 4ZN1A 1YCSB 3TEGA 3CCVT 1SSHA 2HSEB 1VYTA 5AYFA 4FCYA 2LDMA 2C0IA 2FZGB 3N5BB 3TEHB 1SERA 1NYQA 2EGEA 4PJOF 3MP8A 1WHHA 2LRQA 1M3CA 4EPCA 1H4VB 2ALYA 5KYUA 2ZPFB 4HVVA 1U5SA 2K9GA 3REXA 2PQWA 3L42A 5J39A 4RTVA 4EX5A 2KT8A 3CCUA 2OX7A 1BIAA 4M7AD 5LJ5d 1H3ZA 1WGSA 4YRSA 1H4QA 3S6WA 3M4QA 5FU6B 1PM3A 2ZINA 1AVZC 2F5TX 1IL2A 5FLXE 2J6FA 4BI4A 4M77D 2J6KA 3M0QA 3CCJQ 3A5YA 3REBB 2FVUA 1OZ3A 3I5RA 1UE9A 4AFUC 2XDDA 5GANh 2SRCA 2KK4A 2ZNIA 3L2VA 2A08A 3GNFB 2XKOC 2A8EA 4RQFA 4CRIA 4A4GA 1M90C 4YRPA 4C8QB 5GAMe 5CQYA 3EFOA 3L4GB 1QCOA 2ODRD 4YRGA 1TTHB 3CCJA 1AHJB 12ASA 2YUNA 1G5IA 1QW1A 3QYHB 4X5OA 1ZUYA 4KUDK 4PJNA 4JDSA 4F7UG 2OTJT 5I2MA 1ATIA 1YJ9Q 1X2GA 4P73C 1TG0A 1D1CA 1BI2A 1ZLMA 2HEQA 1T3SA 2CIMA 4H2XB 1QWEA 4NS5A 1VQNQ 2EWNA 2ZNJA 2KAFA 3OS0A 3VQYA 1UGRB 5HK0A 2F69A 4OMOA 1Q81R 1X2QA 1AWJA 4F7UB 2Y90A 1UFFA 1K9MR 1F1BB 3C4SA 3GPLA 2GF7A 2W0ZA 1VQZA 3EH2A 4P74A 5FRMA 3NTIA 2I0NA 1ABOA 2RQTA 2JW4A 1YI2A 2F2WA 2X9HA 4PG3A 2QQAA 1AOJA 2CH4A 2M1HA 4M75G 1SESA 4YPFA 2YUOA 3QIIA 2E3HA 1RAFB 1UGPB 4Y92A 2FZCB 3CMAQ 1VQMA 4GLMA 4XU0A 1VQNA 4LE9A 4LXCA 1K0SA 2XDBA 4AFZC 2RD1A 3RKWA 1IB8A 3RACA 1B34B 4P3OA 2CP7A 1W4SA 2K5FA 1EIYB 2H3EB 3I55T 4HVUA 3WVDB 1TH7A 3EGDB 4KUIA 2BIVA 2JMCA 4YRRA 4BDZA 5KE2A 1Q7YU 3OYCA 4QQ6A 4JJNK 1K0XA 4FM4B 1PKSA 4H2VA 2EFIA 5HY6A 1DJ7B 1IO6A 1KC8R 2RJFA 3TCJA 1YJNT 5FU7C 4BB7A 5GANd 5GAOn 3I5SA 3GIBA 2PZ1A 2VYTA 1AWWA 1SKUB 3UGQA 4YP0A 2Y4YA 5GAMj 2ALYB 3VQWA 3J81E 2WSEE 2PVOB 1WXBA 1VQ7Q 2V8KA 3META 4TWAA 3OS5A 4CS2A 2DBKA 3LWIA 4HA8A 2HD0A 2FYKA 1EIFA 4E6RA 2K4YA 1OX9A 1XOVA 4HXJA 1M3BA 3EFSA 3H0FA 3P8DA 1KHIA 4TVYA 3OB9A 3NGPA 4YYEA 3SD4A 3OW2P 2RHQA 2L3PA 3OBWA 4M7AE 2DL5A 3A8LB 2XHCA 3HRTA 2KE9A 1H4TA 2ZR2A 2RN8A 4J6XA 4LVIA 1B70A 4CH3A 3E9FA 1VQKA 4V2SA 4F16A 1VQ7A 3RMSA 4M77E 4C8QF 4P3PA 4C5IA 3I9QA 2P5IA 2HSPA 4YRQA 1WJRA 1NJ2A 5J3BA 3EFOB 2KROA 4CH6A 1YCYA 4OMPA 5GAMh 2AKWB 1KQSA 2CYZB 1S72Q 4HWOA 3CCST 3PT9A 3PVLA 2IVWA 3FDRA 2I2LA 2JNGA 1RLPC 1PD0A 2ZPBB 1YJWQ 4QQGA 3L2QA 3JB9I 3VS2A 2K3XA 1LYLA 2DL3A 4YDQA 1SPKA 2RA2A 4TQFA 3M53A 2L2PA 1VQ8Q 4YRNA 4J15A 4PLLA 2NWMA 4J5YA 1D3BA 4K87A 1PCXA 1JXMA 5D6WA 2R58A 3VKIA 4ZTJA 3A98A 4FT2A 1GRIA 2DQ3A 2KYBA 4C0FA 2HQEA 3QDRB 3A7UA 3UA7A 4RMOA 3CC2Q 1YJWA 4J9BA 2QEXQ 2QDLA 4PJOA 2E64A 3CC4T 2CREA 1KC8U 2JM9A 1VQ8A 3UFGA 3VRZA 2F2XA 4PJOE 2DDZA 3A74A 4KR2A 1WLEA 2I4MA 3H6ZA 5GJWB 1WQ7A 8ATCB 1QCFA 2JJ9A 3MEWA 2CKKA 1GBRA 4OMFB 2JTFA 1VQ6Q 2ZIOA 1NEBA 8AT1B 2D1XA 4OB1B 4ORZA 3MKDA 2OAUA 4CC3A 1H92A 2KSSA 4CS4A 1UUEA 2C06A 1OV3A 3V8LA 1S72T 3QHSA 2RI5A 1R77A 4E7IA 3TVTA 2YLBA 3KUFA 2ZPGB 1NJIR 3WVEB 4ZGJB 1KQSS 4KQEA 3QYGB 4LVKA 2DEQA 1WJSA 4PJMA 5CKEA 4M7AG 2LJ3A 2GCXA 2RH2A 1Q95G 2QGFB 2DZCA 2C0OA 3X25B 1BYMA 3S3MA 1RAAB 4JLIA 1CKAA 4HKEA 4C92C 4M77G 1W2BA 4N4HA 4CC7A 1WXTA 1YFNA 4MDXA 2AMCB 3E9GA 2EYXA 3TSZA 5I21A 2X35A 5CVIA 5IXFA 2YUPA 1JEGA 2V1RA 3CD6T 2RHQB 4OB2B 5GJVB 4HWTA 1N9RA 3CXCA 1JJ2P 1QVGA 1OEBA 2MWPA 1VQPQ 2KVQG 1X6GA 1B70B 2QEXT 2WSCE 2ATCB 1YHQT 2K5LA 3IALA 4EO4A 2XGTA 1M30A 4TTVA 3M9QA 2LCSA 3CMQA 3JCMV 2WACA 2EGCA 3QNEA 2HQXA 1VYVA 2VUBA 3A1PA 1U8RA 5C51B 4XEOA 3LYIA 2DJQA 4H2TA 3MO8A 3VYGA 1VQOA 2KXCA 5GAN5 2DX1A 1T0HA 1WHLA 2RQRA 2HAXA 3BJUA 3UF4A 1WA7A 4YRMA 1WNLA 1ASZA 4RTYA 2EQMA 4KR3A 3UWNA 4M75D 1VQPA 2MWOA 2OTLT 5D6YA 2JN0A 4X9DA 3EHQA 1MV0B 2A0FB 1VQ9T 1VQLT 1D3BB 4XTWA 4BACA 4C5EA 3G4SQ 3OA6A 3A8OB 3MPUB 4PJOG 2DXBA 4FYWB 4EMHA 2X4XA 2ARSA 4JZ4A 2DPPB 2PNIA 4BUGA 3MCAB 4JPBW 2DM1A 3RNJA 4AMCA 2E3IA 4BY6C 5GAN2 1VQ5T 1HK9A 2RQWA 4UP9A 2XK0A 4YCWA 4E51A 4J83A 4WTOB 4B9XA 1NBEB 3TEHA 2CSQA 3PIOA 3L2ZA 1JRIA 2PMEA 5LJ5j 1QVFA 4L5GA 1I1JA 1M2VB 2BZXA 1W2BS 5ELNA 4MMLA 2AIRB 1QCNA 2FRYA 1ZUKA 3P8YA 1HJDA 2HCKA 4TVAB 1NJIU 2L89A 3OQ5A 1PD1A 2ZIMA 2C8MA 3PGGA 1A0NB 1Z7MA 1EVLA 1WIEA 2XICA 3HY0A 5D6XA 3CXCS 1QVGS 2FPFA 4ZGEB 2CP6A 1G5VA 4LDWA 2L3SA 4K88A 1X69A 1QWFA 4PJLA 2DZ9A 3VS7A 1EOVA 2DXTA 2DA9A 4BWAA 1MHNA 4HCCA 3OMGA 4PHCA 1BU1A 3LGFA 1D0ZA 1JXOA 4LDXA 3CMEQ 4UC4A 1W6XA 2M16A 3M0UA 1PKTA 4G84A 2E70A 2IIMA 1SSFA 2VC8A 3PFSA 4M75C 3I56Q 1Z7NA 2ZPIB 4C8QA 4JRKA 2PUOB 4NL3A 1KD1C 1NJ5A 4P75C 1SHGA 2GQIA 3CC7Q 4Z89A 3JAME 3M58A 1EX4A 2KY9A 1W1FA 2DU5A 2RQVA 4DBFA 4C8QE 1IREB 5EC7A 4RKUE 2ZCFB 3VS4A 2HMAA 3CPWS 1RAEB 3JCMX 3RESA 3L2RA 4OMLA 4OMNA 1Y57A 5LJ3f 3OSVA 2V26A 3CMEA 3PVQA 1I5OB 2BE7D 3RIRA 2QG9B 5FROA 1Q82R 1TUGB 1M3AA 4LUEA 1YITA 1H3HA 3CQTA 4M78B 4A54A 2NYSA 3HRUA 1UJ0A 3CCLA 3CC7A 2LQKA 2X51A 3M56A 3HFVA 3QJYA 2KRMA 2LJ0A 4C5GA 1FYNA 2RHXA 1K9AA 1WXUA 1RABB 4N0AA 3VU3C 3G1ZA 5GAN7 3CCRQ 1K8AU 4O5VA 2M0OA 1BI0A 3G7ZA 1UECA 1FX7A 2AZSA 3I35A 3I7FA 3NMZC 1BKBA 4LN2A 3OYHA 2DYBA 3ZEHA 4C5HA 3BDUA 5GAOr 4DBRA 4KRTA 3REAB 1OOTA 4JJBA 4P71A 3JCMJ 3NETA 2EYZA 3RF1A 1HD3A 1M9SA 3DB4A 2LX7A 3JB9F 3RMQA 1BK2A 2COYA 4ESRA 3O5ZA 3CCUQ 1BB9A 4FW2A 4XAXB 2CS7A 5GANj 2DTOA 1X6BA 4FSXA 1K76A 4DQ2A 3CCRA 4XQ3A 5KH6A 1QE0A 2ZR3A 4MZPA 2K57A 2DRMA 1E24A 2YXYA 1TS9A 2EKOA 4CC4B 1EFWA 4F04B 1NEGA 1C6VX 1E6HA 4C0DC 1SRYA 2HQHA 4G85A 1KMMA 3E9IA 3PIPA 2YRVA 4XK8E 2PTKA 3CCMT 2EL9A 2JOYA 1ZSZC 1G8XA 2A36A 4RCBA 3QDFA 3LSQA 1ARKA 1NE8A 4OVAA 2E3CA 1H641 2JVVA 2FPEA 3OSSC 3A32A 5DM7R 1V1CA 2DL7A 4C8QG 1WQWA 2QAZA 2VASA 2COZA 3PZCA 2A7YA 2DL4A 1U06A 3OYMA 2JM8A 2ZT5A 3QTCA 1SRLA 3R6OA 3CCET 1N8RC 3CEYA 5LJ5f 3REUA 4LNPA 2RNAA 4JRPA 3LW5E 5GAOp 5CK9A 1SF9A 4A4EA 2QA4Q 2DVEA 3R07A 3H8ZA 1OPLA 3QWYA 2GTJA 1ADYA 5K1PA 2HKQB 2AKWA 1JB0E 3QUIA 2CJ9A 3SB2A 2Q5IA 5IT9E 4QT7A 3CCQQ 3ZFJA 1WPYA 1U1TA 3EG3A 1GCQA 4IKFA 5IH2A 1YI2Q 1ABQA 7AT1B 3JB9D 2V8JA
chains in the Genus database with same CATH topology
4EMKC 3SWNB 4M78F 3FRNA 1P92A 2QDYB 2CZ7B 1HC7A 2RHYA 1BBWA 4HWSA 1XTDA 3RL6A 2QA4A 5GMKl 1SETA 3OYAA 4PJOD 3CCQA 4M7AC 3HP9A 1K73C 3I55A 1Q7YC 2RB6A 2K3YA 2XDPA 3OYBA 2IG0A 4M7DB 1M90U 2DK3A 4YRKA 4M77C 3NELA 2FL7A 1BBUA 2A3LA 2DKGA 3OYJA 5GAN6 3VYHB 1YJNA 3CCJT 1E22A 4XTYA 5GAOl 1Y7XA 1I81A 3PMTA 1VIEA 4LDVA 4JRQA 1NJ1A 1ASYA 2O01E 2PVDB 4LD6A 1U1SA 2CJAA 4J7FA 1YFTA 1G3TA 2X4JA 2MI6A 2ODRC 3MEYA 3V7SA 4H2UA 1KG1A 3S3OA 1R8OB 1YJ9T 1G3WA 2FB7A 3DKMA 3HRSA 3M5AA 1VQNT 1I8FA 4BE0A 2AMCA 4OGCA 4P73A 5KE3A 2YLCA 2RHIA 3UH0A 3C94A 3CCSA 4PJOC 3HXVA 2CZ1B 2DQ0A 2K5IA 4P72C 3HTZA 4BD3A 2D9TA 1PSFA 2Y4XA 1BI3A 2JUFA 4AH6A 2ZZDA 1X6OA 2ZXFA 4FL6A 4NOYA 1XNIA 3MF2A 2EQKA 3OYNA 5L8RE 3CMAT 2RHSA 2XU8A 3RERA 2DU7A 4RCCA 1Q81U 3C12A 1BI1A 3M55A 4OLFA 3AHUA 1K9MU 3UGTA 4CH5A 2ZCEA 1M1KC 3TREA 4Q6GA 3DB3A 1B7YB 2KDSA 4R56A 2MMPA 2PU9B 3JB9J 2XG8D 3SDZA 4PL6A 5GMKh 5EG2A 4HWPA 4WJ4A 3O8VA 3V7CA 3VQXA 4B9WA 1FYFA 3SFMA 2LCCA 2RK1A 1VQ7T 4RG2A 4FT4A 4M7DF 3CBPA 4BI3A 5DLQE 1V29B 3CBOA 2FHDA 4II1A 1MGQA 1X55A 4TVAA 4VUBA 2MF2A 2ARUA 5CAIA 4HT8A 3HXXA 1G5HA 3ERRA 2EIFA 4JLGA 3ZBDA 4Q15A 1YFSA 4YTLA 4A4KA 4C8QD 4OB3B 1Q86C 4HT9A 5CIUA 1G3SA 1O9SA 3OW2A 1YJWT 3RKXA 2RK2A 3EAEA 1YHQA 4UP7A 1VQ8T 3P8BB 2DTIA 2E12A 5CCAA 4UPAA 2VXFA 2DIGA 1N9WA 4MDWA 4DOWA 1ZHIA 5CQXA 3CC2T 2QHTA 3LSSA 3ER0A 2JTMA 4M78A 3BW1A 5DY9A 2B8AA 4LNSA 5FU6C 5GAMf 1YGBA 4OP0A 2LNVA 4WF2A 4M78E 2RHSB 4M7DD 2DIQA 2QHSA 4EDUA 1ZQ1A 4XTZA 1ADJA 1VQ6T 3HKSA 3JB9G 3VUZA 3LH0A 2NLUA 1OZ2A 1VQ5A 4JS5A 1M8VA 3ME9A 4BI8B 1YIJA 1N9SA 4KULA 4C8QC 3G71A 2QHUA 1M1FA 3RUXA 1N6AA 3M4YA 3A8GB 1NJ8A 2HNIA 4A4HA 4Q5WA 5FU7B 4JUVA 2D0QB 2XTIA 4XTVA 3A7AA 4LVMA 3Q1JA 2DAQA 3V8KA 1JJCB 3IKLA 4BE2A 3JCMW 3MHXA 4QW2A 4GY5A 2D6FA 2IY5A 5CKFA 4CH4A 3A8HB 4FIBA 4L87A 1E1TA 3NFCA 1VQPT 3PCOA 2GQVA 3OYLA 1VQ4A 1X01A 4HWRA 3JSCA 2LTOA 5GAOq 1NJ6A 2AHJB 3RKYA 4A4FA 3UPUA 4YRCA 2RHZA 1NPPA 1O75A 3BDLA 2LT1A 2EAYA 4OF1A 3PTAA 3VV0A 1JJ2A 2QHVA 3G6EA 3JCMf 2R5AA 4ATOA 4M78G 3M54A 5LJ3d 3G4ST 1K8AC 3DLLA 3M4GA 4HT4A 3QBYA 4YRIA 5CKHA 4YRTA 5KCOA 4ELZC 3OS2A 3SWNA 3ICAA 3VJPA 1GGMA 3FC3A 4J8OA 1C0AA 4H2YA 2V8IA 1LJOA 1EQRA 5GAN3 5A0GA 1OYXA 3JCMQ 3DLMA 3ASKA 4ZTUB 1QVFS 2ARTA 5I2SA 1BIBA 2K2VA 4E7HA 4LD9K 4M7DA 4Y28E 3CCVA 4N4IA 1Y96A 2XD0A 4X34A 4M7DE 1I4K1 2ZZEA 3VBBA 4N4GA 2EQJA 4HCZA 2DXCA 5HGQA 3CMET 2M9UA 2J3LA 4XU2A 1KOGA 3JB9H 3I56T 1EVKA 2P0QA 3QO5A 3CC7T 1RIQA 2X4YA 4E7LA 3VUBA 4Z02A 5IN1A 2LC4A 1JJ2S 4DPGA 1J5WA 3A8MB 4P75A 3QSUA 4HCBA 1M1GA 3NTKA 1Y71A 3MP1A 4C92B 2IY5B 3MEAA 3X26B 4XEMA 4P74C 3LWHA 2L3RA 4OGEA 3PCOB 4YRLA 2EQUA 1NYRA 4J6WA 4L59A 1QP3A 3FIFA 1KHCA 2OTJA 3MQZA 2ZPHB 3CCRT 4RMFA 5IAYA 4ZTFA 1Q82U 2I4NA 2ZGWA 2L5QA 1W66A 3X24B 3UDCA 3GLXA 2EJFA 1USYA 3S3NA 2DJZA 3NTHA 4ME7A 3MEUA 1UGQB 3CCUT 4J6YA 4PLIA 5GAN4 2PUKB 1Y07A 3QZ5B 3C95A 1B7YA 5F5WA 2E6ZA 3MEVA 1G3YA 3VQVA 5GMKe 2F5KA 3HRKA 1RL2A 4H2WA 2I4OA 4C0ZA 3OS1A 1UB4A 4L6V5 4M7DG 1FWZA 5GAMg 5A2QE 3URGA 4BY6B 2E5QA 2QQSA 4R55A 1N8RU 3OYYA 4HVCA 3OD1A 2VV5A 3HFOA 4TQDA 1X75C 2ZZGA 4A53A 1Y96B 3HFZB 3OMCA 4J7IA 5E3IA 1M5Q1 5C6SA 1YJ9A 2O4XB 4QQDA 2KQWA 3T9NA 3V7RA 5FRNA 1H4SA 4LDYA 2QA4T 3LX7A 1QP2A 3X28B 4QVDA 4Y91A 3TU4K 4KT0E 2RO0A 2P0LA 3BFMA 1N27A 3CCQT 2RJEA 4M75B 4JRIA 2J3MA 3JCMb 1ZBXA 1K73U 3GP8A 1YI2T 4C92F 4RQEA 3HY1A 2VGNA 4YREA 1JBMA 1X54A 4UP8A 1VQMT 3CMAA 4IUPA 1Q81C 3P8TA 5GANf 1K9MC 4M78D 4EMKA 1YBYA 5GMKj 4BDYA 1PSEA 1X56A 4OB0B 3IG2A 4IUUA 4CI0C 3JCMe 2MAMA 2RI3A 1XQHA 4M7AA 3MF1A 1M4ZA 3QO8A 2C7IA 3KBGA 2VGMA 5LJ3e 1NPRA 2DO3A 3JCMg 4XTUA 3OBYA 4M77A 4E7KA 3M59A 2LCLA 1I5LA 1PYSA 2ZT7A 2I4LA 4ZIBA 3OY9A 5LJ3g 5HKCA 5KNNA 3LLRA 1YFRA 3IKMB 2DD4A 1KC8C 3M4PA 3CC4A 3L2WA 5CKDA 2EYQA 3UT1A 3TEEA 2E5AA 2CGHA 2DTHA 4IUQA 2P4TA 2E10A 1VQKT 4E7JA 3GNGA 1B76A 5J26A 2VXEA 1LNXA 2E1HA 4LDUA 4C0DB 5C52B 2R5MA 4YCUA 2QI2A 4C92D 4YRJA 4JS4A 4F7UF 3A5ZA 2DD5A 5K1XA 4M78C 1JJCA 3M57A 3QZ9B 1S72A 1UEBA 1VUBA 4ZN3A 3NENA 3HRIA 2QTXA 5A0DA 2PVGB 3HXYA 5CR2A 2RHUA 3OYFA 4EMGA 1M1KU 2ZPEB 3E9HA 2X4WA 4C0GA 2DXUA 4ELYC 4P72A 1OI1A 2GFAA 2JZ2A 4XTXA 3EFRA 3QXEB 2LX9A 2EJGA 1NNHA 4M75F 3CD6A 3DSQA 4H02A 2CZ6B 2RI2A 1GXIE 3CC2A 2KMTA 3JCMc 5LJ3j 2QEXA 3V8JA 5DLOA 3KFUA 4BW9A 2E6NA 4EMKB 3GF5A 4MZTA 5LJ5e 1KMNA 3L2UA 2E41A 2P0KA 1QF6A 3INZA 1VQ6A 3WQZA 3PMIA 5GAMd 1HTTA 5LJ5g 4DA4A 2OTLA 3FLGA 3JCMh 4M7AB 2QQBA 4IUTA 1VQ9A 1VQLA 3LC0A 3HXUA 2RM4A 3OYDA 1Q86U 4M77B 5LJ3h 1B8AA 1WU7A 1LOJA 1PYSB 4PNOA 3OYKA 3W3SA 5KCHA 3PNWC 4O2DA 4K86A 5LL6S 3QO7A 3X20B 2QQRA 5GMKi 4H2SA 4P3NA 1NJIC 3P8HA 2ZT6A 2EJ9A 3E1SA 2P0PA 3QG1A 2RJDA 4BE1A 1UGSB 3QJ6A 3CPWA 2Q7GA 4PKCC 3OW2S 4LVLA 4YCVA 4ZTZB 5HK3A 2ZTGA 3SWNC 5GAN8 3A5ZB 3FJPA 5ELOA 1YB3A 3GOXA 4YRFA 1VQOT 3HXZA 4XU3A 1WYDA 4C92A 4WJ3M 2XI9A 2H3JA 3HL8A 2WSFE 1RI0A 2GFUA 2YHTA 4N0AC 1YIJT 4C92E 1VIFA 4PJOB 4KBMB 2Q7EA 3G71T 2QQ9A 4M7DC 4NL2A 3HXWA 3JCMP 11ASA 2LVMA 3QKJA 3G4SA 2Q5HA 4X9CA 5M9OA 3BY7A 4FU6A 1NZ9A 4P71C 3TUPA 4LVJA 2NS6A 2CZ0B 2CJBA 3JCMd 2HBPA 5GANe 5C0MA 4NCXA 4RDXA 3J80E 2ZZFA 3RGLA 2E65A 5GMKm 3KXTA 1L0WA 4MMKA 3J7AF 3L1AA 2G3RA 3F70A 5GANg 2L8DA 2LQ8A 4D6WA 5LJ5h 2BKDN 2BUDA 3HHTB 1IZ6A 1FXXA 1VQ4T 3L4GA 5GAOm 3FB9A 4E47A 1KQ2A 3OYGA 5A0LA 3A31A 1WJQA 4M7AF 5CO7A 3HPWA 4XU1A 4P5NA 1E1OA 3CBMA 4M77F 4H2XA 4RG8A 1KQ1A 3QPHA 3HSBA 3E19A 3I56A 2QXFA 2ZT8A 3MP6A 1KD1U 3G6ET 3P8VA 4F7UA 2G4CA 3WXMB 3HFZA 1QVPA 4WI1A 5CKBA 4F7UE 5C53B 3FEOA 3CCMA 3LGLA 4ZGDB 4QVZA 2O4XA 4QVCA 1USYC 2R57A 3JRZA 3OYIA 4IUVA 1YITT 4O6JA 3A7RA 3CPFA 1X2HA 2PMFA 3CCLT 4C92G 3NEMA 3OYEA 1HXDA 4DOVA 2LT4A 4TVWA 1G51A 4TVRA 2Q7HA 4CS3A 1B34A 4IURA 4YROA 3HFNA 4M75A 1EIYA 3QO3A 2RJCA 3CCEA 4M75E 4GLKA 1Q82C 2XIDA 4MZMA 4ZN1A 3TEGA 3CCVT 5AYFA 2LDMA 3N5BB 3TEHB 1SERA 1NYQA 4PJOF 3MP8A 2LRQA 4EPCA 1H4VB 2ALYA 2ZPFB 3REXA 2PQWA 3L42A 5J39A 4EX5A 3CCUA 1BIAA 4M7AD 5LJ5d 1H3ZA 1WGSA 4YRSA 1H4QA 3S6WA 3M4QA 5FU6B 2ZINA 2F5TX 1IL2A 5FLXE 4BI4A 4M77D 3A5YA 2FVUA 1OZ3A 2XDDA 5GANh 2KK4A 2ZNIA 3L2VA 3GNFB 2XKOC 2A8EA 4RQFA 4CRIA 4A4GA 1M90C 4YRPA 4C8QB 5GAMe 5CQYA 3L4GB 2ODRD 4YRGA 3CCJA 1AHJB 12ASA 1G5IA 1QW1A 3QYHB 4X5OA 4KUDK 4JDSA 4F7UG 2OTJT 5I2MA 1ATIA 1X2GA 4P73C 1BI2A 2CIMA 4H2XB 4NS5A 2EWNA 2ZNJA 2KAFA 3OS0A 3VQYA 1UGRB 5HK0A 2F69A 4F7UB 2Y90A 3C4SA 3GPLA 2GF7A 1VQZA 4P74A 5FRMA 3NTIA 1YI2A 4PG3A 2QQAA 2M1HA 4M75G 1SESA 4YPFA 3QIIA 1UGPB 1VQMA 4XU0A 1VQNA 2XDBA 2RD1A 3RKWA 3RACA 1B34B 4P3OA 1W4SA 2K5FA 1EIYB 3I55T 3WVDB 1TH7A 4KUIA 2BIVA 4YRRA 4BDZA 5KE2A 1Q7YU 3OYCA 4QQ6A 4JJNK 4FM4B 4H2VA 2EFIA 5HY6A 1DJ7B 2RJFA 3TCJA 1YJNT 5FU7C 4BB7A 5GANd 5GAOn 3GIBA 2VYTA 3UGQA 4YP0A 2Y4YA 5GAMj 2ALYB 3VQWA 3J81E 2WSEE 2PVOB 2V8KA 3META 4TWAA 3OS5A 4CS2A 3LWIA 4HA8A 2HD0A 2FYKA 1EIFA 2K4YA 1XOVA 3EFSA 3P8DA 1KHIA 4TVYA 3OB9A 4YYEA 3SD4A 2RHQA 3OBWA 4M7AE 3HRTA 3A8LB 2XHCA 1H4TA 2ZR2A 4J6XA 4LVIA 1B70A 4CH3A 3E9FA 1VQKA 4V2SA 1VQ7A 3RMSA 4M77E 4C8QF 4P3PA 4C5IA 2P5IA 4YRQA 1WJRA 1NJ2A 5J3BA 4CH6A 1YCYA 5GAMh 2AKWB 1KQSA 2CYZB 4HWOA 3CCST 3PT9A 2IVWA 3FDRA 2I2LA 2JNGA 2ZPBB 4QQGA 3L2QA 3JB9I 2K3XA 1LYLA 4YDQA 2RA2A 4TQFA 3M53A 4YRNA 4J15A 4PLLA 4J5YA 1D3BA 4K87A 5D6WA 2R58A 3VKIA 4ZTJA 4FT2A 2DQ3A 4C0FA 2HQEA 3QDRB 3A7UA 4RMOA 1YJWA 4PJOA 2E64A 3CC4T 1KC8U 1VQ8A 3UFGA 4PJOE 2DDZA 3A74A 4KR2A 1WLEA 2I4MA 3H6ZA 1WQ7A 3MEWA 2CKKA 4OMFB 2JTFA 2ZIOA 4OB1B 2OAUA 2KSSA 4CS4A 2C06A 3V8LA 1S72T 3QHSA 2RI5A 4E7IA 2YLBA 3KUFA 2ZPGB 3WVEB 4ZGJB 1KQSS 4KQEA 3QYGB 4LVKA 2DEQA 1WJSA 5CKEA 4M7AG 2GCXA 2RH2A 2DZCA 3X25B 1BYMA 3S3MA 4JLIA 4HKEA 4C92C 4M77G 1W2BA 4N4HA 4MDXA 2AMCB 3E9GA 5I21A 2X35A 5CVIA 3CD6T 2RHQB 4OB2B 4HWTA 1N9RA 3CXCA 1QVGA 2MWPA 2KVQG 1B70B 2QEXT 2WSCE 1YHQT 2K5LA 3IALA 4EO4A 2XGTA 4TTVA 3M9QA 3CMQA 3JCMV 2WACA 3QNEA 2HQXA 2VUBA 1U8RA 5C51B 4XEOA 3LYIA 4H2TA 3MO8A 3VYGA 1VQOA 5GAN5 2HAXA 3BJUA 4YRMA 1WNLA 1ASZA 2EQMA 4KR3A 3UWNA 4M75D 1VQPA 2MWOA 2OTLT 5D6YA 2JN0A 4X9DA 1VQ9T 1VQLT 1D3BB 4XTWA 4BACA 4C5EA 3OA6A 3A8OB 4PJOG 2DXBA 4EMHA 2X4XA 2ARSA 2DPPB 4BUGA 3MCAB 4BY6C 5GAN2 1VQ5T 1HK9A 4YCWA 4UP9A 2XK0A 4E51A 4J83A 4B9XA 3TEHA 3PIOA 3L2ZA 1JRIA 2PMEA 5LJ5j 1QVFA 4L5GA 1W2BS 5ELNA 4MMLA 3P8YA 4TVAB 1NJIU 2L89A 3OQ5A 2ZIMA 2C8MA 3PGGA 1Z7MA 1EVLA 2XICA 3HY0A 5D6XA 3CXCS 1QVGS 4ZGEB 1G5VA 4LDWA 4K88A 2DZ9A 1EOVA 2DXTA 4BWAA 1MHNA 4HCCA 3OMGA 4PHCA 3LGFA 4LDXA 4UC4A 2M16A 4G84A 2E70A 1SSFA 2VC8A 3PFSA 4M75C 1Z7NA 2ZPIB 4C8QA 4JRKA 2PUOB 4NL3A 1KD1C 1NJ5A 4P75C 3JAME 3M58A 2KY9A 2DU5A 4C8QE 1IREB 4RKUE 2ZCFB 3CPWS 3JCMX 3RESA 3L2RA 5LJ3f 3OSVA 3CMEA 3RIRA 5FROA 1YITA 4M78B 4A54A 3HRUA 3CCLA 3CC7A 2LQKA 3M56A 3HFVA 3QJYA 4C5GA 2RHXA 4N0AA 3VU3C 3G1ZA 5GAN7 1K8AU 4O5VA 2M0OA 1BI0A 3G7ZA 1FX7A 3I7FA 1BKBA 3OYHA 3ZEHA 4C5HA 3BDUA 5GAOr 4P71A 3JCMJ 3NETA 3RF1A 1M9SA 3DB4A 3JB9F 3RMQA 4XAXB 2CS7A 5GANj 2DTOA 4FSXA 4DQ2A 3CCRA 4XQ3A 5KH6A 1QE0A 2ZR3A 4MZPA 2K57A 1E24A 2EKOA 1EFWA 4C0DC 1SRYA 4G85A 1KMMA 3E9IA 3PIPA 2YRVA 4XK8E 3CCMT 2EL9A 2JOYA 4RCBA 3LSQA 1NE8A 4OVAA 2E3CA 1H641 2JVVA 3OSSC 3A32A 5DM7R 4C8QG 1WQWA 3PZCA 2A7YA 3OYMA 2ZT5A 3QTCA 3R6OA 3CCET 1N8RC 3CEYA 5LJ5f 3REUA 4JRPA 3LW5E 5GAOp 5CK9A 4A4EA 2DVEA 3R07A 3H8ZA 1ADYA 5K1PA 2AKWA 1JB0E 3QUIA 2CJ9A 3SB2A 2Q5IA 5IT9E 3ZFJA 1WPYA 1U1TA 4IKFA 3JB9D 2V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK C;  4HWO A;  1EQR A;  5GAN 3;  1LOJ A;  1PYS B;  3SWN B;  4PNO A;  4M78 F;  3W3S A;  2I2L A;  3JCM Q;  4ZTU B;  1HC7 A;  2ART A;  1BBW A;  4HWS A;  3JB9 I;  3RL6 A;  1BIB A;  1LYL A;  4O2D A;  4K86 A;  3QO7 A;  4M7D A;  4YDQ A;  5GMK i;  4H2S A;  5GMK l;  1SET A;  2RA2 A;  4P3N A;  4TQF A;  4PJO D;  1Y96 A;  4M7A C;  4YRN A;  4J15 A;  4M7D E;  1I4K 1;  4J5Y A;  1D3B A;  2ZT6 A;  2EJ9 A;  2ZZE A;  4K87 A;  2RB6 A;  3VBB A;  4M7D B;  5HGQ A;  4YRK A;  4M77 C;  3NEL A;  1BBU A;  2Q7G A;  2DQ3 A;  2DKG A;  2J3L A;  5GAN 6;  3A7U A;  4YCV A;  4ZTZ B;  2ZTG A;  3SWN C;  1E22 A;  4XU2 A;  1KOG A;  4XTY A;  5GAN 8;  5GAO l;  3FJP A;  1I81 A;  3JB9 H;  1EVK A;  1NJ1 A;  3QO5 A;  1ASY A;  5ELO A;  1YB3 A;  4PJO A;  1U1S A;  2E64 A;  4YRF A;  1RIQ A;  3HXZ A;  4XU3 A;  2CJA A;  1WYD A;  4C92 A;  4WJ3 M;  3UFG A;  1YFT A;  4PJO E;  2DDZ A;  3A74 A;  1J5W A;  4DPG A;  4KR2 A;  1WLE A;  2I4M A;  4P75 A;  1WQ7 A;  2YHT A;  4N0A C;  3QSU A;  4C92 E;  4PJO B;  2Q7E A;  2ODR C;  3MEY A;  4M7D C;  3V7S A;  4C92 B;  4NL2 A;  2ZIO A;  2IY5 B;  3HXW A;  3JCM P;  4H2U A;  11AS A;  4XEM A;  4P74 C;  2Q5H A;  4X9C A;  3BY7 A;  3PCO B;  4YRL A;  4CS4 A;  4P71 C;  3V8L A;  3TUP A;  2FB7 A;  1NYR A;  3QHS A;  4J6W A;  2YLB A;  2CJB A;  3FIF A;  3JCM d;  4KQE A;  1I8F A;  5GAN e;  2DEQ A;  4M7A G;  2AMC A;  4NCX A;  4RDX A;  2ZZF A;  4RMF A;  2E65 A;  5GMK m;  4P73 A;  3RGL A;  2YLC A;  1L0W A;  2DZC A;  4MMK A;  3UH0 A;  4PJO C;  3HXV A;  2I4N A;  4JLI A;  2DQ0 A;  2ZGW A;  3L1A A;  4P72 C;  4C92 C;  4M77 G;  3HTZ A;  1W66 A;  5GAN g;  4AH6 A;  2AMC B;  5I21 A;  2EJF A;  2ZXF A;  5LJ5 h;  1USY A;  4NOY A;  2DJZ A;  3MF2 A;  2RHQ B;  3L4G A;  2RHS A;  4HWT A;  1N9R A;  5GAO m;  3RER A;  3FB9 A;  2DU7 A;  1KQ2 A;  4RCC A;  4J6Y A;  5GAN 4;  3A31 A;  4M7A F;  1B7Y A;  1B70 B;  5F5W A;  4OLF A;  4XU1 A;  3VQV A;  3AHU A;  3IAL A;  5GMK e;  3UGT A;  4CH5 A;  4EO4 A;  1E1O A;  2ZCE A;  2XGT A;  4TTV A;  3HRK A;  4H2W A;  4M77 F;  2I4O A;  3CMQ A;  4H2X A;  4M7D G;  1KQ1 A;  3JCM V;  3HSB A;  4Q6G A;  5GAM g;  1B7Y B;  3QNE A;  2ZT8 A;  5C51 B;  4XEO A;  3JB9 J;  4H2T A;  5GAN 5;  3P8V A;  4F7U A;  2G4C A;  5GMK h;  4WJ4 A;  4HWP A;  3BJU A;  3HFZ A;  4HVC A;  4YRM A;  1WNL A;  1ASZ A;  4WI1 A;  3OD1 A;  4KR3 A;  4F7U E;  3HFO A;  4TQD A;  4M75 D;  5C53 B;  2JN0 A;  4X9D A;  3V7C A;  2ZZG A;  3VQX A;  4A53 A;  1FYF A;  1Y96 B;  4QVC A;  1USY C;  3HFZ B;  1D3B B;  4XTW A;  4M7D F;  4PJO G;  5E3I A;  3A7R A;  1X2H A;  2PMF A;  1M5Q 1;  4EMH A;  4C92 G;  2ARS A;  3NEM A;  1HXD A;  4TVW A;  1G51 A;  2Q7H A;  4CS3 A;  1B34 A;  5GAN 2;  1HK9 A;  4YRO A;  4YCW A;  4UP9 A;  4E51 A;  3HFN A;  3V7R A;  4M75 A;  1EIY A;  3TEH A;  3QO3 A;  1MGQ A;  1X55 A;  4TVA A;  1H4S A;  3L2Z A;  1JRI A;  2PME A;  5LJ5 j;  2ARU A;  4QVD A;  4M75 E;  4Y91 A;  5CAI A;  5ELN A;  3TEG A;  4HT8 A;  4MML A;  3HXX A;  2P0L A;  3BFM A;  4M75 B;  4JRI A;  1G5H A;  3TEH B;  1SER A;  3P8Y A;  3ERR A;  1NYQ A;  4TVA B;  4PJO F;  2J3M A;  3JCM b;  1H4V B;  2ZIM A;  4Q15 A;  2C8M A;  1YFS A;  3PGG A;  4C92 F;  4RQE A;  3HY1 A;  1Z7M A;  2ALY A;  1EVL A;  4C8Q D;  3HY0 A;  4YRE A;  1JBM A;  3REX A;  1X54 A;  4HT9 A;  4UP8 A;  4K88 A;  4EX5 A;  1BIA A;  4M7A D;  2DZ9 A;  5LJ5 d;  1EOV A;  2DXT A;  4YRS A;  3RKX A;  3M4Q A;  1H4Q A;  4BWA A;  3P8T A;  2ZIN A;  5GAN f;  4PHC A;  1IL2 A;  4M78 D;  4EMK A;  4UP7 A;  5GMK j;  4M77 D;  3A5Y A;  4G84 A;  1X56 A;  3IG2 A;  2DTI A;  2VC8 A;  4M75 C;  1Z7N A;  4C8Q A;  4JRK A;  4NL3 A;  4P75 C;  1NJ5 A;  5GAN h;  2ZNI A;  3JCM e;  4UPA A;  2DU5 A;  2VXF A;  1N9W A;  4C8Q E;  4M7A A;  4RQF A;  3MF1 A;  3QO8 A;  2C7I A;  2QHT A;  4YRP A;  3LSS A;  4C8Q B;  5LJ3 e;  4M78 A;  3BW1 A;  5DY9 A;  3JCM X;  5GAM e;  3RES A;  3JCM g;  4XTU A;  5LJ3 f;  4LNS A;  4M77 A;  5GAM f;  1YGB A;  4OP0 A;  3L4G B;  4WF2 A;  4M78 E;  3RIR A;  1I5L A;  2ODR D;  4YRG A;  2RHS B;  4M7D D;  1PYS A;  12AS A;  2ZT7 A;  2I4L A;  1G5I A;  4ZIB A;  5LJ3 g;  4X5O A;  4M78 B;  4A54 A;  2QHS A;  4F7U G;  4XTZ A;  1ATI A;  1X2G A;  1YFR A;  3IKM B;  5KNN A;  1ADJ A;  4P73 C;  3M4P A;  3HFV A;  3JB9 G;  2CIM A;  4H2X B;  1M8V A;  2E5A A;  2CGH A;  2EWN A;  2ZNJ A;  4N0A A;  1N9S A;  2DTH A;  3VU3 C;  3G1Z A;  3VQY A;  5GAN 7;  4C8Q C;  4F7U B;  2Y90 A;  2E10 A;  2QHU A;  3I7F A;  1B76 A;  2VXE A;  1LNX A;  1VQZ A;  2E1H A;  4P74 A;  5C52 B;  3RUX A;  3BDU A;  4YCU A;  4C92 D;  5GAO r;  4YRJ A;  4F7U F;  3A5Z A;  5K1X A;  4M78 C;  4PG3 A;  1NJ8 A;  3JCM J;  1JJC A;  4P71 A;  2HNI A;  3NET A;  3RF1 A;  4M75 G;  1SES A;  4YPF A;  4JUV A;  3JB9 F;  2XTI A;  4XTV A;  3NEN A;  3HRI A;  2QTX A;  3HXY A;  3A7A A;  4XU0 A;  5GAN j;  2DTO A;  4EMG A;  2RD1 A;  4DQ2 A;  3RKW A;  3E9H A;  4XQ3 A;  3V8K A;  1JJC B;  1QE0 A;  2ZR3 A;  3RAC A;  3IKL A;  1B34 B;  2DXU A;  4P3O A;  3JCM W;  2K57 A;  1E24 A;  4P72 A;  1EIY B;  1TH7 A;  2IY5 A;  4CH4 A;  1EFW A;  4XTX A;  4L87 A;  4YRR A;  1SRY A;  1E1T A;  3EFR A;  4G85 A;  1KMM A;  3E9I A;  3PCO A;  2EJG A;  1NNH A;  2EL9 A;  4M75 F;  4H2V A;  3DSQ A;  4H02 A;  1X01 A;  4HWR A;  4RCB A;  5GAN d;  3LSQ A;  5GAO n;  3JCM c;  3GIB A;  5GAO q;  5LJ3 j;  1NJ6 A;  3UGQ A;  4YP0 A;  3RKY A;  5GAM j;  2ALY B;  2E3C A;  3VQW A;  1H64 1;  4YRC A;  3V8J A;  3A32 A;  2EAY A;  4C8Q G;  1WQW A;  3PZC A;  4TWA A;  3KFU A;  4BW9 A;  4CS2 A;  2ZT5 A;  4HA8 A;  4EMK B;  3QTC A;  2FYK A;  5LJ5 e;  1KMN A;  2QHV A;  3JCM f;  3EFS A;  2E41 A;  5LJ5 f;  1QF6 A;  3REU A;  4TVY A;  3INZ A;  4YYE A;  4M78 G;  5GAO p;  2RHQ A;  5LJ3 d;  3WQZ A;  5GAM d;  4M7A E;  1HTT A;  3M4G A;  1H4T A;  5LJ5 g;  2ZR2 A;  4YRI A;  2DVE A;  3R07 A;  4J6X A;  1ADY A;  1B70 A;  4CH3 A;  5K1P A;  2AKW A;  3JCM h;  4M7A B;  4YRT A;  3QUI A;  4V2S A;  3SB2 A;  2CJ9 A;  2Q5I A;  3SWN A;  3LC0 A;  1WPY A;  3ICA A;  4M77 E;  4C8Q F;  1U1T A;  3HXU A;  4P3P A;  2RM4 A;  2P5I A;  4YRQ A;  1GGM A;  1NJ2 A;  1C0A A;  4M77 B;  5LJ3 h;  4H2Y A;  1B8A A;  4CH6 A;  1LJO A;  1YCY A;  5GAM h;  1WU7 A;  3JB9 D;  2AKW B; 
#chains in the Genus database with same CATH topology
 4EMK C;  1GFD A;  2M0Y A;  3SWN B;  1ZX6 A;  4M78 F;  1VQM Q;  1AWX A;  3FRN A;  1P92 A;  2QDY B;  2CZ7 B;  3EG1 A;  1HC7 A;  2RHY A;  1BBW A;  4HWS A;  1XTD A;  3RL6 A;  2QA4 A;  2KYM A;  5GMK l;  1SET A;  3OYA A;  4PJO D;  3CCQ A;  4M7A C;  3HP9 A;  1K73 C;  3I55 A;  2DVJ A;  1Q7Y C;  2RB6 A;  2K3Y A;  2XDP A;  3OYB A;  2K79 A;  2IG0 A;  4M7D B;  1M90 U;  2DK3 A;  3RDV A;  4YRK A;  2KR3 A;  4M77 C;  5I11 A;  2FL7 A;  1BBU A;  3NEL A;  2A3L A;  1M8M A;  2DKG A;  2LMJ A;  3M0T A;  3OYJ A;  5GAN 6;  3VYH B;  1YJN A;  3CCJ T;  1E22 A;  1NYG A;  4XTY A;  5GAO l;  1Y7X A;  1I81 A;  2DBM A;  3PMT A;  1VIE A;  4LDV A;  4JRQ A;  2CDT A;  1NJ1 A;  4KH1 B;  1ASY A;  2O01 E;  2JMA A;  2PVD B;  4FYV B;  4LD6 A;  1U1S A;  4PJJ A;  2CJA A;  4J7F A;  1IHW A;  1YFT A;  1G3T A;  4FSS A;  2K6D A;  2OI3 A;  4J9G A;  1J3T A;  2X4J A;  2X3W D;  2MI6 A;  2DIL A;  2ODR C;  3MEY A;  3V7S A;  2K7A A;  4H2U A;  1KG1 A;  3UAT A;  2HZY A;  2BZ8 A;  3S3O A;  1ZUU A;  1OU8 A;  3FJ5 A;  1R8O B;  5I22 A;  1YJ9 T;  1G3W A;  1VQK Q;  1QQJ A;  2FB7 A;  3DKM A;  1ZA1 B;  1GCP A;  2LP5 A;  3HRS A;  3M5A A;  1VQN T;  1I8F A;  4BE0 A;  2AMC A;  4OGC A;  4P73 A;  5KE3 A;  2YLC A;  2RHI A;  3UH0 A;  3C94 A;  3CCS A;  4PJO C;  3HXV A;  2CZ1 B;  1IHV A;  2FRW A;  5IHK A;  2DQ0 A;  2K5I A;  4P72 C;  2HBW A;  4IIO A;  3HTZ A;  1YN8 A;  2MK5 A;  4BD3 A;  2D9T A;  2K2M A;  1PSF A;  2Y4X A;  1BI3 A;  2JT4 A;  2JUF A;  4AH6 A;  2ZZD A;  1X6O A;  4OMM A;  2ZXF A;  2X3X D;  1WDX A;  4FL6 A;  4NOY A;  2CP5 A;  2DF6 A;  1XNI A;  3MF2 A;  1UTI A;  2EQK A;  3OYN A;  4PFZ A;  1ZA2 B;  4ZNX A;  5L8R E;  3CMA T;  2RHS A;  2XU8 A;  3RER A;  2DU7 A;  5KYX B;  4RCC A;  6AT1 B;  1Q81 U;  3C12 A;  3MJX A;  1BI1 A;  2M02 A;  3M55 A;  4OLF A;  3AHU A;  1K9M U;  3UGT A;  4CH5 A;  1TU0 B;  1NLO C;  2ZCE A;  2F2V A;  4ANJ A;  1M1K C;  3TRE A;  1X27 A;  4Q6G A;  3DB3 A;  1B7Y B;  2KDS A;  4R56 A;  2MMP A;  2PU9 B;  1OUL A;  3JB9 J;  1TOV A;  2XG8 D;  3SDZ A;  4PL6 A;  5GMK h;  5EG2 A;  4HWP A;  4WJ4 A;  3O8V A;  5HCK A;  1FMV A;  3TQ7 P;  4RTW A;  2JTE A;  2J06 A;  1WYX A;  2DMO A;  3V7C A;  3VQX A;  4B9W A;  1FYF A;  3SFM A;  2LCC A;  4PK4 A;  2RK1 A;  1VQ7 T;  4RG2 A;  2ZAE A;  2GTO A;  4E7Z A;  3VS1 A;  4PFP A;  4FT4 A;  2VKN A;  4M7D F;  1LVK A;  1VYU A;  3CBP A;  4BI3 A;  5DLQ E;  2RF0 A;  1V29 B;  2DYI A;  3CBO A;  2FHD A;  4II1 A;  1M2V A;  3VS0 A;  2LZ6 B;  1W70 A;  1MGQ A;  1X55 A;  4TVA A;  4VUB A;  2MF2 A;  3CPW P;  2D0N A;  4RTU A;  2ARU A;  4E7S A;  5CAI A;  2E4H A;  1ACM B;  4HT8 A;  3HXX A;  3G1J A;  2JXB A;  2YWW A;  3M0R A;  1WHG A;  1G5H A;  3ERR A;  2V1Q A;  2EIF A;  4JLG A;  3ZBD A;  3AT1 B;  4Q15 A;  1YFS A;  4YTL A;  3EGX B;  4A4K A;  1V76 A;  1BCO A;  4C8Q D;  3NHN A;  4OB3 B;  1Q86 C;  4HT9 A;  2DFU A;  5CIU A;  1G3S A;  1O9S A;  3OW2 A;  1YJW T;  3RKX A;  2EGA A;  2RK2 A;  2LNH B;  3EAE A;  1YHQ A;  4UP7 A;  1TSF A;  1NLP C;  1VQ8 T;  3P8B B;  2DTI A;  2E12 A;  2GGR A;  5CCA A;  2YRD A;  1LCK A;  5IXB A;  4UPA A;  1VQO Q;  2VXF A;  2DIG A;  1N9W A;  5IHI A;  4E2F B;  4MDW A;  4DOW A;  1ZHI A;  5CQX A;  3CC2 T;  2QHT A;  3LSS A;  1YIJ Q;  3ER0 A;  2JTM A;  4M78 A;  3BW1 A;  5DY9 A;  5L23 A;  2B8A A;  4LNS A;  5FU6 C;  4PFO A;  3G71 Q;  5GAM f;  1YGB A;  4OP0 A;  2VWF A;  1B07 A;  2LNV A;  1KFZ A;  4WF2 A;  4M78 E;  1PRM C;  2RHS B;  4M7D D;  1BCM A;  2E5K A;  1AZE A;  4EIK A;  2DIQ A;  4D8K A;  2QHS A;  4EDU A;  1ZQ1 A;  4XTZ A;  1ADJ A;  3C0C A;  1VQ6 T;  3HKS A;  3JB9 G;  3VUZ A;  3LH0 A;  2NLU A;  1OZ2 A;  1VQ5 A;  2YUQ A;  4JS5 A;  1M8V A;  3ME9 A;  4BI8 B;  1XJW B;  1YIJ A;  1N9S A;  2D8H A;  4KUL A;  2CP2 A;  4C8Q C;  3G71 A;  2QHU A;  2QTV A;  1M1F A;  5KYW B;  4AG2 C;  3RUX A;  1N6A A;  2FO0 A;  3EH1 A;  3M4Y A;  3A8G B;  1NJ8 A;  2HNI A;  4A4H A;  4Q5W A;  1KD1 R;  2KEA A;  5FU7 B;  1VQ4 Q;  4JUV A;  2D0Q B;  2XTI A;  4XTV A;  3NPF A;  1FMK A;  2JS0 A;  1OX8 A;  3THK A;  3A7A A;  4LVM A;  1KJW A;  2Z0W A;  3Q1J A;  1X43 A;  2DAQ A;  3V8K A;  2DEU A;  1JJC B;  3IKL A;  1EFN A;  4BE2 A;  3JCM W;  3MHX A;  4QW2 A;  5FWC A;  1MUZ A;  4GY5 A;  2D6F A;  2IY5 A;  1JU5 C;  5CKF A;  4CH4 A;  1SHF A;  4FIB A;  3A8H B;  4L87 A;  2QAS A;  1E1T A;  1PC0 A;  3NFC A;  1VQP T;  1QKW A;  3PCO A;  2GQV A;  3G6E Q;  3OYL A;  2KT1 A;  1VQ4 A;  1X01 A;  4HWR A;  3JSC A;  2P4R A;  2DE0 X;  2LTO A;  5GAO q;  1NJ6 A;  2J6O A;  2AHJ B;  3RKY A;  4B6M A;  2FG0 A;  4A4F A;  2O31 A;  3UPU A;  4YRC A;  2RHZ A;  1NPP A;  1O75 A;  3BDL A;  2LT1 A;  2EAY A;  4OF1 A;  3H0I A;  2CUB A;  2FPD A;  1YIT Q;  3PTA A;  2KRN A;  3CCL Q;  3VV0 A;  1JJ2 A;  1YNZ A;  3HTR A;  1WHK A;  2QHV A;  3G6E A;  3JCM f;  4J9F A;  2R5A A;  4ATO A;  2CP3 A;  4M78 G;  3M54 A;  1X2K A;  5LJ3 d;  3G4S T;  1K8A C;  3DLL A;  2ED0 A;  3M4G A;  4HT4 A;  3QBY A;  4YRI A;  5CKH A;  1Z9Q A;  1FMW A;  4YRT A;  3CCV Q;  5KCO A;  4ELZ C;  3OS2 A;  3SWN A;  3ICA A;  3QWX X;  3VJP A;  1IGU A;  4FYY B;  1GGM A;  3FC3 A;  1NM7 A;  4J8O A;  1SEM A;  1I07 A;  1C0A A;  4H2Y A;  2V8I A;  1LJO A;  2EYW A;  1EQR A;  5GAN 3;  4J9I A;  1MMA A;  2LQW A;  5A0G A;  1OYX A;  4F17 A;  4GBQ A;  3JCM Q;  3DLM A;  3ASK A;  4ZTU B;  1QVF S;  2ART A;  4RTX A;  5I2S A;  1D0Y A;  1BIB A;  2K2V A;  4E7H A;  4LD9 K;  4M7D A;  4Y28 E;  2OAW A;  3CCV A;  2RPN A;  4N4I A;  1Y96 A;  2XD0 A;  4X34 A;  4M7D E;  1I4K 1;  2ZZE A;  1QMC A;  2G6F X;  3VBB A;  1AZG B;  4N4G A;  2EQJ A;  4HCZ A;  2DXC A;  2DET A;  2ED1 A;  5IHN A;  5HGQ A;  4R0K A;  2MOX A;  3CME T;  2M9U A;  1HYO A;  2J3L A;  1N8R R;  3H41 A;  2CH4 W;  4XU2 A;  1KOG A;  1R0C B;  3JB9 H;  1GCQ C;  3I56 T;  1EVK A;  2P0Q A;  3QO5 A;  4DEY A;  1T0J A;  3CC7 T;  1RIQ A;  2EQI A;  2X4Y A;  4E7L A;  2J7I A;  3VUB A;  4Z02 A;  5IN1 A;  2LC4 A;  1JJ2 S;  4DPG A;  1J5W A;  1PG5 B;  3A8M B;  4P75 A;  3H0H A;  3QSU A;  2OTJ Q;  2EBP A;  2EVR A;  2NUT B;  5D7U A;  1M1G A;  4HCB A;  1H8K A;  3NTK A;  1Y71 A;  3MP1 A;  2O2O A;  4C92 B;  2IY5 B;  2AK5 A;  3MEA A;  1YWO A;  5AT1 B;  3X26 B;  4RTZ A;  4XEM A;  1GBQ A;  1PNJ A;  4P74 C;  3LWH A;  2L3R A;  4OGE A;  4HCK A;  3RR6 A;  3PCO B;  2CP0 A;  4YRL A;  2EQU A;  1U3O A;  4K11 A;  1NYR A;  4J6W A;  2AKK A;  4L59 A;  1QP3 A;  3FIF A;  1JQQ A;  2B86 A;  3U23 A;  1KHC A;  1K73 R;  2OTJ A;  3MQZ A;  2ZPH B;  1Q7Y R;  3CCR T;  4RMF A;  3IQL A;  2L0A A;  5IAY A;  4ZTF A;  5KYY B;  1RAH B;  1QKX A;  1Q82 U;  2I4N A;  2ZGW A;  1WHJ A;  2L5Q A;  1W66 A;  1Z9Z A;  3X24 B;  5KYX A;  4M4Z A;  2KGT A;  1R0B G;  5FW9 A;  2H8H A;  3UDC A;  1MV3 A;  2YDL A;  2EJF A;  3GLX A;  2VVK A;  4J9H A;  1USY A;  3S3N A;  2DJZ A;  3NTH A;  4ME7 A;  1PHT A;  2BTT A;  3MEU A;  1UGQ B;  3I55 Q;  2MYS A;  3CCU T;  3LH5 A;  4J6Y A;  2DL8 A;  4PLI A;  5GAN 4;  2PUK B;  3TSW A;  1Y07 A;  3QZ5 B;  3C95 A;  4KGV B;  2IPO B;  1B7Y A;  5F5W A;  2E6Z A;  3MEV A;  1G3Y A;  2ROL A;  4DBQ A;  1OU9 A;  3VQV A;  4OMQ A;  5GMK e;  2EPD A;  2F5K A;  1YJN Q;  1RL2 A;  3HRK A;  4H2W A;  4C0Z A;  3OS1 A;  2I4O A;  1UB4 A;  4L6V 5;  4M7D G;  3SEM A;  1FWZ A;  5GAM g;  5A2Q E;  3URG A;  4BY6 B;  2E5Q A;  1ZBJ A;  2QQS A;  4R55 A;  1TXQ A;  1N8R U;  3OYY A;  4HVC A;  3OD1 A;  1D1A A;  2VV5 A;  3VS3 A;  3HFO A;  1KQS P;  4TQD A;  1HSQ A;  1X75 C;  1MNE A;  2SEM A;  2ZZG A;  1CSK A;  4A53 A;  1ZSZ A;  1Y96 B;  2BE9 B;  3HFZ B;  3OMC A;  4J7I A;  5E3I A;  1OQK A;  1M5Q 1;  1QLY A;  5C6S A;  1B7T A;  2KXD A;  3ZL7 C;  1YJ9 A;  2O4X B;  4QQD A;  1RAC B;  2KQW A;  3EG0 A;  3T9N A;  3V7R A;  1CKB A;  5FRN A;  1H4S A;  4LDY A;  2QA4 T;  3LX7 A;  1QP2 A;  4RUG A;  3X28 B;  1N5Z A;  2KRS A;  2NUP B;  4QVD A;  3EGX A;  4Y91 A;  2HL5 C;  3CCS Q;  3TU4 K;  4KT0 E;  2RO0 A;  1OPK A;  2P0L A;  3BFM A;  1UDL A;  5KYN A;  1N27 A;  3CCQ T;  2RJE A;  4M75 B;  4JRI A;  1YP5 A;  1NG2 A;  1M27 C;  4FYX B;  2MCN A;  1G83 A;  2J3M A;  4AG1 C;  3JCM b;  1ZBX A;  4A63 B;  3GP8 A;  1K73 U;  1M1K R;  1D1B A;  1YI2 T;  1M2O A;  4C92 F;  1RLQ C;  4RQE A;  4X1V A;  3HY1 A;  1IGQ A;  2L3Q A;  1WHM A;  2VGN A;  1RI9 A;  4YRE A;  2AT1 B;  2A28 A;  2O88 A;  1JBM A;  1X54 A;  4UP8 A;  1VQM T;  3CMA A;  4IUP A;  1Q81 C;  2HDA A;  2W10 A;  3P8T A;  1VA7 A;  5GAN f;  4KGX B;  3KFV A;  1K9M C;  4JJC A;  4M78 D;  4EMK A;  4AT1 B;  1YBY A;  1D0X A;  5KYU B;  5GMK j;  4BDY A;  1IXD A;  1PSE A;  1X56 A;  4OB0 B;  3IG2 A;  1UGV A;  4IUU A;  4KGZ B;  1EZZ B;  4CI0 C;  2KBT A;  1K1Z A;  3JCM e;  2MAM A;  2RI3 A;  3CC4 Q;  1XQH A;  4M7A A;  2GNC A;  1E6G A;  3MF1 A;  1M4Z A;  3QO8 A;  2C7I A;  1ZSG A;  3KBG A;  4DBH A;  3VS6 A;  2VGM A;  1E7O A;  5LJ3 e;  2DRK A;  1GL5 A;  1K4U S;  1KSW A;  1NPR A;  2DO3 A;  3JCM g;  4XTU A;  1MMN A;  3OBY A;  4M77 A;  3D7S B;  4J9C A;  4E7K A;  2YT6 A;  3M59 A;  2ESW A;  2LCL A;  1I5L A;  1W2B P;  1AT1 B;  1KIK A;  2FZK B;  1WI7 A;  1PYS A;  1T3L A;  2ZT7 A;  2I4L A;  4ZIB A;  3OY9 A;  1WFW A;  5LJ3 g;  3M0P A;  2QYZ A;  4Z8A A;  5HKC A;  5KNN A;  3LLR A;  1YFR A;  3IKM B;  2YSQ A;  3PE0 A;  2DD4 A;  1KC8 C;  1UJY A;  3M4P A;  1UG1 A;  4JJD A;  3EGU A;  3CC4 A;  3L2W A;  5CKD A;  2EYQ A;  4FW1 A;  3UT1 A;  3CXC P;  1LPL A;  3TEE A;  1QVG P;  9ATC B;  1B3Q A;  2E5A A;  2CGH A;  5KYW A;  1RAD B;  2DTH A;  4LUD A;  1Q86 R;  4IUQ A;  2AKL A;  2P4T A;  1D09 B;  1UHF A;  1WX6 A;  2E10 A;  1AEY A;  1VQK T;  1RAG B;  4E7J A;  3GNG A;  3EG2 A;  1B76 A;  2LJ1 A;  5J26 A;  2VXE A;  1LNX A;  4CC2 A;  2E1H A;  4LDU A;  4C0D B;  5C52 B;  2R5M A;  4YCU A;  2QI2 A;  4C92 D;  2D8J A;  3UA6 A;  4YRJ A;  4JS4 A;  4F7U F;  3A5Z A;  2DD5 A;  5K1X A;  4M78 C;  1ZSZ B;  2ROT A;  1JJC A;  3M57 A;  3QZ9 B;  3CD6 Q;  1JO8 A;  1UEB A;  1S72 A;  1VUB A;  4ZN3 A;  3NEN A;  3HRI A;  2QTX A;  5A0D A;  2PVG B;  3HXY A;  5CR2 A;  2RHU A;  3OYF A;  4EMG A;  1M1K U;  2ZPE B;  2FEI A;  3E9H A;  1I0C A;  1YHQ Q;  2X4W A;  4C0G A;  2DXU A;  4ELY C;  2OJ2 A;  1YWP A;  4P72 A;  1OI1 A;  2GFA A;  2EYY A;  2JZ2 A;  4XTX A;  2ECZ A;  3EFR A;  3QXE B;  2LX9 A;  2EJG A;  1AWO A;  1NNH A;  4M75 F;  3CD6 A;  3DSQ A;  4H02 A;  2YRC A;  2CZ6 B;  2RI2 A;  1GXI E;  1S1N A;  4Z88 A;  2BZY A;  3E2U A;  4J9D A;  3CC2 A;  2KMT A;  3JCM c;  5LJ3 j;  1QVF P;  2QEX A;  2OTL Q;  2AZV A;  1RUW A;  3V8J A;  1VQ9 Q;  1VQL Q;  5DLO A;  3KFU A;  5ECA A;  4BW9 A;  4KH0 B;  2E6N A;  4EMK B;  3GF5 A;  4MZT A;  5LJ5 e;  3GBQ A;  2HL3 A;  2A37 A;  1KMN A;  3L2U A;  2E41 A;  2P0K A;  1QF6 A;  3INZ A;  1VQ6 A;  1VQ5 Q;  4RTT A;  1UHC A;  3WQZ A;  3PMI A;  5GAM d;  2GBQ A;  1HTT A;  2KNB B;  5LJ5 g;  4DA4 A;  2JS2 A;  2OTL A;  2NUZ A;  1MMG A;  3FLG A;  3M0S A;  2RQU A;  4M7A B;  3JCM h;  2QQB A;  4IUT A;  1MND A;  1VQ9 A;  1VQL A;  3LC0 A;  1C0M A;  1TUD A;  2RM4 A;  3HXU A;  2XMF A;  1RAI B;  3OYD A;  1Q86 U;  4M77 B;  5LJ3 h;  1B8A A;  1WU7 A;  3VS5 A;  1LOJ A;  1PYS B;  4PNO A;  3OYK A;  3W3S A;  5KCH A;  5FWB A;  2KI7 A;  3PNW C;  4O2D A;  4K86 A;  5LL6 S;  3QO7 A;  2C0T A;  2CT3 A;  3X20 B;  2QQR A;  2MIO A;  5GMK i;  1SG5 A;  4H2S A;  4P3N A;  1NJI C;  1NYF A;  4J9E A;  4D8D A;  3P8H A;  2ZT6 A;  2EJ9 A;  3EG9 A;  1AD5 A;  4WCI A;  3E1S A;  2P0P A;  2QK0 A;  3QG1 A;  2RJD A;  3H9N A;  4BE1 A;  1UGS B;  3QJ6 A;  3CPW A;  2Q7G A;  4PKC C;  3OW2 S;  4LVL A;  2F1L A;  4YCV A;  2K3B A;  4ZTZ B;  5HK3 A;  2ZTG A;  3SWN C;  2DLP A;  5GAN 8;  3A5Z B;  3FJP A;  2NUT A;  5ELO A;  1K8A R;  1YB3 A;  1WZO A;  3GOX A;  4YRF A;  2O9S A;  4QKU A;  1VQO T;  3HXZ A;  4XU3 A;  1WYD A;  4C92 A;  4WJ3 M;  2CSI A;  2XI9 A;  2H3J A;  3HL8 A;  2WSF E;  1RI0 A;  2GFU A;  3RBB B;  2YHT A;  4N0A C;  1YIJ T;  4C92 E;  1VIF A;  4PJO B;  4KBM B;  2Q7E A;  3G71 T;  2QQ9 A;  4M7D C;  4HVW A;  4NL2 A;  3HXW A;  3JCM P;  11AS A;  2LVM A;  3QKJ A;  3G4S A;  2Q5H A;  4X9C A;  3R6N A;  5M9O A;  3BY7 A;  3VRY A;  2ABL A;  3SHW A;  2COW A;  4FU6 A;  1NZ9 A;  4P71 C;  3JV3 A;  3TUP A;  5KYY A;  4LVJ A;  4IIM A;  2NS6 A;  2CZ0 B;  2CJB A;  2J05 A;  3JCM d;  3BE3 A;  4AFQ C;  2HBP A;  5GAN e;  5C0M A;  4AFS C;  4NCX A;  4RDX A;  1WLP B;  3J80 E;  2ZZF A;  2E65 A;  5GMK m;  3KXT A;  3RGL A;  1L0W A;  4MMK A;  2CT4 A;  2DNU A;  3J7A F;  3L1A A;  2G3R A;  3F70 A;  1Y0M A;  1KK7 A;  5GAN g;  2L8D A;  2MPX C;  1TWB A;  2LQ8 A;  1C1A A;  4D6W A;  5LJ5 h;  2BKD N;  2BUD A;  3HHT B;  1IZ6 A;  1FXX A;  3ULR B;  1VQ4 T;  2O9V A;  3L4G A;  2EKH A;  5GAO m;  3FB9 A;  4E47 A;  1KQ2 A;  2RMO A;  3OYG A;  5A0L A;  3A31 A;  1WJQ A;  2M51 A;  4M7A F;  5CO7 A;  1MMD A;  3CCM Q;  2CUD A;  3HPW A;  4XU1 A;  4P5N A;  1E1O A;  3EHR A;  3CBM A;  1G2B A;  4M77 F;  4H2X A;  4RG8 A;  1KQ1 A;  3QPH A;  3HSB A;  1TUC A;  3E19 A;  2DER A;  1PWT A;  3I56 A;  2QXF A;  2ZT8 A;  3MP6 A;  1KD1 U;  3G6E T;  2QGG A;  3P8V A;  4F7U A;  2G4C A;  2VB6 A;  3WXM B;  1VOM A;  3HFZ A;  4F14 A;  1QVP A;  4WI1 A;  5CKB A;  4F7U E;  5C53 B;  3FEO A;  3CCM A;  3CCE Q;  2EW3 A;  3LGL A;  1PRL C;  4ZGD B;  4QVZ A;  1GFC A;  2O4X A;  4QVC A;  1USY C;  2R57 A;  3JRZ A;  3OYI A;  1SRM A;  3EG9 B;  4IUV A;  1YIT T;  1BBZ A;  4O6J A;  3A7R A;  3CPF A;  1X2H A;  2PMF A;  3CCL T;  2P84 A;  4DEX A;  4C92 G;  3NEM A;  3OYE A;  1HXD A;  4DOV A;  2NUP A;  2LT4 A;  4TVW A;  1G51 A;  4TVR A;  2Q7H A;  4CS3 A;  1B34 A;  2ENM A;  4IUR A;  4YRO A;  2HKN A;  3HFN A;  4M75 A;  1EIY A;  3QO3 A;  3EGD A;  2RJC A;  4JZ3 A;  1IRX A;  3CCE A;  4M75 E;  4GLK A;  1M90 R;  1Q82 C;  2LQN A;  2XID A;  4MZM A;  4ZN1 A;  1YCS B;  3TEG A;  3CCV T;  1SSH A;  2HSE B;  1VYT A;  5AYF A;  4FCY A;  2LDM A;  2C0I A;  2FZG B;  3N5B B;  3TEH B;  1SER A;  1NYQ A;  2EGE A;  4PJO F;  3MP8 A;  1WHH A;  2LRQ A;  1M3C A;  4EPC A;  1H4V B;  2ALY A;  5KYU A;  2ZPF B;  4HVV A;  1U5S A;  2K9G A;  3REX A;  2PQW A;  3L42 A;  5J39 A;  4RTV A;  4EX5 A;  2KT8 A;  3CCU A;  2OX7 A;  1BIA A;  4M7A D;  5LJ5 d;  1H3Z A;  1WGS A;  4YRS A;  1H4Q A;  3S6W A;  3M4Q A;  5FU6 B;  1PM3 A;  2ZIN A;  1AVZ C;  2F5T X;  1IL2 A;  5FLX E;  2J6F A;  4BI4 A;  4M77 D;  2J6K A;  3M0Q A;  3CCJ Q;  3A5Y A;  3REB B;  2FVU A;  1OZ3 A;  3I5R A;  1UE9 A;  4AFU C;  2XDD A;  5GAN h;  2SRC A;  2KK4 A;  2ZNI A;  3L2V A;  2A08 A;  3GNF B;  2XKO C;  2A8E A;  4RQF A;  4CRI A;  4A4G A;  1M90 C;  4YRP A;  4C8Q B;  5GAM e;  5CQY A;  3EFO A;  3L4G B;  1QCO A;  2ODR D;  4YRG A;  1TTH B;  3CCJ A;  1AHJ B;  12AS A;  2YUN A;  1G5I A;  1QW1 A;  3QYH B;  4X5O A;  1ZUY A;  4KUD K;  4PJN A;  4JDS A;  4F7U G;  2OTJ T;  5I2M A;  1ATI A;  1YJ9 Q;  1X2G A;  4P73 C;  1TG0 A;  1D1C A;  1BI2 A;  1ZLM A;  2HEQ A;  1T3S A;  2CIM A;  4H2X B;  1QWE A;  4NS5 A;  1VQN Q;  2EWN A;  2ZNJ A;  2KAF A;  3OS0 A;  3VQY A;  1UGR B;  5HK0 A;  2F69 A;  4OMO A;  1Q81 R;  1X2Q A;  1AWJ A;  4F7U B;  2Y90 A;  1UFF A;  1K9M R;  1F1B B;  3C4S A;  3GPL A;  2GF7 A;  2W0Z A;  1VQZ A;  3EH2 A;  4P74 A;  5FRM A;  3NTI A;  2I0N A;  1ABO A;  2RQT A;  2JW4 A;  1YI2 A;  2F2W A;  2X9H A;  4PG3 A;  2QQA A;  1AOJ A;  2CH4 A;  2M1H A;  4M75 G;  1SES A;  4YPF A;  2YUO A;  3QII A;  2E3H A;  1RAF B;  1UGP B;  4Y92 A;  2FZC B;  3CMA Q;  1VQM A;  4GLM A;  4XU0 A;  1VQN A;  4LE9 A;  4LXC A;  1K0S A;  2XDB A;  4AFZ C;  2RD1 A;  3RKW A;  1IB8 A;  3RAC A;  1B34 B;  4P3O A;  2CP7 A;  1W4S A;  2K5F A;  1EIY B;  2H3E B;  3I55 T;  4HVU A;  3WVD B;  1TH7 A;  3EGD B;  4KUI A;  2BIV A;  2JMC A;  4YRR A;  4BDZ A;  5KE2 A;  1Q7Y U;  3OYC A;  4QQ6 A;  4JJN K;  1K0X A;  4FM4 B;  1PKS A;  4H2V A;  2EFI A;  5HY6 A;  1DJ7 B;  1IO6 A;  1KC8 R;  2RJF A;  3TCJ A;  1YJN T;  5FU7 C;  4BB7 A;  5GAN d;  5GAO n;  3I5S A;  3GIB A;  2PZ1 A;  2VYT A;  1AWW A;  1SKU B;  3UGQ A;  4YP0 A;  2Y4Y A;  5GAM j;  2ALY B;  3VQW A;  3J81 E;  2WSE E;  2PVO B;  1WXB A;  1VQ7 Q;  2V8K A;  3MET A;  4TWA A;  3OS5 A;  4CS2 A;  2DBK A;  3LWI A;  4HA8 A;  2HD0 A;  2FYK A;  1EIF A;  4E6R A;  2K4Y A;  1OX9 A;  1XOV A;  4HXJ A;  1M3B A;  3EFS A;  3H0F A;  3P8D A;  1KHI A;  4TVY A;  3OB9 A;  3NGP A;  4YYE A;  3SD4 A;  3OW2 P;  2RHQ A;  2L3P A;  3OBW A;  4M7A E;  2DL5 A;  3A8L B;  2XHC A;  3HRT A;  2KE9 A;  1H4T A;  2ZR2 A;  2RN8 A;  4J6X A;  4LVI A;  1B70 A;  4CH3 A;  3E9F A;  1VQK A;  4V2S A;  4F16 A;  1VQ7 A;  3RMS A;  4M77 E;  4C8Q F;  4P3P A;  4C5I A;  3I9Q A;  2P5I A;  2HSP A;  4YRQ A;  1WJR A;  1NJ2 A;  5J3B A;  3EFO B;  2KRO A;  4CH6 A;  1YCY A;  4OMP A;  5GAM h;  2AKW B;  1KQS A;  2CYZ B;  1S72 Q;  4HWO A;  3CCS T;  3PT9 A;  3PVL A;  2IVW A;  3FDR A;  2I2L A;  2JNG A;  1RLP C;  1PD0 A;  2ZPB B;  1YJW Q;  4QQG A;  3L2Q A;  3JB9 I;  3VS2 A;  2K3X A;  1LYL A;  2DL3 A;  4YDQ A;  1SPK A;  2RA2 A;  4TQF A;  3M53 A;  2L2P A;  1VQ8 Q;  4YRN A;  4J15 A;  4PLL A;  2NWM A;  4J5Y A;  1D3B A;  4K87 A;  1PCX A;  1JXM A;  5D6W A;  2R58 A;  3VKI A;  4ZTJ A;  3A98 A;  4FT2 A;  1GRI A;  2DQ3 A;  2KYB A;  4C0F A;  2HQE A;  3QDR B;  3A7U A;  3UA7 A;  4RMO A;  3CC2 Q;  1YJW A;  4J9B A;  2QEX Q;  2QDL A;  4PJO A;  2E64 A;  3CC4 T;  2CRE A;  1KC8 U;  2JM9 A;  1VQ8 A;  3UFG A;  3VRZ A;  2F2X A;  4PJO E;  2DDZ A;  3A74 A;  4KR2 A;  1WLE A;  2I4M A;  3H6Z A;  5GJW B;  1WQ7 A;  8ATC B;  1QCF A;  2JJ9 A;  3MEW A;  2CKK A;  1GBR A;  4OMF B;  2JTF A;  1VQ6 Q;  2ZIO A;  1NEB A;  8AT1 B;  2D1X A;  4OB1 B;  4ORZ A;  3MKD A;  2OAU A;  4CC3 A;  1H92 A;  2KSS A;  4CS4 A;  1UUE A;  2C06 A;  1OV3 A;  3V8L A;  1S72 T;  3QHS A;  2RI5 A;  1R77 A;  4E7I A;  3TVT A;  2YLB A;  3KUF A;  2ZPG B;  1NJI R;  3WVE B;  4ZGJ B;  1KQS S;  4KQE A;  3QYG B;  4LVK A;  2DEQ A;  1WJS A;  4PJM A;  5CKE A;  4M7A G;  2LJ3 A;  2GCX A;  2RH2 A;  1Q95 G;  2QGF B;  2DZC A;  2C0O A;  3X25 B;  1BYM A;  3S3M A;  1RAA B;  4JLI A;  1CKA A;  4HKE A;  4C92 C;  4M77 G;  1W2B A;  4N4H A;  4CC7 A;  1WXT A;  1YFN A;  4MDX A;  2AMC B;  3E9G A;  2EYX A;  3TSZ A;  5I21 A;  2X35 A;  5CVI A;  5IXF A;  2YUP A;  1JEG A;  2V1R A;  3CD6 T;  2RHQ B;  4OB2 B;  5GJV B;  4HWT A;  1N9R A;  3CXC A;  1JJ2 P;  1QVG A;  1OEB A;  2MWP A;  1VQP Q;  2KVQ G;  1X6G A;  1B70 B;  2QEX T;  2WSC E;  2ATC B;  1YHQ T;  2K5L A;  3IAL A;  4EO4 A;  2XGT A;  1M30 A;  4TTV A;  3M9Q A;  2LCS A;  3CMQ A;  3JCM V;  2WAC A;  2EGC A;  3QNE A;  2HQX A;  1VYV A;  2VUB A;  3A1P A;  1U8R A;  5C51 B;  4XEO A;  3LYI A;  2DJQ A;  4H2T A;  3MO8 A;  3VYG A;  1VQO A;  2KXC A;  5GAN 5;  2DX1 A;  1T0H A;  1WHL A;  2RQR A;  2HAX A;  3BJU A;  3UF4 A;  1WA7 A;  4YRM A;  1WNL A;  1ASZ A;  4RTY A;  2EQM A;  4KR3 A;  3UWN A;  4M75 D;  1VQP A;  2MWO A;  2OTL T;  5D6Y A;  2JN0 A;  4X9D A;  3EHQ A;  1MV0 B;  2A0F B;  1VQ9 T;  1VQL T;  1D3B B;  4XTW A;  4BAC A;  4C5E A;  3G4S Q;  3OA6 A;  3A8O B;  3MPU B;  4PJO G;  2DXB A;  4FYW B;  4EMH A;  2X4X A;  2ARS A;  4JZ4 A;  2DPP B;  2PNI A;  4BUG A;  3MCA B;  4JPB W;  2DM1 A;  3RNJ A;  4AMC A;  2E3I A;  4BY6 C;  5GAN 2;  1VQ5 T;  1HK9 A;  2RQW A;  4UP9 A;  2XK0 A;  4YCW A;  4E51 A;  4J83 A;  4WTO B;  4B9X A;  1NBE B;  3TEH A;  2CSQ A;  3PIO A;  3L2Z A;  1JRI A;  2PME A;  5LJ5 j;  1QVF A;  4L5G A;  1I1J A;  1M2V B;  2BZX A;  1W2B S;  5ELN A;  4MML A;  2AIR B;  1QCN A;  2FRY A;  1ZUK A;  3P8Y A;  1HJD A;  2HCK A;  4TVA B;  1NJI U;  2L89 A;  3OQ5 A;  1PD1 A;  2ZIM A;  2C8M A;  3PGG A;  1A0N B;  1Z7M A;  1EVL A;  1WIE A;  2XIC A;  3HY0 A;  5D6X A;  3CXC S;  1QVG S;  2FPF A;  4ZGE B;  2CP6 A;  1G5V A;  4LDW A;  2L3S A;  4K88 A;  1X69 A;  1QWF A;  4PJL A;  2DZ9 A;  3VS7 A;  1EOV A;  2DXT A;  2DA9 A;  4BWA A;  1MHN A;  4HCC A;  3OMG A;  4PHC A;  1BU1 A;  3LGF A;  1D0Z A;  1JXO A;  4LDX A;  3CME Q;  4UC4 A;  1W6X A;  2M16 A;  3M0U A;  1PKT A;  4G84 A;  2E70 A;  2IIM A;  1SSF A;  2VC8 A;  3PFS A;  4M75 C;  3I56 Q;  1Z7N A;  2ZPI B;  4C8Q A;  4JRK A;  2PUO B;  4NL3 A;  1KD1 C;  1NJ5 A;  4P75 C;  1SHG A;  2GQI A;  3CC7 Q;  4Z89 A;  3JAM E;  3M58 A;  1EX4 A;  2KY9 A;  1W1F A;  2DU5 A;  2RQV A;  4DBF A;  4C8Q E;  1IRE B;  5EC7 A;  4RKU E;  2ZCF B;  3VS4 A;  2HMA A;  3CPW S;  1RAE B;  3JCM X;  3RES A;  3L2R A;  4OML A;  4OMN A;  1Y57 A;  5LJ3 f;  3OSV A;  2V26 A;  3CME A;  3PVQ A;  1I5O B;  2BE7 D;  3RIR A;  2QG9 B;  5FRO A;  1Q82 R;  1TUG B;  1M3A A;  4LUE A;  1YIT A;  1H3H A;  3CQT A;  4M78 B;  4A54 A;  2NYS A;  3HRU A;  1UJ0 A;  3CCL A;  3CC7 A;  2LQK A;  2X51 A;  3M56 A;  3HFV A;  3QJY A;  2KRM A;  2LJ0 A;  4C5G A;  1FYN A;  2RHX A;  1K9A A;  1WXU A;  1RAB B;  4N0A A;  3VU3 C;  3G1Z A;  5GAN 7;  3CCR Q;  1K8A U;  4O5V A;  2M0O A;  1BI0 A;  3G7Z A;  1UEC A;  1FX7 A;  2AZS A;  3I35 A;  3I7F A;  3NMZ C;  1BKB A;  4LN2 A;  3OYH A;  2DYB A;  3ZEH A;  4C5H A;  3BDU A;  5GAO r;  4DBR A;  4KRT A;  3REA B;  1OOT A;  4JJB A;  4P71 A;  3JCM J;  3NET A;  2EYZ A;  3RF1 A;  1HD3 A;  1M9S A;  3DB4 A;  2LX7 A;  3JB9 F;  3RMQ A;  1BK2 A;  2COY A;  4ESR A;  3O5Z A;  3CCU Q;  1BB9 A;  4FW2 A;  4XAX B;  2CS7 A;  5GAN j;  2DTO A;  1X6B A;  4FSX A;  1K76 A;  4DQ2 A;  3CCR A;  4XQ3 A;  5KH6 A;  1QE0 A;  2ZR3 A;  4MZP A;  2K57 A;  2DRM A;  1E24 A;  2YXY A;  1TS9 A;  2EKO A;  4CC4 B;  1EFW A;  4F04 B;  1NEG A;  1C6V X;  1E6H A;  4C0D C;  1SRY A;  2HQH A;  4G85 A;  1KMM A;  3E9I A;  3PIP A;  2YRV A;  4XK8 E;  2PTK A;  3CCM T;  2EL9 A;  2JOY A;  1ZSZ C;  1G8X A;  2A36 A;  4RCB A;  3QDF A;  3LSQ A;  1ARK A;  1NE8 A;  4OVA A;  2E3C A;  1H64 1;  2JVV A;  2FPE A;  3OSS C;  3A32 A;  5DM7 R;  1V1C A;  2DL7 A;  4C8Q G;  1WQW A;  2QAZ A;  2VAS A;  2COZ A;  3PZC A;  2A7Y A;  2DL4 A;  1U06 A;  3OYM A;  2JM8 A;  2ZT5 A;  3QTC A;  1SRL A;  3R6O A;  3CCE T;  1N8R C;  3CEY A;  5LJ5 f;  3REU A;  4LNP A;  2RNA A;  4JRP A;  3LW5 E;  5GAO p;  5CK9 A;  1SF9 A;  4A4E A;  2QA4 Q;  2DVE A;  3R07 A;  3H8Z A;  1OPL A;  3QWY A;  2GTJ A;  1ADY A;  5K1P A;  2HKQ B;  2AKW A;  1JB0 E;  3QUI A;  2CJ9 A;  3SB2 A;  2Q5I A;  5IT9 E;  4QT7 A;  3CCQ Q;  3ZFJ A;  1WPY A;  1U1T A;  3EG3 A;  1GCQ A;  4IKF A;  5IH2 A;  1YI2 Q;  1ABQ A;  7AT1 B;  3JB9 D;  2V8J A; 
#chains in the Genus database with same CATH homology
 4EMK C;  3SWN B;  4M78 F;  3FRN A;  1P92 A;  2QDY B;  2CZ7 B;  1HC7 A;  2RHY A;  1BBW A;  4HWS A;  1XTD A;  3RL6 A;  2QA4 A;  5GMK l;  1SET A;  3OYA A;  4PJO D;  3CCQ A;  4M7A C;  3HP9 A;  1K73 C;  3I55 A;  1Q7Y C;  2RB6 A;  2K3Y A;  2XDP A;  3OYB A;  2IG0 A;  4M7D B;  1M90 U;  2DK3 A;  4YRK A;  4M77 C;  3NEL A;  2FL7 A;  1BBU A;  2A3L A;  2DKG A;  3OYJ A;  5GAN 6;  3VYH B;  1YJN A;  3CCJ T;  1E22 A;  4XTY A;  5GAO l;  1Y7X A;  1I81 A;  3PMT A;  1VIE A;  4LDV A;  4JRQ A;  1NJ1 A;  1ASY A;  2O01 E;  2PVD B;  4LD6 A;  1U1S A;  2CJA A;  4J7F A;  1YFT A;  1G3T A;  2X4J A;  2MI6 A;  2ODR C;  3MEY A;  3V7S A;  4H2U A;  1KG1 A;  3S3O A;  1R8O B;  1YJ9 T;  1G3W A;  2FB7 A;  3DKM A;  3HRS A;  3M5A A;  1VQN T;  1I8F A;  4BE0 A;  2AMC A;  4OGC A;  4P73 A;  5KE3 A;  2YLC A;  2RHI A;  3UH0 A;  3C94 A;  3CCS A;  4PJO C;  3HXV A;  2CZ1 B;  2DQ0 A;  2K5I A;  4P72 C;  3HTZ A;  4BD3 A;  2D9T A;  1PSF A;  2Y4X A;  1BI3 A;  2JUF A;  4AH6 A;  2ZZD A;  1X6O A;  2ZXF A;  4FL6 A;  4NOY A;  1XNI A;  3MF2 A;  2EQK A;  3OYN A;  5L8R E;  3CMA T;  2RHS A;  2XU8 A;  3RER A;  2DU7 A;  4RCC A;  1Q81 U;  3C12 A;  1BI1 A;  3M55 A;  4OLF A;  3AHU A;  1K9M U;  3UGT A;  4CH5 A;  2ZCE A;  1M1K C;  3TRE A;  4Q6G A;  3DB3 A;  1B7Y B;  2KDS A;  4R56 A;  2MMP A;  2PU9 B;  3JB9 J;  2XG8 D;  3SDZ A;  4PL6 A;  5GMK h;  5EG2 A;  4HWP A;  4WJ4 A;  3O8V A;  3V7C A;  3VQX A;  4B9W A;  1FYF A;  3SFM A;  2LCC A;  2RK1 A;  1VQ7 T;  4RG2 A;  4FT4 A;  4M7D F;  3CBP A;  4BI3 A;  5DLQ E;  1V29 B;  3CBO A;  2FHD A;  4II1 A;  1MGQ A;  1X55 A;  4TVA A;  4VUB A;  2MF2 A;  2ARU A;  5CAI A;  4HT8 A;  3HXX A;  1G5H A;  3ERR A;  2EIF A;  4JLG A;  3ZBD A;  4Q15 A;  1YFS A;  4YTL A;  4A4K A;  4C8Q D;  4OB3 B;  1Q86 C;  4HT9 A;  5CIU A;  1G3S A;  1O9S A;  3OW2 A;  1YJW T;  3RKX A;  2RK2 A;  3EAE A;  1YHQ A;  4UP7 A;  1VQ8 T;  3P8B B;  2DTI A;  2E12 A;  5CCA A;  4UPA A;  2VXF A;  2DIG A;  1N9W A;  4MDW A;  4DOW A;  1ZHI A;  5CQX A;  3CC2 T;  2QHT A;  3LSS A;  3ER0 A;  2JTM A;  4M78 A;  3BW1 A;  5DY9 A;  2B8A A;  4LNS A;  5FU6 C;  5GAM f;  1YGB A;  4OP0 A;  2LNV A;  4WF2 A;  4M78 E;  2RHS B;  4M7D D;  2DIQ A;  2QHS A;  4EDU A;  1ZQ1 A;  4XTZ A;  1ADJ A;  1VQ6 T;  3HKS A;  3JB9 G;  3VUZ A;  3LH0 A;  2NLU A;  1OZ2 A;  1VQ5 A;  4JS5 A;  1M8V A;  3ME9 A;  4BI8 B;  1YIJ A;  1N9S A;  4KUL A;  4C8Q C;  3G71 A;  2QHU A;  1M1F A;  3RUX A;  1N6A A;  3M4Y A;  3A8G B;  1NJ8 A;  2HNI A;  4A4H A;  4Q5W A;  5FU7 B;  4JUV A;  2D0Q B;  2XTI A;  4XTV A;  3A7A A;  4LVM A;  3Q1J A;  2DAQ A;  3V8K A;  1JJC B;  3IKL A;  4BE2 A;  3JCM W;  3MHX A;  4QW2 A;  4GY5 A;  2D6F A;  2IY5 A;  5CKF A;  4CH4 A;  3A8H B;  4FIB A;  4L87 A;  1E1T A;  3NFC A;  1VQP T;  3PCO A;  2GQV A;  3OYL A;  1VQ4 A;  1X01 A;  4HWR A;  3JSC A;  2LTO A;  5GAO q;  1NJ6 A;  2AHJ B;  3RKY A;  4A4F A;  3UPU A;  4YRC A;  2RHZ A;  1NPP A;  1O75 A;  3BDL A;  2LT1 A;  2EAY A;  4OF1 A;  3PTA A;  3VV0 A;  1JJ2 A;  2QHV A;  3G6E A;  3JCM f;  2R5A A;  4ATO A;  4M78 G;  3M54 A;  5LJ3 d;  3G4S T;  1K8A C;  3DLL A;  3M4G A;  4HT4 A;  3QBY A;  4YRI A;  5CKH A;  4YRT A;  5KCO A;  4ELZ C;  3OS2 A;  3SWN A;  3ICA A;  3VJP A;  1GGM A;  3FC3 A;  4J8O A;  1C0A A;  4H2Y A;  2V8I A;  1LJO A;  1EQR A;  5GAN 3;  5A0G A;  1OYX A;  3JCM Q;  3DLM A;  3ASK A;  4ZTU B;  1QVF S;  2ART A;  5I2S A;  1BIB A;  2K2V A;  4E7H A;  4LD9 K;  4M7D A;  4Y28 E;  3CCV A;  4N4I A;  1Y96 A;  2XD0 A;  4X34 A;  4M7D E;  1I4K 1;  2ZZE A;  3VBB A;  4N4G A;  2EQJ A;  4HCZ A;  2DXC A;  5HGQ A;  3CME T;  2M9U A;  2J3L A;  4XU2 A;  1KOG A;  3JB9 H;  3I56 T;  1EVK A;  2P0Q A;  3QO5 A;  3CC7 T;  1RIQ A;  2X4Y A;  4E7L A;  3VUB A;  4Z02 A;  5IN1 A;  2LC4 A;  1JJ2 S;  4DPG A;  1J5W A;  3A8M B;  4P75 A;  3QSU A;  4HCB A;  1M1G A;  3NTK A;  1Y71 A;  3MP1 A;  4C92 B;  2IY5 B;  3MEA A;  3X26 B;  4XEM A;  4P74 C;  3LWH A;  2L3R A;  4OGE A;  3PCO B;  4YRL A;  2EQU A;  1NYR A;  4J6W A;  4L59 A;  1QP3 A;  3FIF A;  1KHC A;  2OTJ A;  3MQZ A;  2ZPH B;  3CCR T;  4RMF A;  5IAY A;  4ZTF A;  1Q82 U;  2I4N A;  2ZGW A;  2L5Q A;  1W66 A;  3X24 B;  3UDC A;  3GLX A;  2EJF A;  1USY A;  3S3N A;  2DJZ A;  3NTH A;  4ME7 A;  3MEU A;  1UGQ B;  3CCU T;  4J6Y A;  4PLI A;  5GAN 4;  2PUK B;  1Y07 A;  3QZ5 B;  3C95 A;  1B7Y A;  5F5W A;  2E6Z A;  3MEV A;  1G3Y A;  3VQV A;  5GMK e;  2F5K A;  3HRK A;  1RL2 A;  4H2W A;  2I4O A;  4C0Z A;  3OS1 A;  1UB4 A;  4L6V 5;  4M7D G;  1FWZ A;  5GAM g;  5A2Q E;  3URG A;  4BY6 B;  2E5Q A;  2QQS A;  4R55 A;  1N8R U;  3OYY A;  4HVC A;  3OD1 A;  2VV5 A;  3HFO A;  4TQD A;  1X75 C;  2ZZG A;  4A53 A;  1Y96 B;  3HFZ B;  3OMC A;  4J7I A;  5E3I A;  1M5Q 1;  5C6S A;  1YJ9 A;  2O4X B;  4QQD A;  2KQW A;  3T9N A;  3V7R A;  5FRN A;  1H4S A;  4LDY A;  2QA4 T;  3LX7 A;  1QP2 A;  3X28 B;  4QVD A;  4Y91 A;  3TU4 K;  4KT0 E;  2RO0 A;  2P0L A;  3BFM A;  1N27 A;  3CCQ T;  2RJE A;  4M75 B;  4JRI A;  2J3M A;  3JCM b;  1ZBX A;  1K73 U;  3GP8 A;  1YI2 T;  4C92 F;  4RQE A;  3HY1 A;  2VGN A;  4YRE A;  1JBM A;  1X54 A;  4UP8 A;  1VQM T;  3CMA A;  4IUP A;  1Q81 C;  3P8T A;  5GAN f;  1K9M C;  4M78 D;  4EMK A;  1YBY A;  5GMK j;  4BDY A;  1PSE A;  1X56 A;  4OB0 B;  3IG2 A;  4IUU A;  4CI0 C;  3JCM e;  2MAM A;  2RI3 A;  1XQH A;  4M7A A;  3MF1 A;  1M4Z A;  3QO8 A;  2C7I A;  3KBG A;  2VGM A;  5LJ3 e;  1NPR A;  2DO3 A;  3JCM g;  4XTU A;  3OBY A;  4M77 A;  4E7K A;  3M59 A;  2LCL A;  1I5L A;  1PYS A;  2ZT7 A;  2I4L A;  4ZIB A;  3OY9 A;  5LJ3 g;  5HKC A;  5KNN A;  3LLR A;  1YFR A;  3IKM B;  2DD4 A;  1KC8 C;  3M4P A;  3CC4 A;  3L2W A;  5CKD A;  2EYQ A;  3UT1 A;  3TEE A;  2E5A A;  2CGH A;  2DTH A;  4IUQ A;  2P4T A;  2E10 A;  1VQK T;  4E7J A;  3GNG A;  1B76 A;  5J26 A;  2VXE A;  1LNX A;  2E1H A;  4LDU A;  4C0D B;  5C52 B;  2R5M A;  4YCU A;  2QI2 A;  4C92 D;  4YRJ A;  4JS4 A;  4F7U F;  3A5Z A;  2DD5 A;  5K1X A;  4M78 C;  1JJC A;  3M57 A;  3QZ9 B;  1S72 A;  1UEB A;  1VUB A;  4ZN3 A;  3NEN A;  3HRI A;  2QTX A;  5A0D A;  2PVG B;  3HXY A;  5CR2 A;  2RHU A;  3OYF A;  4EMG A;  1M1K U;  2ZPE B;  3E9H A;  2X4W A;  4C0G A;  2DXU A;  4ELY C;  4P72 A;  1OI1 A;  2GFA A;  2JZ2 A;  4XTX A;  3EFR A;  3QXE B;  2LX9 A;  2EJG A;  1NNH A;  4M75 F;  3CD6 A;  3DSQ A;  4H02 A;  2CZ6 B;  2RI2 A;  1GXI E;  3CC2 A;  2KMT A;  3JCM c;  5LJ3 j;  2QEX A;  3V8J A;  5DLO A;  3KFU A;  4BW9 A;  2E6N A;  4EMK B;  3GF5 A;  4MZT A;  5LJ5 e;  1KMN A;  3L2U A;  2E41 A;  2P0K A;  1QF6 A;  3INZ A;  1VQ6 A;  3WQZ A;  3PMI A;  5GAM d;  1HTT A;  5LJ5 g;  4DA4 A;  2OTL A;  3FLG A;  3JCM h;  4M7A B;  2QQB A;  4IUT A;  1VQ9 A;  1VQL A;  3LC0 A;  3HXU A;  2RM4 A;  3OYD A;  1Q86 U;  4M77 B;  5LJ3 h;  1B8A A;  1WU7 A;  1LOJ A;  1PYS B;  4PNO A;  3OYK A;  3W3S A;  5KCH A;  3PNW C;  4O2D A;  4K86 A;  5LL6 S;  3QO7 A;  3X20 B;  2QQR A;  5GMK i;  4H2S A;  4P3N A;  1NJI C;  3P8H A;  2ZT6 A;  2EJ9 A;  3E1S A;  2P0P A;  3QG1 A;  2RJD A;  4BE1 A;  1UGS B;  3QJ6 A;  3CPW A;  2Q7G A;  4PKC C;  3OW2 S;  4LVL A;  4YCV A;  4ZTZ B;  5HK3 A;  2ZTG A;  3SWN C;  5GAN 8;  3A5Z B;  3FJP A;  5ELO A;  1YB3 A;  3GOX A;  4YRF A;  1VQO T;  3HXZ A;  4XU3 A;  1WYD A;  4C92 A;  4WJ3 M;  2XI9 A;  2H3J A;  3HL8 A;  2WSF E;  1RI0 A;  2GFU A;  2YHT A;  4N0A C;  1YIJ T;  4C92 E;  1VIF A;  4PJO B;  4KBM B;  2Q7E A;  3G71 T;  2QQ9 A;  4M7D C;  4NL2 A;  3HXW A;  3JCM P;  11AS A;  2LVM A;  3QKJ A;  3G4S A;  2Q5H A;  4X9C A;  5M9O A;  3BY7 A;  4FU6 A;  1NZ9 A;  4P71 C;  3TUP A;  4LVJ A;  2NS6 A;  2CZ0 B;  2CJB A;  3JCM d;  2HBP A;  5GAN e;  5C0M A;  4NCX A;  4RDX A;  3J80 E;  2ZZF A;  3RGL A;  2E65 A;  5GMK m;  3KXT A;  1L0W A;  4MMK A;  3J7A F;  3L1A A;  2G3R A;  3F70 A;  5GAN g;  2L8D A;  2LQ8 A;  4D6W A;  5LJ5 h;  2BKD N;  2BUD A;  3HHT B;  1IZ6 A;  1FXX A;  1VQ4 T;  3L4G A;  5GAO m;  3FB9 A;  4E47 A;  1KQ2 A;  3OYG A;  5A0L A;  3A31 A;  1WJQ A;  4M7A F;  5CO7 A;  3HPW A;  4XU1 A;  4P5N A;  1E1O A;  3CBM A;  4M77 F;  4H2X A;  4RG8 A;  1KQ1 A;  3QPH A;  3HSB A;  3E19 A;  3I56 A;  2QXF A;  2ZT8 A;  3MP6 A;  1KD1 U;  3G6E T;  3P8V A;  4F7U A;  2G4C A;  3WXM B;  3HFZ A;  1QVP A;  4WI1 A;  5CKB A;  4F7U E;  5C53 B;  3FEO A;  3CCM A;  3LGL A;  4ZGD B;  4QVZ A;  2O4X A;  4QVC A;  1USY C;  2R57 A;  3JRZ A;  3OYI A;  4IUV A;  1YIT T;  4O6J A;  3A7R A;  3CPF A;  1X2H A;  2PMF A;  3CCL T;  4C92 G;  3NEM A;  3OYE A;  1HXD A;  4DOV A;  2LT4 A;  4TVW A;  1G51 A;  4TVR A;  2Q7H A;  4CS3 A;  1B34 A;  4IUR A;  4YRO A;  3HFN A;  4M75 A;  1EIY A;  3QO3 A;  2RJC A;  3CCE A;  4M75 E;  4GLK A;  1Q82 C;  2XID A;  4MZM A;  4ZN1 A;  3TEG A;  3CCV T;  5AYF A;  2LDM A;  3N5B B;  3TEH B;  1SER A;  1NYQ A;  4PJO F;  3MP8 A;  2LRQ A;  4EPC A;  1H4V B;  2ALY A;  2ZPF B;  3REX A;  2PQW A;  3L42 A;  5J39 A;  4EX5 A;  3CCU A;  1BIA A;  4M7A D;  5LJ5 d;  1H3Z A;  1WGS A;  4YRS A;  1H4Q A;  3S6W A;  3M4Q A;  5FU6 B;  2ZIN A;  2F5T X;  1IL2 A;  5FLX E;  4BI4 A;  4M77 D;  3A5Y A;  2FVU A;  1OZ3 A;  2XDD A;  5GAN h;  2KK4 A;  2ZNI A;  3L2V A;  3GNF B;  2XKO C;  2A8E A;  4RQF A;  4CRI A;  4A4G A;  1M90 C;  4YRP A;  4C8Q B;  5GAM e;  5CQY A;  3L4G B;  2ODR D;  4YRG A;  3CCJ A;  1AHJ B;  12AS A;  1G5I A;  1QW1 A;  3QYH B;  4X5O A;  4KUD K;  4JDS A;  4F7U G;  2OTJ T;  5I2M A;  1ATI A;  1X2G A;  4P73 C;  1BI2 A;  2CIM A;  4H2X B;  4NS5 A;  2EWN A;  2ZNJ A;  2KAF A;  3OS0 A;  3VQY A;  1UGR B;  5HK0 A;  2F69 A;  4F7U B;  2Y90 A;  3C4S A;  3GPL A;  2GF7 A;  1VQZ A;  4P74 A;  5FRM A;  3NTI A;  1YI2 A;  4PG3 A;  2QQA A;  2M1H A;  4M75 G;  1SES A;  4YPF A;  3QII A;  1UGP B;  1VQM A;  4XU0 A;  1VQN A;  2XDB A;  2RD1 A;  3RKW A;  3RAC A;  1B34 B;  4P3O A;  1W4S A;  2K5F A;  1EIY B;  3I55 T;  3WVD B;  1TH7 A;  4KUI A;  2BIV A;  4YRR A;  4BDZ A;  5KE2 A;  1Q7Y U;  3OYC A;  4QQ6 A;  4JJN K;  4FM4 B;  4H2V A;  2EFI A;  5HY6 A;  1DJ7 B;  2RJF A;  3TCJ A;  1YJN T;  5FU7 C;  4BB7 A;  5GAN d;  5GAO n;  3GIB A;  2VYT A;  3UGQ A;  4YP0 A;  2Y4Y A;  5GAM j;  2ALY B;  3VQW A;  3J81 E;  2WSE E;  2PVO B;  2V8K A;  3MET A;  4TWA A;  3OS5 A;  4CS2 A;  3LWI A;  4HA8 A;  2HD0 A;  2FYK A;  1EIF A;  2K4Y A;  1XOV A;  3EFS A;  3P8D A;  1KHI A;  4TVY A;  3OB9 A;  4YYE A;  3SD4 A;  2RHQ A;  3OBW A;  4M7A E;  3HRT A;  3A8L B;  2XHC A;  1H4T A;  2ZR2 A;  4J6X A;  4LVI A;  1B70 A;  4CH3 A;  3E9F A;  1VQK A;  4V2S A;  1VQ7 A;  3RMS A;  4M77 E;  4C8Q F;  4P3P A;  4C5I A;  2P5I A;  4YRQ A;  1WJR A;  1NJ2 A;  5J3B A;  4CH6 A;  1YCY A;  5GAM h;  2AKW B;  1KQS A;  2CYZ B;  4HWO A;  3CCS T;  3PT9 A;  2IVW A;  3FDR A;  2I2L A;  2JNG A;  2ZPB B;  4QQG A;  3L2Q A;  3JB9 I;  2K3X A;  1LYL A;  4YDQ A;  2RA2 A;  4TQF A;  3M53 A;  4YRN A;  4J15 A;  4PLL A;  4J5Y A;  1D3B A;  4K87 A;  5D6W A;  2R58 A;  3VKI A;  4ZTJ A;  4FT2 A;  2DQ3 A;  4C0F A;  2HQE A;  3QDR B;  3A7U A;  4RMO A;  1YJW A;  4PJO A;  2E64 A;  3CC4 T;  1KC8 U;  1VQ8 A;  3UFG A;  4PJO E;  2DDZ A;  3A74 A;  4KR2 A;  1WLE A;  2I4M A;  3H6Z A;  1WQ7 A;  3MEW A;  2CKK A;  4OMF B;  2JTF A;  2ZIO A;  4OB1 B;  2OAU A;  2KSS A;  4CS4 A;  2C06 A;  3V8L A;  1S72 T;  3QHS A;  2RI5 A;  4E7I A;  2YLB A;  3KUF A;  2ZPG B;  3WVE B;  4ZGJ B;  1KQS S;  4KQE A;  3QYG B;  4LVK A;  2DEQ A;  1WJS A;  5CKE A;  4M7A G;  2GCX A;  2RH2 A;  2DZC A;  3X25 B;  1BYM A;  3S3M A;  4JLI A;  4HKE A;  4C92 C;  4M77 G;  1W2B A;  4N4H A;  4MDX A;  2AMC B;  3E9G A;  5I21 A;  2X35 A;  5CVI A;  3CD6 T;  2RHQ B;  4OB2 B;  4HWT A;  1N9R A;  3CXC A;  1QVG A;  2MWP A;  2KVQ G;  1B70 B;  2QEX T;  2WSC E;  1YHQ T;  2K5L A;  3IAL A;  4EO4 A;  2XGT A;  4TTV A;  3M9Q A;  3CMQ A;  3JCM V;  2WAC A;  3QNE A;  2HQX A;  2VUB A;  1U8R A;  5C51 B;  4XEO A;  3LYI A;  4H2T A;  3MO8 A;  3VYG A;  1VQO A;  5GAN 5;  2HAX A;  3BJU A;  4YRM A;  1WNL A;  1ASZ A;  2EQM A;  4KR3 A;  3UWN A;  4M75 D;  1VQP A;  2MWO A;  2OTL T;  5D6Y A;  2JN0 A;  4X9D A;  1VQ9 T;  1VQL T;  1D3B B;  4XTW A;  4BAC A;  4C5E A;  3OA6 A;  3A8O B;  4PJO G;  2DXB A;  4EMH A;  2X4X A;  2ARS A;  2DPP B;  4BUG A;  3MCA B;  4BY6 C;  5GAN 2;  1VQ5 T;  1HK9 A;  4YCW A;  4UP9 A;  2XK0 A;  4E51 A;  4J83 A;  4B9X A;  3TEH A;  3PIO A;  3L2Z A;  1JRI A;  2PME A;  5LJ5 j;  1QVF A;  4L5G A;  1W2B S;  5ELN A;  4MML A;  3P8Y A;  4TVA B;  1NJI U;  2L89 A;  3OQ5 A;  2ZIM A;  2C8M A;  3PGG A;  1Z7M A;  1EVL A;  2XIC A;  3HY0 A;  5D6X A;  3CXC S;  1QVG S;  4ZGE B;  1G5V A;  4LDW A;  4K88 A;  2DZ9 A;  1EOV A;  2DXT A;  4BWA A;  1MHN A;  4HCC A;  3OMG A;  4PHC A;  3LGF A;  4LDX A;  4UC4 A;  2M16 A;  4G84 A;  2E70 A;  1SSF A;  2VC8 A;  3PFS A;  4M75 C;  1Z7N A;  2ZPI B;  4C8Q A;  4JRK A;  2PUO B;  4NL3 A;  1KD1 C;  1NJ5 A;  4P75 C;  3JAM E;  3M58 A;  2KY9 A;  2DU5 A;  4C8Q E;  1IRE B;  4RKU E;  2ZCF B;  3CPW S;  3JCM X;  3RES A;  3L2R A;  5LJ3 f;  3OSV A;  3CME A;  3RIR A;  5FRO A;  1YIT A;  4M78 B;  4A54 A;  3HRU A;  3CCL A;  3CC7 A;  2LQK A;  3M56 A;  3HFV A;  3QJY A;  4C5G A;  2RHX A;  4N0A A;  3VU3 C;  3G1Z A;  5GAN 7;  1K8A U;  4O5V A;  2M0O A;  1BI0 A;  3G7Z A;  1FX7 A;  3I7F A;  1BKB A;  3OYH A;  3ZEH A;  4C5H A;  3BDU A;  5GAO r;  4P71 A;  3JCM J;  3NET A;  3RF1 A;  1M9S A;  3DB4 A;  3JB9 F;  3RMQ A;  4XAX B;  2CS7 A;  5GAN j;  2DTO A;  4FSX A;  4DQ2 A;  3CCR A;  4XQ3 A;  5KH6 A;  1QE0 A;  2ZR3 A;  4MZP A;  2K57 A;  1E24 A;  2EKO A;  1EFW A;  4C0D C;  1SRY A;  4G85 A;  1KMM A;  3E9I A;  3PIP A;  2YRV A;  4XK8 E;  3CCM T;  2EL9 A;  2JOY A;  4RCB A;  3LSQ A;  1NE8 A;  4OVA A;  2E3C A;  1H64 1;  2JVV A;  3OSS C;  3A32 A;  5DM7 R;  4C8Q G;  1WQW A;  3PZC A;  2A7Y A;  3OYM A;  2ZT5 A;  3QTC A;  3R6O A;  3CCE T;  1N8R C;  3CEY A;  5LJ5 f;  3REU A;  4JRP A;  3LW5 E;  5GAO p;  5CK9 A;  4A4E A;  2DVE A;  3R07 A;  3H8Z A;  1ADY A;  5K1P A;  2AKW A;  1JB0 E;  3QUI A;  2CJ9 A;  3SB2 A;  2Q5I A;  5IT9 E;  3ZFJ A;  1WPY A;  1U1T A;  4IKF A;  3JB9 D;  2V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...