4XTUA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (n-({[(1r,2s,3r,4r)-4-(6-amino-9h-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
b'VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtuA01
4C92G 3ERRA 3RESA 4HWPA 3HRIA 1YFSA 3HFOA 3JB9I 5GAN4 3KFUA 4P3PA 1E1TA 2EAYA 4EMKC 1M8VA 4CS4A 4YDQA 1LNXA 3BDUA 4KR3A 4C92B 2DVEA 1G51A 4K88A 4H2XA 4N0AC 2ALYA 4XTYA 2ZZFA 4A54A 3A74A 2I4NA 4RQFA 4H2UA 1USYA 2Q7EA 3QHSA 2ZIMA 3PGGA 1D3BB 2QHVA 4OLFA 2XTIA 5GAOq 5LJ5f 3IKMB 4M75A 2ZT8A 4G85A 1EOVA 1N9WA 5GAN3 5GAMd 4YRIA 4H2WA 3JB9F 1HC7A 2G4CA 5CAIA 5LJ5j 1NJ1A 3HXWA 4HWTA 3REXA 3LSQA 1JJCB 2DDZA 4A53A 2J3MA 4DQ2A 5GAOl 4P75C 4YRFA 2ZIOA 3UGTA 3P8YA 4M7AF 4ZTUB 1X56A 3QSUA 3P8VA 4CH3A 3BW1A 4P71C 1N9SA 4C92E 3UGQA 4MMKA 1B70B 4WJ3M 3JB9G 4J5YA 4EMGA 1EIYA 2DQ3A 3QO5A 2Q7GA 4P72A 1Z7MA 1QE0A 4YPFA 3HFZA 4M75D 1EVLA 4V2SA 5ELNA 5ELOA 3HXUA 4EMKB 3UFGA 1PYSB 1WLEA 4BW9A 1KOGA 3V7RA 4O2DA 2CJAA 5LJ3d 4X5OA 1FYFA 5GMKe 2ZXFA 4YRLA 2ZR3A 2DTHA 3RKXA 4ZTZB 4HWSA 2DU5A 4TVAB 2C8MA 1VQZA 1Y96B 3HFNA 1KMNA 3A5ZA 4AH6A 4HT9A 4DPGA 2IY5B 2CIMA 3JCMb 3IALA 3SWNC 2RHQA 4PJOA 3RF1A 3L2ZA 3HY1A 5GANf 3A7AA 3LSSA 1WPYA 5GAMg 4KR2A 4JRKA 4YRGA 4NL2A 1E1OA 4YCWA 4YRJA 1NYRA 2EJFA 4M75C 2QTXA 4M78D 2YLCA 4C8QC 1LYLA 1X2GA 3BFMA 12ASA 4J15A 5C51B 3A7UA 3PCOB 1NJ2A 4TVYA 4CH5A 3VBBA 3VQXA 3NENA 4EX5A 3TUPA 1KMMA 5GAMh 4H2VA 4P73A 3TEGA 2RA2A 2RHSA 5KNNA 1BBUA 4PJOD 1YFTA 3FIFA 4M75F 4H02A 2ODRD 4C8QF 3MEYA 5GAOr 1YB3A 4K87A 5E3IA 4M7DA 2P5IA 4M77A 3L4GA 5K1PA 5GMKj 3QO8A 3A32A 3AHUA 4NCXA 3PZCA 4YCUA 5GMKi 5LJ3g 4WJ4A 2Q5HA 2ZT7A 3HFVA 4UP8A 2JN0A 1NJ6A 3M4GA 4M75G 4G84A 2DZCA 4C8QG 2DTOA 3SWNB 1GGMA 1BIBA 4H2XB 5I21A 2ALYB 3L1AA 4XEOA 4XU2A 4XU3A 3P8TA 5LJ3h 4RQEA 4M7DD 4M78C 4M77D 4XU0A 2PMEA 3TEHA 3JCMX 2AKWA 4M75B 3RGLA 4C8QB 3JCMf 4TVWA 4F7UA 4PJOC 4M78F 1YFRA 4YRKA 2ODRC 4ZIBA 1HTTA 2ZTGA 3JCMQ 4M7AC 4YYEA 4PNOA 4RCBA 3A31A 4YRMA 3IKLA 2K57A 1X2HA 1EFWA 4PJOF 4YRTA 3RIRA 1EQRA 4CH6A 1U1TA 2HNIA 4YRRA 4J6WA 4M78G 4X9CA 5GANe 3HFZB 4CS3A 3HTZA 3HRKA 4P73C 4BWAA 1H4SA 4J6XA 1U1SA 4M75E 5K1XA 4C92A 4C8QE 4M77C 4PJOG 4YRSA 2C7IA 1MGQA 1G5IA 11ASA 1L0WA 3VQYA 4M7AG 5LJ5d 4XU1A 4M78B 3M4QA 4EO4A 3GIBA 4M7DF 4M77F 5C53B 2YLBA 3HXXA 5GAOm 2RHQB 3BY7A 1JJCA 4PJOB 2E3CA 1I4K1 1B34B 3EFSA 3RKWA 4C92D 1M5Q1 4OP0A 5DY9A 4M7AB 3BJUA 4TQDA 4X9DA 3M4PA 3QNEA 2AMCB 2ZNIA 4M77G 1HXDA 4QVCA 1BIAA 4JRIA 2Y90A 2ARSA 2Q5IA 5GMKh 1USYC 2EJGA 3VU3C 3NETA 2I4MA 3HXZA 3RUXA 3V7SA 5GANj 4M78E 4XEMA 3RL6A 2ARTA 3JB9H 4MMLA 4NL3A 1PYSA 4YP0A 1J5WA 3A5YA 2I4OA 1LJOA 1Z7NA 1TH7A 3IG2A 4M77B 4F7UF 3L4GB 2E10A 4PJOE 2ZZGA 3JB9J 1H4VB 3JCMe 4RDXA 1N9RA 1H641 4JLIA 1WQ7A 4M7AE 4Q6GA 5GMKl 4WI1A 1HK9A 1Y96A 3RACA 2CJBA 3CMQA 4XTWA 5GAN7 5GANd 5LJ5g 2E5AA 5GAOn 3REUA 5GAN5 4F7UG 4P72C 1QF6A 2ZCEA 4UPAA 3W3SA 4XTZA 4HT8A 2XGTA 3G1ZA 4LNSA 1X54A 4HA8A 3TEHB 4TTVA 4L87A 1B8AA 1ASZA 3INZA 4C92F 4XTXA 3RERA 4M77E 5LJ5h 2AKWB 3QTCA 3VQVA 2ZR2A 4F7UB 2VXEA 5LJ3e 2QHSA 2EJ9A 1WQWA 2EWNA 5GAOp 3V8LA 3NEMA 3FJPA 3RKYA 2RD1A 2E65A 1JBMA 3A7RA 1X01A 1EVKA 1E24A 5GAMf 1SETA 1JRIA 1YCYA 4UP7A 4CH4A 4H2TA 4YROA 5GAMj 4PHCA 1B7YA 2DXUA 1I81A 4RCCA 3UH0A 3SWNA 4H2YA 4K86A 2J3LA 1IL2A 4P3NA 4XQ3A 2CGHA 1EIYB 3MF2A 3JCMJ 4F7UE 1G5HA 5GANg 3FB9A 2I4LA 1SERA 3VQWA 4TQFA 1B76A 2YHTA 2ARUA 1ASYA 3JCMd 2RB6A 4J6YA 1LOJA 4M7DC 4UP9A 3HY0A 4WF2A 1NYQA 3NELA 2DTIA 1NJ8A 1NJ5A 4C8QA 4TWAA 2E41A 4XTUA 5LJ3f 2DXTA 2QHTA 3QUIA 4YCVA 1D3BA 5GANh 3DSQA 5LJ3j 3OD1A 4P74A 1C0AA 1SESA 4QVDA 2ZINA 1SRYA 1NNHA 4XTVA 5GAN2 5F5WA 4H2SA 4YREA 1ADJA 2ZNJA 2ZT6A 2DJZA 1H4QA 2ZGWA 4YRPA 2VXFA 2ZT5A 3I7FA 1I8FA 2I2LA 4C8QD 2P0LA 3V8KA 1ADYA 4M7DG 3JCMP 1B70A 1X55A 1E22A 2DQ0A 4YRNA 4CS2A 3HXVA 2CJ9A 3ICAA 4EMKA 2QHUA 4HWOA 4M78A 2RHSB 4E51A 2E1HA 3E9HA 1KQ2A 4HWRA 5GAN8 5HGQA 2Q7HA 4M7DB 1WNLA 4N0AA 1WU7A 1KQ1A 3LC0A 2EL9A 1W66A 3JCMg 2FB7A 4YRQA 2VC8A 3WQZA 1B34A 3QO7A 3QO3A 4RMFA 1H4TA 3E9IA 5GAMe 4TVAA 3EFRA 4M7AA 2E64A 4JUVA 3SB2A 5C52B 2IY5A 2DEQA 2AMCA 4C92C 2ZZEA 1I5LA 2DKGA 3R07A 3JCMV 4P75A 3HSBA 3JCMh 5GAN6 2DZ9A 3V8JA 3JB9D 2DU7A 4P3OA 4P74C 4P71A 2RM4A 3MF1A 4KQEA 4M7DE 1YGBA 4YRCA 4Q15A 5LJ5e 2FYKA 4M7AD 3PCOA 4EMHA 3JCMW 4Y91A 4PG3A 5GMKm 1ATIA 4HVCA 2PMFA 3JCMc 3V7CA 1WYDA 3HXYA 4NOYA 1RIQA 1B7YB 1BBWA
chains in the Genus database with same CATH superfamily
2ABLA 3EFOA 2RQUA 4PJMA 1YFSA 4MZTA 1GBRA 1KC8U 2MYSA 2O9VA 1PD1A 4AFZC 5GAN4 3KFUA 2KMTA 2YT6A 2YUOA 1YITT 3OY9A 2HAXA 1KHCA 3M5AA 3BDUA 2GTJA 1VOMA 3PIPA 1ZSZB 4LVIA 5FU7C 3G6EA 1FMVA 4XTYA 2ZZFA 5KYUA 4A54A 2O4XA 2I4NA 4H2UA 1KFZA 1USYA 2KT8A 2Q7EA 1O75A 2ZIMA 1RI9A 4MDWA 1VQ8T 2DRMA 3OBWA 4OLFA 1N5ZA 1MMAA 2XTIA 1PG5B 3IKMB 4G85A 1BYMA 4Z89A 5LJ5j 2DM1A 2DDZA 2QA4Q 4A53A 2J3MA 2GF7A 1BU1A 2AIRB 4OMQA 4DQ2A 1N8RR 2OTJA 1EIFA 1XNIA 4M7AF 1K0XA 2FPFA 1X56A 4ZTUB 3GLXA 1RAIB 3MCAB 4DOVA 4XAXB 4LDXA 4CH3A 2XU8A 3BW1A 2RJCA 3QDRB 4P71C 3H8ZA 1N9SA 1B70B 3G71A 1VQ7T 3JB9G 1EIYA 4HVVA 3UATA 3QO5A 2Q7GA 4C0FA 2ENMA 4YPFA 4CC7A 2RHIA 2AHJB 4V2SA 4JRQA 4EMKB 2QQBA 2X9HA 3NGPA 1KOGA 1M90U 2HQHA 2HKNA 1WHJA 1Y71A 4CC4B 1VQMA 4X5OA 3G6ET 5GMKe 4YRLA 3CPFA 4AG1C 1QWEA 3RBBB 4C5IA 2V8JA 5KCHA 4GLMA 3NTHA 4HWSA 2EYYA 2DU5A 2LZ6B 3X20B 1KMNA 1CKBA 4HT9A 2IY5B 3QKJA 1ABOA 2GFUA 3JCMb 2CIMA 2DK3A 3SWNC 4C5EA 2RHQA 2KY9A 1A0NB 2X4JA 5ECAA 4D6WA 3CC2Q 5GAMg 2OTJT 1X6BA 3VS7A 3PNWC 4LDUA 4PKCC 2IG0A 2R5AA 3MEVA 1JJ2A 4BDZA 2XKOC 4B9WA 4JRPA 2K3YA 4ESRA 4YRJA 4M75C 1YIJA 4E7LA 2DEUA 4KH1B 1IO6A 12ASA 3FC3A 3G71T 3CCUT 4L59A 4A4KA 3HL8A 1VA7A 1YJWQ 3PCOB 2KXDA 4TVYA 3VBBA 2CP0A 4CH5A 3NENA 4PJLA 1WJRA 3TUPA 2LNHB 3TEGA 3CCMA 1NG2A 3EGXB 4PJOD 4M75F 2V8KA 2QI2A 3MEYA 4P5NA 2CT4A 4HKEA 1V76A 3L4GA 1KHIA 3VJPA 4JPBW 1VQMT 2RMOA 3TU4K 2OAUA 5LJ3g 2ZT7A 2GQIA 4UP8A 1JEGA 2LC4A 1ZBJA 4BD3A 4G84A 1GFCA 2XDPA 2JS2A 4H2XB 5I21A 2CP5A 2MIOA 1NPPA 2JUFA 3UF4A 4AFQC 4RQEA 4M78C 5I2MA 1ZSGA 2X3WD 2PMEA 2LJ3A 4BY6B 4FL6A 4OB3B 2K3XA 2ESWA 1YIJT 2EGCA 4M78F 2ODRC 5CKDA 2ZTGA 3QJYA 1K73R 2DXCA 3OYIA 1KQSS 4YRMA 3CCMT 1Q82R 3IKLA 2VVKA 1X2HA 4QT7A 1V1CA 3FJ5A 1U1TA 3C0CA 2L89A 5GANe 5J26A 3EAEA 1PM3A 4N4GA 3OYFA 4CS3A 1E6HA 1YI2Q 3EG9A 3LLRA 4J6XA 1ZSZA 4IUQA 1JJ2S 1U5SA 4HCKA 1QLYA 4M77C 4PJOG 2FEIA 3I55A 1YHQA 2KYMA 3EH2A 4Q5WA 1G5IA 2HMAA 11ASA 3OBYA 4XU1A 3M4QA 4M7DF 4M77F 2YLBA 3SEMA 3TREA 1UHFA 2G6FX 2E3CA 2QQ9A 3JSCA 4BE2A 5FRMA 3RKWA 4JJNK 1M5Q1 3OYGA 3BJUA 2BTTA 1VQPQ 3OS5A 1TTHB 4X9DA 3CMEA 4DA4A 2AMCB 4QVCA 1WI7A 2ARSA 5A2QE 2Q5IA 5FU6C 2CP7A 3NETA 2KROA 3V7SA 1VQNT 3MKDA 2ARTA 2FRYA 4MMLA 1W1FA 4NL3A 4BY6C 4YP0A 1GRIA 4J9IA 2E4HA 2DL4A 1D0YA 1VQ9A 4F7UF 1D1AA 1D0ZA 4PJOE 1G5VA 3JB9J 1H4VB 3I55T 1N9RA 2P0KA 1QCFA 1ZHIA 4Q6GA 5GMKl 1WXBA 4WI1A 5IXBA 3CCRA 1CKAA 3GNFB 3LGLA 1HJDA 8ATCB 5KE3A 2RQWA 5KYWA 2NS6A 2ZPFB 2HD0A 2MCNA 3PTAA 2XDDA 5KCOA 4E6RA 3L2WA 4JLGA 3TQ7P 3VUZA 3ZFJA 3TEHB 1N6AA 1E7OA 1MV0B 1VQOQ 2QG9B 1MNEA 5D6YA 2DO3A 1YJ9Q 4XTXA 3RERA 3CMET 1K8AU 3CD6A 1RI0A 3VQVA 1S72Q 2DX1A 2OTLQ 2E12A 5A0LA 1PC0A 3PFSA 3J81E 2CUDA 1WJSA 5CKHA 2KBTA 4KRTA 1JXOA 3NEMA 3PT9A 1VQ5T 3PMTA 2K4YA 4JS5A 3MHXA 2RD1A 3CCVQ 5J39A 2RI3A 2K2VA 2E65A 1JBMA 1MMDA 1X01A 3NTKA 1VQ9T 1EVKA 1B07A 4OF1A 3M0QA 3OYNA 5I22A 3CCJA 2B86A 2KR3A 4BI4A 5GAMj 1I81A 2R58A 3CCRT 1YJNQ 1IL2A 2JTFA 5C6SA 3MF2A 2AZSA 2M0OA 2I4LA 1RABB 5KE2A 1B76A 1SKUB 2YHTA 2LQNA 2OI3A 2V1RA 1M3AA 1UFFA 2QA4A 1K9MR 4J6YA 3IQLA 3HY0A 4CRIA 1NYQA 3MPUB 3CD6T 3P8DA 2MMPA 3UWNA 1SG5A 5D6XA 3QUIA 2QHTA 2KDSA 1RAEB 5LJ3j 2EYWA 1YWOA 2X3XD 2J6KA 2KK4A 2JJ9A 1NNHA 3M59A 4A4EA 4XTVA 4YREA 5IHIA 1H4QA 1N27A 2ZT5A 3CEYA 3I7FA 3CCJT 3L42A 3I56Q 2AK5A 1OX9A 1K9AA 2LCLA 1D09B 4CS2A 2CJ9A 2QEXQ 1QVPA 2XI9A 1W2BA 3EGUA 2QHUA 1SHGA 2RHSB 2E1HA 3MQZA 4HWRA 1Y0MA 1ZQ1A 1KD1U 1FX7A 3CC2A 1WU7A 4CC2A 1G2BA 3S3OA 4DEYA 3WQZA 3PIOA 1EX4A 1SF9A 3SD4A 5HKCA 3E9IA 5GAMe 4TVAA 1WIEA 1SSFA 3CCSQ 2LDMA 3HPWA 1KSWA 2AMCA 2EBPA 4RTWA 4C92C 1YJWA 3AT1B 1M2VB 2RQVA 2B8AA 2YUQA 3E1SA 3MEWA 3PMIA 5GAN6 2CP2A 4P3OA 2BE7D 4RMOA 3LYIA 1YGBA 2L3PA 1G8XA 1EFNA 2AT1B 2MK5A 2BUDA 4Z88A 2CKKA 4Y91A 4HVCA 3TEEA 1TOVA 2F69A 3M54A 2PMFA 3HXYA 2P0QA 1SRMA 3A8LB 4E7IA 4TVRA 2NUPB 3RESA 4JJCA 3CC2T 4DOWA 2L8DA 2C0TA 2VWFA 3CXCP 4P3PA 4QVZA 1E1TA 3I5RA 1M8VA 4CS4A 4YDQA 3VYGA 4BDYA 1RLQC 1VQ4Q 2DVEA 3KFVA 1G51A 1YJWT 3RMSA 3CC4A 4K88A 1BI1A 3M0UA 4RQFA 3ZL7C 4C0DC 2ZPGB 4EPCA 1D3BB 1YWPA 2QHVA 3OMCA 1W2BS 1GCQC 4C5GA 1UGRB 3Q1JA 2ZT8A 1EOVA 4YRIA 1HC7A 1M30A 5CAIA 3HXWA 3REXA 2JZ2A 3LSQA 1JJCB 1Q81R 3P8HA 1YI2A 4RTTA 1HD3A 2AKLA 2JM8A 2DLPA 3M0SA 2O01E 4OGCA 2L3SA 3LH5A 3OYEA 2HSPA 4IUPA 2YRCA 2GGRA 4MMKA 3E9FA 4EMGA 4P72A 1WGSA 2DD5A 1QE0A 1GFDA 5ELOA 3HXUA 2Y4XA 1PKTA 3MP6A 2M0YA 3VS1A 2DA9A 4OB1B 4FT4A 4O2DA 1IGQA 3CCLQ 1W6XA 2XDBA 5FU7B 3CC4T 2ZR3A 4OMFB 4IKFA 1WX6A 3HKSA 3JAME 1AZEA 3RKXA 1LPLA 1WXTA 3DB3A 3PVLA 1OQKA 2RQTA 1I0CA 4LD9K 1VQKA 2F2XA 1Y96B 4LDYA 4LD6A 3A5ZA 4X34A 4C0ZA 4PJOA 3QXEB 4R0KA 2KNBB 1VYUA 1NLOC 3LSSA 1WPYA 5DLOA 1UE9A 4JRKA 2VV5A 1E1OA 5EC7A 2EJFA 2QTXA 1OPLA 1R77A 1NLPC 2NUTA 4C8QC 3LH0A 1T3SA 4J15A 5C51B 2E6NA 1KMMA 2RJDA 1MHNA 2P0PA 2CDTA 4P73A 2W10A 2O31A 2EYXA 2RA2A 2RHSA 5KNNA 1YFTA 2H3JA 3FIFA 2MAMA 1YBYA 3G7ZA 4H02A 2PNIA 2A36A 5E3IA 4C8QF 5GAOr 4K87A 1UJ0A 2OAWA 1N8RU 5K1PA 4BI8B 5GMKj 4ELYC 1T0JA 3QZ9B 3VS6A 4YCUA 5GMKi 1VQOA 4WJ4A 5CR2A 1YJ9A 1TG0A 1P92A 4LDWA 3M4GA 1VQKT 1S72A 3SWNB 1M2VA 1BIBA 1M1KR 1GBQA 2ALYB 3L1AA 4QQ6A 3H41A 2CP6A 2PVDB 4XU3A 3H0HA 3CCVA 2F5TX 2DYBA 4RG8A 3JCMX 2AKWA 4M75B 3RGLA 2O9SA 2XK0A 2V26A 2DERA 3JCMf 1IZ6A 1WHMA 1IHVA 1YJNA 3OYAA 2FHDA 4M7AC 4ZTFA 4BE0A 2FPDA 3CCET 1Y7XA 2JVVA 3RIRA 4ZN3A 2CH4A 4CH6A 2EW3A 2HQEA 4X9CA 5KYXB 3HFZB 1VQOT 3X26B 4A4GA 1YJ9T 3FDRA 1C0MA 1H4SA 3WVEB 2CSQA 1CSKA 5AYFA 4AT1B 1Q86C 4YRSA 1JQQA 3M53A 3WVDB 4M78B 2FL7A 3GIBA 2COYA 1PSFA 2FVUA 3HHTB 5C53B 1VIEA 3F70A 2RO0A 5A0GA 1JJCA 2GBQA 1B34B 3I56A 3ME9A 3FEOA 4FIBA 4C92D 3OW2A 5IAYA 5DY9A 3A98A 1YJNT 2YSQA 1KC8R 4RTVA 1HXDA 4JRIA 2QEXA 2Y90A 3QWXX 2O2OA 2PTKA 2QDLA 3RNJA 4KGVB 3OS0A 1X75C 2BZYA 4HVWA 3RUXA 5GANj 3RL6A 1JU5C 2AKKA 2PZ1A 5AT1B 2R57A 1QKXA 5J3BA 2QGGA 2QDYB 2WSEE 1NJIR 1NEBA 1Z7NA 3DB4A 2ZAEA 1TH7A 4M77B 1M1FA 3HTRA 2ZZGA 1K73U 1N8RC 4RDXA 2RK1A 1H641 4JLIA 2DPPB 2MF2A 4FW2A 3REBB 5CCAA 2RK2A 4UC4A 4B6MA 1YFNA 5IT9E 4ORZA 1Y96A 1PSEA 2KAFA 2CJBA 5GAN7 5IN1A 3QG1A 1ZA1B 2R5MA 4QQGA 1AWXA 3QPHA 1QF6A 2EYQA 4UPAA 1RAAB 3I56T 3W3SA 4HT8A 1AWWA 2XGTA 4HA8A 1KIKA 1AVZC 3INZA 1X2QA 3CCQQ 2M9UA 2QEXT 1KQSP 5FU6B 3VS3A 4KBMB 1M90R 4ATOA 4F7UB 3M0RA 2EWNA 1WQWA 5GAOp 1BBZA 1QW1A 1FMWA 3EGDA 3FJPA 3O5ZA 3RKYA 2VGNA 2KRNA 2VYTA 1QP3A 2I0NA 3A7RA 1E24A 4FU6A 5CVIA 3VYHB 5FWBA 1SETA 1RLPC 1YP5A 1AZGB 3X28B 4UP7A 1E6GA 2BZXA 1JJ2P 2RI2A 1VQ4A 4H2TA 4KGXB 1B7YA 3UPUA 2WSFE 4JS4A 2D8JA 5CKBA 3OW2S 1NJIC 4L5GA 3HRTA 4PK4A 3SWNA 4PJNA 3CPWA 2FPEA 1MV3A 3M0PA 4GY5A 4E7KA 3FB9A 3BDLA 1C6VX 1SERA 1QWFA 3MEAA 4JZ3A 4KULA 3OYBA 2L3RA 5L8RE 1ASYA 3JCMd 1M8MA 2YWWA 4M7DC 3HRSA 2QQSA 4UP9A 3NELA 4TWAA 1YN8A 5KH6A 4E7JA 2DXTA 2YDLA 1WYXA 2MI6A 3ZBDA 1SESA 4OB0B 3CC7A 1O9SA 3MEUA 4IUVA 2CT3A 1S1NA 1ZX6A 5GAN2 2DAQA 4LNPA 2ZNJA 1ZUUA 2DJZA 2HEQA 5KYXA 4YRPA 2HL5C 4J9DA 2LT1A 3A8MB 2I2LA 4C8QD 5HY6A 1VQ4T 1QVFA 3V8KA 1XJWB 2D9TA 1AHJB 5IHNA 2ZPBB 1B70A 3UT1A 4OVAA 2DJQA 3OSVA 2L3QA 4EMKA 2K5FA 4J9EA 4M78A 1K73C 2XG8D 4HWOA 2JTEA 1Q82C 1RAHB 3CMAQ 4N0AA 4ANJA 1GXIE 3BE3A 4EDUA 1XQHA 2X4XA 4O6JA 1YHQT 4YRQA 2VC8A 1B34A 1MUZA 3QO7A 1TUCA 3EFRA 3M55A 1X2KA 3OYJA 1YCSB 2IY5A 1OU9A 3ER0A 4RG2A 1LCKA 3CC7T 2ZZEA 1M1GA 1YITQ 1AT1B 4HCCA 2PU9B 2A8EA 2OJ2A 3SFMA 3R07A 4P75A 1I1JA 2DVJA 3JCMh 2L2PA 3CPWS 2JMCA 2DZ9A 1UGPB 3CBPA 1K9MU 1IXDA 5CQYA 3V8JA 2JTMA 2F2WA 3MP8A 4KQEA 3CBOA 2BKDN 2BZ8A 1PRMC 3VRYA 2ZCFB 2FYKA 4M7AD 3L2VA 3JCMW 3PCOA 2CZ6B 2GTOA 3U23A 4PG3A 1QQJA 4J8OA 1RAGB 2VKNA 3OYMA 3VS0A 1RADB 3EGXA 2L5QA 4HVUA 3OB9A 2KSSA 4PL6A 3V7CA 4NOYA 4OMMA 5GJWB 2GCXA 2HL3A 2CP3A 3MP1A 2C0IA 3HRIA 3KBGA 3HFOA 3PE0A 1NZ9A 2RH2A 1RL2A 4KUDK 1KJWA 1OV3A 2ZPHB 2CH4W 1NEGA 3QWYA 4J9HA 1VQ7Q 3CBMA 1WA7A 3L2UA 1DJ7B 1BI2A 2E5KA 3P8BB 1LNXA 4D8KA 2E3HA 1PNJA 1U3OA 1PRLC 1QVFS 4C92B 2EGAA 3N5BB 4R56A 4H2XA 1X27A 3LX7A 2KE9A 2DBKA 2PQWA 2RF0A 2MWPA 3M56A 3PGGA 3G6EQ 2KYBA 2QK0A 3OYKA 5LJ5f 1N9WA 4FYWB 5GAN3 3JB9F 2D1XA 3H0FA 2PVGB 1X6OA 1F1BB 3GF5A 4YRFA 1B7TA 2ZIOA 4JJBA 2RHUA 3P8YA 3QSUA 2IPOB 3P8VA 2YXYA 4MZMA 1WHGA 3D7SB 3UGQA 5DM7R 4J9BA 3O8VA 4WJ3M 1W70A 4FYVB 2DQ3A 4M75D 2PVOB 3EG0A 1K8AR 4N4IA 2YRVA 5ELNA 3CCUQ 3G71Q 3ASKA 3M4YA 5KYYB 1QVGA 1JXMA 1PYSB 3QBYA 4LXCA 3OSSC 2DFUA 2GQVA 2JMAA 2EPDA 3S3MA 3G4SQ 3E9GA 1IHWA 1RAFB 1I07A 1NBEB 4AFSC 5HK3A 2ZXFA 6AT1B 2DTHA 4C0DB 1TSFA 4ZTZB 4OMNA 4A63B 1VQMQ 4ZGDB 1VQZA 3HFNA 2CS7A 4AH6A 1UG1A 2DRKA 1Q7YR 2QA4T 3IALA 2MPXC 3C4SA 2HBWA 2ATCB 2X35A 1OZ3A 5GANf 3OS1A 1D1CA 1GCPA 4KR2A 4NL2A 1K9MC 4YCWA 4HXJA 1NYRA 4M78D 1JO8A 2W0ZA 3A7UA 2F5KA 4Z02A 3GPLA 1NJ2A 1QCNA 3RMQA 3VQXA 4J9CA 2M16A 4HT4A 1BBUA 2XICA 2FZKB 3I35A 2ODRD 1YB3A 4ZN1A 3EFOB 1AEYA 2P5IA 1K1ZA 3QO8A 2DF6A 3M0TA 1GL5A 2KQWA 3AHUA 2GNCA 2Q5HA 4FYXB 3CCQA 4LVJA 1AWJA 4M75G 8AT1B 2JS0A 1HYOA 2DZCA 4LE9A 1GGMA 1Y57A 4JJDA 1W2BP 4AMCA 4HCBA 1EZZB 4XEOA 4XU2A 3P8TA 1XTDA 4M7DD 4M77D 4XU0A 1G83A 3GNGA 5D7UA 3TEHA 1B3QA 1QVGS 1Q7YC 3H6ZA 1VQLQ 4C8QB 4ZTJA 4PJOC 2A28A 4KH0B 2LX7A 1KD1R 4ZIBA 1HTTA 1JB0E 3NMZC 1H3ZA 4YYEA 4PNOA 1M4ZA 3A31A 4F04B 1FXXA 2M1HA 2K57A 2LP5A 1EFWA 4PJOF 2LJ1A 1TUDA 4AFUC 4J6WA 4M78G 3LWHA 2DILA 3HRKA 2WSCE 4P73C 3CCQT 1VQNQ 4MZPA 1TU0B 4M75E 4C92A 1TUGB 1VYTA 4B9XA 4OMPA 1IGUA 1MGQA 1SEMA 1G3YA 4RTUA 3VQYA 5LJ5d 1Q86U 2NLUA 2FRWA 3I55Q 2FO0A 1X69A 2LQKA 2ZPEB 2P4RA 1Z9ZA 5M9OA 4E2FB 5GAOm 1ZLMA 2KVQG 2RHQB 1U8RA 1VQPA 2DL8A 2Y4YA 1I4K1 4MDXA 4Y92A 5IHKA 3EH1A 3VV0A 4M7AB 4KGZB 3KUFA 4BB7A 3NTIA 3QNEA 2X51A 2LNVA 4M77G 2ZNIA 2QQAA 3KXTA 3I9QA 5GMKh 1USYC 3VU3C 3HXZA 1BKBA 3CMEQ 1WHLA 4EIKA 1YI2T 2KRMA 4XEMA 4M78E 3L2RA 1T3LA 5KYYA 3CMAA 3JB9H 2EVRA 5A0DA 3QJ6A 1PYSA 1J5WA 2I4OA 4LVMA 1LJOA 1K4US 1WDXA 4NS5A 1VQ6Q 1VQ5Q 3L4GB 2E3IA 1Q81C 5FWCA 1PKSA 3UDCA 1UB4A 1TS9A 1YNZA 2J6OA 2DIQA 4XTWA 5GANd 1MMNA 2OX7A 5GAOn 4JDSA 2ZPIB 4F7UG 4M4ZA 2JNGA 4PLIA 5IH2A 2X4WA 1VQPT 2ZCEA 3CQTA 2V8IA 4XTZA 2A37A 4WTOB 3RR6A 1WHKA 4LNSA 4TTVA 4L87A 1ZBXA 1B8AA 1ASZA 2OTLA 2D0NA 1MNDA 4F14A 2EQMA 4M77E 5LJ5h 3QTCA 5HK0A 2LCCA 2EIFA 2NWMA 2ZR2A 3MJXA 4CC3A 1MMGA 3CD6Q 2VXEA 2QHSA 1VIFA 3CMAT 2XMFA 3V8LA 3LWIA 2D6FA 1RACB 2KGTA 2SRCA 3TSWA 1VQ7A 4N4HA 5D6WA 3GOXA 5GAMf 1WJQA 3H9NA 4E7ZA 1JRIA 2K79A 1YCYA 2CYZB 4YROA 4PHCA 2XIDA 4DEXA 1OU8A 2CUBA 4E47A 4IURA 1WLPB 2NUPA 3EG9B 3UH0A 1D0XA 3CCJQ 4H2YA 2J3LA 4RKUE 4K86A 4XQ3A 1PCXA 2CGHA 2KRSA 4F7UE 1NJIU 4FSXA 1R0BG 4TQFA 3UA7A 3A8OB 4OB2B 4XK8E 2RB6A 4RUGA 1S72T 2K5IA 2OTLT 2QGFB 1NJ8A 1NJ5A 4C8QA 2RHXA 4FT2A 2DL5A 3A1PA 2K6DA 4IUTA 5LJ3f 1Y07A 1D3BA 5GANh 4BUGA 3M58A 3CCVT 3OD1A 4P74A 2PUKB 1C0AA 4C5HA 4QVDA 2ZINA 4FW1A 3JRZA 1M2OA 1QP2A 4QKUA 4X1VA 2JXBA 4DBQA 1M1KC 3CCUA 5F5WA 1XOVA 1ADJA 2ZT6A 2A0FB 2ZGWA 1NPRA 2VXFA 1R0CB 2K2MA 3S6WA 4C0GA 1Q95G 5KYNA 3G4SA 3META 1V29B 4IUUA 3JCMP 1X55A 3G1JA 4II1A 3VS5A 3EG3A 4J83A 2DQ0A 2LT4A 4K11A 2KEAA 3HXVA 4OGEA 1KQSA 2DXBA 4KUIA 1ACMB 3REAB 5GAN8 2Q7HA 4M7DB 1WNLA 2V1QA 1KQ1A 2EL9A 2QQRA 1W66A 3JCMg 4DBFA 2D0QB 3CCSA 5KYWB 2EFIA 1Q82U 4O5VA 2JOYA 2DE0X 3MO8A 1H4TA 4M7AA 4JUVA 2YRDA 5C52B 1ZSZC 2K7AA 1OX8A 3R6OA 3VKIA 1I5LA 2DKGA 2P84A 2JM9A 1SPKA 3HSBA 1AWOA 2ED0A 4P71A 3G4ST 3MF1A 2SEMA 3VUBA 4YRCA 4Q15A 2IIMA 5LJ5e 3J80E 1OPKA 2MOXA 4KT0E 3OW2P 1ATIA 4RTZA 4A4FA 2G3RA 1UGSB 2CSIA 2DYIA 1KC8C 1RIQA 4OMLA 3EHRA 1BBWA 2CZ7B 4C92G 3ERRA 9ATCB 3DLLA 4HWPA 1AOJA 3X24B 2QAZA 1OULA 2AZVA 1H92A 2P4TA 3VS2A 3JB9I 3CCST 4PFPA 3SDZA 2MWOA 2EAYA 4EMKC 4DBRA 1VQLA 5CO7A 5LL6S 1SHFA 4OMOA 3C94A 3EG2A 4KR3A 2LCSA 2J6FA 4N0AC 5FLXE 2ALYA 3A74A 4Y28E 3QHSA 3CC4Q 2GFAA 1UHCA 4PLLA 1WHHA 5GAOq 2HKQB 4M75A 2FG0A 2QASA 4J7FA 5GAMd 4H2WA 2KI7A 2G4CA 4HWTA 1NJ1A 4LN2A 3WXMB 4P75C 5GAOl 4Z8AA 4FCYA 2RN8A 1VQNA 3UGTA 1AD5A 4RTYA 4C92E 3L2QA 2RNAA 4VUBA 4J5YA 5CQXA 1M90C 1UTIA 4QQDA 1Z7MA 3HFZA 1C1AA 3CCLA 1EVLA 2COZA 2FZCB 3ULRB 3UA6A 3UFGA 2LRQA 1WLEA 4BW9A 1VQLT 3PVQA 3V7RA 2CJAA 5LJ3d 3M57A 3SHWA 2EKHA 1OZ2A 1FYFA 2LVMA 3LGFA 2LJ0A 1IREB 4TVAB 2C8MA 2A08A 4DPGA 3GBQA 1BK2A 3CPWP 5EG2A 1VQKQ 4LVLA 3RF1A 3L2ZA 3HY1A 3A7AA 1QMCA 2YUPA 1VQ6A 1UGVA 1NYFA 1VQ5A 4YRGA 2JT4A 2H3EB 2J7IA 3FRNA 2RJEA 1LYLA 1X2GA 3BFMA 3DLMA 2J06A 5IXFA 2CZ1B 1WFWA 4EX5A 2RPNA 3JV3A 5GAMh 4H2VA 2RI5A 3GP8A 3CCLT 2DD4A 1ZUKA 3TCJA 4BE1A 4GLKA 1VQ8Q 1I5OB 4M7DA 4F17A 4FM4B 4M77A 4L6V5 1BB9A 2M51A 5I2SA 3A32A 3CCEQ 4NCXA 3PZCA 2E5QA 1QVFP 1ARKA 4D8DA 2LMJA 1UGQB 4LUEA 2DETA 3HFVA 2K3BA 1FYNA 2JN0A 4PJJA 1NJ6A 2KT1A 2K9GA 4ZGEB 2CREA 2QXFA 2HCKA 2DTOA 4C8QG 1HSQA 4R55A 1PHTA 4CI0C 1LVKA 5LJ3h 4AG2C 2EYZA 1VQ6T 2X4YA 1ZA2B 2RQRA 1X6GA 4TVWA 4F7UA 3QZ5B 1YFRA 4YRKA 3OYYA 1Q7YU 3OA6A 3JCMQ 1G3TA 2RJFA 1QKWA 4RCBA 2BE9B 1U06A 4YRTA 2A3LA 1EQRA 4DBHA 3HRUA 3X25B 1D1BA 2HNIA 1VUBA 3I5SA 3OMGA 4YRRA 3URGA 4FYYB 4LUDA 3J7AF 3HTZA 3NHNA 2OTJQ 4BWAA 1T0HA 1U1SA 5FW9A 1G3WA 5K1XA 2A7YA 4C8QE 1J3TA 1R8OB 4YTLA 2C7IA 4E7HA 1UDLA 2Z0WA 1L0WA 2E6ZA 4M7AG 2JW4A 4EO4A 3E19A 3A5ZB 3RDVA 1H3HA 3HXXA 4PFOA 3BY7A 1BCMA 4GBQA 4PJOB 1IB8A 3EFSA 3OS2A 4E7SA 4OP0A 1NM7A 4ZGJB 4TQDA 1UECA 2EKOA 2EQKA 3M4PA 1BCOA 1BIAA 2DMOA 2IVWA 2NUTB 7AT1B 2DBMA 3VS4A 1WZOA 2EJGA 2I4MA 1K0SA 1ABQA 1X43A 2HZYA 2J05A 1TXQA 2E70A 3CXCA 1BI3A 2XHCA 5I11A 5L23A 3A5YA 4ZNXA 1TWBA 2LQWA 3IG2A 2E10A 3JCMe 1YIJQ 1WQ7A 2L0AA 4M7AE 2KXCA 3OQ5A 3R6NA 1HK9A 5CKFA 3OYHA 3RACA 1ZUYA 1KK7A 2F2VA 2PUOB 1Q81U 5CIUA 3CMQA 2H8HA 5LJ5g 2E5AA 3CCMQ 1IRXA 2O88A 3REUA 5GAN5 2C06A 1H8KA 2EGEA 4A4HA 4P72C 5GJVB 1QVGP 1K8AC 1PD0A 2LX9A 3G1ZA 4J9GA 2ROLA 1X54A 1Z9QA 4C92F 1VYVA 5HCKA 1FWZA 2C0OA 2AKWB 2ED1A 5KYUB 2O4XB 2QTVA 1WXUA 1OOTA 3S3NA 5LJ3e 2EJ9A 1UEBA 3T9NA 4F16A 2FZGB 1PWTA 5FRNA 1QCOA 1SRLA 4IIMA 1RUWA 3EG1A 4CH4A 3TVTA 2VUBA 2F1LA 2DXUA 2COWA 2DL7A 4RCCA 3QYGB 4P3NA 2DNUA 1M3CA 1EIYB 3JCMJ 1G5HA 2DIGA 2VGMA 5GANg 3VQWA 2NUZA 3LW5E 2ECZA 2ARUA 2EQIA 3CXCS 2WACA 1LOJA 2ROTA 1OI1A 1M9SA 2NYSA 4WF2A 2DTIA 5CK9A 4IIOA 2E41A 4XTUA 3EHQA 2HDAA 4YCVA 3DSQA 3A8GB 1YHQQ 1M3BA 2RHZA 4J7IA 1NE8A 1SRYA 1M27C 4RTXA 4ELZC 3QIIA 4H2SA 3CC7Q 5FROA 2M02A 1I8FA 2RHYA 1M1KU 2K5LA 3H0IA 4PFZA 2P0LA 2LTOA 1ADYA 4M7DG 2BIVA 3NPFA 4WCIA 5C0MA 1E22A 1W4SA 3C12A 4YRNA 4LDVA 3C95A 3ICAA 1KD1C 2VB6A 3VRZA 4J9FA 4BACA 3E2UA 3M9QA 4E51A 3E9HA 1KQ2A 5HGQA 3NFCA 1NYGA 4QW2A 2HSEB 3A8HB 4HCZA 4BI3A 3LC0A 1G3SA 2FB7A 2DL3A 3THKA 1SSHA 2QYZA 3QO3A 1VQ9Q 4RMFA 1OYXA 1YITA 5CKEA 2HQXA 5DLQE 2ZZDA 1K76A 2E64A 2EQUA 1GCQA 2HBPA 2LQ8A 2VASA 3SB2A 3TSZA 2EQJA 3OYLA 2XD0A 2CZ0B 2DEQA 1FMKA 1KG1A 3CCRQ 3ZEHA 3JCMV 3OYDA 1UJYA 1VQ8A 3OYCA 1UUEA 3QYHB 3JB9D 2DU7A 4P74C 4JZ4A 2RM4A 3CCEA 4M7DE 3EGDB 1Q86R 3HP9A 4EMHA 4FSSA 3DKMA 5GMKm 2YUNA 4LVKA 4ME7A 1BI0A 2D8HA 3QDFA 3FLGA 3JCMc 1WYDA 1B7YB 1OEBA 2YLCA
chains in the Genus database with same CATH topology
1YFSA 4MZTA 1KC8U 5GAN4 3KFUA 2KMTA 1YITT 3OY9A 2HAXA 1KHCA 3M5AA 3BDUA 3PIPA 4LVIA 5FU7C 3G6EA 4XTYA 2ZZFA 4A54A 2O4XA 2I4NA 4H2UA 1USYA 2Q7EA 1O75A 2ZIMA 4MDWA 1VQ8T 3OBWA 4OLFA 2XTIA 3IKMB 4G85A 1BYMA 5LJ5j 2DDZA 4A53A 2J3MA 2GF7A 4DQ2A 2OTJA 1EIFA 1XNIA 4M7AF 4ZTUB 1X56A 3GLXA 3MCAB 4DOVA 4XAXB 4LDXA 4CH3A 2XU8A 3BW1A 2RJCA 3QDRB 4P71C 3H8ZA 1N9SA 1B70B 3G71A 1VQ7T 3JB9G 1EIYA 3QO5A 2Q7GA 4C0FA 4YPFA 2RHIA 2AHJB 4V2SA 4JRQA 4EMKB 2QQBA 1KOGA 1M90U 1Y71A 1VQMA 4X5OA 3G6ET 5GMKe 4YRLA 3CPFA 4C5IA 5KCHA 2V8JA 3NTHA 4HWSA 2DU5A 3X20B 1KMNA 4HT9A 2IY5B 3QKJA 2CIMA 2GFUA 3JCMb 2DK3A 3SWNC 4C5EA 2RHQA 2KY9A 2X4JA 4D6WA 5GAMg 2OTJT 3PNWC 4LDUA 4PKCC 2IG0A 2R5AA 3MEVA 1JJ2A 4BDZA 2XKOC 4B9WA 4JRPA 2K3YA 4YRJA 4M75C 1YIJA 4E7LA 12ASA 3FC3A 3G71T 3CCUT 4L59A 4A4KA 3HL8A 3PCOB 4TVYA 4CH5A 3VBBA 3NENA 3TUPA 1WJRA 3TEGA 3CCMA 4PJOD 4M75F 2V8KA 2QI2A 3MEYA 4P5NA 4HKEA 3L4GA 1KHIA 3VJPA 1VQMT 3TU4K 2OAUA 5LJ3g 2ZT7A 4UP8A 2LC4A 4BD3A 4G84A 2XDPA 4H2XB 5I21A 1NPPA 2JUFA 4RQEA 4M78C 5I2MA 2PMEA 4BY6B 4FL6A 4OB3B 2K3XA 1YIJT 4M78F 2ODRC 5CKDA 2ZTGA 3QJYA 2DXCA 3OYIA 1KQSS 4YRMA 3CCMT 3IKLA 1X2HA 1U1TA 2L89A 5GANe 5J26A 3EAEA 4N4GA 3OYFA 4CS3A 3LLRA 4J6XA 4IUQA 1JJ2S 4M77C 4PJOG 3I55A 1YHQA 4Q5WA 1G5IA 11ASA 3OBYA 4XU1A 3M4QA 4M7DF 4M77F 2YLBA 3TREA 2E3CA 2QQ9A 3JSCA 4BE2A 5FRMA 3RKWA 4JJNK 1M5Q1 3OYGA 3BJUA 3OS5A 4X9DA 3CMEA 4DA4A 2AMCB 4QVCA 2ARSA 5A2QE 2Q5IA 5FU6C 3NETA 3V7SA 1VQNT 2ARTA 4MMLA 4NL3A 4BY6C 4YP0A 1VQ9A 4F7UF 4PJOE 1G5VA 3JB9J 1H4VB 3I55T 1N9RA 2P0KA 1ZHIA 4Q6GA 5GMKl 4WI1A 3CCRA 3GNFB 3LGLA 5KE3A 2NS6A 2ZPFB 2HD0A 3PTAA 2XDDA 5KCOA 3L2WA 4JLGA 3VUZA 3ZFJA 3TEHB 1N6AA 5D6YA 2DO3A 4XTXA 3RERA 3CMET 1K8AU 3CD6A 1RI0A 3VQVA 2E12A 5A0LA 3PFSA 3J81E 1WJSA 5CKHA 3NEMA 3PT9A 1VQ5T 3PMTA 2K4YA 4JS5A 3MHXA 2RD1A 5J39A 2RI3A 2K2VA 2E65A 1JBMA 1X01A 3NTKA 1VQ9T 1EVKA 4OF1A 3OYNA 3CCJA 4BI4A 5GAMj 1I81A 2R58A 3CCRT 1IL2A 2JTFA 5C6SA 3MF2A 2M0OA 2I4LA 5KE2A 1B76A 2YHTA 2QA4A 4J6YA 3HY0A 4CRIA 1NYQA 3CD6T 3P8DA 2MMPA 3UWNA 5D6XA 3QUIA 2QHTA 2KDSA 5LJ3j 2KK4A 1NNHA 3M59A 4A4EA 4XTVA 4YREA 1H4QA 1N27A 2ZT5A 3CEYA 3I7FA 3CCJT 3L42A 2LCLA 4CS2A 2CJ9A 1QVPA 2XI9A 1W2BA 2QHUA 2RHSB 2E1HA 3MQZA 4HWRA 1ZQ1A 1KD1U 1FX7A 3CC2A 1WU7A 3S3OA 3WQZA 3PIOA 3SD4A 5HKCA 3E9IA 5GAMe 4TVAA 1SSFA 2LDMA 3HPWA 2AMCA 1YJWA 4C92C 2B8AA 3E1SA 3MEWA 3PMIA 5GAN6 4P3OA 4RMOA 3LYIA 1YGBA 2BUDA 2CKKA 4Y91A 4HVCA 3TEEA 2F69A 3M54A 2PMFA 3HXYA 2P0QA 3A8LB 4E7IA 4TVRA 3RESA 3CC2T 4DOWA 2L8DA 4P3PA 4QVZA 1E1TA 1M8VA 4CS4A 4YDQA 3VYGA 4BDYA 2DVEA 1G51A 4K88A 1YJWT 3RMSA 3CC4A 1BI1A 4RQFA 4C0DC 2ZPGB 4EPCA 1D3BB 2QHVA 3OMCA 1W2BS 4C5GA 1UGRB 3Q1JA 2ZT8A 1EOVA 4YRIA 1HC7A 5CAIA 3HXWA 3REXA 2JZ2A 3LSQA 1JJCB 3P8HA 1YI2A 2O01E 4OGCA 3OYEA 4IUPA 4MMKA 3E9FA 4EMGA 4P72A 1WGSA 2DD5A 1QE0A 5ELOA 3HXUA 2Y4XA 3MP6A 4OB1B 4FT4A 4O2DA 2XDBA 5FU7B 3CC4T 2ZR3A 4OMFB 4IKFA 3HKSA 3JAME 3RKXA 3DB3A 4LD9K 1VQKA 4LDYA 1Y96B 4LD6A 3A5ZA 4X34A 4C0ZA 4PJOA 3QXEB 3LSSA 1WPYA 5DLOA 4JRKA 2VV5A 1E1OA 2EJFA 2QTXA 4C8QC 3LH0A 4J15A 5C51B 2E6NA 1KMMA 2RJDA 1MHNA 2P0PA 4P73A 5KNNA 2RA2A 2RHSA 1YFTA 2H3JA 3FIFA 2MAMA 1YBYA 3G7ZA 4H02A 5E3IA 4C8QF 5GAOr 4K87A 1N8RU 5K1PA 4BI8B 5GMKj 4ELYC 3QZ9B 4YCUA 5GMKi 1VQOA 4WJ4A 5CR2A 1YJ9A 1P92A 4LDWA 3M4GA 1VQKT 1S72A 3SWNB 1BIBA 2ALYB 3L1AA 4QQ6A 2PVDB 4XU3A 3CCVA 2F5TX 4RG8A 3JCMX 2AKWA 4M75B 3RGLA 2XK0A 3JCMf 1IZ6A 1YJNA 3OYAA 2FHDA 4M7AC 4ZTFA 4BE0A 3CCET 1Y7XA 2JVVA 3RIRA 4ZN3A 4CH6A 2HQEA 4X9CA 3HFZB 1VQOT 3X26B 4A4GA 1YJ9T 3FDRA 1H4SA 3WVEB 5AYFA 1Q86C 4YRSA 3M53A 3WVDB 4M78B 2FL7A 3GIBA 2FVUA 1PSFA 3HHTB 5C53B 1VIEA 3F70A 2RO0A 5A0GA 1JJCA 1B34B 3I56A 3ME9A 3FEOA 4FIBA 4C92D 3OW2A 5IAYA 5DY9A 1YJNT 1HXDA 4JRIA 2QEXA 2Y90A 3OS0A 1X75C 3RUXA 5GANj 3RL6A 2R57A 5J3BA 2QDYB 2WSEE 1Z7NA 3DB4A 1TH7A 4M77B 1M1FA 2ZZGA 1K73U 1N8RC 4RDXA 2RK1A 1H641 4JLIA 2DPPB 2MF2A 5CCAA 2RK2A 4UC4A 5IT9E 1Y96A 1PSEA 2KAFA 2CJBA 5GAN7 5IN1A 3QG1A 2R5MA 4QQGA 3QPHA 1QF6A 2EYQA 4UPAA 3W3SA 3I56T 4HT8A 2XGTA 4HA8A 3INZA 2M9UA 2QEXT 5FU6B 4KBMB 4ATOA 4F7UB 2EWNA 1WQWA 5GAOp 1QW1A 3FJPA 3RKYA 2VGNA 2VYTA 1QP3A 3A7RA 1E24A 4FU6A 5CVIA 3VYHB 1SETA 3X28B 4UP7A 4H2TA 2RI2A 1VQ4A 1B7YA 3UPUA 2WSFE 4JS4A 5CKBA 3OW2S 1NJIC 4L5GA 3HRTA 3SWNA 3CPWA 4GY5A 4E7KA 3FB9A 3BDLA 1SERA 3MEAA 4KULA 3OYBA 2L3RA 5L8RE 1ASYA 3JCMd 4M7DC 3HRSA 2QQSA 4UP9A 3NELA 4TWAA 5KH6A 4E7JA 2DXTA 2MI6A 3ZBDA 1SESA 4OB0B 3CC7A 1O9SA 3MEUA 4IUVA 5GAN2 2DAQA 2ZNJA 2DJZA 4YRPA 2LT1A 3A8MB 2I2LA 4C8QD 5HY6A 1VQ4T 1QVFA 3V8KA 2D9TA 1AHJB 2ZPBB 1B70A 3UT1A 4OVAA 3OSVA 4EMKA 2K5FA 4M78A 1K73C 4HWOA 2XG8D 1Q82C 4N0AA 1GXIE 4EDUA 1XQHA 2X4XA 4O6JA 1YHQT 4YRQA 2VC8A 1B34A 3QO7A 3EFRA 3M55A 3OYJA 2IY5A 3ER0A 4RG2A 3CC7T 2ZZEA 1M1GA 4HCCA 2PU9B 2A8EA 3SFMA 3R07A 4P75A 3JCMh 3CPWS 2DZ9A 1UGPB 3CBPA 1K9MU 5CQYA 3V8JA 2JTMA 3MP8A 4KQEA 3CBOA 2BKDN 2ZCFB 2FYKA 4M7AD 3L2VA 3JCMW 3PCOA 2CZ6B 4PG3A 4J8OA 3OYMA 2L5QA 3OB9A 2KSSA 4PL6A 3V7CA 4NOYA 2GCXA 3MP1A 3HRIA 3KBGA 3HFOA 4KUDK 1NZ9A 2RH2A 1RL2A 2ZPHB 3CBMA 3L2UA 1DJ7B 1BI2A 3P8BB 1LNXA 1QVFS 4C92B 3N5BB 4R56A 4H2XA 3LX7A 2PQWA 2MWPA 3M56A 3PGGA 3OYKA 5LJ5f 1N9WA 5GAN3 3JB9F 2PVGB 1X6OA 3GF5A 4YRFA 2ZIOA 2RHUA 3P8YA 3QSUA 3P8VA 4MZMA 3UGQA 5DM7R 3O8VA 4WJ3M 2DQ3A 4M75D 2PVOB 4N4IA 2YRVA 5ELNA 3ASKA 3M4YA 1QVGA 1PYSB 3QBYA 3OSSC 2GQVA 3S3MA 3E9GA 5HK3A 2ZXFA 2DTHA 4C0DB 4ZTZB 4ZGDB 1VQZA 3HFNA 2CS7A 4AH6A 2QA4T 3IALA 3C4SA 2X35A 1OZ3A 5GANf 3OS1A 4KR2A 4NL2A 1K9MC 4YCWA 1NYRA 4M78D 3A7UA 2F5KA 4Z02A 3GPLA 1NJ2A 3RMQA 3VQXA 2M16A 4HT4A 1BBUA 2XICA 2ODRD 1YB3A 4ZN1A 2P5IA 3QO8A 2KQWA 3AHUA 2Q5HA 3CCQA 4LVJA 4M75G 2DZCA 1GGMA 4HCBA 4XEOA 4XU2A 3P8TA 1XTDA 4M7DD 4M77D 4XU0A 3GNGA 3TEHA 1QVGS 1Q7YC 3H6ZA 4C8QB 4ZTJA 4PJOC 4ZIBA 1HTTA 1JB0E 1H3ZA 4YYEA 4PNOA 1M4ZA 3A31A 1FXXA 2M1HA 2K57A 1EFWA 4PJOF 4J6WA 4M78G 3LWHA 3HRKA 2WSCE 4P73C 3CCQT 4MZPA 4M75E 4C92A 4B9XA 1MGQA 1G3YA 3VQYA 5LJ5d 1Q86U 2NLUA 2LQKA 2ZPEB 5M9OA 5GAOm 2KVQG 2RHQB 1U8RA 1VQPA 2Y4YA 1I4K1 4MDXA 3VV0A 4M7AB 3KUFA 4BB7A 3NTIA 3QNEA 2LNVA 4M77G 2ZNIA 2QQAA 3KXTA 5GMKh 1USYC 3VU3C 3HXZA 1BKBA 1YI2T 4XEMA 4M78E 3L2RA 3CMAA 3JB9H 5A0DA 3QJ6A 1PYSA 1J5WA 2I4OA 4LVMA 1LJOA 4NS5A 3L4GB 1Q81C 3UDCA 1UB4A 2DIQA 4XTWA 5GANd 5GAOn 4JDSA 2ZPIB 4F7UG 2JNGA 4PLIA 2X4WA 1VQPT 2ZCEA 2V8IA 4XTZA 4LNSA 4TTVA 4L87A 1ZBXA 1B8AA 1ASZA 2OTLA 2EQMA 4M77E 5LJ5h 3QTCA 5HK0A 2LCCA 2EIFA 2ZR2A 2VXEA 2QHSA 1VIFA 3CMAT 3V8LA 3LWIA 2D6FA 1VQ7A 4N4HA 5D6WA 3GOXA 5GAMf 1WJQA 1JRIA 1YCYA 2CYZB 4YROA 4PHCA 2XIDA 4E47A 4IURA 3UH0A 4H2YA 4K86A 2J3LA 4RKUE 4XQ3A 2CGHA 4F7UE 1NJIU 4FSXA 4TQFA 3A8OB 4OB2B 4XK8E 2RB6A 1S72T 2K5IA 2OTLT 1NJ8A 1NJ5A 4C8QA 2RHXA 4FT2A 4IUTA 5LJ3f 1Y07A 1D3BA 5GANh 4BUGA 3M58A 3CCVT 3OD1A 4P74A 2PUKB 1C0AA 4C5HA 4QVDA 2ZINA 3JRZA 1QP2A 1M1KC 3CCUA 5F5WA 1XOVA 1ADJA 2ZT6A 2ZGWA 1NPRA 2VXFA 3S6WA 4C0GA 3G4SA 3META 1V29B 4IUUA 3JCMP 1X55A 4II1A 4J83A 2DQ0A 2LT4A 3HXVA 4OGEA 1KQSA 2DXBA 4KUIA 5GAN8 2Q7HA 4M7DB 1WNLA 1KQ1A 2EL9A 2QQRA 1W66A 3JCMg 3CCSA 2D0QB 1Q82U 2EFIA 4O5VA 2JOYA 3MO8A 1H4TA 4M7AA 4JUVA 5C52B 3R6OA 3VKIA 1I5LA 2DKGA 3HSBA 4P71A 3G4ST 3MF1A 4YRCA 3VUBA 4Q15A 5LJ5e 3J80E 4KT0E 1ATIA 4A4FA 2G3RA 1UGSB 1KC8C 1RIQA 1BBWA 2CZ7B 4C92G 3ERRA 3DLLA 4HWPA 3X24B 2P4TA 3JB9I 3CCST 3SDZA 2MWOA 2EAYA 4EMKC 1VQLA 5CO7A 5LL6S 3C94A 4KR3A 4N0AC 5FLXE 2ALYA 3A74A 4Y28E 3QHSA 2GFAA 4PLLA 5GAOq 4M75A 4J7FA 5GAMd 4H2WA 2G4CA 4HWTA 1NJ1A 3WXMB 4P75C 5GAOl 1VQNA 3UGTA 4C92E 3L2QA 4VUBA 4J5YA 5CQXA 1M90C 4QQDA 1Z7MA 3HFZA 3CCLA 1EVLA 3UFGA 2LRQA 1WLEA 4BW9A 1VQLT 3V7RA 2CJAA 5LJ3d 3M57A 1OZ2A 1FYFA 2LVMA 3LGFA 1IREB 4TVAB 2C8MA 4DPGA 5EG2A 4LVLA 3RF1A 3L2ZA 3HY1A 3A7AA 1VQ6A 1VQ5A 4YRGA 3FRNA 2RJEA 1LYLA 1X2GA 3BFMA 3DLMA 2CZ1B 4EX5A 5GAMh 4H2VA 2RI5A 3GP8A 3CCLT 2DD4A 3TCJA 4BE1A 4GLKA 4M7DA 4FM4B 4M77A 4L6V5 5I2SA 3A32A 4NCXA 3PZCA 2E5QA 3HFVA 1UGQB 2JN0A 1NJ6A 4ZGEB 2QXFA 4C8QG 2DTOA 4R55A 4CI0C 5LJ3h 1VQ6T 2X4YA 4TVWA 4F7UA 3QZ5B 1YFRA 4YRKA 3OYYA 1Q7YU 3OA6A 3JCMQ 1G3TA 2RJFA 4RCBA 4YRTA 2A3LA 1EQRA 3HRUA 3X25B 2HNIA 1VUBA 3OMGA 4YRRA 3URGA 3J7AF 3HTZA 4BWAA 1U1SA 1G3WA 5K1XA 2A7YA 4C8QE 1R8OB 4YTLA 2C7IA 4E7HA 1L0WA 2E6ZA 4M7AG 4EO4A 3E19A 3A5ZB 3HXXA 3BY7A 4PJOB 3EFSA 3OS2A 4OP0A 4ZGJB 4TQDA 2EKOA 2EQKA 3M4PA 1BIAA 2IVWA 2EJGA 2I4MA 2E70A 3CXCA 1BI3A 2XHCA 3A5YA 3IG2A 2E10A 3JCMe 1WQ7A 4M7AE 3OQ5A 1HK9A 5CKFA 3OYHA 3RACA 2PUOB 1Q81U 5CIUA 3CMQA 5LJ5g 2E5AA 3REUA 5GAN5 2C06A 4A4HA 4P72C 1K8AC 2LX9A 3G1ZA 1X54A 4C92F 1FWZA 2AKWB 2O4XB 3S3NA 5LJ3e 2EJ9A 1UEBA 3T9NA 5FRNA 4CH4A 2VUBA 2DXUA 4RCCA 3QYGB 4P3NA 1EIYB 3JCMJ 1G5HA 2DIGA 2VGMA 5GANg 3VQWA 3LW5E 2ARUA 3CXCS 2WACA 1LOJA 1OI1A 1M9SA 4WF2A 2DTIA 5CK9A 2E41A 4XTUA 4YCVA 3DSQA 3A8GB 2RHZA 4J7IA 1NE8A 1SRYA 4ELZC 3QIIA 4H2SA 5FROA 1I8FA 2RHYA 1M1KU 2K5LA 2P0LA 2LTOA 1ADYA 4M7DG 2BIVA 5C0MA 1E22A 1W4SA 3C12A 4YRNA 4LDVA 3C95A 3ICAA 1KD1C 4BACA 3M9QA 4E51A 3E9HA 1KQ2A 5HGQA 3NFCA 4QW2A 4BI3A 3A8HB 4HCZA 3LC0A 1G3SA 2FB7A 3QO3A 4RMFA 1OYXA 1YITA 5CKEA 2HQXA 5DLQE 2ZZDA 2E64A 2EQUA 2HBPA 2LQ8A 3SB2A 3OYLA 2XD0A 2EQJA 2CZ0B 2DEQA 1KG1A 3ZEHA 3JCMV 3OYDA 1VQ8A 3OYCA 3QYHB 3JB9D 2DU7A 4P74C 2RM4A 3CCEA 4M7DE 3HP9A 4EMHA 3DKMA 5GMKm 4LVKA 1BI0A 4ME7A 3FLGA 3JCMc 1WYDA 1B7YB 2YLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  3ERR A;  3RES A;  4HWP A;  3HRI A;  1YFS A;  3HFO A;  3JB9 I;  5GAN 4;  3KFU A;  4P3P A;  1E1T A;  2EAY A;  4EMK C;  1M8V A;  4CS4 A;  4YDQ A;  1LNX A;  3BDU A;  4KR3 A;  4C92 B;  2DVE A;  1G51 A;  4K88 A;  4H2X A;  4N0A C;  2ALY A;  4XTY A;  2ZZF A;  4A54 A;  3A74 A;  2I4N A;  4RQF A;  4H2U A;  1USY A;  2Q7E A;  3QHS A;  2ZIM A;  3PGG A;  1D3B B;  2QHV A;  4OLF A;  2XTI A;  5GAO q;  5LJ5 f;  3IKM B;  4M75 A;  2ZT8 A;  4G85 A;  1EOV A;  1N9W A;  5GAN 3;  5GAM d;  4YRI A;  4H2W A;  3JB9 F;  1HC7 A;  2G4C A;  5CAI A;  5LJ5 j;  1NJ1 A;  3HXW A;  4HWT A;  3REX A;  3LSQ A;  1JJC B;  2DDZ A;  4A53 A;  2J3M A;  4DQ2 A;  5GAO l;  4P75 C;  4YRF A;  2ZIO A;  3UGT A;  3P8Y A;  4M7A F;  4ZTU B;  1X56 A;  3QSU A;  3P8V A;  4CH3 A;  3BW1 A;  4P71 C;  1N9S A;  4C92 E;  3UGQ A;  4MMK A;  1B70 B;  4WJ3 M;  3JB9 G;  4J5Y A;  4EMG A;  1EIY A;  2DQ3 A;  3QO5 A;  2Q7G A;  4P72 A;  1Z7M A;  1QE0 A;  4YPF A;  3HFZ A;  4M75 D;  1EVL A;  4V2S A;  5ELN A;  5ELO A;  3HXU A;  4EMK B;  3UFG A;  1PYS B;  1WLE A;  4BW9 A;  1KOG A;  3V7R A;  4O2D A;  2CJA A;  5LJ3 d;  4X5O A;  1FYF A;  5GMK e;  2ZXF A;  4YRL A;  2ZR3 A;  2DTH A;  3RKX A;  4ZTZ B;  4HWS A;  2DU5 A;  4TVA B;  2C8M A;  1VQZ A;  1Y96 B;  3HFN A;  1KMN A;  3A5Z A;  4AH6 A;  4HT9 A;  4DPG A;  2IY5 B;  2CIM A;  3JCM b;  3IAL A;  3SWN C;  2RHQ A;  4PJO A;  3RF1 A;  3L2Z A;  3HY1 A;  5GAN f;  3A7A A;  3LSS A;  1WPY A;  5GAM g;  4KR2 A;  4JRK A;  4YRG A;  4NL2 A;  1E1O A;  4YCW A;  4YRJ A;  1NYR A;  2EJF A;  4M75 C;  2QTX A;  4M78 D;  2YLC A;  4C8Q C;  1LYL A;  1X2G A;  3BFM A;  12AS A;  4J15 A;  5C51 B;  3A7U A;  3PCO B;  1NJ2 A;  4TVY A;  4CH5 A;  3VBB A;  3VQX A;  3NEN A;  4EX5 A;  3TUP A;  1KMM A;  5GAM h;  4H2V A;  4P73 A;  3TEG A;  2RA2 A;  2RHS A;  5KNN A;  1BBU A;  4PJO D;  1YFT A;  3FIF A;  4M75 F;  4H02 A;  2ODR D;  4C8Q F;  3MEY A;  5GAO r;  1YB3 A;  4K87 A;  5E3I A;  4M7D A;  2P5I A;  4M77 A;  3L4G A;  5K1P A;  5GMK j;  3QO8 A;  3A32 A;  3AHU A;  4NCX A;  3PZC A;  4YCU A;  5GMK i;  5LJ3 g;  4WJ4 A;  2Q5H A;  2ZT7 A;  3HFV A;  4UP8 A;  2JN0 A;  1NJ6 A;  3M4G A;  4M75 G;  4G84 A;  2DZC A;  4C8Q G;  2DTO A;  3SWN B;  1GGM A;  1BIB A;  4H2X B;  5I21 A;  2ALY B;  3L1A A;  4XEO A;  4XU2 A;  4XU3 A;  3P8T A;  5LJ3 h;  4RQE A;  4M7D D;  4M78 C;  4M77 D;  4XU0 A;  2PME A;  3TEH A;  3JCM X;  2AKW A;  4M75 B;  3RGL A;  4C8Q B;  3JCM f;  4TVW A;  4F7U A;  4PJO C;  4M78 F;  1YFR A;  4YRK A;  2ODR C;  4ZIB A;  1HTT A;  2ZTG A;  3JCM Q;  4M7A C;  4YYE A;  4PNO A;  4RCB A;  3A31 A;  4YRM A;  3IKL A;  2K57 A;  1X2H A;  1EFW A;  4PJO F;  4YRT A;  3RIR A;  1EQR A;  4CH6 A;  1U1T A;  2HNI A;  4YRR A;  4J6W A;  4M78 G;  4X9C A;  5GAN e;  3HFZ B;  4CS3 A;  3HTZ A;  3HRK A;  4P73 C;  4BWA A;  1H4S A;  4J6X A;  1U1S A;  4M75 E;  5K1X A;  4C92 A;  4C8Q E;  4M77 C;  4PJO G;  4YRS A;  2C7I A;  1MGQ A;  1G5I A;  11AS A;  1L0W A;  3VQY A;  4M7A G;  5LJ5 d;  4XU1 A;  4M78 B;  3M4Q A;  4EO4 A;  3GIB A;  4M7D F;  4M77 F;  5C53 B;  2YLB A;  3HXX A;  5GAO m;  2RHQ B;  3BY7 A;  1JJC A;  4PJO B;  2E3C A;  1I4K 1;  1B34 B;  3EFS A;  3RKW A;  4C92 D;  1M5Q 1;  4OP0 A;  5DY9 A;  4M7A B;  3BJU A;  4TQD A;  4X9D A;  3M4P A;  3QNE A;  2AMC B;  2ZNI A;  4M77 G;  1HXD A;  4QVC A;  1BIA A;  4JRI A;  2Y90 A;  2ARS A;  2Q5I A;  5GMK h;  1USY C;  2EJG A;  3VU3 C;  3NET A;  2I4M A;  3HXZ A;  3RUX A;  3V7S A;  5GAN j;  4M78 E;  4XEM A;  3RL6 A;  2ART A;  3JB9 H;  4MML A;  4NL3 A;  1PYS A;  4YP0 A;  1J5W A;  3A5Y A;  2I4O A;  1LJO A;  1Z7N A;  1TH7 A;  3IG2 A;  4M77 B;  4F7U F;  3L4G B;  2E10 A;  4PJO E;  2ZZG A;  3JB9 J;  1H4V B;  3JCM e;  4RDX A;  1N9R A;  1H64 1;  4JLI A;  1WQ7 A;  4M7A E;  4Q6G A;  5GMK l;  4WI1 A;  1HK9 A;  1Y96 A;  3RAC A;  2CJB A;  3CMQ A;  4XTW A;  5GAN 7;  5GAN d;  5LJ5 g;  2E5A A;  5GAO n;  3REU A;  5GAN 5;  4F7U G;  4P72 C;  1QF6 A;  2ZCE A;  4UPA A;  3W3S A;  4XTZ A;  4HT8 A;  2XGT A;  3G1Z A;  4LNS A;  1X54 A;  4HA8 A;  3TEH B;  4TTV A;  4L87 A;  1B8A A;  1ASZ A;  3INZ A;  4C92 F;  4XTX A;  3RER A;  4M77 E;  5LJ5 h;  2AKW B;  3QTC A;  3VQV A;  2ZR2 A;  4F7U B;  2VXE A;  5LJ3 e;  2QHS A;  2EJ9 A;  1WQW A;  2EWN A;  5GAO p;  3V8L A;  3NEM A;  3FJP A;  3RKY A;  2RD1 A;  2E65 A;  1JBM A;  3A7R A;  1X01 A;  1EVK A;  1E24 A;  5GAM f;  1SET A;  1JRI A;  1YCY A;  4UP7 A;  4CH4 A;  4H2T A;  4YRO A;  5GAM j;  4PHC A;  1B7Y A;  2DXU A;  1I81 A;  4RCC A;  3UH0 A;  3SWN A;  4H2Y A;  4K86 A;  2J3L A;  1IL2 A;  4P3N A;  4XQ3 A;  2CGH A;  1EIY B;  3MF2 A;  3JCM J;  4F7U E;  1G5H A;  5GAN g;  3FB9 A;  2I4L A;  1SER A;  3VQW A;  4TQF A;  1B76 A;  2YHT A;  2ARU A;  1ASY A;  3JCM d;  2RB6 A;  4J6Y A;  1LOJ A;  4M7D C;  4UP9 A;  3HY0 A;  4WF2 A;  1NYQ A;  3NEL A;  2DTI A;  1NJ8 A;  1NJ5 A;  4C8Q A;  4TWA A;  2E41 A;  4XTU A;  5LJ3 f;  2DXT A;  2QHT A;  3QUI A;  4YCV A;  1D3B A;  5GAN h;  3DSQ A;  5LJ3 j;  3OD1 A;  4P74 A;  1C0A A;  1SES A;  4QVD A;  2ZIN A;  1SRY A;  1NNH A;  4XTV A;  5GAN 2;  5F5W A;  4H2S A;  4YRE A;  1ADJ A;  2ZNJ A;  2ZT6 A;  2DJZ A;  1H4Q A;  2ZGW A;  4YRP A;  2VXF A;  2ZT5 A;  3I7F A;  1I8F A;  2I2L A;  4C8Q D;  2P0L A;  3V8K A;  1ADY A;  4M7D G;  3JCM P;  1B70 A;  1X55 A;  1E22 A;  2DQ0 A;  4YRN A;  4CS2 A;  3HXV A;  2CJ9 A;  3ICA A;  4EMK A;  2QHU A;  4HWO A;  4M78 A;  2RHS B;  4E51 A;  2E1H A;  3E9H A;  1KQ2 A;  4HWR A;  5GAN 8;  5HGQ A;  2Q7H A;  4M7D B;  1WNL A;  4N0A A;  1WU7 A;  1KQ1 A;  3LC0 A;  2EL9 A;  1W66 A;  3JCM g;  2FB7 A;  4YRQ A;  2VC8 A;  3WQZ A;  1B34 A;  3QO7 A;  3QO3 A;  4RMF A;  1H4T A;  3E9I A;  5GAM e;  4TVA A;  3EFR A;  4M7A A;  2E64 A;  4JUV A;  3SB2 A;  5C52 B;  2IY5 A;  2DEQ A;  2AMC A;  4C92 C;  2ZZE A;  1I5L A;  2DKG A;  3R07 A;  3JCM V;  4P75 A;  3HSB A;  3JCM h;  5GAN 6;  2DZ9 A;  3V8J A;  3JB9 D;  2DU7 A;  4P3O A;  4P74 C;  4P71 A;  2RM4 A;  3MF1 A;  4KQE A;  4M7D E;  1YGB A;  4YRC A;  4Q15 A;  5LJ5 e;  2FYK A;  4M7A D;  3PCO A;  4EMH A;  3JCM W;  4Y91 A;  4PG3 A;  5GMK m;  1ATI A;  4HVC A;  2PMF A;  3JCM c;  3V7C A;  1WYD A;  3HXY A;  4NOY A;  1RIQ A;  1B7Y B;  1BBW A; 
#chains in the Genus database with same CATH topology
 2ABL A;  3EFO A;  2RQU A;  4PJM A;  1YFS A;  4MZT A;  1GBR A;  1KC8 U;  2MYS A;  2O9V A;  1PD1 A;  4AFZ C;  5GAN 4;  3KFU A;  2KMT A;  2YT6 A;  2YUO A;  1YIT T;  3OY9 A;  2HAX A;  1KHC A;  3M5A A;  3BDU A;  2GTJ A;  1VOM A;  3PIP A;  1ZSZ B;  4LVI A;  5FU7 C;  3G6E A;  1FMV A;  4XTY A;  2ZZF A;  5KYU A;  4A54 A;  2O4X A;  2I4N A;  4H2U A;  1KFZ A;  1USY A;  2KT8 A;  2Q7E A;  1O75 A;  2ZIM A;  1RI9 A;  4MDW A;  1VQ8 T;  2DRM A;  3OBW A;  4OLF A;  1N5Z A;  1MMA A;  2XTI A;  1PG5 B;  3IKM B;  4G85 A;  1BYM A;  4Z89 A;  5LJ5 j;  2DM1 A;  2DDZ A;  2QA4 Q;  4A53 A;  2J3M A;  2GF7 A;  1BU1 A;  2AIR B;  4OMQ A;  4DQ2 A;  1N8R R;  2OTJ A;  1EIF A;  1XNI A;  4M7A F;  1K0X A;  2FPF A;  1X56 A;  4ZTU B;  3GLX A;  1RAI B;  3MCA B;  4DOV A;  4XAX B;  4LDX A;  4CH3 A;  2XU8 A;  3BW1 A;  2RJC A;  3QDR B;  4P71 C;  3H8Z A;  1N9S A;  1B70 B;  3G71 A;  1VQ7 T;  3JB9 G;  1EIY A;  4HVV A;  3UAT A;  3QO5 A;  2Q7G A;  4C0F A;  2ENM A;  4YPF A;  4CC7 A;  2RHI A;  2AHJ B;  4V2S A;  4JRQ A;  4EMK B;  2QQB A;  2X9H A;  3NGP A;  1KOG A;  1M90 U;  2HQH A;  2HKN A;  1WHJ A;  1Y71 A;  4CC4 B;  1VQM A;  4X5O A;  3G6E T;  5GMK e;  4YRL A;  3CPF A;  4AG1 C;  1QWE A;  3RBB B;  4C5I A;  2V8J A;  5KCH A;  4GLM A;  3NTH A;  4HWS A;  2EYY A;  2DU5 A;  2LZ6 B;  3X20 B;  1KMN A;  1CKB A;  4HT9 A;  2IY5 B;  3QKJ A;  1ABO A;  2GFU A;  3JCM b;  2CIM A;  2DK3 A;  3SWN C;  4C5E A;  2RHQ A;  2KY9 A;  1A0N B;  2X4J A;  5ECA A;  4D6W A;  3CC2 Q;  5GAM g;  2OTJ T;  1X6B A;  3VS7 A;  3PNW C;  4LDU A;  4PKC C;  2IG0 A;  2R5A A;  3MEV A;  1JJ2 A;  4BDZ A;  2XKO C;  4B9W A;  4JRP A;  2K3Y A;  4ESR A;  4YRJ A;  4M75 C;  1YIJ A;  4E7L A;  2DEU A;  4KH1 B;  1IO6 A;  12AS A;  3FC3 A;  3G71 T;  3CCU T;  4L59 A;  4A4K A;  3HL8 A;  1VA7 A;  1YJW Q;  3PCO B;  2KXD A;  4TVY A;  3VBB A;  2CP0 A;  4CH5 A;  3NEN A;  4PJL A;  1WJR A;  3TUP A;  2LNH B;  3TEG A;  3CCM A;  1NG2 A;  3EGX B;  4PJO D;  4M75 F;  2V8K A;  2QI2 A;  3MEY A;  4P5N A;  2CT4 A;  4HKE A;  1V76 A;  3L4G A;  1KHI A;  3VJP A;  4JPB W;  1VQM T;  2RMO A;  3TU4 K;  2OAU A;  5LJ3 g;  2ZT7 A;  2GQI A;  4UP8 A;  1JEG A;  2LC4 A;  1ZBJ A;  4BD3 A;  4G84 A;  1GFC A;  2XDP A;  2JS2 A;  4H2X B;  5I21 A;  2CP5 A;  2MIO A;  1NPP A;  2JUF A;  3UF4 A;  4AFQ C;  4RQE A;  4M78 C;  5I2M A;  1ZSG A;  2X3W D;  2PME A;  2LJ3 A;  4BY6 B;  4FL6 A;  4OB3 B;  2K3X A;  2ESW A;  1YIJ T;  2EGC A;  4M78 F;  2ODR C;  5CKD A;  2ZTG A;  3QJY A;  1K73 R;  2DXC A;  3OYI A;  1KQS S;  4YRM A;  3CCM T;  1Q82 R;  3IKL A;  2VVK A;  1X2H A;  4QT7 A;  1V1C A;  3FJ5 A;  1U1T A;  3C0C A;  2L89 A;  5GAN e;  5J26 A;  3EAE A;  1PM3 A;  4N4G A;  3OYF A;  4CS3 A;  1E6H A;  1YI2 Q;  3EG9 A;  3LLR A;  4J6X A;  1ZSZ A;  4IUQ A;  1JJ2 S;  1U5S A;  4HCK A;  1QLY A;  4M77 C;  4PJO G;  2FEI A;  3I55 A;  1YHQ A;  2KYM A;  3EH2 A;  4Q5W A;  1G5I A;  2HMA A;  11AS A;  3OBY A;  4XU1 A;  3M4Q A;  4M7D F;  4M77 F;  2YLB A;  3SEM A;  3TRE A;  1UHF A;  2G6F X;  2E3C A;  2QQ9 A;  3JSC A;  4BE2 A;  5FRM A;  3RKW A;  4JJN K;  1M5Q 1;  3OYG A;  3BJU A;  2BTT A;  1VQP Q;  3OS5 A;  1TTH B;  4X9D A;  3CME A;  4DA4 A;  2AMC B;  4QVC A;  1WI7 A;  2ARS A;  5A2Q E;  2Q5I A;  5FU6 C;  2CP7 A;  3NET A;  2KRO A;  3V7S A;  1VQN T;  3MKD A;  2ART A;  2FRY A;  4MML A;  1W1F A;  4NL3 A;  4BY6 C;  4YP0 A;  1GRI A;  4J9I A;  2E4H A;  2DL4 A;  1D0Y A;  1VQ9 A;  4F7U F;  1D1A A;  1D0Z A;  4PJO E;  1G5V A;  3JB9 J;  1H4V B;  3I55 T;  1N9R A;  2P0K A;  1QCF A;  1ZHI A;  4Q6G A;  5GMK l;  1WXB A;  4WI1 A;  5IXB A;  3CCR A;  1CKA A;  3GNF B;  3LGL A;  1HJD A;  8ATC B;  5KE3 A;  2RQW A;  5KYW A;  2NS6 A;  2ZPF B;  2HD0 A;  2MCN A;  3PTA A;  2XDD A;  5KCO A;  4E6R A;  3L2W A;  4JLG A;  3TQ7 P;  3VUZ A;  3ZFJ A;  3TEH B;  1N6A A;  1E7O A;  1MV0 B;  1VQO Q;  2QG9 B;  1MNE A;  5D6Y A;  2DO3 A;  1YJ9 Q;  4XTX A;  3RER A;  3CME T;  1K8A U;  3CD6 A;  1RI0 A;  3VQV A;  1S72 Q;  2DX1 A;  2OTL Q;  2E12 A;  5A0L A;  1PC0 A;  3PFS A;  3J81 E;  2CUD A;  1WJS A;  5CKH A;  2KBT A;  4KRT A;  1JXO A;  3NEM A;  3PT9 A;  1VQ5 T;  3PMT A;  2K4Y A;  4JS5 A;  3MHX A;  2RD1 A;  3CCV Q;  5J39 A;  2RI3 A;  2K2V A;  2E65 A;  1JBM A;  1MMD A;  1X01 A;  3NTK A;  1VQ9 T;  1EVK A;  1B07 A;  4OF1 A;  3M0Q A;  3OYN A;  5I22 A;  3CCJ A;  2B86 A;  2KR3 A;  4BI4 A;  5GAM j;  1I81 A;  2R58 A;  3CCR T;  1YJN Q;  1IL2 A;  2JTF A;  5C6S A;  3MF2 A;  2AZS A;  2M0O A;  2I4L A;  1RAB B;  5KE2 A;  1B76 A;  1SKU B;  2YHT A;  2LQN A;  2OI3 A;  2V1R A;  1M3A A;  1UFF A;  2QA4 A;  1K9M R;  4J6Y A;  3IQL A;  3HY0 A;  4CRI A;  1NYQ A;  3MPU B;  3CD6 T;  3P8D A;  2MMP A;  3UWN A;  1SG5 A;  5D6X A;  3QUI A;  2QHT A;  2KDS A;  1RAE B;  5LJ3 j;  2EYW A;  1YWO A;  2X3X D;  2J6K A;  2KK4 A;  2JJ9 A;  1NNH A;  3M59 A;  4A4E A;  4XTV A;  4YRE A;  5IHI A;  1H4Q A;  1N27 A;  2ZT5 A;  3CEY A;  3I7F A;  3CCJ T;  3L42 A;  3I56 Q;  2AK5 A;  1OX9 A;  1K9A A;  2LCL A;  1D09 B;  4CS2 A;  2CJ9 A;  2QEX Q;  1QVP A;  2XI9 A;  1W2B A;  3EGU A;  2QHU A;  1SHG A;  2RHS B;  2E1H A;  3MQZ A;  4HWR A;  1Y0M A;  1ZQ1 A;  1KD1 U;  1FX7 A;  3CC2 A;  1WU7 A;  4CC2 A;  1G2B A;  3S3O A;  4DEY A;  3WQZ A;  3PIO A;  1EX4 A;  1SF9 A;  3SD4 A;  5HKC A;  3E9I A;  5GAM e;  4TVA A;  1WIE A;  1SSF A;  3CCS Q;  2LDM A;  3HPW A;  1KSW A;  2AMC A;  2EBP A;  4RTW A;  4C92 C;  1YJW A;  3AT1 B;  1M2V B;  2RQV A;  2B8A A;  2YUQ A;  3E1S A;  3MEW A;  3PMI A;  5GAN 6;  2CP2 A;  4P3O A;  2BE7 D;  4RMO A;  3LYI A;  1YGB A;  2L3P A;  1G8X A;  1EFN A;  2AT1 B;  2MK5 A;  2BUD A;  4Z88 A;  2CKK A;  4Y91 A;  4HVC A;  3TEE A;  1TOV A;  2F69 A;  3M54 A;  2PMF A;  3HXY A;  2P0Q A;  1SRM A;  3A8L B;  4E7I A;  4TVR A;  2NUP B;  3RES A;  4JJC A;  3CC2 T;  4DOW A;  2L8D A;  2C0T A;  2VWF A;  3CXC P;  4P3P A;  4QVZ A;  1E1T A;  3I5R A;  1M8V A;  4CS4 A;  4YDQ A;  3VYG A;  4BDY A;  1RLQ C;  1VQ4 Q;  2DVE A;  3KFV A;  1G51 A;  1YJW T;  3RMS A;  3CC4 A;  4K88 A;  1BI1 A;  3M0U A;  4RQF A;  3ZL7 C;  4C0D C;  2ZPG B;  4EPC A;  1D3B B;  1YWP A;  2QHV A;  3OMC A;  1W2B S;  1GCQ C;  4C5G A;  1UGR B;  3Q1J A;  2ZT8 A;  1EOV A;  4YRI A;  1HC7 A;  1M30 A;  5CAI A;  3HXW A;  3REX A;  2JZ2 A;  3LSQ A;  1JJC B;  1Q81 R;  3P8H A;  1YI2 A;  4RTT A;  1HD3 A;  2AKL A;  2JM8 A;  2DLP A;  3M0S A;  2O01 E;  4OGC A;  2L3S A;  3LH5 A;  3OYE A;  2HSP A;  4IUP A;  2YRC A;  2GGR A;  4MMK A;  3E9F A;  4EMG A;  4P72 A;  1WGS A;  2DD5 A;  1QE0 A;  1GFD A;  5ELO A;  3HXU A;  2Y4X A;  1PKT A;  3MP6 A;  2M0Y A;  3VS1 A;  2DA9 A;  4OB1 B;  4FT4 A;  4O2D A;  1IGQ A;  3CCL Q;  1W6X A;  2XDB A;  5FU7 B;  3CC4 T;  2ZR3 A;  4OMF B;  4IKF A;  1WX6 A;  3HKS A;  3JAM E;  1AZE A;  3RKX A;  1LPL A;  1WXT A;  3DB3 A;  3PVL A;  1OQK A;  2RQT A;  1I0C A;  4LD9 K;  1VQK A;  2F2X A;  1Y96 B;  4LDY A;  4LD6 A;  3A5Z A;  4X34 A;  4C0Z A;  4PJO A;  3QXE B;  4R0K A;  2KNB B;  1VYU A;  1NLO C;  3LSS A;  1WPY A;  5DLO A;  1UE9 A;  4JRK A;  2VV5 A;  1E1O A;  5EC7 A;  2EJF A;  2QTX A;  1OPL A;  1R77 A;  1NLP C;  2NUT A;  4C8Q C;  3LH0 A;  1T3S A;  4J15 A;  5C51 B;  2E6N A;  1KMM A;  2RJD A;  1MHN A;  2P0P A;  2CDT A;  4P73 A;  2W10 A;  2O31 A;  2EYX A;  2RA2 A;  2RHS A;  5KNN A;  1YFT A;  2H3J A;  3FIF A;  2MAM A;  1YBY A;  3G7Z A;  4H02 A;  2PNI A;  2A36 A;  5E3I A;  4C8Q F;  5GAO r;  4K87 A;  1UJ0 A;  2OAW A;  1N8R U;  5K1P A;  4BI8 B;  5GMK j;  4ELY C;  1T0J A;  3QZ9 B;  3VS6 A;  4YCU A;  5GMK i;  1VQO A;  4WJ4 A;  5CR2 A;  1YJ9 A;  1TG0 A;  1P92 A;  4LDW A;  3M4G A;  1VQK T;  1S72 A;  3SWN B;  1M2V A;  1BIB A;  1M1K R;  1GBQ A;  2ALY B;  3L1A A;  4QQ6 A;  3H41 A;  2CP6 A;  2PVD B;  4XU3 A;  3H0H A;  3CCV A;  2F5T X;  2DYB A;  4RG8 A;  3JCM X;  2AKW A;  4M75 B;  3RGL A;  2O9S A;  2XK0 A;  2V26 A;  2DER A;  3JCM f;  1IZ6 A;  1WHM A;  1IHV A;  1YJN A;  3OYA A;  2FHD A;  4M7A C;  4ZTF A;  4BE0 A;  2FPD A;  3CCE T;  1Y7X A;  2JVV A;  3RIR A;  4ZN3 A;  2CH4 A;  4CH6 A;  2EW3 A;  2HQE A;  4X9C A;  5KYX B;  3HFZ B;  1VQO T;  3X26 B;  4A4G A;  1YJ9 T;  3FDR A;  1C0M A;  1H4S A;  3WVE B;  2CSQ A;  1CSK A;  5AYF A;  4AT1 B;  1Q86 C;  4YRS A;  1JQQ A;  3M53 A;  3WVD B;  4M78 B;  2FL7 A;  3GIB A;  2COY A;  1PSF A;  2FVU A;  3HHT B;  5C53 B;  1VIE A;  3F70 A;  2RO0 A;  5A0G A;  1JJC A;  2GBQ A;  1B34 B;  3I56 A;  3ME9 A;  3FEO A;  4FIB A;  4C92 D;  3OW2 A;  5IAY A;  5DY9 A;  3A98 A;  1YJN T;  2YSQ A;  1KC8 R;  4RTV A;  1HXD A;  4JRI A;  2QEX A;  2Y90 A;  3QWX X;  2O2O A;  2PTK A;  2QDL A;  3RNJ A;  4KGV B;  3OS0 A;  1X75 C;  2BZY A;  4HVW A;  3RUX A;  5GAN j;  3RL6 A;  1JU5 C;  2AKK A;  2PZ1 A;  5AT1 B;  2R57 A;  1QKX A;  5J3B A;  2QGG A;  2QDY B;  2WSE E;  1NJI R;  1NEB A;  1Z7N A;  3DB4 A;  2ZAE A;  1TH7 A;  4M77 B;  1M1F A;  3HTR A;  2ZZG A;  1K73 U;  1N8R C;  4RDX A;  2RK1 A;  1H64 1;  4JLI A;  2DPP B;  2MF2 A;  4FW2 A;  3REB B;  5CCA A;  2RK2 A;  4UC4 A;  4B6M A;  1YFN A;  5IT9 E;  4ORZ A;  1Y96 A;  1PSE A;  2KAF A;  2CJB A;  5GAN 7;  5IN1 A;  3QG1 A;  1ZA1 B;  2R5M A;  4QQG A;  1AWX A;  3QPH A;  1QF6 A;  2EYQ A;  4UPA A;  1RAA B;  3I56 T;  3W3S A;  4HT8 A;  1AWW A;  2XGT A;  4HA8 A;  1KIK A;  1AVZ C;  3INZ A;  1X2Q A;  3CCQ Q;  2M9U A;  2QEX T;  1KQS P;  5FU6 B;  3VS3 A;  4KBM B;  1M90 R;  4ATO A;  4F7U B;  3M0R A;  2EWN A;  1WQW A;  5GAO p;  1BBZ A;  1QW1 A;  1FMW A;  3EGD A;  3FJP A;  3O5Z A;  3RKY A;  2VGN A;  2KRN A;  2VYT A;  1QP3 A;  2I0N A;  3A7R A;  1E24 A;  4FU6 A;  5CVI A;  3VYH B;  5FWB A;  1SET A;  1RLP C;  1YP5 A;  1AZG B;  3X28 B;  4UP7 A;  1E6G A;  2BZX A;  1JJ2 P;  2RI2 A;  1VQ4 A;  4H2T A;  4KGX B;  1B7Y A;  3UPU A;  2WSF E;  4JS4 A;  2D8J A;  5CKB A;  3OW2 S;  1NJI C;  4L5G A;  3HRT A;  4PK4 A;  3SWN A;  4PJN A;  3CPW A;  2FPE A;  1MV3 A;  3M0P A;  4GY5 A;  4E7K A;  3FB9 A;  3BDL A;  1C6V X;  1SER A;  1QWF A;  3MEA A;  4JZ3 A;  4KUL A;  3OYB A;  2L3R A;  5L8R E;  1ASY A;  3JCM d;  1M8M A;  2YWW A;  4M7D C;  3HRS A;  2QQS A;  4UP9 A;  3NEL A;  4TWA A;  1YN8 A;  5KH6 A;  4E7J A;  2DXT A;  2YDL A;  1WYX A;  2MI6 A;  3ZBD A;  1SES A;  4OB0 B;  3CC7 A;  1O9S A;  3MEU A;  4IUV A;  2CT3 A;  1S1N A;  1ZX6 A;  5GAN 2;  2DAQ A;  4LNP A;  2ZNJ A;  1ZUU A;  2DJZ A;  2HEQ A;  5KYX A;  4YRP A;  2HL5 C;  4J9D A;  2LT1 A;  3A8M B;  2I2L A;  4C8Q D;  5HY6 A;  1VQ4 T;  1QVF A;  3V8K A;  1XJW B;  2D9T A;  1AHJ B;  5IHN A;  2ZPB B;  1B70 A;  3UT1 A;  4OVA A;  2DJQ A;  3OSV A;  2L3Q A;  4EMK A;  2K5F A;  4J9E A;  4M78 A;  1K73 C;  2XG8 D;  4HWO A;  2JTE A;  1Q82 C;  1RAH B;  3CMA Q;  4N0A A;  4ANJ A;  1GXI E;  3BE3 A;  4EDU A;  1XQH A;  2X4X A;  4O6J A;  1YHQ T;  4YRQ A;  2VC8 A;  1B34 A;  1MUZ A;  3QO7 A;  1TUC A;  3EFR A;  3M55 A;  1X2K A;  3OYJ A;  1YCS B;  2IY5 A;  1OU9 A;  3ER0 A;  4RG2 A;  1LCK A;  3CC7 T;  2ZZE A;  1M1G A;  1YIT Q;  1AT1 B;  4HCC A;  2PU9 B;  2A8E A;  2OJ2 A;  3SFM A;  3R07 A;  4P75 A;  1I1J A;  2DVJ A;  3JCM h;  2L2P A;  3CPW S;  2JMC A;  2DZ9 A;  1UGP B;  3CBP A;  1K9M U;  1IXD A;  5CQY A;  3V8J A;  2JTM A;  2F2W A;  3MP8 A;  4KQE A;  3CBO A;  2BKD N;  2BZ8 A;  1PRM C;  3VRY A;  2ZCF B;  2FYK A;  4M7A D;  3L2V A;  3JCM W;  3PCO A;  2CZ6 B;  2GTO A;  3U23 A;  4PG3 A;  1QQJ A;  4J8O A;  1RAG B;  2VKN A;  3OYM A;  3VS0 A;  1RAD B;  3EGX A;  2L5Q A;  4HVU A;  3OB9 A;  2KSS A;  4PL6 A;  3V7C A;  4NOY A;  4OMM A;  5GJW B;  2GCX A;  2HL3 A;  2CP3 A;  3MP1 A;  2C0I A;  3HRI A;  3KBG A;  3HFO A;  3PE0 A;  1NZ9 A;  2RH2 A;  1RL2 A;  4KUD K;  1KJW A;  1OV3 A;  2ZPH B;  2CH4 W;  1NEG A;  3QWY A;  4J9H A;  1VQ7 Q;  3CBM A;  1WA7 A;  3L2U A;  1DJ7 B;  1BI2 A;  2E5K A;  3P8B B;  1LNX A;  4D8K A;  2E3H A;  1PNJ A;  1U3O A;  1PRL C;  1QVF S;  4C92 B;  2EGA A;  3N5B B;  4R56 A;  4H2X A;  1X27 A;  3LX7 A;  2KE9 A;  2DBK A;  2PQW A;  2RF0 A;  2MWP A;  3M56 A;  3PGG A;  3G6E Q;  2KYB A;  2QK0 A;  3OYK A;  5LJ5 f;  1N9W A;  4FYW B;  5GAN 3;  3JB9 F;  2D1X A;  3H0F A;  2PVG B;  1X6O A;  1F1B B;  3GF5 A;  4YRF A;  1B7T A;  2ZIO A;  4JJB A;  2RHU A;  3P8Y A;  3QSU A;  2IPO B;  3P8V A;  2YXY A;  4MZM A;  1WHG A;  3D7S B;  3UGQ A;  5DM7 R;  4J9B A;  3O8V A;  4WJ3 M;  1W70 A;  4FYV B;  2DQ3 A;  4M75 D;  2PVO B;  3EG0 A;  1K8A R;  4N4I A;  2YRV A;  5ELN A;  3CCU Q;  3G71 Q;  3ASK A;  3M4Y A;  5KYY B;  1QVG A;  1JXM A;  1PYS B;  3QBY A;  4LXC A;  3OSS C;  2DFU A;  2GQV A;  2JMA A;  2EPD A;  3S3M A;  3G4S Q;  3E9G A;  1IHW A;  1RAF B;  1I07 A;  1NBE B;  4AFS C;  5HK3 A;  2ZXF A;  6AT1 B;  2DTH A;  4C0D B;  1TSF A;  4ZTZ B;  4OMN A;  4A63 B;  1VQM Q;  4ZGD B;  1VQZ A;  3HFN A;  2CS7 A;  4AH6 A;  1UG1 A;  2DRK A;  1Q7Y R;  2QA4 T;  3IAL A;  2MPX C;  3C4S A;  2HBW A;  2ATC B;  2X35 A;  1OZ3 A;  5GAN f;  3OS1 A;  1D1C A;  1GCP A;  4KR2 A;  4NL2 A;  1K9M C;  4YCW A;  4HXJ A;  1NYR A;  4M78 D;  1JO8 A;  2W0Z A;  3A7U A;  2F5K A;  4Z02 A;  3GPL A;  1NJ2 A;  1QCN A;  3RMQ A;  3VQX A;  4J9C A;  2M16 A;  4HT4 A;  1BBU A;  2XIC A;  2FZK B;  3I35 A;  2ODR D;  1YB3 A;  4ZN1 A;  3EFO B;  1AEY A;  2P5I A;  1K1Z A;  3QO8 A;  2DF6 A;  3M0T A;  1GL5 A;  2KQW A;  3AHU A;  2GNC A;  2Q5H A;  4FYX B;  3CCQ A;  4LVJ A;  1AWJ A;  4M75 G;  8AT1 B;  2JS0 A;  1HYO A;  2DZC A;  4LE9 A;  1GGM A;  1Y57 A;  4JJD A;  1W2B P;  4AMC A;  4HCB A;  1EZZ B;  4XEO A;  4XU2 A;  3P8T A;  1XTD A;  4M7D D;  4M77 D;  4XU0 A;  1G83 A;  3GNG A;  5D7U A;  3TEH A;  1B3Q A;  1QVG S;  1Q7Y C;  3H6Z A;  1VQL Q;  4C8Q B;  4ZTJ A;  4PJO C;  2A28 A;  4KH0 B;  2LX7 A;  1KD1 R;  4ZIB A;  1HTT A;  1JB0 E;  3NMZ C;  1H3Z A;  4YYE A;  4PNO A;  1M4Z A;  3A31 A;  4F04 B;  1FXX A;  2M1H A;  2K57 A;  2LP5 A;  1EFW A;  4PJO F;  2LJ1 A;  1TUD A;  4AFU C;  4J6W A;  4M78 G;  3LWH A;  2DIL A;  3HRK A;  2WSC E;  4P73 C;  3CCQ T;  1VQN Q;  4MZP A;  1TU0 B;  4M75 E;  4C92 A;  1TUG B;  1VYT A;  4B9X A;  4OMP A;  1IGU A;  1MGQ A;  1SEM A;  1G3Y A;  4RTU A;  3VQY A;  5LJ5 d;  1Q86 U;  2NLU A;  2FRW A;  3I55 Q;  2FO0 A;  1X69 A;  2LQK A;  2ZPE B;  2P4R A;  1Z9Z A;  5M9O A;  4E2F B;  5GAO m;  1ZLM A;  2KVQ G;  2RHQ B;  1U8R A;  1VQP A;  2DL8 A;  2Y4Y A;  1I4K 1;  4MDX A;  4Y92 A;  5IHK A;  3EH1 A;  3VV0 A;  4M7A B;  4KGZ B;  3KUF A;  4BB7 A;  3NTI A;  3QNE A;  2X51 A;  2LNV A;  4M77 G;  2ZNI A;  2QQA A;  3KXT A;  3I9Q A;  5GMK h;  1USY C;  3VU3 C;  3HXZ A;  1BKB A;  3CME Q;  1WHL A;  4EIK A;  1YI2 T;  2KRM A;  4XEM A;  4M78 E;  3L2R A;  1T3L A;  5KYY A;  3CMA A;  3JB9 H;  2EVR A;  5A0D A;  3QJ6 A;  1PYS A;  1J5W A;  2I4O A;  4LVM A;  1LJO A;  1K4U S;  1WDX A;  4NS5 A;  1VQ6 Q;  1VQ5 Q;  3L4G B;  2E3I A;  1Q81 C;  5FWC A;  1PKS A;  3UDC A;  1UB4 A;  1TS9 A;  1YNZ A;  2J6O A;  2DIQ A;  4XTW A;  5GAN d;  1MMN A;  2OX7 A;  5GAO n;  4JDS A;  2ZPI B;  4F7U G;  4M4Z A;  2JNG A;  4PLI A;  5IH2 A;  2X4W A;  1VQP T;  2ZCE A;  3CQT A;  2V8I A;  4XTZ A;  2A37 A;  4WTO B;  3RR6 A;  1WHK A;  4LNS A;  4TTV A;  4L87 A;  1ZBX A;  1B8A A;  1ASZ A;  2OTL A;  2D0N A;  1MND A;  4F14 A;  2EQM A;  4M77 E;  5LJ5 h;  3QTC A;  5HK0 A;  2LCC A;  2EIF A;  2NWM A;  2ZR2 A;  3MJX A;  4CC3 A;  1MMG A;  3CD6 Q;  2VXE A;  2QHS A;  1VIF A;  3CMA T;  2XMF A;  3V8L A;  3LWI A;  2D6F A;  1RAC B;  2KGT A;  2SRC A;  3TSW A;  1VQ7 A;  4N4H A;  5D6W A;  3GOX A;  5GAM f;  1WJQ A;  3H9N A;  4E7Z A;  1JRI A;  2K79 A;  1YCY A;  2CYZ B;  4YRO A;  4PHC A;  2XID A;  4DEX A;  1OU8 A;  2CUB A;  4E47 A;  4IUR A;  1WLP B;  2NUP A;  3EG9 B;  3UH0 A;  1D0X A;  3CCJ Q;  4H2Y A;  2J3L A;  4RKU E;  4K86 A;  4XQ3 A;  1PCX A;  2CGH A;  2KRS A;  4F7U E;  1NJI U;  4FSX A;  1R0B G;  4TQF A;  3UA7 A;  3A8O B;  4OB2 B;  4XK8 E;  2RB6 A;  4RUG A;  1S72 T;  2K5I A;  2OTL T;  2QGF B;  1NJ8 A;  1NJ5 A;  4C8Q A;  2RHX A;  4FT2 A;  2DL5 A;  3A1P A;  2K6D A;  4IUT A;  5LJ3 f;  1Y07 A;  1D3B A;  5GAN h;  4BUG A;  3M58 A;  3CCV T;  3OD1 A;  4P74 A;  2PUK B;  1C0A A;  4C5H A;  4QVD A;  2ZIN A;  4FW1 A;  3JRZ A;  1M2O A;  1QP2 A;  4QKU A;  4X1V A;  2JXB A;  4DBQ A;  1M1K C;  3CCU A;  5F5W A;  1XOV A;  1ADJ A;  2ZT6 A;  2A0F B;  2ZGW A;  1NPR A;  2VXF A;  1R0C B;  2K2M A;  3S6W A;  4C0G A;  1Q95 G;  5KYN A;  3G4S A;  3MET A;  1V29 B;  4IUU A;  3JCM P;  1X55 A;  3G1J A;  4II1 A;  3VS5 A;  3EG3 A;  4J83 A;  2DQ0 A;  2LT4 A;  4K11 A;  2KEA A;  3HXV A;  4OGE A;  1KQS A;  2DXB A;  4KUI A;  1ACM B;  3REA B;  5GAN 8;  2Q7H A;  4M7D B;  1WNL A;  2V1Q A;  1KQ1 A;  2EL9 A;  2QQR A;  1W66 A;  3JCM g;  4DBF A;  2D0Q B;  3CCS A;  5KYW B;  2EFI A;  1Q82 U;  4O5V A;  2JOY A;  2DE0 X;  3MO8 A;  1H4T A;  4M7A A;  4JUV A;  2YRD A;  5C52 B;  1ZSZ C;  2K7A A;  1OX8 A;  3R6O A;  3VKI A;  1I5L A;  2DKG A;  2P84 A;  2JM9 A;  1SPK A;  3HSB A;  1AWO A;  2ED0 A;  4P71 A;  3G4S T;  3MF1 A;  2SEM A;  3VUB A;  4YRC A;  4Q15 A;  2IIM A;  5LJ5 e;  3J80 E;  1OPK A;  2MOX A;  4KT0 E;  3OW2 P;  1ATI A;  4RTZ A;  4A4F A;  2G3R A;  1UGS B;  2CSI A;  2DYI A;  1KC8 C;  1RIQ A;  4OML A;  3EHR A;  1BBW A;  2CZ7 B;  4C92 G;  3ERR A;  9ATC B;  3DLL A;  4HWP A;  1AOJ A;  3X24 B;  2QAZ A;  1OUL A;  2AZV A;  1H92 A;  2P4T A;  3VS2 A;  3JB9 I;  3CCS T;  4PFP A;  3SDZ A;  2MWO A;  2EAY A;  4EMK C;  4DBR A;  1VQL A;  5CO7 A;  5LL6 S;  1SHF A;  4OMO A;  3C94 A;  3EG2 A;  4KR3 A;  2LCS A;  2J6F A;  4N0A C;  5FLX E;  2ALY A;  3A74 A;  4Y28 E;  3QHS A;  3CC4 Q;  2GFA A;  1UHC A;  4PLL A;  1WHH A;  5GAO q;  2HKQ B;  4M75 A;  2FG0 A;  2QAS A;  4J7F A;  5GAM d;  4H2W A;  2KI7 A;  2G4C A;  4HWT A;  1NJ1 A;  4LN2 A;  3WXM B;  4P75 C;  5GAO l;  4Z8A A;  4FCY A;  2RN8 A;  1VQN A;  3UGT A;  1AD5 A;  4RTY A;  4C92 E;  3L2Q A;  2RNA A;  4VUB A;  4J5Y A;  5CQX A;  1M90 C;  1UTI A;  4QQD A;  1Z7M A;  3HFZ A;  1C1A A;  3CCL A;  1EVL A;  2COZ A;  2FZC B;  3ULR B;  3UA6 A;  3UFG A;  2LRQ A;  1WLE A;  4BW9 A;  1VQL T;  3PVQ A;  3V7R A;  2CJA A;  5LJ3 d;  3M57 A;  3SHW A;  2EKH A;  1OZ2 A;  1FYF A;  2LVM A;  3LGF A;  2LJ0 A;  1IRE B;  4TVA B;  2C8M A;  2A08 A;  4DPG A;  3GBQ A;  1BK2 A;  3CPW P;  5EG2 A;  1VQK Q;  4LVL A;  3RF1 A;  3L2Z A;  3HY1 A;  3A7A A;  1QMC A;  2YUP A;  1VQ6 A;  1UGV A;  1NYF A;  1VQ5 A;  4YRG A;  2JT4 A;  2H3E B;  2J7I A;  3FRN A;  2RJE A;  1LYL A;  1X2G A;  3BFM A;  3DLM A;  2J06 A;  5IXF A;  2CZ1 B;  1WFW A;  4EX5 A;  2RPN A;  3JV3 A;  5GAM h;  4H2V A;  2RI5 A;  3GP8 A;  3CCL T;  2DD4 A;  1ZUK A;  3TCJ A;  4BE1 A;  4GLK A;  1VQ8 Q;  1I5O B;  4M7D A;  4F17 A;  4FM4 B;  4M77 A;  4L6V 5;  1BB9 A;  2M51 A;  5I2S A;  3A32 A;  3CCE Q;  4NCX A;  3PZC A;  2E5Q A;  1QVF P;  1ARK A;  4D8D A;  2LMJ A;  1UGQ B;  4LUE A;  2DET A;  3HFV A;  2K3B A;  1FYN A;  2JN0 A;  4PJJ A;  1NJ6 A;  2KT1 A;  2K9G A;  4ZGE B;  2CRE A;  2QXF A;  2HCK A;  2DTO A;  4C8Q G;  1HSQ A;  4R55 A;  1PHT A;  4CI0 C;  1LVK A;  5LJ3 h;  4AG2 C;  2EYZ A;  1VQ6 T;  2X4Y A;  1ZA2 B;  2RQR A;  1X6G A;  4TVW A;  4F7U A;  3QZ5 B;  1YFR A;  4YRK A;  3OYY A;  1Q7Y U;  3OA6 A;  3JCM Q;  1G3T A;  2RJF A;  1QKW A;  4RCB A;  2BE9 B;  1U06 A;  4YRT A;  2A3L A;  1EQR A;  4DBH A;  3HRU A;  3X25 B;  1D1B A;  2HNI A;  1VUB A;  3I5S A;  3OMG A;  4YRR A;  3URG A;  4FYY B;  4LUD A;  3J7A F;  3HTZ A;  3NHN A;  2OTJ Q;  4BWA A;  1T0H A;  1U1S A;  5FW9 A;  1G3W A;  5K1X A;  2A7Y A;  4C8Q E;  1J3T A;  1R8O B;  4YTL A;  2C7I A;  4E7H A;  1UDL A;  2Z0W A;  1L0W A;  2E6Z A;  4M7A G;  2JW4 A;  4EO4 A;  3E19 A;  3A5Z B;  3RDV A;  1H3H A;  3HXX A;  4PFO A;  3BY7 A;  1BCM A;  4GBQ A;  4PJO B;  1IB8 A;  3EFS A;  3OS2 A;  4E7S A;  4OP0 A;  1NM7 A;  4ZGJ B;  4TQD A;  1UEC A;  2EKO A;  2EQK A;  3M4P A;  1BCO A;  1BIA A;  2DMO A;  2IVW A;  2NUT B;  7AT1 B;  2DBM A;  3VS4 A;  1WZO A;  2EJG A;  2I4M A;  1K0S A;  1ABQ A;  1X43 A;  2HZY A;  2J05 A;  1TXQ A;  2E70 A;  3CXC A;  1BI3 A;  2XHC A;  5I11 A;  5L23 A;  3A5Y A;  4ZNX A;  1TWB A;  2LQW A;  3IG2 A;  2E10 A;  3JCM e;  1YIJ Q;  1WQ7 A;  2L0A A;  4M7A E;  2KXC A;  3OQ5 A;  3R6N A;  1HK9 A;  5CKF A;  3OYH A;  3RAC A;  1ZUY A;  1KK7 A;  2F2V A;  2PUO B;  1Q81 U;  5CIU A;  3CMQ A;  2H8H A;  5LJ5 g;  2E5A A;  3CCM Q;  1IRX A;  2O88 A;  3REU A;  5GAN 5;  2C06 A;  1H8K A;  2EGE A;  4A4H A;  4P72 C;  5GJV B;  1QVG P;  1K8A C;  1PD0 A;  2LX9 A;  3G1Z A;  4J9G A;  2ROL A;  1X54 A;  1Z9Q A;  4C92 F;  1VYV A;  5HCK A;  1FWZ A;  2C0O A;  2AKW B;  2ED1 A;  5KYU B;  2O4X B;  2QTV A;  1WXU A;  1OOT A;  3S3N A;  5LJ3 e;  2EJ9 A;  1UEB A;  3T9N A;  4F16 A;  2FZG B;  1PWT A;  5FRN A;  1QCO A;  1SRL A;  4IIM A;  1RUW A;  3EG1 A;  4CH4 A;  3TVT A;  2VUB A;  2F1L A;  2DXU A;  2COW A;  2DL7 A;  4RCC A;  3QYG B;  4P3N A;  2DNU A;  1M3C A;  1EIY B;  3JCM J;  1G5H A;  2DIG A;  2VGM A;  5GAN g;  3VQW A;  2NUZ A;  3LW5 E;  2ECZ A;  2ARU A;  2EQI A;  3CXC S;  2WAC A;  1LOJ A;  2ROT A;  1OI1 A;  1M9S A;  2NYS A;  4WF2 A;  2DTI A;  5CK9 A;  4IIO A;  2E41 A;  4XTU A;  3EHQ A;  2HDA A;  4YCV A;  3DSQ A;  3A8G B;  1YHQ Q;  1M3B A;  2RHZ A;  4J7I A;  1NE8 A;  1SRY A;  1M27 C;  4RTX A;  4ELZ C;  3QII A;  4H2S A;  3CC7 Q;  5FRO A;  2M02 A;  1I8F A;  2RHY A;  1M1K U;  2K5L A;  3H0I A;  4PFZ A;  2P0L A;  2LTO A;  1ADY A;  4M7D G;  2BIV A;  3NPF A;  4WCI A;  5C0M A;  1E22 A;  1W4S A;  3C12 A;  4YRN A;  4LDV A;  3C95 A;  3ICA A;  1KD1 C;  2VB6 A;  3VRZ A;  4J9F A;  4BAC A;  3E2U A;  3M9Q A;  4E51 A;  3E9H A;  1KQ2 A;  5HGQ A;  3NFC A;  1NYG A;  4QW2 A;  2HSE B;  3A8H B;  4HCZ A;  4BI3 A;  3LC0 A;  1G3S A;  2FB7 A;  2DL3 A;  3THK A;  1SSH A;  2QYZ A;  3QO3 A;  1VQ9 Q;  4RMF A;  1OYX A;  1YIT A;  5CKE A;  2HQX A;  5DLQ E;  2ZZD A;  1K76 A;  2E64 A;  2EQU A;  1GCQ A;  2HBP A;  2LQ8 A;  2VAS A;  3SB2 A;  3TSZ A;  2EQJ A;  3OYL A;  2XD0 A;  2CZ0 B;  2DEQ A;  1FMK A;  1KG1 A;  3CCR Q;  3ZEH A;  3JCM V;  3OYD A;  1UJY A;  1VQ8 A;  3OYC A;  1UUE A;  3QYH B;  3JB9 D;  2DU7 A;  4P74 C;  4JZ4 A;  2RM4 A;  3CCE A;  4M7D E;  3EGD B;  1Q86 R;  3HP9 A;  4EMH A;  4FSS A;  3DKM A;  5GMK m;  2YUN A;  4LVK A;  4ME7 A;  1BI0 A;  2D8H A;  3QDF A;  3FLG A;  3JCM c;  1WYD A;  1B7Y B;  1OEB A;  2YLC A; 
#chains in the Genus database with same CATH homology
 1YFS A;  4MZT A;  1KC8 U;  5GAN 4;  3KFU A;  2KMT A;  1YIT T;  3OY9 A;  2HAX A;  1KHC A;  3M5A A;  3BDU A;  3PIP A;  4LVI A;  5FU7 C;  3G6E A;  4XTY A;  2ZZF A;  4A54 A;  2O4X A;  2I4N A;  4H2U A;  1USY A;  2Q7E A;  1O75 A;  2ZIM A;  4MDW A;  1VQ8 T;  3OBW A;  4OLF A;  2XTI A;  3IKM B;  4G85 A;  1BYM A;  5LJ5 j;  2DDZ A;  4A53 A;  2J3M A;  2GF7 A;  4DQ2 A;  2OTJ A;  1EIF A;  1XNI A;  4M7A F;  4ZTU B;  1X56 A;  3GLX A;  3MCA B;  4DOV A;  4XAX B;  4LDX A;  4CH3 A;  2XU8 A;  3BW1 A;  2RJC A;  3QDR B;  4P71 C;  3H8Z A;  1N9S A;  1B70 B;  3G71 A;  1VQ7 T;  3JB9 G;  1EIY A;  3QO5 A;  2Q7G A;  4C0F A;  4YPF A;  2RHI A;  2AHJ B;  4V2S A;  4JRQ A;  4EMK B;  2QQB A;  1KOG A;  1M90 U;  1Y71 A;  1VQM A;  4X5O A;  3G6E T;  5GMK e;  4YRL A;  3CPF A;  4C5I A;  5KCH A;  2V8J A;  3NTH A;  4HWS A;  2DU5 A;  3X20 B;  1KMN A;  4HT9 A;  2IY5 B;  3QKJ A;  2CIM A;  2GFU A;  3JCM b;  2DK3 A;  3SWN C;  4C5E A;  2RHQ A;  2KY9 A;  2X4J A;  4D6W A;  5GAM g;  2OTJ T;  3PNW C;  4LDU A;  4PKC C;  2IG0 A;  2R5A A;  3MEV A;  1JJ2 A;  4BDZ A;  2XKO C;  4B9W A;  4JRP A;  2K3Y A;  4YRJ A;  4M75 C;  1YIJ A;  4E7L A;  12AS A;  3FC3 A;  3G71 T;  3CCU T;  4L59 A;  4A4K A;  3HL8 A;  3PCO B;  4TVY A;  4CH5 A;  3VBB A;  3NEN A;  3TUP A;  1WJR A;  3TEG A;  3CCM A;  4PJO D;  4M75 F;  2V8K A;  2QI2 A;  3MEY A;  4P5N A;  4HKE A;  3L4G A;  1KHI A;  3VJP A;  1VQM T;  3TU4 K;  2OAU A;  5LJ3 g;  2ZT7 A;  4UP8 A;  2LC4 A;  4BD3 A;  4G84 A;  2XDP A;  4H2X B;  5I21 A;  1NPP A;  2JUF A;  4RQE A;  4M78 C;  5I2M A;  2PME A;  4BY6 B;  4FL6 A;  4OB3 B;  2K3X A;  1YIJ T;  4M78 F;  2ODR C;  5CKD A;  2ZTG A;  3QJY A;  2DXC A;  3OYI A;  1KQS S;  4YRM A;  3CCM T;  3IKL A;  1X2H A;  1U1T A;  2L89 A;  5GAN e;  5J26 A;  3EAE A;  4N4G A;  3OYF A;  4CS3 A;  3LLR A;  4J6X A;  4IUQ A;  1JJ2 S;  4M77 C;  4PJO G;  3I55 A;  1YHQ A;  4Q5W A;  1G5I A;  11AS A;  3OBY A;  4XU1 A;  3M4Q A;  4M7D F;  4M77 F;  2YLB A;  3TRE A;  2E3C A;  2QQ9 A;  3JSC A;  4BE2 A;  5FRM A;  3RKW A;  4JJN K;  1M5Q 1;  3OYG A;  3BJU A;  3OS5 A;  4X9D A;  3CME A;  4DA4 A;  2AMC B;  4QVC A;  2ARS A;  5A2Q E;  2Q5I A;  5FU6 C;  3NET A;  3V7S A;  1VQN T;  2ART A;  4MML A;  4NL3 A;  4BY6 C;  4YP0 A;  1VQ9 A;  4F7U F;  4PJO E;  1G5V A;  3JB9 J;  1H4V B;  3I55 T;  1N9R A;  2P0K A;  1ZHI A;  4Q6G A;  5GMK l;  4WI1 A;  3CCR A;  3GNF B;  3LGL A;  5KE3 A;  2NS6 A;  2ZPF B;  2HD0 A;  3PTA A;  2XDD A;  5KCO A;  3L2W A;  4JLG A;  3VUZ A;  3ZFJ A;  3TEH B;  1N6A A;  5D6Y A;  2DO3 A;  4XTX A;  3RER A;  3CME T;  1K8A U;  3CD6 A;  1RI0 A;  3VQV A;  2E12 A;  5A0L A;  3PFS A;  3J81 E;  1WJS A;  5CKH A;  3NEM A;  3PT9 A;  1VQ5 T;  3PMT A;  2K4Y A;  4JS5 A;  3MHX A;  2RD1 A;  5J39 A;  2RI3 A;  2K2V A;  2E65 A;  1JBM A;  1X01 A;  3NTK A;  1VQ9 T;  1EVK A;  4OF1 A;  3OYN A;  3CCJ A;  4BI4 A;  5GAM j;  1I81 A;  2R58 A;  3CCR T;  1IL2 A;  2JTF A;  5C6S A;  3MF2 A;  2M0O A;  2I4L A;  5KE2 A;  1B76 A;  2YHT A;  2QA4 A;  4J6Y A;  3HY0 A;  4CRI A;  1NYQ A;  3CD6 T;  3P8D A;  2MMP A;  3UWN A;  5D6X A;  3QUI A;  2QHT A;  2KDS A;  5LJ3 j;  2KK4 A;  1NNH A;  3M59 A;  4A4E A;  4XTV A;  4YRE A;  1H4Q A;  1N27 A;  2ZT5 A;  3CEY A;  3I7F A;  3CCJ T;  3L42 A;  2LCL A;  4CS2 A;  2CJ9 A;  1QVP A;  2XI9 A;  1W2B A;  2QHU A;  2RHS B;  2E1H A;  3MQZ A;  4HWR A;  1ZQ1 A;  1KD1 U;  1FX7 A;  3CC2 A;  1WU7 A;  3S3O A;  3WQZ A;  3PIO A;  3SD4 A;  5HKC A;  3E9I A;  5GAM e;  4TVA A;  1SSF A;  2LDM A;  3HPW A;  2AMC A;  1YJW A;  4C92 C;  2B8A A;  3E1S A;  3MEW A;  3PMI A;  5GAN 6;  4P3O A;  4RMO A;  3LYI A;  1YGB A;  2BUD A;  2CKK A;  4Y91 A;  4HVC A;  3TEE A;  2F69 A;  3M54 A;  2PMF A;  3HXY A;  2P0Q A;  3A8L B;  4E7I A;  4TVR A;  3RES A;  3CC2 T;  4DOW A;  2L8D A;  4P3P A;  4QVZ A;  1E1T A;  1M8V A;  4CS4 A;  4YDQ A;  3VYG A;  4BDY A;  2DVE A;  1G51 A;  4K88 A;  1YJW T;  3RMS A;  3CC4 A;  1BI1 A;  4RQF A;  4C0D C;  2ZPG B;  4EPC A;  1D3B B;  2QHV A;  3OMC A;  1W2B S;  4C5G A;  1UGR B;  3Q1J A;  2ZT8 A;  1EOV A;  4YRI A;  1HC7 A;  5CAI A;  3HXW A;  3REX A;  2JZ2 A;  3LSQ A;  1JJC B;  3P8H A;  1YI2 A;  2O01 E;  4OGC A;  3OYE A;  4IUP A;  4MMK A;  3E9F A;  4EMG A;  4P72 A;  1WGS A;  2DD5 A;  1QE0 A;  5ELO A;  3HXU A;  2Y4X A;  3MP6 A;  4OB1 B;  4FT4 A;  4O2D A;  2XDB A;  5FU7 B;  3CC4 T;  2ZR3 A;  4OMF B;  4IKF A;  3HKS A;  3JAM E;  3RKX A;  3DB3 A;  4LD9 K;  1VQK A;  4LDY A;  1Y96 B;  4LD6 A;  3A5Z A;  4X34 A;  4C0Z A;  4PJO A;  3QXE B;  3LSS A;  1WPY A;  5DLO A;  4JRK A;  2VV5 A;  1E1O A;  2EJF A;  2QTX A;  4C8Q C;  3LH0 A;  4J15 A;  5C51 B;  2E6N A;  1KMM A;  2RJD A;  1MHN A;  2P0P A;  4P73 A;  5KNN A;  2RA2 A;  2RHS A;  1YFT A;  2H3J A;  3FIF A;  2MAM A;  1YBY A;  3G7Z A;  4H02 A;  5E3I A;  4C8Q F;  5GAO r;  4K87 A;  1N8R U;  5K1P A;  4BI8 B;  5GMK j;  4ELY C;  3QZ9 B;  4YCU A;  5GMK i;  1VQO A;  4WJ4 A;  5CR2 A;  1YJ9 A;  1P92 A;  4LDW A;  3M4G A;  1VQK T;  1S72 A;  3SWN B;  1BIB A;  2ALY B;  3L1A A;  4QQ6 A;  2PVD B;  4XU3 A;  3CCV A;  2F5T X;  4RG8 A;  3JCM X;  2AKW A;  4M75 B;  3RGL A;  2XK0 A;  3JCM f;  1IZ6 A;  1YJN A;  3OYA A;  2FHD A;  4M7A C;  4ZTF A;  4BE0 A;  3CCE T;  1Y7X A;  2JVV A;  3RIR A;  4ZN3 A;  4CH6 A;  2HQE A;  4X9C A;  3HFZ B;  1VQO T;  3X26 B;  4A4G A;  1YJ9 T;  3FDR A;  1H4S A;  3WVE B;  5AYF A;  1Q86 C;  4YRS A;  3M53 A;  3WVD B;  4M78 B;  2FL7 A;  3GIB A;  2FVU A;  1PSF A;  3HHT B;  5C53 B;  1VIE A;  3F70 A;  2RO0 A;  5A0G A;  1JJC A;  1B34 B;  3I56 A;  3ME9 A;  3FEO A;  4FIB A;  4C92 D;  3OW2 A;  5IAY A;  5DY9 A;  1YJN T;  1HXD A;  4JRI A;  2QEX A;  2Y90 A;  3OS0 A;  1X75 C;  3RUX A;  5GAN j;  3RL6 A;  2R57 A;  5J3B A;  2QDY B;  2WSE E;  1Z7N A;  3DB4 A;  1TH7 A;  4M77 B;  1M1F A;  2ZZG A;  1K73 U;  1N8R C;  4RDX A;  2RK1 A;  1H64 1;  4JLI A;  2DPP B;  2MF2 A;  5CCA A;  2RK2 A;  4UC4 A;  5IT9 E;  1Y96 A;  1PSE A;  2KAF A;  2CJB A;  5GAN 7;  5IN1 A;  3QG1 A;  2R5M A;  4QQG A;  3QPH A;  1QF6 A;  2EYQ A;  4UPA A;  3W3S A;  3I56 T;  4HT8 A;  2XGT A;  4HA8 A;  3INZ A;  2M9U A;  2QEX T;  5FU6 B;  4KBM B;  4ATO A;  4F7U B;  2EWN A;  1WQW A;  5GAO p;  1QW1 A;  3FJP A;  3RKY A;  2VGN A;  2VYT A;  1QP3 A;  3A7R A;  1E24 A;  4FU6 A;  5CVI A;  3VYH B;  1SET A;  3X28 B;  4UP7 A;  4H2T A;  2RI2 A;  1VQ4 A;  1B7Y A;  3UPU A;  2WSF E;  4JS4 A;  5CKB A;  3OW2 S;  1NJI C;  4L5G A;  3HRT A;  3SWN A;  3CPW A;  4GY5 A;  4E7K A;  3FB9 A;  3BDL A;  1SER A;  3MEA A;  4KUL A;  3OYB A;  2L3R A;  5L8R E;  1ASY A;  3JCM d;  4M7D C;  3HRS A;  2QQS A;  4UP9 A;  3NEL A;  4TWA A;  5KH6 A;  4E7J A;  2DXT A;  2MI6 A;  3ZBD A;  1SES A;  4OB0 B;  3CC7 A;  1O9S A;  3MEU A;  4IUV A;  5GAN 2;  2DAQ A;  2ZNJ A;  2DJZ A;  4YRP A;  2LT1 A;  3A8M B;  2I2L A;  4C8Q D;  5HY6 A;  1VQ4 T;  1QVF A;  3V8K A;  2D9T A;  1AHJ B;  2ZPB B;  1B70 A;  3UT1 A;  4OVA A;  3OSV A;  4EMK A;  2K5F A;  4M78 A;  1K73 C;  4HWO A;  2XG8 D;  1Q82 C;  4N0A A;  1GXI E;  4EDU A;  1XQH A;  2X4X A;  4O6J A;  1YHQ T;  4YRQ A;  2VC8 A;  1B34 A;  3QO7 A;  3EFR A;  3M55 A;  3OYJ A;  2IY5 A;  3ER0 A;  4RG2 A;  3CC7 T;  2ZZE A;  1M1G A;  4HCC A;  2PU9 B;  2A8E A;  3SFM A;  3R07 A;  4P75 A;  3JCM h;  3CPW S;  2DZ9 A;  1UGP B;  3CBP A;  1K9M U;  5CQY A;  3V8J A;  2JTM A;  3MP8 A;  4KQE A;  3CBO A;  2BKD N;  2ZCF B;  2FYK A;  4M7A D;  3L2V A;  3JCM W;  3PCO A;  2CZ6 B;  4PG3 A;  4J8O A;  3OYM A;  2L5Q A;  3OB9 A;  2KSS A;  4PL6 A;  3V7C A;  4NOY A;  2GCX A;  3MP1 A;  3HRI A;  3KBG A;  3HFO A;  4KUD K;  1NZ9 A;  2RH2 A;  1RL2 A;  2ZPH B;  3CBM A;  3L2U A;  1DJ7 B;  1BI2 A;  3P8B B;  1LNX A;  1QVF S;  4C92 B;  3N5B B;  4R56 A;  4H2X A;  3LX7 A;  2PQW A;  2MWP A;  3M56 A;  3PGG A;  3OYK A;  5LJ5 f;  1N9W A;  5GAN 3;  3JB9 F;  2PVG B;  1X6O A;  3GF5 A;  4YRF A;  2ZIO A;  2RHU A;  3P8Y A;  3QSU A;  3P8V A;  4MZM A;  3UGQ A;  5DM7 R;  3O8V A;  4WJ3 M;  2DQ3 A;  4M75 D;  2PVO B;  4N4I A;  2YRV A;  5ELN A;  3ASK A;  3M4Y A;  1QVG A;  1PYS B;  3QBY A;  3OSS C;  2GQV A;  3S3M A;  3E9G A;  5HK3 A;  2ZXF A;  2DTH A;  4C0D B;  4ZTZ B;  4ZGD B;  1VQZ A;  3HFN A;  2CS7 A;  4AH6 A;  2QA4 T;  3IAL A;  3C4S A;  2X35 A;  1OZ3 A;  5GAN f;  3OS1 A;  4KR2 A;  4NL2 A;  1K9M C;  4YCW A;  1NYR A;  4M78 D;  3A7U A;  2F5K A;  4Z02 A;  3GPL A;  1NJ2 A;  3RMQ A;  3VQX A;  2M16 A;  4HT4 A;  1BBU A;  2XIC A;  2ODR D;  1YB3 A;  4ZN1 A;  2P5I A;  3QO8 A;  2KQW A;  3AHU A;  2Q5H A;  3CCQ A;  4LVJ A;  4M75 G;  2DZC A;  1GGM A;  4HCB A;  4XEO A;  4XU2 A;  3P8T A;  1XTD A;  4M7D D;  4M77 D;  4XU0 A;  3GNG A;  3TEH A;  1QVG S;  1Q7Y C;  3H6Z A;  4C8Q B;  4ZTJ A;  4PJO C;  4ZIB A;  1HTT A;  1JB0 E;  1H3Z A;  4YYE A;  4PNO A;  1M4Z A;  3A31 A;  1FXX A;  2M1H A;  2K57 A;  1EFW A;  4PJO F;  4J6W A;  4M78 G;  3LWH A;  3HRK A;  2WSC E;  4P73 C;  3CCQ T;  4MZP A;  4M75 E;  4C92 A;  4B9X A;  1MGQ A;  1G3Y A;  3VQY A;  5LJ5 d;  1Q86 U;  2NLU A;  2LQK A;  2ZPE B;  5M9O A;  5GAO m;  2KVQ G;  2RHQ B;  1U8R A;  1VQP A;  2Y4Y A;  1I4K 1;  4MDX A;  3VV0 A;  4M7A B;  3KUF A;  4BB7 A;  3NTI A;  3QNE A;  2LNV A;  4M77 G;  2ZNI A;  2QQA A;  3KXT A;  5GMK h;  1USY C;  3VU3 C;  3HXZ A;  1BKB A;  1YI2 T;  4XEM A;  4M78 E;  3L2R A;  3CMA A;  3JB9 H;  5A0D A;  3QJ6 A;  1PYS A;  1J5W A;  2I4O A;  4LVM A;  1LJO A;  4NS5 A;  3L4G B;  1Q81 C;  3UDC A;  1UB4 A;  2DIQ A;  4XTW A;  5GAN d;  5GAO n;  4JDS A;  2ZPI B;  4F7U G;  2JNG A;  4PLI A;  2X4W A;  1VQP T;  2ZCE A;  2V8I A;  4XTZ A;  4LNS A;  4TTV A;  4L87 A;  1ZBX A;  1B8A A;  1ASZ A;  2OTL A;  2EQM A;  4M77 E;  5LJ5 h;  3QTC A;  5HK0 A;  2LCC A;  2EIF A;  2ZR2 A;  2VXE A;  2QHS A;  1VIF A;  3CMA T;  3V8L A;  3LWI A;  2D6F A;  1VQ7 A;  4N4H A;  5D6W A;  3GOX A;  5GAM f;  1WJQ A;  1JRI A;  1YCY A;  2CYZ B;  4YRO A;  4PHC A;  2XID A;  4E47 A;  4IUR A;  3UH0 A;  4H2Y A;  4K86 A;  2J3L A;  4RKU E;  4XQ3 A;  2CGH A;  4F7U E;  1NJI U;  4FSX A;  4TQF A;  3A8O B;  4OB2 B;  4XK8 E;  2RB6 A;  1S72 T;  2K5I A;  2OTL T;  1NJ8 A;  1NJ5 A;  4C8Q A;  2RHX A;  4FT2 A;  4IUT A;  5LJ3 f;  1Y07 A;  1D3B A;  5GAN h;  4BUG A;  3M58 A;  3CCV T;  3OD1 A;  4P74 A;  2PUK B;  1C0A A;  4C5H A;  4QVD A;  2ZIN A;  3JRZ A;  1QP2 A;  1M1K C;  3CCU A;  5F5W A;  1XOV A;  1ADJ A;  2ZT6 A;  2ZGW A;  1NPR A;  2VXF A;  3S6W A;  4C0G A;  3G4S A;  3MET A;  1V29 B;  4IUU A;  3JCM P;  1X55 A;  4II1 A;  4J83 A;  2DQ0 A;  2LT4 A;  3HXV A;  4OGE A;  1KQS A;  2DXB A;  4KUI A;  5GAN 8;  2Q7H A;  4M7D B;  1WNL A;  1KQ1 A;  2EL9 A;  2QQR A;  1W66 A;  3JCM g;  3CCS A;  2D0Q B;  1Q82 U;  2EFI A;  4O5V A;  2JOY A;  3MO8 A;  1H4T A;  4M7A A;  4JUV A;  5C52 B;  3R6O A;  3VKI A;  1I5L A;  2DKG A;  3HSB A;  4P71 A;  3G4S T;  3MF1 A;  4YRC A;  3VUB A;  4Q15 A;  5LJ5 e;  3J80 E;  4KT0 E;  1ATI A;  4A4F A;  2G3R A;  1UGS B;  1KC8 C;  1RIQ A;  1BBW A;  2CZ7 B;  4C92 G;  3ERR A;  3DLL A;  4HWP A;  3X24 B;  2P4T A;  3JB9 I;  3CCS T;  3SDZ A;  2MWO A;  2EAY A;  4EMK C;  1VQL A;  5CO7 A;  5LL6 S;  3C94 A;  4KR3 A;  4N0A C;  5FLX E;  2ALY A;  3A74 A;  4Y28 E;  3QHS A;  2GFA A;  4PLL A;  5GAO q;  4M75 A;  4J7F A;  5GAM d;  4H2W A;  2G4C A;  4HWT A;  1NJ1 A;  3WXM B;  4P75 C;  5GAO l;  1VQN A;  3UGT A;  4C92 E;  3L2Q A;  4VUB A;  4J5Y A;  5CQX A;  1M90 C;  4QQD A;  1Z7M A;  3HFZ A;  3CCL A;  1EVL A;  3UFG A;  2LRQ A;  1WLE A;  4BW9 A;  1VQL T;  3V7R A;  2CJA A;  5LJ3 d;  3M57 A;  1OZ2 A;  1FYF A;  2LVM A;  3LGF A;  1IRE B;  4TVA B;  2C8M A;  4DPG A;  5EG2 A;  4LVL A;  3RF1 A;  3L2Z A;  3HY1 A;  3A7A A;  1VQ6 A;  1VQ5 A;  4YRG A;  3FRN A;  2RJE A;  1LYL A;  1X2G A;  3BFM A;  3DLM A;  2CZ1 B;  4EX5 A;  5GAM h;  4H2V A;  2RI5 A;  3GP8 A;  3CCL T;  2DD4 A;  3TCJ A;  4BE1 A;  4GLK A;  4M7D A;  4FM4 B;  4M77 A;  4L6V 5;  5I2S A;  3A32 A;  4NCX A;  3PZC A;  2E5Q A;  3HFV A;  1UGQ B;  2JN0 A;  1NJ6 A;  4ZGE B;  2QXF A;  4C8Q G;  2DTO A;  4R55 A;  4CI0 C;  5LJ3 h;  1VQ6 T;  2X4Y A;  4TVW A;  4F7U A;  3QZ5 B;  1YFR A;  4YRK A;  3OYY A;  1Q7Y U;  3OA6 A;  3JCM Q;  1G3T A;  2RJF A;  4RCB A;  4YRT A;  2A3L A;  1EQR A;  3HRU A;  3X25 B;  2HNI A;  1VUB A;  3OMG A;  4YRR A;  3URG A;  3J7A F;  3HTZ A;  4BWA A;  1U1S A;  1G3W A;  5K1X A;  2A7Y A;  4C8Q E;  1R8O B;  4YTL A;  2C7I A;  4E7H A;  1L0W A;  2E6Z A;  4M7A G;  4EO4 A;  3E19 A;  3A5Z B;  3HXX A;  3BY7 A;  4PJO B;  3EFS A;  3OS2 A;  4OP0 A;  4ZGJ B;  4TQD A;  2EKO A;  2EQK A;  3M4P A;  1BIA A;  2IVW A;  2EJG A;  2I4M A;  2E70 A;  3CXC A;  1BI3 A;  2XHC A;  3A5Y A;  3IG2 A;  2E10 A;  3JCM e;  1WQ7 A;  4M7A E;  3OQ5 A;  1HK9 A;  5CKF A;  3OYH A;  3RAC A;  2PUO B;  1Q81 U;  5CIU A;  3CMQ A;  5LJ5 g;  2E5A A;  3REU A;  5GAN 5;  2C06 A;  4A4H A;  4P72 C;  1K8A C;  2LX9 A;  3G1Z A;  1X54 A;  4C92 F;  1FWZ A;  2AKW B;  2O4X B;  3S3N A;  5LJ3 e;  2EJ9 A;  1UEB A;  3T9N A;  5FRN A;  4CH4 A;  2VUB A;  2DXU A;  4RCC A;  3QYG B;  4P3N A;  1EIY B;  3JCM J;  1G5H A;  2DIG A;  2VGM A;  5GAN g;  3VQW A;  3LW5 E;  2ARU A;  3CXC S;  2WAC A;  1LOJ A;  1OI1 A;  1M9S A;  4WF2 A;  2DTI A;  5CK9 A;  2E41 A;  4XTU A;  4YCV A;  3DSQ A;  3A8G B;  2RHZ A;  4J7I A;  1NE8 A;  1SRY A;  4ELZ C;  3QII A;  4H2S A;  5FRO A;  1I8F A;  2RHY A;  1M1K U;  2K5L A;  2P0L A;  2LTO A;  1ADY A;  4M7D G;  2BIV A;  5C0M A;  1E22 A;  1W4S A;  3C12 A;  4YRN A;  4LDV A;  3C95 A;  3ICA A;  1KD1 C;  4BAC A;  3M9Q A;  4E51 A;  3E9H A;  1KQ2 A;  5HGQ A;  3NFC A;  4QW2 A;  4BI3 A;  3A8H B;  4HCZ A;  3LC0 A;  1G3S A;  2FB7 A;  3QO3 A;  4RMF A;  1OYX A;  1YIT A;  5CKE A;  2HQX A;  5DLQ E;  2ZZD A;  2E64 A;  2EQU A;  2HBP A;  2LQ8 A;  3SB2 A;  3OYL A;  2XD0 A;  2EQJ A;  2CZ0 B;  2DEQ A;  1KG1 A;  3ZEH A;  3JCM V;  3OYD A;  1VQ8 A;  3OYC A;  3QYH B;  3JB9 D;  2DU7 A;  4P74 C;  2RM4 A;  3CCE A;  4M7D E;  3HP9 A;  4EMH A;  3DKM A;  5GMK m;  4LVK A;  1BI0 A;  4ME7 A;  3FLG A;  3JCM c;  1WYD A;  1B7Y B;  2YLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...