4XTUA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (n-({[(1r,2s,3r,4r)-4-(6-amino-9h-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 95
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtuA01
2AKWB 3NEMA 4CH5A 2RHSA 2ZIMA 3M4PA 4YRCA 1WQWA 2ALYB 2RHQB 4XU0A 4M75G 4XU1A 4HWSA 5LJ3f 3HXXA 4TVAA 4UP9A 3JCMc 1YCYA 4TVYA 2DTHA 1E22A 1ATIA 3BJUA 5GMKh 3VBBA 4L87A 4JRKA 4M7DG 4K87A 2ODRC 5GANj 3PZCA 1LJOA 3BDUA 4YYEA 3INZA 4N0AC 4EMGA 5GMKe 4C8QF 5GAOq 3VU3C 1U1TA 3LSQA 2I2LA 3E9HA 3V8LA 5GAMd 2QHSA 3TEHA 4C92E 4EMKC 1JJCA 5LJ5g 1H641 1I8FA 3JCMf 4C8QG 2DU7A 4KR3A 1JRIA 4YCWA 1C0AA 4M7DC 2ZNJA 4K86A 4YRNA 3IG2A 4HWPA 4H2UA 4QVCA 1GGMA 3E9IA 2DTIA 1TH7A 3I7FA 3JCMP 4BW9A 4P71A 3TEGA 1B34B 4NL3A 4UP7A 1NYQA 1WU7A 4PJOG 3JCMJ 5GAOm 4F7UA 4M7AB 3V8KA 1KQ1A 5I21A 3BFMA 4P75A 4XEOA 3REUA 2AKWA 4UP8A 2IY5B 4M7DD 1D3BA 4F7UF 1B70B 1E1OA 4YRPA 4YDQA 2PMFA 4BWAA 4P74A 3VQYA 4EMKA 2HNIA 3L1AA 4H2XB 3UGQA 4EMKB 3QHSA 3P8TA 5GANh 1NJ2A 2IY5A 1EVKA 4XTVA 4J6WA 2E5AA 4M7AF 3A31A 1H4TA 1I4K1 3HRIA 3HXWA 4WF2A 3LC0A 2E1HA 2ZR2A 4J6YA 4OP0A 3RGLA 5GAN7 1BBWA 3HFZB 4YRFA 4C92G 3ICAA 4HT8A 4PJOE 2ZZEA 2ARSA 2DZCA 3RUXA 3MEYA 4X5OA 1B8AA 4AH6A 3A5YA 5GAN2 4RDXA 2ZR3A 4CS2A 4K88A 4Y91A 4YCUA 3M4QA 5ELNA 1NNHA 2RD1A 2YLBA 2XGTA 2DQ0A 3JCMb 3RACA 4C92F 4NL2A 2G4CA 1YB3A 4YRKA 4TWAA 4ZTUB 2ZZFA 1ASZA 4M78B 2FB7A 4EX5A 3W3SA 3JB9G 5KNNA 4M7DE 3JCMQ 3HY1A 1IL2A 4TQDA 4PJOD 4XEMA 4RQEA 4M7AG 2P5IA 1YFRA 4J15A 4A53A 2CJAA 3JB9F 1B76A 1I5LA 1KMMA 5GANg 4XTYA 3RIRA 2Q5HA 1X2HA 4M77F 1X2GA 4P3PA 1USYC 2J3MA 2FYKA 5GAN5 2I4LA 4P73C 4TVWA 4NOYA 4PJOC 4V2SA 2Q7HA 3SB2A 1HK9A 1Z7MA 4M77G 4F7UB 2QHTA 4CH3A 4XU2A 1N9RA 3HRKA 1X55A 1U1SA 5GMKm 4RQFA 1BBUA 1HC7A 1WPYA 4X9CA 3A74A 3V7CA 1X56A 4M77E 1N9SA 1H4QA 5GAN8 2RHQA 4X9DA 3JCMd 2EJGA 5LJ5d 2CJBA 4H2YA 4YRJA 4H02A 4XTWA 1WNLA 4EO4A 2DXUA 3JB9D 1ADJA 1J5WA 1N9WA 1Z7NA 4HVCA 3EFSA 4YRGA 4XTUA 4C92C 2I4NA 3L4GB 4JUVA 4YP0A 2CGHA 1X01A 4J5YA 5LJ3g 2P0LA 3QO7A 4M78G 1NJ6A 4WJ3M 4XTXA 4YROA 2DTOA 1LYLA 5GANf 4M75A 3L4GA 4MMLA 2DXTA 3QSUA 1WLEA 3HTZA 3REXA 4C92D 3FJPA 3G1ZA 3HFVA 5LJ5j 5GAOn 4P72C 1BIBA 5LJ5f 2Q7EA 2DDZA 5K1XA 2E65A 3PCOB 2RA2A 3VQWA 1B7YB 4YRRA 4M7AC 2C7IA 3RL6A 1EFWA 5GANe 4M7AE 4H2WA 3OD1A 3QUIA 1PYSA 3TUPA 4C92B 5HGQA 5LJ3h 4YCVA 1G51A 1NYRA 4M78F 1B7YA 1ADYA 3NELA 3L2ZA 5LJ3e 2YHTA 3RF1A 2PMEA 4H2VA 4M7AD 3V7RA 1I81A 4H2SA 4PNOA 1EIYA 3DSQA 2E64A 4M77C 4P73A 4M78E 4Q6GA 4Q15A 1QF6A 2ZGWA 4J6XA 3A5ZA 4M75D 4CH4A 1D3BB 1MGQA 4HWTA 3GIBA 4ZTZB 4C8QB 4P71C 3HXUA 1QE0A 1G5HA 3HXZA 3V7SA 1SERA 4QVDA 1KMNA 4RMFA 3UGTA 1LNXA 5K1PA 1HXDA 3RESA 4M77D 4TQFA 3JCMe 3HXVA 4M75C 4HT9A 2Y90A 2EL9A 2EWNA 2C8MA 4TTVA 2ZNIA 3JCMh 5GAMj 2EAYA 3M4GA 5GAMf 4M77B 1JJCB 2Q7GA 1NJ5A 3HXYA 4PJOF 5GAN3 3PGGA 5GMKl 3EFRA 2YLCA 3A7UA 2I4OA 2Q5IA 1HTTA 4M7DA 3HY0A 4LNSA 2I4MA 3UH0A 3MF2A 2RM4A 2QHVA 5GAN4 4CH6A 1E24A 5LJ3j 2QTXA 5GAMe 3JB9H 3HFNA 4M78A 3JCMX 2ZCEA 4DPGA 2J3LA 3IKMB 1Y96A 5GAMh 3VQXA 2ZXFA 4YRQA 4C8QA 3JB9I 1EQRA 3ERRA 4F7UE 2ARUA 3VQVA 1W66A 2EJFA 2K57A 1YGBA 4CS3A 2JN0A 4YPFA 1M5Q1 2ZT7A 4YRLA 4G85A 2DVEA 4F7UG 4UPAA 1EVLA 4YRIA 2ZT5A 1EOVA 3A7AA 3NETA 1SRYA 2RB6A 3RKYA 4ZIBA 4HA8A 5C51B 1KOGA 1X54A 2E3CA 2ZTGA 4M7DB 5LJ3d 1JBMA 5GMKj 1NJ1A 1WYDA 1H4SA 1ASYA 3RKWA 1FYFA 4P74C 4WI1A 4NCXA 4JRIA 4G84A 5DY9A 4PJOA 3FB9A 4WJ4A 3SWNC 3QO5A 5GAN6 5CAIA 3A7RA 2DKGA 4H2TA 3MF1A 3BY7A 3P8YA 4M7DF 5C53B 4XTZA 4HWOA 3IKLA 2DU5A 4RCCA 3CMQA 4P3OA 5GAOp 4M75E 2ZINA 4TVAB 5E3IA 2EJ9A 1E1TA 3UFGA 4XQ3A 1BIAA 3RERA 2RHSB 2ALYA 3WQZA 3QNEA 4KQEA 4JLIA 1RIQA 1EIYB 2ZIOA 2AMCA 3QO8A 2ZT6A 3TEHB 1B70A 3JCMg 3BW1A 1USYA 1NJ8A 1Y96B 1G5IA 3LSSA 4YRTA 11ASA 5GMKi 2QHUA 1SETA 5F5WA 4M7AA 1LOJA 2VC8A 4DQ2A 1PYSB 4MMKA 5GAOr 4HWRA 1B34A 2XTIA 3RKXA 3AHUA 3QTCA 1L0WA 2CIMA 4M75F 4C8QC 1YFTA 3HFOA 1VQZA 3SWNB 4A54A 1M8VA 1YFSA 4XU3A 2DZ9A 2DJZA 3A32A 2VXEA 2CJ9A 12ASA 4PJOB 4YREA 1KQ2A 4M77A 5GAMg 3V8JA 4KR2A 3SWNA 4M78D 3FIFA 3JCMV 4C92A 3HFZA 4C8QD 3JB9J 4YRSA 3NENA 3KFUA 4M75B 4CS4A 4O2DA 3QO3A 4P75C 5C52B 5LJ5e 4RCBA 5GANd 2DQ3A 3PCOA 1H4VB 2ARTA 2ZT8A 4PHCA 2E41A 5LJ5h 4E51A 3P8VA 3IALA 1SESA 2E10A 4M78C 4N0AA 2VXFA 4P3NA 4EMHA 4C8QE 2ZZGA 4H2XA 4OLFA 5GAOl 4PG3A 2AMCB 4YRMA 2ODRD 1WQ7A 4P72A 3JCMW 3R07A 3HSBA 2DEQA 5ELOA
chains in the Genus database with same CATH superfamily
2NWMA 4HCBA 2AKWB 4OGCA 1WQWA 4XU0A 4KT0E 5LJ3f 1QVFP 4UP9A 1T3LA 4PJLA 3JCMc 2DTHA 1JJ2P 1ATIA 1NE8A 5GMKh 3VBBA 3PE0A 3PZCA 4YYEA 4N0AC 1Y71A 2BUDA 4EPCA 5GAOq 2OTLT 2FRWA 2IPOB 1NZ9A 2DPPB 2NUZA 4J9HA 1YJ9A 2HKNA 3OYDA 3MEAA 2QQAA 2GTOA 3TEHA 1K4US 2OAUA 5LJ5g 4A4FA 2HCKA 4C8QG 1VQ4T 2DU7A 4C0DC 4IIOA 1C0AA 2OTJQ 4DBHA 3CCSQ 2CS7A 4H2UA 1QCFA 1GGMA 5CQXA 5KCOA 4BW9A 1M90R 4PJOG 4F7UA 1KQ1A 4GBQA 4D6WA 2DXBA 1GCPA 2XDBA 2DL8A 2IY5B 2CP2A 1VQ5Q 4A63B 1P92A 1KG1A 3UA6A 1WFWA 2EYQA 2HNIA 4F17A 1NJIR 1KD1R 2OAWA 4MDXA 4J9EA 1KFZA 1TG0A 5KCHA 5CR2A 2IY5A 1H92A 2LDMA 1UHFA 2E5AA 4M7AF 1RADB 3NFCA 3PMIA 3KUFA 4LE9A 2ZR2A 4J6YA 4OP0A 3PIPA 2HAXA 3RGLA 2DIQA 3M58A 1TXQA 4YRFA 4GLMA 1QCNA 1FWZA 4MDWA 4HT8A 4PJOE 2DZCA 1V76A 2FL7A 1M90U 1B8AA 4J9IA 2LP5A 3TQ7P 1JU5C 1OQKA 3A5YA 3MEWA 2F5KA 5IH2A 1VQNQ 3DB3A 4ORZA 3HRUA 3CCMT 2JTMA 4NL2A 1VQ6A 1KHCA 2ZZFA 1WX6A 4M78B 4OMPA 3LGLA 2YDLA 1IL2A 1PWTA 5J39A 2KROA 4BD3A 1QP2A 2KGTA 2CUBA 3REAB 3G71Q 5GANg 1ZHIA 2KDSA 3CBMA 2MCNA 3CCVQ 1K0XA 3H9NA 4P3PA 1USYC 2J3MA 2MIOA 3M9QA 2F1LA 3RR6A 2FRYA 2DAQA 3I5RA 4L6V5 4P73C 4PJOC 5HKCA 2ENMA 4V2SA 4C5IA 2BE9B 3SB2A 1Z7MA 1Y57A 4CH3A 1PKSA 3OYAA 3HRKA 5HK0A 4FYXB 3NTKA 3MQZA 3IQLA 5CKHA 1VQLT 4AFQC 2A3LA 3GLXA 3RDVA 1WPYA 3A74A 3EG9B 1XJWB 2CZ0B 2X4WA 3V7CA 3VYHB 1IGQA 2HL3A 2E3IA 1UFFA 1C1AA 1UGVA 4FL6A 5LJ5d 2CJBA 4H2YA 4H02A 4BDYA 2K5LA 4A4HA 2C06A 4ME7A 1RAHB 4EO4A 2CP0A 2O9VA 2DXUA 1CKBA 4OMNA 1Z7NA 4HVCA 3EFSA 2I4NA 3L4GB 4C0ZA 4JUVA 1RL2A 4RTTA 1X01A 1M3CA 2KK4A 4J5YA 1ZLMA 4WJ3M 4XTXA 3CC2A 4ANJA 4C0FA 2RQWA 3CCVA 2QQSA 2RO0A 2FG0A 4MMLA 5I2MA 3L4GA 3FRNA 1YBYA 4OMFB 2O01E 3REXA 4C92D 5LJ5j 5KYXB 1VIFA 4CC7A 2AIRB 4E7SA 2AT1B 3CC4T 1M1GA 4CC3A 3MHXA 1AWXA 1WI7A 2RA2A 2YUQA 3HP9A 4FT4A 2O9SA 2MWOA 2XDPA 1I0CA 4BE0A 4PLLA 3OYHA 4H2WA 3OD1A 3TUPA 2O4XA 3EG2A 4Z8AA 1X6GA 1MNEA 2D1XA 3EG3A 2GBQA 1ADYA 3NELA 3L2ZA 2MPXC 3QZ9B 5LJ3e 1UGPB 3H41A 2GTJA 1X43A 1EIYA 2NYSA 2E64A 3OYLA 3CCEQ 2X51A 2HBPA 1WLPB 4M78E 2RI5A 4Q6GA 3A8OB 1D3BB 1MGQA 2ZPEB 1AZEA 2KY9A 3RMQA 3OS2A 1Q82R 4HXJA 3CCJT 1G5HA 3M57A 1QLYA 2J6FA 1SERA 2NUPA 1LNXA 2CYZB 4M77D 4M75C 1D1CA 3OS5A 3QYHB 2YRCA 2EL9A 2K9GA 2ESWA 3OMGA 4L5GA 2ZPHB 2E6NA 1JJCB 1NJ5A 4PJOF 5GAN3 3CCST 2GCXA 2A0FB 1NPRA 1YIJT 1VQNA 3HRTA 4ZGDB 3HY0A 5KYWA 3OYFA 3MP6A 2I4MA 2RM4A 2QHVA 2LT4A 5GAN4 4CH6A 2MWPA 3LGFA 1UEBA 4Y92A 1NEBA 3JB9H 1FMKA 2DYBA 4DPGA 1ZUUA 3OQ5A 2J3LA 4UC4A 2DRMA 2ZXFA 3JB9I 1EQRA 3VQVA 2ATCB 5ECAA 2CP7A 4KUIA 2K57A 1YGBA 2D9TA 5L8RE 2ZAEA 4YPFA 1M5Q1 2PUOB 2GF7A 2ZT7A 2QEXA 5FROA 2A36A 4JJNK 2A7YA 2L3PA 2KXCA 3EG1A 2ZT5A 3UT1A 3CMEQ 2FHDA 1SRYA 1GRIA 3CCEA 2O88A 2ZTGA 1JBMA 3OYEA 4LDXA 1ASYA 4L59A 3CQTA 4PLIA 1VQMA 2X9HA 2G3RA 3M0RA 2XDDA 1Q82C 1SG5A 2E70A 3UATA 4PJOA 3CCMQ 4LDYA 3QO5A 1Y7XA 5A2QE 3MF1A 1YIJQ 2MYSA 3CMET 1VUBA 1UHCA 2L3QA 2JS2A 3IKLA 1W2BP 2DU5A 1YJNT 3X26B 3QIIA 4JRQA 2QK0A 4JJDA 2EW3A 1DJ7B 2Y4YA 1A0NB 2OTLQ 4R55A 2D0QB 3A8HB 5KYNA 1BIAA 2E5QA 2QA4Q 3FEOA 1RLPC 3WQZA 2X4YA 1QVGS 1RIQA 3MP1A 3CCUT 2KT1A 2RJDA 4E7KA 3HRSA 3TEHB 2DD5A 5KE2A 4YRTA 11ASA 4E7LA 2QHUA 5F5WA 2G6FX 4DQ2A 1U3OA 3KXTA 3GNFB 5GJVB 3RKXA 2YRVA 1QKXA 4KRTA 4HCCA 4B9WA 3QTCA 3MO8A 4FCYA 1KD1U 3S6WA 4C8QC 3CC4Q 1YFTA 4HKEA 1VQZA 2L0AA 3SWNB 4A54A 3P8HA 2CT3A 2F2WA 3OSVA 3A32A 2RQVA 2P0KA 2RI2A 3RNJA 3L2RA 2OI3A 2X3XD 3ASKA 2OJ2A 4M77A 1KQ2A 1TUDA 1N27A 1Y07A 1AVZC 1RAIB 2J06A 4PKCC 3SWNA 1Q81C 3FIFA 3A8GB 1K9AA 4OB3B 4BUGA 3A8LB 3M54A 2A08A 2EYWA 4BACA 2K4YA 1YCSB 4CRIA 1YHQA 4O2DA 3QO3A 4P75C 2JNGA 2PTKA 2W10A 1GL5A 3U23A 4BI3A 3ME9A 2DD4A 2HKQB 3QDFA 4E51A 2VVKA 2VXFA 2FZKB 2V8IA 1KD1C 2VGNA 3GP8A 2DRKA 4YRMA 1BCMA 4FT2A 2AMCB 4P72A 4QKUA 3JCMW 3R07A 3CD6A 1X75C 4ZN1A 2QTVA 2JMAA 3HXXA 3E1SA 3GPLA 4CH5A 2ZIMA 4QQ6A 3OW2P 3QG1A 2GGRA 4XU1A 4R0KA 3MCAB 1Q81U 2NLUA 4JJCA 1ARKA 1NYFA 1YCYA 2RHUA 2L2PA 4LXCA 4E6RA 1TU0B 3OYKA 1JJ2S 4LVLA 2ODRC 5GANj 4C0DB 1G5VA 1OI1A 3TSWA 1YWPA 2RHZA 2VGMA 1JEGA 5GMKe 2RJCA 1YITQ 1BI2A 1U1TA 3LSQA 4HVUA 2I2LA 2D8HA 2QHSA 1S1NA 4C92E 2DBMA 4EMKC 5KYYA 4N4IA 2K2MA 1YWOA 2RH2A 4KR3A 4K86A 3CCJQ 4N4HA 1IO6A 3IG2A 3M55A 1M30A 3N5BB 2ED1A 4HWPA 4IUPA 1UTIA 1TH7A 2GNCA 2CUDA 3JCMP 3TEGA 1U8RA 5HK3A 1NYQA 2VUBA 2RF0A 3CCRQ 4FW2A 3EHRA 1E1OA 1Q81R 3H6ZA 4YDQA 3CC2Q 3VQYA 3P8BB 3L1AA 4H2XB 2RNAA 4EMKB 2FZGB 3MEUA 4AFUC 1IZ6A 4E7IA 2EKOA 4PFOA 2RHXA 1NJ2A 2J05A 2LRQA 4XTVA 2BKDN 3EGXB 1K1ZA 5CQYA 4BE2A 3LC0A 2M0OA 2E1HA 1SPKA 2AKLA 1BBWA 5M9OA 2QQRA 2DL7A 3LW5E 3M4YA 1CSKA 3LH5A 5A0GA 3QJYA 4AH6A 1UG1A 3VV0A 3OYCA 5GAN2 1J3TA 2KRNA 3OY9A 4RDXA 1WHKA 4CS2A 1UJYA 4Y91A 4YCUA 2VASA 2DQ0A 3JCMb 2RN8A 2I0NA 4C92F 1SRLA 4MZPA 2G4CA 2LQ8A 4YRKA 4ZNXA 2CP6A 2FB7A 4KULA 4EX5A 1SKUB 4M7DE 3JCMQ 3HY1A 2D8JA 1KQSA 4TQDA 1RABB 4QW2A 4Y28E 2EGCA 4A4EA 2P5IA 3G6ET 2MI6A 1TUCA 3LH0A 1B76A 4JDSA 1I5LA 3O5ZA 3EFOB 4XTYA 4X34A 3S3OA 1X2HA 4M77F 2JT4A 3BDLA 1ZBJA 1ZSZB 2JTEA 1D0YA 1MMDA 3A98A 2LX9A 1HK9A 5D6XA 4XU2A 1Q95G 1M90C 2R5AA 1HC7A 2BZXA 3CEYA 1OPLA 1N9SA 1H4QA 1SHFA 4HCKA 5GAN8 5J3BA 1PSFA 2ROLA 3CCLT 2DILA 2MMPA 5C6SA 4LDUA 2M16A 5J26A 3E9GA 2OTLA 4XTWA 1B07A 5HCKA 5KYXA 2KE9A 1D1BA 4BY6C 1KC8C 2EBPA 1ADJA 1J5WA 2PNIA 1N9WA 3CPWA 4XTUA 1AWWA 3I56T 3CCUA 4IIMA 4M78G 2IVWA 3VJPA 1VQ4Q 3CXCA 3OYGA 3CCLQ 2MK5A 2ABLA 3G6EQ 1WLEA 3OSSC 3M0PA 2RJFA 5FLXE 3G1ZA 3A1PA 1KQSP 3EGDB 1M4ZA 2Q7EA 1UGSB 3WXMB 4CC4B 5K1XA 3PT9A 2E65A 4PJJA 3EH2A 2O2OA 2VWFA 2OTJT 1M1KR 3VQWA 1B7YB 4YRRA 2LT1A 2PU9B 4XAXB 3RL6A 1EFWA 3RMSA 1B3QA 2CZ6B 4KH0B 2L3RA 2LJ0A 3QUIA 4RTUA 2EPDA 1PYSA 3TVTA 1HSQA 1ZSGA 2YUPA 3L2QA 2LX7A 1NYRA 3EGXA 1JQQA 1VQ5T 3OS0A 1YHQT 2YHTA 1SHGA 4M7AD 4H2SA 3MP8A 5DLOA 3DSQA 5A0DA 1VQLA 1W2BA 2XICA 3KBGA 2ZGWA 4J6XA 1BB9A 2CH4A 4Z02A 3GIBA 4OMQA 3CCSA 1BKBA 1VQ6Q 1MMAA 1QE0A 2C0OA 3TSZA 3VUZA 4AT1B 3V7SA 1BCOA 4RMFA 3RBBB 4YTLA 3DLMA 2AZVA 4TQFA 5DM7R 1M3AA 3JCMe 3GBQA 2HL5C 4ELYC 2QG9B 2Y90A 2C8MA 2WSFE 5AT1B 5GAMj 2L89A 3CC2T 3HXYA 2CKKA 1V1CA 3E19A 4PFPA 2A28A 2YLCA 2I4OA 2Q5IA 1OEBA 1HTTA 4M7DA 2DL5A 5KYUB 2QEXT 1MUZA 1FYNA 3JRZA 1RAFB 3GF5A 2QTXA 5GAMe 1M27C 4JZ4A 3HFNA 4M78A 4RTVA 3JCMX 2ZCEA 2QA4T 2JXBA 2XHCA 1Y96A 3VQXA 1PHTA 4YRQA 2ZPBB 1NBEB 3ERRA 2ARUA 2EGAA 1W66A 2EJFA 2X3WD 1BBZA 3BE3A 2NUTA 1CKAA 2RQTA 1BI3A 4OB1B 2HQXA 3EFOA 3PVQA 4LVMA 2ZZDA 4J83A 5FU7C 4IKFA 4G85A 3X20B 4ZGJB 2DVEA 3QJ6A 1KQSS 1VQLQ 2RB6A 5C51B 4HA8A 2E3CA 1B7TA 4D8DA 4WCIA 2LCCA 1H3ZA 4JS4A 1FYFA 2KMTA 2AK5A 2BZ8A 4P74C 4WI1A 4NCXA 1S72Q 1G3TA 4J7IA 3G7ZA 3NHNA 1VQ4A 1OX8A 2RMOA 2KR3A 1C6VX 2WACA 4BE1A 2Z0WA 1PNJA 3BY7A 3JAME 3L2UA 4A4GA 1MMNA 1UGQB 3FLGA 4M7DF 2SEMA 5IHNA 2J6OA 3OYNA 4PK4A 3CMQA 2LJ1A 5GAOp 2MAMA 2GFUA 4M75E 2ZINA 1GFDA 1E1TA 3UFGA 4LVJA 4F16A 1G8XA 1ZSZC 3FDRA 2RHSB 2ALYA 3X24B 3CBOA 3ZFJA 2COYA 1N5ZA 4JRPA 4RKUE 2RQRA 2QI2A 1EIYB 3QO8A 1PD1A 1WJQA 3FJ5A 1EIFA 3UPUA 1VQPA 9ATCB 1G3YA 1Y96B 1VYUA 1D09B 4PFZA 1OPKA 1PKTA 2DMOA 1VA7A 2WSEE 1OU9A 4M7AA 4R56A 1MV3A 2R57A 2GFAA 1Q86R 1UJ0A 4HWRA 2XTIA 3UDCA 5KYWB 1KK7A 4LVIA 1O9SA 3OS1A 4PL6A 2V1RA 2DZ9A 2LQNA 2DJZA 2YWWA 4JPBW 2VXEA 3CCET 5IAYA 2FPDA 12ASA 1R77A 3VS1A 4PJOB 2CREA 2HBWA 1GFCA 1ZUYA 1WJRA 3VYGA 4KR2A 4DEXA 4M78D 3NTIA 1HJDA 1OV3A 2DFUA 2JUFA 1SF9A 4C92A 2EQKA 3L2VA 3HFZA 2H8HA 2XG8D 1S72A 3KFUA 4M75B 1E6GA 3KFVA 3QBYA 1OYXA 1WHHA 3I56A 2DQ3A 4Q5WA 3JV3A 1WHLA 5I11A 4RG2A 1TUGB 3PCOA 1H4VB 3C4SA 2ARTA 2HQHA 2IIMA 2E10A 5EG2A 3E2UA 1YHQQ 1Q7YR 1K8AR 1PCXA 5GAOl 4OLFA 3OYYA 2L8DA 5ELOA 1WHJA 5CKEA 1X2QA 1VQ9A 3M0TA 3CC7Q 1RACB 2RHSA 3M4PA 2ALYB 5FU6B 4OMMA 2XIDA 3GNGA 4KGVB 4M75G 2DK3A 4TVAA 2E6ZA 3I55A 3OB9A 2LQKA 2HEQA 5IN1A 4JRKA 1GBQA 4K87A 2J6KA 5KYUA 3VRZA 3TU4K 3BDUA 1N8RU 1GCQC 1VQMQ 3CPFA 4HVWA 3E9HA 3S3NA 1ZX6A 1JJCA 1JO8A 1H641 1Q7YC 1K8AC 1I8FA 3JCMf 1JRIA 1LVKA 4M7DC 1JXMA 1JJ2A 4QVCA 2HSPA 2DTIA 4DOWA 4P71A 2H3EB 1T3SA 4OB2B 1WU7A 4DBRA 3S3MA 5GAOm 4M7AB 4E7HA 2EYYA 3HHTB 4P75A 4XEOA 4UP8A 3J81E 4F7UF 8ATCB 1B70B 4BWAA 5FRMA 3UGQA 1ZA2B 3VS2A 2DLPA 3P8TA 5GANh 2LZ6B 3I55Q 3EGUA 2M1HA 3DKMA 1U06A 3G1JA 4J6WA 4J9CA 2QEXQ 4J7FA 1I4K1 3HRIA 2GQIA 3QPHA 4WF2A 2QGGA 1WXBA 5CKBA 4DBQA 2XI9A 1D0XA 1Z9QA 2HMAA 1K0SA 3M56A 2QDLA 2X35A 3G4ST 3HFZB 3UWNA 4C92G 1M2OA 1YNZA 3ICAA 2ARSA 5I2SA 3MEYA 4X5OA 3CBPA 1Y0MA 3WVEB 1X27A 3P8DA 3M4QA 2JOYA 2YLBA 2XGTA 3REBB 5IHKA 2XD0A 3ZEHA 1YB3A 2HZYA 2PVGB 1YI2Q 2CDTA 2F2VA 1VQPQ 1ASZA 2D0NA 3W3SA 3JB9G 5KNNA 3DLLA 1QVFS 3CMAT 2ZCFB 2PUKB 1WXUA 1WDXA 1OULA 4E7JA 4XEMA 4RQEA 2YXYA 4J15A 1YJ9Q 3JB9F 1KHIA 2RK2A 3E9FA 4FIBA 4FYWB 1D1AA 1OU8A 1VQOA 1MMGA 1X2GA 3CCLA 2FYKA 5GAN5 4LUDA 4TVWA 4NOYA 2DEUA 3CCQA 1G3WA 2Q7HA 3M53A 4M77G 4F7UB 2QHTA 2CSQA 1N9RA 1FMWA 1X55A 1QVGP 1W70A 5GMKm 1WZOA 1BBUA 2YSQA 1NYGA 4ZTJA 2DL3A 3ULRB 4X9CA 2DL4A 2QQBA 1R0BG 2PVDB 3HTRA 4M77E 1QMCA 3SD4A 3META 4X9DA 5D7UA 2EJGA 2HDAA 1O75A 2JTFA 2P4TA 1X6BA 3M0SA 1IGUA 1BU1A 5LL6S 3TCJA 3UA7A 2LNHB 4NS5A 2JMCA 2MF2A 1N6AA 1MNDA 2DE0X 2CGHA 4YP0A 4JS5A 4QQDA 1EX4A 3CCRT 2K5FA 4FU6A 4YROA 2DVJA 2J7IA 5GJWB 3VS4A 1Z9ZA 5HY6A 1D0ZA 5GANf 1VQ7A 4RTWA 1VQOQ 4D8KA 2DXTA 2K79A 1F1BB 1U5SA 4O6JA 1M1KC 1ZQ1A 1YJWA 2EYZA 3FJPA 3HFVA 2O31A 5GAOn 4P72C 3M5AA 1VOMA 1BIBA 2DDZA 2V8KA 2EVRA 3I35A 1VQ8A 1WHMA 4J9DA 1QP3A 5C0MA 3PCOB 2IG0A 5CK9A 2YUOA 3VS5A 2JVVA 1FMVA 4KGZB 1QVFA 2ECZA 3EG0A 1G2BA 3HPWA 4C92B 3R6NA 3PMTA 4YCVA 1G51A 1WHGA 4M78F 1B7YA 3NGPA 2KQWA 1K9MR 2EQMA 3THKA 2DO3A 3V7RA 4BDZA 1AEYA 4M77C 4DBFA 4P73A 2Y4XA 4M75D 4C8QB 3LLRA 3CCMA 4P71C 3HXZA 1YIJA 3EG9A 4IUTA 4AFSC 4C5HA 1W1FA 1X2KA 1VQ9T 1VQNT 1KMNA 1YJWQ 5K1PA 1HXDA 3RESA 2EQUA 3SHWA 2P0QA 2M02A 2AZSA 4HT9A 2M9UA 3I55T 1XTDA 1SSHA 1H3HA 4TTVA 2ZNIA 3JCMh 3M4GA 4M77B 3T9NA 4OGEA 1VQKQ 2RK1A 2B86A 1TS9A 1AWJA 5GMKl 3EFRA 3VRYA 1K9MC 3CD6Q 3A7UA 3CXCS 1YJWT 1IB8A 3UH0A 2GQVA 1Q82U 2P4RA 1ZA1B 1E24A 4Z88A 1WYXA 1KIKA 5LJ3j 1GBRA 1BI1A 3G71A 3LWIA 4IURA 3M0QA 2JZ2A 2ROTA 4C0GA 2A37A 5GAMh 4C8QA 4F7UE 3L42A 5IT9E 1RAEB 3CD6T 1M1KU 3VS3A 5CO7A 1M1FA 2LC4A 4K11A 4LDVA 4YRLA 3EH1A 4F7UG 2COZA 4B6MA 3NETA 2K2VA 1VQ9Q 2KRMA 3FC3A 2M51A 1X6OA 1X54A 4M7DB 5LJ3d 2VB6A 2P0PA 5GMKj 3CMAQ 2R58A 1WYDA 4ESRA 1K76A 1H4SA 2RPNA 1WJSA 2CP3A 5KYYB 4RG8A 4AG2C 2ED0A 4G84A 5DY9A 4N4GA 4WJ4A 5GAN6 5CAIA 3A7RA 4H2TA 2DXCA 1HD3A 1OX9A 2OTJA 2LNVA 4FSXA 3P8YA 3OYBA 4J9FA 4LD9K 2LCLA 4XTZA 1W6XA 4RMOA 2EGEA 4RCCA 4P3OA 3VS0A 4TVAB 5E3IA 2XKOC 1VQMT 2D6FA 3OYJA 2M0YA 4XQ3A 3LYIA 2RI3A 3RERA 2FPFA 4F14A 3C95A 1GCQA 3QNEA 4KQEA 4JLIA 2NS6A 4J8OA 1MHNA 2H3JA 4LNPA 5FU7B 2ZT6A 1RAAB 1B70A 2CP5A 1NJ8A 3CC7T 1G5IA 2L3SA 2DA9A 2V8JA 5IXBA 1VQOT 1K73R 4WTOB 1TOVA 1I1JA 2O4XB 2VC8A 5FW9A 1C0MA 2BTTA 5GAOr 3MJXA 2FVUA 5I22A 1XQHA 3AHUA 1N8RC 1KC8U 2CIMA 1XOVA 5D6WA 3HFOA 1WXTA 3C0CA 1M8VA 2BZYA 3LX7A 2CJ9A 2A8EA 1TSFA 1X69A 1ZBXA 3EGDA 2JW4A 3H8ZA 3OW2S 3V8JA 3NPFA 3O8VA 4EDUA 2DF6A 1PRLC 4C8QD 2MOXA 4YRSA 1BI0A 5C52B 3MKDA 5LJ5e 4RCBA 5GANd 1QWFA 3PVLA 3OYIA 4PHCA 2E41A 1M2VA 1QW1A 4MZMA 5FU6C 3F70A 5L23A 3P8VA 3IALA 1QVPA 1RAGB 2DBKA 2PQWA 3A5ZB 4N0AA 1PC0A 4BI4A 4OMOA 2ZZGA 2ODRD 1WQ7A 2CSIA 1I5OB 3ZBDA 3GOXA 3NEMA 4YRCA 5FWCA 4BI8B 2RHQB 4ZN3A 1E6HA 2YT6A 4TVRA 3J7AF 4HWSA 2L5QA 1VQ8T 2PZ1A 4TVYA 4FW1A 1E22A 3I9QA 2QXFA 3BJUA 2VV5A 3TEEA 4L87A 4M7DG 2JJ9A 2K6DA 3SFMA 1VIEA 4AFZC 1LJOA 1AT1B 3INZA 4EMGA 1Q7YU 1K8AU 4C8QF 2F2XA 2VYTA 3VU3C 3I56Q 4ELZC 5EC7A 3QDRB 3V8LA 4DA4A 5GAMd 3ZL7C 4B9XA 4PJNA 3LWHA 2LJ3A 2RHYA 4YCWA 2K3BA 2ZNJA 3HL8A 4YRNA 2B8AA 1T0HA 1M8MA 3E9IA 4HVVA 3I7FA 4HT4A 1B34B 4NL3A 4UP7A 1YJNA 3PFSA 3JCMJ 2CH4W 2KYMA 1IHVA 2V26A 1YITA 3V8KA 3JSCA 1NG2A 1YP5A 4FSSA 3BFMA 5I21A 3QKJA 3H0HA 1YJ9T 2XK0A 2HD0A 3REUA 4JLGA 2AKWA 4AMCA 1AWOA 3WVDB 4M7DD 1D3BA 4YRPA 2PMFA 1S72T 4P74A 1VQ7Q 2E5KA 2RQUA 3OMCA 4EMKA 1W2BS 1K9MU 3QHSA 5IXFA 1PM3A 2OX7A 1EVKA 2YRDA 3QWXX 4MZTA 1EFNA 2DERA 3A31A 1VYTA 1H4TA 3HXWA 1VQ8Q 4J9GA 4FYYB 5GAN7 1TTHB 2C0IA 4II1A 1IREB 2ZZEA 3RUXA 1NEGA 4E47A 1RLQC 4LUEA 3VKIA 3G6EA 1EZZB 2JM9A 3EHQA 2ZR3A 2EYXA 4K88A 1IXDA 1UUEA 4F04B 3G71T 3QZ5B 5ELNA 1NNHA 2RD1A 3HKSA 3RACA 3CCVT 3PIOA 2E12A 4TWAA 4ZTUB 2DNUA 1OZ3A 1NPPA 2BIVA 4ZTFA 2NUPB 4JJBA 4PJOD 2QGFB 4M7AG 2C0TA 4CC2A 1YFRA 2W0ZA 4A53A 3CC4A 2CJAA 3A8MB 1VYVA 1KMMA 3RIRA 1K73U 2X4JA 2HSEB 2QAZA 2Q5HA 1YITT 4IUQA 2XMFA 1VQ6T 3H0FA 2I4LA 2HQEA 2AHJB 1WA7A 2YUNA 2KSSA 4A4KA 2LQWA 1U1SA 1YFNA 4RQFA 3PTAA 1Q86C 4EIKA 2LMJA 1IRXA 3AT1B 1TWBA 1KSWA 1ABOA 3MEVA 1X56A 2RJEA 3OBYA 4KGXB 2QA4A 2KBTA 1WIEA 2XU8A 2RHQA 5AYFA 4CI0C 3JCMd 4YRJA 1WNLA 3G4SA 1RI0A 2X4XA 2K3XA 4E7ZA 5CIUA 2VKNA 3JB9D 2F69A 4XK8E 3URGA 1OZ2A 4YRGA 4C92C 1YI2A 4LVKA 4M4ZA 1JB0E 1W4SA 5LJ3g 2BE7D 3QO7A 2P0LA 1QQJA 1NJ6A 2DTOA 4C5EA 2ZPFB 1LYLA 2K7AA 4M75A 3PNWC 3QSUA 3HTZA 2EQJA 1Q86U 2KRSA 1G83A 1AOJA 3OW2A 3Q1JA 3CMAA 4LN2A 4LD6A 2KEAA 4J9BA 2QYZA 5LJ5f 1YJNQ 1VQKT 3CCUQ 1QVGA 5CKFA 4JZ3A 3TREA 4M7AC 6AT1B 1OOTA 2FZCB 2C7IA 5GANe 1UE9A 2EQIA 4M7AE 1UGRB 4VUBA 3H0IA 1N8RR 2DIGA 2EFIA 4OVAA 2E3HA 3CPWP 5HGQA 5LJ3h 1QWEA 1SSFA 3C94A 3M59A 1ZSZA 2PMEA 2CZ1B 4H2VA 3RF1A 1YN8A 1LCKA 1I81A 4PNOA 3QWYA 1QF6A 4QT7A 2LVMA 5KH6A 4Q15A 3A5ZA 2DM1A 1WGSA 4CH4A 4HWTA 4ZTZB 3NTHA 5FWBA 4HCZA 1NJIU 1HYOA 4X1VA 3R6OA 2QASA 3HXUA 4AG1C 1RUWA 2K3YA 4QVDA 1GXIE 3G4SQ 2KYBA 3UGTA 1VQ5A 1BK2A 3HXVA 1AHJB 3D7SB 4O5VA 2EWNA 3J80E 1M3BA 4GLKA 2EAYA 7AT1B 3L2WA 2KAFA 4QQGA 5GAMf 2Q7GA 1VQ7T 1QCOA 3PGGA 3CCJA 4KBMB 4DEYA 2LCSA 5CVIA 3CCQT 1PSEA 4GY5A 3SDZA 2P84A 1XNIA 3QXEB 4LNSA 3MF2A 4E2FB 1VQKA 1E7OA 1FX7A 1PRMC 2KVQG 3VS6A 1FXXA 4PJMA 3CPWS 8AT1B 2RHIA 3IKMB 3DB4A 4LDWA 2COWA 2AKKA 1MV0B 1AD5A 1ZUKA 4OB0B 4Z89A 4CS3A 3X25B 3M0UA 2R5MA 2JN0A 4ZGEB 2K5IA 4UPAA 4IUUA 1AZGB 2SRCA 1EVLA 4YRIA 1EOVA 4RUGA 4P5NA 3A7AA 4RTYA 3RKYA 4ZIBA 2FPEA 2WSCE 1KOGA 1NLPC 1NJ1A 5DLQE 4BY6B 2CT4A 4IUVA 3MPUB 3RKWA 2NUTB 2ZPGB 1V29B 2LTOA 4JRIA 1I07A 3FB9A 3SWNC 2KT8A 2DKGA 2F5TX 1PD0A 3UF4A 2DX1A 3CCQQ 1NM7A 5C53B 4HWOA 3C12A 3CC7A 4RTZA 1G3SA 3I5SA 4OMLA 3SEMA 4FYVB 4QVZA 1KJWA 3OBWA 1M9SA 1KC8R 2EJ9A 4ATOA 1R0CB 5CKDA 1ACMB 3QYGB 2EKHA 3X28B 1BYMA 4RTXA 1IHWA 5KE3A 2ZIOA 1UECA 3CMEA 3VS7A 2AMCA 2KNBB 4KUDK 3JCMg 4BB7A 2DYIA 3BW1A 1M2VB 2JM8A 1USYA 5CCAA 3LSSA 5GMKi 2DETA 4C5GA 1SETA 1LOJA 2E4HA 3EAEA 1PYSB 2V1QA 4MMKA 4OF1A 2QQ9A 1B34A 2DJQA 5D6YA 1RI9A 1SEMA 2CZ7B 1L0WA 2FEIA 2EIFA 4M75F 1T0JA 1UB4A 1LPLA 4DOVA 3CXCP 2KXDA 1YFSA 1UDLA 4XU3A 1VQPT 1NJIC 1R8OB 3NMZC 4KH1B 4YREA 5GAMg 4FM4B 2ZPIB 3JCMV 1PG5B 2KI7A 3JB9J 1NLOC 3NENA 1K73C 5IHIA 5A0LA 4CS4A 2JS0A 3OYMA 3VUBA 1YI2T 2QDYB 1QKWA 3ER0A 3OA6A 5FRNA 2ZT8A 3CCRA 5LJ5h 2PVOB 1JXOA 1SESA 4M78C 1ABQA 2FO0A 4P3NA 4EMHA 4C8QE 4H2XA 4PG3A 1SRMA 3HSBA 1H8KA 2DEQA
chains in the Genus database with same CATH topology
4HCBA 2AKWB 4OGCA 1WQWA 4XU0A 4KT0E 5LJ3f 4UP9A 3JCMc 2DTHA 1ATIA 1NE8A 5GMKh 3VBBA 3PZCA 4YYEA 4N0AC 1Y71A 2BUDA 4EPCA 5GAOq 2OTLT 1NZ9A 2DPPB 1YJ9A 3OYDA 3MEAA 2QQAA 3TEHA 2OAUA 5LJ5g 4A4FA 4C8QG 1VQ4T 2DU7A 4C0DC 1C0AA 2CS7A 4H2UA 1GGMA 5CQXA 5KCOA 4BW9A 4PJOG 4F7UA 1KQ1A 4D6WA 2DXBA 2XDBA 2IY5B 1P92A 1KG1A 2EYQA 2HNIA 4MDXA 5KCHA 5CR2A 2IY5A 2LDMA 2E5AA 4M7AF 3NFCA 3PMIA 3KUFA 2ZR2A 4J6YA 4OP0A 3PIPA 2HAXA 3RGLA 2DIQA 3M58A 4YRFA 1FWZA 4MDWA 4HT8A 4PJOE 2DZCA 2FL7A 1M90U 1B8AA 3A5YA 3MEWA 2F5KA 3DB3A 3HRUA 3CCMT 2JTMA 4NL2A 1VQ6A 1KHCA 2ZZFA 4M78B 3LGLA 1IL2A 5J39A 4BD3A 1QP2A 5GANg 1ZHIA 2KDSA 3CBMA 4P3PA 1USYC 2J3MA 3M9QA 4L6V5 2DAQA 4P73C 4PJOC 5HKCA 4V2SA 4C5IA 3SB2A 1Z7MA 4CH3A 3OYAA 3HRKA 5HK0A 3NTKA 3MQZA 5CKHA 1VQLT 2A3LA 3GLXA 1WPYA 3A74A 3V7CA 2CZ0B 2X4WA 3VYHB 4FL6A 5LJ5d 2CJBA 4H2YA 4H02A 4BDYA 2K5LA 4A4HA 2C06A 4ME7A 4EO4A 2DXUA 4HVCA 1Z7NA 3EFSA 2I4NA 3L4GB 4C0ZA 4JUVA 1RL2A 1X01A 4J5YA 2KK4A 4WJ3M 4XTXA 3CC2A 4C0FA 3L4GA 3CCVA 2QQSA 2RO0A 5I2MA 4MMLA 3FRNA 1YBYA 4OMFB 2O01E 3REXA 4C92D 5LJ5j 1VIFA 3CC4T 1M1GA 3MHXA 2RA2A 4FT4A 3HP9A 2MWOA 2XDPA 4BE0A 4PLLA 3OYHA 4H2WA 3OD1A 3TUPA 2O4XA 1ADYA 3NELA 3L2ZA 3QZ9B 5LJ3e 1UGPB 1EIYA 2E64A 3OYLA 2HBPA 4M78E 4Q6GA 2RI5A 3A8OB 1D3BB 1MGQA 2ZPEB 2KY9A 3RMQA 3OS2A 3CCJT 1G5HA 3M57A 1SERA 1LNXA 2CYZB 4M77D 4M75C 3OS5A 3QYHB 2EL9A 3OMGA 4L5GA 2ZPHB 2E6NA 1JJCB 1NJ5A 4PJOF 5GAN3 3CCST 2GCXA 1NPRA 1YIJT 1VQNA 3HRTA 4ZGDB 3HY0A 3OYFA 3MP6A 2I4MA 2RM4A 2QHVA 2LT4A 5GAN4 4CH6A 2MWPA 3LGFA 1UEBA 3JB9H 4DPGA 3OQ5A 2J3LA 4UC4A 2ZXFA 3JB9I 1EQRA 3VQVA 4KUIA 2K57A 1YGBA 2D9TA 5L8RE 4YPFA 1M5Q1 2PUOB 2ZT7A 2GF7A 2QEXA 5FROA 4JJNK 2A7YA 2ZT5A 3UT1A 2FHDA 1SRYA 3CCEA 2ZTGA 1JBMA 3OYEA 4LDXA 1ASYA 4L59A 4PLIA 1VQMA 2G3RA 2XDDA 1Q82C 2E70A 4PJOA 4LDYA 3QO5A 1Y7XA 5A2QE 3MF1A 3CMET 1VUBA 3IKLA 2DU5A 1YJNT 3X26B 3QIIA 4JRQA 1DJ7B 2Y4YA 4R55A 2D0QB 3A8HB 1BIAA 2E5QA 3FEOA 3WQZA 2X4YA 1QVGS 1RIQA 3MP1A 3CCUT 2RJDA 4E7KA 3HRSA 3TEHB 2DD5A 5KE2A 4YRTA 11ASA 4E7LA 2QHUA 5F5WA 4DQ2A 3KXTA 3GNFB 3RKXA 2YRVA 4HCCA 4B9WA 3QTCA 3MO8A 1KD1U 3S6WA 4C8QC 1YFTA 4HKEA 1VQZA 3SWNB 4A54A 3P8HA 3OSVA 3A32A 2P0KA 2RI2A 3L2RA 3ASKA 4M77A 1KQ2A 1Y07A 1N27A 4PKCC 3SWNA 1Q81C 3FIFA 3A8GB 4OB3B 4BUGA 3A8LB 3M54A 4BACA 2K4YA 4CRIA 1YHQA 4O2DA 3QO3A 4P75C 2JNGA 4BI3A 3ME9A 2DD4A 4E51A 2VXFA 2V8IA 1KD1C 2VGNA 3GP8A 4YRMA 4FT2A 2AMCB 4P72A 3JCMW 3R07A 3CD6A 1X75C 4ZN1A 3HXXA 3E1SA 3GPLA 4CH5A 2ZIMA 4QQ6A 3QG1A 4XU1A 3MCAB 1Q81U 2NLUA 1YCYA 2RHUA 3OYKA 1JJ2S 4LVLA 2ODRC 5GANj 4C0DB 1G5VA 1OI1A 2RHZA 2VGMA 5GMKe 2RJCA 1BI2A 1U1TA 3LSQA 2I2LA 2QHSA 4C92E 4EMKC 4N4IA 2RH2A 4KR3A 4K86A 4N4HA 3IG2A 3M55A 3N5BB 4HWPA 4IUPA 1TH7A 3JCMP 3TEGA 1U8RA 5HK3A 1NYQA 2VUBA 1E1OA 4YDQA 3H6ZA 3VQYA 3P8BB 3L1AA 4H2XB 4EMKB 3MEUA 4E7IA 1IZ6A 2EKOA 2RHXA 1NJ2A 2LRQA 4XTVA 2BKDN 5CQYA 4BE2A 3LC0A 2M0OA 2E1HA 1BBWA 5M9OA 2QQRA 3M4YA 3LW5E 5A0GA 3QJYA 4AH6A 3VV0A 3OYCA 5GAN2 4RDXA 3OY9A 4CS2A 4Y91A 4YCUA 2DQ0A 3JCMb 4C92F 4MZPA 2G4CA 2LQ8A 4YRKA 2FB7A 4KULA 4EX5A 4M7DE 3JCMQ 3HY1A 1KQSA 4TQDA 4QW2A 4Y28E 4A4EA 2P5IA 3G6ET 2MI6A 3LH0A 1B76A 4JDSA 1I5LA 4XTYA 4X34A 3S3OA 1X2HA 4M77F 3BDLA 2LX9A 1HK9A 5D6XA 4XU2A 1M90C 2R5AA 1HC7A 3CEYA 1N9SA 1H4QA 5GAN8 5J3BA 3CCLT 1PSFA 5C6SA 2MMPA 2OTLA 4LDUA 2M16A 5J26A 3E9GA 4XTWA 4BY6C 1KC8C 1ADJA 1J5WA 1N9WA 3CPWA 4XTUA 3I56T 3CCUA 4M78G 2IVWA 3VJPA 3CXCA 3OYGA 1WLEA 3OSSC 2RJFA 5FLXE 3G1ZA 2Q7EA 1M4ZA 1UGSB 3WXMB 5K1XA 3PT9A 2E65A 2OTJT 3VQWA 1B7YB 4YRRA 2LT1A 2PU9B 4XAXB 3RL6A 1EFWA 3RMSA 2CZ6B 2L3RA 3QUIA 1PYSA 3L2QA 1NYRA 1VQ5T 3OS0A 1YHQT 2YHTA 4M7AD 4H2SA 3MP8A 5DLOA 3DSQA 5A0DA 1VQLA 1W2BA 2XICA 3KBGA 2ZGWA 4J6XA 4Z02A 3GIBA 3CCSA 1BKBA 1QE0A 3VUZA 3V7SA 4RMFA 4YTLA 3DLMA 4TQFA 5DM7R 3JCMe 4ELYC 2Y90A 2C8MA 2WSFE 5GAMj 2L89A 3CC2T 3HXYA 2CKKA 3E19A 2YLCA 2I4OA 2Q5IA 1HTTA 4M7DA 2QEXT 3JRZA 3GF5A 2QTXA 5GAMe 3HFNA 4M78A 3JCMX 2ZCEA 2QA4T 2XHCA 1Y96A 3VQXA 4YRQA 2ZPBB 3ERRA 2ARUA 1W66A 2EJFA 1BI3A 4OB1B 2HQXA 4LVMA 2ZZDA 4J83A 5FU7C 4IKFA 4G85A 3X20B 4ZGJB 2DVEA 3QJ6A 1KQSS 2RB6A 5C51B 4HA8A 2E3CA 2LCCA 1H3ZA 4JS4A 1FYFA 2KMTA 4P74C 4WI1A 4NCXA 1G3TA 4J7IA 3G7ZA 1VQ4A 2WACA 4BE1A 3BY7A 3JAME 3L2UA 4A4GA 1UGQB 3FLGA 4M7DF 3OYNA 3CMQA 5GAOp 2MAMA 2GFUA 4M75E 2ZINA 1E1TA 3UFGA 4LVJA 3FDRA 2RHSB 2ALYA 3X24B 3CBOA 3ZFJA 4JRPA 4RKUE 2QI2A 1EIYB 3QO8A 1WJQA 1EIFA 3UPUA 1VQPA 1G3YA 1Y96B 2WSEE 4M7AA 4R56A 2R57A 2GFAA 4HWRA 2XTIA 3UDCA 4LVIA 1O9SA 3OS1A 4PL6A 2DZ9A 2DJZA 3CCET 2VXEA 5IAYA 12ASA 4PJOB 1WJRA 3VYGA 4KR2A 4M78D 3NTIA 2JUFA 4C92A 2EQKA 3L2VA 3HFZA 2XG8D 1S72A 3KFUA 4M75B 3QBYA 1OYXA 3I56A 2DQ3A 4Q5WA 3PCOA 4RG2A 1H4VB 3C4SA 2ARTA 2E10A 5EG2A 4OLFA 5GAOl 3OYYA 2L8DA 5ELOA 5CKEA 1VQ9A 2RHSA 3M4PA 2ALYB 5FU6B 2XIDA 3GNGA 4M75G 2DK3A 4TVAA 2E6ZA 3I55A 3OB9A 2LQKA 5IN1A 4JRKA 4K87A 3TU4K 3BDUA 1N8RU 3CPFA 3E9HA 3S3NA 1JJCA 1H641 1Q7YC 1K8AC 1I8FA 3JCMf 1JRIA 4M7DC 1JJ2A 4QVCA 2DTIA 4DOWA 4P71A 4OB2B 1WU7A 3S3MA 5GAOm 4M7AB 4E7HA 3HHTB 4P75A 4XEOA 4UP8A 3J81E 4F7UF 1B70B 4BWAA 5FRMA 3UGQA 3P8TA 5GANh 2M1HA 3DKMA 4J6WA 4J7FA 1I4K1 3HRIA 3QPHA 4WF2A 5CKBA 2XI9A 3M56A 2X35A 3G4ST 3HFZB 3UWNA 4C92G 3ICAA 2ARSA 5I2SA 3MEYA 4X5OA 3CBPA 3WVEB 3P8DA 3M4QA 2JOYA 2YLBA 2XGTA 2XD0A 3ZEHA 1YB3A 2PVGB 1ASZA 3W3SA 3JB9G 5KNNA 3DLLA 1QVFS 3CMAT 2ZCFB 2PUKB 4E7JA 4XEMA 4RQEA 4J15A 3JB9F 1KHIA 2RK2A 3E9FA 4FIBA 1VQOA 1X2GA 3CCLA 2FYKA 5GAN5 4TVWA 4NOYA 3CCQA 1G3WA 2Q7HA 3M53A 4M77G 4F7UB 2QHTA 1N9RA 1X55A 5GMKm 1BBUA 4ZTJA 4X9CA 2QQBA 2PVDB 4M77E 3SD4A 3META 4X9DA 2EJGA 2JTFA 1O75A 2P4TA 5LL6S 3TCJA 4NS5A 2MF2A 1N6AA 4YP0A 2CGHA 4JS5A 4QQDA 3CCRT 2K5FA 4FU6A 4YROA 5HY6A 5GANf 1VQ7A 2DXTA 4O6JA 1M1KC 1ZQ1A 1YJWA 3FJPA 3HFVA 5GAOn 4P72C 3M5AA 1BIBA 2DDZA 2V8KA 1VQ8A 1QP3A 5C0MA 3PCOB 2IG0A 5CK9A 2JVVA 1QVFA 3HPWA 4C92B 3PMTA 4YCVA 1G51A 4M78F 1B7YA 2KQWA 2EQMA 2DO3A 3V7RA 4BDZA 4M77C 4P73A 2Y4XA 4M75D 4C8QB 3LLRA 3CCMA 4P71C 3HXZA 1YIJA 4IUTA 4C5HA 1KMNA 1VQ9T 1VQNT 5K1PA 1HXDA 3RESA 2EQUA 2P0QA 4HT9A 2M9UA 3I55T 1XTDA 4TTVA 2ZNIA 3JCMh 3M4GA 4M77B 3T9NA 4OGEA 2RK1A 5GMKl 3EFRA 1K9MC 3A7UA 3CXCS 1YJWT 3UH0A 2GQVA 1Q82U 1E24A 5LJ3j 1BI1A 3G71A 3LWIA 4IURA 2JZ2A 4C0GA 5GAMh 4C8QA 4F7UE 3L42A 5IT9E 3CD6T 1M1KU 5CO7A 1M1FA 2LC4A 4LDVA 4YRLA 4F7UG 3NETA 2K2VA 3FC3A 1X6OA 1X54A 4M7DB 5LJ3d 5GMKj 2P0PA 1WYDA 2R58A 1H4SA 1WJSA 4RG8A 4G84A 5DY9A 4N4GA 4WJ4A 5GAN6 5CAIA 3A7RA 4H2TA 2DXCA 2OTJA 2LNVA 4FSXA 3P8YA 3OYBA 4LD9K 2LCLA 4XTZA 4RMOA 4RCCA 4P3OA 4TVAB 5E3IA 2XKOC 1VQMT 2D6FA 3OYJA 4XQ3A 3LYIA 2RI3A 3RERA 3C95A 3QNEA 4KQEA 2NS6A 4JLIA 4J8OA 1MHNA 2H3JA 5FU7B 2ZT6A 1B70A 1NJ8A 3CC7T 1G5IA 2V8JA 1VQOT 2O4XB 2VC8A 5GAOr 2FVUA 3AHUA 1XQHA 1N8RC 1KC8U 2CIMA 1XOVA 5D6WA 3HFOA 1M8VA 3LX7A 2CJ9A 2A8EA 1ZBXA 3H8ZA 3OW2S 3V8JA 3O8VA 4EDUA 4C8QD 4YRSA 1BI0A 5C52B 5LJ5e 4RCBA 5GANd 3OYIA 4PHCA 2E41A 4MZMA 1QW1A 5FU6C 3F70A 3P8VA 3IALA 1QVPA 2PQWA 3A5ZB 4N0AA 4BI4A 2ZZGA 2ODRD 1WQ7A 3ZBDA 3GOXA 3NEMA 4YRCA 4BI8B 2RHQB 4ZN3A 4TVRA 3J7AF 4HWSA 2L5QA 1VQ8T 4TVYA 1E22A 2QXFA 3BJUA 2VV5A 3TEEA 4L87A 4M7DG 3SFMA 1VIEA 1LJOA 3INZA 4EMGA 1Q7YU 1K8AU 4C8QF 2VYTA 3VU3C 4ELZC 3QDRB 3V8LA 4DA4A 5GAMd 4B9XA 3LWHA 2RHYA 4YCWA 2ZNJA 3HL8A 4YRNA 2B8AA 3E9IA 3I7FA 4HT4A 1B34B 4NL3A 4UP7A 1YJNA 3PFSA 3JCMJ 1YITA 3V8KA 3JSCA 5I21A 3BFMA 3QKJA 1YJ9T 2XK0A 2HD0A 3REUA 4JLGA 2AKWA 3WVDB 4M7DD 1D3BA 4YRPA 2PMFA 1S72T 4P74A 4EMKA 3OMCA 1W2BS 1K9MU 3QHSA 1EVKA 4MZTA 3A31A 1H4TA 3HXWA 5GAN7 4II1A 1IREB 2ZZEA 3RUXA 4E47A 3VKIA 3G6EA 2ZR3A 4K88A 3G71T 3QZ5B 5ELNA 1NNHA 2RD1A 3HKSA 3RACA 3CCVT 3PIOA 2E12A 4TWAA 4ZTUB 1OZ3A 1NPPA 2BIVA 4ZTFA 4PJOD 4M7AG 1YFRA 4A53A 3CC4A 2CJAA 3A8MB 1KMMA 3RIRA 1K73U 2X4JA 2Q5HA 1YITT 4IUQA 1VQ6T 2I4LA 2HQEA 2AHJB 2KSSA 4A4KA 1U1SA 4RQFA 3PTAA 1Q86C 3MEVA 1X56A 2RJEA 3OBYA 2QA4A 2XU8A 2RHQA 5AYFA 3JCMd 4CI0C 4YRJA 1WNLA 3G4SA 1RI0A 2X4XA 2K3XA 5CIUA 3JB9D 2F69A 4XK8E 3URGA 1OZ2A 4YRGA 4C92C 1YI2A 4LVKA 1JB0E 1W4SA 5LJ3g 3QO7A 2P0LA 1NJ6A 2DTOA 4C5EA 2ZPFB 1LYLA 4M75A 3PNWC 3QSUA 3HTZA 2EQJA 1Q86U 3OW2A 3Q1JA 3CMAA 4LD6A 5LJ5f 1VQKT 1QVGA 5CKFA 3TREA 4M7AC 2C7IA 5GANe 4M7AE 1UGRB 4VUBA 2DIGA 2EFIA 4OVAA 5HGQA 5LJ3h 1SSFA 3C94A 3M59A 3RF1A 2PMEA 2CZ1B 4H2VA 1I81A 4PNOA 1QF6A 4Q15A 2LVMA 5KH6A 3A5ZA 1WGSA 4CH4A 4HWTA 4ZTZB 3NTHA 4HCZA 1NJIU 3R6OA 3HXUA 2K3YA 4QVDA 1GXIE 3UGTA 1VQ5A 3HXVA 1AHJB 4O5VA 2EWNA 3J80E 4GLKA 2EAYA 3L2WA 2KAFA 4QQGA 5GAMf 2Q7GA 1VQ7T 3PGGA 3CCJA 4KBMB 5CVIA 3CCQT 1PSEA 4GY5A 3SDZA 1XNIA 3QXEB 4LNSA 3MF2A 1VQKA 1FX7A 2KVQG 1FXXA 3CPWS 2RHIA 3IKMB 3DB4A 4LDWA 4OB0B 4CS3A 3X25B 2R5MA 2JN0A 4ZGEB 2K5IA 4UPAA 4IUUA 1EVLA 4YRIA 1EOVA 4P5NA 3A7AA 3RKYA 4ZIBA 2WSCE 1KOGA 1NJ1A 5DLQE 4BY6B 4IUVA 3RKWA 2ZPGB 1V29B 2LTOA 4JRIA 3FB9A 3SWNC 2DKGA 2F5TX 5C53B 4HWOA 3C12A 3CC7A 1G3SA 4QVZA 3OBWA 1M9SA 2EJ9A 4ATOA 5CKDA 3QYGB 3X28B 1BYMA 5KE3A 2ZIOA 2AMCA 3CMEA 4KUDK 3JCMg 4BB7A 3BW1A 1USYA 5CCAA 3LSSA 5GMKi 4C5GA 1SETA 1LOJA 3EAEA 1PYSB 4MMKA 4OF1A 2QQ9A 1B34A 5D6YA 2CZ7B 1L0WA 2EIFA 4M75F 1UB4A 4DOVA 1YFSA 4XU3A 1VQPT 1NJIC 1R8OB 4YREA 5GAMg 4FM4B 2ZPIB 3JCMV 3JB9J 3NENA 1K73C 5A0LA 4CS4A 3OYMA 3VUBA 1YI2T 2QDYB 3ER0A 3OA6A 5FRNA 2ZT8A 3CCRA 5LJ5h 2PVOB 1SESA 4M78C 4P3NA 4EMHA 4C8QE 4H2XA 4PG3A 3HSBA 2DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKW B;  3NEM A;  4CH5 A;  2RHS A;  2ZIM A;  3M4P A;  4YRC A;  1WQW A;  2ALY B;  2RHQ B;  4XU0 A;  4M75 G;  4XU1 A;  4HWS A;  5LJ3 f;  3HXX A;  4TVA A;  4UP9 A;  3JCM c;  1YCY A;  4TVY A;  2DTH A;  1E22 A;  1ATI A;  3BJU A;  5GMK h;  3VBB A;  4L87 A;  4JRK A;  4M7D G;  4K87 A;  2ODR C;  5GAN j;  3PZC A;  1LJO A;  3BDU A;  4YYE A;  3INZ A;  4N0A C;  4EMG A;  5GMK e;  4C8Q F;  5GAO q;  3VU3 C;  1U1T A;  3LSQ A;  2I2L A;  3E9H A;  3V8L A;  5GAM d;  2QHS A;  3TEH A;  4C92 E;  4EMK C;  1JJC A;  5LJ5 g;  1H64 1;  1I8F A;  3JCM f;  4C8Q G;  2DU7 A;  4KR3 A;  1JRI A;  4YCW A;  1C0A A;  4M7D C;  2ZNJ A;  4K86 A;  4YRN A;  3IG2 A;  4HWP A;  4H2U A;  4QVC A;  1GGM A;  3E9I A;  2DTI A;  1TH7 A;  3I7F A;  3JCM P;  4BW9 A;  4P71 A;  3TEG A;  1B34 B;  4NL3 A;  4UP7 A;  1NYQ A;  1WU7 A;  4PJO G;  3JCM J;  5GAO m;  4F7U A;  4M7A B;  3V8K A;  1KQ1 A;  5I21 A;  3BFM A;  4P75 A;  4XEO A;  3REU A;  2AKW A;  4UP8 A;  2IY5 B;  4M7D D;  1D3B A;  4F7U F;  1B70 B;  1E1O A;  4YRP A;  4YDQ A;  2PMF A;  4BWA A;  4P74 A;  3VQY A;  4EMK A;  2HNI A;  3L1A A;  4H2X B;  3UGQ A;  4EMK B;  3QHS A;  3P8T A;  5GAN h;  1NJ2 A;  2IY5 A;  1EVK A;  4XTV A;  4J6W A;  2E5A A;  4M7A F;  3A31 A;  1H4T A;  1I4K 1;  3HRI A;  3HXW A;  4WF2 A;  3LC0 A;  2E1H A;  2ZR2 A;  4J6Y A;  4OP0 A;  3RGL A;  5GAN 7;  1BBW A;  3HFZ B;  4YRF A;  4C92 G;  3ICA A;  4HT8 A;  4PJO E;  2ZZE A;  2ARS A;  2DZC A;  3RUX A;  3MEY A;  4X5O A;  1B8A A;  4AH6 A;  3A5Y A;  5GAN 2;  4RDX A;  2ZR3 A;  4CS2 A;  4K88 A;  4Y91 A;  4YCU A;  3M4Q A;  5ELN A;  1NNH A;  2RD1 A;  2YLB A;  2XGT A;  2DQ0 A;  3JCM b;  3RAC A;  4C92 F;  4NL2 A;  2G4C A;  1YB3 A;  4YRK A;  4TWA A;  4ZTU B;  2ZZF A;  1ASZ A;  4M78 B;  2FB7 A;  4EX5 A;  3W3S A;  3JB9 G;  5KNN A;  4M7D E;  3JCM Q;  3HY1 A;  1IL2 A;  4TQD A;  4PJO D;  4XEM A;  4RQE A;  4M7A G;  2P5I A;  1YFR A;  4J15 A;  4A53 A;  2CJA A;  3JB9 F;  1B76 A;  1I5L A;  1KMM A;  5GAN g;  4XTY A;  3RIR A;  2Q5H A;  1X2H A;  4M77 F;  1X2G A;  4P3P A;  1USY C;  2J3M A;  2FYK A;  5GAN 5;  2I4L A;  4P73 C;  4TVW A;  4NOY A;  4PJO C;  4V2S A;  2Q7H A;  3SB2 A;  1HK9 A;  1Z7M A;  4M77 G;  4F7U B;  2QHT A;  4CH3 A;  4XU2 A;  1N9R A;  3HRK A;  1X55 A;  1U1S A;  5GMK m;  4RQF A;  1BBU A;  1HC7 A;  1WPY A;  4X9C A;  3A74 A;  3V7C A;  1X56 A;  4M77 E;  1N9S A;  1H4Q A;  5GAN 8;  2RHQ A;  4X9D A;  3JCM d;  2EJG A;  5LJ5 d;  2CJB A;  4H2Y A;  4YRJ A;  4H02 A;  4XTW A;  1WNL A;  4EO4 A;  2DXU A;  3JB9 D;  1ADJ A;  1J5W A;  1N9W A;  1Z7N A;  4HVC A;  3EFS A;  4YRG A;  4XTU A;  4C92 C;  2I4N A;  3L4G B;  4JUV A;  4YP0 A;  2CGH A;  1X01 A;  4J5Y A;  5LJ3 g;  2P0L A;  3QO7 A;  4M78 G;  1NJ6 A;  4WJ3 M;  4XTX A;  4YRO A;  2DTO A;  1LYL A;  5GAN f;  4M75 A;  3L4G A;  4MML A;  2DXT A;  3QSU A;  1WLE A;  3HTZ A;  3REX A;  4C92 D;  3FJP A;  3G1Z A;  3HFV A;  5LJ5 j;  5GAO n;  4P72 C;  1BIB A;  5LJ5 f;  2Q7E A;  2DDZ A;  5K1X A;  2E65 A;  3PCO B;  2RA2 A;  3VQW A;  1B7Y B;  4YRR A;  4M7A C;  2C7I A;  3RL6 A;  1EFW A;  5GAN e;  4M7A E;  4H2W A;  3OD1 A;  3QUI A;  1PYS A;  3TUP A;  4C92 B;  5HGQ A;  5LJ3 h;  4YCV A;  1G51 A;  1NYR A;  4M78 F;  1B7Y A;  1ADY A;  3NEL A;  3L2Z A;  5LJ3 e;  2YHT A;  3RF1 A;  2PME A;  4H2V A;  4M7A D;  3V7R A;  1I81 A;  4H2S A;  4PNO A;  1EIY A;  3DSQ A;  2E64 A;  4M77 C;  4P73 A;  4M78 E;  4Q6G A;  4Q15 A;  1QF6 A;  2ZGW A;  4J6X A;  3A5Z A;  4M75 D;  4CH4 A;  1D3B B;  1MGQ A;  4HWT A;  3GIB A;  4ZTZ B;  4C8Q B;  4P71 C;  3HXU A;  1QE0 A;  1G5H A;  3HXZ A;  3V7S A;  1SER A;  4QVD A;  1KMN A;  4RMF A;  3UGT A;  1LNX A;  5K1P A;  1HXD A;  3RES A;  4M77 D;  4TQF A;  3JCM e;  3HXV A;  4M75 C;  4HT9 A;  2Y90 A;  2EL9 A;  2EWN A;  2C8M A;  4TTV A;  2ZNI A;  3JCM h;  5GAM j;  2EAY A;  3M4G A;  5GAM f;  4M77 B;  1JJC B;  2Q7G A;  1NJ5 A;  3HXY A;  4PJO F;  5GAN 3;  3PGG A;  5GMK l;  3EFR A;  2YLC A;  3A7U A;  2I4O A;  2Q5I A;  1HTT A;  4M7D A;  3HY0 A;  4LNS A;  2I4M A;  3UH0 A;  3MF2 A;  2RM4 A;  2QHV A;  5GAN 4;  4CH6 A;  1E24 A;  5LJ3 j;  2QTX A;  5GAM e;  3JB9 H;  3HFN A;  4M78 A;  3JCM X;  2ZCE A;  4DPG A;  2J3L A;  3IKM B;  1Y96 A;  5GAM h;  3VQX A;  2ZXF A;  4YRQ A;  4C8Q A;  3JB9 I;  1EQR A;  3ERR A;  4F7U E;  2ARU A;  3VQV A;  1W66 A;  2EJF A;  2K57 A;  1YGB A;  4CS3 A;  2JN0 A;  4YPF A;  1M5Q 1;  2ZT7 A;  4YRL A;  4G85 A;  2DVE A;  4F7U G;  4UPA A;  1EVL A;  4YRI A;  2ZT5 A;  1EOV A;  3A7A A;  3NET A;  1SRY A;  2RB6 A;  3RKY A;  4ZIB A;  4HA8 A;  5C51 B;  1KOG A;  1X54 A;  2E3C A;  2ZTG A;  4M7D B;  5LJ3 d;  1JBM A;  5GMK j;  1NJ1 A;  1WYD A;  1H4S A;  1ASY A;  3RKW A;  1FYF A;  4P74 C;  4WI1 A;  4NCX A;  4JRI A;  4G84 A;  5DY9 A;  4PJO A;  3FB9 A;  4WJ4 A;  3SWN C;  3QO5 A;  5GAN 6;  5CAI A;  3A7R A;  2DKG A;  4H2T A;  3MF1 A;  3BY7 A;  3P8Y A;  4M7D F;  5C53 B;  4XTZ A;  4HWO A;  3IKL A;  2DU5 A;  4RCC A;  3CMQ A;  4P3O A;  5GAO p;  4M75 E;  2ZIN A;  4TVA B;  5E3I A;  2EJ9 A;  1E1T A;  3UFG A;  4XQ3 A;  1BIA A;  3RER A;  2RHS B;  2ALY A;  3WQZ A;  3QNE A;  4KQE A;  4JLI A;  1RIQ A;  1EIY B;  2ZIO A;  2AMC A;  3QO8 A;  2ZT6 A;  3TEH B;  1B70 A;  3JCM g;  3BW1 A;  1USY A;  1NJ8 A;  1Y96 B;  1G5I A;  3LSS A;  4YRT A;  11AS A;  5GMK i;  2QHU A;  1SET A;  5F5W A;  4M7A A;  1LOJ A;  2VC8 A;  4DQ2 A;  1PYS B;  4MMK A;  5GAO r;  4HWR A;  1B34 A;  2XTI A;  3RKX A;  3AHU A;  3QTC A;  1L0W A;  2CIM A;  4M75 F;  4C8Q C;  1YFT A;  3HFO A;  1VQZ A;  3SWN B;  4A54 A;  1M8V A;  1YFS A;  4XU3 A;  2DZ9 A;  2DJZ A;  3A32 A;  2VXE A;  2CJ9 A;  12AS A;  4PJO B;  4YRE A;  1KQ2 A;  4M77 A;  5GAM g;  3V8J A;  4KR2 A;  3SWN A;  4M78 D;  3FIF A;  3JCM V;  4C92 A;  3HFZ A;  4C8Q D;  3JB9 J;  4YRS A;  3NEN A;  3KFU A;  4M75 B;  4CS4 A;  4O2D A;  3QO3 A;  4P75 C;  5C52 B;  5LJ5 e;  4RCB A;  5GAN d;  2DQ3 A;  3PCO A;  1H4V B;  2ART A;  2ZT8 A;  4PHC A;  2E41 A;  5LJ5 h;  4E51 A;  3P8V A;  3IAL A;  1SES A;  2E10 A;  4M78 C;  4N0A A;  2VXF A;  4P3N A;  4EMH A;  4C8Q E;  2ZZG A;  4H2X A;  4OLF A;  5GAO l;  4PG3 A;  2AMC B;  4YRM A;  2ODR D;  1WQ7 A;  4P72 A;  3JCM W;  3R07 A;  3HSB A;  2DEQ A;  5ELO A; 
#chains in the Genus database with same CATH topology
 2NWM A;  4HCB A;  2AKW B;  4OGC A;  1WQW A;  4XU0 A;  4KT0 E;  5LJ3 f;  1QVF P;  4UP9 A;  1T3L A;  4PJL A;  3JCM c;  2DTH A;  1JJ2 P;  1ATI A;  1NE8 A;  5GMK h;  3VBB A;  3PE0 A;  3PZC A;  4YYE A;  4N0A C;  1Y71 A;  2BUD A;  4EPC A;  5GAO q;  2OTL T;  2FRW A;  2IPO B;  1NZ9 A;  2DPP B;  2NUZ A;  4J9H A;  1YJ9 A;  2HKN A;  3OYD A;  3MEA A;  2QQA A;  2GTO A;  3TEH A;  1K4U S;  2OAU A;  5LJ5 g;  4A4F A;  2HCK A;  4C8Q G;  1VQ4 T;  2DU7 A;  4C0D C;  4IIO A;  1C0A A;  2OTJ Q;  4DBH A;  3CCS Q;  2CS7 A;  4H2U A;  1QCF A;  1GGM A;  5CQX A;  5KCO A;  4BW9 A;  1M90 R;  4PJO G;  4F7U A;  1KQ1 A;  4GBQ A;  4D6W A;  2DXB A;  1GCP A;  2XDB A;  2DL8 A;  2IY5 B;  2CP2 A;  1VQ5 Q;  4A63 B;  1P92 A;  1KG1 A;  3UA6 A;  1WFW A;  2EYQ A;  2HNI A;  4F17 A;  1NJI R;  1KD1 R;  2OAW A;  4MDX A;  4J9E A;  1KFZ A;  1TG0 A;  5KCH A;  5CR2 A;  2IY5 A;  1H92 A;  2LDM A;  1UHF A;  2E5A A;  4M7A F;  1RAD B;  3NFC A;  3PMI A;  3KUF A;  4LE9 A;  2ZR2 A;  4J6Y A;  4OP0 A;  3PIP A;  2HAX A;  3RGL A;  2DIQ A;  3M58 A;  1TXQ A;  4YRF A;  4GLM A;  1QCN A;  1FWZ A;  4MDW A;  4HT8 A;  4PJO E;  2DZC A;  1V76 A;  2FL7 A;  1M90 U;  1B8A A;  4J9I A;  2LP5 A;  3TQ7 P;  1JU5 C;  1OQK A;  3A5Y A;  3MEW A;  2F5K A;  5IH2 A;  1VQN Q;  3DB3 A;  4ORZ A;  3HRU A;  3CCM T;  2JTM A;  4NL2 A;  1VQ6 A;  1KHC A;  2ZZF A;  1WX6 A;  4M78 B;  4OMP A;  3LGL A;  2YDL A;  1IL2 A;  1PWT A;  5J39 A;  2KRO A;  4BD3 A;  1QP2 A;  2KGT A;  2CUB A;  3REA B;  3G71 Q;  5GAN g;  1ZHI A;  2KDS A;  3CBM A;  2MCN A;  3CCV Q;  1K0X A;  3H9N A;  4P3P A;  1USY C;  2J3M A;  2MIO A;  3M9Q A;  2F1L A;  3RR6 A;  2FRY A;  2DAQ A;  3I5R A;  4L6V 5;  4P73 C;  4PJO C;  5HKC A;  2ENM A;  4V2S A;  4C5I A;  2BE9 B;  3SB2 A;  1Z7M A;  1Y57 A;  4CH3 A;  1PKS A;  3OYA A;  3HRK A;  5HK0 A;  4FYX B;  3NTK A;  3MQZ A;  3IQL A;  5CKH A;  1VQL T;  4AFQ C;  2A3L A;  3GLX A;  3RDV A;  1WPY A;  3A74 A;  3EG9 B;  1XJW B;  2CZ0 B;  2X4W A;  3V7C A;  3VYH B;  1IGQ A;  2HL3 A;  2E3I A;  1UFF A;  1C1A A;  1UGV A;  4FL6 A;  5LJ5 d;  2CJB A;  4H2Y A;  4H02 A;  4BDY A;  2K5L A;  4A4H A;  2C06 A;  4ME7 A;  1RAH B;  4EO4 A;  2CP0 A;  2O9V A;  2DXU A;  1CKB A;  4OMN A;  1Z7N A;  4HVC A;  3EFS A;  2I4N A;  3L4G B;  4C0Z A;  4JUV A;  1RL2 A;  4RTT A;  1X01 A;  1M3C A;  2KK4 A;  4J5Y A;  1ZLM A;  4WJ3 M;  4XTX A;  3CC2 A;  4ANJ A;  4C0F A;  2RQW A;  3CCV A;  2QQS A;  2RO0 A;  2FG0 A;  4MML A;  5I2M A;  3L4G A;  3FRN A;  1YBY A;  4OMF B;  2O01 E;  3REX A;  4C92 D;  5LJ5 j;  5KYX B;  1VIF A;  4CC7 A;  2AIR B;  4E7S A;  2AT1 B;  3CC4 T;  1M1G A;  4CC3 A;  3MHX A;  1AWX A;  1WI7 A;  2RA2 A;  2YUQ A;  3HP9 A;  4FT4 A;  2O9S A;  2MWO A;  2XDP A;  1I0C A;  4BE0 A;  4PLL A;  3OYH A;  4H2W A;  3OD1 A;  3TUP A;  2O4X A;  3EG2 A;  4Z8A A;  1X6G A;  1MNE A;  2D1X A;  3EG3 A;  2GBQ A;  1ADY A;  3NEL A;  3L2Z A;  2MPX C;  3QZ9 B;  5LJ3 e;  1UGP B;  3H41 A;  2GTJ A;  1X43 A;  1EIY A;  2NYS A;  2E64 A;  3OYL A;  3CCE Q;  2X51 A;  2HBP A;  1WLP B;  4M78 E;  2RI5 A;  4Q6G A;  3A8O B;  1D3B B;  1MGQ A;  2ZPE B;  1AZE A;  2KY9 A;  3RMQ A;  3OS2 A;  1Q82 R;  4HXJ A;  3CCJ T;  1G5H A;  3M57 A;  1QLY A;  2J6F A;  1SER A;  2NUP A;  1LNX A;  2CYZ B;  4M77 D;  4M75 C;  1D1C A;  3OS5 A;  3QYH B;  2YRC A;  2EL9 A;  2K9G A;  2ESW A;  3OMG A;  4L5G A;  2ZPH B;  2E6N A;  1JJC B;  1NJ5 A;  4PJO F;  5GAN 3;  3CCS T;  2GCX A;  2A0F B;  1NPR A;  1YIJ T;  1VQN A;  3HRT A;  4ZGD B;  3HY0 A;  5KYW A;  3OYF A;  3MP6 A;  2I4M A;  2RM4 A;  2QHV A;  2LT4 A;  5GAN 4;  4CH6 A;  2MWP A;  3LGF A;  1UEB A;  4Y92 A;  1NEB A;  3JB9 H;  1FMK A;  2DYB A;  4DPG A;  1ZUU A;  3OQ5 A;  2J3L A;  4UC4 A;  2DRM A;  2ZXF A;  3JB9 I;  1EQR A;  3VQV A;  2ATC B;  5ECA A;  2CP7 A;  4KUI A;  2K57 A;  1YGB A;  2D9T A;  5L8R E;  2ZAE A;  4YPF A;  1M5Q 1;  2PUO B;  2GF7 A;  2ZT7 A;  2QEX A;  5FRO A;  2A36 A;  4JJN K;  2A7Y A;  2L3P A;  2KXC A;  3EG1 A;  2ZT5 A;  3UT1 A;  3CME Q;  2FHD A;  1SRY A;  1GRI A;  3CCE A;  2O88 A;  2ZTG A;  1JBM A;  3OYE A;  4LDX A;  1ASY A;  4L59 A;  3CQT A;  4PLI A;  1VQM A;  2X9H A;  2G3R A;  3M0R A;  2XDD A;  1Q82 C;  1SG5 A;  2E70 A;  3UAT A;  4PJO A;  3CCM Q;  4LDY A;  3QO5 A;  1Y7X A;  5A2Q E;  3MF1 A;  1YIJ Q;  2MYS A;  3CME T;  1VUB A;  1UHC A;  2L3Q A;  2JS2 A;  3IKL A;  1W2B P;  2DU5 A;  1YJN T;  3X26 B;  3QII A;  4JRQ A;  2QK0 A;  4JJD A;  2EW3 A;  1DJ7 B;  2Y4Y A;  1A0N B;  2OTL Q;  4R55 A;  2D0Q B;  3A8H B;  5KYN A;  1BIA A;  2E5Q A;  2QA4 Q;  3FEO A;  1RLP C;  3WQZ A;  2X4Y A;  1QVG S;  1RIQ A;  3MP1 A;  3CCU T;  2KT1 A;  2RJD A;  4E7K A;  3HRS A;  3TEH B;  2DD5 A;  5KE2 A;  4YRT A;  11AS A;  4E7L A;  2QHU A;  5F5W A;  2G6F X;  4DQ2 A;  1U3O A;  3KXT A;  3GNF B;  5GJV B;  3RKX A;  2YRV A;  1QKX A;  4KRT A;  4HCC A;  4B9W A;  3QTC A;  3MO8 A;  4FCY A;  1KD1 U;  3S6W A;  4C8Q C;  3CC4 Q;  1YFT A;  4HKE A;  1VQZ A;  2L0A A;  3SWN B;  4A54 A;  3P8H A;  2CT3 A;  2F2W A;  3OSV A;  3A32 A;  2RQV A;  2P0K A;  2RI2 A;  3RNJ A;  3L2R A;  2OI3 A;  2X3X D;  3ASK A;  2OJ2 A;  4M77 A;  1KQ2 A;  1TUD A;  1N27 A;  1Y07 A;  1AVZ C;  1RAI B;  2J06 A;  4PKC C;  3SWN A;  1Q81 C;  3FIF A;  3A8G B;  1K9A A;  4OB3 B;  4BUG A;  3A8L B;  3M54 A;  2A08 A;  2EYW A;  4BAC A;  2K4Y A;  1YCS B;  4CRI A;  1YHQ A;  4O2D A;  3QO3 A;  4P75 C;  2JNG A;  2PTK A;  2W10 A;  1GL5 A;  3U23 A;  4BI3 A;  3ME9 A;  2DD4 A;  2HKQ B;  3QDF A;  4E51 A;  2VVK A;  2VXF A;  2FZK B;  2V8I A;  1KD1 C;  2VGN A;  3GP8 A;  2DRK A;  4YRM A;  1BCM A;  4FT2 A;  2AMC B;  4P72 A;  4QKU A;  3JCM W;  3R07 A;  3CD6 A;  1X75 C;  4ZN1 A;  2QTV A;  2JMA A;  3HXX A;  3E1S A;  3GPL A;  4CH5 A;  2ZIM A;  4QQ6 A;  3OW2 P;  3QG1 A;  2GGR A;  4XU1 A;  4R0K A;  3MCA B;  1Q81 U;  2NLU A;  4JJC A;  1ARK A;  1NYF A;  1YCY A;  2RHU A;  2L2P A;  4LXC A;  4E6R A;  1TU0 B;  3OYK A;  1JJ2 S;  4LVL A;  2ODR C;  5GAN j;  4C0D B;  1G5V A;  1OI1 A;  3TSW A;  1YWP A;  2RHZ A;  2VGM A;  1JEG A;  5GMK e;  2RJC A;  1YIT Q;  1BI2 A;  1U1T A;  3LSQ A;  4HVU A;  2I2L A;  2D8H A;  2QHS A;  1S1N A;  4C92 E;  2DBM A;  4EMK C;  5KYY A;  4N4I A;  2K2M A;  1YWO A;  2RH2 A;  4KR3 A;  4K86 A;  3CCJ Q;  4N4H A;  1IO6 A;  3IG2 A;  3M55 A;  1M30 A;  3N5B B;  2ED1 A;  4HWP A;  4IUP A;  1UTI A;  1TH7 A;  2GNC A;  2CUD A;  3JCM P;  3TEG A;  1U8R A;  5HK3 A;  1NYQ A;  2VUB A;  2RF0 A;  3CCR Q;  4FW2 A;  3EHR A;  1E1O A;  1Q81 R;  3H6Z A;  4YDQ A;  3CC2 Q;  3VQY A;  3P8B B;  3L1A A;  4H2X B;  2RNA A;  4EMK B;  2FZG B;  3MEU A;  4AFU C;  1IZ6 A;  4E7I A;  2EKO A;  4PFO A;  2RHX A;  1NJ2 A;  2J05 A;  2LRQ A;  4XTV A;  2BKD N;  3EGX B;  1K1Z A;  5CQY A;  4BE2 A;  3LC0 A;  2M0O A;  2E1H A;  1SPK A;  2AKL A;  1BBW A;  5M9O A;  2QQR A;  2DL7 A;  3LW5 E;  3M4Y A;  1CSK A;  3LH5 A;  5A0G A;  3QJY A;  4AH6 A;  1UG1 A;  3VV0 A;  3OYC A;  5GAN 2;  1J3T A;  2KRN A;  3OY9 A;  4RDX A;  1WHK A;  4CS2 A;  1UJY A;  4Y91 A;  4YCU A;  2VAS A;  2DQ0 A;  3JCM b;  2RN8 A;  2I0N A;  4C92 F;  1SRL A;  4MZP A;  2G4C A;  2LQ8 A;  4YRK A;  4ZNX A;  2CP6 A;  2FB7 A;  4KUL A;  4EX5 A;  1SKU B;  4M7D E;  3JCM Q;  3HY1 A;  2D8J A;  1KQS A;  4TQD A;  1RAB B;  4QW2 A;  4Y28 E;  2EGC A;  4A4E A;  2P5I A;  3G6E T;  2MI6 A;  1TUC A;  3LH0 A;  1B76 A;  4JDS A;  1I5L A;  3O5Z A;  3EFO B;  4XTY A;  4X34 A;  3S3O A;  1X2H A;  4M77 F;  2JT4 A;  3BDL A;  1ZBJ A;  1ZSZ B;  2JTE A;  1D0Y A;  1MMD A;  3A98 A;  2LX9 A;  1HK9 A;  5D6X A;  4XU2 A;  1Q95 G;  1M90 C;  2R5A A;  1HC7 A;  2BZX A;  3CEY A;  1OPL A;  1N9S A;  1H4Q A;  1SHF A;  4HCK A;  5GAN 8;  5J3B A;  1PSF A;  2ROL A;  3CCL T;  2DIL A;  2MMP A;  5C6S A;  4LDU A;  2M16 A;  5J26 A;  3E9G A;  2OTL A;  4XTW A;  1B07 A;  5HCK A;  5KYX A;  2KE9 A;  1D1B A;  4BY6 C;  1KC8 C;  2EBP A;  1ADJ A;  1J5W A;  2PNI A;  1N9W A;  3CPW A;  4XTU A;  1AWW A;  3I56 T;  3CCU A;  4IIM A;  4M78 G;  2IVW A;  3VJP A;  1VQ4 Q;  3CXC A;  3OYG A;  3CCL Q;  2MK5 A;  2ABL A;  3G6E Q;  1WLE A;  3OSS C;  3M0P A;  2RJF A;  5FLX E;  3G1Z A;  3A1P A;  1KQS P;  3EGD B;  1M4Z A;  2Q7E A;  1UGS B;  3WXM B;  4CC4 B;  5K1X A;  3PT9 A;  2E65 A;  4PJJ A;  3EH2 A;  2O2O A;  2VWF A;  2OTJ T;  1M1K R;  3VQW A;  1B7Y B;  4YRR A;  2LT1 A;  2PU9 B;  4XAX B;  3RL6 A;  1EFW A;  3RMS A;  1B3Q A;  2CZ6 B;  4KH0 B;  2L3R A;  2LJ0 A;  3QUI A;  4RTU A;  2EPD A;  1PYS A;  3TVT A;  1HSQ A;  1ZSG A;  2YUP A;  3L2Q A;  2LX7 A;  1NYR A;  3EGX A;  1JQQ A;  1VQ5 T;  3OS0 A;  1YHQ T;  2YHT A;  1SHG A;  4M7A D;  4H2S A;  3MP8 A;  5DLO A;  3DSQ A;  5A0D A;  1VQL A;  1W2B A;  2XIC A;  3KBG A;  2ZGW A;  4J6X A;  1BB9 A;  2CH4 A;  4Z02 A;  3GIB A;  4OMQ A;  3CCS A;  1BKB A;  1VQ6 Q;  1MMA A;  1QE0 A;  2C0O A;  3TSZ A;  3VUZ A;  4AT1 B;  3V7S A;  1BCO A;  4RMF A;  3RBB B;  4YTL A;  3DLM A;  2AZV A;  4TQF A;  5DM7 R;  1M3A A;  3JCM e;  3GBQ A;  2HL5 C;  4ELY C;  2QG9 B;  2Y90 A;  2C8M A;  2WSF E;  5AT1 B;  5GAM j;  2L89 A;  3CC2 T;  3HXY A;  2CKK A;  1V1C A;  3E19 A;  4PFP A;  2A28 A;  2YLC A;  2I4O A;  2Q5I A;  1OEB A;  1HTT A;  4M7D A;  2DL5 A;  5KYU B;  2QEX T;  1MUZ A;  1FYN A;  3JRZ A;  1RAF B;  3GF5 A;  2QTX A;  5GAM e;  1M27 C;  4JZ4 A;  3HFN A;  4M78 A;  4RTV A;  3JCM X;  2ZCE A;  2QA4 T;  2JXB A;  2XHC A;  1Y96 A;  3VQX A;  1PHT A;  4YRQ A;  2ZPB B;  1NBE B;  3ERR A;  2ARU A;  2EGA A;  1W66 A;  2EJF A;  2X3W D;  1BBZ A;  3BE3 A;  2NUT A;  1CKA A;  2RQT A;  1BI3 A;  4OB1 B;  2HQX A;  3EFO A;  3PVQ A;  4LVM A;  2ZZD A;  4J83 A;  5FU7 C;  4IKF A;  4G85 A;  3X20 B;  4ZGJ B;  2DVE A;  3QJ6 A;  1KQS S;  1VQL Q;  2RB6 A;  5C51 B;  4HA8 A;  2E3C A;  1B7T A;  4D8D A;  4WCI A;  2LCC A;  1H3Z A;  4JS4 A;  1FYF A;  2KMT A;  2AK5 A;  2BZ8 A;  4P74 C;  4WI1 A;  4NCX A;  1S72 Q;  1G3T A;  4J7I A;  3G7Z A;  3NHN A;  1VQ4 A;  1OX8 A;  2RMO A;  2KR3 A;  1C6V X;  2WAC A;  4BE1 A;  2Z0W A;  1PNJ A;  3BY7 A;  3JAM E;  3L2U A;  4A4G A;  1MMN A;  1UGQ B;  3FLG A;  4M7D F;  2SEM A;  5IHN A;  2J6O A;  3OYN A;  4PK4 A;  3CMQ A;  2LJ1 A;  5GAO p;  2MAM A;  2GFU A;  4M75 E;  2ZIN A;  1GFD A;  1E1T A;  3UFG A;  4LVJ A;  4F16 A;  1G8X A;  1ZSZ C;  3FDR A;  2RHS B;  2ALY A;  3X24 B;  3CBO A;  3ZFJ A;  2COY A;  1N5Z A;  4JRP A;  4RKU E;  2RQR A;  2QI2 A;  1EIY B;  3QO8 A;  1PD1 A;  1WJQ A;  3FJ5 A;  1EIF A;  3UPU A;  1VQP A;  9ATC B;  1G3Y A;  1Y96 B;  1VYU A;  1D09 B;  4PFZ A;  1OPK A;  1PKT A;  2DMO A;  1VA7 A;  2WSE E;  1OU9 A;  4M7A A;  4R56 A;  1MV3 A;  2R57 A;  2GFA A;  1Q86 R;  1UJ0 A;  4HWR A;  2XTI A;  3UDC A;  5KYW B;  1KK7 A;  4LVI A;  1O9S A;  3OS1 A;  4PL6 A;  2V1R A;  2DZ9 A;  2LQN A;  2DJZ A;  2YWW A;  4JPB W;  2VXE A;  3CCE T;  5IAY A;  2FPD A;  12AS A;  1R77 A;  3VS1 A;  4PJO B;  2CRE A;  2HBW A;  1GFC A;  1ZUY A;  1WJR A;  3VYG A;  4KR2 A;  4DEX A;  4M78 D;  3NTI A;  1HJD A;  1OV3 A;  2DFU A;  2JUF A;  1SF9 A;  4C92 A;  2EQK A;  3L2V A;  3HFZ A;  2H8H A;  2XG8 D;  1S72 A;  3KFU A;  4M75 B;  1E6G A;  3KFV A;  3QBY A;  1OYX A;  1WHH A;  3I56 A;  2DQ3 A;  4Q5W A;  3JV3 A;  1WHL A;  5I11 A;  4RG2 A;  1TUG B;  3PCO A;  1H4V B;  3C4S A;  2ART A;  2HQH A;  2IIM A;  2E10 A;  5EG2 A;  3E2U A;  1YHQ Q;  1Q7Y R;  1K8A R;  1PCX A;  5GAO l;  4OLF A;  3OYY A;  2L8D A;  5ELO A;  1WHJ A;  5CKE A;  1X2Q A;  1VQ9 A;  3M0T A;  3CC7 Q;  1RAC B;  2RHS A;  3M4P A;  2ALY B;  5FU6 B;  4OMM A;  2XID A;  3GNG A;  4KGV B;  4M75 G;  2DK3 A;  4TVA A;  2E6Z A;  3I55 A;  3OB9 A;  2LQK A;  2HEQ A;  5IN1 A;  4JRK A;  1GBQ A;  4K87 A;  2J6K A;  5KYU A;  3VRZ A;  3TU4 K;  3BDU A;  1N8R U;  1GCQ C;  1VQM Q;  3CPF A;  4HVW A;  3E9H A;  3S3N A;  1ZX6 A;  1JJC A;  1JO8 A;  1H64 1;  1Q7Y C;  1K8A C;  1I8F A;  3JCM f;  1JRI A;  1LVK A;  4M7D C;  1JXM A;  1JJ2 A;  4QVC A;  2HSP A;  2DTI A;  4DOW A;  4P71 A;  2H3E B;  1T3S A;  4OB2 B;  1WU7 A;  4DBR A;  3S3M A;  5GAO m;  4M7A B;  4E7H A;  2EYY A;  3HHT B;  4P75 A;  4XEO A;  4UP8 A;  3J81 E;  4F7U F;  8ATC B;  1B70 B;  4BWA A;  5FRM A;  3UGQ A;  1ZA2 B;  3VS2 A;  2DLP A;  3P8T A;  5GAN h;  2LZ6 B;  3I55 Q;  3EGU A;  2M1H A;  3DKM A;  1U06 A;  3G1J A;  4J6W A;  4J9C A;  2QEX Q;  4J7F A;  1I4K 1;  3HRI A;  2GQI A;  3QPH A;  4WF2 A;  2QGG A;  1WXB A;  5CKB A;  4DBQ A;  2XI9 A;  1D0X A;  1Z9Q A;  2HMA A;  1K0S A;  3M56 A;  2QDL A;  2X35 A;  3G4S T;  3HFZ B;  3UWN A;  4C92 G;  1M2O A;  1YNZ A;  3ICA A;  2ARS A;  5I2S A;  3MEY A;  4X5O A;  3CBP A;  1Y0M A;  3WVE B;  1X27 A;  3P8D A;  3M4Q A;  2JOY A;  2YLB A;  2XGT A;  3REB B;  5IHK A;  2XD0 A;  3ZEH A;  1YB3 A;  2HZY A;  2PVG B;  1YI2 Q;  2CDT A;  2F2V A;  1VQP Q;  1ASZ A;  2D0N A;  3W3S A;  3JB9 G;  5KNN A;  3DLL A;  1QVF S;  3CMA T;  2ZCF B;  2PUK B;  1WXU A;  1WDX A;  1OUL A;  4E7J A;  4XEM A;  4RQE A;  2YXY A;  4J15 A;  1YJ9 Q;  3JB9 F;  1KHI A;  2RK2 A;  3E9F A;  4FIB A;  4FYW B;  1D1A A;  1OU8 A;  1VQO A;  1MMG A;  1X2G A;  3CCL A;  2FYK A;  5GAN 5;  4LUD A;  4TVW A;  4NOY A;  2DEU A;  3CCQ A;  1G3W A;  2Q7H A;  3M53 A;  4M77 G;  4F7U B;  2QHT A;  2CSQ A;  1N9R A;  1FMW A;  1X55 A;  1QVG P;  1W70 A;  5GMK m;  1WZO A;  1BBU A;  2YSQ A;  1NYG A;  4ZTJ A;  2DL3 A;  3ULR B;  4X9C A;  2DL4 A;  2QQB A;  1R0B G;  2PVD B;  3HTR A;  4M77 E;  1QMC A;  3SD4 A;  3MET A;  4X9D A;  5D7U A;  2EJG A;  2HDA A;  1O75 A;  2JTF A;  2P4T A;  1X6B A;  3M0S A;  1IGU A;  1BU1 A;  5LL6 S;  3TCJ A;  3UA7 A;  2LNH B;  4NS5 A;  2JMC A;  2MF2 A;  1N6A A;  1MND A;  2DE0 X;  2CGH A;  4YP0 A;  4JS5 A;  4QQD A;  1EX4 A;  3CCR T;  2K5F A;  4FU6 A;  4YRO A;  2DVJ A;  2J7I A;  5GJW B;  3VS4 A;  1Z9Z A;  5HY6 A;  1D0Z A;  5GAN f;  1VQ7 A;  4RTW A;  1VQO Q;  4D8K A;  2DXT A;  2K79 A;  1F1B B;  1U5S A;  4O6J A;  1M1K C;  1ZQ1 A;  1YJW A;  2EYZ A;  3FJP A;  3HFV A;  2O31 A;  5GAO n;  4P72 C;  3M5A A;  1VOM A;  1BIB A;  2DDZ A;  2V8K A;  2EVR A;  3I35 A;  1VQ8 A;  1WHM A;  4J9D A;  1QP3 A;  5C0M A;  3PCO B;  2IG0 A;  5CK9 A;  2YUO A;  3VS5 A;  2JVV A;  1FMV A;  4KGZ B;  1QVF A;  2ECZ A;  3EG0 A;  1G2B A;  3HPW A;  4C92 B;  3R6N A;  3PMT A;  4YCV A;  1G51 A;  1WHG A;  4M78 F;  1B7Y A;  3NGP A;  2KQW A;  1K9M R;  2EQM A;  3THK A;  2DO3 A;  3V7R A;  4BDZ A;  1AEY A;  4M77 C;  4DBF A;  4P73 A;  2Y4X A;  4M75 D;  4C8Q B;  3LLR A;  3CCM A;  4P71 C;  3HXZ A;  1YIJ A;  3EG9 A;  4IUT A;  4AFS C;  4C5H A;  1W1F A;  1X2K A;  1VQ9 T;  1VQN T;  1KMN A;  1YJW Q;  5K1P A;  1HXD A;  3RES A;  2EQU A;  3SHW A;  2P0Q A;  2M02 A;  2AZS A;  4HT9 A;  2M9U A;  3I55 T;  1XTD A;  1SSH A;  1H3H A;  4TTV A;  2ZNI A;  3JCM h;  3M4G A;  4M77 B;  3T9N A;  4OGE A;  1VQK Q;  2RK1 A;  2B86 A;  1TS9 A;  1AWJ A;  5GMK l;  3EFR A;  3VRY A;  1K9M C;  3CD6 Q;  3A7U A;  3CXC S;  1YJW T;  1IB8 A;  3UH0 A;  2GQV A;  1Q82 U;  2P4R A;  1ZA1 B;  1E24 A;  4Z88 A;  1WYX A;  1KIK A;  5LJ3 j;  1GBR A;  1BI1 A;  3G71 A;  3LWI A;  4IUR A;  3M0Q A;  2JZ2 A;  2ROT A;  4C0G A;  2A37 A;  5GAM h;  4C8Q A;  4F7U E;  3L42 A;  5IT9 E;  1RAE B;  3CD6 T;  1M1K U;  3VS3 A;  5CO7 A;  1M1F A;  2LC4 A;  4K11 A;  4LDV A;  4YRL A;  3EH1 A;  4F7U G;  2COZ A;  4B6M A;  3NET A;  2K2V A;  1VQ9 Q;  2KRM A;  3FC3 A;  2M51 A;  1X6O A;  1X54 A;  4M7D B;  5LJ3 d;  2VB6 A;  2P0P A;  5GMK j;  3CMA Q;  2R58 A;  1WYD A;  4ESR A;  1K76 A;  1H4S A;  2RPN A;  1WJS A;  2CP3 A;  5KYY B;  4RG8 A;  4AG2 C;  2ED0 A;  4G84 A;  5DY9 A;  4N4G A;  4WJ4 A;  5GAN 6;  5CAI A;  3A7R A;  4H2T A;  2DXC A;  1HD3 A;  1OX9 A;  2OTJ A;  2LNV A;  4FSX A;  3P8Y A;  3OYB A;  4J9F A;  4LD9 K;  2LCL A;  4XTZ A;  1W6X A;  4RMO A;  2EGE A;  4RCC A;  4P3O A;  3VS0 A;  4TVA B;  5E3I A;  2XKO C;  1VQM T;  2D6F A;  3OYJ A;  2M0Y A;  4XQ3 A;  3LYI A;  2RI3 A;  3RER A;  2FPF A;  4F14 A;  3C95 A;  1GCQ A;  3QNE A;  4KQE A;  4JLI A;  2NS6 A;  4J8O A;  1MHN A;  2H3J A;  4LNP A;  5FU7 B;  2ZT6 A;  1RAA B;  1B70 A;  2CP5 A;  1NJ8 A;  3CC7 T;  1G5I A;  2L3S A;  2DA9 A;  2V8J A;  5IXB A;  1VQO T;  1K73 R;  4WTO B;  1TOV A;  1I1J A;  2O4X B;  2VC8 A;  5FW9 A;  1C0M A;  2BTT A;  5GAO r;  3MJX A;  2FVU A;  5I22 A;  1XQH A;  3AHU A;  1N8R C;  1KC8 U;  2CIM A;  1XOV A;  5D6W A;  3HFO A;  1WXT A;  3C0C A;  1M8V A;  2BZY A;  3LX7 A;  2CJ9 A;  2A8E A;  1TSF A;  1X69 A;  1ZBX A;  3EGD A;  2JW4 A;  3H8Z A;  3OW2 S;  3V8J A;  3NPF A;  3O8V A;  4EDU A;  2DF6 A;  1PRL C;  4C8Q D;  2MOX A;  4YRS A;  1BI0 A;  5C52 B;  3MKD A;  5LJ5 e;  4RCB A;  5GAN d;  1QWF A;  3PVL A;  3OYI A;  4PHC A;  2E41 A;  1M2V A;  1QW1 A;  4MZM A;  5FU6 C;  3F70 A;  5L23 A;  3P8V A;  3IAL A;  1QVP A;  1RAG B;  2DBK A;  2PQW A;  3A5Z B;  4N0A A;  1PC0 A;  4BI4 A;  4OMO A;  2ZZG A;  2ODR D;  1WQ7 A;  2CSI A;  1I5O B;  3ZBD A;  3GOX A;  3NEM A;  4YRC A;  5FWC A;  4BI8 B;  2RHQ B;  4ZN3 A;  1E6H A;  2YT6 A;  4TVR A;  3J7A F;  4HWS A;  2L5Q A;  1VQ8 T;  2PZ1 A;  4TVY A;  4FW1 A;  1E22 A;  3I9Q A;  2QXF A;  3BJU A;  2VV5 A;  3TEE A;  4L87 A;  4M7D G;  2JJ9 A;  2K6D A;  3SFM A;  1VIE A;  4AFZ C;  1LJO A;  1AT1 B;  3INZ A;  4EMG A;  1Q7Y U;  1K8A U;  4C8Q F;  2F2X A;  2VYT A;  3VU3 C;  3I56 Q;  4ELZ C;  5EC7 A;  3QDR B;  3V8L A;  4DA4 A;  5GAM d;  3ZL7 C;  4B9X A;  4PJN A;  3LWH A;  2LJ3 A;  2RHY A;  4YCW A;  2K3B A;  2ZNJ A;  3HL8 A;  4YRN A;  2B8A A;  1T0H A;  1M8M A;  3E9I A;  4HVV A;  3I7F A;  4HT4 A;  1B34 B;  4NL3 A;  4UP7 A;  1YJN A;  3PFS A;  3JCM J;  2CH4 W;  2KYM A;  1IHV A;  2V26 A;  1YIT A;  3V8K A;  3JSC A;  1NG2 A;  1YP5 A;  4FSS A;  3BFM A;  5I21 A;  3QKJ A;  3H0H A;  1YJ9 T;  2XK0 A;  2HD0 A;  3REU A;  4JLG A;  2AKW A;  4AMC A;  1AWO A;  3WVD B;  4M7D D;  1D3B A;  4YRP A;  2PMF A;  1S72 T;  4P74 A;  1VQ7 Q;  2E5K A;  2RQU A;  3OMC A;  4EMK A;  1W2B S;  1K9M U;  3QHS A;  5IXF A;  1PM3 A;  2OX7 A;  1EVK A;  2YRD A;  3QWX X;  4MZT A;  1EFN A;  2DER A;  3A31 A;  1VYT A;  1H4T A;  3HXW A;  1VQ8 Q;  4J9G A;  4FYY B;  5GAN 7;  1TTH B;  2C0I A;  4II1 A;  1IRE B;  2ZZE A;  3RUX A;  1NEG A;  4E47 A;  1RLQ C;  4LUE A;  3VKI A;  3G6E A;  1EZZ B;  2JM9 A;  3EHQ A;  2ZR3 A;  2EYX A;  4K88 A;  1IXD A;  1UUE A;  4F04 B;  3G71 T;  3QZ5 B;  5ELN A;  1NNH A;  2RD1 A;  3HKS A;  3RAC A;  3CCV T;  3PIO A;  2E12 A;  4TWA A;  4ZTU B;  2DNU A;  1OZ3 A;  1NPP A;  2BIV A;  4ZTF A;  2NUP B;  4JJB A;  4PJO D;  2QGF B;  4M7A G;  2C0T A;  4CC2 A;  1YFR A;  2W0Z A;  4A53 A;  3CC4 A;  2CJA A;  3A8M B;  1VYV A;  1KMM A;  3RIR A;  1K73 U;  2X4J A;  2HSE B;  2QAZ A;  2Q5H A;  1YIT T;  4IUQ A;  2XMF A;  1VQ6 T;  3H0F A;  2I4L A;  2HQE A;  2AHJ B;  1WA7 A;  2YUN A;  2KSS A;  4A4K A;  2LQW A;  1U1S A;  1YFN A;  4RQF A;  3PTA A;  1Q86 C;  4EIK A;  2LMJ A;  1IRX A;  3AT1 B;  1TWB A;  1KSW A;  1ABO A;  3MEV A;  1X56 A;  2RJE A;  3OBY A;  4KGX B;  2QA4 A;  2KBT A;  1WIE A;  2XU8 A;  2RHQ A;  5AYF A;  4CI0 C;  3JCM d;  4YRJ A;  1WNL A;  3G4S A;  1RI0 A;  2X4X A;  2K3X A;  4E7Z A;  5CIU A;  2VKN A;  3JB9 D;  2F69 A;  4XK8 E;  3URG A;  1OZ2 A;  4YRG A;  4C92 C;  1YI2 A;  4LVK A;  4M4Z A;  1JB0 E;  1W4S A;  5LJ3 g;  2BE7 D;  3QO7 A;  2P0L A;  1QQJ A;  1NJ6 A;  2DTO A;  4C5E A;  2ZPF B;  1LYL A;  2K7A A;  4M75 A;  3PNW C;  3QSU A;  3HTZ A;  2EQJ A;  1Q86 U;  2KRS A;  1G83 A;  1AOJ A;  3OW2 A;  3Q1J A;  3CMA A;  4LN2 A;  4LD6 A;  2KEA A;  4J9B A;  2QYZ A;  5LJ5 f;  1YJN Q;  1VQK T;  3CCU Q;  1QVG A;  5CKF A;  4JZ3 A;  3TRE A;  4M7A C;  6AT1 B;  1OOT A;  2FZC B;  2C7I A;  5GAN e;  1UE9 A;  2EQI A;  4M7A E;  1UGR B;  4VUB A;  3H0I A;  1N8R R;  2DIG A;  2EFI A;  4OVA A;  2E3H A;  3CPW P;  5HGQ A;  5LJ3 h;  1QWE A;  1SSF A;  3C94 A;  3M59 A;  1ZSZ A;  2PME A;  2CZ1 B;  4H2V A;  3RF1 A;  1YN8 A;  1LCK A;  1I81 A;  4PNO A;  3QWY A;  1QF6 A;  4QT7 A;  2LVM A;  5KH6 A;  4Q15 A;  3A5Z A;  2DM1 A;  1WGS A;  4CH4 A;  4HWT A;  4ZTZ B;  3NTH A;  5FWB A;  4HCZ A;  1NJI U;  1HYO A;  4X1V A;  3R6O A;  2QAS A;  3HXU A;  4AG1 C;  1RUW A;  2K3Y A;  4QVD A;  1GXI E;  3G4S Q;  2KYB A;  3UGT A;  1VQ5 A;  1BK2 A;  3HXV A;  1AHJ B;  3D7S B;  4O5V A;  2EWN A;  3J80 E;  1M3B A;  4GLK A;  2EAY A;  7AT1 B;  3L2W A;  2KAF A;  4QQG A;  5GAM f;  2Q7G A;  1VQ7 T;  1QCO A;  3PGG A;  3CCJ A;  4KBM B;  4DEY A;  2LCS A;  5CVI A;  3CCQ T;  1PSE A;  4GY5 A;  3SDZ A;  2P84 A;  1XNI A;  3QXE B;  4LNS A;  3MF2 A;  4E2F B;  1VQK A;  1E7O A;  1FX7 A;  1PRM C;  2KVQ G;  3VS6 A;  1FXX A;  4PJM A;  3CPW S;  8AT1 B;  2RHI A;  3IKM B;  3DB4 A;  4LDW A;  2COW A;  2AKK A;  1MV0 B;  1AD5 A;  1ZUK A;  4OB0 B;  4Z89 A;  4CS3 A;  3X25 B;  3M0U A;  2R5M A;  2JN0 A;  4ZGE B;  2K5I A;  4UPA A;  4IUU A;  1AZG B;  2SRC A;  1EVL A;  4YRI A;  1EOV A;  4RUG A;  4P5N A;  3A7A A;  4RTY A;  3RKY A;  4ZIB A;  2FPE A;  2WSC E;  1KOG A;  1NLP C;  1NJ1 A;  5DLQ E;  4BY6 B;  2CT4 A;  4IUV A;  3MPU B;  3RKW A;  2NUT B;  2ZPG B;  1V29 B;  2LTO A;  4JRI A;  1I07 A;  3FB9 A;  3SWN C;  2KT8 A;  2DKG A;  2F5T X;  1PD0 A;  3UF4 A;  2DX1 A;  3CCQ Q;  1NM7 A;  5C53 B;  4HWO A;  3C12 A;  3CC7 A;  4RTZ A;  1G3S A;  3I5S A;  4OML A;  3SEM A;  4FYV B;  4QVZ A;  1KJW A;  3OBW A;  1M9S A;  1KC8 R;  2EJ9 A;  4ATO A;  1R0C B;  5CKD A;  1ACM B;  3QYG B;  2EKH A;  3X28 B;  1BYM A;  4RTX A;  1IHW A;  5KE3 A;  2ZIO A;  1UEC A;  3CME A;  3VS7 A;  2AMC A;  2KNB B;  4KUD K;  3JCM g;  4BB7 A;  2DYI A;  3BW1 A;  1M2V B;  2JM8 A;  1USY A;  5CCA A;  3LSS A;  5GMK i;  2DET A;  4C5G A;  1SET A;  1LOJ A;  2E4H A;  3EAE A;  1PYS B;  2V1Q A;  4MMK A;  4OF1 A;  2QQ9 A;  1B34 A;  2DJQ A;  5D6Y A;  1RI9 A;  1SEM A;  2CZ7 B;  1L0W A;  2FEI A;  2EIF A;  4M75 F;  1T0J A;  1UB4 A;  1LPL A;  4DOV A;  3CXC P;  2KXD A;  1YFS A;  1UDL A;  4XU3 A;  1VQP T;  1NJI C;  1R8O B;  3NMZ C;  4KH1 B;  4YRE A;  5GAM g;  4FM4 B;  2ZPI B;  3JCM V;  1PG5 B;  2KI7 A;  3JB9 J;  1NLO C;  3NEN A;  1K73 C;  5IHI A;  5A0L A;  4CS4 A;  2JS0 A;  3OYM A;  3VUB A;  1YI2 T;  2QDY B;  1QKW A;  3ER0 A;  3OA6 A;  5FRN A;  2ZT8 A;  3CCR A;  5LJ5 h;  2PVO B;  1JXO A;  1SES A;  4M78 C;  1ABQ A;  2FO0 A;  4P3N A;  4EMH A;  4C8Q E;  4H2X A;  4PG3 A;  1SRM A;  3HSB A;  1H8K A;  2DEQ A; 
#chains in the Genus database with same CATH homology
 4HCB A;  2AKW B;  4OGC A;  1WQW A;  4XU0 A;  4KT0 E;  5LJ3 f;  4UP9 A;  3JCM c;  2DTH A;  1ATI A;  1NE8 A;  5GMK h;  3VBB A;  3PZC A;  4YYE A;  4N0A C;  1Y71 A;  2BUD A;  4EPC A;  5GAO q;  2OTL T;  1NZ9 A;  2DPP B;  1YJ9 A;  3OYD A;  3MEA A;  2QQA A;  3TEH A;  2OAU A;  5LJ5 g;  4A4F A;  4C8Q G;  1VQ4 T;  2DU7 A;  4C0D C;  1C0A A;  2CS7 A;  4H2U A;  1GGM A;  5CQX A;  5KCO A;  4BW9 A;  4PJO G;  4F7U A;  1KQ1 A;  4D6W A;  2DXB A;  2XDB A;  2IY5 B;  1P92 A;  1KG1 A;  2EYQ A;  2HNI A;  4MDX A;  5KCH A;  5CR2 A;  2IY5 A;  2LDM A;  2E5A A;  4M7A F;  3NFC A;  3PMI A;  3KUF A;  2ZR2 A;  4J6Y A;  4OP0 A;  3PIP A;  2HAX A;  3RGL A;  2DIQ A;  3M58 A;  4YRF A;  1FWZ A;  4MDW A;  4HT8 A;  4PJO E;  2DZC A;  2FL7 A;  1M90 U;  1B8A A;  3A5Y A;  3MEW A;  2F5K A;  3DB3 A;  3HRU A;  3CCM T;  2JTM A;  4NL2 A;  1VQ6 A;  1KHC A;  2ZZF A;  4M78 B;  3LGL A;  1IL2 A;  5J39 A;  4BD3 A;  1QP2 A;  5GAN g;  1ZHI A;  2KDS A;  3CBM A;  4P3P A;  1USY C;  2J3M A;  3M9Q A;  4L6V 5;  2DAQ A;  4P73 C;  4PJO C;  5HKC A;  4V2S A;  4C5I A;  3SB2 A;  1Z7M A;  4CH3 A;  3OYA A;  3HRK A;  5HK0 A;  3NTK A;  3MQZ A;  5CKH A;  1VQL T;  2A3L A;  3GLX A;  1WPY A;  3A74 A;  3V7C A;  2CZ0 B;  2X4W A;  3VYH B;  4FL6 A;  5LJ5 d;  2CJB A;  4H2Y A;  4H02 A;  4BDY A;  2K5L A;  4A4H A;  2C06 A;  4ME7 A;  4EO4 A;  2DXU A;  4HVC A;  1Z7N A;  3EFS A;  2I4N A;  3L4G B;  4C0Z A;  4JUV A;  1RL2 A;  1X01 A;  4J5Y A;  2KK4 A;  4WJ3 M;  4XTX A;  3CC2 A;  4C0F A;  3L4G A;  3CCV A;  2QQS A;  2RO0 A;  5I2M A;  4MML A;  3FRN A;  1YBY A;  4OMF B;  2O01 E;  3REX A;  4C92 D;  5LJ5 j;  1VIF A;  3CC4 T;  1M1G A;  3MHX A;  2RA2 A;  4FT4 A;  3HP9 A;  2MWO A;  2XDP A;  4BE0 A;  4PLL A;  3OYH A;  4H2W A;  3OD1 A;  3TUP A;  2O4X A;  1ADY A;  3NEL A;  3L2Z A;  3QZ9 B;  5LJ3 e;  1UGP B;  1EIY A;  2E64 A;  3OYL A;  2HBP A;  4M78 E;  4Q6G A;  2RI5 A;  3A8O B;  1D3B B;  1MGQ A;  2ZPE B;  2KY9 A;  3RMQ A;  3OS2 A;  3CCJ T;  1G5H A;  3M57 A;  1SER A;  1LNX A;  2CYZ B;  4M77 D;  4M75 C;  3OS5 A;  3QYH B;  2EL9 A;  3OMG A;  4L5G A;  2ZPH B;  2E6N A;  1JJC B;  1NJ5 A;  4PJO F;  5GAN 3;  3CCS T;  2GCX A;  1NPR A;  1YIJ T;  1VQN A;  3HRT A;  4ZGD B;  3HY0 A;  3OYF A;  3MP6 A;  2I4M A;  2RM4 A;  2QHV A;  2LT4 A;  5GAN 4;  4CH6 A;  2MWP A;  3LGF A;  1UEB A;  3JB9 H;  4DPG A;  3OQ5 A;  2J3L A;  4UC4 A;  2ZXF A;  3JB9 I;  1EQR A;  3VQV A;  4KUI A;  2K57 A;  1YGB A;  2D9T A;  5L8R E;  4YPF A;  1M5Q 1;  2PUO B;  2ZT7 A;  2GF7 A;  2QEX A;  5FRO A;  4JJN K;  2A7Y A;  2ZT5 A;  3UT1 A;  2FHD A;  1SRY A;  3CCE A;  2ZTG A;  1JBM A;  3OYE A;  4LDX A;  1ASY A;  4L59 A;  4PLI A;  1VQM A;  2G3R A;  2XDD A;  1Q82 C;  2E70 A;  4PJO A;  4LDY A;  3QO5 A;  1Y7X A;  5A2Q E;  3MF1 A;  3CME T;  1VUB A;  3IKL A;  2DU5 A;  1YJN T;  3X26 B;  3QII A;  4JRQ A;  1DJ7 B;  2Y4Y A;  4R55 A;  2D0Q B;  3A8H B;  1BIA A;  2E5Q A;  3FEO A;  3WQZ A;  2X4Y A;  1QVG S;  1RIQ A;  3MP1 A;  3CCU T;  2RJD A;  4E7K A;  3HRS A;  3TEH B;  2DD5 A;  5KE2 A;  4YRT A;  11AS A;  4E7L A;  2QHU A;  5F5W A;  4DQ2 A;  3KXT A;  3GNF B;  3RKX A;  2YRV A;  4HCC A;  4B9W A;  3QTC A;  3MO8 A;  1KD1 U;  3S6W A;  4C8Q C;  1YFT A;  4HKE A;  1VQZ A;  3SWN B;  4A54 A;  3P8H A;  3OSV A;  3A32 A;  2P0K A;  2RI2 A;  3L2R A;  3ASK A;  4M77 A;  1KQ2 A;  1Y07 A;  1N27 A;  4PKC C;  3SWN A;  1Q81 C;  3FIF A;  3A8G B;  4OB3 B;  4BUG A;  3A8L B;  3M54 A;  4BAC A;  2K4Y A;  4CRI A;  1YHQ A;  4O2D A;  3QO3 A;  4P75 C;  2JNG A;  4BI3 A;  3ME9 A;  2DD4 A;  4E51 A;  2VXF A;  2V8I A;  1KD1 C;  2VGN A;  3GP8 A;  4YRM A;  4FT2 A;  2AMC B;  4P72 A;  3JCM W;  3R07 A;  3CD6 A;  1X75 C;  4ZN1 A;  3HXX A;  3E1S A;  3GPL A;  4CH5 A;  2ZIM A;  4QQ6 A;  3QG1 A;  4XU1 A;  3MCA B;  1Q81 U;  2NLU A;  1YCY A;  2RHU A;  3OYK A;  1JJ2 S;  4LVL A;  2ODR C;  5GAN j;  4C0D B;  1G5V A;  1OI1 A;  2RHZ A;  2VGM A;  5GMK e;  2RJC A;  1BI2 A;  1U1T A;  3LSQ A;  2I2L A;  2QHS A;  4C92 E;  4EMK C;  4N4I A;  2RH2 A;  4KR3 A;  4K86 A;  4N4H A;  3IG2 A;  3M55 A;  3N5B B;  4HWP A;  4IUP A;  1TH7 A;  3JCM P;  3TEG A;  1U8R A;  5HK3 A;  1NYQ A;  2VUB A;  1E1O A;  4YDQ A;  3H6Z A;  3VQY A;  3P8B B;  3L1A A;  4H2X B;  4EMK B;  3MEU A;  4E7I A;  1IZ6 A;  2EKO A;  2RHX A;  1NJ2 A;  2LRQ A;  4XTV A;  2BKD N;  5CQY A;  4BE2 A;  3LC0 A;  2M0O A;  2E1H A;  1BBW A;  5M9O A;  2QQR A;  3M4Y A;  3LW5 E;  5A0G A;  3QJY A;  4AH6 A;  3VV0 A;  3OYC A;  5GAN 2;  4RDX A;  3OY9 A;  4CS2 A;  4Y91 A;  4YCU A;  2DQ0 A;  3JCM b;  4C92 F;  4MZP A;  2G4C A;  2LQ8 A;  4YRK A;  2FB7 A;  4KUL A;  4EX5 A;  4M7D E;  3JCM Q;  3HY1 A;  1KQS A;  4TQD A;  4QW2 A;  4Y28 E;  4A4E A;  2P5I A;  3G6E T;  2MI6 A;  3LH0 A;  1B76 A;  4JDS A;  1I5L A;  4XTY A;  4X34 A;  3S3O A;  1X2H A;  4M77 F;  3BDL A;  2LX9 A;  1HK9 A;  5D6X A;  4XU2 A;  1M90 C;  2R5A A;  1HC7 A;  3CEY A;  1N9S A;  1H4Q A;  5GAN 8;  5J3B A;  3CCL T;  1PSF A;  5C6S A;  2MMP A;  2OTL A;  4LDU A;  2M16 A;  5J26 A;  3E9G A;  4XTW A;  4BY6 C;  1KC8 C;  1ADJ A;  1J5W A;  1N9W A;  3CPW A;  4XTU A;  3I56 T;  3CCU A;  4M78 G;  2IVW A;  3VJP A;  3CXC A;  3OYG A;  1WLE A;  3OSS C;  2RJF A;  5FLX E;  3G1Z A;  2Q7E A;  1M4Z A;  1UGS B;  3WXM B;  5K1X A;  3PT9 A;  2E65 A;  2OTJ T;  3VQW A;  1B7Y B;  4YRR A;  2LT1 A;  2PU9 B;  4XAX B;  3RL6 A;  1EFW A;  3RMS A;  2CZ6 B;  2L3R A;  3QUI A;  1PYS A;  3L2Q A;  1NYR A;  1VQ5 T;  3OS0 A;  1YHQ T;  2YHT A;  4M7A D;  4H2S A;  3MP8 A;  5DLO A;  3DSQ A;  5A0D A;  1VQL A;  1W2B A;  2XIC A;  3KBG A;  2ZGW A;  4J6X A;  4Z02 A;  3GIB A;  3CCS A;  1BKB A;  1QE0 A;  3VUZ A;  3V7S A;  4RMF A;  4YTL A;  3DLM A;  4TQF A;  5DM7 R;  3JCM e;  4ELY C;  2Y90 A;  2C8M A;  2WSF E;  5GAM j;  2L89 A;  3CC2 T;  3HXY A;  2CKK A;  3E19 A;  2YLC A;  2I4O A;  2Q5I A;  1HTT A;  4M7D A;  2QEX T;  3JRZ A;  3GF5 A;  2QTX A;  5GAM e;  3HFN A;  4M78 A;  3JCM X;  2ZCE A;  2QA4 T;  2XHC A;  1Y96 A;  3VQX A;  4YRQ A;  2ZPB B;  3ERR A;  2ARU A;  1W66 A;  2EJF A;  1BI3 A;  4OB1 B;  2HQX A;  4LVM A;  2ZZD A;  4J83 A;  5FU7 C;  4IKF A;  4G85 A;  3X20 B;  4ZGJ B;  2DVE A;  3QJ6 A;  1KQS S;  2RB6 A;  5C51 B;  4HA8 A;  2E3C A;  2LCC A;  1H3Z A;  4JS4 A;  1FYF A;  2KMT A;  4P74 C;  4WI1 A;  4NCX A;  1G3T A;  4J7I A;  3G7Z A;  1VQ4 A;  2WAC A;  4BE1 A;  3BY7 A;  3JAM E;  3L2U A;  4A4G A;  1UGQ B;  3FLG A;  4M7D F;  3OYN A;  3CMQ A;  5GAO p;  2MAM A;  2GFU A;  4M75 E;  2ZIN A;  1E1T A;  3UFG A;  4LVJ A;  3FDR A;  2RHS B;  2ALY A;  3X24 B;  3CBO A;  3ZFJ A;  4JRP A;  4RKU E;  2QI2 A;  1EIY B;  3QO8 A;  1WJQ A;  1EIF A;  3UPU A;  1VQP A;  1G3Y A;  1Y96 B;  2WSE E;  4M7A A;  4R56 A;  2R57 A;  2GFA A;  4HWR A;  2XTI A;  3UDC A;  4LVI A;  1O9S A;  3OS1 A;  4PL6 A;  2DZ9 A;  2DJZ A;  3CCE T;  2VXE A;  5IAY A;  12AS A;  4PJO B;  1WJR A;  3VYG A;  4KR2 A;  4M78 D;  3NTI A;  2JUF A;  4C92 A;  2EQK A;  3L2V A;  3HFZ A;  2XG8 D;  1S72 A;  3KFU A;  4M75 B;  3QBY A;  1OYX A;  3I56 A;  2DQ3 A;  4Q5W A;  3PCO A;  4RG2 A;  1H4V B;  3C4S A;  2ART A;  2E10 A;  5EG2 A;  4OLF A;  5GAO l;  3OYY A;  2L8D A;  5ELO A;  5CKE A;  1VQ9 A;  2RHS A;  3M4P A;  2ALY B;  5FU6 B;  2XID A;  3GNG A;  4M75 G;  2DK3 A;  4TVA A;  2E6Z A;  3I55 A;  3OB9 A;  2LQK A;  5IN1 A;  4JRK A;  4K87 A;  3TU4 K;  3BDU A;  1N8R U;  3CPF A;  3E9H A;  3S3N A;  1JJC A;  1H64 1;  1Q7Y C;  1K8A C;  1I8F A;  3JCM f;  1JRI A;  4M7D C;  1JJ2 A;  4QVC A;  2DTI A;  4DOW A;  4P71 A;  4OB2 B;  1WU7 A;  3S3M A;  5GAO m;  4M7A B;  4E7H A;  3HHT B;  4P75 A;  4XEO A;  4UP8 A;  3J81 E;  4F7U F;  1B70 B;  4BWA A;  5FRM A;  3UGQ A;  3P8T A;  5GAN h;  2M1H A;  3DKM A;  4J6W A;  4J7F A;  1I4K 1;  3HRI A;  3QPH A;  4WF2 A;  5CKB A;  2XI9 A;  3M56 A;  2X35 A;  3G4S T;  3HFZ B;  3UWN A;  4C92 G;  3ICA A;  2ARS A;  5I2S A;  3MEY A;  4X5O A;  3CBP A;  3WVE B;  3P8D A;  3M4Q A;  2JOY A;  2YLB A;  2XGT A;  2XD0 A;  3ZEH A;  1YB3 A;  2PVG B;  1ASZ A;  3W3S A;  3JB9 G;  5KNN A;  3DLL A;  1QVF S;  3CMA T;  2ZCF B;  2PUK B;  4E7J A;  4XEM A;  4RQE A;  4J15 A;  3JB9 F;  1KHI A;  2RK2 A;  3E9F A;  4FIB A;  1VQO A;  1X2G A;  3CCL A;  2FYK A;  5GAN 5;  4TVW A;  4NOY A;  3CCQ A;  1G3W A;  2Q7H A;  3M53 A;  4M77 G;  4F7U B;  2QHT A;  1N9R A;  1X55 A;  5GMK m;  1BBU A;  4ZTJ A;  4X9C A;  2QQB A;  2PVD B;  4M77 E;  3SD4 A;  3MET A;  4X9D A;  2EJG A;  2JTF A;  1O75 A;  2P4T A;  5LL6 S;  3TCJ A;  4NS5 A;  2MF2 A;  1N6A A;  4YP0 A;  2CGH A;  4JS5 A;  4QQD A;  3CCR T;  2K5F A;  4FU6 A;  4YRO A;  5HY6 A;  5GAN f;  1VQ7 A;  2DXT A;  4O6J A;  1M1K C;  1ZQ1 A;  1YJW A;  3FJP A;  3HFV A;  5GAO n;  4P72 C;  3M5A A;  1BIB A;  2DDZ A;  2V8K A;  1VQ8 A;  1QP3 A;  5C0M A;  3PCO B;  2IG0 A;  5CK9 A;  2JVV A;  1QVF A;  3HPW A;  4C92 B;  3PMT A;  4YCV A;  1G51 A;  4M78 F;  1B7Y A;  2KQW A;  2EQM A;  2DO3 A;  3V7R A;  4BDZ A;  4M77 C;  4P73 A;  2Y4X A;  4M75 D;  4C8Q B;  3LLR A;  3CCM A;  4P71 C;  3HXZ A;  1YIJ A;  4IUT A;  4C5H A;  1KMN A;  1VQ9 T;  1VQN T;  5K1P A;  1HXD A;  3RES A;  2EQU A;  2P0Q A;  4HT9 A;  2M9U A;  3I55 T;  1XTD A;  4TTV A;  2ZNI A;  3JCM h;  3M4G A;  4M77 B;  3T9N A;  4OGE A;  2RK1 A;  5GMK l;  3EFR A;  1K9M C;  3A7U A;  3CXC S;  1YJW T;  3UH0 A;  2GQV A;  1Q82 U;  1E24 A;  5LJ3 j;  1BI1 A;  3G71 A;  3LWI A;  4IUR A;  2JZ2 A;  4C0G A;  5GAM h;  4C8Q A;  4F7U E;  3L42 A;  5IT9 E;  3CD6 T;  1M1K U;  5CO7 A;  1M1F A;  2LC4 A;  4LDV A;  4YRL A;  4F7U G;  3NET A;  2K2V A;  3FC3 A;  1X6O A;  1X54 A;  4M7D B;  5LJ3 d;  5GMK j;  2P0P A;  1WYD A;  2R58 A;  1H4S A;  1WJS A;  4RG8 A;  4G84 A;  5DY9 A;  4N4G A;  4WJ4 A;  5GAN 6;  5CAI A;  3A7R A;  4H2T A;  2DXC A;  2OTJ A;  2LNV A;  4FSX A;  3P8Y A;  3OYB A;  4LD9 K;  2LCL A;  4XTZ A;  4RMO A;  4RCC A;  4P3O A;  4TVA B;  5E3I A;  2XKO C;  1VQM T;  2D6F A;  3OYJ A;  4XQ3 A;  3LYI A;  2RI3 A;  3RER A;  3C95 A;  3QNE A;  4KQE A;  2NS6 A;  4JLI A;  4J8O A;  1MHN A;  2H3J A;  5FU7 B;  2ZT6 A;  1B70 A;  1NJ8 A;  3CC7 T;  1G5I A;  2V8J A;  1VQO T;  2O4X B;  2VC8 A;  5GAO r;  2FVU A;  3AHU A;  1XQH A;  1N8R C;  1KC8 U;  2CIM A;  1XOV A;  5D6W A;  3HFO A;  1M8V A;  3LX7 A;  2CJ9 A;  2A8E A;  1ZBX A;  3H8Z A;  3OW2 S;  3V8J A;  3O8V A;  4EDU A;  4C8Q D;  4YRS A;  1BI0 A;  5C52 B;  5LJ5 e;  4RCB A;  5GAN d;  3OYI A;  4PHC A;  2E41 A;  4MZM A;  1QW1 A;  5FU6 C;  3F70 A;  3P8V A;  3IAL A;  1QVP A;  2PQW A;  3A5Z B;  4N0A A;  4BI4 A;  2ZZG A;  2ODR D;  1WQ7 A;  3ZBD A;  3GOX A;  3NEM A;  4YRC A;  4BI8 B;  2RHQ B;  4ZN3 A;  4TVR A;  3J7A F;  4HWS A;  2L5Q A;  1VQ8 T;  4TVY A;  1E22 A;  2QXF A;  3BJU A;  2VV5 A;  3TEE A;  4L87 A;  4M7D G;  3SFM A;  1VIE A;  1LJO A;  3INZ A;  4EMG A;  1Q7Y U;  1K8A U;  4C8Q F;  2VYT A;  3VU3 C;  4ELZ C;  3QDR B;  3V8L A;  4DA4 A;  5GAM d;  4B9X A;  3LWH A;  2RHY A;  4YCW A;  2ZNJ A;  3HL8 A;  4YRN A;  2B8A A;  3E9I A;  3I7F A;  4HT4 A;  1B34 B;  4NL3 A;  4UP7 A;  1YJN A;  3PFS A;  3JCM J;  1YIT A;  3V8K A;  3JSC A;  5I21 A;  3BFM A;  3QKJ A;  1YJ9 T;  2XK0 A;  2HD0 A;  3REU A;  4JLG A;  2AKW A;  3WVD B;  4M7D D;  1D3B A;  4YRP A;  2PMF A;  1S72 T;  4P74 A;  4EMK A;  3OMC A;  1W2B S;  1K9M U;  3QHS A;  1EVK A;  4MZT A;  3A31 A;  1H4T A;  3HXW A;  5GAN 7;  4II1 A;  1IRE B;  2ZZE A;  3RUX A;  4E47 A;  3VKI A;  3G6E A;  2ZR3 A;  4K88 A;  3G71 T;  3QZ5 B;  5ELN A;  1NNH A;  2RD1 A;  3HKS A;  3RAC A;  3CCV T;  3PIO A;  2E12 A;  4TWA A;  4ZTU B;  1OZ3 A;  1NPP A;  2BIV A;  4ZTF A;  4PJO D;  4M7A G;  1YFR A;  4A53 A;  3CC4 A;  2CJA A;  3A8M B;  1KMM A;  3RIR A;  1K73 U;  2X4J A;  2Q5H A;  1YIT T;  4IUQ A;  1VQ6 T;  2I4L A;  2HQE A;  2AHJ B;  2KSS A;  4A4K A;  1U1S A;  4RQF A;  3PTA A;  1Q86 C;  3MEV A;  1X56 A;  2RJE A;  3OBY A;  2QA4 A;  2XU8 A;  2RHQ A;  5AYF A;  3JCM d;  4CI0 C;  4YRJ A;  1WNL A;  3G4S A;  1RI0 A;  2X4X A;  2K3X A;  5CIU A;  3JB9 D;  2F69 A;  4XK8 E;  3URG A;  1OZ2 A;  4YRG A;  4C92 C;  1YI2 A;  4LVK A;  1JB0 E;  1W4S A;  5LJ3 g;  3QO7 A;  2P0L A;  1NJ6 A;  2DTO A;  4C5E A;  2ZPF B;  1LYL A;  4M75 A;  3PNW C;  3QSU A;  3HTZ A;  2EQJ A;  1Q86 U;  3OW2 A;  3Q1J A;  3CMA A;  4LD6 A;  5LJ5 f;  1VQK T;  1QVG A;  5CKF A;  3TRE A;  4M7A C;  2C7I A;  5GAN e;  4M7A E;  1UGR B;  4VUB A;  2DIG A;  2EFI A;  4OVA A;  5HGQ A;  5LJ3 h;  1SSF A;  3C94 A;  3M59 A;  3RF1 A;  2PME A;  2CZ1 B;  4H2V A;  1I81 A;  4PNO A;  1QF6 A;  4Q15 A;  2LVM A;  5KH6 A;  3A5Z A;  1WGS A;  4CH4 A;  4HWT A;  4ZTZ B;  3NTH A;  4HCZ A;  1NJI U;  3R6O A;  3HXU A;  2K3Y A;  4QVD A;  1GXI E;  3UGT A;  1VQ5 A;  3HXV A;  1AHJ B;  4O5V A;  2EWN A;  3J80 E;  4GLK A;  2EAY A;  3L2W A;  2KAF A;  4QQG A;  5GAM f;  2Q7G A;  1VQ7 T;  3PGG A;  3CCJ A;  4KBM B;  5CVI A;  3CCQ T;  1PSE A;  4GY5 A;  3SDZ A;  1XNI A;  3QXE B;  4LNS A;  3MF2 A;  1VQK A;  1FX7 A;  2KVQ G;  1FXX A;  3CPW S;  2RHI A;  3IKM B;  3DB4 A;  4LDW A;  4OB0 B;  4CS3 A;  3X25 B;  2R5M A;  2JN0 A;  4ZGE B;  2K5I A;  4UPA A;  4IUU A;  1EVL A;  4YRI A;  1EOV A;  4P5N A;  3A7A A;  3RKY A;  4ZIB A;  2WSC E;  1KOG A;  1NJ1 A;  5DLQ E;  4BY6 B;  4IUV A;  3RKW A;  2ZPG B;  1V29 B;  2LTO A;  4JRI A;  3FB9 A;  3SWN C;  2DKG A;  2F5T X;  5C53 B;  4HWO A;  3C12 A;  3CC7 A;  1G3S A;  4QVZ A;  3OBW A;  1M9S A;  2EJ9 A;  4ATO A;  5CKD A;  3QYG B;  3X28 B;  1BYM A;  5KE3 A;  2ZIO A;  2AMC A;  3CME A;  4KUD K;  3JCM g;  4BB7 A;  3BW1 A;  1USY A;  5CCA A;  3LSS A;  5GMK i;  4C5G A;  1SET A;  1LOJ A;  3EAE A;  1PYS B;  4MMK A;  4OF1 A;  2QQ9 A;  1B34 A;  5D6Y A;  2CZ7 B;  1L0W A;  2EIF A;  4M75 F;  1UB4 A;  4DOV A;  1YFS A;  4XU3 A;  1VQP T;  1NJI C;  1R8O B;  4YRE A;  5GAM g;  4FM4 B;  2ZPI B;  3JCM V;  3JB9 J;  3NEN A;  1K73 C;  5A0L A;  4CS4 A;  3OYM A;  3VUB A;  1YI2 T;  2QDY B;  3ER0 A;  3OA6 A;  5FRN A;  2ZT8 A;  3CCR A;  5LJ5 h;  2PVO B;  1SES A;  4M78 C;  4P3N A;  4EMH A;  4C8Q E;  4H2X A;  4PG3 A;  3HSB A;  2DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...