4XTUA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (n-({[(1r,2s,3r,4r)-4-(6-amino-9h-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
rcsb
molecule keywords Bifunctional ligase/repressor BirA
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtuA01
4BW9A 4YCVA 4M7AB 3M4PA 1GGMA 1LYLA 4WF2A 5GANh 1J5WA 1LJOA 3QSUA 11ASA 1H641 1X2GA 1X55A 4C8QC 4M75B 1NNHA 2J3MA 3WQZA 5I21A 3DSQA 3JCMc 3JB9G 2DEQA 3JCMQ 4H2VA 4CH5A 2YLBA 3HSBA 4M7AE 3JCMh 4YYEA 4M77C 3JB9J 3V8JA 4YRTA 4YREA 4A54A 3VQXA 1M5Q1 3JCMW 3HFZA 4YRJA 3BFMA 5LJ5e 4M75E 4M77E 4QVCA 3EFSA 4YP0A 1KOGA 3A74A 3TEHB 5LJ3d 3JCMJ 5K1PA 3VQYA 3MF1A 4HT9A 1WNLA 3SB2A 4Q6GA 1Y96B 5ELNA 2I4LA 1EFWA 4M7DG 2ZTGA 2I4NA 3M4GA 3RIRA 4K86A 3V7SA 4PNOA 3HY0A 3A7RA 5C53B 1BBUA 4F7UE 1E22A 3P8VA 4C8QG 2QHSA 2ZXFA 1H4SA 4HA8A 3SWNC 3UGTA 1B70A 5C52B 4P74C 4UPAA 3RUXA 4M7DA 4H02A 4XTUA 4C92E 1B76A 4PJOE 1HC7A 2ZIMA 2G4CA 4A53A 4EMHA 2JN0A 3VQWA 2C7IA 4EMGA 3GIBA 4YRFA 5HGQA 1MGQA 5GAN2 2Q7HA 4H2TA 4ZIBA 1ASYA 4G85A 3V7RA 1Z7NA 4CH4A 3TEGA 4TVYA 3HRIA 1I81A 4WJ3M 1RIQA 4AH6A 1YFTA 5GANf 1KQ1A 4M78F 3W3SA 3NEMA 3FB9A 4HWRA 3HFVA 3VU3C 3JB9D 5LJ3e 3V7CA 2ZR3A 4KQEA 12ASA 3ERRA 3TEHA 1YB3A 4YRCA 3P8YA 4P71A 3JCMf 5LJ3j 4UP7A 2E1HA 4TVWA 2DZ9A 5LJ5d 4PG3A 1WYDA 4H2UA 3IKMB 3HXYA 1FYFA 4YRNA 3MF2A 3QO3A 2Y90A 1WQ7A 2RD1A 4J6XA 1G5HA 4P75C 4M7AF 2CJ9A 2VC8A 4P3OA 4M78C 5GMKj 1I8FA 4P72A 2YLCA 4HWSA 1I5LA 5GAMj 4NCXA 4M75F 4M77F 1WQWA 5GAOn 3M4QA 2Q5HA 2I4MA 2DTHA 1NYRA 5GANg 2HNIA 4EMKC 4XEOA 2CIMA 3PZCA 1Z7MA 2QHUA 2K57A 4NOYA 4QVDA 5GMKm 4C8QD 4YRPA 4EO4A 1B70B 4JRKA 2DJZA 3QO7A 2ALYA 4M7DB 5GAN6 1X2HA 3HXXA 3VQVA 3RF1A 2ARTA 2QTXA 1KQ2A 3HFOA 1ADJA 3JCMg 1EVKA 1NJ5A 4M7AC 1EQRA 4H2XA 3RERA 4F7UF 5GAOr 1SERA 1BBWA 2RM4A 3ICAA 1N9RA 4M75C 2CJBA 4RCBA 4J15A 4P73C 3I7FA 4C92F 4PJOF 3HY1A 3IALA 5LJ3h 1N9WA 5E3IA 1EOVA 2ZZEA 4CS2A 2ZT8A 4PHCA 3HTZA 4MMLA 4CS3A 4M78G 4HWPA 3QNEA 5GAMg 5GAN5 1USYC 5LJ5j 3RGLA 4KR3A 4NL3A 3PCOA 4ZTUB 1WLEA 4TVAA 2RHSA 3HRKA 5GMKh 4V2SA 4H2SA 1M8VA 3E9IA 1U1TA 1JJCB 4MMKA 2FB7A 5GAMh 2DQ3A 1U1SA 4X5OA 5C51B 3A32A 3UGQA 1QE0A 2IY5B 4M78A 3LSSA 3JCMb 1B34A 4WI1A 3UH0A 4N0AC 2PMFA 3KFUA 2CGHA 1X54A 4C92C 1LNXA 4PJOC 4JLIA 4XU0A 2ZZFA 3TUPA 2VXFA 4CH6A 3QO8A 4Q15A 3QUIA 4J6YA 1ASZA 1NJ6A 2DU7A 3A5ZA 3RKWA 1G51A 4DPGA 3JB9I 1N9SA 4M77G 4XEMA 1L0WA 5CAIA 4H2YA 3V8KA 4C8QA 4DQ2A 2ALYB 4HT8A 2DVEA 2EJFA 2ODRC 1H4QA 4EX5A 3JCMP 4UP8A 1C0AA 5GANe 4H2XB 3L2ZA 2DKGA 4YCWA 2ZR2A 4M77A 3JB9H 2RB6A 3RESA 1B8AA 1PYSA 2RA2A 1W66A 3PGGA 2E3CA 5LJ5h 5GAOl 2RHQB 3RKXA 4F7UG 4JRIA 4XU2A 5GAOm 3L4GB 3JCMe 1JJCA 1I4K1 1WPYA 3V8LA 4XTVA 4TQDA 4Y91A 3A7AA 5LJ3f 2DQ0A 4M78D 4C92G 2VXEA 4PJOG 4H2WA 4TWAA 2IY5A 3PCOB 3REUA 3HFNA 4YRIA 2Q7GA 4TVAB 2RHSB 2ZGWA 4F7UA 4XTZA 4JUVA 2XTIA 4YRQA 3NELA 2QHVA 1X56A 4M78B 1H4TA 4KR2A 4TTVA 5GAMf 1B34B 5KNNA 4C92A 2CJAA 2ARSA 4WJ4A 1B7YA 3SWNA 2ZT6A 2ZT5A 4P74A 3INZA 4TQFA 1D3BB 1TH7A 1NYQA 2E41A 4EMKB 1HK9A 1E1TA 1HTTA 2I4OA 1G5IA 1SRYA 5GAN4 5GAOq 4G84A 4M7AD 5ELOA 2P0LA 4UP9A 3IKLA 4E51A 2ZIOA 2AKWA 3HXVA 4M77D 4M75D 3JCMX 2AMCB 4C8QB 4M7DC 5LJ3g 5GAN3 1EVLA 3HXZA 1IL2A 4XU1A 3A5YA 3NENA 4HVCA 5GAN8 4M7DE 4RCCA 4X9CA 4K87A 2RHQA 4P3PA 2DDZA 4M77B 5F5WA 5GANd 3L4GA 2DTOA 1PYSB 4C8QE 4XQ3A 1HXDA 4K88A 1EIYA 3CMQA 4RMFA 3LC0A 4YRKA 2FYKA 3UFGA 5LJ5f 4YROA 3BW1A 2ZZGA 2I2LA 3VBBA 2P5IA 4P75A 3BY7A 2ZINA 2DXTA 3A7UA 3JCMd 1ATIA 4L87A 2PMEA 3FJPA 4C92D 4P71C 4PJOD 1QF6A 4O2DA 3QTCA 4F7UB 4J6WA 1YCYA 4XU3A 2EWNA 4LNSA 1D3BA 5K1XA 1YGBA 1X01A 5DY9A 4YRMA 4XTYA 4EMKA 4M7AG 4C92B 2E64A 4PJOB 1B7YB 4HWTA 4RQEA 2QHTA 3SWNB 1E24A 2EJ9A 1JRIA 3LSQA 2DTIA 4P72C 4M75G 1SESA 3BDUA 2ODRD 2AMCA 5GAMd 4CH3A 3G1ZA 2DXUA 4M7AA 1WU7A 3BJUA 1H4VB 1KMNA 2E65A 3JB9F 2AKWB 3AHUA 4YDQA 4CS4A 5LJ5g 2XGTA 1BIBA 3RKYA 4M75A 4P73A 4NL2A 1ADYA 3RL6A 1LOJA 1KMMA 3MEYA 4YRLA 5GANj 4YCUA 2Q5IA 3HXWA 2EJGA 4YRRA 1VQZA 4HWOA 4OP0A 4OLFA 3QO5A 2ZCEA 1USYA 3OD1A 3HXUA 4ZTZB 2ZNJA 1JBMA 5GMKi 1NJ8A 2Q7EA 3R07A 4RDXA 1EIYB 2EL9A 1BIAA 4YRSA 3FIFA 3NETA 4XTXA 3QHSA 2DU5A 4M7DF 2ARUA 3A31A 3HFZB 3P8TA 3L1AA 3JCMV 4X9DA 1SETA 5GAOp 2E10A 4N0AA 5GAN7 2C8MA 2EAYA 1NJ1A 4XTWA 5GMKe 4PJOA 1Y96A 4C8QF 2YHTA 5GAMe 4YPFA 4BWAA 4YRGA 3IG2A 3REXA 2DZCA 2J3LA 2ZT7A 3EFRA 2ZNIA 1YFRA 1NJ2A 3E9HA 4M7DD 2E5AA 3RACA 4J5YA 4M78E 1YFSA 4P3NA 4RQFA 5GMKl 1E1OA
chains in the Genus database with same CATH superfamily
1M3AA 4YCVA 2F2VA 2SRCA 3CCMA 2LMJA 2B86A 3M4PA 4WF2A 5GANh 1QVFS 2QGGA 1ZA1B 4IIMA 2K3BA 3PIPA 1OZ3A 3WQZA 1G3SA 2QTVA 4FL6A 5KYWA 3HSBA 4M7AE 1OI1A 2RN8A 1MMDA 3I56A 3L42A 3UWNA 3VQXA 4YRJA 2RK2A 3VRYA 2K4YA 1YHQQ 1M8MA 1DJ7B 3C4SA 1BCMA 3A74A 1M3CA 2XDBA 1SF9A 5K1PA 4JJNK 2FL7A 3MF1A 1WNLA 1RACB 2HD0A 3HKSA 3M55A 1Y96B 1VQ8Q 2I4LA 2MOXA 1NJIR 2YUQA 3M4GA 2ESWA 4OMPA 4HCKA 3CCUQ 3QYGB 3V7SA 3E2UA 1E22A 3P8VA 4BACA 3I35A 4F04B 1H4SA 3UGTA 1B70A 5AT1B 5C52B 1YJ9T 2ZIMA 1ZX6A 2K7AA 4DBQA 4H2TA 3AT1B 3QPHA 3V7RA 2KBTA 3TEGA 3HRIA 1WHLA 4C5EA 1RIQA 3OMCA 4B6MA 4RKUE 4WCIA 2BTTA 3A8GB 3I9QA 3NEMA 2DE0X 4HWRA 3HFVA 1O9SA 1KD1U 4LUEA 1UJ0A 3V7CA 4IUQA 4OMQA 1UEBA 1H8KA 1YB3A 2F1LA 4P71A 2CS7A 2JTEA 4UP7A 4ZGJB 5CVIA 9ATCB 2A08A 1VQPA 3VS7A 4YRNA 3MF2A 3CC7T 3MEAA 1WQ7A 3OS0A 1G5HA 3CCVT 4FYXB 5C0MA 1BI1A 1E6HA 2D8JA 2DLPA 4AMCA 4M78C 2E12A 3C95A 3G71T 4HWSA 5GAMj 2KDSA 4M77F 1QMCA 1WQWA 5GAOn 2Q5HA 3OA6A 2CP7A 2I4MA 5KCHA 3D7SB 1N5ZA 2EGAA 2NYSA 4EMKC 1VQ6T 5D6YA 4BE1A 2V26A 4XEOA 5FLXE 2GCXA 2ZPGB 4NOYA 4EO4A 2H3JA 3QO7A 4KGXB 2AT1B 4R56A 1X2HA 2M51A 2E5KA 3HXXA 2QA4T 3VQVA 3N5BB 3G4ST 2L5QA 1U8RA 1UFFA 2MPXC 4H2XA 3ZL7C 4F7UF 2K5LA 3WVEB 2MMPA 4JZ4A 1UECA 1N9RA 3M0PA 4M75C 4PJLA 2J6OA 2RQUA 4PJOF 3HY1A 1PCXA 2KAFA 5LJ3h 1N9WA 5E3IA 1LPLA 1Q81R 3QNEA 4C0FA 5GAMg 3X25B 5GAN5 4J9HA 3O8VA 1JQQA 3PCOA 5CKBA 2Z0WA 1KHIA 3M0QA 4TVAA 2E70A 3HRKA 4QT7A 4EDUA 3PMTA 1YIJA 1XOVA 1NG2A 1U1SA 4K11A 1QCFA 2R5AA 2K5FA 3LGFA 5A0GA 2HCKA 3E1SA 3CCQQ 4ORZA 4M78A 1VQ5A 2XDPA 1NYFA 3UH0A 3PT9A 2YSQA 3VS2A 4C92C 1Z9QA 4KT0E 2QQRA 2QQBA 1YHQA 4KH1B 3M4YA 3CXCP 3QO8A 4MDWA 1NJ6A 4Z02A 4DEYA 1KSWA 2HDAA 1VA7A 3RKWA 1OPKA 4DPGA 2EYYA 1D1AA 4BD3A 3OS2A 1G5VA 3JB9I 4QKUA 3H0IA 1KQSA 2ALYB 2V1QA 1Q86C 4OVAA 2KXCA 1G3YA 3RNJA 1M27C 4MZPA 3H6ZA 1VQ7T 2CKKA 2X3WD 1CSKA 4FYVB 1XTDA 4UP8A 1KK7A 2JTMA 2FRWA 3L2ZA 1SSFA 3QZ5B 2JT4A 2K5IA 1M1GA 1WI7A 5GAOl 3KFVA 2DEUA 1N8RU 1IZ6A 4JRIA 5CR2A 4JRQA 3L4GB 3JCMe 1ZUKA 1I4K1 4XTVA 2VWFA 1OU9A 4M78D 1WHHA 3I55T 1YITA 2IVWA 4RTVA 3HFNA 5HKCA 1AHJB 4YRIA 3RMSA 3TREA 2P0QA 2D9TA 2X51A 3QJYA 2OTJT 1ZHIA 3CCJQ 3HRSA 4YRQA 1RAFB 1K8AU 5L23A 1X43A 1VQLA 1FX7A 4C92A 2ARSA 3F70A 2DYIA 1PKSA 5CK9A 1VQMA 2VVKA 1OX9A 4RTTA 3CCLT 4TQFA 1TH7A 1HK9A 3I5SA 1MNEA 3MEUA 3NFCA 3ZBDA 5GAN4 5GAOq 1G5IA 1SRYA 1ARKA 3LW5E 3QDRB 3TEEA 4BI3A 2MCNA 2ZIOA 3GLXA 2CZ0B 1OZ2A 2M16A 4M75D 2BUDA 2JM9A 4EPCA 2O01E 3PIOA 3OYKA 2DF6A 2FPFA 3G6EQ 2EIFA 1K73R 3HXZA 1WHJA 4M7DE 1OOTA 4RCCA 4M4ZA 1QLYA 2RNAA 2JM8A 4BB7A 2JUFA 2EQUA 4JLGA 1YJWQ 1M1FA 1NYGA 2CZ1B 1RAHB 3GBQA 4RMFA 3REAB 2FYKA 1PG5B 2DILA 1GL5A 2QAZA 1G3TA 1OQKA 5LJ5f 5FU7B 2QYZA 3BW1A 3S6WA 2DBKA 1QCOA 2DXTA 1LVKA 1ABOA 4C92D 2MWPA 3KUFA 2LX9A 1OV3A 4LDYA 5KYUA 4C0DB 2KI7A 2ENMA 3UF4A 2KROA 2VB6A 4E7JA 2EWNA 1D3BA 1X01A 2DRKA 2X4XA 1NLPC 2K6DA 1PKTA 1K9MU 2E64A 1B7YB 2GQVA 2QHTA 1WA7A 3NMZC 3NTHA 1FMKA 2GGRA 3UPUA 4HCBA 2AMCA 1TWBA 5GAMd 1SEMA 2JMCA 4LDVA 3G1ZA 3BJUA 3CCQA 2NUTB 2E65A 3AHUA 4FYYB 1PHTA 1WHGA 5LJ5g 2NUZA 2XMFA 3L2VA 3SD4A 4B9XA 3CCRQ 3CXCS 1TUDA 2X3XD 3MO8A 4KRTA 2DYBA 2LVMA 5GANj 2Q5IA 4HWOA 4YTLA 1USYA 1VQ9T 1AZGB 1X6OA 2DA9A 4JJCA 3OSSC 5FROA 1NJ8A 4PJNA 4IKFA 4DA4A 3NETA 3A31A 3LYIA 3M0TA 3HFZB 1R77A 2YRDA 3L1AA 3CCMQ 4X9DA 2FPDA 2E10A 5GAN7 3M58A 1IO6A 5GMKe 4PJOA 1Y96A 2LNVA 2YHTA 2BZ8A 4YRGA 1YJ9A 3IG2A 1ZSGA 2HAXA 2ZNIA 4RTXA 4RTYA 2D0QB 3L2UA 3E9HA 1AOJA 3I56Q 2FG0A 4LXCA 2PUKB 4A4GA 5GJWB 2LCSA 2V8IA 1LYLA 1RUWA 2J7IA 1Q82C 3GP8A 4IURA 3MJXA 4C8QC 3A1PA 4M75B 3CC2Q 2P0KA 2CUBA 3DLLA 3JB9G 3JCMQ 4H2VA 1VUBA 2X35A 2YLBA 3PTAA 3FEOA 3CC7A 3JCMh 5KH6A 3JB9J 2NWMA 5ECAA 1M5Q1 1WXBA 2MWOA 4M77E 1UGVA 3C94A 3G71A 1WYXA 3EFSA 3FDRA 2M9UA 5M9OA 1UJYA 2RHYA 2XU8A 4HKEA 4QQGA 1VQ6A 2YWWA 2EQMA 4HT9A 3SEMA 5CKEA 1YJWA 4HVWA 1QKWA 5AYFA 3VS6A 1EFWA 4M7DG 1ZBXA 2I4NA 4XK8E 5CKDA 4DBFA 1JU5C 2QA4A 4K86A 4PNOA 3HY0A 3A7RA 4LVMA 4FCYA 4BI4A 4ELYC 4F7UE 1BI3A 1SHGA 2JMAA 2DD5A 2QHSA 3SWNC 4PJJA 1NE8A 4P74C 3RUXA 3VKIA 4XTUA 4C5IA 1ZUYA 2JS2A 3LWIA 4PJOE 4EMHA 1V1CA 3QDFA 4EMGA 5J26A 5HGQA 4BDZA 1C1AA 4R0KA 4FU6A 1VIFA 1VQPQ 1T3LA 1IB8A 1NEBA 3BDLA 2LZ6B 3Q1JA 2PTKA 1GFDA 3A8MB 1W1FA 2M0OA 1KQ1A 4M78F 1JO8A 2XHCA 3OB9A 4NS5A 1S72Q 1R0CB 2PVDB 2DM1A 5J3BA 3JV3A 4ZTJA 3DKMA 4BY6C 1M3BA 5LJ3e 2DJQA 2ZR3A 2DBMA 3FJ5A 1NLOC 4KQEA 3UA6A 12ASA 3TEHA 1QVGP 1NJIU 4D8DA 1ABQA 2P84A 4JZ3A 1ACMB 5LJ3j 1HSQA 4RUGA 3OYBA 2OTLT 2MK5A 2E1HA 3E9FA 1YJNQ 1HJDA 2DZ9A 5LJ5d 5EG2A 1TUCA 4N4IA 3HXYA 4KUIA 1FYFA 4HXJA 2QK0A 5KCOA 4OF1A 1FMVA 2RD1A 2ZPEB 4J6XA 2BZYA 2CJ9A 4UC4A 2VC8A 2OAWA 1I8FA 2E4HA 1Q95G 4P72A 2YLCA 4M75F 2AZSA 1NYRA 1VOMA 2KGTA 3X24B 2EGCA 2HNIA 2F2WA 1WIEA 2E3IA 2FZCB 1Z7MA 1M4ZA 4C8QD 2ALYA 5GAN6 2M0YA 1YFNA 2QEXQ 2CDTA 2LT4A 1IHWA 3OW2P 3RMQA 5FU6C 4FSXA 1BK2A 1EQRA 3QG1A 1YIJQ 3HP9A 2PVOB 5GAOr 4WTOB 3A8LB 1W2BS 2DL3A 3MP1A 3X26B 2CZ7B 1VQ5Q 1Y0MA 2CJBA 2NS6A 3I55A 4J15A 3HRUA 4C92F 4PFOA 5FWCA 4DOVA 3OY9A 1ZQ1A 4CS2A 5A0LA 4PHCA 3HTZA 1IREB 4RTZA 5EC7A 3CPWA 4HWPA 5FU7C 2E6NA 1OX8A 2F69A 4KR3A 4NL3A 3CMAT 4FSSA 5GMKh 4V2SA 3CC2A 4H2SA 1M8VA 3CCLA 4L59A 5IT9E 5D6XA 2EGEA 1RAIB 4ZGEB 5A0DA 2DQ3A 1ZSZB 4C0DC 4X5OA 1ZA2B 2CP6A 5C51B 3A32A 3UGQA 1QE0A 2IY5B 5I11A 2LT1A 4OMLA 3OYLA 4OMFB 2K9GA 2Y4XA 2FZKB 2PMFA 1HD3A 1SKUB 2CGHA 3KFUA 4JLIA 1SPKA 1PSFA 3EG9B 1QCNA 4QW2A 2VXFA 3OYCA 1RL2A 2ATCB 2DU7A 4ELZC 1JEGA 2RQRA 3CBMA 1TTHB 1YWPA 4M77G 1L0WA 3V8KA 1BBZA 2COZA 4DQ2A 1VQKT 1YITQ 2DVEA 2EJFA 1Q81U 2V8KA 4QQDA 5IHIA 3JCMP 4EX5A 1MV0B 1NPRA 1WJQA 1C0AA 1KC8R 2L8DA 5IN1A 3CD6T 4YCWA 1OYXA 1AWXA 4IUUA 3JB9H 2VKNA 1VQLQ 1VQMQ 3MHXA 5KYYB 2NUPB 1GBQA 3RKXA 4F7UG 1FYNA 3MPUB 5GAOm 1JJCA 1WPYA 5IXBA 2DQ0A 4J9EA 2VXEA 4PJOG 4H2WA 4HT4A 4CC2A 2L3PA 3UA7A 2ZGWA 1G2BA 1S72A 2E5QA 2RK1A 3LLRA 4JUVA 4XTZA 2CREA 2CP2A 1FMWA 2XI9A 2J06A 2KYMA 1VQ4T 1H4TA 2YRVA 4KR2A 1YI2Q 5GAMf 1QVGS 2CJAA 2RJCA 1B7YA 5D7UA 4EIKA 4BE0A 4PFZA 2LQNA 1VQOQ 3RDVA 2EPDA 1YJNA 4ME7A 4F16A 2E41A 2P0LA 1NPPA 1R8OB 2LX7A 1MMAA 5L8RE 2GFAA 4N4GA 4UP9A 4E51A 2NUTA 4VUBA 1Q7YR 2GBQA 2F5TX 3JCMX 4C8QB 3QIIA 3J81E 4M7DC 1WFWA 4LN2A 1AD5A 1JJ2S 5C6SA 4XU1A 3NENA 3A8HB 5GAN8 2AK5A 2L3QA 4X9CA 3REBB 2RHQA 2QQ9A 2DDZA 3URGA 3M5AA 2DTOA 4ANJA 2K2VA 1FXXA 1PYSB 1TOVA 2ZAEA 1D1BA 3CMQA 4L5GA 2QEXA 3OW2S 5DLOA 3LC0A 3THKA 1XQHA 2C06A 3NTKA 5GJVB 2JS0A 4Z88A 3UFGA 3MP8A 4YROA 2ZZGA 2QGFB 1GCQC 2ZINA 2PMEA 3A98A 3HTRA 2KSSA 4L87A 3FJPA 1QP3A 1QF6A 1V76A 4O2DA 2D6FA 4LVIA 2EYZA 4J83A 2V8JA 3A8OB 2KMTA 1YCYA 4FW1A 1D1CA 1PWTA 1VQNT 1RAGB 1QQJA 5K1XA 4EMKA 4M7AG 1BYMA 2KK4A 1K73U 1M1KC 4RQEA 2X4YA 4PFPA 2ROLA 1N6AA 2RI5A 3LH0A 3SWNB 2EJ9A 1JRIA 1T0HA 3QKJA 4O5VA 1SESA 1QWEA 1CKBA 2DNUA 2PZ1A 2DO3A 4F17A 3CCET 2DXUA 3CMET 2DMOA 1KMNA 2LJ0A 2DIQA 3GF5A 4FM4B 2O4XB 4M75A 1MMGA 4E7KA 4NL2A 1LOJA 3MEYA 2K2MA 4YRLA 5DM7R 3S3NA 3FRNA 4YCUA 1O75A 1RI0A 4BY6B 2H8HA 1YJ9Q 4LE9A 3HXWA 4KH0B 1GFCA 1UHFA 2QQAA 1VQZA 4OP0A 2OI3A 4TVRA 4ZN1A 3VYHB 3OD1A 2IIMA 3HXUA 3HL8A 1R0BG 4RTUA 4ZTZB 1EIYB 1SG5A 2YXYA 2JTFA 1H3HA 2RI3A 2EL9A 4JS4A 2AZVA 5KYWB 1ZUUA 1RI9A 4XTXA 3QHSA 5FW9A 4C0GA 4J9CA 5IH2A 3CC4T 4CC3A 1X69A 1SETA 2C8MA 3NHNA 3L2RA 2KNBB 4C8QF 4JJBA 2CSIA 3REXA 2DZCA 3OYNA 3OQ5A 2XIDA 4BE2A 1M90R 2YUOA 3I5RA 3CC7Q 2HKQB 4IUVA 4M7DD 1PM3A 1BU1A 4LNPA 3RACA 2WACA 4M78E 1YFSA 2HBPA 3OYEA 4RMOA 1PSEA 4JPBW 3CCVQ 4P3NA 3ME9A 1IGQA 5FU6B 4AFSC 3G71Q 3QBYA 2V1RA 1GGMA 4ZGDB 1J3TA 1J5WA 4X34A 1YI2A 3QSUA 11ASA 2W10A 1X55A 3UT1A 1AWOA 2YUPA 1VQ6Q 1NNHA 2J3MA 1VQOA 1T3SA 1MNDA 1Q82R 3OS5A 2ZPIB 4CRIA 2OTLA 2DEQA 1ZLMA 4J9GA 3EG1A 4CC4B 4CH5A 1T0JA 2QA4Q 2VV5A 3G4SQ 4M77C 3NGPA 4YYEA 4BUGA 4F14A 3V8JA 4YREA 1Q81C 1Y7XA 1JXMA 1HYOA 2XICA 2XDDA 3CEYA 3BFMA 2COWA 5LJ5e 2KY9A 1WLPB 4M75E 2WSCE 2YT6A 4QVCA 1KD1C 1B07A 1K9AA 1QWFA 3JCMJ 1ZSZC 2CP3A 1UE9A 2DX1A 1RAAB 4Q6GA 1G83A 5ELNA 3EFOB 3RIRA 2RJFA 5C53B 1YCSB 1BBUA 2BE9B 2C0IA 3MCAB 4HA8A 5IHKA 1VQPT 5HY6A 3G7ZA 3MKDA 2P4RA 4C92E 3OYGA 2CP0A 1AWWA 2EKOA 2JN0A 3EAEA 3VQWA 4DBHA 1UG1A 3GIBA 2VGMA 2AKKA 2RHZA 1MGQA 3HPWA 4LDWA 1U5SA 4ZIBA 1U3OA 1Z7NA 4TVYA 2KT1A 1I81A 4WJ3M 5CQXA 3HHTB 5GANf 3CMAA 3W3SA 3CCST 2HZYA 3FB9A 1JXOA 2JZ2A 3VU3C 2B8AA 1K0SA 2HQHA 5HCKA 1QVFA 3G1JA 1VQ7Q 2EKHA 3ERRA 2EFIA 1QW1A 4J9DA 2JJ9A 1I1JA 1CKAA 2LQ8A 4TVWA 1WHMA 1WYDA 2CH4W 3JRZA 3IKMB 2ZPFB 5DLQE 5HK3A 1ZSZA 3QJ6A 2Y90A 4C5HA 3EG3A 4P75C 1UDLA 2OX7A 2RH2A 5GMKj 1I5LA 1M30A 4NCXA 1KQSS 3EG9A 1W2BP 5I2SA 3I55Q 2DTHA 5GANg 2YRCA 4ZNXA 3VS3A 2A8EA 2JW4A 1XNIA 2CIMA 3PZCA 4AFZC 2OTJQ 1C6VX 5GMKm 1PRLC 3CD6A 2G3RA 2DJZA 4E7HA 3OYJA 2H3EB 4M7DB 4J9FA 2DAQA 4J9BA 2QTXA 1KQ2A 1NJ5A 4OGEA 3CCLQ 4M7AC 4ATOA 3FC3A 1YHQT 3EGXB 3R6NA 3OS1A 4N4HA 2D8HA 2KEAA 1BBWA 1SERA 5HK0A 1PD1A 2WSEE 4RCBA 3EG2A 4P73C 3CCVA 2GTJA 3I7FA 4L6V5 2EW3A 2CUDA 3IALA 1GCPA 5KYYA 3CPFA 3P8BB 4PJMA 3L2QA 1VQ8T 2LC4A 4MMLA 3MQZA 4M78G 1X27A 3CCUT 1GRIA 3RGLA 1KG1A 4PLIA 4ZTUB 4HVUA 1WLEA 1N8RC 3E9IA 1U1TA 3CBOA 5IHNA 1K4US 5I2MA 2LRQA 3G4SA 3JCMb 3EHRA 4WI1A 2HQXA 4N0AC 3L2WA 2KE9A 2HBWA 2XG8D 1LNXA 4Q5WA 3QWXX 4XU0A 3TUPA 2A3LA 4Q15A 2Y4YA 3IQLA 3QUIA 3VS5A 3TSZA 1UGRB 3M59A 1YP5A 1K8AC 2ZZDA 3DB4A 4B9WA 1N9SA 1WZOA 5FRMA 2MYSA 3EGDB 2LP5A 4H2YA 4C8QA 1D0YA 1BI0A 3OYMA 4HT8A 4OB2B 2ODRC 2DRMA 1SRMA 3MEVA 4FYWB 2VGNA 2XK0A 3X20B 4D8KA 4GY5A 3PNWC 2ZR2A 1RLPC 3S3MA 3OYAA 3RESA 1X75C 2JVVA 3EH2A 1PYSA 1W66A 3PGGA 4Y92A 5LJ5h 3U23A 1NBEB 2LCLA 1X6BA 1G3WA 7AT1B 4XU2A 2ECZA 2KT8A 4LVLA 1VQNA 3P8HA 4HCCA 4Y91A 1OPLA 5LJ3f 2RF0A 4C92G 5CKHA 2Q7GA 4GLKA 2RHSB 2CT3A 2YUNA 2XTIA 1VQ9Q 3DLMA 4KUDK 3NELA 2EQKA 1JJ2P 1F1BB 1VQ7A 1X56A 3CCEA 2BKDN 3P8DA 3M0RA 4D6WA 3CMEA 4TTVA 4IUPA 1B34B 2DXCA 4LDUA 3JAME 2JXBA 4WJ4A 1WXUA 4QQ6A 3SWNA 5IAYA 2ZT6A 2ZT5A 4P74A 3H0HA 5LL6S 3INZA 1D3BB 4AFQC 5CO7A 1KC8U 1NYQA 4LVJA 3LWHA 2K3XA 1YBYA 2PQWA 3A5ZB 4G84A 4OB0B 4M7AD 5ELOA 1K9MC 3KBGA 4MZTA 1QVPA 1TXQA 2A7YA 3HXVA 3H9NA 2KXDA 2EYXA 2O4XA 1AEYA 2AMCB 1VYTA 3OSVA 4J7FA 1A0NB 1UGPB 2CSQA 5LJ3g 4FW2A 1IL2A 3A5YA 4HVCA 1X2KA 2A0FB 4P3PA 4PL6A 4A4HA 2L2PA 1UHCA 5CQYA 2DL8A 4M77B 1OU8A 2OTJA 2HKNA 3CC4A 1YNZA 4IUTA 5GANd 3L4GA 5F5WA 1TUGB 1KIKA 4C8QE 1WJRA 1EIYA 2EYQA 3CCQT 1WDXA 2COYA 2C0OA 1LCKA 2J6FA 4AG1C 1YWOA 3MEWA 2M02A 3UATA 2I2LA 3PVQA 2O9VA 3ASKA 3RBBB 3X28B 3GPLA 1ATIA 2LJ1A 2R58A 3EH1A 4P71C 1TG0A 4Y28E 2HSPA 3VS4A 4E7ZA 4DOWA 4F7UB 4J6WA 4CC7A 3QZ9B 2KR3A 3CBPA 2RJEA 3SDZA 1X6GA 2K3YA 4GBQA 1Q7YU 5DY9A 3M0UA 1EFNA 4PJOB 1YN8A 1WXTA 3CPWP 5A2QE 1C0MA 2DIGA 2DTIA 3M56A 2X4JA 3T9NA 2ODRD 1M1KR 2MIOA 1BCOA 2ZPHB 3PFSA 4AT1B 4CH3A 1XJWB 4II1A 1GBRA 1H4VB 1EZZB 2VASA 1Q86R 2AKWB 4CS4A 3M9QA 3VS1A 3SFMA 2XGTA 3RKYA 1M2VB 3FLGA 1ADYA 2R57A 1KMMA 2CT4A 2E6ZA 3E9GA 2XD0A 3QXEB 2ZCFB 4YRRA 1RADB 1S1NA 4OLFA 2ZCEA 2DERA 3CCJT 1AZEA 5GMKi 2Q7EA 4E7LA 6AT1B 2A36A 1I5OB 1BIAA 2HMAA 1FWZA 1MHNA 4KGZB 3VV0A 3PVLA 2KRNA 2LQWA 3JCMV 1K1ZA 2LCCA 5GAOp 4JRPA 2LTOA 3UDCA 2RPNA 3HRTA 2EAYA 2L0AA 4GLMA 2O31A 4HVVA 3EFOA 5GAMe 4YPFA 2KVQG 3DB3A 3EGUA 4J7IA 4LD6A 4A63B 2ZT7A 1AVZC 4E7SA 2RHIA 3G6ET 2OTLQ 2DD4A 4CI0C 1TSFA 1D0XA 2KRSA 1G8XA 1YFRA 5KYXB 2E5AA 4RQFA 1Z9ZA 1BKBA 1W4SA 2HL3A 1E1OA 4QVZA 4BW9A 5CKFA 3CCSA 1VQ9A 2AHJB 1YJWT 4M7AB 3SHWA 2D1XA 1LJOA 3S3OA 3H0FA 3NTIA 1H641 1X2GA 5FWBA 4RTWA 2CP5A 2RI2A 5I21A 3DSQA 4FIBA 3QWYA 3JCMc 3VJPA 2ED1A 4HCZA 4OB3B 3OYIA 4YRTA 4A54A 2PU9B 3JCMW 3HFZA 3CXCA 4OGCA 2C0TA 1KOGA 4YP0A 4KULA 1M90U 3TEHB 4RG2A 5LJ3d 3ZFJA 1PC0A 2G6FX 1NJIC 2RO0A 2A37A 1KD1R 3VQYA 4BI8B 3RR6A 1WGSA 1PNJA 3SB2A 2L3SA 5KE3A 2HQEA 3OYYA 2ZTGA 4DBRA 2QI2A 2M1HA 2DL4A 3OBYA 2HEQA 3CMAQ 2ZPBB 3CCRT 4C8QG 2F5KA 2ZXFA 1Q82U 4IIOA 4UPAA 4M7DA 4H02A 1B76A 1HC7A 2FZGB 2FEIA 4AG2C 2G4CA 4A53A 2E3HA 5KE2A 3J7AF 1UGSB 2PVGB 2C7IA 8ATCB 4YRFA 1IRXA 3C12A 5GAN2 2Q7HA 1ASYA 1MMNA 3R6OA 4G85A 2OJ2A 4CH4A 3EGXA 3CPWS 1VQ8A 1KFZA 1KC8C 4AH6A 4KBMB 1SHFA 1YFTA 1WJSA 2J6KA 3CCUA 2J05A 3TU4K 3CCMT 2I0NA 3TSWA 3JB9D 1VQKQ 1KQSP 2QG9B 1GCQA 4YRCA 3P8YA 2ABLA 3JCMf 3CD6Q 4PG3A 4H2UA 2XKOC 1SRLA 3OYDA 2O9SA 3QO3A 2HSEB 3I56T 2BZXA 4JS5A 2IPOB 2BIVA 4M7AF 1K76A 3VS0A 4P3OA 1B3QA 4KGVB 4AFUC 2W0ZA 3VUBA 2GNCA 3M4QA 4MDXA 2MAMA 2CH4A 4PLLA 1NEGA 4LD9K 2QQSA 3VRZA 2QHUA 3CC2T 1UB4A 2K57A 4YRPA 4QVDA 1B70B 1VYVA 3EGDA 4JRKA 5I22A 2EVRA 1VQ4Q 4XAXB 1Q7YC 1IXDA 1BB9A 2OAUA 2X9HA 3RF1A 2ARTA 1UUEA 3HFOA 1ADJA 3JCMg 1EVKA 3NPFA 1MV3A 3RERA 1JB0E 4C5GA 1E6GA 1I0CA 1RLQC 3O5ZA 2RM4A 3PMIA 4O6JA 3ICAA 1M9SA 3TCJA 1GXIE 1V29B 1N27A 1EOVA 2ZZEA 4E2FB 2ZT8A 4LDXA 3PE0A 3TVTA 4CS3A 1K0XA 2VYTA 1USYC 5LJ5j 1QKXA 2NLUA 2LJ3A 2RHSA 1KHCA 1JJCB 4MMKA 2FB7A 5GAMh 1AWJA 3OBWA 4OMNA 1N8RR 3LSSA 1B34A 1X54A 2X4WA 4PJOC 2BE7D 2ZZFA 1KJWA 4CH6A 3H41A 2YDLA 4J6YA 2DXBA 2RQWA 1ASZA 3A5ZA 4A4FA 2DVJA 1EX4A 1H92A 1G51A 2PNIA 1S72T 4XEMA 4BDYA 5CAIA 2RHXA 1K8AR 1VQNQ 2ED0A 2ROTA 2JNGA 2DK3A 1W6XA 1WX6A 3GNFB 4Z89A 1Y07A 1H4QA 5GANe 3META 4H2XB 1BI2A 3E19A 2DKGA 4M77A 1YJNT 2O88A 2LQKA 1B7TA 3J80E 1EIFA 3CCEQ 2RB6A 3CMEQ 1B8AA 2RA2A 2E3CA 2RHQB 2L89A 2R5MA 3M53A 8AT1B 3M54A 4LVKA 2QASA 3H8ZA 1PRMC 3V8LA 1E7OA 4TQDA 3A7AA 1W2BA 2DPPB 3WVDB 1SSHA 4TWAA 2IY5A 3PCOB 3REUA 3OYHA 2FO0A 4TVAB 4F7UA 2HL5C 4ZN3A 3JSCA 3WXMB 1VQKA 4OMOA 1OULA 2L3RA 1PD0A 2QHVA 4JJDA 4M78B 4E47A 5KNNA 2QEXT 2EQJA 2EBPA 4J8OA 2O2OA 1QVFP 3GOXA 3CQTA 3CC4Q 1M90C 1I07A 1IHVA 2KYBA 1YIJT 3VUZA 1IGUA 4EMKB 4ESRA 1E1TA 1HTTA 2I4OA 4PK4A 2DL7A 4OB1B 1VQ5T 5J39A 3ER0A 1K73C 4C0ZA 3IKLA 1Y71A 2AKWA 4M77D 2RQTA 2FRYA 3TQ7P 3ULRB 1K9MR 1M2VA 3BE3A 3CCJA 5GAN3 1U06A 1EVLA 2GTOA 5KYNA 1RAEB 4K87A 1W70A 1P92A 2NUPA 1TU0B 1D09B 2LDMA 1TS9A 4A4KA 3MP6A 3GNGA 4PKCC 2EQIA 4JDSA 1VQ4A 4XQ3A 1HXDA 3ZEHA 4K88A 2FVUA 2PUOB 2WSFE 4YRKA 4OMMA 2F2XA 2KRMA 3EHQA 5FRNA 3VBBA 3G6EA 2P5IA 4P75A 3BY7A 2AIRB 3A7UA 3JCMd 4PJOD 3M57A 3QTCA 4XU3A 2EYWA 3OYFA 1VYUA 4LNSA 2RJDA 4DEXA 1YGBA 2JOYA 1WHKA 4LUDA 4XTYA 3EG0A 4YRMA 1ZBJA 3LX7A 3LGLA 4C92B 1YITT 2MF2A 4HWTA 4FT4A 2RMOA 1E24A 4MZMA 5KYXA 3LSQA 4P72C 2IG0A 2P4TA 4M75G 3BDUA 2RHUA 4X1VA 2AKLA 1UTIA 1AT1B 1VQLT 1H3ZA 4M7AA 1WU7A 1QVGA 3JB9F 1VQMT 4YDQA 5D6WA 2K79A 2GFUA 4P5NA 5CCAA 1BIBA 2P0PA 4P73A 3RL6A 2GF7A 4FT2A 2MI6A 1VIEA 2QDYB 2DL5A 1Y57A 4E7IA 2EJGA 2DFUA 2A28A 4A4EA 3QO5A 1NM7A 5IXFA 2SEMA 3QYHB 2ZNJA 1JBMA 1JJ2A 4RDXA 3R07A 2GQIA 1YI2T 1MUZA 4YRSA 3FIFA 2DU5A 4M7DF 2ARUA 2FPEA 2KQWA 3C0CA 4R55A 4J9IA 2DETA 3CCSQ 1VQOT 3P8TA 3LH5A 2LNHB 5CIUA 1RABB 2QDLA 3CCRA 4N0AA 4Z8AA 1M1KU 2CYZB 1NJ1A 2RQVA 4XTWA 2CZ6B 3OW2A 5KYUB 1X2QA 1M2OA 3KXTA 4BWAA 3VYGA 1D0ZA 2FHDA 2J3LA 3EFRA 2VUBA 3OMGA 1Q86U 4ZTFA 1OEBA 1NZ9A 2QXFA 2D0NA 4E6RA 1NJ2A 4J5YA 3M0SA 1QP2A 4RG8A 1UGQB 5GMKl
chains in the Genus database with same CATH topology
4YCVA 3CCMA 3M4PA 4WF2A 5GANh 1QVFS 3PIPA 1OZ3A 3WQZA 1G3SA 4FL6A 3HSBA 4M7AE 1OI1A 3I56A 3L42A 3UWNA 3VQXA 4YRJA 2RK2A 2K4YA 1DJ7B 3C4SA 3A74A 2XDBA 5K1PA 4JJNK 2FL7A 3MF1A 1WNLA 2HD0A 3HKSA 3M55A 1Y96B 2I4LA 3M4GA 3QYGB 3V7SA 1E22A 3P8VA 4BACA 1H4SA 3UGTA 1B70A 5C52B 1YJ9T 2ZIMA 4H2TA 3QPHA 3V7RA 3TEGA 3HRIA 4C5EA 1RIQA 3OMCA 4RKUE 3A8GB 3NEMA 4HWRA 3HFVA 1O9SA 1KD1U 3V7CA 4IUQA 1UEBA 1YB3A 4P71A 2CS7A 4UP7A 4ZGJB 5CVIA 1VQPA 4YRNA 3MF2A 3CC7T 3MEAA 1WQ7A 3OS0A 1G5HA 3CCVT 5C0MA 1BI1A 4M78C 2E12A 3C95A 3G71T 4HWSA 5GAMj 2KDSA 4M77F 1WQWA 5GAOn 2Q5HA 3OA6A 2I4MA 5KCHA 4EMKC 1VQ6T 5D6YA 4BE1A 4XEOA 5FLXE 2GCXA 2ZPGB 4NOYA 4EO4A 2H3JA 3QO7A 4R56A 1X2HA 3HXXA 2QA4T 3VQVA 3N5BB 3G4ST 2L5QA 1U8RA 4H2XA 4F7UF 2K5LA 3WVEB 2MMPA 1N9RA 4M75C 4PJOF 3HY1A 2KAFA 5LJ3h 1N9WA 5E3IA 3QNEA 4C0FA 5GAMg 3X25B 5GAN5 3O8VA 3PCOA 5CKBA 1KHIA 4TVAA 2E70A 3HRKA 4EDUA 3PMTA 1YIJA 1XOVA 1U1SA 2R5AA 2K5FA 3LGFA 5A0GA 3E1SA 4M78A 1VQ5A 2XDPA 3UH0A 3PT9A 4C92C 4KT0E 2QQRA 2QQBA 1YHQA 3M4YA 3QO8A 4MDWA 1NJ6A 4Z02A 3RKWA 4DPGA 4BD3A 3OS2A 1G5VA 3JB9I 1KQSA 2ALYB 1Q86C 4OVAA 1G3YA 4MZPA 3H6ZA 1VQ7T 2CKKA 1XTDA 4UP8A 2JTMA 3L2ZA 1SSFA 3QZ5B 2K5IA 1M1GA 5GAOl 1N8RU 1IZ6A 4JRIA 5CR2A 4JRQA 3L4GB 3JCMe 1I4K1 4XTVA 4M78D 3I55T 1YITA 2IVWA 5HKCA 3HFNA 1AHJB 4YRIA 3RMSA 3TREA 2P0QA 2D9TA 3QJYA 2OTJT 1ZHIA 3HRSA 4YRQA 1K8AU 1VQLA 1FX7A 4C92A 2ARSA 3F70A 5CK9A 1VQMA 3CCLT 4TQFA 1TH7A 1HK9A 1SRYA 3MEUA 3NFCA 3ZBDA 5GAN4 5GAOq 1G5IA 3LW5E 3QDRB 3TEEA 4BI3A 2ZIOA 3GLXA 2CZ0B 3OYKA 1OZ2A 2M16A 3PIOA 2BUDA 4M75D 2O01E 4EPCA 2EIFA 3HXZA 4M7DE 4RCCA 4BB7A 2JUFA 2EQUA 4JLGA 1M1FA 2CZ1B 4RMFA 2FYKA 1G3TA 5LJ5f 5FU7B 3BW1A 3S6WA 2DXTA 4C92D 2MWPA 3KUFA 2LX9A 4LDYA 4C0DB 4E7JA 2EWNA 1D3BA 1X01A 2X4XA 1K9MU 2E64A 1B7YB 2GQVA 2QHTA 3NTHA 3UPUA 4HCBA 2AMCA 5GAMd 4LDVA 3G1ZA 3BJUA 3CCQA 2E65A 3AHUA 5LJ5g 3L2VA 3SD4A 4B9XA 3CXCS 3MO8A 2LVMA 5GANj 2Q5IA 4HWOA 4YTLA 1USYA 1VQ9T 1X6OA 5FROA 3OSSC 1NJ8A 4IKFA 4DA4A 3NETA 3A31A 3LYIA 3HFZB 3L1AA 4X9DA 2E10A 5GAN7 3M58A 5GMKe 4PJOA 1Y96A 2LNVA 2YHTA 4YRGA 1YJ9A 3IG2A 2HAXA 2ZNIA 2D0QB 3L2UA 3E9HA 2PUKB 4A4GA 1LYLA 2V8IA 1Q82C 3GP8A 4IURA 4C8QC 4M75B 2P0KA 3DLLA 3JB9G 3JCMQ 4H2VA 1VUBA 2X35A 2YLBA 3PTAA 3FEOA 3CC7A 3JCMh 5KH6A 3JB9J 1M5Q1 2MWOA 4M77E 3C94A 3G71A 3EFSA 3FDRA 2M9UA 5M9OA 2RHYA 2XU8A 4HKEA 4QQGA 1VQ6A 2EQMA 4HT9A 5CKEA 1YJWA 5AYFA 1EFWA 4M7DG 1ZBXA 2I4NA 4XK8E 5CKDA 2QA4A 4K86A 4PNOA 3HY0A 3A7RA 4LVMA 4BI4A 4ELYC 4F7UE 1BI3A 2DD5A 2QHSA 3SWNC 1NE8A 4P74C 3RUXA 3VKIA 4XTUA 4C5IA 4PJOE 3LWIA 4EMHA 4EMGA 5J26A 5HGQA 4BDZA 4FU6A 1VIFA 3BDLA 3Q1JA 3A8MB 2M0OA 1KQ1A 4M78F 2XHCA 3OB9A 4NS5A 2PVDB 5J3BA 4ZTJA 3DKMA 4BY6C 5LJ3e 2ZR3A 4KQEA 12ASA 3TEHA 1NJIU 5LJ3j 3OYBA 2OTLT 2E1HA 3E9FA 2DZ9A 5LJ5d 5EG2A 4N4IA 3HXYA 4KUIA 1FYFA 5KCOA 4OF1A 2RD1A 2ZPEB 4J6XA 2CJ9A 4UC4A 2VC8A 1I8FA 4P72A 2YLCA 4M75F 1NYRA 3X24B 2HNIA 1Z7MA 1M4ZA 4C8QD 2ALYA 5GAN6 2LT4A 3RMQA 5FU6C 4FSXA 1EQRA 3QG1A 3HP9A 2PVOB 5GAOr 3A8LB 1W2BS 3MP1A 3X26B 2CZ7B 2CJBA 2NS6A 3I55A 4J15A 3HRUA 4C92F 4DOVA 3OY9A 1ZQ1A 4CS2A 5A0LA 4PHCA 3HTZA 1IREB 3CPWA 4HWPA 5FU7C 2E6NA 2F69A 4KR3A 4NL3A 3CMAT 5GMKh 4V2SA 4H2SA 3CC2A 1M8VA 3CCLA 4L59A 5IT9E 5D6XA 2DQ3A 5A0DA 4ZGEB 4C0DC 4X5OA 5C51B 3A32A 3UGQA 1QE0A 2IY5B 2LT1A 3OYLA 4OMFB 2Y4XA 2PMFA 3KFUA 2CGHA 4JLIA 1PSFA 4QW2A 2VXFA 3OYCA 1RL2A 2DU7A 4ELZC 3CBMA 4M77G 1L0WA 3V8KA 4DQ2A 1VQKT 2DVEA 2EJFA 1Q81U 2V8KA 4QQDA 4EX5A 3JCMP 1NPRA 1WJQA 1C0AA 2L8DA 5IN1A 3CD6T 4YCWA 1OYXA 4IUUA 3JB9H 3MHXA 3RKXA 4F7UG 5GAOm 1JJCA 1WPYA 2DQ0A 2VXEA 4PJOG 4H2WA 4HT4A 2ZGWA 1S72A 2E5QA 2RK1A 3LLRA 4JUVA 4XTZA 2XI9A 1VQ4T 1H4TA 2YRVA 4KR2A 1QVGS 5GAMf 2CJAA 2RJCA 1B7YA 4BE0A 1YJNA 4ME7A 2E41A 2P0LA 1NPPA 1R8OB 5L8RE 2GFAA 4N4GA 4UP9A 4E51A 4VUBA 2F5TX 3JCMX 4C8QB 3QIIA 3J81E 4M7DC 1JJ2S 5C6SA 4XU1A 3NENA 3A8HB 5GAN8 4X9CA 2RHQA 2QQ9A 2DDZA 3URGA 3M5AA 2DTOA 2K2VA 1FXXA 1PYSB 3CMQA 4L5GA 2QEXA 3OW2S 5DLOA 3LC0A 1XQHA 2C06A 3NTKA 3UFGA 3MP8A 4YROA 2ZZGA 2ZINA 2PMEA 2KSSA 4L87A 3FJPA 1QP3A 1QF6A 4O2DA 2D6FA 4LVIA 4J83A 2V8JA 3A8OB 2KMTA 1YCYA 1VQNT 5K1XA 4EMKA 4M7AG 1BYMA 2KK4A 1K73U 1M1KC 4RQEA 2X4YA 1N6AA 2RI5A 3LH0A 3SWNB 2EJ9A 1JRIA 3QKJA 4O5VA 1SESA 2DO3A 3CCET 2DXUA 3CMET 1KMNA 2DIQA 3GF5A 4FM4B 2O4XB 4M75A 4E7KA 4NL2A 1LOJA 3MEYA 4YRLA 5DM7R 3S3NA 3FRNA 4YCUA 1O75A 1RI0A 4BY6B 3HXWA 2QQAA 1VQZA 4OP0A 4TVRA 4ZN1A 3VYHB 3OD1A 3HXUA 3HL8A 4ZTZB 1EIYB 2JTFA 2RI3A 2EL9A 4JS4A 4XTXA 3QHSA 4C0GA 3CC4T 1SETA 2C8MA 3L2RA 4C8QF 3REXA 2DZCA 3OYNA 3OQ5A 2XIDA 4BE2A 4IUVA 4M7DD 3RACA 2WACA 4M78E 1YFSA 2HBPA 3OYEA 4RMOA 1PSEA 4P3NA 3ME9A 5FU6B 3QBYA 1GGMA 4ZGDB 1J5WA 4X34A 1YI2A 3QSUA 11ASA 1X55A 3UT1A 1NNHA 2J3MA 1VQOA 3OS5A 2ZPIB 4CRIA 2OTLA 2DEQA 4CH5A 2VV5A 4YYEA 4M77C 4BUGA 3V8JA 4YREA 1Q81C 1Y7XA 2XICA 2XDDA 3CEYA 3BFMA 5LJ5e 2KY9A 4M75E 2WSCE 4QVCA 1KD1C 3JCMJ 4Q6GA 5ELNA 3RIRA 2RJFA 5C53B 1BBUA 3MCAB 4HA8A 1VQPT 5HY6A 3G7ZA 4C92E 3OYGA 2EKOA 2JN0A 3EAEA 3VQWA 3GIBA 2VGMA 2RHZA 1MGQA 3HPWA 4LDWA 4ZIBA 1Z7NA 4TVYA 1I81A 4WJ3M 5CQXA 3HHTB 5GANf 3CMAA 3W3SA 3CCST 3FB9A 2JZ2A 3VU3C 2B8AA 1QVFA 3ERRA 2EFIA 1QW1A 2LQ8A 4TVWA 1WYDA 3JRZA 3IKMB 2ZPFB 5DLQE 5HK3A 3QJ6A 2Y90A 4C5HA 4P75C 2RH2A 5GMKj 1I5LA 4NCXA 1KQSS 5I2SA 2DTHA 5GANg 2A8EA 1XNIA 2CIMA 3PZCA 5GMKm 3CD6A 2G3RA 2DJZA 4E7HA 3OYJA 4M7DB 2DAQA 2QTXA 1KQ2A 1NJ5A 4OGEA 4M7AC 4ATOA 3FC3A 1YHQT 3OS1A 4N4HA 1SERA 1BBWA 5HK0A 2WSEE 4RCBA 4P73C 3CCVA 3I7FA 4L6V5 3IALA 3CPFA 3P8BB 3L2QA 1VQ8T 2LC4A 4MMLA 3MQZA 4M78G 3CCUT 3RGLA 1KG1A 4PLIA 4ZTUB 1WLEA 1N8RC 3E9IA 1U1TA 3CBOA 5I2MA 2LRQA 3G4SA 3JCMb 4WI1A 2HQXA 4N0AC 3L2WA 2XG8D 1LNXA 4Q5WA 4XU0A 3TUPA 2A3LA 4Q15A 2Y4YA 3QUIA 1UGRB 3M59A 1K8AC 2ZZDA 3DB4A 4B9WA 1N9SA 5FRMA 4H2YA 4C8QA 3OYMA 1BI0A 4HT8A 4OB2B 2ODRC 3MEVA 2VGNA 2XK0A 3X20B 4GY5A 3PNWC 2ZR2A 3S3MA 3OYAA 3RESA 1X75C 2JVVA 1PYSA 1W66A 3PGGA 5LJ5h 2LCLA 1G3WA 4XU2A 4LVLA 1VQNA 3P8HA 4HCCA 4Y91A 5LJ3f 4C92G 5CKHA 2Q7GA 4GLKA 2RHSB 2XTIA 3DLMA 4KUDK 3NELA 2EQKA 1VQ7A 1X56A 3CCEA 2BKDN 3P8DA 4D6WA 3CMEA 4TTVA 4IUPA 1B34B 2DXCA 4LDUA 3JAME 4WJ4A 4QQ6A 3SWNA 5IAYA 2ZT6A 2ZT5A 4P74A 5LL6S 3INZA 1D3BB 5CO7A 1KC8U 1NYQA 4LVJA 3LWHA 2K3XA 1YBYA 2PQWA 3A5ZB 4G84A 4M7AD 4OB0B 5ELOA 1K9MC 3KBGA 4MZTA 1QVPA 2A7YA 3HXVA 2AMCB 2O4XA 3OSVA 4J7FA 1UGPB 5LJ3g 1IL2A 3A5YA 4HVCA 4P3PA 4PL6A 4A4HA 5CQYA 4M77B 2OTJA 3CC4A 5F5WA 4IUTA 5GANd 3L4GA 4C8QE 1WJRA 1EIYA 2EYQA 3CCQT 3MEWA 2I2LA 3GPLA 3X28B 3ASKA 1ATIA 2R58A 4P71C 4Y28E 4DOWA 4F7UB 4J6WA 3QZ9B 2RJEA 3CBPA 3SDZA 2K3YA 1Q7YU 5DY9A 4PJOB 5A2QE 2DIGA 2DTIA 3M56A 2X4JA 3T9NA 2ODRD 2ZPHB 3PFSA 4CH3A 4II1A 1H4VB 2AKWB 4CS4A 3M9QA 3SFMA 2XGTA 3RKYA 3FLGA 1ADYA 2R57A 1KMMA 2E6ZA 3E9GA 2XD0A 3QXEB 2ZCFB 4YRRA 4OLFA 2ZCEA 3CCJT 5GMKi 2Q7EA 4E7LA 1BIAA 1FWZA 1MHNA 3VV0A 3JCMV 2LCCA 5GAOp 4JRPA 2LTOA 3UDCA 3HRTA 2EAYA 5GAMe 4YPFA 2KVQG 3DB3A 4J7IA 4LD6A 2ZT7A 2RHIA 3G6ET 2DD4A 4CI0C 1YFRA 2E5AA 4RQFA 1BKBA 1W4SA 1E1OA 4QVZA 4BW9A 5CKFA 3CCSA 1VQ9A 2AHJB 1YJWT 4M7AB 1LJOA 3S3OA 3NTIA 1H641 1X2GA 2RI2A 5I21A 3DSQA 4FIBA 3JCMc 3VJPA 4HCZA 4OB3B 3OYIA 4YRTA 4A54A 2PU9B 3JCMW 3HFZA 3CXCA 4OGCA 1KOGA 4YP0A 4KULA 1M90U 3TEHB 4RG2A 5LJ3d 3ZFJA 1NJIC 2RO0A 3VQYA 4BI8B 1WGSA 3SB2A 5KE3A 2HQEA 3OYYA 2ZTGA 2QI2A 2M1HA 3OBYA 2ZPBB 3CCRT 4C8QG 2F5KA 2ZXFA 1Q82U 4UPAA 4M7DA 4H02A 1B76A 1HC7A 2G4CA 4A53A 5KE2A 3J7AF 1UGSB 2PVGB 2C7IA 4YRFA 3C12A 5GAN2 2Q7HA 1ASYA 3R6OA 4G85A 4CH4A 3CPWS 1VQ8A 1KC8C 4AH6A 4KBMB 1YFTA 1WJSA 3CCUA 3TU4K 3CCMT 3JB9D 4YRCA 3P8YA 3JCMf 4PG3A 4H2UA 2XKOC 3OYDA 3QO3A 3I56T 4JS5A 2BIVA 4M7AF 4P3OA 3VUBA 3M4QA 4MDXA 2MAMA 4PLLA 4LD9K 2QQSA 2QHUA 3CC2T 1UB4A 2K57A 4YRPA 4QVDA 1B70B 4JRKA 4XAXB 1Q7YC 2OAUA 3RF1A 2ARTA 3HFOA 1ADJA 3JCMg 1EVKA 3RERA 1JB0E 4C5GA 2RM4A 3PMIA 4O6JA 3ICAA 1M9SA 3TCJA 1GXIE 1V29B 1N27A 1EOVA 2ZZEA 2ZT8A 4LDXA 4CS3A 2VYTA 1USYC 5LJ5j 2NLUA 2RHSA 1KHCA 1JJCB 4MMKA 2FB7A 5GAMh 3OBWA 3LSSA 1B34A 1X54A 2X4WA 4PJOC 2ZZFA 4CH6A 4J6YA 2DXBA 1ASZA 3A5ZA 4A4FA 1G51A 1S72T 4XEMA 4BDYA 5CAIA 2RHXA 2JNGA 2DK3A 3GNFB 1Y07A 1H4QA 5GANe 3META 4H2XB 1BI2A 3E19A 2DKGA 4M77A 1YJNT 2LQKA 3J80E 1EIFA 2RB6A 1B8AA 2RA2A 2E3CA 2RHQB 2L89A 2R5MA 3M53A 3M54A 4LVKA 3H8ZA 3V8LA 4TQDA 3A7AA 1W2BA 2DPPB 3WVDB 4TWAA 2IY5A 3PCOB 3REUA 3OYHA 4TVAB 4F7UA 4ZN3A 3JSCA 3WXMB 1VQKA 2L3RA 2QHVA 4M78B 4E47A 5KNNA 2QEXT 2EQJA 4J8OA 3GOXA 1M90C 1YIJT 3VUZA 4EMKB 1E1TA 1HTTA 2I4OA 4OB1B 1VQ5T 5J39A 3ER0A 1K73C 4C0ZA 3IKLA 1Y71A 2AKWA 4M77D 3CCJA 5GAN3 1EVLA 4K87A 1P92A 2LDMA 4A4KA 3MP6A 3GNGA 4PKCC 4JDSA 1VQ4A 4XQ3A 1HXDA 3ZEHA 4K88A 2FVUA 2PUOB 2WSFE 4YRKA 5FRNA 3VBBA 3G6EA 2P5IA 4P75A 3BY7A 3A7UA 3JCMd 4PJOD 3M57A 3QTCA 4XU3A 3OYFA 4LNSA 2RJDA 1YGBA 2JOYA 4YRMA 4XTYA 3LX7A 3LGLA 4C92B 1YITT 2MF2A 4HWTA 4FT4A 1E24A 4MZMA 3LSQA 4P72C 2IG0A 2P4TA 4M75G 3BDUA 2RHUA 1VQLT 1H3ZA 4M7AA 1WU7A 1QVGA 3JB9F 1VQMT 4YDQA 5D6WA 2GFUA 4P5NA 5CCAA 1BIBA 2P0PA 4P73A 3RL6A 2GF7A 4FT2A 2MI6A 1VIEA 2QDYB 4E7IA 2EJGA 4A4EA 3QO5A 3QYHB 2ZNJA 1JBMA 1JJ2A 4RDXA 3R07A 1YI2T 4YRSA 3FIFA 2DU5A 4M7DF 2ARUA 2KQWA 4R55A 1VQOT 3P8TA 5CIUA 3CCRA 4N0AA 1M1KU 2CYZB 1NJ1A 4XTWA 2CZ6B 3OW2A 3KXTA 4BWAA 3VYGA 2FHDA 2J3LA 3EFRA 2VUBA 3OMGA 1Q86U 4ZTFA 1NZ9A 2QXFA 1NJ2A 4J5YA 1QP2A 4RG8A 1UGQB 5GMKl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW9 A;  4YCV A;  4M7A B;  3M4P A;  1GGM A;  1LYL A;  4WF2 A;  5GAN h;  1J5W A;  1LJO A;  3QSU A;  11AS A;  1H64 1;  1X2G A;  1X55 A;  4C8Q C;  4M75 B;  1NNH A;  2J3M A;  3WQZ A;  5I21 A;  3DSQ A;  3JCM c;  3JB9 G;  2DEQ A;  3JCM Q;  4H2V A;  4CH5 A;  2YLB A;  3HSB A;  4M7A E;  3JCM h;  4YYE A;  4M77 C;  3JB9 J;  3V8J A;  4YRT A;  4YRE A;  4A54 A;  3VQX A;  1M5Q 1;  3JCM W;  3HFZ A;  4YRJ A;  3BFM A;  5LJ5 e;  4M75 E;  4M77 E;  4QVC A;  3EFS A;  4YP0 A;  1KOG A;  3A74 A;  3TEH B;  5LJ3 d;  3JCM J;  5K1P A;  3VQY A;  3MF1 A;  4HT9 A;  1WNL A;  3SB2 A;  4Q6G A;  1Y96 B;  5ELN A;  2I4L A;  1EFW A;  4M7D G;  2ZTG A;  2I4N A;  3M4G A;  3RIR A;  4K86 A;  3V7S A;  4PNO A;  3HY0 A;  3A7R A;  5C53 B;  1BBU A;  4F7U E;  1E22 A;  3P8V A;  4C8Q G;  2QHS A;  2ZXF A;  1H4S A;  4HA8 A;  3SWN C;  3UGT A;  1B70 A;  5C52 B;  4P74 C;  4UPA A;  3RUX A;  4M7D A;  4H02 A;  4XTU A;  4C92 E;  1B76 A;  4PJO E;  1HC7 A;  2ZIM A;  2G4C A;  4A53 A;  4EMH A;  2JN0 A;  3VQW A;  2C7I A;  4EMG A;  3GIB A;  4YRF A;  5HGQ A;  1MGQ A;  5GAN 2;  2Q7H A;  4H2T A;  4ZIB A;  1ASY A;  4G85 A;  3V7R A;  1Z7N A;  4CH4 A;  3TEG A;  4TVY A;  3HRI A;  1I81 A;  4WJ3 M;  1RIQ A;  4AH6 A;  1YFT A;  5GAN f;  1KQ1 A;  4M78 F;  3W3S A;  3NEM A;  3FB9 A;  4HWR A;  3HFV A;  3VU3 C;  3JB9 D;  5LJ3 e;  3V7C A;  2ZR3 A;  4KQE A;  12AS A;  3ERR A;  3TEH A;  1YB3 A;  4YRC A;  3P8Y A;  4P71 A;  3JCM f;  5LJ3 j;  4UP7 A;  2E1H A;  4TVW A;  2DZ9 A;  5LJ5 d;  4PG3 A;  1WYD A;  4H2U A;  3IKM B;  3HXY A;  1FYF A;  4YRN A;  3MF2 A;  3QO3 A;  2Y90 A;  1WQ7 A;  2RD1 A;  4J6X A;  1G5H A;  4P75 C;  4M7A F;  2CJ9 A;  2VC8 A;  4P3O A;  4M78 C;  5GMK j;  1I8F A;  4P72 A;  2YLC A;  4HWS A;  1I5L A;  5GAM j;  4NCX A;  4M75 F;  4M77 F;  1WQW A;  5GAO n;  3M4Q A;  2Q5H A;  2I4M A;  2DTH A;  1NYR A;  5GAN g;  2HNI A;  4EMK C;  4XEO A;  2CIM A;  3PZC A;  1Z7M A;  2QHU A;  2K57 A;  4NOY A;  4QVD A;  5GMK m;  4C8Q D;  4YRP A;  4EO4 A;  1B70 B;  4JRK A;  2DJZ A;  3QO7 A;  2ALY A;  4M7D B;  5GAN 6;  1X2H A;  3HXX A;  3VQV A;  3RF1 A;  2ART A;  2QTX A;  1KQ2 A;  3HFO A;  1ADJ A;  3JCM g;  1EVK A;  1NJ5 A;  4M7A C;  1EQR A;  4H2X A;  3RER A;  4F7U F;  5GAO r;  1SER A;  1BBW A;  2RM4 A;  3ICA A;  1N9R A;  4M75 C;  2CJB A;  4RCB A;  4J15 A;  4P73 C;  3I7F A;  4C92 F;  4PJO F;  3HY1 A;  3IAL A;  5LJ3 h;  1N9W A;  5E3I A;  1EOV A;  2ZZE A;  4CS2 A;  2ZT8 A;  4PHC A;  3HTZ A;  4MML A;  4CS3 A;  4M78 G;  4HWP A;  3QNE A;  5GAM g;  5GAN 5;  1USY C;  5LJ5 j;  3RGL A;  4KR3 A;  4NL3 A;  3PCO A;  4ZTU B;  1WLE A;  4TVA A;  2RHS A;  3HRK A;  5GMK h;  4V2S A;  4H2S A;  1M8V A;  3E9I A;  1U1T A;  1JJC B;  4MMK A;  2FB7 A;  5GAM h;  2DQ3 A;  1U1S A;  4X5O A;  5C51 B;  3A32 A;  3UGQ A;  1QE0 A;  2IY5 B;  4M78 A;  3LSS A;  3JCM b;  1B34 A;  4WI1 A;  3UH0 A;  4N0A C;  2PMF A;  3KFU A;  2CGH A;  1X54 A;  4C92 C;  1LNX A;  4PJO C;  4JLI A;  4XU0 A;  2ZZF A;  3TUP A;  2VXF A;  4CH6 A;  3QO8 A;  4Q15 A;  3QUI A;  4J6Y A;  1ASZ A;  1NJ6 A;  2DU7 A;  3A5Z A;  3RKW A;  1G51 A;  4DPG A;  3JB9 I;  1N9S A;  4M77 G;  4XEM A;  1L0W A;  5CAI A;  4H2Y A;  3V8K A;  4C8Q A;  4DQ2 A;  2ALY B;  4HT8 A;  2DVE A;  2EJF A;  2ODR C;  1H4Q A;  4EX5 A;  3JCM P;  4UP8 A;  1C0A A;  5GAN e;  4H2X B;  3L2Z A;  2DKG A;  4YCW A;  2ZR2 A;  4M77 A;  3JB9 H;  2RB6 A;  3RES A;  1B8A A;  1PYS A;  2RA2 A;  1W66 A;  3PGG A;  2E3C A;  5LJ5 h;  5GAO l;  2RHQ B;  3RKX A;  4F7U G;  4JRI A;  4XU2 A;  5GAO m;  3L4G B;  3JCM e;  1JJC A;  1I4K 1;  1WPY A;  3V8L A;  4XTV A;  4TQD A;  4Y91 A;  3A7A A;  5LJ3 f;  2DQ0 A;  4M78 D;  4C92 G;  2VXE A;  4PJO G;  4H2W A;  4TWA A;  2IY5 A;  3PCO B;  3REU A;  3HFN A;  4YRI A;  2Q7G A;  4TVA B;  2RHS B;  2ZGW A;  4F7U A;  4XTZ A;  4JUV A;  2XTI A;  4YRQ A;  3NEL A;  2QHV A;  1X56 A;  4M78 B;  1H4T A;  4KR2 A;  4TTV A;  5GAM f;  1B34 B;  5KNN A;  4C92 A;  2CJA A;  2ARS A;  4WJ4 A;  1B7Y A;  3SWN A;  2ZT6 A;  2ZT5 A;  4P74 A;  3INZ A;  4TQF A;  1D3B B;  1TH7 A;  1NYQ A;  2E41 A;  4EMK B;  1HK9 A;  1E1T A;  1HTT A;  2I4O A;  1G5I A;  1SRY A;  5GAN 4;  5GAO q;  4G84 A;  4M7A D;  5ELO A;  2P0L A;  4UP9 A;  3IKL A;  4E51 A;  2ZIO A;  2AKW A;  3HXV A;  4M77 D;  4M75 D;  3JCM X;  2AMC B;  4C8Q B;  4M7D C;  5LJ3 g;  5GAN 3;  1EVL A;  3HXZ A;  1IL2 A;  4XU1 A;  3A5Y A;  3NEN A;  4HVC A;  5GAN 8;  4M7D E;  4RCC A;  4X9C A;  4K87 A;  2RHQ A;  4P3P A;  2DDZ A;  4M77 B;  5F5W A;  5GAN d;  3L4G A;  2DTO A;  1PYS B;  4C8Q E;  4XQ3 A;  1HXD A;  4K88 A;  1EIY A;  3CMQ A;  4RMF A;  3LC0 A;  4YRK A;  2FYK A;  3UFG A;  5LJ5 f;  4YRO A;  3BW1 A;  2ZZG A;  2I2L A;  3VBB A;  2P5I A;  4P75 A;  3BY7 A;  2ZIN A;  2DXT A;  3A7U A;  3JCM d;  1ATI A;  4L87 A;  2PME A;  3FJP A;  4C92 D;  4P71 C;  4PJO D;  1QF6 A;  4O2D A;  3QTC A;  4F7U B;  4J6W A;  1YCY A;  4XU3 A;  2EWN A;  4LNS A;  1D3B A;  5K1X A;  1YGB A;  1X01 A;  5DY9 A;  4YRM A;  4XTY A;  4EMK A;  4M7A G;  4C92 B;  2E64 A;  4PJO B;  1B7Y B;  4HWT A;  4RQE A;  2QHT A;  3SWN B;  1E24 A;  2EJ9 A;  1JRI A;  3LSQ A;  2DTI A;  4P72 C;  4M75 G;  1SES A;  3BDU A;  2ODR D;  2AMC A;  5GAM d;  4CH3 A;  3G1Z A;  2DXU A;  4M7A A;  1WU7 A;  3BJU A;  1H4V B;  1KMN A;  2E65 A;  3JB9 F;  2AKW B;  3AHU A;  4YDQ A;  4CS4 A;  5LJ5 g;  2XGT A;  1BIB A;  3RKY A;  4M75 A;  4P73 A;  4NL2 A;  1ADY A;  3RL6 A;  1LOJ A;  1KMM A;  3MEY A;  4YRL A;  5GAN j;  4YCU A;  2Q5I A;  3HXW A;  2EJG A;  4YRR A;  1VQZ A;  4HWO A;  4OP0 A;  4OLF A;  3QO5 A;  2ZCE A;  1USY A;  3OD1 A;  3HXU A;  4ZTZ B;  2ZNJ A;  1JBM A;  5GMK i;  1NJ8 A;  2Q7E A;  3R07 A;  4RDX A;  1EIY B;  2EL9 A;  1BIA A;  4YRS A;  3FIF A;  3NET A;  4XTX A;  3QHS A;  2DU5 A;  4M7D F;  2ARU A;  3A31 A;  3HFZ B;  3P8T A;  3L1A A;  3JCM V;  4X9D A;  1SET A;  5GAO p;  2E10 A;  4N0A A;  5GAN 7;  2C8M A;  2EAY A;  1NJ1 A;  4XTW A;  5GMK e;  4PJO A;  1Y96 A;  4C8Q F;  2YHT A;  5GAM e;  4YPF A;  4BWA A;  4YRG A;  3IG2 A;  3REX A;  2DZC A;  2J3L A;  2ZT7 A;  3EFR A;  2ZNI A;  1YFR A;  1NJ2 A;  3E9H A;  4M7D D;  2E5A A;  3RAC A;  4J5Y A;  4M78 E;  1YFS A;  4P3N A;  4RQF A;  5GMK l;  1E1O A; 
#chains in the Genus database with same CATH topology
 1M3A A;  4YCV A;  2F2V A;  2SRC A;  3CCM A;  2LMJ A;  2B86 A;  3M4P A;  4WF2 A;  5GAN h;  1QVF S;  2QGG A;  1ZA1 B;  4IIM A;  2K3B A;  3PIP A;  1OZ3 A;  3WQZ A;  1G3S A;  2QTV A;  4FL6 A;  5KYW A;  3HSB A;  4M7A E;  1OI1 A;  2RN8 A;  1MMD A;  3I56 A;  3L42 A;  3UWN A;  3VQX A;  4YRJ A;  2RK2 A;  3VRY A;  2K4Y A;  1YHQ Q;  1M8M A;  1DJ7 B;  3C4S A;  1BCM A;  3A74 A;  1M3C A;  2XDB A;  1SF9 A;  5K1P A;  4JJN K;  2FL7 A;  3MF1 A;  1WNL A;  1RAC B;  2HD0 A;  3HKS A;  3M55 A;  1Y96 B;  1VQ8 Q;  2I4L A;  2MOX A;  1NJI R;  2YUQ A;  3M4G A;  2ESW A;  4OMP A;  4HCK A;  3CCU Q;  3QYG B;  3V7S A;  3E2U A;  1E22 A;  3P8V A;  4BAC A;  3I35 A;  4F04 B;  1H4S A;  3UGT A;  1B70 A;  5AT1 B;  5C52 B;  1YJ9 T;  2ZIM A;  1ZX6 A;  2K7A A;  4DBQ A;  4H2T A;  3AT1 B;  3QPH A;  3V7R A;  2KBT A;  3TEG A;  3HRI A;  1WHL A;  4C5E A;  1RIQ A;  3OMC A;  4B6M A;  4RKU E;  4WCI A;  2BTT A;  3A8G B;  3I9Q A;  3NEM A;  2DE0 X;  4HWR A;  3HFV A;  1O9S A;  1KD1 U;  4LUE A;  1UJ0 A;  3V7C A;  4IUQ A;  4OMQ A;  1UEB A;  1H8K A;  1YB3 A;  2F1L A;  4P71 A;  2CS7 A;  2JTE A;  4UP7 A;  4ZGJ B;  5CVI A;  9ATC B;  2A08 A;  1VQP A;  3VS7 A;  4YRN A;  3MF2 A;  3CC7 T;  3MEA A;  1WQ7 A;  3OS0 A;  1G5H A;  3CCV T;  4FYX B;  5C0M A;  1BI1 A;  1E6H A;  2D8J A;  2DLP A;  4AMC A;  4M78 C;  2E12 A;  3C95 A;  3G71 T;  4HWS A;  5GAM j;  2KDS A;  4M77 F;  1QMC A;  1WQW A;  5GAO n;  2Q5H A;  3OA6 A;  2CP7 A;  2I4M A;  5KCH A;  3D7S B;  1N5Z A;  2EGA A;  2NYS A;  4EMK C;  1VQ6 T;  5D6Y A;  4BE1 A;  2V26 A;  4XEO A;  5FLX E;  2GCX A;  2ZPG B;  4NOY A;  4EO4 A;  2H3J A;  3QO7 A;  4KGX B;  2AT1 B;  4R56 A;  1X2H A;  2M51 A;  2E5K A;  3HXX A;  2QA4 T;  3VQV A;  3N5B B;  3G4S T;  2L5Q A;  1U8R A;  1UFF A;  2MPX C;  4H2X A;  3ZL7 C;  4F7U F;  2K5L A;  3WVE B;  2MMP A;  4JZ4 A;  1UEC A;  1N9R A;  3M0P A;  4M75 C;  4PJL A;  2J6O A;  2RQU A;  4PJO F;  3HY1 A;  1PCX A;  2KAF A;  5LJ3 h;  1N9W A;  5E3I A;  1LPL A;  1Q81 R;  3QNE A;  4C0F A;  5GAM g;  3X25 B;  5GAN 5;  4J9H A;  3O8V A;  1JQQ A;  3PCO A;  5CKB A;  2Z0W A;  1KHI A;  3M0Q A;  4TVA A;  2E70 A;  3HRK A;  4QT7 A;  4EDU A;  3PMT A;  1YIJ A;  1XOV A;  1NG2 A;  1U1S A;  4K11 A;  1QCF A;  2R5A A;  2K5F A;  3LGF A;  5A0G A;  2HCK A;  3E1S A;  3CCQ Q;  4ORZ A;  4M78 A;  1VQ5 A;  2XDP A;  1NYF A;  3UH0 A;  3PT9 A;  2YSQ A;  3VS2 A;  4C92 C;  1Z9Q A;  4KT0 E;  2QQR A;  2QQB A;  1YHQ A;  4KH1 B;  3M4Y A;  3CXC P;  3QO8 A;  4MDW A;  1NJ6 A;  4Z02 A;  4DEY A;  1KSW A;  2HDA A;  1VA7 A;  3RKW A;  1OPK A;  4DPG A;  2EYY A;  1D1A A;  4BD3 A;  3OS2 A;  1G5V A;  3JB9 I;  4QKU A;  3H0I A;  1KQS A;  2ALY B;  2V1Q A;  1Q86 C;  4OVA A;  2KXC A;  1G3Y A;  3RNJ A;  1M27 C;  4MZP A;  3H6Z A;  1VQ7 T;  2CKK A;  2X3W D;  1CSK A;  4FYV B;  1XTD A;  4UP8 A;  1KK7 A;  2JTM A;  2FRW A;  3L2Z A;  1SSF A;  3QZ5 B;  2JT4 A;  2K5I A;  1M1G A;  1WI7 A;  5GAO l;  3KFV A;  2DEU A;  1N8R U;  1IZ6 A;  4JRI A;  5CR2 A;  4JRQ A;  3L4G B;  3JCM e;  1ZUK A;  1I4K 1;  4XTV A;  2VWF A;  1OU9 A;  4M78 D;  1WHH A;  3I55 T;  1YIT A;  2IVW A;  4RTV A;  3HFN A;  5HKC A;  1AHJ B;  4YRI A;  3RMS A;  3TRE A;  2P0Q A;  2D9T A;  2X51 A;  3QJY A;  2OTJ T;  1ZHI A;  3CCJ Q;  3HRS A;  4YRQ A;  1RAF B;  1K8A U;  5L23 A;  1X43 A;  1VQL A;  1FX7 A;  4C92 A;  2ARS A;  3F70 A;  2DYI A;  1PKS A;  5CK9 A;  1VQM A;  2VVK A;  1OX9 A;  4RTT A;  3CCL T;  4TQF A;  1TH7 A;  1HK9 A;  3I5S A;  1MNE A;  3MEU A;  3NFC A;  3ZBD A;  5GAN 4;  5GAO q;  1G5I A;  1SRY A;  1ARK A;  3LW5 E;  3QDR B;  3TEE A;  4BI3 A;  2MCN A;  2ZIO A;  3GLX A;  2CZ0 B;  1OZ2 A;  2M16 A;  4M75 D;  2BUD A;  2JM9 A;  4EPC A;  2O01 E;  3PIO A;  3OYK A;  2DF6 A;  2FPF A;  3G6E Q;  2EIF A;  1K73 R;  3HXZ A;  1WHJ A;  4M7D E;  1OOT A;  4RCC A;  4M4Z A;  1QLY A;  2RNA A;  2JM8 A;  4BB7 A;  2JUF A;  2EQU A;  4JLG A;  1YJW Q;  1M1F A;  1NYG A;  2CZ1 B;  1RAH B;  3GBQ A;  4RMF A;  3REA B;  2FYK A;  1PG5 B;  2DIL A;  1GL5 A;  2QAZ A;  1G3T A;  1OQK A;  5LJ5 f;  5FU7 B;  2QYZ A;  3BW1 A;  3S6W A;  2DBK A;  1QCO A;  2DXT A;  1LVK A;  1ABO A;  4C92 D;  2MWP A;  3KUF A;  2LX9 A;  1OV3 A;  4LDY A;  5KYU A;  4C0D B;  2KI7 A;  2ENM A;  3UF4 A;  2KRO A;  2VB6 A;  4E7J A;  2EWN A;  1D3B A;  1X01 A;  2DRK A;  2X4X A;  1NLP C;  2K6D A;  1PKT A;  1K9M U;  2E64 A;  1B7Y B;  2GQV A;  2QHT A;  1WA7 A;  3NMZ C;  3NTH A;  1FMK A;  2GGR A;  3UPU A;  4HCB A;  2AMC A;  1TWB A;  5GAM d;  1SEM A;  2JMC A;  4LDV A;  3G1Z A;  3BJU A;  3CCQ A;  2NUT B;  2E65 A;  3AHU A;  4FYY B;  1PHT A;  1WHG A;  5LJ5 g;  2NUZ A;  2XMF A;  3L2V A;  3SD4 A;  4B9X A;  3CCR Q;  3CXC S;  1TUD A;  2X3X D;  3MO8 A;  4KRT A;  2DYB A;  2LVM A;  5GAN j;  2Q5I A;  4HWO A;  4YTL A;  1USY A;  1VQ9 T;  1AZG B;  1X6O A;  2DA9 A;  4JJC A;  3OSS C;  5FRO A;  1NJ8 A;  4PJN A;  4IKF A;  4DA4 A;  3NET A;  3A31 A;  3LYI A;  3M0T A;  3HFZ B;  1R77 A;  2YRD A;  3L1A A;  3CCM Q;  4X9D A;  2FPD A;  2E10 A;  5GAN 7;  3M58 A;  1IO6 A;  5GMK e;  4PJO A;  1Y96 A;  2LNV A;  2YHT A;  2BZ8 A;  4YRG A;  1YJ9 A;  3IG2 A;  1ZSG A;  2HAX A;  2ZNI A;  4RTX A;  4RTY A;  2D0Q B;  3L2U A;  3E9H A;  1AOJ A;  3I56 Q;  2FG0 A;  4LXC A;  2PUK B;  4A4G A;  5GJW B;  2LCS A;  2V8I A;  1LYL A;  1RUW A;  2J7I A;  1Q82 C;  3GP8 A;  4IUR A;  3MJX A;  4C8Q C;  3A1P A;  4M75 B;  3CC2 Q;  2P0K A;  2CUB A;  3DLL A;  3JB9 G;  3JCM Q;  4H2V A;  1VUB A;  2X35 A;  2YLB A;  3PTA A;  3FEO A;  3CC7 A;  3JCM h;  5KH6 A;  3JB9 J;  2NWM A;  5ECA A;  1M5Q 1;  1WXB A;  2MWO A;  4M77 E;  1UGV A;  3C94 A;  3G71 A;  1WYX A;  3EFS A;  3FDR A;  2M9U A;  5M9O A;  1UJY A;  2RHY A;  2XU8 A;  4HKE A;  4QQG A;  1VQ6 A;  2YWW A;  2EQM A;  4HT9 A;  3SEM A;  5CKE A;  1YJW A;  4HVW A;  1QKW A;  5AYF A;  3VS6 A;  1EFW A;  4M7D G;  1ZBX A;  2I4N A;  4XK8 E;  5CKD A;  4DBF A;  1JU5 C;  2QA4 A;  4K86 A;  4PNO A;  3HY0 A;  3A7R A;  4LVM A;  4FCY A;  4BI4 A;  4ELY C;  4F7U E;  1BI3 A;  1SHG A;  2JMA A;  2DD5 A;  2QHS A;  3SWN C;  4PJJ A;  1NE8 A;  4P74 C;  3RUX A;  3VKI A;  4XTU A;  4C5I A;  1ZUY A;  2JS2 A;  3LWI A;  4PJO E;  4EMH A;  1V1C A;  3QDF A;  4EMG A;  5J26 A;  5HGQ A;  4BDZ A;  1C1A A;  4R0K A;  4FU6 A;  1VIF A;  1VQP Q;  1T3L A;  1IB8 A;  1NEB A;  3BDL A;  2LZ6 B;  3Q1J A;  2PTK A;  1GFD A;  3A8M B;  1W1F A;  2M0O A;  1KQ1 A;  4M78 F;  1JO8 A;  2XHC A;  3OB9 A;  4NS5 A;  1S72 Q;  1R0C B;  2PVD B;  2DM1 A;  5J3B A;  3JV3 A;  4ZTJ A;  3DKM A;  4BY6 C;  1M3B A;  5LJ3 e;  2DJQ A;  2ZR3 A;  2DBM A;  3FJ5 A;  1NLO C;  4KQE A;  3UA6 A;  12AS A;  3TEH A;  1QVG P;  1NJI U;  4D8D A;  1ABQ A;  2P84 A;  4JZ3 A;  1ACM B;  5LJ3 j;  1HSQ A;  4RUG A;  3OYB A;  2OTL T;  2MK5 A;  2E1H A;  3E9F A;  1YJN Q;  1HJD A;  2DZ9 A;  5LJ5 d;  5EG2 A;  1TUC A;  4N4I A;  3HXY A;  4KUI A;  1FYF A;  4HXJ A;  2QK0 A;  5KCO A;  4OF1 A;  1FMV A;  2RD1 A;  2ZPE B;  4J6X A;  2BZY A;  2CJ9 A;  4UC4 A;  2VC8 A;  2OAW A;  1I8F A;  2E4H A;  1Q95 G;  4P72 A;  2YLC A;  4M75 F;  2AZS A;  1NYR A;  1VOM A;  2KGT A;  3X24 B;  2EGC A;  2HNI A;  2F2W A;  1WIE A;  2E3I A;  2FZC B;  1Z7M A;  1M4Z A;  4C8Q D;  2ALY A;  5GAN 6;  2M0Y A;  1YFN A;  2QEX Q;  2CDT A;  2LT4 A;  1IHW A;  3OW2 P;  3RMQ A;  5FU6 C;  4FSX A;  1BK2 A;  1EQR A;  3QG1 A;  1YIJ Q;  3HP9 A;  2PVO B;  5GAO r;  4WTO B;  3A8L B;  1W2B S;  2DL3 A;  3MP1 A;  3X26 B;  2CZ7 B;  1VQ5 Q;  1Y0M A;  2CJB A;  2NS6 A;  3I55 A;  4J15 A;  3HRU A;  4C92 F;  4PFO A;  5FWC A;  4DOV A;  3OY9 A;  1ZQ1 A;  4CS2 A;  5A0L A;  4PHC A;  3HTZ A;  1IRE B;  4RTZ A;  5EC7 A;  3CPW A;  4HWP A;  5FU7 C;  2E6N A;  1OX8 A;  2F69 A;  4KR3 A;  4NL3 A;  3CMA T;  4FSS A;  5GMK h;  4V2S A;  3CC2 A;  4H2S A;  1M8V A;  3CCL A;  4L59 A;  5IT9 E;  5D6X A;  2EGE A;  1RAI B;  4ZGE B;  5A0D A;  2DQ3 A;  1ZSZ B;  4C0D C;  4X5O A;  1ZA2 B;  2CP6 A;  5C51 B;  3A32 A;  3UGQ A;  1QE0 A;  2IY5 B;  5I11 A;  2LT1 A;  4OML A;  3OYL A;  4OMF B;  2K9G A;  2Y4X A;  2FZK B;  2PMF A;  1HD3 A;  1SKU B;  2CGH A;  3KFU A;  4JLI A;  1SPK A;  1PSF A;  3EG9 B;  1QCN A;  4QW2 A;  2VXF A;  3OYC A;  1RL2 A;  2ATC B;  2DU7 A;  4ELZ C;  1JEG A;  2RQR A;  3CBM A;  1TTH B;  1YWP A;  4M77 G;  1L0W A;  3V8K A;  1BBZ A;  2COZ A;  4DQ2 A;  1VQK T;  1YIT Q;  2DVE A;  2EJF A;  1Q81 U;  2V8K A;  4QQD A;  5IHI A;  3JCM P;  4EX5 A;  1MV0 B;  1NPR A;  1WJQ A;  1C0A A;  1KC8 R;  2L8D A;  5IN1 A;  3CD6 T;  4YCW A;  1OYX A;  1AWX A;  4IUU A;  3JB9 H;  2VKN A;  1VQL Q;  1VQM Q;  3MHX A;  5KYY B;  2NUP B;  1GBQ A;  3RKX A;  4F7U G;  1FYN A;  3MPU B;  5GAO m;  1JJC A;  1WPY A;  5IXB A;  2DQ0 A;  4J9E A;  2VXE A;  4PJO G;  4H2W A;  4HT4 A;  4CC2 A;  2L3P A;  3UA7 A;  2ZGW A;  1G2B A;  1S72 A;  2E5Q A;  2RK1 A;  3LLR A;  4JUV A;  4XTZ A;  2CRE A;  2CP2 A;  1FMW A;  2XI9 A;  2J06 A;  2KYM A;  1VQ4 T;  1H4T A;  2YRV A;  4KR2 A;  1YI2 Q;  5GAM f;  1QVG S;  2CJA A;  2RJC A;  1B7Y A;  5D7U A;  4EIK A;  4BE0 A;  4PFZ A;  2LQN A;  1VQO Q;  3RDV A;  2EPD A;  1YJN A;  4ME7 A;  4F16 A;  2E41 A;  2P0L A;  1NPP A;  1R8O B;  2LX7 A;  1MMA A;  5L8R E;  2GFA A;  4N4G A;  4UP9 A;  4E51 A;  2NUT A;  4VUB A;  1Q7Y R;  2GBQ A;  2F5T X;  3JCM X;  4C8Q B;  3QII A;  3J81 E;  4M7D C;  1WFW A;  4LN2 A;  1AD5 A;  1JJ2 S;  5C6S A;  4XU1 A;  3NEN A;  3A8H B;  5GAN 8;  2AK5 A;  2L3Q A;  4X9C A;  3REB B;  2RHQ A;  2QQ9 A;  2DDZ A;  3URG A;  3M5A A;  2DTO A;  4ANJ A;  2K2V A;  1FXX A;  1PYS B;  1TOV A;  2ZAE A;  1D1B A;  3CMQ A;  4L5G A;  2QEX A;  3OW2 S;  5DLO A;  3LC0 A;  3THK A;  1XQH A;  2C06 A;  3NTK A;  5GJV B;  2JS0 A;  4Z88 A;  3UFG A;  3MP8 A;  4YRO A;  2ZZG A;  2QGF B;  1GCQ C;  2ZIN A;  2PME A;  3A98 A;  3HTR A;  2KSS A;  4L87 A;  3FJP A;  1QP3 A;  1QF6 A;  1V76 A;  4O2D A;  2D6F A;  4LVI A;  2EYZ A;  4J83 A;  2V8J A;  3A8O B;  2KMT A;  1YCY A;  4FW1 A;  1D1C A;  1PWT A;  1VQN T;  1RAG B;  1QQJ A;  5K1X A;  4EMK A;  4M7A G;  1BYM A;  2KK4 A;  1K73 U;  1M1K C;  4RQE A;  2X4Y A;  4PFP A;  2ROL A;  1N6A A;  2RI5 A;  3LH0 A;  3SWN B;  2EJ9 A;  1JRI A;  1T0H A;  3QKJ A;  4O5V A;  1SES A;  1QWE A;  1CKB A;  2DNU A;  2PZ1 A;  2DO3 A;  4F17 A;  3CCE T;  2DXU A;  3CME T;  2DMO A;  1KMN A;  2LJ0 A;  2DIQ A;  3GF5 A;  4FM4 B;  2O4X B;  4M75 A;  1MMG A;  4E7K A;  4NL2 A;  1LOJ A;  3MEY A;  2K2M A;  4YRL A;  5DM7 R;  3S3N A;  3FRN A;  4YCU A;  1O75 A;  1RI0 A;  4BY6 B;  2H8H A;  1YJ9 Q;  4LE9 A;  3HXW A;  4KH0 B;  1GFC A;  1UHF A;  2QQA A;  1VQZ A;  4OP0 A;  2OI3 A;  4TVR A;  4ZN1 A;  3VYH B;  3OD1 A;  2IIM A;  3HXU A;  3HL8 A;  1R0B G;  4RTU A;  4ZTZ B;  1EIY B;  1SG5 A;  2YXY A;  2JTF A;  1H3H A;  2RI3 A;  2EL9 A;  4JS4 A;  2AZV A;  5KYW B;  1ZUU A;  1RI9 A;  4XTX A;  3QHS A;  5FW9 A;  4C0G A;  4J9C A;  5IH2 A;  3CC4 T;  4CC3 A;  1X69 A;  1SET A;  2C8M A;  3NHN A;  3L2R A;  2KNB B;  4C8Q F;  4JJB A;  2CSI A;  3REX A;  2DZC A;  3OYN A;  3OQ5 A;  2XID A;  4BE2 A;  1M90 R;  2YUO A;  3I5R A;  3CC7 Q;  2HKQ B;  4IUV A;  4M7D D;  1PM3 A;  1BU1 A;  4LNP A;  3RAC A;  2WAC A;  4M78 E;  1YFS A;  2HBP A;  3OYE A;  4RMO A;  1PSE A;  4JPB W;  3CCV Q;  4P3N A;  3ME9 A;  1IGQ A;  5FU6 B;  4AFS C;  3G71 Q;  3QBY A;  2V1R A;  1GGM A;  4ZGD B;  1J3T A;  1J5W A;  4X34 A;  1YI2 A;  3QSU A;  11AS A;  2W10 A;  1X55 A;  3UT1 A;  1AWO A;  2YUP A;  1VQ6 Q;  1NNH A;  2J3M A;  1VQO A;  1T3S A;  1MND A;  1Q82 R;  3OS5 A;  2ZPI B;  4CRI A;  2OTL A;  2DEQ A;  1ZLM A;  4J9G A;  3EG1 A;  4CC4 B;  4CH5 A;  1T0J A;  2QA4 Q;  2VV5 A;  3G4S Q;  4M77 C;  3NGP A;  4YYE A;  4BUG A;  4F14 A;  3V8J A;  4YRE A;  1Q81 C;  1Y7X A;  1JXM A;  1HYO A;  2XIC A;  2XDD A;  3CEY A;  3BFM A;  2COW A;  5LJ5 e;  2KY9 A;  1WLP B;  4M75 E;  2WSC E;  2YT6 A;  4QVC A;  1KD1 C;  1B07 A;  1K9A A;  1QWF A;  3JCM J;  1ZSZ C;  2CP3 A;  1UE9 A;  2DX1 A;  1RAA B;  4Q6G A;  1G83 A;  5ELN A;  3EFO B;  3RIR A;  2RJF A;  5C53 B;  1YCS B;  1BBU A;  2BE9 B;  2C0I A;  3MCA B;  4HA8 A;  5IHK A;  1VQP T;  5HY6 A;  3G7Z A;  3MKD A;  2P4R A;  4C92 E;  3OYG A;  2CP0 A;  1AWW A;  2EKO A;  2JN0 A;  3EAE A;  3VQW A;  4DBH A;  1UG1 A;  3GIB A;  2VGM A;  2AKK A;  2RHZ A;  1MGQ A;  3HPW A;  4LDW A;  1U5S A;  4ZIB A;  1U3O A;  1Z7N A;  4TVY A;  2KT1 A;  1I81 A;  4WJ3 M;  5CQX A;  3HHT B;  5GAN f;  3CMA A;  3W3S A;  3CCS T;  2HZY A;  3FB9 A;  1JXO A;  2JZ2 A;  3VU3 C;  2B8A A;  1K0S A;  2HQH A;  5HCK A;  1QVF A;  3G1J A;  1VQ7 Q;  2EKH A;  3ERR A;  2EFI A;  1QW1 A;  4J9D A;  2JJ9 A;  1I1J A;  1CKA A;  2LQ8 A;  4TVW A;  1WHM A;  1WYD A;  2CH4 W;  3JRZ A;  3IKM B;  2ZPF B;  5DLQ E;  5HK3 A;  1ZSZ A;  3QJ6 A;  2Y90 A;  4C5H A;  3EG3 A;  4P75 C;  1UDL A;  2OX7 A;  2RH2 A;  5GMK j;  1I5L A;  1M30 A;  4NCX A;  1KQS S;  3EG9 A;  1W2B P;  5I2S A;  3I55 Q;  2DTH A;  5GAN g;  2YRC A;  4ZNX A;  3VS3 A;  2A8E A;  2JW4 A;  1XNI A;  2CIM A;  3PZC A;  4AFZ C;  2OTJ Q;  1C6V X;  5GMK m;  1PRL C;  3CD6 A;  2G3R A;  2DJZ A;  4E7H A;  3OYJ A;  2H3E B;  4M7D B;  4J9F A;  2DAQ A;  4J9B A;  2QTX A;  1KQ2 A;  1NJ5 A;  4OGE A;  3CCL Q;  4M7A C;  4ATO A;  3FC3 A;  1YHQ T;  3EGX B;  3R6N A;  3OS1 A;  4N4H A;  2D8H A;  2KEA A;  1BBW A;  1SER A;  5HK0 A;  1PD1 A;  2WSE E;  4RCB A;  3EG2 A;  4P73 C;  3CCV A;  2GTJ A;  3I7F A;  4L6V 5;  2EW3 A;  2CUD A;  3IAL A;  1GCP A;  5KYY A;  3CPF A;  3P8B B;  4PJM A;  3L2Q A;  1VQ8 T;  2LC4 A;  4MML A;  3MQZ A;  4M78 G;  1X27 A;  3CCU T;  1GRI A;  3RGL A;  1KG1 A;  4PLI A;  4ZTU B;  4HVU A;  1WLE A;  1N8R C;  3E9I A;  1U1T A;  3CBO A;  5IHN A;  1K4U S;  5I2M A;  2LRQ A;  3G4S A;  3JCM b;  3EHR A;  4WI1 A;  2HQX A;  4N0A C;  3L2W A;  2KE9 A;  2HBW A;  2XG8 D;  1LNX A;  4Q5W A;  3QWX X;  4XU0 A;  3TUP A;  2A3L A;  4Q15 A;  2Y4Y A;  3IQL A;  3QUI A;  3VS5 A;  3TSZ A;  1UGR B;  3M59 A;  1YP5 A;  1K8A C;  2ZZD A;  3DB4 A;  4B9W A;  1N9S A;  1WZO A;  5FRM A;  2MYS A;  3EGD B;  2LP5 A;  4H2Y A;  4C8Q A;  1D0Y A;  1BI0 A;  3OYM A;  4HT8 A;  4OB2 B;  2ODR C;  2DRM A;  1SRM A;  3MEV A;  4FYW B;  2VGN A;  2XK0 A;  3X20 B;  4D8K A;  4GY5 A;  3PNW C;  2ZR2 A;  1RLP C;  3S3M A;  3OYA A;  3RES A;  1X75 C;  2JVV A;  3EH2 A;  1PYS A;  1W66 A;  3PGG A;  4Y92 A;  5LJ5 h;  3U23 A;  1NBE B;  2LCL A;  1X6B A;  1G3W A;  7AT1 B;  4XU2 A;  2ECZ A;  2KT8 A;  4LVL A;  1VQN A;  3P8H A;  4HCC A;  4Y91 A;  1OPL A;  5LJ3 f;  2RF0 A;  4C92 G;  5CKH A;  2Q7G A;  4GLK A;  2RHS B;  2CT3 A;  2YUN A;  2XTI A;  1VQ9 Q;  3DLM A;  4KUD K;  3NEL A;  2EQK A;  1JJ2 P;  1F1B B;  1VQ7 A;  1X56 A;  3CCE A;  2BKD N;  3P8D A;  3M0R A;  4D6W A;  3CME A;  4TTV A;  4IUP A;  1B34 B;  2DXC A;  4LDU A;  3JAM E;  2JXB A;  4WJ4 A;  1WXU A;  4QQ6 A;  3SWN A;  5IAY A;  2ZT6 A;  2ZT5 A;  4P74 A;  3H0H A;  5LL6 S;  3INZ A;  1D3B B;  4AFQ C;  5CO7 A;  1KC8 U;  1NYQ A;  4LVJ A;  3LWH A;  2K3X A;  1YBY A;  2PQW A;  3A5Z B;  4G84 A;  4OB0 B;  4M7A D;  5ELO A;  1K9M C;  3KBG A;  4MZT A;  1QVP A;  1TXQ A;  2A7Y A;  3HXV A;  3H9N A;  2KXD A;  2EYX A;  2O4X A;  1AEY A;  2AMC B;  1VYT A;  3OSV A;  4J7F A;  1A0N B;  1UGP B;  2CSQ A;  5LJ3 g;  4FW2 A;  1IL2 A;  3A5Y A;  4HVC A;  1X2K A;  2A0F B;  4P3P A;  4PL6 A;  4A4H A;  2L2P A;  1UHC A;  5CQY A;  2DL8 A;  4M77 B;  1OU8 A;  2OTJ A;  2HKN A;  3CC4 A;  1YNZ A;  4IUT A;  5GAN d;  3L4G A;  5F5W A;  1TUG B;  1KIK A;  4C8Q E;  1WJR A;  1EIY A;  2EYQ A;  3CCQ T;  1WDX A;  2COY A;  2C0O A;  1LCK A;  2J6F A;  4AG1 C;  1YWO A;  3MEW A;  2M02 A;  3UAT A;  2I2L A;  3PVQ A;  2O9V A;  3ASK A;  3RBB B;  3X28 B;  3GPL A;  1ATI A;  2LJ1 A;  2R58 A;  3EH1 A;  4P71 C;  1TG0 A;  4Y28 E;  2HSP A;  3VS4 A;  4E7Z A;  4DOW A;  4F7U B;  4J6W A;  4CC7 A;  3QZ9 B;  2KR3 A;  3CBP A;  2RJE A;  3SDZ A;  1X6G A;  2K3Y A;  4GBQ A;  1Q7Y U;  5DY9 A;  3M0U A;  1EFN A;  4PJO B;  1YN8 A;  1WXT A;  3CPW P;  5A2Q E;  1C0M A;  2DIG A;  2DTI A;  3M56 A;  2X4J A;  3T9N A;  2ODR D;  1M1K R;  2MIO A;  1BCO A;  2ZPH B;  3PFS A;  4AT1 B;  4CH3 A;  1XJW B;  4II1 A;  1GBR A;  1H4V B;  1EZZ B;  2VAS A;  1Q86 R;  2AKW B;  4CS4 A;  3M9Q A;  3VS1 A;  3SFM A;  2XGT A;  3RKY A;  1M2V B;  3FLG A;  1ADY A;  2R57 A;  1KMM A;  2CT4 A;  2E6Z A;  3E9G A;  2XD0 A;  3QXE B;  2ZCF B;  4YRR A;  1RAD B;  1S1N A;  4OLF A;  2ZCE A;  2DER A;  3CCJ T;  1AZE A;  5GMK i;  2Q7E A;  4E7L A;  6AT1 B;  2A36 A;  1I5O B;  1BIA A;  2HMA A;  1FWZ A;  1MHN A;  4KGZ B;  3VV0 A;  3PVL A;  2KRN A;  2LQW A;  3JCM V;  1K1Z A;  2LCC A;  5GAO p;  4JRP A;  2LTO A;  3UDC A;  2RPN A;  3HRT A;  2EAY A;  2L0A A;  4GLM A;  2O31 A;  4HVV A;  3EFO A;  5GAM e;  4YPF A;  2KVQ G;  3DB3 A;  3EGU A;  4J7I A;  4LD6 A;  4A63 B;  2ZT7 A;  1AVZ C;  4E7S A;  2RHI A;  3G6E T;  2OTL Q;  2DD4 A;  4CI0 C;  1TSF A;  1D0X A;  2KRS A;  1G8X A;  1YFR A;  5KYX B;  2E5A A;  4RQF A;  1Z9Z A;  1BKB A;  1W4S A;  2HL3 A;  1E1O A;  4QVZ A;  4BW9 A;  5CKF A;  3CCS A;  1VQ9 A;  2AHJ B;  1YJW T;  4M7A B;  3SHW A;  2D1X A;  1LJO A;  3S3O A;  3H0F A;  3NTI A;  1H64 1;  1X2G A;  5FWB A;  4RTW A;  2CP5 A;  2RI2 A;  5I21 A;  3DSQ A;  4FIB A;  3QWY A;  3JCM c;  3VJP A;  2ED1 A;  4HCZ A;  4OB3 B;  3OYI A;  4YRT A;  4A54 A;  2PU9 B;  3JCM W;  3HFZ A;  3CXC A;  4OGC A;  2C0T A;  1KOG A;  4YP0 A;  4KUL A;  1M90 U;  3TEH B;  4RG2 A;  5LJ3 d;  3ZFJ A;  1PC0 A;  2G6F X;  1NJI C;  2RO0 A;  2A37 A;  1KD1 R;  3VQY A;  4BI8 B;  3RR6 A;  1WGS A;  1PNJ A;  3SB2 A;  2L3S A;  5KE3 A;  2HQE A;  3OYY A;  2ZTG A;  4DBR A;  2QI2 A;  2M1H A;  2DL4 A;  3OBY A;  2HEQ A;  3CMA Q;  2ZPB B;  3CCR T;  4C8Q G;  2F5K A;  2ZXF A;  1Q82 U;  4IIO A;  4UPA A;  4M7D A;  4H02 A;  1B76 A;  1HC7 A;  2FZG B;  2FEI A;  4AG2 C;  2G4C A;  4A53 A;  2E3H A;  5KE2 A;  3J7A F;  1UGS B;  2PVG B;  2C7I A;  8ATC B;  4YRF A;  1IRX A;  3C12 A;  5GAN 2;  2Q7H A;  1ASY A;  1MMN A;  3R6O A;  4G85 A;  2OJ2 A;  4CH4 A;  3EGX A;  3CPW S;  1VQ8 A;  1KFZ A;  1KC8 C;  4AH6 A;  4KBM B;  1SHF A;  1YFT A;  1WJS A;  2J6K A;  3CCU A;  2J05 A;  3TU4 K;  3CCM T;  2I0N A;  3TSW A;  3JB9 D;  1VQK Q;  1KQS P;  2QG9 B;  1GCQ A;  4YRC A;  3P8Y A;  2ABL A;  3JCM f;  3CD6 Q;  4PG3 A;  4H2U A;  2XKO C;  1SRL A;  3OYD A;  2O9S A;  3QO3 A;  2HSE B;  3I56 T;  2BZX A;  4JS5 A;  2IPO B;  2BIV A;  4M7A F;  1K76 A;  3VS0 A;  4P3O A;  1B3Q A;  4KGV B;  4AFU C;  2W0Z A;  3VUB A;  2GNC A;  3M4Q A;  4MDX A;  2MAM A;  2CH4 A;  4PLL A;  1NEG A;  4LD9 K;  2QQS A;  3VRZ A;  2QHU A;  3CC2 T;  1UB4 A;  2K57 A;  4YRP A;  4QVD A;  1B70 B;  1VYV A;  3EGD A;  4JRK A;  5I22 A;  2EVR A;  1VQ4 Q;  4XAX B;  1Q7Y C;  1IXD A;  1BB9 A;  2OAU A;  2X9H A;  3RF1 A;  2ART A;  1UUE A;  3HFO A;  1ADJ A;  3JCM g;  1EVK A;  3NPF A;  1MV3 A;  3RER A;  1JB0 E;  4C5G A;  1E6G A;  1I0C A;  1RLQ C;  3O5Z A;  2RM4 A;  3PMI A;  4O6J A;  3ICA A;  1M9S A;  3TCJ A;  1GXI E;  1V29 B;  1N27 A;  1EOV A;  2ZZE A;  4E2F B;  2ZT8 A;  4LDX A;  3PE0 A;  3TVT A;  4CS3 A;  1K0X A;  2VYT A;  1USY C;  5LJ5 j;  1QKX A;  2NLU A;  2LJ3 A;  2RHS A;  1KHC A;  1JJC B;  4MMK A;  2FB7 A;  5GAM h;  1AWJ A;  3OBW A;  4OMN A;  1N8R R;  3LSS A;  1B34 A;  1X54 A;  2X4W A;  4PJO C;  2BE7 D;  2ZZF A;  1KJW A;  4CH6 A;  3H41 A;  2YDL A;  4J6Y A;  2DXB A;  2RQW A;  1ASZ A;  3A5Z A;  4A4F A;  2DVJ A;  1EX4 A;  1H92 A;  1G51 A;  2PNI A;  1S72 T;  4XEM A;  4BDY A;  5CAI A;  2RHX A;  1K8A R;  1VQN Q;  2ED0 A;  2ROT A;  2JNG A;  2DK3 A;  1W6X A;  1WX6 A;  3GNF B;  4Z89 A;  1Y07 A;  1H4Q A;  5GAN e;  3MET A;  4H2X B;  1BI2 A;  3E19 A;  2DKG A;  4M77 A;  1YJN T;  2O88 A;  2LQK A;  1B7T A;  3J80 E;  1EIF A;  3CCE Q;  2RB6 A;  3CME Q;  1B8A A;  2RA2 A;  2E3C A;  2RHQ B;  2L89 A;  2R5M A;  3M53 A;  8AT1 B;  3M54 A;  4LVK A;  2QAS A;  3H8Z A;  1PRM C;  3V8L A;  1E7O A;  4TQD A;  3A7A A;  1W2B A;  2DPP B;  3WVD B;  1SSH A;  4TWA A;  2IY5 A;  3PCO B;  3REU A;  3OYH A;  2FO0 A;  4TVA B;  4F7U A;  2HL5 C;  4ZN3 A;  3JSC A;  3WXM B;  1VQK A;  4OMO A;  1OUL A;  2L3R A;  1PD0 A;  2QHV A;  4JJD A;  4M78 B;  4E47 A;  5KNN A;  2QEX T;  2EQJ A;  2EBP A;  4J8O A;  2O2O A;  1QVF P;  3GOX A;  3CQT A;  3CC4 Q;  1M90 C;  1I07 A;  1IHV A;  2KYB A;  1YIJ T;  3VUZ A;  1IGU A;  4EMK B;  4ESR A;  1E1T A;  1HTT A;  2I4O A;  4PK4 A;  2DL7 A;  4OB1 B;  1VQ5 T;  5J39 A;  3ER0 A;  1K73 C;  4C0Z A;  3IKL A;  1Y71 A;  2AKW A;  4M77 D;  2RQT A;  2FRY A;  3TQ7 P;  3ULR B;  1K9M R;  1M2V A;  3BE3 A;  3CCJ A;  5GAN 3;  1U06 A;  1EVL A;  2GTO A;  5KYN A;  1RAE B;  4K87 A;  1W70 A;  1P92 A;  2NUP A;  1TU0 B;  1D09 B;  2LDM A;  1TS9 A;  4A4K A;  3MP6 A;  3GNG A;  4PKC C;  2EQI A;  4JDS A;  1VQ4 A;  4XQ3 A;  1HXD A;  3ZEH A;  4K88 A;  2FVU A;  2PUO B;  2WSF E;  4YRK A;  4OMM A;  2F2X A;  2KRM A;  3EHQ A;  5FRN A;  3VBB A;  3G6E A;  2P5I A;  4P75 A;  3BY7 A;  2AIR B;  3A7U A;  3JCM d;  4PJO D;  3M57 A;  3QTC A;  4XU3 A;  2EYW A;  3OYF A;  1VYU A;  4LNS A;  2RJD A;  4DEX A;  1YGB A;  2JOY A;  1WHK A;  4LUD A;  4XTY A;  3EG0 A;  4YRM A;  1ZBJ A;  3LX7 A;  3LGL A;  4C92 B;  1YIT T;  2MF2 A;  4HWT A;  4FT4 A;  2RMO A;  1E24 A;  4MZM A;  5KYX A;  3LSQ A;  4P72 C;  2IG0 A;  2P4T A;  4M75 G;  3BDU A;  2RHU A;  4X1V A;  2AKL A;  1UTI A;  1AT1 B;  1VQL T;  1H3Z A;  4M7A A;  1WU7 A;  1QVG A;  3JB9 F;  1VQM T;  4YDQ A;  5D6W A;  2K79 A;  2GFU A;  4P5N A;  5CCA A;  1BIB A;  2P0P A;  4P73 A;  3RL6 A;  2GF7 A;  4FT2 A;  2MI6 A;  1VIE A;  2QDY B;  2DL5 A;  1Y57 A;  4E7I A;  2EJG A;  2DFU A;  2A28 A;  4A4E A;  3QO5 A;  1NM7 A;  5IXF A;  2SEM A;  3QYH B;  2ZNJ A;  1JBM A;  1JJ2 A;  4RDX A;  3R07 A;  2GQI A;  1YI2 T;  1MUZ A;  4YRS A;  3FIF A;  2DU5 A;  4M7D F;  2ARU A;  2FPE A;  2KQW A;  3C0C A;  4R55 A;  4J9I A;  2DET A;  3CCS Q;  1VQO T;  3P8T A;  3LH5 A;  2LNH B;  5CIU A;  1RAB B;  2QDL A;  3CCR A;  4N0A A;  4Z8A A;  1M1K U;  2CYZ B;  1NJ1 A;  2RQV A;  4XTW A;  2CZ6 B;  3OW2 A;  5KYU B;  1X2Q A;  1M2O A;  3KXT A;  4BWA A;  3VYG A;  1D0Z A;  2FHD A;  2J3L A;  3EFR A;  2VUB A;  3OMG A;  1Q86 U;  4ZTF A;  1OEB A;  1NZ9 A;  2QXF A;  2D0N A;  4E6R A;  1NJ2 A;  4J5Y A;  3M0S A;  1QP2 A;  4RG8 A;  1UGQ B;  5GMK l; 
#chains in the Genus database with same CATH homology
 4YCV A;  3CCM A;  3M4P A;  4WF2 A;  5GAN h;  1QVF S;  3PIP A;  1OZ3 A;  3WQZ A;  1G3S A;  4FL6 A;  3HSB A;  4M7A E;  1OI1 A;  3I56 A;  3L42 A;  3UWN A;  3VQX A;  4YRJ A;  2RK2 A;  2K4Y A;  1DJ7 B;  3C4S A;  3A74 A;  2XDB A;  5K1P A;  4JJN K;  2FL7 A;  3MF1 A;  1WNL A;  2HD0 A;  3HKS A;  3M55 A;  1Y96 B;  2I4L A;  3M4G A;  3QYG B;  3V7S A;  1E22 A;  3P8V A;  4BAC A;  1H4S A;  3UGT A;  1B70 A;  5C52 B;  1YJ9 T;  2ZIM A;  4H2T A;  3QPH A;  3V7R A;  3TEG A;  3HRI A;  4C5E A;  1RIQ A;  3OMC A;  4RKU E;  3A8G B;  3NEM A;  4HWR A;  3HFV A;  1O9S A;  1KD1 U;  3V7C A;  4IUQ A;  1UEB A;  1YB3 A;  4P71 A;  2CS7 A;  4UP7 A;  4ZGJ B;  5CVI A;  1VQP A;  4YRN A;  3MF2 A;  3CC7 T;  3MEA A;  1WQ7 A;  3OS0 A;  1G5H A;  3CCV T;  5C0M A;  1BI1 A;  4M78 C;  2E12 A;  3C95 A;  3G71 T;  4HWS A;  5GAM j;  2KDS A;  4M77 F;  1WQW A;  5GAO n;  2Q5H A;  3OA6 A;  2I4M A;  5KCH A;  4EMK C;  1VQ6 T;  5D6Y A;  4BE1 A;  4XEO A;  5FLX E;  2GCX A;  2ZPG B;  4NOY A;  4EO4 A;  2H3J A;  3QO7 A;  4R56 A;  1X2H A;  3HXX A;  2QA4 T;  3VQV A;  3N5B B;  3G4S T;  2L5Q A;  1U8R A;  4H2X A;  4F7U F;  2K5L A;  3WVE B;  2MMP A;  1N9R A;  4M75 C;  4PJO F;  3HY1 A;  2KAF A;  5LJ3 h;  1N9W A;  5E3I A;  3QNE A;  4C0F A;  5GAM g;  3X25 B;  5GAN 5;  3O8V A;  3PCO A;  5CKB A;  1KHI A;  4TVA A;  2E70 A;  3HRK A;  4EDU A;  3PMT A;  1YIJ A;  1XOV A;  1U1S A;  2R5A A;  2K5F A;  3LGF A;  5A0G A;  3E1S A;  4M78 A;  1VQ5 A;  2XDP A;  3UH0 A;  3PT9 A;  4C92 C;  4KT0 E;  2QQR A;  2QQB A;  1YHQ A;  3M4Y A;  3QO8 A;  4MDW A;  1NJ6 A;  4Z02 A;  3RKW A;  4DPG A;  4BD3 A;  3OS2 A;  1G5V A;  3JB9 I;  1KQS A;  2ALY B;  1Q86 C;  4OVA A;  1G3Y A;  4MZP A;  3H6Z A;  1VQ7 T;  2CKK A;  1XTD A;  4UP8 A;  2JTM A;  3L2Z A;  1SSF A;  3QZ5 B;  2K5I A;  1M1G A;  5GAO l;  1N8R U;  1IZ6 A;  4JRI A;  5CR2 A;  4JRQ A;  3L4G B;  3JCM e;  1I4K 1;  4XTV A;  4M78 D;  3I55 T;  1YIT A;  2IVW A;  5HKC A;  3HFN A;  1AHJ B;  4YRI A;  3RMS A;  3TRE A;  2P0Q A;  2D9T A;  3QJY A;  2OTJ T;  1ZHI A;  3HRS A;  4YRQ A;  1K8A U;  1VQL A;  1FX7 A;  4C92 A;  2ARS A;  3F70 A;  5CK9 A;  1VQM A;  3CCL T;  4TQF A;  1TH7 A;  1HK9 A;  1SRY A;  3MEU A;  3NFC A;  3ZBD A;  5GAN 4;  5GAO q;  1G5I A;  3LW5 E;  3QDR B;  3TEE A;  4BI3 A;  2ZIO A;  3GLX A;  2CZ0 B;  3OYK A;  1OZ2 A;  2M16 A;  3PIO A;  2BUD A;  4M75 D;  2O01 E;  4EPC A;  2EIF A;  3HXZ A;  4M7D E;  4RCC A;  4BB7 A;  2JUF A;  2EQU A;  4JLG A;  1M1F A;  2CZ1 B;  4RMF A;  2FYK A;  1G3T A;  5LJ5 f;  5FU7 B;  3BW1 A;  3S6W A;  2DXT A;  4C92 D;  2MWP A;  3KUF A;  2LX9 A;  4LDY A;  4C0D B;  4E7J A;  2EWN A;  1D3B A;  1X01 A;  2X4X A;  1K9M U;  2E64 A;  1B7Y B;  2GQV A;  2QHT A;  3NTH A;  3UPU A;  4HCB A;  2AMC A;  5GAM d;  4LDV A;  3G1Z A;  3BJU A;  3CCQ A;  2E65 A;  3AHU A;  5LJ5 g;  3L2V A;  3SD4 A;  4B9X A;  3CXC S;  3MO8 A;  2LVM A;  5GAN j;  2Q5I A;  4HWO A;  4YTL A;  1USY A;  1VQ9 T;  1X6O A;  5FRO A;  3OSS C;  1NJ8 A;  4IKF A;  4DA4 A;  3NET A;  3A31 A;  3LYI A;  3HFZ B;  3L1A A;  4X9D A;  2E10 A;  5GAN 7;  3M58 A;  5GMK e;  4PJO A;  1Y96 A;  2LNV A;  2YHT A;  4YRG A;  1YJ9 A;  3IG2 A;  2HAX A;  2ZNI A;  2D0Q B;  3L2U A;  3E9H A;  2PUK B;  4A4G A;  1LYL A;  2V8I A;  1Q82 C;  3GP8 A;  4IUR A;  4C8Q C;  4M75 B;  2P0K A;  3DLL A;  3JB9 G;  3JCM Q;  4H2V A;  1VUB A;  2X35 A;  2YLB A;  3PTA A;  3FEO A;  3CC7 A;  3JCM h;  5KH6 A;  3JB9 J;  1M5Q 1;  2MWO A;  4M77 E;  3C94 A;  3G71 A;  3EFS A;  3FDR A;  2M9U A;  5M9O A;  2RHY A;  2XU8 A;  4HKE A;  4QQG A;  1VQ6 A;  2EQM A;  4HT9 A;  5CKE A;  1YJW A;  5AYF A;  1EFW A;  4M7D G;  1ZBX A;  2I4N A;  4XK8 E;  5CKD A;  2QA4 A;  4K86 A;  4PNO A;  3HY0 A;  3A7R A;  4LVM A;  4BI4 A;  4ELY C;  4F7U E;  1BI3 A;  2DD5 A;  2QHS A;  3SWN C;  1NE8 A;  4P74 C;  3RUX A;  3VKI A;  4XTU A;  4C5I A;  4PJO E;  3LWI A;  4EMH A;  4EMG A;  5J26 A;  5HGQ A;  4BDZ A;  4FU6 A;  1VIF A;  3BDL A;  3Q1J A;  3A8M B;  2M0O A;  1KQ1 A;  4M78 F;  2XHC A;  3OB9 A;  4NS5 A;  2PVD B;  5J3B A;  4ZTJ A;  3DKM A;  4BY6 C;  5LJ3 e;  2ZR3 A;  4KQE A;  12AS A;  3TEH A;  1NJI U;  5LJ3 j;  3OYB A;  2OTL T;  2E1H A;  3E9F A;  2DZ9 A;  5LJ5 d;  5EG2 A;  4N4I A;  3HXY A;  4KUI A;  1FYF A;  5KCO A;  4OF1 A;  2RD1 A;  2ZPE B;  4J6X A;  2CJ9 A;  4UC4 A;  2VC8 A;  1I8F A;  4P72 A;  2YLC A;  4M75 F;  1NYR A;  3X24 B;  2HNI A;  1Z7M A;  1M4Z A;  4C8Q D;  2ALY A;  5GAN 6;  2LT4 A;  3RMQ A;  5FU6 C;  4FSX A;  1EQR A;  3QG1 A;  3HP9 A;  2PVO B;  5GAO r;  3A8L B;  1W2B S;  3MP1 A;  3X26 B;  2CZ7 B;  2CJB A;  2NS6 A;  3I55 A;  4J15 A;  3HRU A;  4C92 F;  4DOV A;  3OY9 A;  1ZQ1 A;  4CS2 A;  5A0L A;  4PHC A;  3HTZ A;  1IRE B;  3CPW A;  4HWP A;  5FU7 C;  2E6N A;  2F69 A;  4KR3 A;  4NL3 A;  3CMA T;  5GMK h;  4V2S A;  4H2S A;  3CC2 A;  1M8V A;  3CCL A;  4L59 A;  5IT9 E;  5D6X A;  2DQ3 A;  5A0D A;  4ZGE B;  4C0D C;  4X5O A;  5C51 B;  3A32 A;  3UGQ A;  1QE0 A;  2IY5 B;  2LT1 A;  3OYL A;  4OMF B;  2Y4X A;  2PMF A;  3KFU A;  2CGH A;  4JLI A;  1PSF A;  4QW2 A;  2VXF A;  3OYC A;  1RL2 A;  2DU7 A;  4ELZ C;  3CBM A;  4M77 G;  1L0W A;  3V8K A;  4DQ2 A;  1VQK T;  2DVE A;  2EJF A;  1Q81 U;  2V8K A;  4QQD A;  4EX5 A;  3JCM P;  1NPR A;  1WJQ A;  1C0A A;  2L8D A;  5IN1 A;  3CD6 T;  4YCW A;  1OYX A;  4IUU A;  3JB9 H;  3MHX A;  3RKX A;  4F7U G;  5GAO m;  1JJC A;  1WPY A;  2DQ0 A;  2VXE A;  4PJO G;  4H2W A;  4HT4 A;  2ZGW A;  1S72 A;  2E5Q A;  2RK1 A;  3LLR A;  4JUV A;  4XTZ A;  2XI9 A;  1VQ4 T;  1H4T A;  2YRV A;  4KR2 A;  1QVG S;  5GAM f;  2CJA A;  2RJC A;  1B7Y A;  4BE0 A;  1YJN A;  4ME7 A;  2E41 A;  2P0L A;  1NPP A;  1R8O B;  5L8R E;  2GFA A;  4N4G A;  4UP9 A;  4E51 A;  4VUB A;  2F5T X;  3JCM X;  4C8Q B;  3QII A;  3J81 E;  4M7D C;  1JJ2 S;  5C6S A;  4XU1 A;  3NEN A;  3A8H B;  5GAN 8;  4X9C A;  2RHQ A;  2QQ9 A;  2DDZ A;  3URG A;  3M5A A;  2DTO A;  2K2V A;  1FXX A;  1PYS B;  3CMQ A;  4L5G A;  2QEX A;  3OW2 S;  5DLO A;  3LC0 A;  1XQH A;  2C06 A;  3NTK A;  3UFG A;  3MP8 A;  4YRO A;  2ZZG A;  2ZIN A;  2PME A;  2KSS A;  4L87 A;  3FJP A;  1QP3 A;  1QF6 A;  4O2D A;  2D6F A;  4LVI A;  4J83 A;  2V8J A;  3A8O B;  2KMT A;  1YCY A;  1VQN T;  5K1X A;  4EMK A;  4M7A G;  1BYM A;  2KK4 A;  1K73 U;  1M1K C;  4RQE A;  2X4Y A;  1N6A A;  2RI5 A;  3LH0 A;  3SWN B;  2EJ9 A;  1JRI A;  3QKJ A;  4O5V A;  1SES A;  2DO3 A;  3CCE T;  2DXU A;  3CME T;  1KMN A;  2DIQ A;  3GF5 A;  4FM4 B;  2O4X B;  4M75 A;  4E7K A;  4NL2 A;  1LOJ A;  3MEY A;  4YRL A;  5DM7 R;  3S3N A;  3FRN A;  4YCU A;  1O75 A;  1RI0 A;  4BY6 B;  3HXW A;  2QQA A;  1VQZ A;  4OP0 A;  4TVR A;  4ZN1 A;  3VYH B;  3OD1 A;  3HXU A;  3HL8 A;  4ZTZ B;  1EIY B;  2JTF A;  2RI3 A;  2EL9 A;  4JS4 A;  4XTX A;  3QHS A;  4C0G A;  3CC4 T;  1SET A;  2C8M A;  3L2R A;  4C8Q F;  3REX A;  2DZC A;  3OYN A;  3OQ5 A;  2XID A;  4BE2 A;  4IUV A;  4M7D D;  3RAC A;  2WAC A;  4M78 E;  1YFS A;  2HBP A;  3OYE A;  4RMO A;  1PSE A;  4P3N A;  3ME9 A;  5FU6 B;  3QBY A;  1GGM A;  4ZGD B;  1J5W A;  4X34 A;  1YI2 A;  3QSU A;  11AS A;  1X55 A;  3UT1 A;  1NNH A;  2J3M A;  1VQO A;  3OS5 A;  2ZPI B;  4CRI A;  2OTL A;  2DEQ A;  4CH5 A;  2VV5 A;  4YYE A;  4M77 C;  4BUG A;  3V8J A;  4YRE A;  1Q81 C;  1Y7X A;  2XIC A;  2XDD A;  3CEY A;  3BFM A;  5LJ5 e;  2KY9 A;  4M75 E;  2WSC E;  4QVC A;  1KD1 C;  3JCM J;  4Q6G A;  5ELN A;  3RIR A;  2RJF A;  5C53 B;  1BBU A;  3MCA B;  4HA8 A;  1VQP T;  5HY6 A;  3G7Z A;  4C92 E;  3OYG A;  2EKO A;  2JN0 A;  3EAE A;  3VQW A;  3GIB A;  2VGM A;  2RHZ A;  1MGQ A;  3HPW A;  4LDW A;  4ZIB A;  1Z7N A;  4TVY A;  1I81 A;  4WJ3 M;  5CQX A;  3HHT B;  5GAN f;  3CMA A;  3W3S A;  3CCS T;  3FB9 A;  2JZ2 A;  3VU3 C;  2B8A A;  1QVF A;  3ERR A;  2EFI A;  1QW1 A;  2LQ8 A;  4TVW A;  1WYD A;  3JRZ A;  3IKM B;  2ZPF B;  5DLQ E;  5HK3 A;  3QJ6 A;  2Y90 A;  4C5H A;  4P75 C;  2RH2 A;  5GMK j;  1I5L A;  4NCX A;  1KQS S;  5I2S A;  2DTH A;  5GAN g;  2A8E A;  1XNI A;  2CIM A;  3PZC A;  5GMK m;  3CD6 A;  2G3R A;  2DJZ A;  4E7H A;  3OYJ A;  4M7D B;  2DAQ A;  2QTX A;  1KQ2 A;  1NJ5 A;  4OGE A;  4M7A C;  4ATO A;  3FC3 A;  1YHQ T;  3OS1 A;  4N4H A;  1SER A;  1BBW A;  5HK0 A;  2WSE E;  4RCB A;  4P73 C;  3CCV A;  3I7F A;  4L6V 5;  3IAL A;  3CPF A;  3P8B B;  3L2Q A;  1VQ8 T;  2LC4 A;  4MML A;  3MQZ A;  4M78 G;  3CCU T;  3RGL A;  1KG1 A;  4PLI A;  4ZTU B;  1WLE A;  1N8R C;  3E9I A;  1U1T A;  3CBO A;  5I2M A;  2LRQ A;  3G4S A;  3JCM b;  4WI1 A;  2HQX A;  4N0A C;  3L2W A;  2XG8 D;  1LNX A;  4Q5W A;  4XU0 A;  3TUP A;  2A3L A;  4Q15 A;  2Y4Y A;  3QUI A;  1UGR B;  3M59 A;  1K8A C;  2ZZD A;  3DB4 A;  4B9W A;  1N9S A;  5FRM A;  4H2Y A;  4C8Q A;  3OYM A;  1BI0 A;  4HT8 A;  4OB2 B;  2ODR C;  3MEV A;  2VGN A;  2XK0 A;  3X20 B;  4GY5 A;  3PNW C;  2ZR2 A;  3S3M A;  3OYA A;  3RES A;  1X75 C;  2JVV A;  1PYS A;  1W66 A;  3PGG A;  5LJ5 h;  2LCL A;  1G3W A;  4XU2 A;  4LVL A;  1VQN A;  3P8H A;  4HCC A;  4Y91 A;  5LJ3 f;  4C92 G;  5CKH A;  2Q7G A;  4GLK A;  2RHS B;  2XTI A;  3DLM A;  4KUD K;  3NEL A;  2EQK A;  1VQ7 A;  1X56 A;  3CCE A;  2BKD N;  3P8D A;  4D6W A;  3CME A;  4TTV A;  4IUP A;  1B34 B;  2DXC A;  4LDU A;  3JAM E;  4WJ4 A;  4QQ6 A;  3SWN A;  5IAY A;  2ZT6 A;  2ZT5 A;  4P74 A;  5LL6 S;  3INZ A;  1D3B B;  5CO7 A;  1KC8 U;  1NYQ A;  4LVJ A;  3LWH A;  2K3X A;  1YBY A;  2PQW A;  3A5Z B;  4G84 A;  4M7A D;  4OB0 B;  5ELO A;  1K9M C;  3KBG A;  4MZT A;  1QVP A;  2A7Y A;  3HXV A;  2AMC B;  2O4X A;  3OSV A;  4J7F A;  1UGP B;  5LJ3 g;  1IL2 A;  3A5Y A;  4HVC A;  4P3P A;  4PL6 A;  4A4H A;  5CQY A;  4M77 B;  2OTJ A;  3CC4 A;  5F5W A;  4IUT A;  5GAN d;  3L4G A;  4C8Q E;  1WJR A;  1EIY A;  2EYQ A;  3CCQ T;  3MEW A;  2I2L A;  3GPL A;  3X28 B;  3ASK A;  1ATI A;  2R58 A;  4P71 C;  4Y28 E;  4DOW A;  4F7U B;  4J6W A;  3QZ9 B;  2RJE A;  3CBP A;  3SDZ A;  2K3Y A;  1Q7Y U;  5DY9 A;  4PJO B;  5A2Q E;  2DIG A;  2DTI A;  3M56 A;  2X4J A;  3T9N A;  2ODR D;  2ZPH B;  3PFS A;  4CH3 A;  4II1 A;  1H4V B;  2AKW B;  4CS4 A;  3M9Q A;  3SFM A;  2XGT A;  3RKY A;  3FLG A;  1ADY A;  2R57 A;  1KMM A;  2E6Z A;  3E9G A;  2XD0 A;  3QXE B;  2ZCF B;  4YRR A;  4OLF A;  2ZCE A;  3CCJ T;  5GMK i;  2Q7E A;  4E7L A;  1BIA A;  1FWZ A;  1MHN A;  3VV0 A;  3JCM V;  2LCC A;  5GAO p;  4JRP A;  2LTO A;  3UDC A;  3HRT A;  2EAY A;  5GAM e;  4YPF A;  2KVQ G;  3DB3 A;  4J7I A;  4LD6 A;  2ZT7 A;  2RHI A;  3G6E T;  2DD4 A;  4CI0 C;  1YFR A;  2E5A A;  4RQF A;  1BKB A;  1W4S A;  1E1O A;  4QVZ A;  4BW9 A;  5CKF A;  3CCS A;  1VQ9 A;  2AHJ B;  1YJW T;  4M7A B;  1LJO A;  3S3O A;  3NTI A;  1H64 1;  1X2G A;  2RI2 A;  5I21 A;  3DSQ A;  4FIB A;  3JCM c;  3VJP A;  4HCZ A;  4OB3 B;  3OYI A;  4YRT A;  4A54 A;  2PU9 B;  3JCM W;  3HFZ A;  3CXC A;  4OGC A;  1KOG A;  4YP0 A;  4KUL A;  1M90 U;  3TEH B;  4RG2 A;  5LJ3 d;  3ZFJ A;  1NJI C;  2RO0 A;  3VQY A;  4BI8 B;  1WGS A;  3SB2 A;  5KE3 A;  2HQE A;  3OYY A;  2ZTG A;  2QI2 A;  2M1H A;  3OBY A;  2ZPB B;  3CCR T;  4C8Q G;  2F5K A;  2ZXF A;  1Q82 U;  4UPA A;  4M7D A;  4H02 A;  1B76 A;  1HC7 A;  2G4C A;  4A53 A;  5KE2 A;  3J7A F;  1UGS B;  2PVG B;  2C7I A;  4YRF A;  3C12 A;  5GAN 2;  2Q7H A;  1ASY A;  3R6O A;  4G85 A;  4CH4 A;  3CPW S;  1VQ8 A;  1KC8 C;  4AH6 A;  4KBM B;  1YFT A;  1WJS A;  3CCU A;  3TU4 K;  3CCM T;  3JB9 D;  4YRC A;  3P8Y A;  3JCM f;  4PG3 A;  4H2U A;  2XKO C;  3OYD A;  3QO3 A;  3I56 T;  4JS5 A;  2BIV A;  4M7A F;  4P3O A;  3VUB A;  3M4Q A;  4MDX A;  2MAM A;  4PLL A;  4LD9 K;  2QQS A;  2QHU A;  3CC2 T;  1UB4 A;  2K57 A;  4YRP A;  4QVD A;  1B70 B;  4JRK A;  4XAX B;  1Q7Y C;  2OAU A;  3RF1 A;  2ART A;  3HFO A;  1ADJ A;  3JCM g;  1EVK A;  3RER A;  1JB0 E;  4C5G A;  2RM4 A;  3PMI A;  4O6J A;  3ICA A;  1M9S A;  3TCJ A;  1GXI E;  1V29 B;  1N27 A;  1EOV A;  2ZZE A;  2ZT8 A;  4LDX A;  4CS3 A;  2VYT A;  1USY C;  5LJ5 j;  2NLU A;  2RHS A;  1KHC A;  1JJC B;  4MMK A;  2FB7 A;  5GAM h;  3OBW A;  3LSS A;  1B34 A;  1X54 A;  2X4W A;  4PJO C;  2ZZF A;  4CH6 A;  4J6Y A;  2DXB A;  1ASZ A;  3A5Z A;  4A4F A;  1G51 A;  1S72 T;  4XEM A;  4BDY A;  5CAI A;  2RHX A;  2JNG A;  2DK3 A;  3GNF B;  1Y07 A;  1H4Q A;  5GAN e;  3MET A;  4H2X B;  1BI2 A;  3E19 A;  2DKG A;  4M77 A;  1YJN T;  2LQK A;  3J80 E;  1EIF A;  2RB6 A;  1B8A A;  2RA2 A;  2E3C A;  2RHQ B;  2L89 A;  2R5M A;  3M53 A;  3M54 A;  4LVK A;  3H8Z A;  3V8L A;  4TQD A;  3A7A A;  1W2B A;  2DPP B;  3WVD B;  4TWA A;  2IY5 A;  3PCO B;  3REU A;  3OYH A;  4TVA B;  4F7U A;  4ZN3 A;  3JSC A;  3WXM B;  1VQK A;  2L3R A;  2QHV A;  4M78 B;  4E47 A;  5KNN A;  2QEX T;  2EQJ A;  4J8O A;  3GOX A;  1M90 C;  1YIJ T;  3VUZ A;  4EMK B;  1E1T A;  1HTT A;  2I4O A;  4OB1 B;  1VQ5 T;  5J39 A;  3ER0 A;  1K73 C;  4C0Z A;  3IKL A;  1Y71 A;  2AKW A;  4M77 D;  3CCJ A;  5GAN 3;  1EVL A;  4K87 A;  1P92 A;  2LDM A;  4A4K A;  3MP6 A;  3GNG A;  4PKC C;  4JDS A;  1VQ4 A;  4XQ3 A;  1HXD A;  3ZEH A;  4K88 A;  2FVU A;  2PUO B;  2WSF E;  4YRK A;  5FRN A;  3VBB A;  3G6E A;  2P5I A;  4P75 A;  3BY7 A;  3A7U A;  3JCM d;  4PJO D;  3M57 A;  3QTC A;  4XU3 A;  3OYF A;  4LNS A;  2RJD A;  1YGB A;  2JOY A;  4YRM A;  4XTY A;  3LX7 A;  3LGL A;  4C92 B;  1YIT T;  2MF2 A;  4HWT A;  4FT4 A;  1E24 A;  4MZM A;  3LSQ A;  4P72 C;  2IG0 A;  2P4T A;  4M75 G;  3BDU A;  2RHU A;  1VQL T;  1H3Z A;  4M7A A;  1WU7 A;  1QVG A;  3JB9 F;  1VQM T;  4YDQ A;  5D6W A;  2GFU A;  4P5N A;  5CCA A;  1BIB A;  2P0P A;  4P73 A;  3RL6 A;  2GF7 A;  4FT2 A;  2MI6 A;  1VIE A;  2QDY B;  4E7I A;  2EJG A;  4A4E A;  3QO5 A;  3QYH B;  2ZNJ A;  1JBM A;  1JJ2 A;  4RDX A;  3R07 A;  1YI2 T;  4YRS A;  3FIF A;  2DU5 A;  4M7D F;  2ARU A;  2KQW A;  4R55 A;  1VQO T;  3P8T A;  5CIU A;  3CCR A;  4N0A A;  1M1K U;  2CYZ B;  1NJ1 A;  4XTW A;  2CZ6 B;  3OW2 A;  3KXT A;  4BWA A;  3VYG A;  2FHD A;  2J3L A;  3EFR A;  2VUB A;  3OMG A;  1Q86 U;  4ZTF A;  1NZ9 A;  2QXF A;  1NJ2 A;  4J5Y A;  1QP2 A;  4RG8 A;  1UGQ B;  5GMK l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...