4XTVA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 36 (n-({[(1r,3s)-3-(6-amino-9h-purin-9-yl)cyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
264
structure length
264
Chain Sequence
b'TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
total genus 95
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtvA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtvA01
1HK9A 4TVAA 4P71A 3QO8A 3BDUA 4RCBA 1I4K1 4PJOC 4M7DA 4XQ3A 5GMKm 1LYLA 2ALYA 2QHTA 2ZR2A 4UP7A 3JCMP 4EMHA 1Z7NA 4XTYA 2XTIA 2ZTGA 3HXWA 4NL3A 4PHCA 4PNOA 3BY7A 3L4GA 4YYEA 3NETA 4C8QE 2ARUA 2QTXA 2ZT6A 1H4SA 4XTXA 2J3LA 3RUXA 2QHSA 5GAN5 2PMEA 3HFVA 2DQ0A 3RESA 2IY5A 5LJ3j 4PJOA 4X5OA 3HXZA 3MEYA 5GAMe 4C8QA 2ZINA 3RERA 1EOVA 5GAMd 4YRFA 12ASA 4WJ3M 4PJOF 1WNLA 4JRKA 4M7AC 2CJAA 2EWNA 1NJ2A 3HRIA 3HXUA 3LC0A 3IKMB 5GANd 1YFSA 3JCMh 4C92C 4ZTZB 4K88A 3V7RA 4KQEA 4EO4A 3A5ZA 4CH3A 4P3PA 1USYC 2QHVA 2E65A 4RQFA 3A5YA 1H4QA 4C92F 4M78C 3JCMc 4TTVA 3BW1A 1NYRA 2DZ9A 4NCXA 1SESA 1BBWA 5LJ5f 2ALYB 4KR2A 1JRIA 1X2HA 4M7AB 3W3SA 2E41A 3JCMJ 2E3CA 1X01A 3JB9J 1PYSB 2Q7HA 4V2SA 5GAOn 3JCMV 5GAN2 5GAMh 2E64A 3TEHB 5LJ3d 2DU5A 4A53A 3L4GB 4MMLA 5LJ3e 3QHSA 1N9RA 1Z7MA 4M75B 4OP0A 5LJ3f 3JB9I 1I8FA 1NJ6A 4P3OA 4Q15A 1LOJA 3RIRA 2CJ9A 3HTZA 4H2UA 4RCCA 2DEQA 1EIYA 1C0AA 1YGBA 1USYA 2ZIOA 3JB9H 4YRKA 4H02A 4F7UB 3JCMe 1H4VB 4HVCA 3SB2A 2E5AA 4YRGA 4EMKB 4YREA 5GAN4 4MMKA 3HFZA 3PGGA 4M7DE 2I4MA 4UP9A 3A32A 4C8QB 1B70A 2CIMA 3JB9F 4M75D 2DTHA 4M7DB 4CH5A 3WQZA 2YLBA 3PCOB 3HXYA 4A54A 3A7AA 4C92A 2I4LA 1WLEA 4F7UG 2ZT7A 4CS3A 4M7DD 4HWPA 2VXEA 4M77D 1M5Q1 4HT9A 4YCUA 2E10A 3QO3A 4YRSA 1NNHA 3RKXA 3JB9G 3NELA 5K1PA 4BWAA 4X9DA 4H2WA 2RHSA 3NENA 4TVAB 3L1AA 4M78D 3M4QA 4M77E 2EJFA 2CJBA 4HWRA 1NJ8A 4M78G 3EFRA 3NEMA 1N9SA 4M78B 3A7RA 3QTCA 1ASZA 4DQ2A 4EMKC 4YRRA 1X54A 3SWNB 5GAOm 1KMMA 4HWOA 4TQDA 1X55A 4QVCA 2HNIA 4BW9A 3QSUA 4M75A 4M7DC 1GGMA 3RL6A 4YDQA 1EIYB 3M4GA 4M7AG 4WJ4A 1YFTA 1YFRA 1VQZA 4C92E 3RKWA 4XU2A 5GMKh 4H2YA 1JJCB 3RACA 5ELNA 4M77A 4NL2A 5LJ5g 1BBUA 1KQ1A 4J6YA 4XTVA 4XU3A 4J6WA 1G51A 1SETA 3GIBA 4YRJA 2DTIA 3INZA 1X2GA 4CH4A 4EX5A 1TH7A 3HSBA 2DU7A 1Y96B 5C52B 1N9WA 5F5WA 3PCOA 4M75C 4K86A 5GAN6 1NYQA 1HTTA 1W66A 3E9IA 1NJ5A 3JCMX 3G1ZA 3VQXA 2Q5IA 5GAN7 1KOGA 4ZIBA 3E9HA 5GAOl 1D3BB 4C8QC 2ZXFA 4PJOG 3VBBA 1I81A 4CS4A 3HFNA 4KR3A 5GAMg 2JN0A 11ASA 4CH6A 2ZGWA 3JCMf 4XU1A 1M8VA 2AMCA 2ARTA 4C8QG 3P8VA 2I2LA 2IY5B 5GMKl 1FYFA 1PYSA 5C51B 3JCMQ 1B70B 4F7UF 3REUA 5CAIA 1B7YA 4O2DA 3DSQA 1ASYA 3LSQA 4XEOA 3JCMW 4YP0A 5LJ5h 4H2TA 4J5YA 4H2XB 4ZTUB 4P74C 1G5HA 3MF1A 4QVDA 4XTWA 4LNSA 3JCMd 5GANg 1RIQA 3IG2A 4JRIA 1EVLA 4P75C 3HFZB 3TUPA 4G84A 4N0AC 4P71C 2RHQB 3QO7A 5ELOA 3QO5A 1Y96A 3BFMA 3VQYA 2ZNIA 5GMKi 5GAN3 2RM4A 3MF2A 4X9CA 4M7AA 4C92B 3KFUA 3SWNA 4UP8A 4XEMA 2YLCA 1WYDA 5LJ3g 3V7CA 3TEHA 5LJ5j 3JB9D 4WF2A 4M78E 4C92D 4TVYA 1E22A 2RA2A 3L2ZA 4M7AF 4P75A 2K57A 3OD1A 2FB7A 1KMNA 3HY0A 1SRYA 4CS2A 2DXTA 4YRPA 3VU3C 3A7UA 4YRCA 3SWNC 2AMCB 3BJUA 4UPAA 4WI1A 2RD1A 4P73C 4M7AE 1B34B 2I4OA 1E1TA 3FIFA 4YROA 4C92G 2DVEA 4YRTA 4K87A 3FB9A 5GAOr 2ZZEA 1ADYA 2DXUA 3UFGA 4M7AD 4EMGA 1WQWA 1B8AA 5K1XA 2C8MA 5LJ5d 4HWSA 4M7DG 5GANe 3HFOA 5GAOp 1HC7A 2EJGA 2EAYA 3P8TA 4N0AA 4PJOB 1JBMA 2YHTA 3I7FA 1YCYA 4F7UE 1D3BA 2DKGA 1LJOA 1WPYA 4Y91A 2AKWA 2XGTA 1H4TA 4YRQA 4OLFA 2ZNJA 1EVKA 2ZZGA 1QE0A 3TEGA 2Y90A 4M77F 4YRLA 4TVWA 4M78A 4YRIA 5HGQA 3V8JA 4PJOE 4M75E 2ZT5A 2P5IA 1NJ1A 2PMFA 2G4CA 4H2VA 4M77G 4J15A 4M77C 4RDXA 1ATIA 1LNXA 1B7YB 4M78F 1BIAA 4JLIA 1BIBA 5GMKj 2RHQA 4Q6GA 5GANh 4P73A 3RF1A 2C7IA 4C8QD 2ARSA 4M75F 2ODRC 1B76A 1B34A 4RQEA 1JJCA 5I21A 1U1TA 3EFSA 2ZIMA 4YPFA 2DZCA 4TWAA 4G85A 1HXDA 3VQVA 2ZZFA 2ZT8A 3LSSA 4HT8A 1EFWA 3P8YA 3QUIA 4YCVA 4P3NA 3V7SA 4PG3A 3VQWA 1G5IA 4F7UA 1EQRA 2CGHA 2Q7EA 1I5LA 2DQ3A 3R07A 3ERRA 2ODRD 2AKWB 2FYKA 3HXXA 1MGQA 5GAMf 4P74A 3UGTA 2RB6A 3REXA 3RKYA 1E24A 2EL9A 5LJ3h 4L87A 2DJZA 1E1OA 4J6XA 3V8KA 3CMQA 4RMFA 5GANf 2Q5HA 3QNEA 3M4PA 1YB3A 3UGQA 2DTOA 4YRNA 4P72C 3IALA 5C53B 1X56A 2QHUA 2DDZA 2J3MA 3JCMb 1KQ2A 4AH6A 5GMKe 2ZCEA 3RGLA 3UH0A 4XU0A 3HXVA 4P72A 4TQFA 2P0LA 3A31A 2ZR3A 2I4NA 4H2XA 4XTUA 3V8LA 3PZCA 1J5WA 2E1HA 1IL2A 2EJ9A 3A74A 1H641 2Q7GA 3AHUA 5GAOq 5E3IA 4H2SA 4JUVA 3JCMg 4HWTA 3HY1A 3FJPA 5DY9A 4PJOD 4DPGA 4YRMA 5GAN8 2VXFA 4HA8A 5GAMj 1ADJA 3HRKA 3ICAA 1WU7A 2VC8A 5LJ5e 1U1SA 1QF6A 4XTZA 1L0WA 4C8QF 5GANj 4YCWA 5KNNA 4M77B 1WQ7A 4M7DF 3IKLA 4E51A 1SERA 4NOYA 4M75G 4EMKA 2RHSB
chains in the Genus database with same CATH superfamily
1PM3A 1HK9A 1ZLMA 4YTLA 4X1VA 3OYIA 4GLMA 2KRNA 3TREA 1I4K1 2VV5A 1AWWA 4KRTA 1G2BA 4ZN3A 1VQKT 4Q5WA 1H3HA 2FRWA 2J05A 4A4GA 2ZTGA 2P0KA 4PHCA 2IVWA 2V8KA 2H3EB 3A8OB 3PT9A 2ARUA 2QTXA 1QP3A 3X26B 3OSVA 4A4KA 1WFWA 3VS0A 5GAN5 3L2VA 1QVFS 2PMEA 2DXCA 2K3BA 1TOVA 2DQ0A 2PUOB 1VA7A 1W1FA 4PJOA 1VYVA 2O4XB 4P5NA 2OAUA 2JXBA 3E9GA 2LT1A 2QAZA 3RERA 1EOVA 3OS5A 3M56A 1WYXA 4M7AC 2KYBA 4N4IA 2EWNA 2Y4XA 4LD9K 3REBB 4DEXA 1Z9QA 1IRXA 3OSSC 3UF4A 4C92C 3RBBB 2QDLA 4K88A 5FROA 2E65A 2MOXA 2X4WA 3EH2A 1KC8U 4M78C 3BW1A 4C0FA 1YP5A 4HCZA 2LT4A 1NJIC 2NUPB 1BBWA 4KR2A 2EYYA 4M7AB 2E41A 3OW2A 2F2VA 4CC7A 3JB9J 1PYSB 2O9SA 1ZSGA 3L4GB 4MMLA 5LJ3e 2CT4A 3RL6A 4M75B 1WIEA 3E19A 3G7ZA 4OP0A 3QDFA 3C12A 1LOJA 3RIRA 5HK0A 3VKIA 1YGBA 1YITA 3KXTA 1WLPB 2L5QA 1MMNA 2P84A 3CMEQ 4YRKA 2WSFE 2FL7A 4H02A 1VQ4A 4F7UB 1OZ2A 1Q81C 1H4VB 2A37A 1JB0E 2AKLA 4J7IA 2QASA 2E5AA 3CC7Q 1N27A 2E70A 4EMKB 3PIPA 4YRGA 2J7IA 4MMKA 4QT7A 4BI3A 3BDLA 1VQ5Q 4QQDA 4UP9A 1D0ZA 3A32A 1VQMT 4C8QB 1XQHA 2RPNA 5LL6S 3CPWS 3VS4A 3CC7T 3PCOB 2ZZDA 4F7UG 3OY9A 2DYIA 4M7DD 4HWPA 1VQ7A 1M5Q1 1SG5A 2DL4A 2E10A 5AYFA 2FG0A 1K9MU 1AWXA 4LE9A 2E12A 1WHKA 3JB9G 4LXCA 3CCRA 4BWAA 4H2WA 3VUZA 1ZA2B 3KBGA 4DOVA 3NENA 4M78D 2LCSA 2QQRA 4J9CA 2D6FA 4EMKC 3VS2A 4MZPA 1KMMA 3MP8A 3DB4A 2HKQB 1M1KU 4M75A 2LC4A 5CKFA 2DL8A 1EIYB 3X28B 4UC4A 3CD6T 4BE2A 3EGXB 3UA6A 3VYHB 1MMDA 1YFRA 4RTWA 1FXXA 3GLXA 5J26A 3CCLT 1W70A 1QCOA 2QG9B 4OMQA 1SETA 3GIBA 3INZA 3HSBA 1V1CA 1M3CA 2BE7D 1EFNA 2CUBA 1Q7YU 3PCOA 1PKSA 2OI3A 3REAB 1O9SA 2DERA 1NJ5A 2Q5IA 5GAN7 2A0FB 3EFOA 3E9HA 1YIJA 1YJ9Q 5ECAA 4D6WA 3CCLQ 4FT4A 2JT4A 2KR3A 4PJOG 1V76A 5GAMg 4KGVB 3JCMf 1VQNT 2JMAA 1W4SA 3OYYA 2I2LA 2F5TX 5C51B 3JCMQ 2ZPFB 3JSCA 2ECZA 4OF1A 5KH6A 2KY9A 4YP0A 5LJ5h 3MP6A 3QDRB 4J5YA 4A4FA 4EIKA 1G5HA 3VRYA 3M5AA 4XTWA 1QWEA 5GANg 3IG2A 1ZUKA 1EVLA 1VQ4T 1PNJA 3ZEHA 4E7LA 3G71Q 2QQSA 2K9GA 3G71A 2K2VA 2RHXA 2B8AA 2O01E 3CCEA 1Q81U 1Y96A 3VQYA 3FEOA 3OB9A 3NGPA 2RM4A 4PJNA 2VB6A 4X9CA 1QP2A 1YWPA 1NG2A 5D6YA 1WJRA 3SWNA 4UP8A 1KJWA 4XEMA 1WYDA 4BDZA 4OMPA 3CMAQ 4C92D 3CC4Q 2LMJA 3OYAA 2NLUA 4F04B 4LUEA 2YRVA 5AT1B 4AFZC 3HY0A 3OD1A 3H0FA 3MHXA 3HRUA 3OYLA 4PLIA 4C5EA 4ZGDB 4QQGA 1ABOA 4UPAA 4O6JA 2X3WD 2HAXA 1MUZA 3HKSA 1RAFB 2DVEA 3O5ZA 3FB9A 2NWMA 1VQOQ 2ZZEA 3MPUB 1GCQC 8AT1B 3UFGA 2NS6A 4BACA 1X2QA 1WHHA 4FIBA 5CQYA 1FMWA 1Y7XA 4A4HA 2MPXC 2XDBA 1HC7A 2EJGA 4PK4A 4LVJA 3CPWA 2CUDA 4N0AA 2YHTA 2MWPA 2J6OA 3QIIA 2AKWA 1D3BA 2DKGA 4Y91A 2FZCB 1GFCA 1H4TA 2ZAEA 3FC3A 1QE0A 3TEGA 4M78A 1AZGB 4PJOE 3I9QA 4Z88A 1NEBA 3URGA 4BD3A 3GF5A 4B9WA 3OYGA 1IGQA 2NYSA 1BKBA 1UG1A 3CBMA 2XK0A 5FU7C 2QEXQ 4Q6GA 3ULRB 3GP8A 4C8QD 4J9FA 2QYZA 5IXBA 4AMCA 2F5KA 1JJCA 3VUBA 1U1TA 2HBPA 5I21A 4DBHA 2DZCA 2K5FA 2AKKA 4TWAA 1Q95G 1ZHIA 2DL3A 4G85A 3NTIA 1EX4A 1M27C 2DA9A 3OYFA 3JRZA 2ZT8A 3LSSA 3VRZA 4HT8A 2XDDA 3P8YA 5I22A 3QUIA 1RACB 2JNGA 2J6KA 4P3NA 2M1HA 2X51A 3EGUA 3V7SA 1E7OA 3PMTA 1TUCA 1NBEB 1RUWA 1YCSB 4HT4A 2CGHA 1QKXA 4RTYA 2LX7A 2ODRD 1RABB 2FYKA 3HXXA 5GAMf 2KI7A 1Q81R 1E6HA 3CC7A 1VQPA 1ZA1B 2DJZA 5KYNA 1NJIR 1VQ4Q 1AOJA 3NFCA 1TXQA 3CMEA 3CMQA 3MEWA 2Q5HA 4LD6A 2W10A 3J80E 2GTOA 2PVOB 3SHWA 2RQRA 1UGSB 3WXMB 3OYKA 4PKCC 2JW4A 4XU0A 2RI5A 4P72A 3A31A 2P0PA 3MKDA 3V8LA 3OYHA 1IL2A 2EJ9A 1X27A 3UWNA 1QVFP 1Z9ZA 3A74A 1Y0MA 2L89A 4C5HA 4ZTFA 4OB0B 1YFNA 3MJXA 4PJOD 5CQXA 1WZOA 1G83A 1YN8A 3CCVT 2VXFA 3CPWP 3PFSA 5GAMj 3A8HB 1ADJA 3DKMA 4BE1A 1ZSZB 1QW1A 2X4JA 2ZPGB 2HD0A 4HVVA 3CCUA 2X4XA 1Y71A 1SERA 4NOYA 3CC2A 2PQWA 4P71A 1J3TA 1MNEA 1VYUA 4M7DA 1AWOA 4LVKA 5GMKm 1YHQT 2ALYA 4UP7A 4DBFA 4C5GA 1CKBA 2EQIA 1RL2A 1ZBJA 4JZ3A 3CMAT 3HXWA 4NL3A 4PNOA 4KH0B 4YYEA 5IN1A 1G3YA 2MWOA 3CCVQ 4C8QE 3OS2A 2C0OA 5KE2A 3D7SB 3A8GB 1H4SA 4J9GA 2J3LA 3FJ5A 3M0UA 2QA4Q 3S3NA 3L2UA 1NLOC 1WDXA 4BDYA 2R58A 2SRCA 1BI1A 2EQKA 3MP1A 2IPOB 3MEYA 5GAMe 1Q82C 1M2VB 2DVJA 4IIOA 1QKWA 12ASA 2ZINA 3EG2A 1Q86U 4PJOF 2XI9A 3UDCA 1Q7YC 3LC0A 1YWOA 3H6ZA 3CXCP 2QDYB 3NTHA 4FSSA 1PCXA 4OMFB 1VQPT 4CC3A 3LH0A 5J39A 3A5YA 4C5IA 3L2WA 5HKCA 4E7SA 1NYRA 1VQMA 1S72A 2JM8A 1M1KC 1VIFA 2ALYB 2QA4A 1X2HA 3UT1A 2LQWA 2DNUA 2KXDA 3CCMT 1KG1A 5GAMh 1VQKQ 3TEHB 4A53A 3QHSA 1Z7MA 5LJ3f 5KYXB 1NJ6A 2LTOA 2O9VA 4H2UA 4N4GA 2RJEA 2M51A 4RUGA 4DOWA 4ZGEB 2ZIOA 4OB2B 3G4ST 2CH4W 3I56Q 3CD6Q 3SB2A 1WXUA 4PJMA 4PFZA 3CCJA 5GAN4 3HFZA 3PGGA 4M7DE 5HK3A 5KYYA 4XAXB 3I55A 3NPFA 1VQNA 4M7DB 3CBPA 1QLYA 4BUGA 1WXBA 3HXYA 1GFDA 2RH2A 1WLEA 1W6XA 3O8VA 4CS3A 4J9IA 1R0CB 1ACMB 3LX7A 1OEBA 3QO3A 4YRSA 1NNHA 3NELA 4PL6A 2RHSA 3AT1B 4JZ4A 3VV0A 2CJBA 3MCAB 2DYBA 3EH1A 4HWRA 4CI0C 3EFRA 3NEMA 1N9SA 2F2XA 2PZ1A 3QXEB 4RKUE 4DQ2A 5DM7R 3A7RA 4YRRA 1GCPA 1HD3A 4OMLA 4TQDA 5CVIA 2EYWA 4BW9A 3QSUA 4M7DC 1GGMA 2ED1A 4MZMA 3M0SA 3M4GA 2XICA 2EQMA 3VS3A 2SEMA 4VUBA 5FU6C 1VQ6Q 3RKWA 4CC2A 1K76A 1PD0A 2LP5A 1JJCB 4M77A 4NL2A 2QI2A 1VQPQ 3EHRA 1BBUA 4J6YA 3EGDB 4XU3A 3OYNA 3CCUT 4J6WA 2L3QA 5KYYB 1W2BS 1Q86R 1X2GA 3I5SA 1VQ8Q 4FT2A 2E5QA 3RR6A 2H3JA 3CC2T 5F5WA 2K2MA 1BBZA 1NPPA 4Y92A 1G3WA 1HTTA 3E9IA 1RAIB 1IGUA 3OBYA 3A98A 1N8RC 1Q82U 1TTHB 1VQ6T 2LJ1A 4IUUA 3SEMA 1KOGA 2DLPA 3OW2P 3QPHA 5C0MA 2EYXA 5FU6B 1JJ2A 2E3IA 3KFVA 3SDZA 4KR3A 4AFQC 1QCNA 5A0DA 11ASA 4CH6A 2BUDA 2V1RA 2RK1A 4XU1A 1M8VA 2AMCA 3GNFB 2ZPIB 3P8VA 1AT1B 1WJSA 2CREA 2COZA 2IY5B 1UFFA 1NZ9A 1PYSA 2QEXA 1GRIA 1G8XA 3TVTA 2YRDA 1OYXA 1B7YA 3DSQA 1ASYA 3JCMW 4H2XB 2VWFA 4ZTUB 2P4TA 2DO3A 2HMAA 2BZ8A 1QCFA 2VGMA 2QGFB 4AG1C 1UE9A 2K79A 3QJYA 1RIQA 5GJWB 1E6GA 1UGVA 3HPWA 5IHKA 2RHZA 3CCQQ 2L2PA 3TUPA 4G84A 1X2KA 1WHLA 2HKNA 3QO7A 3KUFA 2QQBA 4E47A 2DEUA 2JOYA 3BFMA 2DRKA 5D6XA 2CZ1B 1S72T 4C92B 3OYDA 1D0XA 2HEQA 2EYZA 5EG2A 1YITT 2RO0A 3TEHA 2L3SA 3FRNA 4WF2A 2X3XD 2E6NA 1SRYA 3C95A 4QVZA 3CXCA 4QQ6A 1K8AC 2QXFA 2KDSA 2GGRA 2KMTA 2EYQA 1K73R 4KGZB 1B34B 4KUDK 2YXYA 4O5VA 3NTKA 2ZPBB 4YROA 1WJQA 3CCST 2IIMA 4YRTA 2KAFA 2CDTA 4K87A 1ADYA 2DXUA 1KFZA 1X6GA 2O88A 4DBQA 2FZGB 2HDAA 1WQWA 1BI2A 5CKBA 5LJ5d 5GANe 1OX8A 3QZ5B 1UDLA 1BCOA 2DL7A 4MDWA 3OYMA 3E9FA 1VQ8A 1OPKA 3E1SA 3CCEQ 3I7FA 2C0TA 4F7UE 1WPYA 2PU9B 3CCSA 1M1GA 1KK7A 1SRMA 3RMQA 1YHQA 2K5IA 2RHUA 2ZNJA 2D8JA 2Y90A 4YRLA 1I0CA 1KD1C 4YRIA 2JM9A 2NUTA 1Q82R 3V8JA 2KEAA 4M75E 3M0TA 3Q1JA 2P5IA 2PMFA 4J15A 1VUBA 3VS5A 4M78F 1BIBA 5GMKj 2XU8A 4DBRA 2O31A 4ELZC 4R55A 3ZL7C 4P73A 2LJ0A 1ZUYA 3R6NA 1K9MC 2AK5A 4M75F 2LQKA 3JV3A 4RQEA 5FRMA 2HQXA 2RN8A 4Z02A 3EG0A 4F17A 1Y57A 3J7AF 1HYOA 3VQVA 1WHJA 3QYGB 1JXOA 1UJ0A 2PVDB 1EFWA 4FYXB 1T0HA 3META 4II1A 2HBWA 2R5AA 2BIVA 1M90C 1YBYA 2FEIA 2KSSA 4IURA 1EQRA 1R8OB 4KUIA 2CP7A 4C0GA 5CO7A 2DQ3A 1X43A 2LCLA 2DE0X 2RQVA 1LCKA 4E7HA 3P8DA 2PUKB 3CCJQ 1E24A 2EL9A 4FCYA 2J06A 3LH5A 1M1KR 4J6XA 3V8KA 4RMFA 4LVMA 2NUTB 3QNEA 3M4PA 4J9DA 1K1ZA 1KHCA 1X56A 1YJNQ 3VS7A 1D09B 2QHUA 2DDZA 1ZX6A 1D0YA 2J3MA 2EPDA 4J9EA 2ZCFB 5GMKe 3UH0A 3QJ6A 2RK2A 1ZQ1A 4JDSA 3PIOA 2ZR3A 2DM1A 2JJ9A 4J9BA 1K0XA 3EG3A 3TSWA 1K73U 4C0ZA 2PTKA 1KQSA 5GAOq 4M4ZA 1X6OA 4H2SA 1GL5A 4HWTA 4BE0A 2DMOA 3FJPA 1RAEB 1K8AU 5A0LA 5DY9A 2JTMA 4OGEA 4YRMA 2CP3A 3CCRQ 1SKUB 4C0DB 2WACA 3DLMA 3HRKA 3RNJA 1QVPA 2VC8A 3WVEB 5LJ5e 2RHYA 1U1SA 1QF6A 4XTZA 4B6MA 1L0WA 2DK3A 5GANj 2AZSA 2X4YA 5KNNA 3THKA 3IKLA 5FWCA 1TG0A 8ATCB 2Q7GA 4M75G 3JCMX 1VQ5A 1QVGA 2RHQB 2DIQA 3QO8A 4ZNXA 4HCKA 3BDUA 5FRNA 4RCBA 4PJOC 3A8LB 4J8OA 4XQ3A 2DILA 3JCMP 1GXIE 1Z7NA 3C94A 3LGFA 3FLGA 4XTYA 3VS1A 3L4GA 3CCVA 1WGSA 1PG5B 3EFOB 1LPLA 1OV3A 2QEXT 3LGLA 3RUXA 1U3OA 2NUZA 5CR2A 4IUVA 1NYGA 1JO8A 3RESA 4MZTA 4D8KA 3M0QA 2DETA 3VJPA 2MIOA 4OMNA 1UGQB 1P92A 3M53A 4C8QA 4YRFA 2PVGB 1WHMA 1FYNA 2A36A 4WJ3M 2ED0A 5KYWA 2EGCA 3PTAA 1WNLA 4JRKA 2CJAA 1VYTA 3HXUA 3G4SQ 2FPDA 5CKEA 3IKMB 1N8RR 5GANd 3JCMh 4ZTZB 4KQEA 3V7RA 2DBKA 4EO4A 3A5ZA 2AHJB 1FMVA 1USYC 4LUDA 2L8DA 4RQFA 1H4QA 2ROLA 1JQQA 5C6SA 1I5OB 4ORZA 2DZ9A 2R5MA 2E3HA 3JAME 2I0NA 4AFUC 1SESA 3M4YA 3QG1A 2A08A 2AT1B 5LJ5f 4KH1B 1VQLT 5A2QE 1X01A 3CPFA 3NMZC 4BI4A 1VQ5T 3SFMA 5GAN2 3JCMV 5GAOn 2E64A 5EC7A 5LJ3d 3T9NA 2XTIA 4EDUA 2FZKB 5K1XA 2DBMA 2CJ9A 4RCCA 2DEQA 2DD5A 2COYA 1F1BB 4FL6A 1OZ3A 2FVUA 2X35A 4LDXA 2CZ7B 4YREA 5KCOA 2LJ3A 1K73C 5IAYA 1B70A 2CIMA 3JB9F 4JRQA 4M75D 2KBTA 2E6ZA 2D8HA 4CH5A 2YLBA 3WQZA 1PSFA 3A7AA 2CP0A 2MMPA 2ZT7A 3X20B 4M77D 1PKTA 2BE9B 4HT9A 3ME9A 3RKXA 2CZ6B 3OW2S 2YUNA 4TVAB 4M77E 2GFAA 2EJFA 2M02A 2FPEA 2KT1A 1NJ8A 1KHIA 4M78G 1BYMA 2HSPA 2OAWA 2EQJA 4HWOA 4RTTA 4A4EA 2WSEE 2LQ8A 1M90R 2G3RA 5DLQE 4M7AG 1YJNA 1K4US 1VQLA 3EAEA 1VQZA 1EIFA 1OOTA 3OQ5A 5GMKh 3CQTA 4H2YA 4HCBA 2RJCA 3QBYA 1HJDA 5ELNA 5LJ5g 5I11A 1KQ1A 4LDVA 3CCET 2HQEA 2DTIA 2CH4A 4CH4A 1TH7A 3EG9A 2DU7A 1Y96B 1UHCA 3HHTB 5KYWB 4M75C 4K86A 5GAN6 1N8RU 1W66A 1QVGP 1SSHA 1M2OA 3TSZA 3G1ZA 5IHIA 3LWIA 3QYHB 1IREB 3QKJA 1KQSP 1VQOA 4JJDA 1BI3A 2HZYA 1D3BB 1XOVA 4C8QC 5I2MA 2JTEA 2ZXFA 1I81A 2JTFA 2JN0A 2M0OA 4C8QG 4GY5A 5GMKl 2XKOC 2M16A 4LN2A 2D0NA 1HSQA 5D6WA 2DX1A 2RMOA 2YRCA 1KQSS 1B70B 5CAIA 1U8RA 2LX9A 4FYWB 4ESRA 3CMAA 2E4HA 3MEVA 3L42A 4XEOA 3H41A 4OGCA 4H2TA 1T0JA 2OTLA 1GCQA 1PWTA 4ZN1A 4LDYA 1W2BA 4PJLA 1UGPB 1UJYA 1B7TA 2K5LA 3I56T 4JRIA 3HP9A 3DLLA 1FX7A 5FU7B 3G6EA 1YHQQ 1U5SA 2KRSA 1VQ9A 2Y4YA 4P75C 1YI2Q 3HFZB 2A7YA 4N0AC 2YUQA 1ZSZC 5J3BA 1SF9A 1VQ9Q 1QMCA 2EIFA 2Z0WA 4FU6A 1NYFA 5GMKi 5GAN3 3ASKA 3UA7A 4M7AA 4HKEA 1PRMC 3KFUA 2ABLA 3S3OA 3V7CA 2BZYA 2EQUA 5LJ5j 2EW3A 1MNDA 2K3YA 3M54A 2M9UA 4M78E 2RA2A 4AT1B 3BE3A 2LQNA 4M7AF 4P75A 2FB7A 4IKFA 2VASA 3I5RA 1GBRA 1DJ7B 4YRPA 3A7UA 1AHJB 2MCNA 2DIGA 2AMCB 1MMAA 2RD1A 4P73C 4M7AE 2BTTA 2KQWA 2I4OA 1KC8R 1I07A 2OTJT 3MEUA 4R56A 1M90U 1YIJQ 1YJ9A 2CP5A 1D1AA 2CZ0B 1QWFA 4E7ZA 4RG8A 2ESWA 2C8MA 1OQKA 4E6RA 4HWSA 4M7DG 5GAOp 4JPBW 1TS9A 2ATCB 4BY6B 3M59A 3S3MA 3P8TA 4PJOB 3CC4T 4PJJA 3M0PA 2RHIA 3CCQA 1YJWT 2XIDA 2W0ZA 1M2VA 4E2FB 1ZUUA 1YI2T 2XGTA 3M55A 3FDRA 4YRQA 3ZFJA 1SHFA 1EVKA 2ZZGA 2RNAA 1XJWB 5CCAA 1UEBA 3H0IA 5HGQA 1TSFA 2K4YA 2YSQA 3CXCS 2GBQA 3OMCA 4H2VA 2MI6A 5D7UA 1YJ9T 4M77C 3CMET 1ATIA 4HXJA 4RTUA 2J6FA 3CCMA 3S6WA 1BIAA 4JLIA 1VIEA 2RHQA 1JEGA 1IB8A 3RF1A 2LNHB 1XTDA 3M57A 1OU9A 3RMSA 1B34A 2E5KA 2ZIMA 2CP2A 1G3TA 1KC8C 3EGDA 4LDUA 1KD1R 1R0BG 2EBPA 3G71T 3GOXA 2DL5A 2QQ9A 1YJNT 1PSEA 2ZZFA 2RI3A 1MMGA 3ZBDA 2EVRA 2KVQG 2DJQA 1I1JA 4PG3A 3VQWA 3TQ7P 4F7UA 2Q7EA 3A8MB 3E2UA 2CKKA 2O4XA 1MGQA 4P74A 2RJFA 2DFUA 2QK0A 2RB6A 3REXA 5LJ3h 4RMOA 4OB1B 2HL3A 1FWZA 3QWXX 4IUPA 4BB7A 1YB3A 1PC0A 2DTOA 1YITQ 1G5VA 2KXCA 4JLGA 3LWHA 3JCMb 1LVKA 1Q7YR 3A5ZB 1AWJA 1EZZB 5IT9E 2C0IA 4F16A 2ZCEA 4RTZA 4TQFA 3GPLA 4FYVB 2VUBA 2B86A 4H2XA 4XTUA 3PZCA 3G1JA 1T3SA 4J9HA 5CIUA 5GJVB 4ZGJB 2FPFA 1C6VX 1H641 2LVMA 3SD4A 3CCRT 3AHUA 5E3IA 4JUVA 3M0RA 4B9XA 1VQ7T 1NEGA 4DPGA 3LW5E 4KBMB 2O2OA 5GAN8 2ROTA 1PD1A 4HA8A 4MDXA 1BI0A 2X9HA 3ICAA 4CRIA 3G4SA 2EGAA 1C0MA 4ANJA 3QZ9B 2QQAA 4C8QF 1RADB 4M77B 2KT8A 3I55Q 1WQ7A 4HCCA 3OYCA 4EMKA 2RHSB 4C0DC 4TVAA 1W2BP 1M3BA 1JU5C 2OJ2A 1LYLA 2QHTA 2ZR2A 4HVWA 2C06A 4EMHA 2L3PA 3X24B 2DAQA 2V8JA 3BY7A 4NS5A 3NETA 2QA4T 2ZT6A 5KCHA 4XTXA 4TVRA 2PNIA 2QHSA 1U06A 2LDMA 3A1PA 2L3RA 3HFVA 2HQHA 1KSWA 1RI9A 1QQJA 1RLPC 2IY5A 5LJ3j 1M1FA 1S72Q 1KD1U 4K11A 1VQMQ 4X5OA 1BCMA 2EKOA 5KE3A 4FW1A 3HXZA 4L5GA 1AZEA 1IHWA 3C0CA 3TEEA 4ELYC 5GAMd 1UGRB 1IO6A 2RI2A 2K3XA 4FW2A 2XDPA 1QVGS 1ZBXA 1NJ2A 1JXMA 3HRIA 5IHNA 1YFSA 2DPPB 1C1AA 2YDLA 1OU8A 4P3PA 4CH3A 2QHVA 1NM7A 4C92F 4TTVA 3JCMc 2L0AA 3OMGA 4LVLA 1RAHB 3QWYA 3CBOA 4NCXA 3P8BB 5CKHA 1JRIA 1AVZC 5FWBA 3W3SA 2D1XA 3JCMJ 2E3CA 2Q7HA 4V2SA 2MF2A 2DU5A 1N9RA 3JB9I 4P3OA 1I8FA 4Q15A 3H8ZA 1EIYA 3HTZA 1C0AA 1NPRA 2P0QA 2BKDN 2VGNA 3HTRA 2EFIA 1USYA 4ATOA 4AG2C 3JB9H 1D1BA 2D9TA 3H9NA 1UUEA 1M30A 1WXTA 2FHDA 3JCMe 3LYIA 1VQ9T 4HVCA 1H8KA 3IQLA 4KGXB 2VYTA 3PVLA 2RQTA 4FYYB 3RDVA 3CC2Q 2RJDA 1ABQA 2I4MA 2JS0A 4J7FA 2GQVA 2CT3A 2MK5A 1B07A 2DTHA 3CCUQ 5A0GA 4A54A 1H3ZA 4C92A 2I4LA 2P4RA 2VXEA 1VQOT 4YCUA 3MEAA 3CCQT 1RI0A 5K1PA 4X9DA 4Y28E 3L1AA 1WI7A 3M4QA 4E7IA 4IUTA 2YUOA 4JJBA 4LVIA 2EKHA 4M78B 2GQIA 2OX7A 3QTCA 1ASZA 4DA4A 2XMFA 1X54A 3SWNB 5GAOm 5FLXE 2VVKA 1X55A 3VS6A 4QVCA 1NJIU 2HNIA 4Z89A 5KYXA 3C4SA 1MV3A 1UB4A 2CP6A 4X34A 4YDQA 1YNZA 2KRMA 6AT1B 4CC4B 2OTJA 1CKAA 1KIKA 2JMCA 1SSFA 4WJ4A 1YFTA 2A3LA 4C92E 4QKUA 7AT1B 4XU2A 2V26A 4OMMA 1OI1A 3RACA 5CKDA 1MV0B 4LDWA 2LNVA 3CCSQ 4XTVA 1MHNA 1G51A 4YRJA 4EX5A 1K9AA 4AFSC 5C52B 5HCKA 3ER0A 4OVAA 1N9WA 3OS0A 1NYQA 3M58A 1CSKA 3VQXA 1VQ8T 2KE9A 2V1QA 1BU1A 1GBQA 4ZIBA 2JUFA 5GAOl 1WA7A 1M8MA 2KROA 4EPCA 1YJWQ 3VBBA 3WVDB 5IXFA 2HCKA 4CS4A 3H0HA 2GFUA 3HFNA 1K8AR 1IZ6A 2ZGWA 2XD0A 2IG0A 2ARTA 1Y07A 2CSQA 1RLQC 1K0SA 3MO8A 3OS1A 1FYFA 3I35A 1BB9A 3HRSA 2G6FX 1QVFA 4F7UF 3REUA 3CCMQ 4O2DA 4BI8B 5FW9A 3GBQA 3LSQA 4KT0E 2LZ6B 2JZ2A 5KYUA 1YIJT 1TUGB 1D1CA 4P74C 3MF1A 4QVDA 4LNSA 1TU0B 4PFOA 3JCMd 2ZPHB 3PE0A 3I55T 1TWBA 2MYSA 2F69A 4P71C 3J81E 3OYJA 3CCJT 4QW2A 5ELOA 1X6BA 3QO5A 2K7AA 2ZNIA 1R77A 2GTJA 2NUPA 2A8EA 1B3QA 2LRQA 3MF2A 4OB3B 1JJ2S 1FMKA 1AD5A 4J83A 2YLCA 2JS2A 1SEMA 1WX6A 5LJ3g 1M9SA 1SPKA 3JB9D 3NHNA 4TVYA 1E22A 3L2ZA 4WTOB 2K57A 1KMNA 2OTLT 2YT6A 4CS2A 2DXTA 3VU3C 4N4HA 1WHGA 3F70A 4YRCA 3SWNC 3BJUA 4WI1A 2XHCA 2DD4A 4PFPA 4RTXA 1Q86C 1JJ2P 2H8HA 2DXBA 1E1TA 1G3SA 2GF7A 3FIFA 5I2SA 4C92G 1YJWA 1M3AA 1VOMA 3MQZA 5GAOr 3CC4A 4RG2A 2HL5C 4M7AD 4EMGA 3TCJA 1B8AA 3M9QA 3EGXA 2YUPA 3EG1A 2CSIA 3HFOA 4L6V5 3PVQA 1RAAB 1PRLC 2EAYA 1JBMA 2VKNA 1YCYA 1IHVA 5HY6A 1LJOA 5IH2A 4GLKA 4IIMA 5L8RE 1YI2A 1OULA 2K6DA 2COWA 3EG9B 3G6EQ 3OYEA 2ZPEB 4OLFA 2RF0A 1BK2A 4M77F 1VQ6A 4TVWA 2DF6A 3L2QA 4HVUA 2ZT5A 9ATCB 1NJ1A 2G4CA 2OTLQ 4M77G 2OTJQ 4OMOA 4RDXA 4Z8AA 3CEYA 1T3LA 1LNXA 3P8HA 3VYGA 1B7YB 1NLPC 5GANh 4E7KA 2MAMA 3LLRA 2C7IA 2ARSA 4DEYA 2ODRC 1B76A 2HSEB 2KYMA 4KULA 3EFSA 4YPFA 4R0KA 2R57A 3PMIA 2FO0A 4D8DA 3HL8A 1N6AA 4A63B 1HXDA 3CCLA 3HRTA 1X69A 1PHTA 1TUDA 4GBQA 3DB3A 1V29B 1ZSZA 4YCVA 3OBWA 5M9OA 2ENMA 2AZVA 4JJNK 1G5IA 2CS7A 2EGEA 1VQNQ 4JS4A 3GNGA 2D0QB 2YWWA 2GCXA 3EHQA 3X25B 1I5LA 3R07A 3ERRA 2AKWB 3G6ET 1M4ZA 3UGTA 4L59A 1IXDA 3UPUA 3RKYA 1H92A 4JRPA 4L87A 1E1OA 1RAGB 3R6OA 2KNBB 3CD6A 5GANf 3I56A 3UGQA 2QGGA 4YRNA 3L2RA 1X75C 1VQLQ 4FM4B 3IALA 4P72C 5C53B 1S1NA 4RTVA 2GNCA 3OA6A 1UECA 4IUQA 2KK4A 1O75A 4BY6C 4ZTJA 1KQ2A 4AH6A 3N5BB 2XG8D 2BZXA 3RGLA 5L23A 1VQKA 3HXVA 4LNPA 2M0YA 5KYUB 2P0LA 4F14A 2FRYA 5DLOA 1OX9A 2I4NA 4XK8E 1J5WA 2E1HA 1N5ZA 2A28A 1ARKA 1A0NB 4E7JA 2CYZB 3JCMg 3HY1A 2V8IA 1NE8A 2RQUA 2LCCA 4WCIA 2DRMA 2QTVA 2RQWA 2KGTA 3OYBA 1WU7A 2F1LA 1VQ7Q 3U23A 1XNIA 1UTIA 2F2WA 3UATA 4JJCA 1SRLA 1OPLA 4YCWA 2WSCE 2AIRB 2JVVA 3PNWC 1SHGA 1AEYA 4FSXA 1UHFA 5CK9A 4M7DF 4JS5A 1K9MR 4E51A 3TU4K 4PLLA 4ME7A
chains in the Genus database with same CATH topology
1HK9A 4YTLA 3OYIA 3TREA 1I4K1 2VV5A 4ZN3A 1VQKT 4Q5WA 4A4GA 2ZTGA 2P0KA 4PHCA 2IVWA 2V8KA 3A8OB 3PT9A 2ARUA 2QTXA 1QP3A 3X26B 3OSVA 4A4KA 5GAN5 3L2VA 1QVFS 2PMEA 2DXCA 2DQ0A 2PUOB 4PJOA 2O4XB 4P5NA 2OAUA 3E9GA 2LT1A 3RERA 1EOVA 3OS5A 3M56A 4M7AC 4N4IA 2EWNA 2Y4XA 4LD9K 3OSSC 4C92C 4K88A 5FROA 2E65A 2X4WA 1KC8U 4M78C 3BW1A 4C0FA 4HCZA 2LT4A 1NJIC 1BBWA 4KR2A 4M7AB 2E41A 3OW2A 3JB9J 1PYSB 3L4GB 4MMLA 5LJ3e 3RL6A 4M75B 3G7ZA 3E19A 4OP0A 3C12A 1LOJA 3RIRA 5HK0A 3VKIA 1YGBA 1YITA 3KXTA 2L5QA 4YRKA 2WSFE 2FL7A 4H02A 1VQ4A 4F7UB 1OZ2A 1Q81C 1H4VB 1JB0E 4J7IA 2E5AA 1N27A 2E70A 4EMKB 3PIPA 4YRGA 4MMKA 4BI3A 3BDLA 4QQDA 4UP9A 3A32A 1VQMT 4C8QB 1XQHA 5LL6S 3CPWS 3CC7T 3PCOB 2ZZDA 4F7UG 3OY9A 4M7DD 4HWPA 1VQ7A 1M5Q1 2E10A 5AYFA 1K9MU 2E12A 3JB9G 3CCRA 4BWAA 4H2WA 3VUZA 3KBGA 3NENA 4DOVA 4M78D 2QQRA 2D6FA 4EMKC 4MZPA 1KMMA 3MP8A 3DB4A 1M1KU 4M75A 2LC4A 5CKFA 1EIYB 3X28B 4UC4A 3CD6T 4BE2A 3VYHB 1YFRA 1FXXA 3GLXA 5J26A 3CCLT 1SETA 3GIBA 3INZA 3HSBA 1Q7YU 3PCOA 1O9SA 1NJ5A 2Q5IA 5GAN7 3E9HA 1YIJA 4D6WA 4FT4A 4PJOG 5GAMg 3JCMf 1VQNT 1W4SA 3OYYA 2I2LA 2F5TX 5C51B 3JCMQ 2ZPFB 3JSCA 4OF1A 5KH6A 2KY9A 4YP0A 5LJ5h 3MP6A 3QDRB 4J5YA 4A4FA 1G5HA 3M5AA 4XTWA 5GANg 3IG2A 1EVLA 1VQ4T 3ZEHA 4E7LA 2QQSA 3G71A 2K2VA 2RHXA 2B8AA 2O01E 3CCEA 1Q81U 1Y96A 3VQYA 3FEOA 3OB9A 2RM4A 4X9CA 1QP2A 5D6YA 1WJRA 3SWNA 4UP8A 4XEMA 1WYDA 4BDZA 4C92D 3OYAA 2NLUA 3OD1A 2YRVA 3HY0A 3MHXA 3HRUA 3OYLA 4PLIA 4C5EA 4ZGDB 4QQGA 4UPAA 4O6JA 2HAXA 3HKSA 2DVEA 3FB9A 2ZZEA 3UFGA 2NS6A 4BACA 4FIBA 5CQYA 4A4HA 1Y7XA 1HC7A 2XDBA 2EJGA 4LVJA 3CPWA 4N0AA 2YHTA 2MWPA 3QIIA 2AKWA 1D3BA 2DKGA 4Y91A 1H4TA 3FC3A 1QE0A 3TEGA 4M78A 4PJOE 3URGA 4BD3A 3GF5A 4B9WA 3OYGA 1BKBA 3CBMA 2XK0A 5FU7C 4Q6GA 3GP8A 4C8QD 2F5KA 1JJCA 3VUBA 1U1TA 2HBPA 5I21A 2DZCA 2K5FA 4TWAA 1ZHIA 4G85A 3NTIA 3OYFA 3JRZA 2ZT8A 3LSSA 4HT8A 2XDDA 3P8YA 3QUIA 2JNGA 4P3NA 2M1HA 3V7SA 3PMTA 4HT4A 2CGHA 2ODRD 2FYKA 3HXXA 5GAMf 3CC7A 1VQPA 2DJZA 3NFCA 3CMEA 3CMQA 3MEWA 2Q5HA 4LD6A 3J80E 2PVOB 1UGSB 3WXMB 3OYKA 4PKCC 4P72A 4XU0A 2RI5A 3A31A 2P0PA 3V8LA 3OYHA 1IL2A 2EJ9A 3UWNA 3A74A 2L89A 4C5HA 4ZTFA 4OB0B 4PJOD 5CQXA 3CCVT 2VXFA 3PFSA 5GAMj 3A8HB 1ADJA 3DKMA 4BE1A 1QW1A 2X4JA 2ZPGB 2HD0A 3CCUA 2X4XA 1Y71A 1SERA 4NOYA 3CC2A 2PQWA 4P71A 4M7DA 4LVKA 5GMKm 1YHQT 2ALYA 4UP7A 4C5GA 1RL2A 3CMAT 3HXWA 4NL3A 4PNOA 4YYEA 5IN1A 1G3YA 2MWOA 4C8QE 3OS2A 5KE2A 3A8GB 1H4SA 2J3LA 3S3NA 3L2UA 4BDYA 2R58A 1BI1A 2EQKA 3MP1A 3MEYA 5GAMe 1Q82C 2ZINA 12ASA 1Q86U 4PJOF 2XI9A 3UDCA 1Q7YC 3LC0A 3H6ZA 2QDYB 3NTHA 4OMFB 1VQPT 3LH0A 5J39A 3A5YA 4C5IA 3L2WA 5HKCA 1NYRA 1VQMA 1S72A 1M1KC 1VIFA 2ALYB 2QA4A 1X2HA 3UT1A 3CCMT 1KG1A 5GAMh 3TEHB 4A53A 3QHSA 1Z7MA 5LJ3f 1NJ6A 2LTOA 4H2UA 4N4GA 2RJEA 4DOWA 4ZGEB 2ZIOA 4OB2B 3G4ST 3SB2A 3CCJA 5GAN4 3HFZA 3PGGA 4M7DE 5HK3A 4XAXB 3I55A 1VQNA 4M7DB 3CBPA 4BUGA 3HXYA 2RH2A 1WLEA 3O8VA 4CS3A 3LX7A 3QO3A 4YRSA 1NNHA 3NELA 4PL6A 2RHSA 3VV0A 2CJBA 3MCAB 4HWRA 4CI0C 3EFRA 3NEMA 1N9SA 4RKUE 3A7RA 3QXEB 5DM7R 4DQ2A 4YRRA 4TQDA 5CVIA 4BW9A 3QSUA 4M7DC 1GGMA 4MZMA 3M4GA 2XICA 2EQMA 4VUBA 5FU6C 3RKWA 1JJCB 4M77A 4NL2A 2QI2A 1BBUA 4J6YA 4XU3A 3OYNA 3CCUT 4J6WA 1W2BS 1X2GA 4FT2A 2E5QA 2H3JA 3CC2T 5F5WA 1NPPA 1G3WA 1HTTA 3E9IA 3OBYA 1N8RC 1Q82U 1VQ6T 4IUUA 1KOGA 3QPHA 5C0MA 5FU6B 1JJ2A 3SDZA 4KR3A 5A0DA 11ASA 4CH6A 2BUDA 2RK1A 4XU1A 1M8VA 2AMCA 3GNFB 2ZPIB 3P8VA 1WJSA 2IY5B 1NZ9A 1PYSA 2QEXA 1OYXA 1B7YA 3DSQA 1ASYA 3JCMW 4H2XB 4ZTUB 2P4TA 2DO3A 2VGMA 3QJYA 1RIQA 3HPWA 2RHZA 3TUPA 4G84A 3QO7A 3KUFA 2QQBA 4E47A 2JOYA 3BFMA 5D6XA 2CZ1B 1S72T 4C92B 3OYDA 5EG2A 1YITT 2RO0A 3TEHA 3FRNA 4WF2A 2E6NA 1SRYA 3C95A 4QVZA 3CXCA 4QQ6A 1K8AC 2QXFA 2KDSA 2KMTA 2EYQA 1B34B 4KUDK 4O5VA 3NTKA 2ZPBB 4YROA 1WJQA 3CCST 4YRTA 2KAFA 4K87A 1ADYA 2DXUA 1WQWA 1BI2A 5CKBA 5LJ5d 5GANe 3QZ5B 4MDWA 3OYMA 3E9FA 1VQ8A 3E1SA 3I7FA 4F7UE 1WPYA 2PU9B 3CCSA 1M1GA 3RMQA 1YHQA 2K5IA 2RHUA 2ZNJA 2Y90A 4YRLA 1KD1C 4YRIA 3V8JA 4M75E 3Q1JA 2P5IA 2PMFA 4J15A 1VUBA 4M78F 1BIBA 5GMKj 2XU8A 4ELZC 4R55A 4P73A 1K9MC 4M75F 2LQKA 4RQEA 5FRMA 2HQXA 4Z02A 3J7AF 3VQVA 3QYGB 2PVDB 1EFWA 3META 4II1A 2R5AA 2BIVA 1M90C 1YBYA 2KSSA 4IURA 1EQRA 1R8OB 4KUIA 4C0GA 5CO7A 2DQ3A 2LCLA 4E7HA 3P8DA 2PUKB 1E24A 2EL9A 4J6XA 3V8KA 4RMFA 4LVMA 3QNEA 3M4PA 1KHCA 1X56A 2QHUA 2DDZA 2J3MA 2ZCFB 5GMKe 3UH0A 3QJ6A 2RK2A 1ZQ1A 4JDSA 3PIOA 2ZR3A 1K73U 4C0ZA 1KQSA 5GAOq 1X6OA 4H2SA 4HWTA 4BE0A 3FJPA 1K8AU 5A0LA 5DY9A 2JTMA 4OGEA 4YRMA 4C0DB 2WACA 3DLMA 3HRKA 1QVPA 2VC8A 3WVEB 5LJ5e 2RHYA 1U1SA 1QF6A 4XTZA 1L0WA 2DK3A 5GANj 2X4YA 5KNNA 3IKLA 2Q7GA 2RHQB 1VQ5A 3JCMX 4M75G 1QVGA 2DIQA 3QO8A 5FRNA 3BDUA 4RCBA 4PJOC 3A8LB 4J8OA 4XQ3A 3JCMP 1GXIE 1Z7NA 3C94A 3LGFA 3FLGA 4XTYA 3L4GA 3CCVA 1WGSA 2QEXT 3LGLA 3RUXA 5CR2A 4IUVA 3RESA 4MZTA 3VJPA 1UGQB 1P92A 3M53A 4C8QA 4YRFA 2PVGB 4WJ3M 3PTAA 1WNLA 4JRKA 2CJAA 3HXUA 5CKEA 3IKMB 5GANd 3JCMh 4ZTZB 4KQEA 3V7RA 4EO4A 3A5ZA 2AHJB 1USYC 2L8DA 4RQFA 1H4QA 5C6SA 2DZ9A 2R5MA 3JAME 1SESA 3M4YA 3QG1A 5LJ5f 1VQLT 5A2QE 1X01A 3CPFA 4BI4A 1VQ5T 3SFMA 5GAN2 3JCMV 5GAOn 2E64A 5LJ3d 3T9NA 2XTIA 4EDUA 5K1XA 2CJ9A 4RCCA 2DEQA 2DD5A 4FL6A 1OZ3A 2FVUA 2X35A 4LDXA 2CZ7B 4YREA 5KCOA 1K73C 5IAYA 1B70A 2CIMA 3JB9F 4JRQA 4M75D 2E6ZA 4CH5A 3WQZA 2YLBA 1PSFA 3A7AA 2MMPA 2ZT7A 3X20B 4M77D 4HT9A 3ME9A 3RKXA 2CZ6B 3OW2S 4TVAB 4M77E 2GFAA 2EJFA 1NJ8A 1KHIA 4M78G 1BYMA 2EQJA 4HWOA 4A4EA 2WSEE 2LQ8A 2G3RA 5DLQE 4M7AG 1YJNA 1VQLA 3EAEA 1VQZA 1EIFA 3OQ5A 5GMKh 4H2YA 4HCBA 2RJCA 3QBYA 5ELNA 5LJ5g 1KQ1A 4LDVA 3CCET 2HQEA 2DTIA 4CH4A 1TH7A 2DU7A 1Y96B 3HHTB 4M75C 4K86A 5GAN6 1N8RU 1W66A 3G1ZA 3LWIA 3QYHB 1IREB 3QKJA 1VQOA 1BI3A 1D3BB 1XOVA 4C8QC 5I2MA 2ZXFA 1I81A 2JTFA 2JN0A 2M0OA 4C8QG 4GY5A 5GMKl 2XKOC 2M16A 5D6WA 1B70B 1KQSS 5CAIA 1U8RA 2LX9A 3CMAA 3MEVA 3L42A 4XEOA 4OGCA 4H2TA 2OTLA 4ZN1A 4LDYA 1W2BA 1UGPB 2K5LA 3DLLA 3I56T 4JRIA 3HP9A 1FX7A 5FU7B 3G6EA 1VQ9A 2Y4YA 4P75C 3HFZB 2A7YA 4N0AC 5J3BA 2EIFA 4FU6A 5GMKi 5GAN3 3ASKA 4M7AA 4HKEA 3KFUA 3S3OA 3V7CA 2EQUA 5LJ5j 2K3YA 3M54A 4M78E 2M9UA 2RA2A 4M7AF 4P75A 2FB7A 4IKFA 1DJ7B 4YRPA 3A7UA 1AHJB 2DIGA 2AMCB 2RD1A 4P73C 4M7AE 2KQWA 2I4OA 2OTJT 3MEUA 4R56A 1M90U 1YJ9A 2CZ0B 4RG8A 2C8MA 4HWSA 4M7DG 5GAOp 4BY6B 3M59A 3S3MA 3P8TA 4PJOB 3CC4T 2RHIA 3CCQA 1YJWT 2XIDA 1YI2T 2XGTA 3M55A 3FDRA 4YRQA 3ZFJA 1EVKA 2ZZGA 5CCAA 1UEBA 5HGQA 2K4YA 3CXCS 3OMCA 4H2VA 2MI6A 1YJ9T 4M77C 3CMET 1ATIA 3CCMA 3S6WA 1BIAA 4JLIA 1VIEA 2RHQA 3RF1A 1XTDA 3M57A 3RMSA 1B34A 2ZIMA 1G3TA 1KC8C 4LDUA 3G71T 3GOXA 1YJNT 2QQ9A 1PSEA 2ZZFA 2RI3A 3ZBDA 2KVQG 4PG3A 3VQWA 4F7UA 2Q7EA 3A8MB 2CKKA 2O4XA 1MGQA 4P74A 2RJFA 2RB6A 3REXA 5LJ3h 4RMOA 4OB1B 1FWZA 4IUPA 4BB7A 1YB3A 2DTOA 1G5VA 4JLGA 3LWHA 3JCMb 3A5ZB 5IT9E 2ZCEA 4TQFA 3GPLA 2VUBA 4H2XA 4XTUA 3PZCA 5CIUA 4ZGJB 1H641 2LVMA 3SD4A 3CCRT 3AHUA 5E3IA 4JUVA 4B9XA 1VQ7T 4DPGA 3LW5E 4KBMB 5GAN8 4HA8A 4MDXA 1BI0A 3ICAA 4CRIA 3G4SA 3QZ9B 2QQAA 4C8QF 4M77B 1WQ7A 4HCCA 3OYCA 4EMKA 2RHSB 4C0DC 4TVAA 1LYLA 2ZR2A 2QHTA 2C06A 4EMHA 3X24B 2DAQA 2V8JA 3BY7A 4NS5A 3NETA 2QA4T 2ZT6A 5KCHA 4XTXA 4TVRA 2QHSA 2LDMA 2L3RA 3HFVA 2IY5A 5LJ3j 1M1FA 1KD1U 4X5OA 2EKOA 5KE3A 3HXZA 4L5GA 3TEEA 4ELYC 5GAMd 1UGRB 2RI2A 2K3XA 1QVGS 2XDPA 1ZBXA 1NJ2A 3HRIA 1YFSA 2DPPB 4CH3A 4P3PA 2QHVA 4C92F 4TTVA 3JCMc 3OMGA 4LVLA 3CBOA 4NCXA 3P8BB 5CKHA 1JRIA 3W3SA 3JCMJ 2E3CA 2Q7HA 4V2SA 2MF2A 2DU5A 1N9RA 3JB9I 4P3OA 1I8FA 4Q15A 3H8ZA 1EIYA 3HTZA 1C0AA 1NPRA 2P0QA 2BKDN 2VGNA 2EFIA 1USYA 4ATOA 3JB9H 2D9TA 2FHDA 3JCMe 3LYIA 1VQ9T 4HVCA 2VYTA 2RJDA 2I4MA 4J7FA 2GQVA 2DTHA 5A0GA 4A54A 1H3ZA 4C92A 2I4LA 2VXEA 1VQOT 4YCUA 3MEAA 3CCQT 1RI0A 5K1PA 4X9DA 4Y28E 3L1AA 3M4QA 4E7IA 4IUTA 4LVIA 4M78B 3QTCA 1ASZA 4DA4A 1X54A 3SWNB 5GAOm 5FLXE 1X55A 4QVCA 1NJIU 2HNIA 3C4SA 1UB4A 4X34A 4YDQA 2OTJA 1SSFA 4WJ4A 1YFTA 2A3LA 4C92E 4XU2A 1OI1A 3RACA 5CKDA 4LDWA 2LNVA 4XTVA 1MHNA 1G51A 4YRJA 4EX5A 5C52B 3ER0A 4OVAA 1N9WA 3OS0A 1NYQA 3M58A 3VQXA 1VQ8T 4ZIBA 2JUFA 5GAOl 4EPCA 3VBBA 3WVDB 4CS4A 3HFNA 2GFUA 1IZ6A 2ZGWA 2XD0A 2IG0A 2ARTA 1Y07A 3MO8A 3OS1A 1FYFA 3HRSA 1QVFA 4F7UF 3REUA 4O2DA 4BI8B 3LSQA 4KT0E 2JZ2A 1YIJT 4P74C 3MF1A 4QVDA 4LNSA 3JCMd 2ZPHB 3I55T 2F69A 4P71C 3J81E 3OYJA 3CCJT 4QW2A 5ELOA 3QO5A 2ZNIA 2A8EA 2LRQA 3MF2A 4OB3B 1JJ2S 4J83A 2YLCA 5LJ3g 1M9SA 3JB9D 4TVYA 1E22A 3L2ZA 2K57A 1KMNA 2OTLT 4CS2A 2DXTA 3VU3C 4N4HA 3F70A 4YRCA 3SWNC 3BJUA 4WI1A 2XHCA 2DD4A 1Q86C 2DXBA 1E1TA 1G3SA 2GF7A 3FIFA 5I2SA 4C92G 1YJWA 3MQZA 5GAOr 3CC4A 4RG2A 4M7AD 4EMGA 3TCJA 1B8AA 3M9QA 3HFOA 4L6V5 2EAYA 1JBMA 1YCYA 5HY6A 1LJOA 4GLKA 5L8RE 1YI2A 3OYEA 2ZPEB 4OLFA 4M77F 1VQ6A 4TVWA 3L2QA 2ZT5A 1NJ1A 2G4CA 4M77G 4RDXA 3CEYA 1LNXA 3P8HA 3VYGA 1B7YB 5GANh 4E7KA 2MAMA 3LLRA 2C7IA 2ARSA 2ODRC 1B76A 4KULA 3EFSA 4YPFA 2R57A 3PMIA 3HL8A 1N6AA 1HXDA 3CCLA 3HRTA 3DB3A 1V29B 4YCVA 3OBWA 5M9OA 4JJNK 1G5IA 2CS7A 4JS4A 3GNGA 2D0QB 2GCXA 3X25B 1I5LA 3R07A 3ERRA 2AKWB 3G6ET 1M4ZA 3UGTA 4L59A 3UPUA 3RKYA 4JRPA 4L87A 1E1OA 3CD6A 3R6OA 5GANf 3I56A 3UGQA 4YRNA 4P72C 1X75C 3L2RA 4FM4B 3IALA 5C53B 3OA6A 4IUQA 2KK4A 1O75A 4BY6C 4ZTJA 1KQ2A 4AH6A 3N5BB 2XG8D 3RGLA 3HXVA 1VQKA 2P0LA 5DLOA 2I4NA 4XK8E 1J5WA 2E1HA 4E7JA 2CYZB 3JCMg 3HY1A 2V8IA 1NE8A 2LCCA 3OYBA 1WU7A 1XNIA 4YCWA 2WSCE 2JVVA 3PNWC 4FSXA 5CK9A 4M7DF 4JS5A 4E51A 3TU4K 4PLLA 4ME7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  4TVA A;  4P71 A;  3QO8 A;  3BDU A;  4RCB A;  1I4K 1;  4PJO C;  4M7D A;  4XQ3 A;  5GMK m;  1LYL A;  2ALY A;  2QHT A;  2ZR2 A;  4UP7 A;  3JCM P;  4EMH A;  1Z7N A;  4XTY A;  2XTI A;  2ZTG A;  3HXW A;  4NL3 A;  4PHC A;  4PNO A;  3BY7 A;  3L4G A;  4YYE A;  3NET A;  4C8Q E;  2ARU A;  2QTX A;  2ZT6 A;  1H4S A;  4XTX A;  2J3L A;  3RUX A;  2QHS A;  5GAN 5;  2PME A;  3HFV A;  2DQ0 A;  3RES A;  2IY5 A;  5LJ3 j;  4PJO A;  4X5O A;  3HXZ A;  3MEY A;  5GAM e;  4C8Q A;  2ZIN A;  3RER A;  1EOV A;  5GAM d;  4YRF A;  12AS A;  4WJ3 M;  4PJO F;  1WNL A;  4JRK A;  4M7A C;  2CJA A;  2EWN A;  1NJ2 A;  3HRI A;  3HXU A;  3LC0 A;  3IKM B;  5GAN d;  1YFS A;  3JCM h;  4C92 C;  4ZTZ B;  4K88 A;  3V7R A;  4KQE A;  4EO4 A;  3A5Z A;  4CH3 A;  4P3P A;  1USY C;  2QHV A;  2E65 A;  4RQF A;  3A5Y A;  1H4Q A;  4C92 F;  4M78 C;  3JCM c;  4TTV A;  3BW1 A;  1NYR A;  2DZ9 A;  4NCX A;  1SES A;  1BBW A;  5LJ5 f;  2ALY B;  4KR2 A;  1JRI A;  1X2H A;  4M7A B;  3W3S A;  2E41 A;  3JCM J;  2E3C A;  1X01 A;  3JB9 J;  1PYS B;  2Q7H A;  4V2S A;  5GAO n;  3JCM V;  5GAN 2;  5GAM h;  2E64 A;  3TEH B;  5LJ3 d;  2DU5 A;  4A53 A;  3L4G B;  4MML A;  5LJ3 e;  3QHS A;  1N9R A;  1Z7M A;  4M75 B;  4OP0 A;  5LJ3 f;  3JB9 I;  1I8F A;  1NJ6 A;  4P3O A;  4Q15 A;  1LOJ A;  3RIR A;  2CJ9 A;  3HTZ A;  4H2U A;  4RCC A;  2DEQ A;  1EIY A;  1C0A A;  1YGB A;  1USY A;  2ZIO A;  3JB9 H;  4YRK A;  4H02 A;  4F7U B;  3JCM e;  1H4V B;  4HVC A;  3SB2 A;  2E5A A;  4YRG A;  4EMK B;  4YRE A;  5GAN 4;  4MMK A;  3HFZ A;  3PGG A;  4M7D E;  2I4M A;  4UP9 A;  3A32 A;  4C8Q B;  1B70 A;  2CIM A;  3JB9 F;  4M75 D;  2DTH A;  4M7D B;  4CH5 A;  3WQZ A;  2YLB A;  3PCO B;  3HXY A;  4A54 A;  3A7A A;  4C92 A;  2I4L A;  1WLE A;  4F7U G;  2ZT7 A;  4CS3 A;  4M7D D;  4HWP A;  2VXE A;  4M77 D;  1M5Q 1;  4HT9 A;  4YCU A;  2E10 A;  3QO3 A;  4YRS A;  1NNH A;  3RKX A;  3JB9 G;  3NEL A;  5K1P A;  4BWA A;  4X9D A;  4H2W A;  2RHS A;  3NEN A;  4TVA B;  3L1A A;  4M78 D;  3M4Q A;  4M77 E;  2EJF A;  2CJB A;  4HWR A;  1NJ8 A;  4M78 G;  3EFR A;  3NEM A;  1N9S A;  4M78 B;  3A7R A;  3QTC A;  1ASZ A;  4DQ2 A;  4EMK C;  4YRR A;  1X54 A;  3SWN B;  5GAO m;  1KMM A;  4HWO A;  4TQD A;  1X55 A;  4QVC A;  2HNI A;  4BW9 A;  3QSU A;  4M75 A;  4M7D C;  1GGM A;  3RL6 A;  4YDQ A;  1EIY B;  3M4G A;  4M7A G;  4WJ4 A;  1YFT A;  1YFR A;  1VQZ A;  4C92 E;  3RKW A;  4XU2 A;  5GMK h;  4H2Y A;  1JJC B;  3RAC A;  5ELN A;  4M77 A;  4NL2 A;  5LJ5 g;  1BBU A;  1KQ1 A;  4J6Y A;  4XTV A;  4XU3 A;  4J6W A;  1G51 A;  1SET A;  3GIB A;  4YRJ A;  2DTI A;  3INZ A;  1X2G A;  4CH4 A;  4EX5 A;  1TH7 A;  3HSB A;  2DU7 A;  1Y96 B;  5C52 B;  1N9W A;  5F5W A;  3PCO A;  4M75 C;  4K86 A;  5GAN 6;  1NYQ A;  1HTT A;  1W66 A;  3E9I A;  1NJ5 A;  3JCM X;  3G1Z A;  3VQX A;  2Q5I A;  5GAN 7;  1KOG A;  4ZIB A;  3E9H A;  5GAO l;  1D3B B;  4C8Q C;  2ZXF A;  4PJO G;  3VBB A;  1I81 A;  4CS4 A;  3HFN A;  4KR3 A;  5GAM g;  2JN0 A;  11AS A;  4CH6 A;  2ZGW A;  3JCM f;  4XU1 A;  1M8V A;  2AMC A;  2ART A;  4C8Q G;  3P8V A;  2I2L A;  2IY5 B;  5GMK l;  1FYF A;  1PYS A;  5C51 B;  3JCM Q;  1B70 B;  4F7U F;  3REU A;  5CAI A;  1B7Y A;  4O2D A;  3DSQ A;  1ASY A;  3LSQ A;  4XEO A;  3JCM W;  4YP0 A;  5LJ5 h;  4H2T A;  4J5Y A;  4H2X B;  4ZTU B;  4P74 C;  1G5H A;  3MF1 A;  4QVD A;  4XTW A;  4LNS A;  3JCM d;  5GAN g;  1RIQ A;  3IG2 A;  4JRI A;  1EVL A;  4P75 C;  3HFZ B;  3TUP A;  4G84 A;  4N0A C;  4P71 C;  2RHQ B;  3QO7 A;  5ELO A;  3QO5 A;  1Y96 A;  3BFM A;  3VQY A;  2ZNI A;  5GMK i;  5GAN 3;  2RM4 A;  3MF2 A;  4X9C A;  4M7A A;  4C92 B;  3KFU A;  3SWN A;  4UP8 A;  4XEM A;  2YLC A;  1WYD A;  5LJ3 g;  3V7C A;  3TEH A;  5LJ5 j;  3JB9 D;  4WF2 A;  4M78 E;  4C92 D;  4TVY A;  1E22 A;  2RA2 A;  3L2Z A;  4M7A F;  4P75 A;  2K57 A;  3OD1 A;  2FB7 A;  1KMN A;  3HY0 A;  1SRY A;  4CS2 A;  2DXT A;  4YRP A;  3VU3 C;  3A7U A;  4YRC A;  3SWN C;  2AMC B;  3BJU A;  4UPA A;  4WI1 A;  2RD1 A;  4P73 C;  4M7A E;  1B34 B;  2I4O A;  1E1T A;  3FIF A;  4YRO A;  4C92 G;  2DVE A;  4YRT A;  4K87 A;  3FB9 A;  5GAO r;  2ZZE A;  1ADY A;  2DXU A;  3UFG A;  4M7A D;  4EMG A;  1WQW A;  1B8A A;  5K1X A;  2C8M A;  5LJ5 d;  4HWS A;  4M7D G;  5GAN e;  3HFO A;  5GAO p;  1HC7 A;  2EJG A;  2EAY A;  3P8T A;  4N0A A;  4PJO B;  1JBM A;  2YHT A;  3I7F A;  1YCY A;  4F7U E;  1D3B A;  2DKG A;  1LJO A;  1WPY A;  4Y91 A;  2AKW A;  2XGT A;  1H4T A;  4YRQ A;  4OLF A;  2ZNJ A;  1EVK A;  2ZZG A;  1QE0 A;  3TEG A;  2Y90 A;  4M77 F;  4YRL A;  4TVW A;  4M78 A;  4YRI A;  5HGQ A;  3V8J A;  4PJO E;  4M75 E;  2ZT5 A;  2P5I A;  1NJ1 A;  2PMF A;  2G4C A;  4H2V A;  4M77 G;  4J15 A;  4M77 C;  4RDX A;  1ATI A;  1LNX A;  1B7Y B;  4M78 F;  1BIA A;  4JLI A;  1BIB A;  5GMK j;  2RHQ A;  4Q6G A;  5GAN h;  4P73 A;  3RF1 A;  2C7I A;  4C8Q D;  2ARS A;  4M75 F;  2ODR C;  1B76 A;  1B34 A;  4RQE A;  1JJC A;  5I21 A;  1U1T A;  3EFS A;  2ZIM A;  4YPF A;  2DZC A;  4TWA A;  4G85 A;  1HXD A;  3VQV A;  2ZZF A;  2ZT8 A;  3LSS A;  4HT8 A;  1EFW A;  3P8Y A;  3QUI A;  4YCV A;  4P3N A;  3V7S A;  4PG3 A;  3VQW A;  1G5I A;  4F7U A;  1EQR A;  2CGH A;  2Q7E A;  1I5L A;  2DQ3 A;  3R07 A;  3ERR A;  2ODR D;  2AKW B;  2FYK A;  3HXX A;  1MGQ A;  5GAM f;  4P74 A;  3UGT A;  2RB6 A;  3REX A;  3RKY A;  1E24 A;  2EL9 A;  5LJ3 h;  4L87 A;  2DJZ A;  1E1O A;  4J6X A;  3V8K A;  3CMQ A;  4RMF A;  5GAN f;  2Q5H A;  3QNE A;  3M4P A;  1YB3 A;  3UGQ A;  2DTO A;  4YRN A;  4P72 C;  3IAL A;  5C53 B;  1X56 A;  2QHU A;  2DDZ A;  2J3M A;  3JCM b;  1KQ2 A;  4AH6 A;  5GMK e;  2ZCE A;  3RGL A;  3UH0 A;  4XU0 A;  3HXV A;  4P72 A;  4TQF A;  2P0L A;  3A31 A;  2ZR3 A;  2I4N A;  4H2X A;  4XTU A;  3V8L A;  3PZC A;  1J5W A;  2E1H A;  1IL2 A;  2EJ9 A;  3A74 A;  1H64 1;  2Q7G A;  3AHU A;  5GAO q;  5E3I A;  4H2S A;  4JUV A;  3JCM g;  4HWT A;  3HY1 A;  3FJP A;  5DY9 A;  4PJO D;  4DPG A;  4YRM A;  5GAN 8;  2VXF A;  4HA8 A;  5GAM j;  1ADJ A;  3HRK A;  3ICA A;  1WU7 A;  2VC8 A;  5LJ5 e;  1U1S A;  1QF6 A;  4XTZ A;  1L0W A;  4C8Q F;  5GAN j;  4YCW A;  5KNN A;  4M77 B;  1WQ7 A;  4M7D F;  3IKL A;  4E51 A;  1SER A;  4NOY A;  4M75 G;  4EMK A;  2RHS B; 
#chains in the Genus database with same CATH topology
 1PM3 A;  1HK9 A;  1ZLM A;  4YTL A;  4X1V A;  3OYI A;  4GLM A;  2KRN A;  3TRE A;  1I4K 1;  2VV5 A;  1AWW A;  4KRT A;  1G2B A;  4ZN3 A;  1VQK T;  4Q5W A;  1H3H A;  2FRW A;  2J05 A;  4A4G A;  2ZTG A;  2P0K A;  4PHC A;  2IVW A;  2V8K A;  2H3E B;  3A8O B;  3PT9 A;  2ARU A;  2QTX A;  1QP3 A;  3X26 B;  3OSV A;  4A4K A;  1WFW A;  3VS0 A;  5GAN 5;  3L2V A;  1QVF S;  2PME A;  2DXC A;  2K3B A;  1TOV A;  2DQ0 A;  2PUO B;  1VA7 A;  1W1F A;  4PJO A;  1VYV A;  2O4X B;  4P5N A;  2OAU A;  2JXB A;  3E9G A;  2LT1 A;  2QAZ A;  3RER A;  1EOV A;  3OS5 A;  3M56 A;  1WYX A;  4M7A C;  2KYB A;  4N4I A;  2EWN A;  2Y4X A;  4LD9 K;  3REB B;  4DEX A;  1Z9Q A;  1IRX A;  3OSS C;  3UF4 A;  4C92 C;  3RBB B;  2QDL A;  4K88 A;  5FRO A;  2E65 A;  2MOX A;  2X4W A;  3EH2 A;  1KC8 U;  4M78 C;  3BW1 A;  4C0F A;  1YP5 A;  4HCZ A;  2LT4 A;  1NJI C;  2NUP B;  1BBW A;  4KR2 A;  2EYY A;  4M7A B;  2E41 A;  3OW2 A;  2F2V A;  4CC7 A;  3JB9 J;  1PYS B;  2O9S A;  1ZSG A;  3L4G B;  4MML A;  5LJ3 e;  2CT4 A;  3RL6 A;  4M75 B;  1WIE A;  3E19 A;  3G7Z A;  4OP0 A;  3QDF A;  3C12 A;  1LOJ A;  3RIR A;  5HK0 A;  3VKI A;  1YGB A;  1YIT A;  3KXT A;  1WLP B;  2L5Q A;  1MMN A;  2P84 A;  3CME Q;  4YRK A;  2WSF E;  2FL7 A;  4H02 A;  1VQ4 A;  4F7U B;  1OZ2 A;  1Q81 C;  1H4V B;  2A37 A;  1JB0 E;  2AKL A;  4J7I A;  2QAS A;  2E5A A;  3CC7 Q;  1N27 A;  2E70 A;  4EMK B;  3PIP A;  4YRG A;  2J7I A;  4MMK A;  4QT7 A;  4BI3 A;  3BDL A;  1VQ5 Q;  4QQD A;  4UP9 A;  1D0Z A;  3A32 A;  1VQM T;  4C8Q B;  1XQH A;  2RPN A;  5LL6 S;  3CPW S;  3VS4 A;  3CC7 T;  3PCO B;  2ZZD A;  4F7U G;  3OY9 A;  2DYI A;  4M7D D;  4HWP A;  1VQ7 A;  1M5Q 1;  1SG5 A;  2DL4 A;  2E10 A;  5AYF A;  2FG0 A;  1K9M U;  1AWX A;  4LE9 A;  2E12 A;  1WHK A;  3JB9 G;  4LXC A;  3CCR A;  4BWA A;  4H2W A;  3VUZ A;  1ZA2 B;  3KBG A;  4DOV A;  3NEN A;  4M78 D;  2LCS A;  2QQR A;  4J9C A;  2D6F A;  4EMK C;  3VS2 A;  4MZP A;  1KMM A;  3MP8 A;  3DB4 A;  2HKQ B;  1M1K U;  4M75 A;  2LC4 A;  5CKF A;  2DL8 A;  1EIY B;  3X28 B;  4UC4 A;  3CD6 T;  4BE2 A;  3EGX B;  3UA6 A;  3VYH B;  1MMD A;  1YFR A;  4RTW A;  1FXX A;  3GLX A;  5J26 A;  3CCL T;  1W70 A;  1QCO A;  2QG9 B;  4OMQ A;  1SET A;  3GIB A;  3INZ A;  3HSB A;  1V1C A;  1M3C A;  2BE7 D;  1EFN A;  2CUB A;  1Q7Y U;  3PCO A;  1PKS A;  2OI3 A;  3REA B;  1O9S A;  2DER A;  1NJ5 A;  2Q5I A;  5GAN 7;  2A0F B;  3EFO A;  3E9H A;  1YIJ A;  1YJ9 Q;  5ECA A;  4D6W A;  3CCL Q;  4FT4 A;  2JT4 A;  2KR3 A;  4PJO G;  1V76 A;  5GAM g;  4KGV B;  3JCM f;  1VQN T;  2JMA A;  1W4S A;  3OYY A;  2I2L A;  2F5T X;  5C51 B;  3JCM Q;  2ZPF B;  3JSC A;  2ECZ A;  4OF1 A;  5KH6 A;  2KY9 A;  4YP0 A;  5LJ5 h;  3MP6 A;  3QDR B;  4J5Y A;  4A4F A;  4EIK A;  1G5H A;  3VRY A;  3M5A A;  4XTW A;  1QWE A;  5GAN g;  3IG2 A;  1ZUK A;  1EVL A;  1VQ4 T;  1PNJ A;  3ZEH A;  4E7L A;  3G71 Q;  2QQS A;  2K9G A;  3G71 A;  2K2V A;  2RHX A;  2B8A A;  2O01 E;  3CCE A;  1Q81 U;  1Y96 A;  3VQY A;  3FEO A;  3OB9 A;  3NGP A;  2RM4 A;  4PJN A;  2VB6 A;  4X9C A;  1QP2 A;  1YWP A;  1NG2 A;  5D6Y A;  1WJR A;  3SWN A;  4UP8 A;  1KJW A;  4XEM A;  1WYD A;  4BDZ A;  4OMP A;  3CMA Q;  4C92 D;  3CC4 Q;  2LMJ A;  3OYA A;  2NLU A;  4F04 B;  4LUE A;  2YRV A;  5AT1 B;  4AFZ C;  3HY0 A;  3OD1 A;  3H0F A;  3MHX A;  3HRU A;  3OYL A;  4PLI A;  4C5E A;  4ZGD B;  4QQG A;  1ABO A;  4UPA A;  4O6J A;  2X3W D;  2HAX A;  1MUZ A;  3HKS A;  1RAF B;  2DVE A;  3O5Z A;  3FB9 A;  2NWM A;  1VQO Q;  2ZZE A;  3MPU B;  1GCQ C;  8AT1 B;  3UFG A;  2NS6 A;  4BAC A;  1X2Q A;  1WHH A;  4FIB A;  5CQY A;  1FMW A;  1Y7X A;  4A4H A;  2MPX C;  2XDB A;  1HC7 A;  2EJG A;  4PK4 A;  4LVJ A;  3CPW A;  2CUD A;  4N0A A;  2YHT A;  2MWP A;  2J6O A;  3QII A;  2AKW A;  1D3B A;  2DKG A;  4Y91 A;  2FZC B;  1GFC A;  1H4T A;  2ZAE A;  3FC3 A;  1QE0 A;  3TEG A;  4M78 A;  1AZG B;  4PJO E;  3I9Q A;  4Z88 A;  1NEB A;  3URG A;  4BD3 A;  3GF5 A;  4B9W A;  3OYG A;  1IGQ A;  2NYS A;  1BKB A;  1UG1 A;  3CBM A;  2XK0 A;  5FU7 C;  2QEX Q;  4Q6G A;  3ULR B;  3GP8 A;  4C8Q D;  4J9F A;  2QYZ A;  5IXB A;  4AMC A;  2F5K A;  1JJC A;  3VUB A;  1U1T A;  2HBP A;  5I21 A;  4DBH A;  2DZC A;  2K5F A;  2AKK A;  4TWA A;  1Q95 G;  1ZHI A;  2DL3 A;  4G85 A;  3NTI A;  1EX4 A;  1M27 C;  2DA9 A;  3OYF A;  3JRZ A;  2ZT8 A;  3LSS A;  3VRZ A;  4HT8 A;  2XDD A;  3P8Y A;  5I22 A;  3QUI A;  1RAC B;  2JNG A;  2J6K A;  4P3N A;  2M1H A;  2X51 A;  3EGU A;  3V7S A;  1E7O A;  3PMT A;  1TUC A;  1NBE B;  1RUW A;  1YCS B;  4HT4 A;  2CGH A;  1QKX A;  4RTY A;  2LX7 A;  2ODR D;  1RAB B;  2FYK A;  3HXX A;  5GAM f;  2KI7 A;  1Q81 R;  1E6H A;  3CC7 A;  1VQP A;  1ZA1 B;  2DJZ A;  5KYN A;  1NJI R;  1VQ4 Q;  1AOJ A;  3NFC A;  1TXQ A;  3CME A;  3CMQ A;  3MEW A;  2Q5H A;  4LD6 A;  2W10 A;  3J80 E;  2GTO A;  2PVO B;  3SHW A;  2RQR A;  1UGS B;  3WXM B;  3OYK A;  4PKC C;  2JW4 A;  4XU0 A;  2RI5 A;  4P72 A;  3A31 A;  2P0P A;  3MKD A;  3V8L A;  3OYH A;  1IL2 A;  2EJ9 A;  1X27 A;  3UWN A;  1QVF P;  1Z9Z A;  3A74 A;  1Y0M A;  2L89 A;  4C5H A;  4ZTF A;  4OB0 B;  1YFN A;  3MJX A;  4PJO D;  5CQX A;  1WZO A;  1G83 A;  1YN8 A;  3CCV T;  2VXF A;  3CPW P;  3PFS A;  5GAM j;  3A8H B;  1ADJ A;  3DKM A;  4BE1 A;  1ZSZ B;  1QW1 A;  2X4J A;  2ZPG B;  2HD0 A;  4HVV A;  3CCU A;  2X4X A;  1Y71 A;  1SER A;  4NOY A;  3CC2 A;  2PQW A;  4P71 A;  1J3T A;  1MNE A;  1VYU A;  4M7D A;  1AWO A;  4LVK A;  5GMK m;  1YHQ T;  2ALY A;  4UP7 A;  4DBF A;  4C5G A;  1CKB A;  2EQI A;  1RL2 A;  1ZBJ A;  4JZ3 A;  3CMA T;  3HXW A;  4NL3 A;  4PNO A;  4KH0 B;  4YYE A;  5IN1 A;  1G3Y A;  2MWO A;  3CCV Q;  4C8Q E;  3OS2 A;  2C0O A;  5KE2 A;  3D7S B;  3A8G B;  1H4S A;  4J9G A;  2J3L A;  3FJ5 A;  3M0U A;  2QA4 Q;  3S3N A;  3L2U A;  1NLO C;  1WDX A;  4BDY A;  2R58 A;  2SRC A;  1BI1 A;  2EQK A;  3MP1 A;  2IPO B;  3MEY A;  5GAM e;  1Q82 C;  1M2V B;  2DVJ A;  4IIO A;  1QKW A;  12AS A;  2ZIN A;  3EG2 A;  1Q86 U;  4PJO F;  2XI9 A;  3UDC A;  1Q7Y C;  3LC0 A;  1YWO A;  3H6Z A;  3CXC P;  2QDY B;  3NTH A;  4FSS A;  1PCX A;  4OMF B;  1VQP T;  4CC3 A;  3LH0 A;  5J39 A;  3A5Y A;  4C5I A;  3L2W A;  5HKC A;  4E7S A;  1NYR A;  1VQM A;  1S72 A;  2JM8 A;  1M1K C;  1VIF A;  2ALY B;  2QA4 A;  1X2H A;  3UT1 A;  2LQW A;  2DNU A;  2KXD A;  3CCM T;  1KG1 A;  5GAM h;  1VQK Q;  3TEH B;  4A53 A;  3QHS A;  1Z7M A;  5LJ3 f;  5KYX B;  1NJ6 A;  2LTO A;  2O9V A;  4H2U A;  4N4G A;  2RJE A;  2M51 A;  4RUG A;  4DOW A;  4ZGE B;  2ZIO A;  4OB2 B;  3G4S T;  2CH4 W;  3I56 Q;  3CD6 Q;  3SB2 A;  1WXU A;  4PJM A;  4PFZ A;  3CCJ A;  5GAN 4;  3HFZ A;  3PGG A;  4M7D E;  5HK3 A;  5KYY A;  4XAX B;  3I55 A;  3NPF A;  1VQN A;  4M7D B;  3CBP A;  1QLY A;  4BUG A;  1WXB A;  3HXY A;  1GFD A;  2RH2 A;  1WLE A;  1W6X A;  3O8V A;  4CS3 A;  4J9I A;  1R0C B;  1ACM B;  3LX7 A;  1OEB A;  3QO3 A;  4YRS A;  1NNH A;  3NEL A;  4PL6 A;  2RHS A;  3AT1 B;  4JZ4 A;  3VV0 A;  2CJB A;  3MCA B;  2DYB A;  3EH1 A;  4HWR A;  4CI0 C;  3EFR A;  3NEM A;  1N9S A;  2F2X A;  2PZ1 A;  3QXE B;  4RKU E;  4DQ2 A;  5DM7 R;  3A7R A;  4YRR A;  1GCP A;  1HD3 A;  4OML A;  4TQD A;  5CVI A;  2EYW A;  4BW9 A;  3QSU A;  4M7D C;  1GGM A;  2ED1 A;  4MZM A;  3M0S A;  3M4G A;  2XIC A;  2EQM A;  3VS3 A;  2SEM A;  4VUB A;  5FU6 C;  1VQ6 Q;  3RKW A;  4CC2 A;  1K76 A;  1PD0 A;  2LP5 A;  1JJC B;  4M77 A;  4NL2 A;  2QI2 A;  1VQP Q;  3EHR A;  1BBU A;  4J6Y A;  3EGD B;  4XU3 A;  3OYN A;  3CCU T;  4J6W A;  2L3Q A;  5KYY B;  1W2B S;  1Q86 R;  1X2G A;  3I5S A;  1VQ8 Q;  4FT2 A;  2E5Q A;  3RR6 A;  2H3J A;  3CC2 T;  5F5W A;  2K2M A;  1BBZ A;  1NPP A;  4Y92 A;  1G3W A;  1HTT A;  3E9I A;  1RAI B;  1IGU A;  3OBY A;  3A98 A;  1N8R C;  1Q82 U;  1TTH B;  1VQ6 T;  2LJ1 A;  4IUU A;  3SEM A;  1KOG A;  2DLP A;  3OW2 P;  3QPH A;  5C0M A;  2EYX A;  5FU6 B;  1JJ2 A;  2E3I A;  3KFV A;  3SDZ A;  4KR3 A;  4AFQ C;  1QCN A;  5A0D A;  11AS A;  4CH6 A;  2BUD A;  2V1R A;  2RK1 A;  4XU1 A;  1M8V A;  2AMC A;  3GNF B;  2ZPI B;  3P8V A;  1AT1 B;  1WJS A;  2CRE A;  2COZ A;  2IY5 B;  1UFF A;  1NZ9 A;  1PYS A;  2QEX A;  1GRI A;  1G8X A;  3TVT A;  2YRD A;  1OYX A;  1B7Y A;  3DSQ A;  1ASY A;  3JCM W;  4H2X B;  2VWF A;  4ZTU B;  2P4T A;  2DO3 A;  2HMA A;  2BZ8 A;  1QCF A;  2VGM A;  2QGF B;  4AG1 C;  1UE9 A;  2K79 A;  3QJY A;  1RIQ A;  5GJW B;  1E6G A;  1UGV A;  3HPW A;  5IHK A;  2RHZ A;  3CCQ Q;  2L2P A;  3TUP A;  4G84 A;  1X2K A;  1WHL A;  2HKN A;  3QO7 A;  3KUF A;  2QQB A;  4E47 A;  2DEU A;  2JOY A;  3BFM A;  2DRK A;  5D6X A;  2CZ1 B;  1S72 T;  4C92 B;  3OYD A;  1D0X A;  2HEQ A;  2EYZ A;  5EG2 A;  1YIT T;  2RO0 A;  3TEH A;  2L3S A;  3FRN A;  4WF2 A;  2X3X D;  2E6N A;  1SRY A;  3C95 A;  4QVZ A;  3CXC A;  4QQ6 A;  1K8A C;  2QXF A;  2KDS A;  2GGR A;  2KMT A;  2EYQ A;  1K73 R;  4KGZ B;  1B34 B;  4KUD K;  2YXY A;  4O5V A;  3NTK A;  2ZPB B;  4YRO A;  1WJQ A;  3CCS T;  2IIM A;  4YRT A;  2KAF A;  2CDT A;  4K87 A;  1ADY A;  2DXU A;  1KFZ A;  1X6G A;  2O88 A;  4DBQ A;  2FZG B;  2HDA A;  1WQW A;  1BI2 A;  5CKB A;  5LJ5 d;  5GAN e;  1OX8 A;  3QZ5 B;  1UDL A;  1BCO A;  2DL7 A;  4MDW A;  3OYM A;  3E9F A;  1VQ8 A;  1OPK A;  3E1S A;  3CCE Q;  3I7F A;  2C0T A;  4F7U E;  1WPY A;  2PU9 B;  3CCS A;  1M1G A;  1KK7 A;  1SRM A;  3RMQ A;  1YHQ A;  2K5I A;  2RHU A;  2ZNJ A;  2D8J A;  2Y90 A;  4YRL A;  1I0C A;  1KD1 C;  4YRI A;  2JM9 A;  2NUT A;  1Q82 R;  3V8J A;  2KEA A;  4M75 E;  3M0T A;  3Q1J A;  2P5I A;  2PMF A;  4J15 A;  1VUB A;  3VS5 A;  4M78 F;  1BIB A;  5GMK j;  2XU8 A;  4DBR A;  2O31 A;  4ELZ C;  4R55 A;  3ZL7 C;  4P73 A;  2LJ0 A;  1ZUY A;  3R6N A;  1K9M C;  2AK5 A;  4M75 F;  2LQK A;  3JV3 A;  4RQE A;  5FRM A;  2HQX A;  2RN8 A;  4Z02 A;  3EG0 A;  4F17 A;  1Y57 A;  3J7A F;  1HYO A;  3VQV A;  1WHJ A;  3QYG B;  1JXO A;  1UJ0 A;  2PVD B;  1EFW A;  4FYX B;  1T0H A;  3MET A;  4II1 A;  2HBW A;  2R5A A;  2BIV A;  1M90 C;  1YBY A;  2FEI A;  2KSS A;  4IUR A;  1EQR A;  1R8O B;  4KUI A;  2CP7 A;  4C0G A;  5CO7 A;  2DQ3 A;  1X43 A;  2LCL A;  2DE0 X;  2RQV A;  1LCK A;  4E7H A;  3P8D A;  2PUK B;  3CCJ Q;  1E24 A;  2EL9 A;  4FCY A;  2J06 A;  3LH5 A;  1M1K R;  4J6X A;  3V8K A;  4RMF A;  4LVM A;  2NUT B;  3QNE A;  3M4P A;  4J9D A;  1K1Z A;  1KHC A;  1X56 A;  1YJN Q;  3VS7 A;  1D09 B;  2QHU A;  2DDZ A;  1ZX6 A;  1D0Y A;  2J3M A;  2EPD A;  4J9E A;  2ZCF B;  5GMK e;  3UH0 A;  3QJ6 A;  2RK2 A;  1ZQ1 A;  4JDS A;  3PIO A;  2ZR3 A;  2DM1 A;  2JJ9 A;  4J9B A;  1K0X A;  3EG3 A;  3TSW A;  1K73 U;  4C0Z A;  2PTK A;  1KQS A;  5GAO q;  4M4Z A;  1X6O A;  4H2S A;  1GL5 A;  4HWT A;  4BE0 A;  2DMO A;  3FJP A;  1RAE B;  1K8A U;  5A0L A;  5DY9 A;  2JTM A;  4OGE A;  4YRM A;  2CP3 A;  3CCR Q;  1SKU B;  4C0D B;  2WAC A;  3DLM A;  3HRK A;  3RNJ A;  1QVP A;  2VC8 A;  3WVE B;  5LJ5 e;  2RHY A;  1U1S A;  1QF6 A;  4XTZ A;  4B6M A;  1L0W A;  2DK3 A;  5GAN j;  2AZS A;  2X4Y A;  5KNN A;  3THK A;  3IKL A;  5FWC A;  1TG0 A;  8ATC B;  2Q7G A;  4M75 G;  3JCM X;  1VQ5 A;  1QVG A;  2RHQ B;  2DIQ A;  3QO8 A;  4ZNX A;  4HCK A;  3BDU A;  5FRN A;  4RCB A;  4PJO C;  3A8L B;  4J8O A;  4XQ3 A;  2DIL A;  3JCM P;  1GXI E;  1Z7N A;  3C94 A;  3LGF A;  3FLG A;  4XTY A;  3VS1 A;  3L4G A;  3CCV A;  1WGS A;  1PG5 B;  3EFO B;  1LPL A;  1OV3 A;  2QEX T;  3LGL A;  3RUX A;  1U3O A;  2NUZ A;  5CR2 A;  4IUV A;  1NYG A;  1JO8 A;  3RES A;  4MZT A;  4D8K A;  3M0Q A;  2DET A;  3VJP A;  2MIO A;  4OMN A;  1UGQ B;  1P92 A;  3M53 A;  4C8Q A;  4YRF A;  2PVG B;  1WHM A;  1FYN A;  2A36 A;  4WJ3 M;  2ED0 A;  5KYW A;  2EGC A;  3PTA A;  1WNL A;  4JRK A;  2CJA A;  1VYT A;  3HXU A;  3G4S Q;  2FPD A;  5CKE A;  3IKM B;  1N8R R;  5GAN d;  3JCM h;  4ZTZ B;  4KQE A;  3V7R A;  2DBK A;  4EO4 A;  3A5Z A;  2AHJ B;  1FMV A;  1USY C;  4LUD A;  2L8D A;  4RQF A;  1H4Q A;  2ROL A;  1JQQ A;  5C6S A;  1I5O B;  4ORZ A;  2DZ9 A;  2R5M A;  2E3H A;  3JAM E;  2I0N A;  4AFU C;  1SES A;  3M4Y A;  3QG1 A;  2A08 A;  2AT1 B;  5LJ5 f;  4KH1 B;  1VQL T;  5A2Q E;  1X01 A;  3CPF A;  3NMZ C;  4BI4 A;  1VQ5 T;  3SFM A;  5GAN 2;  3JCM V;  5GAO n;  2E64 A;  5EC7 A;  5LJ3 d;  3T9N A;  2XTI A;  4EDU A;  2FZK B;  5K1X A;  2DBM A;  2CJ9 A;  4RCC A;  2DEQ A;  2DD5 A;  2COY A;  1F1B B;  4FL6 A;  1OZ3 A;  2FVU A;  2X35 A;  4LDX A;  2CZ7 B;  4YRE A;  5KCO A;  2LJ3 A;  1K73 C;  5IAY A;  1B70 A;  2CIM A;  3JB9 F;  4JRQ A;  4M75 D;  2KBT A;  2E6Z A;  2D8H A;  4CH5 A;  2YLB A;  3WQZ A;  1PSF A;  3A7A A;  2CP0 A;  2MMP A;  2ZT7 A;  3X20 B;  4M77 D;  1PKT A;  2BE9 B;  4HT9 A;  3ME9 A;  3RKX A;  2CZ6 B;  3OW2 S;  2YUN A;  4TVA B;  4M77 E;  2GFA A;  2EJF A;  2M02 A;  2FPE A;  2KT1 A;  1NJ8 A;  1KHI A;  4M78 G;  1BYM A;  2HSP A;  2OAW A;  2EQJ A;  4HWO A;  4RTT A;  4A4E A;  2WSE E;  2LQ8 A;  1M90 R;  2G3R A;  5DLQ E;  4M7A G;  1YJN A;  1K4U S;  1VQL A;  3EAE A;  1VQZ A;  1EIF A;  1OOT A;  3OQ5 A;  5GMK h;  3CQT A;  4H2Y A;  4HCB A;  2RJC A;  3QBY A;  1HJD A;  5ELN A;  5LJ5 g;  5I11 A;  1KQ1 A;  4LDV A;  3CCE T;  2HQE A;  2DTI A;  2CH4 A;  4CH4 A;  1TH7 A;  3EG9 A;  2DU7 A;  1Y96 B;  1UHC A;  3HHT B;  5KYW B;  4M75 C;  4K86 A;  5GAN 6;  1N8R U;  1W66 A;  1QVG P;  1SSH A;  1M2O A;  3TSZ A;  3G1Z A;  5IHI A;  3LWI A;  3QYH B;  1IRE B;  3QKJ A;  1KQS P;  1VQO A;  4JJD A;  1BI3 A;  2HZY A;  1D3B B;  1XOV A;  4C8Q C;  5I2M A;  2JTE A;  2ZXF A;  1I81 A;  2JTF A;  2JN0 A;  2M0O A;  4C8Q G;  4GY5 A;  5GMK l;  2XKO C;  2M16 A;  4LN2 A;  2D0N A;  1HSQ A;  5D6W A;  2DX1 A;  2RMO A;  2YRC A;  1KQS S;  1B70 B;  5CAI A;  1U8R A;  2LX9 A;  4FYW B;  4ESR A;  3CMA A;  2E4H A;  3MEV A;  3L42 A;  4XEO A;  3H41 A;  4OGC A;  4H2T A;  1T0J A;  2OTL A;  1GCQ A;  1PWT A;  4ZN1 A;  4LDY A;  1W2B A;  4PJL A;  1UGP B;  1UJY A;  1B7T A;  2K5L A;  3I56 T;  4JRI A;  3HP9 A;  3DLL A;  1FX7 A;  5FU7 B;  3G6E A;  1YHQ Q;  1U5S A;  2KRS A;  1VQ9 A;  2Y4Y A;  4P75 C;  1YI2 Q;  3HFZ B;  2A7Y A;  4N0A C;  2YUQ A;  1ZSZ C;  5J3B A;  1SF9 A;  1VQ9 Q;  1QMC A;  2EIF A;  2Z0W A;  4FU6 A;  1NYF A;  5GMK i;  5GAN 3;  3ASK A;  3UA7 A;  4M7A A;  4HKE A;  1PRM C;  3KFU A;  2ABL A;  3S3O A;  3V7C A;  2BZY A;  2EQU A;  5LJ5 j;  2EW3 A;  1MND A;  2K3Y A;  3M54 A;  2M9U A;  4M78 E;  2RA2 A;  4AT1 B;  3BE3 A;  2LQN A;  4M7A F;  4P75 A;  2FB7 A;  4IKF A;  2VAS A;  3I5R A;  1GBR A;  1DJ7 B;  4YRP A;  3A7U A;  1AHJ B;  2MCN A;  2DIG A;  2AMC B;  1MMA A;  2RD1 A;  4P73 C;  4M7A E;  2BTT A;  2KQW A;  2I4O A;  1KC8 R;  1I07 A;  2OTJ T;  3MEU A;  4R56 A;  1M90 U;  1YIJ Q;  1YJ9 A;  2CP5 A;  1D1A A;  2CZ0 B;  1QWF A;  4E7Z A;  4RG8 A;  2ESW A;  2C8M A;  1OQK A;  4E6R A;  4HWS A;  4M7D G;  5GAO p;  4JPB W;  1TS9 A;  2ATC B;  4BY6 B;  3M59 A;  3S3M A;  3P8T A;  4PJO B;  3CC4 T;  4PJJ A;  3M0P A;  2RHI A;  3CCQ A;  1YJW T;  2XID A;  2W0Z A;  1M2V A;  4E2F B;  1ZUU A;  1YI2 T;  2XGT A;  3M55 A;  3FDR A;  4YRQ A;  3ZFJ A;  1SHF A;  1EVK A;  2ZZG A;  2RNA A;  1XJW B;  5CCA A;  1UEB A;  3H0I A;  5HGQ A;  1TSF A;  2K4Y A;  2YSQ A;  3CXC S;  2GBQ A;  3OMC A;  4H2V A;  2MI6 A;  5D7U A;  1YJ9 T;  4M77 C;  3CME T;  1ATI A;  4HXJ A;  4RTU A;  2J6F A;  3CCM A;  3S6W A;  1BIA A;  4JLI A;  1VIE A;  2RHQ A;  1JEG A;  1IB8 A;  3RF1 A;  2LNH B;  1XTD A;  3M57 A;  1OU9 A;  3RMS A;  1B34 A;  2E5K A;  2ZIM A;  2CP2 A;  1G3T A;  1KC8 C;  3EGD A;  4LDU A;  1KD1 R;  1R0B G;  2EBP A;  3G71 T;  3GOX A;  2DL5 A;  2QQ9 A;  1YJN T;  1PSE A;  2ZZF A;  2RI3 A;  1MMG A;  3ZBD A;  2EVR A;  2KVQ G;  2DJQ A;  1I1J A;  4PG3 A;  3VQW A;  3TQ7 P;  4F7U A;  2Q7E A;  3A8M B;  3E2U A;  2CKK A;  2O4X A;  1MGQ A;  4P74 A;  2RJF A;  2DFU A;  2QK0 A;  2RB6 A;  3REX A;  5LJ3 h;  4RMO A;  4OB1 B;  2HL3 A;  1FWZ A;  3QWX X;  4IUP A;  4BB7 A;  1YB3 A;  1PC0 A;  2DTO A;  1YIT Q;  1G5V A;  2KXC A;  4JLG A;  3LWH A;  3JCM b;  1LVK A;  1Q7Y R;  3A5Z B;  1AWJ A;  1EZZ B;  5IT9 E;  2C0I A;  4F16 A;  2ZCE A;  4RTZ A;  4TQF A;  3GPL A;  4FYV B;  2VUB A;  2B86 A;  4H2X A;  4XTU A;  3PZC A;  3G1J A;  1T3S A;  4J9H A;  5CIU A;  5GJV B;  4ZGJ B;  2FPF A;  1C6V X;  1H64 1;  2LVM A;  3SD4 A;  3CCR T;  3AHU A;  5E3I A;  4JUV A;  3M0R A;  4B9X A;  1VQ7 T;  1NEG A;  4DPG A;  3LW5 E;  4KBM B;  2O2O A;  5GAN 8;  2ROT A;  1PD1 A;  4HA8 A;  4MDX A;  1BI0 A;  2X9H A;  3ICA A;  4CRI A;  3G4S A;  2EGA A;  1C0M A;  4ANJ A;  3QZ9 B;  2QQA A;  4C8Q F;  1RAD B;  4M77 B;  2KT8 A;  3I55 Q;  1WQ7 A;  4HCC A;  3OYC A;  4EMK A;  2RHS B;  4C0D C;  4TVA A;  1W2B P;  1M3B A;  1JU5 C;  2OJ2 A;  1LYL A;  2QHT A;  2ZR2 A;  4HVW A;  2C06 A;  4EMH A;  2L3P A;  3X24 B;  2DAQ A;  2V8J A;  3BY7 A;  4NS5 A;  3NET A;  2QA4 T;  2ZT6 A;  5KCH A;  4XTX A;  4TVR A;  2PNI A;  2QHS A;  1U06 A;  2LDM A;  3A1P A;  2L3R A;  3HFV A;  2HQH A;  1KSW A;  1RI9 A;  1QQJ A;  1RLP C;  2IY5 A;  5LJ3 j;  1M1F A;  1S72 Q;  1KD1 U;  4K11 A;  1VQM Q;  4X5O A;  1BCM A;  2EKO A;  5KE3 A;  4FW1 A;  3HXZ A;  4L5G A;  1AZE A;  1IHW A;  3C0C A;  3TEE A;  4ELY C;  5GAM d;  1UGR B;  1IO6 A;  2RI2 A;  2K3X A;  4FW2 A;  2XDP A;  1QVG S;  1ZBX A;  1NJ2 A;  1JXM A;  3HRI A;  5IHN A;  1YFS A;  2DPP B;  1C1A A;  2YDL A;  1OU8 A;  4P3P A;  4CH3 A;  2QHV A;  1NM7 A;  4C92 F;  4TTV A;  3JCM c;  2L0A A;  3OMG A;  4LVL A;  1RAH B;  3QWY A;  3CBO A;  4NCX A;  3P8B B;  5CKH A;  1JRI A;  1AVZ C;  5FWB A;  3W3S A;  2D1X A;  3JCM J;  2E3C A;  2Q7H A;  4V2S A;  2MF2 A;  2DU5 A;  1N9R A;  3JB9 I;  4P3O A;  1I8F A;  4Q15 A;  3H8Z A;  1EIY A;  3HTZ A;  1C0A A;  1NPR A;  2P0Q A;  2BKD N;  2VGN A;  3HTR A;  2EFI A;  1USY A;  4ATO A;  4AG2 C;  3JB9 H;  1D1B A;  2D9T A;  3H9N A;  1UUE A;  1M30 A;  1WXT A;  2FHD A;  3JCM e;  3LYI A;  1VQ9 T;  4HVC A;  1H8K A;  3IQL A;  4KGX B;  2VYT A;  3PVL A;  2RQT A;  4FYY B;  3RDV A;  3CC2 Q;  2RJD A;  1ABQ A;  2I4M A;  2JS0 A;  4J7F A;  2GQV A;  2CT3 A;  2MK5 A;  1B07 A;  2DTH A;  3CCU Q;  5A0G A;  4A54 A;  1H3Z A;  4C92 A;  2I4L A;  2P4R A;  2VXE A;  1VQO T;  4YCU A;  3MEA A;  3CCQ T;  1RI0 A;  5K1P A;  4X9D A;  4Y28 E;  3L1A A;  1WI7 A;  3M4Q A;  4E7I A;  4IUT A;  2YUO A;  4JJB A;  4LVI A;  2EKH A;  4M78 B;  2GQI A;  2OX7 A;  3QTC A;  1ASZ A;  4DA4 A;  2XMF A;  1X54 A;  3SWN B;  5GAO m;  5FLX E;  2VVK A;  1X55 A;  3VS6 A;  4QVC A;  1NJI U;  2HNI A;  4Z89 A;  5KYX A;  3C4S A;  1MV3 A;  1UB4 A;  2CP6 A;  4X34 A;  4YDQ A;  1YNZ A;  2KRM A;  6AT1 B;  4CC4 B;  2OTJ A;  1CKA A;  1KIK A;  2JMC A;  1SSF A;  4WJ4 A;  1YFT A;  2A3L A;  4C92 E;  4QKU A;  7AT1 B;  4XU2 A;  2V26 A;  4OMM A;  1OI1 A;  3RAC A;  5CKD A;  1MV0 B;  4LDW A;  2LNV A;  3CCS Q;  4XTV A;  1MHN A;  1G51 A;  4YRJ A;  4EX5 A;  1K9A A;  4AFS C;  5C52 B;  5HCK A;  3ER0 A;  4OVA A;  1N9W A;  3OS0 A;  1NYQ A;  3M58 A;  1CSK A;  3VQX A;  1VQ8 T;  2KE9 A;  2V1Q A;  1BU1 A;  1GBQ A;  4ZIB A;  2JUF A;  5GAO l;  1WA7 A;  1M8M A;  2KRO A;  4EPC A;  1YJW Q;  3VBB A;  3WVD B;  5IXF A;  2HCK A;  4CS4 A;  3H0H A;  2GFU A;  3HFN A;  1K8A R;  1IZ6 A;  2ZGW A;  2XD0 A;  2IG0 A;  2ART A;  1Y07 A;  2CSQ A;  1RLQ C;  1K0S A;  3MO8 A;  3OS1 A;  1FYF A;  3I35 A;  1BB9 A;  3HRS A;  2G6F X;  1QVF A;  4F7U F;  3REU A;  3CCM Q;  4O2D A;  4BI8 B;  5FW9 A;  3GBQ A;  3LSQ A;  4KT0 E;  2LZ6 B;  2JZ2 A;  5KYU A;  1YIJ T;  1TUG B;  1D1C A;  4P74 C;  3MF1 A;  4QVD A;  4LNS A;  1TU0 B;  4PFO A;  3JCM d;  2ZPH B;  3PE0 A;  3I55 T;  1TWB A;  2MYS A;  2F69 A;  4P71 C;  3J81 E;  3OYJ A;  3CCJ T;  4QW2 A;  5ELO A;  1X6B A;  3QO5 A;  2K7A A;  2ZNI A;  1R77 A;  2GTJ A;  2NUP A;  2A8E A;  1B3Q A;  2LRQ A;  3MF2 A;  4OB3 B;  1JJ2 S;  1FMK A;  1AD5 A;  4J83 A;  2YLC A;  2JS2 A;  1SEM A;  1WX6 A;  5LJ3 g;  1M9S A;  1SPK A;  3JB9 D;  3NHN A;  4TVY A;  1E22 A;  3L2Z A;  4WTO B;  2K57 A;  1KMN A;  2OTL T;  2YT6 A;  4CS2 A;  2DXT A;  3VU3 C;  4N4H A;  1WHG A;  3F70 A;  4YRC A;  3SWN C;  3BJU A;  4WI1 A;  2XHC A;  2DD4 A;  4PFP A;  4RTX A;  1Q86 C;  1JJ2 P;  2H8H A;  2DXB A;  1E1T A;  1G3S A;  2GF7 A;  3FIF A;  5I2S A;  4C92 G;  1YJW A;  1M3A A;  1VOM A;  3MQZ A;  5GAO r;  3CC4 A;  4RG2 A;  2HL5 C;  4M7A D;  4EMG A;  3TCJ A;  1B8A A;  3M9Q A;  3EGX A;  2YUP A;  3EG1 A;  2CSI A;  3HFO A;  4L6V 5;  3PVQ A;  1RAA B;  1PRL C;  2EAY A;  1JBM A;  2VKN A;  1YCY A;  1IHV A;  5HY6 A;  1LJO A;  5IH2 A;  4GLK A;  4IIM A;  5L8R E;  1YI2 A;  1OUL A;  2K6D A;  2COW A;  3EG9 B;  3G6E Q;  3OYE A;  2ZPE B;  4OLF A;  2RF0 A;  1BK2 A;  4M77 F;  1VQ6 A;  4TVW A;  2DF6 A;  3L2Q A;  4HVU A;  2ZT5 A;  9ATC B;  1NJ1 A;  2G4C A;  2OTL Q;  4M77 G;  2OTJ Q;  4OMO A;  4RDX A;  4Z8A A;  3CEY A;  1T3L A;  1LNX A;  3P8H A;  3VYG A;  1B7Y B;  1NLP C;  5GAN h;  4E7K A;  2MAM A;  3LLR A;  2C7I A;  2ARS A;  4DEY A;  2ODR C;  1B76 A;  2HSE B;  2KYM A;  4KUL A;  3EFS A;  4YPF A;  4R0K A;  2R57 A;  3PMI A;  2FO0 A;  4D8D A;  3HL8 A;  1N6A A;  4A63 B;  1HXD A;  3CCL A;  3HRT A;  1X69 A;  1PHT A;  1TUD A;  4GBQ A;  3DB3 A;  1V29 B;  1ZSZ A;  4YCV A;  3OBW A;  5M9O A;  2ENM A;  2AZV A;  4JJN K;  1G5I A;  2CS7 A;  2EGE A;  1VQN Q;  4JS4 A;  3GNG A;  2D0Q B;  2YWW A;  2GCX A;  3EHQ A;  3X25 B;  1I5L A;  3R07 A;  3ERR A;  2AKW B;  3G6E T;  1M4Z A;  3UGT A;  4L59 A;  1IXD A;  3UPU A;  3RKY A;  1H92 A;  4JRP A;  4L87 A;  1E1O A;  1RAG B;  3R6O A;  2KNB B;  3CD6 A;  5GAN f;  3I56 A;  3UGQ A;  2QGG A;  4YRN A;  3L2R A;  1X75 C;  1VQL Q;  4FM4 B;  3IAL A;  4P72 C;  5C53 B;  1S1N A;  4RTV A;  2GNC A;  3OA6 A;  1UEC A;  4IUQ A;  2KK4 A;  1O75 A;  4BY6 C;  4ZTJ A;  1KQ2 A;  4AH6 A;  3N5B B;  2XG8 D;  2BZX A;  3RGL A;  5L23 A;  1VQK A;  3HXV A;  4LNP A;  2M0Y A;  5KYU B;  2P0L A;  4F14 A;  2FRY A;  5DLO A;  1OX9 A;  2I4N A;  4XK8 E;  1J5W A;  2E1H A;  1N5Z A;  2A28 A;  1ARK A;  1A0N B;  4E7J A;  2CYZ B;  3JCM g;  3HY1 A;  2V8I A;  1NE8 A;  2RQU A;  2LCC A;  4WCI A;  2DRM A;  2QTV A;  2RQW A;  2KGT A;  3OYB A;  1WU7 A;  2F1L A;  1VQ7 Q;  3U23 A;  1XNI A;  1UTI A;  2F2W A;  3UAT A;  4JJC A;  1SRL A;  1OPL A;  4YCW A;  2WSC E;  2AIR B;  2JVV A;  3PNW C;  1SHG A;  1AEY A;  4FSX A;  1UHF A;  5CK9 A;  4M7D F;  4JS5 A;  1K9M R;  4E51 A;  3TU4 K;  4PLL A;  4ME7 A; 
#chains in the Genus database with same CATH homology
 1HK9 A;  4YTL A;  3OYI A;  3TRE A;  1I4K 1;  2VV5 A;  4ZN3 A;  1VQK T;  4Q5W A;  4A4G A;  2ZTG A;  2P0K A;  4PHC A;  2IVW A;  2V8K A;  3A8O B;  3PT9 A;  2ARU A;  2QTX A;  1QP3 A;  3X26 B;  3OSV A;  4A4K A;  5GAN 5;  3L2V A;  1QVF S;  2PME A;  2DXC A;  2DQ0 A;  2PUO B;  4PJO A;  2O4X B;  4P5N A;  2OAU A;  3E9G A;  2LT1 A;  3RER A;  1EOV A;  3OS5 A;  3M56 A;  4M7A C;  4N4I A;  2EWN A;  2Y4X A;  4LD9 K;  3OSS C;  4C92 C;  4K88 A;  5FRO A;  2E65 A;  2X4W A;  1KC8 U;  4M78 C;  3BW1 A;  4C0F A;  4HCZ A;  2LT4 A;  1NJI C;  1BBW A;  4KR2 A;  4M7A B;  2E41 A;  3OW2 A;  3JB9 J;  1PYS B;  3L4G B;  4MML A;  5LJ3 e;  3RL6 A;  4M75 B;  3G7Z A;  3E19 A;  4OP0 A;  3C12 A;  1LOJ A;  3RIR A;  5HK0 A;  3VKI A;  1YGB A;  1YIT A;  3KXT A;  2L5Q A;  4YRK A;  2WSF E;  2FL7 A;  4H02 A;  1VQ4 A;  4F7U B;  1OZ2 A;  1Q81 C;  1H4V B;  1JB0 E;  4J7I A;  2E5A A;  1N27 A;  2E70 A;  4EMK B;  3PIP A;  4YRG A;  4MMK A;  4BI3 A;  3BDL A;  4QQD A;  4UP9 A;  3A32 A;  1VQM T;  4C8Q B;  1XQH A;  5LL6 S;  3CPW S;  3CC7 T;  3PCO B;  2ZZD A;  4F7U G;  3OY9 A;  4M7D D;  4HWP A;  1VQ7 A;  1M5Q 1;  2E10 A;  5AYF A;  1K9M U;  2E12 A;  3JB9 G;  3CCR A;  4BWA A;  4H2W A;  3VUZ A;  3KBG A;  3NEN A;  4DOV A;  4M78 D;  2QQR A;  2D6F A;  4EMK C;  4MZP A;  1KMM A;  3MP8 A;  3DB4 A;  1M1K U;  4M75 A;  2LC4 A;  5CKF A;  1EIY B;  3X28 B;  4UC4 A;  3CD6 T;  4BE2 A;  3VYH B;  1YFR A;  1FXX A;  3GLX A;  5J26 A;  3CCL T;  1SET A;  3GIB A;  3INZ A;  3HSB A;  1Q7Y U;  3PCO A;  1O9S A;  1NJ5 A;  2Q5I A;  5GAN 7;  3E9H A;  1YIJ A;  4D6W A;  4FT4 A;  4PJO G;  5GAM g;  3JCM f;  1VQN T;  1W4S A;  3OYY A;  2I2L A;  2F5T X;  5C51 B;  3JCM Q;  2ZPF B;  3JSC A;  4OF1 A;  5KH6 A;  2KY9 A;  4YP0 A;  5LJ5 h;  3MP6 A;  3QDR B;  4J5Y A;  4A4F A;  1G5H A;  3M5A A;  4XTW A;  5GAN g;  3IG2 A;  1EVL A;  1VQ4 T;  3ZEH A;  4E7L A;  2QQS A;  3G71 A;  2K2V A;  2RHX A;  2B8A A;  2O01 E;  3CCE A;  1Q81 U;  1Y96 A;  3VQY A;  3FEO A;  3OB9 A;  2RM4 A;  4X9C A;  1QP2 A;  5D6Y A;  1WJR A;  3SWN A;  4UP8 A;  4XEM A;  1WYD A;  4BDZ A;  4C92 D;  3OYA A;  2NLU A;  3OD1 A;  2YRV A;  3HY0 A;  3MHX A;  3HRU A;  3OYL A;  4PLI A;  4C5E A;  4ZGD B;  4QQG A;  4UPA A;  4O6J A;  2HAX A;  3HKS A;  2DVE A;  3FB9 A;  2ZZE A;  3UFG A;  2NS6 A;  4BAC A;  4FIB A;  5CQY A;  4A4H A;  1Y7X A;  1HC7 A;  2XDB A;  2EJG A;  4LVJ A;  3CPW A;  4N0A A;  2YHT A;  2MWP A;  3QII A;  2AKW A;  1D3B A;  2DKG A;  4Y91 A;  1H4T A;  3FC3 A;  1QE0 A;  3TEG A;  4M78 A;  4PJO E;  3URG A;  4BD3 A;  3GF5 A;  4B9W A;  3OYG A;  1BKB A;  3CBM A;  2XK0 A;  5FU7 C;  4Q6G A;  3GP8 A;  4C8Q D;  2F5K A;  1JJC A;  3VUB A;  1U1T A;  2HBP A;  5I21 A;  2DZC A;  2K5F A;  4TWA A;  1ZHI A;  4G85 A;  3NTI A;  3OYF A;  3JRZ A;  2ZT8 A;  3LSS A;  4HT8 A;  2XDD A;  3P8Y A;  3QUI A;  2JNG A;  4P3N A;  2M1H A;  3V7S A;  3PMT A;  4HT4 A;  2CGH A;  2ODR D;  2FYK A;  3HXX A;  5GAM f;  3CC7 A;  1VQP A;  2DJZ A;  3NFC A;  3CME A;  3CMQ A;  3MEW A;  2Q5H A;  4LD6 A;  3J80 E;  2PVO B;  1UGS B;  3WXM B;  3OYK A;  4PKC C;  4P72 A;  4XU0 A;  2RI5 A;  3A31 A;  2P0P A;  3V8L A;  3OYH A;  1IL2 A;  2EJ9 A;  3UWN A;  3A74 A;  2L89 A;  4C5H A;  4ZTF A;  4OB0 B;  4PJO D;  5CQX A;  3CCV T;  2VXF A;  3PFS A;  5GAM j;  3A8H B;  1ADJ A;  3DKM A;  4BE1 A;  1QW1 A;  2X4J A;  2ZPG B;  2HD0 A;  3CCU A;  2X4X A;  1Y71 A;  1SER A;  4NOY A;  3CC2 A;  2PQW A;  4P71 A;  4M7D A;  4LVK A;  5GMK m;  1YHQ T;  2ALY A;  4UP7 A;  4C5G A;  1RL2 A;  3CMA T;  3HXW A;  4NL3 A;  4PNO A;  4YYE A;  5IN1 A;  1G3Y A;  2MWO A;  4C8Q E;  3OS2 A;  5KE2 A;  3A8G B;  1H4S A;  2J3L A;  3S3N A;  3L2U A;  4BDY A;  2R58 A;  1BI1 A;  2EQK A;  3MP1 A;  3MEY A;  5GAM e;  1Q82 C;  2ZIN A;  12AS A;  1Q86 U;  4PJO F;  2XI9 A;  3UDC A;  1Q7Y C;  3LC0 A;  3H6Z A;  2QDY B;  3NTH A;  4OMF B;  1VQP T;  3LH0 A;  5J39 A;  3A5Y A;  4C5I A;  3L2W A;  5HKC A;  1NYR A;  1VQM A;  1S72 A;  1M1K C;  1VIF A;  2ALY B;  2QA4 A;  1X2H A;  3UT1 A;  3CCM T;  1KG1 A;  5GAM h;  3TEH B;  4A53 A;  3QHS A;  1Z7M A;  5LJ3 f;  1NJ6 A;  2LTO A;  4H2U A;  4N4G A;  2RJE A;  4DOW A;  4ZGE B;  2ZIO A;  4OB2 B;  3G4S T;  3SB2 A;  3CCJ A;  5GAN 4;  3HFZ A;  3PGG A;  4M7D E;  5HK3 A;  4XAX B;  3I55 A;  1VQN A;  4M7D B;  3CBP A;  4BUG A;  3HXY A;  2RH2 A;  1WLE A;  3O8V A;  4CS3 A;  3LX7 A;  3QO3 A;  4YRS A;  1NNH A;  3NEL A;  4PL6 A;  2RHS A;  3VV0 A;  2CJB A;  3MCA B;  4HWR A;  4CI0 C;  3EFR A;  3NEM A;  1N9S A;  4RKU E;  3A7R A;  3QXE B;  5DM7 R;  4DQ2 A;  4YRR A;  4TQD A;  5CVI A;  4BW9 A;  3QSU A;  4M7D C;  1GGM A;  4MZM A;  3M4G A;  2XIC A;  2EQM A;  4VUB A;  5FU6 C;  3RKW A;  1JJC B;  4M77 A;  4NL2 A;  2QI2 A;  1BBU A;  4J6Y A;  4XU3 A;  3OYN A;  3CCU T;  4J6W A;  1W2B S;  1X2G A;  4FT2 A;  2E5Q A;  2H3J A;  3CC2 T;  5F5W A;  1NPP A;  1G3W A;  1HTT A;  3E9I A;  3OBY A;  1N8R C;  1Q82 U;  1VQ6 T;  4IUU A;  1KOG A;  3QPH A;  5C0M A;  5FU6 B;  1JJ2 A;  3SDZ A;  4KR3 A;  5A0D A;  11AS A;  4CH6 A;  2BUD A;  2RK1 A;  4XU1 A;  1M8V A;  2AMC A;  3GNF B;  2ZPI B;  3P8V A;  1WJS A;  2IY5 B;  1NZ9 A;  1PYS A;  2QEX A;  1OYX A;  1B7Y A;  3DSQ A;  1ASY A;  3JCM W;  4H2X B;  4ZTU B;  2P4T A;  2DO3 A;  2VGM A;  3QJY A;  1RIQ A;  3HPW A;  2RHZ A;  3TUP A;  4G84 A;  3QO7 A;  3KUF A;  2QQB A;  4E47 A;  2JOY A;  3BFM A;  5D6X A;  2CZ1 B;  1S72 T;  4C92 B;  3OYD A;  5EG2 A;  1YIT T;  2RO0 A;  3TEH A;  3FRN A;  4WF2 A;  2E6N A;  1SRY A;  3C95 A;  4QVZ A;  3CXC A;  4QQ6 A;  1K8A C;  2QXF A;  2KDS A;  2KMT A;  2EYQ A;  1B34 B;  4KUD K;  4O5V A;  3NTK A;  2ZPB B;  4YRO A;  1WJQ A;  3CCS T;  4YRT A;  2KAF A;  4K87 A;  1ADY A;  2DXU A;  1WQW A;  1BI2 A;  5CKB A;  5LJ5 d;  5GAN e;  3QZ5 B;  4MDW A;  3OYM A;  3E9F A;  1VQ8 A;  3E1S A;  3I7F A;  4F7U E;  1WPY A;  2PU9 B;  3CCS A;  1M1G A;  3RMQ A;  1YHQ A;  2K5I A;  2RHU A;  2ZNJ A;  2Y90 A;  4YRL A;  1KD1 C;  4YRI A;  3V8J A;  4M75 E;  3Q1J A;  2P5I A;  2PMF A;  4J15 A;  1VUB A;  4M78 F;  1BIB A;  5GMK j;  2XU8 A;  4ELZ C;  4R55 A;  4P73 A;  1K9M C;  4M75 F;  2LQK A;  4RQE A;  5FRM A;  2HQX A;  4Z02 A;  3J7A F;  3VQV A;  3QYG B;  2PVD B;  1EFW A;  3MET A;  4II1 A;  2R5A A;  2BIV A;  1M90 C;  1YBY A;  2KSS A;  4IUR A;  1EQR A;  1R8O B;  4KUI A;  4C0G A;  5CO7 A;  2DQ3 A;  2LCL A;  4E7H A;  3P8D A;  2PUK B;  1E24 A;  2EL9 A;  4J6X A;  3V8K A;  4RMF A;  4LVM A;  3QNE A;  3M4P A;  1KHC A;  1X56 A;  2QHU A;  2DDZ A;  2J3M A;  2ZCF B;  5GMK e;  3UH0 A;  3QJ6 A;  2RK2 A;  1ZQ1 A;  4JDS A;  3PIO A;  2ZR3 A;  1K73 U;  4C0Z A;  1KQS A;  5GAO q;  1X6O A;  4H2S A;  4HWT A;  4BE0 A;  3FJP A;  1K8A U;  5A0L A;  5DY9 A;  2JTM A;  4OGE A;  4YRM A;  4C0D B;  2WAC A;  3DLM A;  3HRK A;  1QVP A;  2VC8 A;  3WVE B;  5LJ5 e;  2RHY A;  1U1S A;  1QF6 A;  4XTZ A;  1L0W A;  2DK3 A;  5GAN j;  2X4Y A;  5KNN A;  3IKL A;  2Q7G A;  2RHQ B;  1VQ5 A;  3JCM X;  4M75 G;  1QVG A;  2DIQ A;  3QO8 A;  5FRN A;  3BDU A;  4RCB A;  4PJO C;  3A8L B;  4J8O A;  4XQ3 A;  3JCM P;  1GXI E;  1Z7N A;  3C94 A;  3LGF A;  3FLG A;  4XTY A;  3L4G A;  3CCV A;  1WGS A;  2QEX T;  3LGL A;  3RUX A;  5CR2 A;  4IUV A;  3RES A;  4MZT A;  3VJP A;  1UGQ B;  1P92 A;  3M53 A;  4C8Q A;  4YRF A;  2PVG B;  4WJ3 M;  3PTA A;  1WNL A;  4JRK A;  2CJA A;  3HXU A;  5CKE A;  3IKM B;  5GAN d;  3JCM h;  4ZTZ B;  4KQE A;  3V7R A;  4EO4 A;  3A5Z A;  2AHJ B;  1USY C;  2L8D A;  4RQF A;  1H4Q A;  5C6S A;  2DZ9 A;  2R5M A;  3JAM E;  1SES A;  3M4Y A;  3QG1 A;  5LJ5 f;  1VQL T;  5A2Q E;  1X01 A;  3CPF A;  4BI4 A;  1VQ5 T;  3SFM A;  5GAN 2;  3JCM V;  5GAO n;  2E64 A;  5LJ3 d;  3T9N A;  2XTI A;  4EDU A;  5K1X A;  2CJ9 A;  4RCC A;  2DEQ A;  2DD5 A;  4FL6 A;  1OZ3 A;  2FVU A;  2X35 A;  4LDX A;  2CZ7 B;  4YRE A;  5KCO A;  1K73 C;  5IAY A;  1B70 A;  2CIM A;  3JB9 F;  4JRQ A;  4M75 D;  2E6Z A;  4CH5 A;  3WQZ A;  2YLB A;  1PSF A;  3A7A A;  2MMP A;  2ZT7 A;  3X20 B;  4M77 D;  4HT9 A;  3ME9 A;  3RKX A;  2CZ6 B;  3OW2 S;  4TVA B;  4M77 E;  2GFA A;  2EJF A;  1NJ8 A;  1KHI A;  4M78 G;  1BYM A;  2EQJ A;  4HWO A;  4A4E A;  2WSE E;  2LQ8 A;  2G3R A;  5DLQ E;  4M7A G;  1YJN A;  1VQL A;  3EAE A;  1VQZ A;  1EIF A;  3OQ5 A;  5GMK h;  4H2Y A;  4HCB A;  2RJC A;  3QBY A;  5ELN A;  5LJ5 g;  1KQ1 A;  4LDV A;  3CCE T;  2HQE A;  2DTI A;  4CH4 A;  1TH7 A;  2DU7 A;  1Y96 B;  3HHT B;  4M75 C;  4K86 A;  5GAN 6;  1N8R U;  1W66 A;  3G1Z A;  3LWI A;  3QYH B;  1IRE B;  3QKJ A;  1VQO A;  1BI3 A;  1D3B B;  1XOV A;  4C8Q C;  5I2M A;  2ZXF A;  1I81 A;  2JTF A;  2JN0 A;  2M0O A;  4C8Q G;  4GY5 A;  5GMK l;  2XKO C;  2M16 A;  5D6W A;  1B70 B;  1KQS S;  5CAI A;  1U8R A;  2LX9 A;  3CMA A;  3MEV A;  3L42 A;  4XEO A;  4OGC A;  4H2T A;  2OTL A;  4ZN1 A;  4LDY A;  1W2B A;  1UGP B;  2K5L A;  3DLL A;  3I56 T;  4JRI A;  3HP9 A;  1FX7 A;  5FU7 B;  3G6E A;  1VQ9 A;  2Y4Y A;  4P75 C;  3HFZ B;  2A7Y A;  4N0A C;  5J3B A;  2EIF A;  4FU6 A;  5GMK i;  5GAN 3;  3ASK A;  4M7A A;  4HKE A;  3KFU A;  3S3O A;  3V7C A;  2EQU A;  5LJ5 j;  2K3Y A;  3M54 A;  4M78 E;  2M9U A;  2RA2 A;  4M7A F;  4P75 A;  2FB7 A;  4IKF A;  1DJ7 B;  4YRP A;  3A7U A;  1AHJ B;  2DIG A;  2AMC B;  2RD1 A;  4P73 C;  4M7A E;  2KQW A;  2I4O A;  2OTJ T;  3MEU A;  4R56 A;  1M90 U;  1YJ9 A;  2CZ0 B;  4RG8 A;  2C8M A;  4HWS A;  4M7D G;  5GAO p;  4BY6 B;  3M59 A;  3S3M A;  3P8T A;  4PJO B;  3CC4 T;  2RHI A;  3CCQ A;  1YJW T;  2XID A;  1YI2 T;  2XGT A;  3M55 A;  3FDR A;  4YRQ A;  3ZFJ A;  1EVK A;  2ZZG A;  5CCA A;  1UEB A;  5HGQ A;  2K4Y A;  3CXC S;  3OMC A;  4H2V A;  2MI6 A;  1YJ9 T;  4M77 C;  3CME T;  1ATI A;  3CCM A;  3S6W A;  1BIA A;  4JLI A;  1VIE A;  2RHQ A;  3RF1 A;  1XTD A;  3M57 A;  3RMS A;  1B34 A;  2ZIM A;  1G3T A;  1KC8 C;  4LDU A;  3G71 T;  3GOX A;  1YJN T;  2QQ9 A;  1PSE A;  2ZZF A;  2RI3 A;  3ZBD A;  2KVQ G;  4PG3 A;  3VQW A;  4F7U A;  2Q7E A;  3A8M B;  2CKK A;  2O4X A;  1MGQ A;  4P74 A;  2RJF A;  2RB6 A;  3REX A;  5LJ3 h;  4RMO A;  4OB1 B;  1FWZ A;  4IUP A;  4BB7 A;  1YB3 A;  2DTO A;  1G5V A;  4JLG A;  3LWH A;  3JCM b;  3A5Z B;  5IT9 E;  2ZCE A;  4TQF A;  3GPL A;  2VUB A;  4H2X A;  4XTU A;  3PZC A;  5CIU A;  4ZGJ B;  1H64 1;  2LVM A;  3SD4 A;  3CCR T;  3AHU A;  5E3I A;  4JUV A;  4B9X A;  1VQ7 T;  4DPG A;  3LW5 E;  4KBM B;  5GAN 8;  4HA8 A;  4MDX A;  1BI0 A;  3ICA A;  4CRI A;  3G4S A;  3QZ9 B;  2QQA A;  4C8Q F;  4M77 B;  1WQ7 A;  4HCC A;  3OYC A;  4EMK A;  2RHS B;  4C0D C;  4TVA A;  1LYL A;  2ZR2 A;  2QHT A;  2C06 A;  4EMH A;  3X24 B;  2DAQ A;  2V8J A;  3BY7 A;  4NS5 A;  3NET A;  2QA4 T;  2ZT6 A;  5KCH A;  4XTX A;  4TVR A;  2QHS A;  2LDM A;  2L3R A;  3HFV A;  2IY5 A;  5LJ3 j;  1M1F A;  1KD1 U;  4X5O A;  2EKO A;  5KE3 A;  3HXZ A;  4L5G A;  3TEE A;  4ELY C;  5GAM d;  1UGR B;  2RI2 A;  2K3X A;  1QVG S;  2XDP A;  1ZBX A;  1NJ2 A;  3HRI A;  1YFS A;  2DPP B;  4CH3 A;  4P3P A;  2QHV A;  4C92 F;  4TTV A;  3JCM c;  3OMG A;  4LVL A;  3CBO A;  4NCX A;  3P8B B;  5CKH A;  1JRI A;  3W3S A;  3JCM J;  2E3C A;  2Q7H A;  4V2S A;  2MF2 A;  2DU5 A;  1N9R A;  3JB9 I;  4P3O A;  1I8F A;  4Q15 A;  3H8Z A;  1EIY A;  3HTZ A;  1C0A A;  1NPR A;  2P0Q A;  2BKD N;  2VGN A;  2EFI A;  1USY A;  4ATO A;  3JB9 H;  2D9T A;  2FHD A;  3JCM e;  3LYI A;  1VQ9 T;  4HVC A;  2VYT A;  2RJD A;  2I4M A;  4J7F A;  2GQV A;  2DTH A;  5A0G A;  4A54 A;  1H3Z A;  4C92 A;  2I4L A;  2VXE A;  1VQO T;  4YCU A;  3MEA A;  3CCQ T;  1RI0 A;  5K1P A;  4X9D A;  4Y28 E;  3L1A A;  3M4Q A;  4E7I A;  4IUT A;  4LVI A;  4M78 B;  3QTC A;  1ASZ A;  4DA4 A;  1X54 A;  3SWN B;  5GAO m;  5FLX E;  1X55 A;  4QVC A;  1NJI U;  2HNI A;  3C4S A;  1UB4 A;  4X34 A;  4YDQ A;  2OTJ A;  1SSF A;  4WJ4 A;  1YFT A;  2A3L A;  4C92 E;  4XU2 A;  1OI1 A;  3RAC A;  5CKD A;  4LDW A;  2LNV A;  4XTV A;  1MHN A;  1G51 A;  4YRJ A;  4EX5 A;  5C52 B;  3ER0 A;  4OVA A;  1N9W A;  3OS0 A;  1NYQ A;  3M58 A;  3VQX A;  1VQ8 T;  4ZIB A;  2JUF A;  5GAO l;  4EPC A;  3VBB A;  3WVD B;  4CS4 A;  3HFN A;  2GFU A;  1IZ6 A;  2ZGW A;  2XD0 A;  2IG0 A;  2ART A;  1Y07 A;  3MO8 A;  3OS1 A;  1FYF A;  3HRS A;  1QVF A;  4F7U F;  3REU A;  4O2D A;  4BI8 B;  3LSQ A;  4KT0 E;  2JZ2 A;  1YIJ T;  4P74 C;  3MF1 A;  4QVD A;  4LNS A;  3JCM d;  2ZPH B;  3I55 T;  2F69 A;  4P71 C;  3J81 E;  3OYJ A;  3CCJ T;  4QW2 A;  5ELO A;  3QO5 A;  2ZNI A;  2A8E A;  2LRQ A;  3MF2 A;  4OB3 B;  1JJ2 S;  4J83 A;  2YLC A;  5LJ3 g;  1M9S A;  3JB9 D;  4TVY A;  1E22 A;  3L2Z A;  2K57 A;  1KMN A;  2OTL T;  4CS2 A;  2DXT A;  3VU3 C;  4N4H A;  3F70 A;  4YRC A;  3SWN C;  3BJU A;  4WI1 A;  2XHC A;  2DD4 A;  1Q86 C;  2DXB A;  1E1T A;  1G3S A;  2GF7 A;  3FIF A;  5I2S A;  4C92 G;  1YJW A;  3MQZ A;  5GAO r;  3CC4 A;  4RG2 A;  4M7A D;  4EMG A;  3TCJ A;  1B8A A;  3M9Q A;  3HFO A;  4L6V 5;  2EAY A;  1JBM A;  1YCY A;  5HY6 A;  1LJO A;  4GLK A;  5L8R E;  1YI2 A;  3OYE A;  2ZPE B;  4OLF A;  4M77 F;  1VQ6 A;  4TVW A;  3L2Q A;  2ZT5 A;  1NJ1 A;  2G4C A;  4M77 G;  4RDX A;  3CEY A;  1LNX A;  3P8H A;  3VYG A;  1B7Y B;  5GAN h;  4E7K A;  2MAM A;  3LLR A;  2C7I A;  2ARS A;  2ODR C;  1B76 A;  4KUL A;  3EFS A;  4YPF A;  2R57 A;  3PMI A;  3HL8 A;  1N6A A;  1HXD A;  3CCL A;  3HRT A;  3DB3 A;  1V29 B;  4YCV A;  3OBW A;  5M9O A;  4JJN K;  1G5I A;  2CS7 A;  4JS4 A;  3GNG A;  2D0Q B;  2GCX A;  3X25 B;  1I5L A;  3R07 A;  3ERR A;  2AKW B;  3G6E T;  1M4Z A;  3UGT A;  4L59 A;  3UPU A;  3RKY A;  4JRP A;  4L87 A;  1E1O A;  3CD6 A;  3R6O A;  5GAN f;  3I56 A;  3UGQ A;  4YRN A;  4P72 C;  1X75 C;  3L2R A;  4FM4 B;  3IAL A;  5C53 B;  3OA6 A;  4IUQ A;  2KK4 A;  1O75 A;  4BY6 C;  4ZTJ A;  1KQ2 A;  4AH6 A;  3N5B B;  2XG8 D;  3RGL A;  3HXV A;  1VQK A;  2P0L A;  5DLO A;  2I4N A;  4XK8 E;  1J5W A;  2E1H A;  4E7J A;  2CYZ B;  3JCM g;  3HY1 A;  2V8I A;  1NE8 A;  2LCC A;  3OYB A;  1WU7 A;  1XNI A;  4YCW A;  2WSC E;  2JVV A;  3PNW C;  4FSX A;  5CK9 A;  4M7D F;  4JS5 A;  4E51 A;  3TU4 K;  4PLL A;  4ME7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...