4XTVA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 36 (n-({[(1r,3s)-3-(6-amino-9h-purin-9-yl)cyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 95
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtvA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtvA01
4M78D 3RL6A 2DQ0A 3EFSA 3JB9D 2ZT8A 5GAMd 2QHSA 4N0AA 1JJCA 5E3IA 2AKWA 3HXZA 3VQWA 1JRIA 1NJ2A 4YREA 4XTXA 3RACA 3NELA 4M78G 4XU0A 4PNOA 3HXXA 1JJCB 3TEHB 3JCMQ 4P75A 1H4QA 2AKWB 4EMKC 4PJOB 1WQWA 1WQ7A 1HTTA 4C92C 4C8QC 3HY0A 4C92G 3VU3C 2EJGA 4J6XA 5GAMe 3AHUA 3KFUA 1M8VA 4NCXA 2ZZGA 1X55A 3V7CA 5DY9A 3LSSA 3A7RA 1SRYA 2P0LA 2ZT7A 3QHSA 4KQEA 3M4GA 3MF1A 3BFMA 2RB6A 4N0AC 2J3MA 3CMQA 2VXFA 2EJFA 4M7DC 5LJ3g 4OP0A 3HTZA 4C92D 1SERA 1QF6A 2ODRD 1D3BA 1W66A 4PJOF 2RHQA 1YCYA 3SWNB 3QO7A 4YRTA 2ZXFA 2DU7A 3ERRA 3REUA 3A74A 3HXYA 2I4OA 2ALYB 2PMEA 2DZCA 3SB2A 2J3LA 4M7AB 3HXUA 3JCMh 4M7DD 4CS4A 4Y91A 4X9CA 4XEMA 3HFZB 4M7AD 4C8QB 2ALYA 4P75C 4P74C 5LJ3h 5LJ3d 1EVLA 1USYC 2I4NA 3HY1A 4C8QG 2E1HA 3LSQA 4NL3A 3BY7A 4HWPA 4XQ3A 4HWOA 1HK9A 4NL2A 4C92B 4Q6GA 1KQ1A 4XU3A 1SESA 3QO3A 4HVCA 2Q7GA 2K57A 1G5IA 1KQ2A 5LJ5f 1E24A 1X56A 4XTWA 4M7AE 3L1AA 1B70B 2ZR3A 3DSQA 1I81A 1X2HA 4EX5A 3L2ZA 4YRKA 2DXUA 2Q7EA 3A7UA 3I7FA 1ADYA 1Y96A 5GAN8 1B7YB 4RCBA 4YRLA 2IY5B 2DTOA 4M78E 1YGBA 3TEHA 4CH4A 4BWAA 2C8MA 3A32A 2RHSA 2I4MA 2ZR2A 3VQXA 1JBMA 1B7YA 4M78A 1I8FA 2ARTA 4OLFA 2RD1A 3HFVA 3IKLA 4BW9A 4CH5A 4XU1A 2I4LA 2DEQA 4XU2A 1YFSA 4DPGA 4YRGA 3VQYA 3V7RA 5C52B 3V8LA 4EMKB 4F7UG 1NJ6A 4XTUA 4M78F 4XTVA 4M7AA 2P5IA 3PCOA 5HGQA 4M77E 5GAOq 4YCWA 4ZTUB 3NEMA 1LNXA 3G1ZA 1B34B 3JB9I 3WQZA 4UPAA 3QTCA 1H4SA 2EL9A 4TTVA 4M7DF 1B34A 4QVDA 4HWSA 4DQ2A 2CIMA 1ADJA 4H2VA 4AH6A 4M78C 3JCMP 1HC7A 2XTIA 4M7DG 2G4CA 4K88A 3FB9A 3RUXA 3V8KA 5GAN5 1H4TA 3A5ZA 4P71C 5LJ5h 2YLCA 4F7UB 1E22A 1ASYA 4M75B 2CJ9A 1J5WA 4YRFA 4M75E 2ZIOA 4YRPA 1EVKA 1N9RA 2ARUA 4XTZA 2RHSB 3PGGA 1X2GA 1WU7A 4HWTA 4M77C 4PHCA 4YRRA 5GMKi 4JRIA 1RIQA 4WJ4A 4G84A 1EIYB 1GGMA 3L4GA 2DVEA 4TVWA 4C8QA 3HRIA 2DXTA 5LJ5j 3BW1A 3RIRA 5GAMg 2EWNA 1EQRA 4P74A 4YRQA 4YYEA 4H2YA 3QSUA 4YRJA 4MMLA 1I4K1 5CAIA 2AMCA 4M77B 3L4GB 4ZTZB 2ARSA 3IKMB 2DTIA 4C92A 5KNNA 3V7SA 2EJ9A 4M77F 2ZT6A 5GANh 1WYDA 3ICAA 2YHTA 1SETA 2ZGWA 2QTXA 1YFRA 1MGQA 2RHQB 2CJAA 4NOYA 4Q15A 4YCUA 5GANj 5GANf 2E41A 2CGHA 4XTYA 4M75A 4L87A 4RQEA 3QO8A 2ZNIA 4F7UA 3JCMd 2Q7HA 2ZTGA 1ASZA 3MF2A 1G51A 5GANd 1BIBA 3JB9G 5GAOp 3JCMJ 1HXDA 3JCMW 4M75G 3RF1A 4YRMA 4UP7A 1YFTA 1BBUA 4P3PA 1PYSB 1X54A 1USYA 4WJ3M 4CS2A 4HWRA 1TH7A 5GANg 2E3CA 2JN0A 3JCMg 1WLEA 1D3BB 4RCCA 3HFOA 3E9IA 1B76A 3JB9H 1BIAA 4HT9A 3INZA 4CH6A 1NYRA 4QVCA 4PJOC 4C92E 1FYFA 1QE0A 2QHTA 5GAMh 3A31A 1BBWA 3IALA 3REXA 4A54A 3QUIA 5ELNA 2QHVA 3PCOB 4KR2A 3EFRA 1Z7NA 4PG3A 1EFWA 5I21A 4C8QF 1NJ1A 4J15A 3JCMf 4UP9A 2ZT5A 2DJZA 5LJ5d 4M7DA 3E9HA 5GAN6 4JUVA 4EO4A 3SWNA 4C8QD 5K1PA 4H2XB 4YDQA 1WNLA 3RGLA 2IY5A 3RESA 3HFNA 4UP8A 1LJOA 3OD1A 4P72C 5LJ5g 2E5AA 5K1XA 4M75D 11ASA 5GMKm 4M7DB 1H4VB 4H2XA 3JCMe 3HXVA 2E10A 4JLIA 5GMKe 5GAN4 2QHUA 3V8JA 1B70A 1WPYA 1N9WA 2C7IA 1E1OA 3JCMX 3TEGA 5GAOm 4H2TA 4F7UE 4K87A 4HA8A 5GMKj 12ASA 2VC8A 4WF2A 2ZNJA 4YRNA 5GMKl 4RDXA 4M77G 5LJ3f 4C8QE 5LJ3j 4H2SA 4YRCA 2YLBA 5C51B 3SWNC 4WI1A 4X9DA 1NJ8A 5ELOA 4RQFA 1X01A 5GAN3 2XGTA 5GAOl 4EMHA 5F5WA 2DTHA 3NETA 2Q5HA 1M5Q1 4MMKA 4PJOE 4TVYA 3RERA 3FIFA 4RMFA 2DKGA 4CS3A 1PYSA 3P8YA 2VXEA 1B8AA 4M75F 3NENA 2ZINA 1Z7MA 3UFGA 4YROA 2PMFA 3HXWA 4YPFA 4EMKA 4P73C 4M7AF 1E1TA 3M4QA 2HNIA 3JCMb 5GAOn 4M78B 4K86A 1EIYA 3PZCA 5GANe 3UH0A 3VBBA 4E51A 2ZZFA 3FJPA 4V2SA 2ZCEA 1LYLA 4YRSA 3UGTA 3BDUA 4EMGA 4HT8A 3JCMV 4TVAA 1C0AA 2RA2A 4KR3A 1U1SA 4M77A 1EOVA 2ODRC 4TWAA 4C92F 4M77D 3MEYA 1KMNA 1NNHA 1IL2A 1LOJA 2DZ9A 3RKXA 4TVAB 4O2DA 3JCMc 3JB9F 2FB7A 2ZIMA 4PJOA 5LJ5e 3LC0A 2CJBA 4YP0A 3W3SA 2E64A 3RKWA 2RM4A 2FYKA 3HRKA 3IG2A 5C53B 4F7UF 3QO5A 4PJOG 3GIBA 2I2LA 1I5LA 4M7DE 4M7AC 1G5HA 4P3NA 3HFZA 3TUPA 2EAYA 5GMKh 3QNEA 5LJ3e 4TQFA 4G85A 3A7AA 4ZIBA 5GAN2 3UGQA 5GAMf 3P8TA 3HSBA 1YB3A 3A5YA 4M75C 5GAMj 3M4PA 4YRIA 1ATIA 1U1TA 1NJ5A 4JRKA 4J6WA 4J5YA 4YCVA 1L0WA 5GAN7 4H02A 4TQDA 4P73A 1KMMA 3RKYA 4X5OA 3BJUA 3JB9J 1KOGA 2DDZA 2E65A 2ZZEA 1N9SA 3R07A 4P71A 4LNSA 2Y90A 5GAOr 3P8VA 1H641 4H2UA 4P72A 4XEOA 3VQVA 1Y96B 2Q5IA 4CH3A 2DQ3A 4H2WA 4J6YA 2AMCB 4A53A 1NYQA 1VQZA 4P3OA 4M7AG 2DU5A 4PJOD
chains in the Genus database with same CATH superfamily
1Q81U 1KSWA 3EG1A 4QQGA 3ASKA 4CC4B 2H8HA 2JXBA 3EG0A 5E3IA 4OB0B 3VKIA 1D1CA 2PTKA 3REAB 4XTXA 2DBKA 4IUUA 2KSSA 4PNOA 2IPOB 4EIKA 3QBYA 1H4QA 5FU7B 1UTIA 4AG2C 4EMKC 2X4JA 2AKWB 3I55A 3UF4A 1HTTA 1T3SA 2D0QB 3CPWS 3GOXA 3VS7A 5GAMe 3AHUA 3T9NA 3JAME 2FZGB 1M90R 3HTRA 2ZT7A 1SRLA 3QHSA 3M4GA 2DMOA 2CUBA 1UGRB 4N0AC 5CKHA 2VXFA 3CPWP 3OYMA 3CCEA 1SERA 4HVUA 4PJOF 3J80E 3CBPA 2QASA 3HRSA 2DE0X 3E1SA 4JRPA 3S3OA 3QO7A 4JJNK 1TUGB 2ZXFA 2DPPB 2DU7A 2ALYB 5L23A 2R57A 4ZN3A 3RBBB 4M7AB 2COYA 1W70A 2D6FA 1Q7YU 1UUEA 2IG0A 1M30A 1VQ4Q 4M7AD 2K79A 2K9GA 3NFCA 4P74C 5LJ3d 2ED0A 1YI2T 1QCNA 1NM7A 3CC4A 1VQ7A 1K0XA 3LSQA 4J9IA 5J39A 1QWEA 3CXCP 4XAXB 2KRSA 3VRYA 1JU5C 4FW2A 3PMTA 5KH6A 3S3MA 1VQMA 4XU3A 1NG2A 3QO3A 2K57A 4N4GA 5LJ5f 3VS0A 3LGFA 2BUDA 2RO0A 1K73R 3TQ7P 1X2HA 3MP8A 2Q7EA 3A7UA 1QP2A 4C5IA 5GAN8 1VUBA 3CQTA 4FYWB 1B7YB 3X25B 3OA6A 2IY5B 2DTOA 2LT4A 4CH4A 5KYUB 2C8MA 3LH5A 4IUVA 1YJWA 1SSFA 1B7YA 1K1ZA 2CUDA 2QG9B 3M0RA 2M0YA 2NUTA 2ARTA 2RD1A 1YWOA 1V76A 3EG9A 4XU2A 1YFSA 5FRMA 4FYXB 4OF1A 5DLOA 4RG2A 1MMAA 2O01E 2NWMA 3M0UA 2BKDN 2A0FB 4IUPA 3CMET 1Z9ZA 1QP3A 2NUPB 1KHIA 5KE2A 5EG2A 5IHIA 1WX6A 1B34B 2QK0A 1OU9A 3WQZA 4UPAA 3FRNA 2W10A 4TTVA 3ULRB 4E7ZA 2FEIA 2RI2A 4QVDA 4HWSA 2CIMA 3OBWA 3OMCA 2COZA 2RI3A 3CC7A 2RQWA 2XTIA 4M7DG 1BKBA 4K88A 4E7LA 3RUXA 3V8KA 1VQ8T 2VV5A 2RNAA 1RLQC 2EBPA 4PJLA 5LJ5h 1TU0B 1UEBA 1VOMA 1ZBJA 1UJYA 4J9BA 4F17A 3OYLA 1K9MU 4Y92A 1KQSP 4JPBW 1G5VA 1J5WA 3EGUA 4YRPA 1CSKA 2ARUA 2RHSB 4XTZA 1SHGA 2HAXA 1W2BP 2QA4T 1LPLA 4DOVA 5KYYA 3QIIA 3IQLA 2MF2A 1PKTA 1OZ3A 1XQHA 4WJ4A 1ARKA 4G84A 4J7FA 4R0KA 2G6FX 1B3QA 5CQXA 4C8QA 5LJ5j 5HKCA 2ZPIB 4J9EA 3CMEQ 2MK5A 2E3HA 1VQ8Q 1QVGP 4YRQA 3X20B 2HQHA 3EG2A 3RMQA 3F70A 1S72T 1VYUA 4ZTZB 2ARSA 3GP8A 5GANh 3CMAT 2XHCA 2QTXA 2QA4Q 2C0IA 3CC4Q 4FT2A 4E2FB 3OQ5A 2DD4A 4KGXB 4M75A 4OGEA 5HK3A 2KNBB 3A8OB 3EG3A 1K9MR 1OZ2A 3QYHB 3JB9G 2PQWA 2O9SA 9ATCB 2JZ2A 1YITA 1PYSB 1VQPA 1QW1A 1M1GA 1PHTA 3CC2A 1KC8R 1AVZC 2ESWA 2JMAA 1XOVA 1QVGS 1IRXA 1ZSGA 4HT9A 3INZA 1AWXA 1PSFA 1FYFA 2XKOC 2MWOA 1ZUUA 2M0OA 4KBMB 3I56A 3PCOB 1VIFA 3L2QA 3EHRA 3H6ZA 3OYKA 1SKUB 2PVOB 1MNDA 2DLPA 4D8DA 3SFMA 1G3TA 1XTDA 5GAN6 3VUBA 2F69A 2CP7A 4F04B 2ABLA 3X28B 3SWNA 4C8QD 2GBQA 1WNLA 2IY5A 1NPRA 3OS2A 3CCVT 2L3SA 4DBRA 2YRDA 3EGDA 2PU9B 4TVRA 1Q86U 2E5AA 5K1XA 3OW2P 3VYHB 3CC2T 2BIVA 4B6MA 5GMKm 1W4SA 3M59A 5IAYA 3HXVA 2LCLA 1UB4A 3V8JA 1B70A 1N9WA 1PM3A 3JCMX 5GAOm 4H2TA 3RR6A 2RHUA 4QQ6A 5GMKj 2D8HA 5DM7R 1OULA 4WF2A 2KDSA 2RQTA 3KXTA 5LJ3f 5LJ3j 2YLBA 5C51B 5A0LA 4ATOA 2A8EA 4X9DA 5ELOA 3RDVA 2DYBA 4RQFA 3M0PA 5I2SA 1QQJA 4MDWA 5CVIA 2O2OA 2XGTA 5GAOl 2RHZA 3NETA 2Q5HA 3OB9A 1IHWA 4MMKA 4TVYA 1M3CA 4CS3A 1I5OB 2EIFA 5EC7A 1VQOQ 3CBOA 4M75F 2FRYA 3NENA 5HK0A 4RTYA 2XIDA 4YROA 4AMCA 2PMFA 3HXWA 4EMKA 4M7AF 2JUFA 3EH1A 4LD6A 1E1TA 1Q82R 4EPCA 2B8AA 1D1AA 4M78B 3CD6T 2J7IA 2RJCA 2COWA 3VBBA 1MMNA 1Y07A 1KQSS 2V26A 1N8RU 1YNZA 2MPXC 3UGTA 3HPWA 8ATCB 4EMGA 2JS2A 4TVAA 2RA2A 3DB4A 4TWAA 3MEYA 5I11A 1VQOT 1MMDA 4IIOA 1Q7YC 2DZ9A 1RAGB 1KD1U 3JCMc 4L6V5 4DEYA 3LC0A 3W3SA 4YP0A 2YWWA 4RTVA 2FYKA 3PE0A 3CC2Q 5C53B 3NTIA 3MP6A 1ZLMA 2MAMA 1T3LA 2I2LA 4KT0E 2GF7A 4M7DE 1QVPA 1G5HA 3E9GA 2AK5A 2EAYA 1HD3A 3CCUQ 1TS9A 4KULA 3QJYA 3CCUA 3CMEA 5FLXE 3A7AA 4AFUC 4ZIBA 2K5LA 3VYGA 4JJCA 3G6EA 1YCSB 2RI5A 3A5ZB 2A36A 1W1FA 6AT1B 4MDXA 2FZCB 1WIEA 2CZ6B 4M75C 4YRIA 1NJ5A 2X4WA 3M57A 4BI3A 4YCVA 1L0WA 2PVDB 4H02A 4P73A 1YJWT 1KMMA 4X5OA 3JB9J 2F2VA 2V1RA 2DIGA 1N9SA 2KXDA 1RAIB 2AKKA 4Z02A 5GAOr 1H641 3R6OA 4P72A 1JJ2P 1I1JA 2Q5IA 1NBEB 1X2QA 4WCIA 5FU6C 4GLMA 1JQQA 4VUBA 3KBGA 3THKA 4P3OA 1VIEA 3CCLQ 3MF2A 1M9SA 2DXBA 3G71T 2P0KA 1VQPQ 3EFSA 1SHFA 4JDSA 2ZT8A 2CP0A 2SEMA 2F5TX 1ZSZC 1X6OA 1BBZA 3VQWA 3META 2K3XA 1X6GA 3TEHB 1K8AU 3CBMA 4P75A 2C0OA 2V8KA 1OOTA 4C8QC 3I56Q 1TOVA 2DAQA 4C92G 2CP5A 4J6XA 1PCXA 2HCKA 4PKCC 4NCXA 2DL8A 3NTKA 3OBYA 5DY9A 3LSSA 3A7RA 2P0LA 2XICA 4OB3B 1NEBA 3M54A 4KQEA 5A2QE 1YBYA 2MMPA 1BK2A 2EJFA 4OP0A 1K9AA 4DBFA 5FWBA 3BE3A 1KHCA 2OAUA 2KXCA 2RHQA 3CMAA 1M1KU 3SWNB 3CPWA 4PJMA 2EYYA 2BZXA 2X9HA 2DEUA 4YRTA 3ERRA 3REUA 3HXYA 5KYWA 4NS5A 4BY6B 3JCMh 2CS7A 4LD9K 3EGXB 4CS4A 4Y91A 4A4EA 4JZ4A 3CEYA 3GF5A 3M0QA 1JXOA 1KC8U 2O9VA 2EGCA 4FSSA 1ACMB 2MYSA 4FL6A 2K2VA 5LJ3h 1H3HA 2P0PA 2E1HA 1O75A 3BY7A 1E7OA 4HWPA 2A7YA 1Y7XA 2WSFE 1HK9A 4IUQA 2O88A 2JM9A 2DERA 2HDAA 4C92B 3QYGB 1KQ1A 1YFNA 5KYXB 1SESA 4C0ZA 3L2VA 1G5IA 3NPFA 4B9WA 1G8XA 5FW9A 3CXCS 4ZN1A 2FHDA 2BE7D 2AZSA 1ZBXA 1I81A 4AG1C 3L2ZA 2DXCA 4YRKA 2RPNA 2GFAA 2E70A 3I7FA 2D0NA 4YTLA 4CC3A 1X6BA 1Y96A 2D1XA 2DBMA 5D7UA 3H0FA 5AYFA 3OYIA 4YRLA 1YGBA 2CT4A 4LNPA 5CIUA 5J26A 3A32A 2YUNA 2I4MA 3ER0A 2ZR2A 3VQXA 3X26B 4M78A 4CH5A 3G4SA 4C5HA 3IKLA 4XU1A 3M5AA 1QLYA 2I4LA 3H0IA 1ZHIA 2DEQA 2GTOA 1AWOA 4DPGA 3VQYA 3V7RA 2CYZB 4EMKB 1VQ9A 2K5FA 4J9GA 3DKMA 4F16A 2P5IA 5HGQA 4X34A 1K76A 1FWZA 1TUCA 2QDLA 4C0DB 1VYVA 3L2WA 2HKQB 4WTOB 3JB9I 3FDRA 2FO0A 2EW3A 5KYYB 4ZGEB 3OSSC 1H4SA 2EL9A 1Q86C 1WXTA 2OTJT 1GRIA 5ECAA 4H2VA 4HVWA 4M78C 4AH6A 3JCMP 2FZKB 2R5AA 4DBQA 2G4CA 4QKUA 3FB9A 4ME7A 2CP3A 2RMOA 2YLCA 3KFVA 4F7UB 1YWPA 1Q7YR 1D0XA 1WHHA 2O31A 1E22A 2RHXA 1TXQA 2DL3A 4E7JA 4M75E 1EVKA 2G3RA 3M4YA 4OGCA 1YHQQ 1VQ7T 2A3LA 1WU7A 4HWTA 2J05A 1X75C 2OTJA 2CH4W 5GMKi 1R0BG 3EGDB 1RIQA 4AFZC 1EIYB 1GGMA 1IO6A 1M1KC 4TVWA 1WDXA 2DJQA 3HRIA 2DXTA 3LH0A 2VKNA 2DVJA 3RIRA 3EFOB 1BI0A 1MV3A 4YRJA 3C4SA 1VQ9T 3QZ9B 2DRKA 2AMCA 4Q5WA 4MZPA 1LVKA 1U06A 3L4GB 4KH1B 1A0NB 3QZ5B 3WVEB 1ZX6A 2DTIA 2LCCA 2E4HA 4M77F 4OMMA 3O5ZA 2ZGWA 3FEOA 2RN8A 2L3PA 1BI2A 3EAEA 2KROA 3NTHA 3HRTA 2D9TA 1MGQA 1ABQA 4NOYA 2CJAA 1OU8A 2F2WA 4DOWA 5GANj 2H3EB 2CGHA 4XTYA 4N4HA 4L87A 1QVGA 4RQEA 3ZFJA 2ZNIA 2Q7HA 1DJ7B 1UGPB 2PVGB 2ZZDA 1G51A 1W2BS 3JCMJ 1HXDA 3C12A 2BZ8A 3S3NA 1BI1A 5GJVB 4CC7A 4WJ3M 4HWRA 2DD5A 3VS2A 3NMZC 1WHGA 1U5SA 2LP5A 5GANg 4LUEA 4OVAA 1M1FA 3JCMg 4FW1A 1D3BB 4RCCA 3CCRT 3CCRA 1UDLA 3HFOA 1K8AC 3JB9H 1WGSA 3L2UA 1BIAA 4QQDA 4C5EA 4PJOC 4C92E 2DRMA 5GAMh 3A31A 3IALA 5ELNA 3E2UA 2VYTA 5FROA 1WJSA 4E7SA 2HZYA 3CCSA 1UHCA 2HKNA 2V1QA 4J15A 2ZT5A 4CC2A 1JJ2S 3TSWA 4JUVA 4O5VA 2KT1A 4JS4A 3PMIA 1R0CB 1E6GA 1TUDA 3OD1A 5LJ5g 1RUWA 4GY5A 2LDMA 1U3OA 3QWXX 2XK0A 4JLIA 2QGFB 5GAN4 1YITT 3LWIA 2QHUA 3OW2S 3TEGA 1QKWA 2WACA 2OI3A 2VC8A 5IXFA 1M3BA 4ESRA 4BDYA 4PLLA 5GMKl 4RDXA 2LJ3A 4H2SA 2ZPGB 4J9FA 3VUZA 3SWNC 1MMGA 4E7IA 1X01A 2EQUA 2Z0WA 5GAN3 4RUGA 3RNJA 2L89A 5C6SA 2BE9B 2P84A 5F5WA 1N8RC 2W0ZA 2M02A 3LLRA 2CSQA 3QKJA 4PJOE 3FIFA 3G71A 2KRNA 2LQNA 3P8YA 3EGXA 4A63B 2E6ZA 4BI4A 4D8KA 2ZINA 3CCLA 2L5QA 3EG9B 3M0TA 2MI6A 4P73C 3L42A 1K8AR 3M4QA 2GCXA 5GAOn 5KYUA 1Q81C 1M1KR 2OTLQ 4DEXA 1EIYA 5GANe 4BI8B 2M1HA 2DNUA 5D6WA 2ZZFA 3FJPA 1KK7A 3M53A 2DM1A 1G3SA 2FVUA 2X3WD 3MEAA 1LYLA 4HT8A 1GCQC 1VQ6T 1C0AA 4KR3A 2LQKA 2NLUA 2ODRC 4FYYB 2LQ8A 5IN1A 1M90U 1QVFA 1LOJA 4O2DA 3OYEA 1WHKA 3QJ6A 3G4ST 3A8MB 3OYHA 1VQKQ 3RKWA 1QVFP 4PLIA 3HRKA 4FT4A 4F7UF 4PK4A 1IGQA 4HCKA 2RQVA 3GIBA 1Q86R 2CP6A 2QXFA 2K3YA 3QNEA 1TG0A 1K4US 2KE9A 4TQFA 4G85A 2CP2A 4O6JA 1RAAB 3ZEHA 1UGVA 1VQLA 1JB0E 1RAFB 1R8OB 1YB3A 7AT1B 3A5YA 3M4PA 2QQSA 2EPDA 4P5NA 1U1TA 4JRKA 3TREA 2QYZA 4J6WA 4LDWA 3CCJQ 2RJEA 4TQDA 1AWJA 3RKYA 4C0FA 1KOGA 4HCBA 3BJUA 1NLOC 2J6KA 2E65A 1M8MA 2GNCA 3R07A 3CD6A 3VS3A 3QWYA 3FC3A 1M2VB 3C95A 3G7ZA 2GGRA 4XEOA 3CXCA 4ELYC 1Y96B 4CH3A 3M55A 1KIKA 2V8JA 2OX7A 4BY6C 4HCZA 4A53A 3TCJA 1PKSA 4M7AG 4PJOD 3OYNA 5LL6S 2K2MA 2DQ0A 2VUBA 4Z88A 4QVZA 4N0AA 1WLPB 4E7HA 2AKWA 3HXZA 1JRIA 1Y71A 1UE9A 1NJ2A 4YREA 3RACA 3NELA 1WHLA 2GQIA 4C5GA 3HXXA 3E19A 3JCMQ 1JEGA 3OYCA 3G4SQ 1UJ0A 1RAEB 2O4XB 4LN2A 1WQ7A 4C92C 3TVTA 2HEQA 1PRLC 3HY0A 3VU3C 2EJGA 3KFUA 2LX7A 1BU1A 1M8VA 1VQ9Q 3J7AF 1X55A 4E7KA 4QW2A 1SRYA 4D6WA 3DLMA 4MZMA 2IIMA 3BFMA 1D1BA 4OMLA 5CK9A 3VS4A 3JV3A 1OV3A 2FPDA 2RHYA 4LUDA 3HTZA 3CCMA 4FSXA 4C92D 1N8RR 3H0HA 1QF6A 1D3BA 3G1JA 1W66A 1WXUA 2FPFA 2JTFA 1YCYA 2MOXA 1K73U 1IGUA 3WXMB 4M4ZA 4K11A 2QQ9A 4FM4B 2PMEA 4A4GA 4ORZA 3H41A 1ZA1B 3OS1A 5GJWB 4Z8AA 5I22A 2A28A 1EFNA 1UGQB 4XEMA 2LTOA 5C0MA 1FX7A 2JNGA 1RACB 1VQ5A 4LDUA 3SHWA 2QA4A 3UPUA 2I4NA 5FU7C 4C8QG 4JJBA 1VQ5Q 2YUOA 4OMFB 4XQ3A 4HWOA 3VV0A 3H8ZA 1M27C 4QT7A 1LCKA 3H9NA 4NL2A 1VQMQ 4Q6GA 3REBB 4B9XA 1RL2A 4LE9A 2Q7GA 2XDDA 1E24A 2EKOA 3G6ET 3PIPA 2MWPA 1X56A 3EFOA 1ZUKA 1VQLQ 4M7AE 1VQNT 3L1AA 3PNWC 1B70B 2ZR3A 4EX5A 1NE8A 1ADYA 3UT1A 2LX9A 1WFWA 2JS0A 4RCBA 3TEHA 4BWAA 4RTUA 1WI7A 2PUKB 2LNVA 3QXEB 1GBQA 4BW9A 4OMOA 4OLFA 3UA6A 2RJDA 2CZ0B 2QI2A 1VQ4T 4LVLA 1N5ZA 2XD0A 5C52B 3L2RA 3V8LA 1VQOA 1VQ6Q 4F7UG 1NJ6A 4XTUA 3PT9A 3MHXA 4M78F 3EHQA 1VQ6A 4M7AA 3PCOA 3GBQA 2QTVA 5GAOq 1UGSB 4OMNA 1GFDA 4YCWA 2WSCE 2YRCA 3NEMA 1LNXA 3G1ZA 1W6XA 4ZNXA 1MUZA 4LVIA 1OQKA 2ATCB 4JJDA 4ZTJA 2E5KA 2JTMA 2RF0A 4BE2A 4DQ2A 4RMOA 1YJNA 2RHIA 1ADJA 3CC7Q 1IXDA 4E47A 1T0JA 1HC7A 3QG1A 2ENMA 4ZTFA 3S6WA 1XJWB 3A5ZA 1B07A 3M0SA 5KCOA 4KUIA 1ASYA 4M75B 2OAWA 4YRFA 2ZIOA 1N9RA 2QQRA 1YIJA 1X2GA 3CC4T 1YI2A 2XDPA 3CCEQ 2PZ1A 3CCMQ 2ROLA 3QPHA 1K0SA 3KUFA 4JRIA 2F5KA 3CD6Q 3DLLA 3OYDA 1YJ9T 2JJ9A 4FIBA 1QWFA 3BW1A 5CKDA 5GAMg 4L59A 1BYMA 3QSUA 4MMLA 3VS5A 3OYFA 5CAIA 2LQWA 4KGVB 3IKMB 4PFZA 2KT8A 3VS6A 4C92A 1WYDA 1PG5B 4RG8A 1M2VA 1JO8A 1QCFA 3J81E 1YFRA 2L3QA 3LYIA 4LDVA 3CCET 2RHQB 4Q15A 4IURA 4N4IA 5GANf 2E41A 1WJRA 4PFPA 1SSHA 4J8OA 1PD0A 1SPKA 1Y57A 4R56A 3JCMd 4HXJA 2ZTGA 3VS1A 5A0GA 5IHNA 3G71Q 1AOJA 4C0DC 2HSPA 5GAOp 1PD1A 2A08A 2CH4A 2J6OA 1CKAA 4M75G 1YFTA 1TTHB 1BBUA 1N27A 1YITQ 2YSQA 1USYA 4CS2A 1UHFA 2K7AA 1RADB 2NUZA 2V8IA 2JN0A 4OB1B 1WZOA 2X3XD 3OY9A 3GLXA 4OMPA 4Z89A 1VQPT 1BBWA 1D0YA 1UG1A 2NUPA 4A4FA 1PWTA 4CRIA 3QUIA 1KD1R 3MQZA 1QCOA 3EFRA 2I0NA 1RLPC 4PG3A 4OMQA 4CI0C 1HSQA 1ZQ1A 4C8QF 1NJ1A 2EKHA 4KGZB 1MNEA 3LGLA 3FLGA 2LNHB 3EH2A 1VQKA 2BTTA 5K1PA 3OYAA 1Z9QA 1G83A 5IT9E 4J7IA 1GXIE 4UP8A 1FMWA 4P72C 2BZYA 1OX8A 1H4VB 1IB8A 3JCMe 2DF6A 3E9FA 2E10A 2DIQA 2DFUA 2C7IA 4RTWA 3RMSA 3HRUA 4KRTA 1GBRA 2ZPEB 4F7UE 3JRZA 1JJ2A 1RAHB 2J6FA 5CR2A 3OYYA 2ZNJA 2HL3A 1PNJA 1YJ9Q 3DB3A 4C8QE 4GBQA 4YRCA 2DL7A 3NGPA 1NJ8A 2WSEE 2JOYA 3PTAA 2C06A 2M9UA 1H92A 3HKSA 2OTLT 1FMVA 2DTHA 3OW2A 1K73C 1QMCA 1M5Q1 2RQRA 3PVQA 1BI3A 3U23A 1BCOA 1KFZA 4RMFA 2DKGA 1PYSA 3A8HB 2RQUA 2VXEA 2ZPBB 1B8AA 1KD1C 1VQ8A 1Z7MA 3UFGA 4ELZC 2K6DA 4HVVA 3OMGA 2O4XA 1W2BA 2R5MA 1PRMC 1AZGB 2KAFA 2QEXQ 4PJJA 1GFCA 2HNIA 5KE3A 3JCMb 4LDXA 5D6YA 2KK4A 2B86A 3OS5A 2MIOA 4K86A 4J9HA 3UH0A 4E51A 2H3JA 1XNIA 4V2SA 2AHJB 3I55Q 2FPEA 2QQBA 2QDYB 1NJIC 2AIRB 1H3ZA 2KEAA 2RH2A 1U1SA 3JSCA 2GQVA 4C92F 3OSVA 2LVMA 1KMNA 1NNHA 3CCSQ 1B7TA 1IL2A 4TVAB 4JRQA 2ZIMA 3URGA 2X4XA 1RABB 3MP1A 4DBHA 5LJ5e 2E64A 4BE1A 1YJNT 2RM4A 2HQXA 1MHNA 2LT1A 2L2PA 4PJOG 1WXBA 1ZSZB 3LX7A 2XG8D 4M7AC 1FYNA 4P3NA 3HFZA 2JMCA 3TUPA 2DK3A 1NYGA 1WYXA 4EDUA 2VB6A 5LJ3e 4F14A 1VQNQ 1QVFS 1Q81R 2EGEA 2KYMA 1FXXA 2YRVA 3G6EQ 5GAN2 3UGQA 5CO7A 5CCAA 2IVWA 1SEMA 2YDLA 4A4HA 2ZPHB 4UC4A 8AT1B 5GAMj 1VQ4A 4LVKA 3SEMA 1VQMT 3ZBDA 4J5YA 5GAN7 2J06A 4J83A 3CCQA 1GL5A 4IIMA 3CCQQ 2NUTB 1BB9A 4RTTA 1SRMA 1UFFA 1VQKT 4AFQC 2ECZA 4P71A 4LNSA 5D6XA 4DA4A 2QEXT 2VVKA 5IH2A 2DYIA 3LW5E 3VQVA 1M3AA 1S72Q 2DQ3A 2AMCB 1WJQA 1OYXA 1I07A 2LRQA 4M78D 1C0MA 3RL6A 1UECA 3JB9D 2SRCA 3P8BB 5GAMd 2EVRA 2QHSA 1EIFA 2EQKA 1JJCA 1AD5A 3VRZA 4ANJA 4M78G 4XU0A 2E12A 1JJCB 4KH0B 1IHVA 2VGMA 2K4YA 1F1BB 1G3WA 2L3RA 2XU8A 4PJOB 1WQWA 2JT4A 2LJ0A 4FU6A 3I35A 2PUOB 2ZZGA 2CZ7B 3V7CA 2HBPA 1OI1A 4LXCA 3UDCA 4R55A 4JLGA 3C0CA 3MF1A 3I55T 2RB6A 1P92A 2J3MA 3CMQA 1MV0B 1IZ6A 4AFSC 4BDZA 4M7DC 5LJ3g 2LC4A 2AZVA 2OTJQ 2ODRD 2EYWA 1C1AA 3CMAQ 1ABOA 2LJ1A 4PL6A 3A74A 2I4OA 1WHJA 2DZCA 2KMTA 3SB2A 2J3LA 3HXUA 4M7DD 2CKKA 2HBWA 2K3BA 4AT1B 2HD0A 4X9CA 1YJ9A 1NLPC 2A37A 3HFZB 3A1PA 3SD4A 3NHNA 5CKFA 4C8QB 4PJNA 2ALYA 4P75C 3ME9A 3CCJA 3CCVQ 1EVLA 1USYC 3HY1A 4BE0A 4NL3A 1NYFA 3TU4K 1ZSZA 5M9OA 2YUQA 2AT1B 2DETA 5IHKA 1D09B 1OEBA 4HVCA 4RTZA 5I2MA 3R6NA 1KQ2A 3M9QA 1Q82U 3LWHA 4XTWA 1J3TA 3CCUT 3DSQA 4J9DA 2DXUA 3SDZA 3MEWA 4ZGDB 2QEXA 1O9SA 1SF9A 1RI0A 4JS5A 3CCRQ 4M78E 2GTJA 2K5IA 2Y4YA 2RHSA 2DL4A 2EYZA 3CCQT 1JBMA 1I8FA 3HFVA 2CSIA 2ROTA 4Y28E 4YRGA 1S72A 1HJDA 2AKLA 3O8VA 1VQLT 1BCMA 1NEGA 4XTVA 3VJPA 2KBTA 2QQAA 2X51A 2KYBA 4M77E 4PFOA 5L8RE 4BD3A 5KYXA 4IKFA 5J3BA 2DA9A 1X43A 2E6NA 5KYWB 4ZTUB 2EGAA 2KY9A 1NZ9A 1V1CA 2CREA 4J9CA 1Y0MA 3QTCA 2F2XA 2JVVA 4M7DF 1B34A 1EX4A 3P8HA 3OYBA 1VQNA 2VGNA 2X4YA 1NJIR 2NS6A 5GAN5 1H4TA 2X35A 4P71C 2HL5C 3BDLA 1KG1A 5FU6B 3P8DA 1HYOA 2FG0A 2CJ9A 2JW4A 1ZUYA 2DILA 2XI9A 1K9MC 3PGGA 1OPKA 3D7SB 1VQ5T 4M77C 1YHQA 4PHCA 1TWBA 4YRRA 4C0GA 2DL5A 3L4GA 2DVEA 1ZA2B 4RTXA 4L5GA 2EWNA 2PNIA 1EQRA 4P74A 4YYEA 3A98A 3MO8A 4H2YA 3UATA 1C6VX 1I4K1 3ZL7C 2D8JA 4M77B 2FL7A 4LDYA 4HT4A 2EQJA 5KNNA 3V7SA 2EJ9A 2ZT6A 3TSZA 3ICAA 2YHTA 1S1NA 1SETA 2OTLA 2E5QA 1R77A 2KRMA 4KUDK 3CCMT 1AEYA 3CCVA 4YCUA 3MEVA 2GFUA 1KJWA 2NYSA 4ZGJB 4FCYA 5HCKA 3I5RA 3HL8A 1AZEA 1YJWQ 5KYNA 2LCSA 3QO8A 5IXBA 3MJXA 4F7UA 1YP5A 2DX1A 1ASZA 5GANd 1BIBA 4HCCA 1G2BA 1X27A 3PFSA 3JCMW 2OJ2A 3RF1A 4YRMA 2KQWA 4UP7A 3I56T 4P3PA 2JTEA 1X54A 3I5SA 2Y4XA 1RI9A 5FWCA 1TH7A 2ZPFB 2E3CA 1I0CA 1X2KA 2RK1A 1WLEA 2LMJA 1E6HA 2MCNA 4LVMA 3E9IA 1QKXA 1B76A 1YN8A 2CDTA 3A8LB 3X24B 4CH6A 1NYRA 1M2OA 5DLQE 4QVCA 1YJNQ 1QE0A 2QHTA 4LVJA 3MPUB 2HMAA 3REXA 1VYTA 4A54A 2QHVA 1WHMA 4KR2A 1Z7NA 3GNFB 1EFWA 5I21A 3CCST 5A0DA 2LZ6B 3JCMf 4UP9A 3GNGA 2DJZA 5LJ5d 4M7DA 3E9HA 1IREB 2RK2A 2DO3A 2FRWA 4XK8E 3PVLA 4EO4A 2VWFA 4H2XB 4YDQA 3WVDB 1YIJQ 1KC8C 3RGLA 3RESA 3HFNA 1YI2Q 1LJOA 4M75D 11ASA 4BB7A 1EZZB 2EYQA 1NPPA 4M7DB 2P0QA 2QAZA 4H2XA 4JZ3A 3AT1B 5GMKe 1OPLA 1WPYA 1E1OA 2C0TA 4K87A 4HA8A 3M56A 12ASA 2M51A 2YXYA 1G3YA 2XMFA 4YRNA 4M77G 1M90C 2XDBA 4WI1A 3GPLA 1Q95G 1YHQT 1VQ7Q 1U8RA 1WA7A 4EMHA 1GCPA 2F1LA 1D0ZA 3I9QA 1KQSA 3OYJA 3RERA 5FRNA 4X1VA 2ED1A 3HP9A 2JM8A 1AT1B 4YPFA 4HKEA 3CC7T 2EQMA 3QDRB 3CPFA 2EFIA 2KVQG 3TEEA 2QGGA 2M16A 1AHJB 2P4RA 3PZCA 2CZ1B 3MKDA 2ZAEA 5AT1B 3OYGA 1YIJT 2KI7A 2ZCEA 4BUGA 4YRSA 3QDFA 1N6AA 1M4ZA 3BDUA 3CCLT 4RKUE 3JCMV 1Q82C 3M58A 4E6RA 4M77A 2R58A 4II1A 1EOVA 1PC0A 4M77D 5KCHA 4IUTA 3RKXA 2RJFA 2YT6A 3JB9F 1T0HA 2FB7A 1OX9A 2CT3A 4PJOA 2CJBA 3Q1JA 4GLKA 5CKEA 3IG2A 1CKBA 2KGTA 5CQYA 2P4TA 3N5BB 3QO5A 1PSEA 1I5LA 1SG5A 2EYXA 5GMKh 2L0AA 1GCQA 3FJ5A 1X69A 4OB2B 2YUPA 5GAMf 3P8TA 5HY6A 3HSBA 3OS0A 2E3IA 4A4KA 1H8KA 1ATIA 3UWNA 2EQIA 1VA7A 3MEUA 3MCAB 1AWWA 2VASA 3A8GB 3PIOA 4BACA 2DDZA 2ZZEA 1V29B 4FYVB 2HSEB 5CKBA 2Y90A 3CCJT 3P8VA 3HHTB 4H2UA 1NJIU 1JXMA 1FMKA 2KR3A 2L8DA 4H2WA 4J6YA 2ZCFB 4MZTA 1TSFA 1NYQA 1VQZA 3UA7A 2DU5A 3C94A 2HQEA
chains in the Genus database with same CATH topology
1Q81U 4QQGA 3ASKA 5E3IA 4OB0B 3VKIA 4XTXA 4IUUA 2KSSA 4PNOA 3QBYA 1H4QA 5FU7B 2AKWB 4EMKC 2X4JA 3I55A 1HTTA 2D0QB 3CPWS 3GOXA 5GAMe 3AHUA 3T9NA 3JAME 2ZT7A 3QHSA 3M4GA 4N0AC 1UGRB 5CKHA 2VXFA 3OYMA 3CCEA 1SERA 4PJOF 3J80E 3CBPA 3HRSA 3E1SA 4JRPA 3S3OA 3QO7A 4JJNK 2ZXFA 2DPPB 2DU7A 2ALYB 2R57A 4ZN3A 4M7AB 2D6FA 1Q7YU 2IG0A 4M7AD 3NFCA 4P74C 5LJ3d 3LSQA 1YI2T 3CC4A 1VQ7A 5J39A 4XAXB 3PMTA 5KH6A 3S3MA 1VQMA 4XU3A 3QO3A 2K57A 4N4GA 5LJ5f 3LGFA 2BUDA 2RO0A 1X2HA 3MP8A 2Q7EA 3A7UA 1QP2A 4C5IA 5GAN8 1VUBA 1B7YB 3X25B 3OA6A 2IY5B 2DTOA 2LT4A 4CH4A 2C8MA 4IUVA 1YJWA 1SSFA 1B7YA 2ARTA 2RD1A 4XU2A 1YFSA 5FRMA 4OF1A 5DLOA 4RG2A 2O01E 2BKDN 4IUPA 3CMET 1QP3A 1KHIA 5KE2A 5EG2A 1B34B 3WQZA 4UPAA 3FRNA 4TTVA 2RI2A 4QVDA 4HWSA 2CIMA 3OBWA 3OMCA 2RI3A 3CC7A 2XTIA 4M7DG 1BKBA 4K88A 4E7LA 3RUXA 3V8KA 1VQ8T 2VV5A 5LJ5h 1UEBA 3OYLA 1K9MU 1G5VA 1J5WA 4YRPA 2ARUA 2RHSB 4XTZA 2HAXA 2QA4T 4DOVA 3QIIA 2MF2A 1OZ3A 1XQHA 4WJ4A 4G84A 4J7FA 5CQXA 4C8QA 5LJ5j 5HKCA 2ZPIB 4YRQA 3X20B 3RMQA 3F70A 1S72T 4ZTZB 2ARSA 3GP8A 5GANh 3CMAT 2XHCA 2QTXA 4FT2A 3OQ5A 2DD4A 4M75A 4OGEA 5HK3A 3A8OB 1OZ2A 3QYHB 3JB9G 2PQWA 2JZ2A 1YITA 1PYSB 1VQPA 1QW1A 1M1GA 3CC2A 1XOVA 1QVGS 4HT9A 3INZA 1FYFA 1PSFA 2XKOC 2MWOA 2M0OA 4KBMB 3I56A 3PCOB 1VIFA 3L2QA 3H6ZA 3OYKA 2PVOB 3SFMA 1G3TA 1XTDA 5GAN6 3VUBA 2F69A 3X28B 3SWNA 4C8QD 1WNLA 2IY5A 1NPRA 3OS2A 3CCVT 2PU9B 4TVRA 1Q86U 2E5AA 5K1XA 3VYHB 3CC2T 2BIVA 5GMKm 1W4SA 3M59A 5IAYA 3HXVA 2LCLA 1UB4A 3V8JA 1B70A 1N9WA 3JCMX 5GAOm 4H2TA 2RHUA 4QQ6A 5GMKj 5DM7R 4WF2A 2KDSA 3KXTA 5LJ3f 5LJ3j 2YLBA 5C51B 5A0LA 4ATOA 2A8EA 4X9DA 5ELOA 4RQFA 5I2SA 4MDWA 5CVIA 2XGTA 5GAOl 2RHZA 3NETA 2Q5HA 3OB9A 4MMKA 4TVYA 4CS3A 2EIFA 3CBOA 4M75F 3NENA 5HK0A 2XIDA 4YROA 2PMFA 3HXWA 4EMKA 4M7AF 2JUFA 4LD6A 1E1TA 4EPCA 2B8AA 4M78B 3CD6T 2RJCA 3VBBA 1Y07A 1KQSS 1N8RU 3UGTA 3HPWA 4EMGA 4TVAA 2RA2A 3DB4A 4TWAA 3MEYA 1VQOT 1Q7YC 2DZ9A 1KD1U 3JCMc 4L6V5 3LC0A 3W3SA 4YP0A 2FYKA 5C53B 3NTIA 3MP6A 2MAMA 2I2LA 4KT0E 2GF7A 4M7DE 1QVPA 1G5HA 3E9GA 2EAYA 4KULA 3QJYA 3CCUA 3CMEA 5FLXE 3A7AA 4ZIBA 2K5LA 3VYGA 3G6EA 2RI5A 3A5ZB 4MDXA 4M75C 2CZ6B 4YRIA 1NJ5A 2X4WA 3M57A 4BI3A 4YCVA 1L0WA 2PVDB 4H02A 4P73A 1YJWT 1KMMA 4X5OA 3JB9J 2DIGA 1N9SA 4Z02A 5GAOr 1H641 3R6OA 4P72A 2Q5IA 5FU6C 4VUBA 3KBGA 4P3OA 1VIEA 3MF2A 1M9SA 2DXBA 3G71T 2P0KA 3EFSA 4JDSA 2ZT8A 2F5TX 1X6OA 3VQWA 3META 2K3XA 3TEHB 1K8AU 3CBMA 4P75A 2V8KA 4C8QC 2DAQA 4C92G 4J6XA 4PKCC 4NCXA 3NTKA 3OBYA 5DY9A 3LSSA 3A7RA 2P0LA 2XICA 4OB3B 3M54A 4KQEA 5A2QE 1YBYA 2MMPA 2EJFA 4OP0A 1KHCA 2OAUA 2RHQA 3CMAA 1M1KU 3SWNB 3CPWA 4YRTA 3ERRA 3REUA 3HXYA 4NS5A 4BY6B 3JCMh 2CS7A 4LD9K 4CS4A 4Y91A 4A4EA 3CEYA 3GF5A 1KC8U 4FL6A 2K2VA 5LJ3h 2P0PA 2E1HA 1O75A 3BY7A 4HWPA 2A7YA 1Y7XA 2WSFE 1HK9A 4IUQA 4C92B 3QYGB 1KQ1A 1SESA 4C0ZA 3L2VA 1G5IA 4B9WA 3CXCS 4ZN1A 2FHDA 1ZBXA 1I81A 3L2ZA 2DXCA 4YRKA 2GFAA 2E70A 3I7FA 4YTLA 1Y96A 5AYFA 3OYIA 4YRLA 1YGBA 3A32A 5CIUA 5J26A 2I4MA 3ER0A 2ZR2A 3VQXA 3X26B 4M78A 4CH5A 3G4SA 4C5HA 3IKLA 4XU1A 3M5AA 2I4LA 1ZHIA 2DEQA 4DPGA 3VQYA 3V7RA 2CYZB 4EMKB 1VQ9A 2K5FA 3DKMA 2P5IA 5HGQA 4X34A 1FWZA 4C0DB 3L2WA 3JB9I 3FDRA 4ZGEB 3OSSC 1H4SA 2EL9A 1Q86C 2OTJT 4H2VA 4AH6A 4M78C 3JCMP 2R5AA 2G4CA 3FB9A 4ME7A 2YLCA 4F7UB 1E22A 2RHXA 4E7JA 4M75E 1EVKA 2G3RA 3M4YA 4OGCA 1VQ7T 2A3LA 1WU7A 4HWTA 1X75C 2OTJA 5GMKi 1RIQA 1EIYB 1GGMA 1M1KC 4TVWA 3HRIA 2DXTA 3LH0A 3RIRA 1BI0A 4YRJA 3C4SA 1VQ9T 3QZ9B 2AMCA 4Q5WA 4MZPA 3L4GB 3QZ5B 3WVEB 2DTIA 2LCCA 4M77F 2ZGWA 3FEOA 1BI2A 3EAEA 3NTHA 3HRTA 2D9TA 1MGQA 2CJAA 4NOYA 4DOWA 5GANj 2CGHA 4XTYA 4N4HA 4L87A 1QVGA 4RQEA 3ZFJA 2ZNIA 2Q7HA 1DJ7B 1UGPB 2PVGB 2ZZDA 1G51A 1W2BS 3JCMJ 1HXDA 3C12A 3S3NA 1BI1A 4WJ3M 4HWRA 2DD5A 5GANg 4OVAA 1M1FA 3JCMg 1D3BB 4RCCA 3CCRT 3CCRA 3HFOA 1K8AC 3JB9H 1WGSA 3L2UA 1BIAA 4QQDA 4C5EA 4PJOC 4C92E 5GAMh 3A31A 3IALA 5ELNA 2VYTA 5FROA 1WJSA 3CCSA 4J15A 2ZT5A 1JJ2S 4JUVA 4O5VA 4JS4A 3PMIA 3OD1A 5LJ5g 4GY5A 2LDMA 2XK0A 4JLIA 5GAN4 1YITT 3LWIA 2QHUA 3OW2S 3TEGA 2WACA 2VC8A 4BDYA 4PLLA 5GMKl 4RDXA 4H2SA 2ZPGB 3VUZA 3SWNC 4E7IA 1X01A 2EQUA 5GAN3 2L89A 5C6SA 5F5WA 1N8RC 3LLRA 3QKJA 4PJOE 3FIFA 3G71A 3P8YA 2E6ZA 4BI4A 2ZINA 3CCLA 2L5QA 2MI6A 4P73C 3L42A 3M4QA 2GCXA 5GAOn 1Q81C 1EIYA 5GANe 4BI8B 2M1HA 5D6WA 2ZZFA 3FJPA 3M53A 1G3SA 2FVUA 3MEAA 1LYLA 4HT8A 1VQ6T 1C0AA 4KR3A 2LQKA 2NLUA 2ODRC 2LQ8A 5IN1A 1M90U 1QVFA 1LOJA 4O2DA 3OYEA 3QJ6A 3G4ST 3A8MB 3OYHA 3RKWA 4PLIA 3HRKA 4FT4A 4F7UF 3GIBA 2QXFA 2K3YA 3QNEA 4TQFA 4G85A 4O6JA 3ZEHA 1VQLA 1JB0E 1R8OB 1YB3A 3A5YA 3M4PA 2QQSA 4P5NA 1U1TA 4JRKA 3TREA 4J6WA 4LDWA 2RJEA 4TQDA 3RKYA 4C0FA 1KOGA 4HCBA 3BJUA 2E65A 3R07A 3CD6A 3FC3A 3C95A 3G7ZA 4XEOA 3CXCA 4ELYC 1Y96B 4CH3A 3M55A 2V8JA 4BY6C 4HCZA 4A53A 3TCJA 4M7AG 4PJOD 3OYNA 5LL6S 2DQ0A 2VUBA 4QVZA 4N0AA 4E7HA 2AKWA 3HXZA 1JRIA 1Y71A 1NJ2A 4YREA 3RACA 3NELA 4C5GA 3HXXA 3E19A 3JCMQ 3OYCA 2O4XB 1WQ7A 4C92C 3HY0A 3VU3C 2EJGA 3KFUA 1M8VA 3J7AF 1X55A 4E7KA 4QW2A 1SRYA 4D6WA 3DLMA 4MZMA 3BFMA 5CK9A 2RHYA 3HTZA 3CCMA 4FSXA 4C92D 1QF6A 1D3BA 1W66A 2JTFA 1YCYA 1K73U 3WXMB 2QQ9A 4FM4B 2PMEA 4A4GA 3OS1A 1UGQB 4XEMA 2LTOA 5C0MA 1FX7A 2JNGA 1VQ5A 4LDUA 2QA4A 3UPUA 2I4NA 5FU7C 4C8QG 4OMFB 4XQ3A 4HWOA 3VV0A 3H8ZA 4NL2A 4Q6GA 4B9XA 1RL2A 2Q7GA 2XDDA 1E24A 2EKOA 3G6ET 3PIPA 2MWPA 1X56A 4M7AE 1VQNT 3L1AA 3PNWC 1B70B 2ZR3A 4EX5A 1NE8A 1ADYA 3UT1A 2LX9A 4RCBA 3TEHA 4BWAA 2PUKB 2LNVA 3QXEB 4BW9A 4OLFA 2RJDA 2CZ0B 2QI2A 1VQ4T 4LVLA 2XD0A 5C52B 3L2RA 3V8LA 1VQOA 4F7UG 1NJ6A 4XTUA 3PT9A 3MHXA 4M78F 1VQ6A 4M7AA 3PCOA 5GAOq 1UGSB 4YCWA 2WSCE 3NEMA 1LNXA 3G1ZA 4LVIA 4ZTJA 2JTMA 4BE2A 4DQ2A 4RMOA 1YJNA 2RHIA 1ADJA 4E47A 1HC7A 3QG1A 4ZTFA 3S6WA 3A5ZA 5KCOA 4KUIA 1ASYA 4M75B 4YRFA 2ZIOA 1N9RA 2QQRA 1YIJA 1X2GA 3CC4T 1YI2A 2XDPA 3QPHA 3KUFA 4JRIA 2F5KA 3DLLA 3OYDA 1YJ9T 4FIBA 3BW1A 5CKDA 5GAMg 4L59A 1BYMA 3QSUA 4MMLA 3OYFA 5CAIA 3IKMB 4C92A 1WYDA 4RG8A 3J81E 1YFRA 4LDVA 3LYIA 3CCET 2RHQB 4Q15A 4IURA 4N4IA 5GANf 2E41A 1WJRA 4J8OA 4R56A 3JCMd 2ZTGA 5A0GA 4C0DC 5GAOp 4M75G 1YFTA 1BBUA 1N27A 1USYA 4CS2A 2V8IA 2JN0A 4OB1B 3OY9A 3GLXA 1VQPT 1BBWA 4A4FA 4CRIA 3QUIA 3MQZA 3EFRA 4PG3A 4CI0C 1ZQ1A 4C8QF 1NJ1A 3LGLA 3FLGA 1VQKA 5K1PA 3OYAA 5IT9E 1GXIE 4J7IA 4UP8A 4P72C 1H4VB 3JCMe 3E9FA 2E10A 2DIQA 2C7IA 3RMSA 3HRUA 2ZPEB 4F7UE 3JRZA 1JJ2A 5CR2A 3OYYA 2ZNJA 3DB3A 4C8QE 4YRCA 1NJ8A 2WSEE 2JOYA 3PTAA 2C06A 2M9UA 3HKSA 2OTLT 3OW2A 2DTHA 1K73C 1M5Q1 1BI3A 4RMFA 2DKGA 1PYSA 3A8HB 2VXEA 2ZPBB 1B8AA 1KD1C 1VQ8A 1Z7MA 3UFGA 4ELZC 3OMGA 2O4XA 1W2BA 2R5MA 2KAFA 2HNIA 5KE3A 3JCMb 4LDXA 5D6YA 2KK4A 3OS5A 4K86A 3UH0A 4E51A 2H3JA 1XNIA 4V2SA 2AHJB 2QQBA 2QDYB 1NJIC 1H3ZA 2RH2A 1U1SA 3JSCA 2GQVA 4C92F 3OSVA 2LVMA 1KMNA 1NNHA 1IL2A 4TVAB 4JRQA 2ZIMA 3URGA 2X4XA 3MP1A 5LJ5e 2E64A 4BE1A 1YJNT 2RM4A 2HQXA 1MHNA 2LT1A 4PJOG 3LX7A 2XG8D 4M7AC 4P3NA 3HFZA 3TUPA 2DK3A 4EDUA 5LJ3e 1QVFS 2YRVA 1FXXA 5GAN2 3UGQA 5CO7A 5CCAA 2IVWA 4A4HA 2ZPHB 4UC4A 5GAMj 1VQ4A 4LVKA 1VQMT 3ZBDA 4J5YA 5GAN7 4J83A 3CCQA 1VQKT 4P71A 4LNSA 5D6XA 4DA4A 2QEXT 3LW5E 3VQVA 2DQ3A 2AMCB 1WJQA 1OYXA 2LRQA 4M78D 3RL6A 3JB9D 3P8BB 5GAMd 2QHSA 1EIFA 2EQKA 1JJCA 4M78G 4XU0A 2E12A 1JJCB 2VGMA 2K4YA 1G3WA 2L3RA 2XU8A 4PJOB 1WQWA 4FU6A 2PUOB 2ZZGA 2CZ7B 3V7CA 2HBPA 1OI1A 3UDCA 4R55A 4JLGA 3MF1A 3I55T 2RB6A 1P92A 2J3MA 3CMQA 1IZ6A 4BDZA 4M7DC 5LJ3g 2LC4A 2ODRD 4PL6A 3A74A 2I4OA 2DZCA 2KMTA 3SB2A 2J3LA 3HXUA 4M7DD 2CKKA 2HD0A 4X9CA 1YJ9A 3HFZB 3SD4A 5CKFA 4C8QB 2ALYA 4P75C 3ME9A 3CCJA 1EVLA 1USYC 3HY1A 4BE0A 4NL3A 3TU4K 5M9OA 4HVCA 5I2MA 1KQ2A 3M9QA 1Q82U 3LWHA 4XTWA 3CCUT 3DSQA 2DXUA 3SDZA 3MEWA 4ZGDB 2QEXA 1O9SA 1RI0A 4JS5A 4M78E 2K5IA 2Y4YA 2RHSA 3CCQT 1JBMA 1I8FA 3HFVA 4Y28E 4YRGA 1S72A 3O8VA 1VQLT 4XTVA 3VJPA 2QQAA 4M77E 4BD3A 4IKFA 5L8RE 5J3BA 4ZTUB 2E6NA 2KY9A 1NZ9A 3QTCA 2JVVA 4M7DF 1B34A 3P8HA 3OYBA 1VQNA 2VGNA 2X4YA 2NS6A 5GAN5 1H4TA 2X35A 4P71C 3BDLA 1KG1A 5FU6B 3P8DA 2CJ9A 2XI9A 1K9MC 3PGGA 1VQ5T 4M77C 1YHQA 4PHCA 4YRRA 4C0GA 3L4GA 2DVEA 4L5GA 2EWNA 1EQRA 4P74A 4YYEA 3MO8A 4H2YA 1I4K1 4M77B 2FL7A 4LDYA 4HT4A 2EQJA 5KNNA 3V7SA 2EJ9A 2ZT6A 3ICAA 2YHTA 1SETA 2OTLA 2E5QA 4KUDK 3CCMT 3CCVA 4YCUA 3MEVA 2GFUA 4ZGJB 3HL8A 3QO8A 4F7UA 1ASZA 5GANd 1BIBA 4HCCA 3PFSA 3JCMW 3RF1A 4YRMA 2KQWA 4UP7A 3I56T 4P3PA 1X54A 2Y4XA 1TH7A 2ZPFB 2E3CA 2RK1A 1WLEA 4LVMA 3E9IA 1B76A 3A8LB 3X24B 4CH6A 1NYRA 5DLQE 4QVCA 2QHTA 1QE0A 4LVJA 3REXA 4A54A 2QHVA 4KR2A 1Z7NA 3GNFB 1EFWA 5I21A 3CCST 5A0DA 3JCMf 4UP9A 3GNGA 2DJZA 5LJ5d 4M7DA 3E9HA 1IREB 2RK2A 2DO3A 4XK8E 4EO4A 4H2XB 4YDQA 3WVDB 1KC8C 3RGLA 3RESA 3HFNA 1LJOA 4M75D 11ASA 4BB7A 4M7DB 2EYQA 1NPPA 2P0QA 4H2XA 5GMKe 1WPYA 1E1OA 4K87A 4HA8A 3M56A 12ASA 1G3YA 4YRNA 4M77G 1M90C 2XDBA 4WI1A 3GPLA 1YHQT 1U8RA 4EMHA 1KQSA 3OYJA 3RERA 5FRNA 3HP9A 4YPFA 4HKEA 3CC7T 2EQMA 3QDRB 3CPFA 2EFIA 2KVQG 3TEEA 2M16A 1AHJB 3PZCA 2CZ1B 3OYGA 1YIJT 2ZCEA 4BUGA 4YRSA 1N6AA 1M4ZA 3BDUA 3CCLT 4RKUE 3JCMV 1Q82C 3M58A 4M77A 1EOVA 2R58A 4II1A 4M77D 5KCHA 4IUTA 3RKXA 2RJFA 3JB9F 2FB7A 4PJOA 2CJBA 3Q1JA 4GLKA 5CKEA 3IG2A 5CQYA 2P4TA 3N5BB 3QO5A 1PSEA 1I5LA 5GMKh 4OB2B 5GAMf 3P8TA 5HY6A 3HSBA 3OS0A 4A4KA 1ATIA 3UWNA 3MEUA 3MCAB 3A8GB 3PIOA 2DDZA 4BACA 2ZZEA 1V29B 5CKBA 2Y90A 3CCJT 3P8VA 3HHTB 4H2UA 1NJIU 2L8DA 4H2WA 4J6YA 2ZCFB 4MZTA 1NYQA 1VQZA 2DU5A 3C94A 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 D;  3RL6 A;  2DQ0 A;  3EFS A;  3JB9 D;  2ZT8 A;  5GAM d;  2QHS A;  4N0A A;  1JJC A;  5E3I A;  2AKW A;  3HXZ A;  3VQW A;  1JRI A;  1NJ2 A;  4YRE A;  4XTX A;  3RAC A;  3NEL A;  4M78 G;  4XU0 A;  4PNO A;  3HXX A;  1JJC B;  3TEH B;  3JCM Q;  4P75 A;  1H4Q A;  2AKW B;  4EMK C;  4PJO B;  1WQW A;  1WQ7 A;  1HTT A;  4C92 C;  4C8Q C;  3HY0 A;  4C92 G;  3VU3 C;  2EJG A;  4J6X A;  5GAM e;  3AHU A;  3KFU A;  1M8V A;  4NCX A;  2ZZG A;  1X55 A;  3V7C A;  5DY9 A;  3LSS A;  3A7R A;  1SRY A;  2P0L A;  2ZT7 A;  3QHS A;  4KQE A;  3M4G A;  3MF1 A;  3BFM A;  2RB6 A;  4N0A C;  2J3M A;  3CMQ A;  2VXF A;  2EJF A;  4M7D C;  5LJ3 g;  4OP0 A;  3HTZ A;  4C92 D;  1SER A;  1QF6 A;  2ODR D;  1D3B A;  1W66 A;  4PJO F;  2RHQ A;  1YCY A;  3SWN B;  3QO7 A;  4YRT A;  2ZXF A;  2DU7 A;  3ERR A;  3REU A;  3A74 A;  3HXY A;  2I4O A;  2ALY B;  2PME A;  2DZC A;  3SB2 A;  2J3L A;  4M7A B;  3HXU A;  3JCM h;  4M7D D;  4CS4 A;  4Y91 A;  4X9C A;  4XEM A;  3HFZ B;  4M7A D;  4C8Q B;  2ALY A;  4P75 C;  4P74 C;  5LJ3 h;  5LJ3 d;  1EVL A;  1USY C;  2I4N A;  3HY1 A;  4C8Q G;  2E1H A;  3LSQ A;  4NL3 A;  3BY7 A;  4HWP A;  4XQ3 A;  4HWO A;  1HK9 A;  4NL2 A;  4C92 B;  4Q6G A;  1KQ1 A;  4XU3 A;  1SES A;  3QO3 A;  4HVC A;  2Q7G A;  2K57 A;  1G5I A;  1KQ2 A;  5LJ5 f;  1E24 A;  1X56 A;  4XTW A;  4M7A E;  3L1A A;  1B70 B;  2ZR3 A;  3DSQ A;  1I81 A;  1X2H A;  4EX5 A;  3L2Z A;  4YRK A;  2DXU A;  2Q7E A;  3A7U A;  3I7F A;  1ADY A;  1Y96 A;  5GAN 8;  1B7Y B;  4RCB A;  4YRL A;  2IY5 B;  2DTO A;  4M78 E;  1YGB A;  3TEH A;  4CH4 A;  4BWA A;  2C8M A;  3A32 A;  2RHS A;  2I4M A;  2ZR2 A;  3VQX A;  1JBM A;  1B7Y A;  4M78 A;  1I8F A;  2ART A;  4OLF A;  2RD1 A;  3HFV A;  3IKL A;  4BW9 A;  4CH5 A;  4XU1 A;  2I4L A;  2DEQ A;  4XU2 A;  1YFS A;  4DPG A;  4YRG A;  3VQY A;  3V7R A;  5C52 B;  3V8L A;  4EMK B;  4F7U G;  1NJ6 A;  4XTU A;  4M78 F;  4XTV A;  4M7A A;  2P5I A;  3PCO A;  5HGQ A;  4M77 E;  5GAO q;  4YCW A;  4ZTU B;  3NEM A;  1LNX A;  3G1Z A;  1B34 B;  3JB9 I;  3WQZ A;  4UPA A;  3QTC A;  1H4S A;  2EL9 A;  4TTV A;  4M7D F;  1B34 A;  4QVD A;  4HWS A;  4DQ2 A;  2CIM A;  1ADJ A;  4H2V A;  4AH6 A;  4M78 C;  3JCM P;  1HC7 A;  2XTI A;  4M7D G;  2G4C A;  4K88 A;  3FB9 A;  3RUX A;  3V8K A;  5GAN 5;  1H4T A;  3A5Z A;  4P71 C;  5LJ5 h;  2YLC A;  4F7U B;  1E22 A;  1ASY A;  4M75 B;  2CJ9 A;  1J5W A;  4YRF A;  4M75 E;  2ZIO A;  4YRP A;  1EVK A;  1N9R A;  2ARU A;  4XTZ A;  2RHS B;  3PGG A;  1X2G A;  1WU7 A;  4HWT A;  4M77 C;  4PHC A;  4YRR A;  5GMK i;  4JRI A;  1RIQ A;  4WJ4 A;  4G84 A;  1EIY B;  1GGM A;  3L4G A;  2DVE A;  4TVW A;  4C8Q A;  3HRI A;  2DXT A;  5LJ5 j;  3BW1 A;  3RIR A;  5GAM g;  2EWN A;  1EQR A;  4P74 A;  4YRQ A;  4YYE A;  4H2Y A;  3QSU A;  4YRJ A;  4MML A;  1I4K 1;  5CAI A;  2AMC A;  4M77 B;  3L4G B;  4ZTZ B;  2ARS A;  3IKM B;  2DTI A;  4C92 A;  5KNN A;  3V7S A;  2EJ9 A;  4M77 F;  2ZT6 A;  5GAN h;  1WYD A;  3ICA A;  2YHT A;  1SET A;  2ZGW A;  2QTX A;  1YFR A;  1MGQ A;  2RHQ B;  2CJA A;  4NOY A;  4Q15 A;  4YCU A;  5GAN j;  5GAN f;  2E41 A;  2CGH A;  4XTY A;  4M75 A;  4L87 A;  4RQE A;  3QO8 A;  2ZNI A;  4F7U A;  3JCM d;  2Q7H A;  2ZTG A;  1ASZ A;  3MF2 A;  1G51 A;  5GAN d;  1BIB A;  3JB9 G;  5GAO p;  3JCM J;  1HXD A;  3JCM W;  4M75 G;  3RF1 A;  4YRM A;  4UP7 A;  1YFT A;  1BBU A;  4P3P A;  1PYS B;  1X54 A;  1USY A;  4WJ3 M;  4CS2 A;  4HWR A;  1TH7 A;  5GAN g;  2E3C A;  2JN0 A;  3JCM g;  1WLE A;  1D3B B;  4RCC A;  3HFO A;  3E9I A;  1B76 A;  3JB9 H;  1BIA A;  4HT9 A;  3INZ A;  4CH6 A;  1NYR A;  4QVC A;  4PJO C;  4C92 E;  1FYF A;  1QE0 A;  2QHT A;  5GAM h;  3A31 A;  1BBW A;  3IAL A;  3REX A;  4A54 A;  3QUI A;  5ELN A;  2QHV A;  3PCO B;  4KR2 A;  3EFR A;  1Z7N A;  4PG3 A;  1EFW A;  5I21 A;  4C8Q F;  1NJ1 A;  4J15 A;  3JCM f;  4UP9 A;  2ZT5 A;  2DJZ A;  5LJ5 d;  4M7D A;  3E9H A;  5GAN 6;  4JUV A;  4EO4 A;  3SWN A;  4C8Q D;  5K1P A;  4H2X B;  4YDQ A;  1WNL A;  3RGL A;  2IY5 A;  3RES A;  3HFN A;  4UP8 A;  1LJO A;  3OD1 A;  4P72 C;  5LJ5 g;  2E5A A;  5K1X A;  4M75 D;  11AS A;  5GMK m;  4M7D B;  1H4V B;  4H2X A;  3JCM e;  3HXV A;  2E10 A;  4JLI A;  5GMK e;  5GAN 4;  2QHU A;  3V8J A;  1B70 A;  1WPY A;  1N9W A;  2C7I A;  1E1O A;  3JCM X;  3TEG A;  5GAO m;  4H2T A;  4F7U E;  4K87 A;  4HA8 A;  5GMK j;  12AS A;  2VC8 A;  4WF2 A;  2ZNJ A;  4YRN A;  5GMK l;  4RDX A;  4M77 G;  5LJ3 f;  4C8Q E;  5LJ3 j;  4H2S A;  4YRC A;  2YLB A;  5C51 B;  3SWN C;  4WI1 A;  4X9D A;  1NJ8 A;  5ELO A;  4RQF A;  1X01 A;  5GAN 3;  2XGT A;  5GAO l;  4EMH A;  5F5W A;  2DTH A;  3NET A;  2Q5H A;  1M5Q 1;  4MMK A;  4PJO E;  4TVY A;  3RER A;  3FIF A;  4RMF A;  2DKG A;  4CS3 A;  1PYS A;  3P8Y A;  2VXE A;  1B8A A;  4M75 F;  3NEN A;  2ZIN A;  1Z7M A;  3UFG A;  4YRO A;  2PMF A;  3HXW A;  4YPF A;  4EMK A;  4P73 C;  4M7A F;  1E1T A;  3M4Q A;  2HNI A;  3JCM b;  5GAO n;  4M78 B;  4K86 A;  1EIY A;  3PZC A;  5GAN e;  3UH0 A;  3VBB A;  4E51 A;  2ZZF A;  3FJP A;  4V2S A;  2ZCE A;  1LYL A;  4YRS A;  3UGT A;  3BDU A;  4EMG A;  4HT8 A;  3JCM V;  4TVA A;  1C0A A;  2RA2 A;  4KR3 A;  1U1S A;  4M77 A;  1EOV A;  2ODR C;  4TWA A;  4C92 F;  4M77 D;  3MEY A;  1KMN A;  1NNH A;  1IL2 A;  1LOJ A;  2DZ9 A;  3RKX A;  4TVA B;  4O2D A;  3JCM c;  3JB9 F;  2FB7 A;  2ZIM A;  4PJO A;  5LJ5 e;  3LC0 A;  2CJB A;  4YP0 A;  3W3S A;  2E64 A;  3RKW A;  2RM4 A;  2FYK A;  3HRK A;  3IG2 A;  5C53 B;  4F7U F;  3QO5 A;  4PJO G;  3GIB A;  2I2L A;  1I5L A;  4M7D E;  4M7A C;  1G5H A;  4P3N A;  3HFZ A;  3TUP A;  2EAY A;  5GMK h;  3QNE A;  5LJ3 e;  4TQF A;  4G85 A;  3A7A A;  4ZIB A;  5GAN 2;  3UGQ A;  5GAM f;  3P8T A;  3HSB A;  1YB3 A;  3A5Y A;  4M75 C;  5GAM j;  3M4P A;  4YRI A;  1ATI A;  1U1T A;  1NJ5 A;  4JRK A;  4J6W A;  4J5Y A;  4YCV A;  1L0W A;  5GAN 7;  4H02 A;  4TQD A;  4P73 A;  1KMM A;  3RKY A;  4X5O A;  3BJU A;  3JB9 J;  1KOG A;  2DDZ A;  2E65 A;  2ZZE A;  1N9S A;  3R07 A;  4P71 A;  4LNS A;  2Y90 A;  5GAO r;  3P8V A;  1H64 1;  4H2U A;  4P72 A;  4XEO A;  3VQV A;  1Y96 B;  2Q5I A;  4CH3 A;  2DQ3 A;  4H2W A;  4J6Y A;  2AMC B;  4A53 A;  1NYQ A;  1VQZ A;  4P3O A;  4M7A G;  2DU5 A;  4PJO D; 
#chains in the Genus database with same CATH topology
 1Q81 U;  1KSW A;  3EG1 A;  4QQG A;  3ASK A;  4CC4 B;  2H8H A;  2JXB A;  3EG0 A;  5E3I A;  4OB0 B;  3VKI A;  1D1C A;  2PTK A;  3REA B;  4XTX A;  2DBK A;  4IUU A;  2KSS A;  4PNO A;  2IPO B;  4EIK A;  3QBY A;  1H4Q A;  5FU7 B;  1UTI A;  4AG2 C;  4EMK C;  2X4J A;  2AKW B;  3I55 A;  3UF4 A;  1HTT A;  1T3S A;  2D0Q B;  3CPW S;  3GOX A;  3VS7 A;  5GAM e;  3AHU A;  3T9N A;  3JAM E;  2FZG B;  1M90 R;  3HTR A;  2ZT7 A;  1SRL A;  3QHS A;  3M4G A;  2DMO A;  2CUB A;  1UGR B;  4N0A C;  5CKH A;  2VXF A;  3CPW P;  3OYM A;  3CCE A;  1SER A;  4HVU A;  4PJO F;  3J80 E;  3CBP A;  2QAS A;  3HRS A;  2DE0 X;  3E1S A;  4JRP A;  3S3O A;  3QO7 A;  4JJN K;  1TUG B;  2ZXF A;  2DPP B;  2DU7 A;  2ALY B;  5L23 A;  2R57 A;  4ZN3 A;  3RBB B;  4M7A B;  2COY A;  1W70 A;  2D6F A;  1Q7Y U;  1UUE A;  2IG0 A;  1M30 A;  1VQ4 Q;  4M7A D;  2K79 A;  2K9G A;  3NFC A;  4P74 C;  5LJ3 d;  2ED0 A;  1YI2 T;  1QCN A;  1NM7 A;  3CC4 A;  1VQ7 A;  1K0X A;  3LSQ A;  4J9I A;  5J39 A;  1QWE A;  3CXC P;  4XAX B;  2KRS A;  3VRY A;  1JU5 C;  4FW2 A;  3PMT A;  5KH6 A;  3S3M A;  1VQM A;  4XU3 A;  1NG2 A;  3QO3 A;  2K57 A;  4N4G A;  5LJ5 f;  3VS0 A;  3LGF A;  2BUD A;  2RO0 A;  1K73 R;  3TQ7 P;  1X2H A;  3MP8 A;  2Q7E A;  3A7U A;  1QP2 A;  4C5I A;  5GAN 8;  1VUB A;  3CQT A;  4FYW B;  1B7Y B;  3X25 B;  3OA6 A;  2IY5 B;  2DTO A;  2LT4 A;  4CH4 A;  5KYU B;  2C8M A;  3LH5 A;  4IUV A;  1YJW A;  1SSF A;  1B7Y A;  1K1Z A;  2CUD A;  2QG9 B;  3M0R A;  2M0Y A;  2NUT A;  2ART A;  2RD1 A;  1YWO A;  1V76 A;  3EG9 A;  4XU2 A;  1YFS A;  5FRM A;  4FYX B;  4OF1 A;  5DLO A;  4RG2 A;  1MMA A;  2O01 E;  2NWM A;  3M0U A;  2BKD N;  2A0F B;  4IUP A;  3CME T;  1Z9Z A;  1QP3 A;  2NUP B;  1KHI A;  5KE2 A;  5EG2 A;  5IHI A;  1WX6 A;  1B34 B;  2QK0 A;  1OU9 A;  3WQZ A;  4UPA A;  3FRN A;  2W10 A;  4TTV A;  3ULR B;  4E7Z A;  2FEI A;  2RI2 A;  4QVD A;  4HWS A;  2CIM A;  3OBW A;  3OMC A;  2COZ A;  2RI3 A;  3CC7 A;  2RQW A;  2XTI A;  4M7D G;  1BKB A;  4K88 A;  4E7L A;  3RUX A;  3V8K A;  1VQ8 T;  2VV5 A;  2RNA A;  1RLQ C;  2EBP A;  4PJL A;  5LJ5 h;  1TU0 B;  1UEB A;  1VOM A;  1ZBJ A;  1UJY A;  4J9B A;  4F17 A;  3OYL A;  1K9M U;  4Y92 A;  1KQS P;  4JPB W;  1G5V A;  1J5W A;  3EGU A;  4YRP A;  1CSK A;  2ARU A;  2RHS B;  4XTZ A;  1SHG A;  2HAX A;  1W2B P;  2QA4 T;  1LPL A;  4DOV A;  5KYY A;  3QII A;  3IQL A;  2MF2 A;  1PKT A;  1OZ3 A;  1XQH A;  4WJ4 A;  1ARK A;  4G84 A;  4J7F A;  4R0K A;  2G6F X;  1B3Q A;  5CQX A;  4C8Q A;  5LJ5 j;  5HKC A;  2ZPI B;  4J9E A;  3CME Q;  2MK5 A;  2E3H A;  1VQ8 Q;  1QVG P;  4YRQ A;  3X20 B;  2HQH A;  3EG2 A;  3RMQ A;  3F70 A;  1S72 T;  1VYU A;  4ZTZ B;  2ARS A;  3GP8 A;  5GAN h;  3CMA T;  2XHC A;  2QTX A;  2QA4 Q;  2C0I A;  3CC4 Q;  4FT2 A;  4E2F B;  3OQ5 A;  2DD4 A;  4KGX B;  4M75 A;  4OGE A;  5HK3 A;  2KNB B;  3A8O B;  3EG3 A;  1K9M R;  1OZ2 A;  3QYH B;  3JB9 G;  2PQW A;  2O9S A;  9ATC B;  2JZ2 A;  1YIT A;  1PYS B;  1VQP A;  1QW1 A;  1M1G A;  1PHT A;  3CC2 A;  1KC8 R;  1AVZ C;  2ESW A;  2JMA A;  1XOV A;  1QVG S;  1IRX A;  1ZSG A;  4HT9 A;  3INZ A;  1AWX A;  1PSF A;  1FYF A;  2XKO C;  2MWO A;  1ZUU A;  2M0O A;  4KBM B;  3I56 A;  3PCO B;  1VIF A;  3L2Q A;  3EHR A;  3H6Z A;  3OYK A;  1SKU B;  2PVO B;  1MND A;  2DLP A;  4D8D A;  3SFM A;  1G3T A;  1XTD A;  5GAN 6;  3VUB A;  2F69 A;  2CP7 A;  4F04 B;  2ABL A;  3X28 B;  3SWN A;  4C8Q D;  2GBQ A;  1WNL A;  2IY5 A;  1NPR A;  3OS2 A;  3CCV T;  2L3S A;  4DBR A;  2YRD A;  3EGD A;  2PU9 B;  4TVR A;  1Q86 U;  2E5A A;  5K1X A;  3OW2 P;  3VYH B;  3CC2 T;  2BIV A;  4B6M A;  5GMK m;  1W4S A;  3M59 A;  5IAY A;  3HXV A;  2LCL A;  1UB4 A;  3V8J A;  1B70 A;  1N9W A;  1PM3 A;  3JCM X;  5GAO m;  4H2T A;  3RR6 A;  2RHU A;  4QQ6 A;  5GMK j;  2D8H A;  5DM7 R;  1OUL A;  4WF2 A;  2KDS A;  2RQT A;  3KXT A;  5LJ3 f;  5LJ3 j;  2YLB A;  5C51 B;  5A0L A;  4ATO A;  2A8E A;  4X9D A;  5ELO A;  3RDV A;  2DYB A;  4RQF A;  3M0P A;  5I2S A;  1QQJ A;  4MDW A;  5CVI A;  2O2O A;  2XGT A;  5GAO l;  2RHZ A;  3NET A;  2Q5H A;  3OB9 A;  1IHW A;  4MMK A;  4TVY A;  1M3C A;  4CS3 A;  1I5O B;  2EIF A;  5EC7 A;  1VQO Q;  3CBO A;  4M75 F;  2FRY A;  3NEN A;  5HK0 A;  4RTY A;  2XID A;  4YRO A;  4AMC A;  2PMF A;  3HXW A;  4EMK A;  4M7A F;  2JUF A;  3EH1 A;  4LD6 A;  1E1T A;  1Q82 R;  4EPC A;  2B8A A;  1D1A A;  4M78 B;  3CD6 T;  2J7I A;  2RJC A;  2COW A;  3VBB A;  1MMN A;  1Y07 A;  1KQS S;  2V26 A;  1N8R U;  1YNZ A;  2MPX C;  3UGT A;  3HPW A;  8ATC B;  4EMG A;  2JS2 A;  4TVA A;  2RA2 A;  3DB4 A;  4TWA A;  3MEY A;  5I11 A;  1VQO T;  1MMD A;  4IIO A;  1Q7Y C;  2DZ9 A;  1RAG B;  1KD1 U;  3JCM c;  4L6V 5;  4DEY A;  3LC0 A;  3W3S A;  4YP0 A;  2YWW A;  4RTV A;  2FYK A;  3PE0 A;  3CC2 Q;  5C53 B;  3NTI A;  3MP6 A;  1ZLM A;  2MAM A;  1T3L A;  2I2L A;  4KT0 E;  2GF7 A;  4M7D E;  1QVP A;  1G5H A;  3E9G A;  2AK5 A;  2EAY A;  1HD3 A;  3CCU Q;  1TS9 A;  4KUL A;  3QJY A;  3CCU A;  3CME A;  5FLX E;  3A7A A;  4AFU C;  4ZIB A;  2K5L A;  3VYG A;  4JJC A;  3G6E A;  1YCS B;  2RI5 A;  3A5Z B;  2A36 A;  1W1F A;  6AT1 B;  4MDX A;  2FZC B;  1WIE A;  2CZ6 B;  4M75 C;  4YRI A;  1NJ5 A;  2X4W A;  3M57 A;  4BI3 A;  4YCV A;  1L0W A;  2PVD B;  4H02 A;  4P73 A;  1YJW T;  1KMM A;  4X5O A;  3JB9 J;  2F2V A;  2V1R A;  2DIG A;  1N9S A;  2KXD A;  1RAI B;  2AKK A;  4Z02 A;  5GAO r;  1H64 1;  3R6O A;  4P72 A;  1JJ2 P;  1I1J A;  2Q5I A;  1NBE B;  1X2Q A;  4WCI A;  5FU6 C;  4GLM A;  1JQQ A;  4VUB A;  3KBG A;  3THK A;  4P3O A;  1VIE A;  3CCL Q;  3MF2 A;  1M9S A;  2DXB A;  3G71 T;  2P0K A;  1VQP Q;  3EFS A;  1SHF A;  4JDS A;  2ZT8 A;  2CP0 A;  2SEM A;  2F5T X;  1ZSZ C;  1X6O A;  1BBZ A;  3VQW A;  3MET A;  2K3X A;  1X6G A;  3TEH B;  1K8A U;  3CBM A;  4P75 A;  2C0O A;  2V8K A;  1OOT A;  4C8Q C;  3I56 Q;  1TOV A;  2DAQ A;  4C92 G;  2CP5 A;  4J6X A;  1PCX A;  2HCK A;  4PKC C;  4NCX A;  2DL8 A;  3NTK A;  3OBY A;  5DY9 A;  3LSS A;  3A7R A;  2P0L A;  2XIC A;  4OB3 B;  1NEB A;  3M54 A;  4KQE A;  5A2Q E;  1YBY A;  2MMP A;  1BK2 A;  2EJF A;  4OP0 A;  1K9A A;  4DBF A;  5FWB A;  3BE3 A;  1KHC A;  2OAU A;  2KXC A;  2RHQ A;  3CMA A;  1M1K U;  3SWN B;  3CPW A;  4PJM A;  2EYY A;  2BZX A;  2X9H A;  2DEU A;  4YRT A;  3ERR A;  3REU A;  3HXY A;  5KYW A;  4NS5 A;  4BY6 B;  3JCM h;  2CS7 A;  4LD9 K;  3EGX B;  4CS4 A;  4Y91 A;  4A4E A;  4JZ4 A;  3CEY A;  3GF5 A;  3M0Q A;  1JXO A;  1KC8 U;  2O9V A;  2EGC A;  4FSS A;  1ACM B;  2MYS A;  4FL6 A;  2K2V A;  5LJ3 h;  1H3H A;  2P0P A;  2E1H A;  1O75 A;  3BY7 A;  1E7O A;  4HWP A;  2A7Y A;  1Y7X A;  2WSF E;  1HK9 A;  4IUQ A;  2O88 A;  2JM9 A;  2DER A;  2HDA A;  4C92 B;  3QYG B;  1KQ1 A;  1YFN A;  5KYX B;  1SES A;  4C0Z A;  3L2V A;  1G5I A;  3NPF A;  4B9W A;  1G8X A;  5FW9 A;  3CXC S;  4ZN1 A;  2FHD A;  2BE7 D;  2AZS A;  1ZBX A;  1I81 A;  4AG1 C;  3L2Z A;  2DXC A;  4YRK A;  2RPN A;  2GFA A;  2E70 A;  3I7F A;  2D0N A;  4YTL A;  4CC3 A;  1X6B A;  1Y96 A;  2D1X A;  2DBM A;  5D7U A;  3H0F A;  5AYF A;  3OYI A;  4YRL A;  1YGB A;  2CT4 A;  4LNP A;  5CIU A;  5J26 A;  3A32 A;  2YUN A;  2I4M A;  3ER0 A;  2ZR2 A;  3VQX A;  3X26 B;  4M78 A;  4CH5 A;  3G4S A;  4C5H A;  3IKL A;  4XU1 A;  3M5A A;  1QLY A;  2I4L A;  3H0I A;  1ZHI A;  2DEQ A;  2GTO A;  1AWO A;  4DPG A;  3VQY A;  3V7R A;  2CYZ B;  4EMK B;  1VQ9 A;  2K5F A;  4J9G A;  3DKM A;  4F16 A;  2P5I A;  5HGQ A;  4X34 A;  1K76 A;  1FWZ A;  1TUC A;  2QDL A;  4C0D B;  1VYV A;  3L2W A;  2HKQ B;  4WTO B;  3JB9 I;  3FDR A;  2FO0 A;  2EW3 A;  5KYY B;  4ZGE B;  3OSS C;  1H4S A;  2EL9 A;  1Q86 C;  1WXT A;  2OTJ T;  1GRI A;  5ECA A;  4H2V A;  4HVW A;  4M78 C;  4AH6 A;  3JCM P;  2FZK B;  2R5A A;  4DBQ A;  2G4C A;  4QKU A;  3FB9 A;  4ME7 A;  2CP3 A;  2RMO A;  2YLC A;  3KFV A;  4F7U B;  1YWP A;  1Q7Y R;  1D0X A;  1WHH A;  2O31 A;  1E22 A;  2RHX A;  1TXQ A;  2DL3 A;  4E7J A;  4M75 E;  1EVK A;  2G3R A;  3M4Y A;  4OGC A;  1YHQ Q;  1VQ7 T;  2A3L A;  1WU7 A;  4HWT A;  2J05 A;  1X75 C;  2OTJ A;  2CH4 W;  5GMK i;  1R0B G;  3EGD B;  1RIQ A;  4AFZ C;  1EIY B;  1GGM A;  1IO6 A;  1M1K C;  4TVW A;  1WDX A;  2DJQ A;  3HRI A;  2DXT A;  3LH0 A;  2VKN A;  2DVJ A;  3RIR A;  3EFO B;  1BI0 A;  1MV3 A;  4YRJ A;  3C4S A;  1VQ9 T;  3QZ9 B;  2DRK A;  2AMC A;  4Q5W A;  4MZP A;  1LVK A;  1U06 A;  3L4G B;  4KH1 B;  1A0N B;  3QZ5 B;  3WVE B;  1ZX6 A;  2DTI A;  2LCC A;  2E4H A;  4M77 F;  4OMM A;  3O5Z A;  2ZGW A;  3FEO A;  2RN8 A;  2L3P A;  1BI2 A;  3EAE A;  2KRO A;  3NTH A;  3HRT A;  2D9T A;  1MGQ A;  1ABQ A;  4NOY A;  2CJA A;  1OU8 A;  2F2W A;  4DOW A;  5GAN j;  2H3E B;  2CGH A;  4XTY A;  4N4H A;  4L87 A;  1QVG A;  4RQE A;  3ZFJ A;  2ZNI A;  2Q7H A;  1DJ7 B;  1UGP B;  2PVG B;  2ZZD A;  1G51 A;  1W2B S;  3JCM J;  1HXD A;  3C12 A;  2BZ8 A;  3S3N A;  1BI1 A;  5GJV B;  4CC7 A;  4WJ3 M;  4HWR A;  2DD5 A;  3VS2 A;  3NMZ C;  1WHG A;  1U5S A;  2LP5 A;  5GAN g;  4LUE A;  4OVA A;  1M1F A;  3JCM g;  4FW1 A;  1D3B B;  4RCC A;  3CCR T;  3CCR A;  1UDL A;  3HFO A;  1K8A C;  3JB9 H;  1WGS A;  3L2U A;  1BIA A;  4QQD A;  4C5E A;  4PJO C;  4C92 E;  2DRM A;  5GAM h;  3A31 A;  3IAL A;  5ELN A;  3E2U A;  2VYT A;  5FRO A;  1WJS A;  4E7S A;  2HZY A;  3CCS A;  1UHC A;  2HKN A;  2V1Q A;  4J15 A;  2ZT5 A;  4CC2 A;  1JJ2 S;  3TSW A;  4JUV A;  4O5V A;  2KT1 A;  4JS4 A;  3PMI A;  1R0C B;  1E6G A;  1TUD A;  3OD1 A;  5LJ5 g;  1RUW A;  4GY5 A;  2LDM A;  1U3O A;  3QWX X;  2XK0 A;  4JLI A;  2QGF B;  5GAN 4;  1YIT T;  3LWI A;  2QHU A;  3OW2 S;  3TEG A;  1QKW A;  2WAC A;  2OI3 A;  2VC8 A;  5IXF A;  1M3B A;  4ESR A;  4BDY A;  4PLL A;  5GMK l;  4RDX A;  2LJ3 A;  4H2S A;  2ZPG B;  4J9F A;  3VUZ A;  3SWN C;  1MMG A;  4E7I A;  1X01 A;  2EQU A;  2Z0W A;  5GAN 3;  4RUG A;  3RNJ A;  2L89 A;  5C6S A;  2BE9 B;  2P84 A;  5F5W A;  1N8R C;  2W0Z A;  2M02 A;  3LLR A;  2CSQ A;  3QKJ A;  4PJO E;  3FIF A;  3G71 A;  2KRN A;  2LQN A;  3P8Y A;  3EGX A;  4A63 B;  2E6Z A;  4BI4 A;  4D8K A;  2ZIN A;  3CCL A;  2L5Q A;  3EG9 B;  3M0T A;  2MI6 A;  4P73 C;  3L42 A;  1K8A R;  3M4Q A;  2GCX A;  5GAO n;  5KYU A;  1Q81 C;  1M1K R;  2OTL Q;  4DEX A;  1EIY A;  5GAN e;  4BI8 B;  2M1H A;  2DNU A;  5D6W A;  2ZZF A;  3FJP A;  1KK7 A;  3M53 A;  2DM1 A;  1G3S A;  2FVU A;  2X3W D;  3MEA A;  1LYL A;  4HT8 A;  1GCQ C;  1VQ6 T;  1C0A A;  4KR3 A;  2LQK A;  2NLU A;  2ODR C;  4FYY B;  2LQ8 A;  5IN1 A;  1M90 U;  1QVF A;  1LOJ A;  4O2D A;  3OYE A;  1WHK A;  3QJ6 A;  3G4S T;  3A8M B;  3OYH A;  1VQK Q;  3RKW A;  1QVF P;  4PLI A;  3HRK A;  4FT4 A;  4F7U F;  4PK4 A;  1IGQ A;  4HCK A;  2RQV A;  3GIB A;  1Q86 R;  2CP6 A;  2QXF A;  2K3Y A;  3QNE A;  1TG0 A;  1K4U S;  2KE9 A;  4TQF A;  4G85 A;  2CP2 A;  4O6J A;  1RAA B;  3ZEH A;  1UGV A;  1VQL A;  1JB0 E;  1RAF B;  1R8O B;  1YB3 A;  7AT1 B;  3A5Y A;  3M4P A;  2QQS A;  2EPD A;  4P5N A;  1U1T A;  4JRK A;  3TRE A;  2QYZ A;  4J6W A;  4LDW A;  3CCJ Q;  2RJE A;  4TQD A;  1AWJ A;  3RKY A;  4C0F A;  1KOG A;  4HCB A;  3BJU A;  1NLO C;  2J6K A;  2E65 A;  1M8M A;  2GNC A;  3R07 A;  3CD6 A;  3VS3 A;  3QWY A;  3FC3 A;  1M2V B;  3C95 A;  3G7Z A;  2GGR A;  4XEO A;  3CXC A;  4ELY C;  1Y96 B;  4CH3 A;  3M55 A;  1KIK A;  2V8J A;  2OX7 A;  4BY6 C;  4HCZ A;  4A53 A;  3TCJ A;  1PKS A;  4M7A G;  4PJO D;  3OYN A;  5LL6 S;  2K2M A;  2DQ0 A;  2VUB A;  4Z88 A;  4QVZ A;  4N0A A;  1WLP B;  4E7H A;  2AKW A;  3HXZ A;  1JRI A;  1Y71 A;  1UE9 A;  1NJ2 A;  4YRE A;  3RAC A;  3NEL A;  1WHL A;  2GQI A;  4C5G A;  3HXX A;  3E19 A;  3JCM Q;  1JEG A;  3OYC A;  3G4S Q;  1UJ0 A;  1RAE B;  2O4X B;  4LN2 A;  1WQ7 A;  4C92 C;  3TVT A;  2HEQ A;  1PRL C;  3HY0 A;  3VU3 C;  2EJG A;  3KFU A;  2LX7 A;  1BU1 A;  1M8V A;  1VQ9 Q;  3J7A F;  1X55 A;  4E7K A;  4QW2 A;  1SRY A;  4D6W A;  3DLM A;  4MZM A;  2IIM A;  3BFM A;  1D1B A;  4OML A;  5CK9 A;  3VS4 A;  3JV3 A;  1OV3 A;  2FPD A;  2RHY A;  4LUD A;  3HTZ A;  3CCM A;  4FSX A;  4C92 D;  1N8R R;  3H0H A;  1QF6 A;  1D3B A;  3G1J A;  1W66 A;  1WXU A;  2FPF A;  2JTF A;  1YCY A;  2MOX A;  1K73 U;  1IGU A;  3WXM B;  4M4Z A;  4K11 A;  2QQ9 A;  4FM4 B;  2PME A;  4A4G A;  4ORZ A;  3H41 A;  1ZA1 B;  3OS1 A;  5GJW B;  4Z8A A;  5I22 A;  2A28 A;  1EFN A;  1UGQ B;  4XEM A;  2LTO A;  5C0M A;  1FX7 A;  2JNG A;  1RAC B;  1VQ5 A;  4LDU A;  3SHW A;  2QA4 A;  3UPU A;  2I4N A;  5FU7 C;  4C8Q G;  4JJB A;  1VQ5 Q;  2YUO A;  4OMF B;  4XQ3 A;  4HWO A;  3VV0 A;  3H8Z A;  1M27 C;  4QT7 A;  1LCK A;  3H9N A;  4NL2 A;  1VQM Q;  4Q6G A;  3REB B;  4B9X A;  1RL2 A;  4LE9 A;  2Q7G A;  2XDD A;  1E24 A;  2EKO A;  3G6E T;  3PIP A;  2MWP A;  1X56 A;  3EFO A;  1ZUK A;  1VQL Q;  4M7A E;  1VQN T;  3L1A A;  3PNW C;  1B70 B;  2ZR3 A;  4EX5 A;  1NE8 A;  1ADY A;  3UT1 A;  2LX9 A;  1WFW A;  2JS0 A;  4RCB A;  3TEH A;  4BWA A;  4RTU A;  1WI7 A;  2PUK B;  2LNV A;  3QXE B;  1GBQ A;  4BW9 A;  4OMO A;  4OLF A;  3UA6 A;  2RJD A;  2CZ0 B;  2QI2 A;  1VQ4 T;  4LVL A;  1N5Z A;  2XD0 A;  5C52 B;  3L2R A;  3V8L A;  1VQO A;  1VQ6 Q;  4F7U G;  1NJ6 A;  4XTU A;  3PT9 A;  3MHX A;  4M78 F;  3EHQ A;  1VQ6 A;  4M7A A;  3PCO A;  3GBQ A;  2QTV A;  5GAO q;  1UGS B;  4OMN A;  1GFD A;  4YCW A;  2WSC E;  2YRC A;  3NEM A;  1LNX A;  3G1Z A;  1W6X A;  4ZNX A;  1MUZ A;  4LVI A;  1OQK A;  2ATC B;  4JJD A;  4ZTJ A;  2E5K A;  2JTM A;  2RF0 A;  4BE2 A;  4DQ2 A;  4RMO A;  1YJN A;  2RHI A;  1ADJ A;  3CC7 Q;  1IXD A;  4E47 A;  1T0J A;  1HC7 A;  3QG1 A;  2ENM A;  4ZTF A;  3S6W A;  1XJW B;  3A5Z A;  1B07 A;  3M0S A;  5KCO A;  4KUI A;  1ASY A;  4M75 B;  2OAW A;  4YRF A;  2ZIO A;  1N9R A;  2QQR A;  1YIJ A;  1X2G A;  3CC4 T;  1YI2 A;  2XDP A;  3CCE Q;  2PZ1 A;  3CCM Q;  2ROL A;  3QPH A;  1K0S A;  3KUF A;  4JRI A;  2F5K A;  3CD6 Q;  3DLL A;  3OYD A;  1YJ9 T;  2JJ9 A;  4FIB A;  1QWF A;  3BW1 A;  5CKD A;  5GAM g;  4L59 A;  1BYM A;  3QSU A;  4MML A;  3VS5 A;  3OYF A;  5CAI A;  2LQW A;  4KGV B;  3IKM B;  4PFZ A;  2KT8 A;  3VS6 A;  4C92 A;  1WYD A;  1PG5 B;  4RG8 A;  1M2V A;  1JO8 A;  1QCF A;  3J81 E;  1YFR A;  2L3Q A;  3LYI A;  4LDV A;  3CCE T;  2RHQ B;  4Q15 A;  4IUR A;  4N4I A;  5GAN f;  2E41 A;  1WJR A;  4PFP A;  1SSH A;  4J8O A;  1PD0 A;  1SPK A;  1Y57 A;  4R56 A;  3JCM d;  4HXJ A;  2ZTG A;  3VS1 A;  5A0G A;  5IHN A;  3G71 Q;  1AOJ A;  4C0D C;  2HSP A;  5GAO p;  1PD1 A;  2A08 A;  2CH4 A;  2J6O A;  1CKA A;  4M75 G;  1YFT A;  1TTH B;  1BBU A;  1N27 A;  1YIT Q;  2YSQ A;  1USY A;  4CS2 A;  1UHF A;  2K7A A;  1RAD B;  2NUZ A;  2V8I A;  2JN0 A;  4OB1 B;  1WZO A;  2X3X D;  3OY9 A;  3GLX A;  4OMP A;  4Z89 A;  1VQP T;  1BBW A;  1D0Y A;  1UG1 A;  2NUP A;  4A4F A;  1PWT A;  4CRI A;  3QUI A;  1KD1 R;  3MQZ A;  1QCO A;  3EFR A;  2I0N A;  1RLP C;  4PG3 A;  4OMQ A;  4CI0 C;  1HSQ A;  1ZQ1 A;  4C8Q F;  1NJ1 A;  2EKH A;  4KGZ B;  1MNE A;  3LGL A;  3FLG A;  2LNH B;  3EH2 A;  1VQK A;  2BTT A;  5K1P A;  3OYA A;  1Z9Q A;  1G83 A;  5IT9 E;  4J7I A;  1GXI E;  4UP8 A;  1FMW A;  4P72 C;  2BZY A;  1OX8 A;  1H4V B;  1IB8 A;  3JCM e;  2DF6 A;  3E9F A;  2E10 A;  2DIQ A;  2DFU A;  2C7I A;  4RTW A;  3RMS A;  3HRU A;  4KRT A;  1GBR A;  2ZPE B;  4F7U E;  3JRZ A;  1JJ2 A;  1RAH B;  2J6F A;  5CR2 A;  3OYY A;  2ZNJ A;  2HL3 A;  1PNJ A;  1YJ9 Q;  3DB3 A;  4C8Q E;  4GBQ A;  4YRC A;  2DL7 A;  3NGP A;  1NJ8 A;  2WSE E;  2JOY A;  3PTA A;  2C06 A;  2M9U A;  1H92 A;  3HKS A;  2OTL T;  1FMV A;  2DTH A;  3OW2 A;  1K73 C;  1QMC A;  1M5Q 1;  2RQR A;  3PVQ A;  1BI3 A;  3U23 A;  1BCO A;  1KFZ A;  4RMF A;  2DKG A;  1PYS A;  3A8H B;  2RQU A;  2VXE A;  2ZPB B;  1B8A A;  1KD1 C;  1VQ8 A;  1Z7M A;  3UFG A;  4ELZ C;  2K6D A;  4HVV A;  3OMG A;  2O4X A;  1W2B A;  2R5M A;  1PRM C;  1AZG B;  2KAF A;  2QEX Q;  4PJJ A;  1GFC A;  2HNI A;  5KE3 A;  3JCM b;  4LDX A;  5D6Y A;  2KK4 A;  2B86 A;  3OS5 A;  2MIO A;  4K86 A;  4J9H A;  3UH0 A;  4E51 A;  2H3J A;  1XNI A;  4V2S A;  2AHJ B;  3I55 Q;  2FPE A;  2QQB A;  2QDY B;  1NJI C;  2AIR B;  1H3Z A;  2KEA A;  2RH2 A;  1U1S A;  3JSC A;  2GQV A;  4C92 F;  3OSV A;  2LVM A;  1KMN A;  1NNH A;  3CCS Q;  1B7T A;  1IL2 A;  4TVA B;  4JRQ A;  2ZIM A;  3URG A;  2X4X A;  1RAB B;  3MP1 A;  4DBH A;  5LJ5 e;  2E64 A;  4BE1 A;  1YJN T;  2RM4 A;  2HQX A;  1MHN A;  2LT1 A;  2L2P A;  4PJO G;  1WXB A;  1ZSZ B;  3LX7 A;  2XG8 D;  4M7A C;  1FYN A;  4P3N A;  3HFZ A;  2JMC A;  3TUP A;  2DK3 A;  1NYG A;  1WYX A;  4EDU A;  2VB6 A;  5LJ3 e;  4F14 A;  1VQN Q;  1QVF S;  1Q81 R;  2EGE A;  2KYM A;  1FXX A;  2YRV A;  3G6E Q;  5GAN 2;  3UGQ A;  5CO7 A;  5CCA A;  2IVW A;  1SEM A;  2YDL A;  4A4H A;  2ZPH B;  4UC4 A;  8AT1 B;  5GAM j;  1VQ4 A;  4LVK A;  3SEM A;  1VQM T;  3ZBD A;  4J5Y A;  5GAN 7;  2J06 A;  4J83 A;  3CCQ A;  1GL5 A;  4IIM A;  3CCQ Q;  2NUT B;  1BB9 A;  4RTT A;  1SRM A;  1UFF A;  1VQK T;  4AFQ C;  2ECZ A;  4P71 A;  4LNS A;  5D6X A;  4DA4 A;  2QEX T;  2VVK A;  5IH2 A;  2DYI A;  3LW5 E;  3VQV A;  1M3A A;  1S72 Q;  2DQ3 A;  2AMC B;  1WJQ A;  1OYX A;  1I07 A;  2LRQ A;  4M78 D;  1C0M A;  3RL6 A;  1UEC A;  3JB9 D;  2SRC A;  3P8B B;  5GAM d;  2EVR A;  2QHS A;  1EIF A;  2EQK A;  1JJC A;  1AD5 A;  3VRZ A;  4ANJ A;  4M78 G;  4XU0 A;  2E12 A;  1JJC B;  4KH0 B;  1IHV A;  2VGM A;  2K4Y A;  1F1B B;  1G3W A;  2L3R A;  2XU8 A;  4PJO B;  1WQW A;  2JT4 A;  2LJ0 A;  4FU6 A;  3I35 A;  2PUO B;  2ZZG A;  2CZ7 B;  3V7C A;  2HBP A;  1OI1 A;  4LXC A;  3UDC A;  4R55 A;  4JLG A;  3C0C A;  3MF1 A;  3I55 T;  2RB6 A;  1P92 A;  2J3M A;  3CMQ A;  1MV0 B;  1IZ6 A;  4AFS C;  4BDZ A;  4M7D C;  5LJ3 g;  2LC4 A;  2AZV A;  2OTJ Q;  2ODR D;  2EYW A;  1C1A A;  3CMA Q;  1ABO A;  2LJ1 A;  4PL6 A;  3A74 A;  2I4O A;  1WHJ A;  2DZC A;  2KMT A;  3SB2 A;  2J3L A;  3HXU A;  4M7D D;  2CKK A;  2HBW A;  2K3B A;  4AT1 B;  2HD0 A;  4X9C A;  1YJ9 A;  1NLP C;  2A37 A;  3HFZ B;  3A1P A;  3SD4 A;  3NHN A;  5CKF A;  4C8Q B;  4PJN A;  2ALY A;  4P75 C;  3ME9 A;  3CCJ A;  3CCV Q;  1EVL A;  1USY C;  3HY1 A;  4BE0 A;  4NL3 A;  1NYF A;  3TU4 K;  1ZSZ A;  5M9O A;  2YUQ A;  2AT1 B;  2DET A;  5IHK A;  1D09 B;  1OEB A;  4HVC A;  4RTZ A;  5I2M A;  3R6N A;  1KQ2 A;  3M9Q A;  1Q82 U;  3LWH A;  4XTW A;  1J3T A;  3CCU T;  3DSQ A;  4J9D A;  2DXU A;  3SDZ A;  3MEW A;  4ZGD B;  2QEX A;  1O9S A;  1SF9 A;  1RI0 A;  4JS5 A;  3CCR Q;  4M78 E;  2GTJ A;  2K5I A;  2Y4Y A;  2RHS A;  2DL4 A;  2EYZ A;  3CCQ T;  1JBM A;  1I8F A;  3HFV A;  2CSI A;  2ROT A;  4Y28 E;  4YRG A;  1S72 A;  1HJD A;  2AKL A;  3O8V A;  1VQL T;  1BCM A;  1NEG A;  4XTV A;  3VJP A;  2KBT A;  2QQA A;  2X51 A;  2KYB A;  4M77 E;  4PFO A;  5L8R E;  4BD3 A;  5KYX A;  4IKF A;  5J3B A;  2DA9 A;  1X43 A;  2E6N A;  5KYW B;  4ZTU B;  2EGA A;  2KY9 A;  1NZ9 A;  1V1C A;  2CRE A;  4J9C A;  1Y0M A;  3QTC A;  2F2X A;  2JVV A;  4M7D F;  1B34 A;  1EX4 A;  3P8H A;  3OYB A;  1VQN A;  2VGN A;  2X4Y A;  1NJI R;  2NS6 A;  5GAN 5;  1H4T A;  2X35 A;  4P71 C;  2HL5 C;  3BDL A;  1KG1 A;  5FU6 B;  3P8D A;  1HYO A;  2FG0 A;  2CJ9 A;  2JW4 A;  1ZUY A;  2DIL A;  2XI9 A;  1K9M C;  3PGG A;  1OPK A;  3D7S B;  1VQ5 T;  4M77 C;  1YHQ A;  4PHC A;  1TWB A;  4YRR A;  4C0G A;  2DL5 A;  3L4G A;  2DVE A;  1ZA2 B;  4RTX A;  4L5G A;  2EWN A;  2PNI A;  1EQR A;  4P74 A;  4YYE A;  3A98 A;  3MO8 A;  4H2Y A;  3UAT A;  1C6V X;  1I4K 1;  3ZL7 C;  2D8J A;  4M77 B;  2FL7 A;  4LDY A;  4HT4 A;  2EQJ A;  5KNN A;  3V7S A;  2EJ9 A;  2ZT6 A;  3TSZ A;  3ICA A;  2YHT A;  1S1N A;  1SET A;  2OTL A;  2E5Q A;  1R77 A;  2KRM A;  4KUD K;  3CCM T;  1AEY A;  3CCV A;  4YCU A;  3MEV A;  2GFU A;  1KJW A;  2NYS A;  4ZGJ B;  4FCY A;  5HCK A;  3I5R A;  3HL8 A;  1AZE A;  1YJW Q;  5KYN A;  2LCS A;  3QO8 A;  5IXB A;  3MJX A;  4F7U A;  1YP5 A;  2DX1 A;  1ASZ A;  5GAN d;  1BIB A;  4HCC A;  1G2B A;  1X27 A;  3PFS A;  3JCM W;  2OJ2 A;  3RF1 A;  4YRM A;  2KQW A;  4UP7 A;  3I56 T;  4P3P A;  2JTE A;  1X54 A;  3I5S A;  2Y4X A;  1RI9 A;  5FWC A;  1TH7 A;  2ZPF B;  2E3C A;  1I0C A;  1X2K A;  2RK1 A;  1WLE A;  2LMJ A;  1E6H A;  2MCN A;  4LVM A;  3E9I A;  1QKX A;  1B76 A;  1YN8 A;  2CDT A;  3A8L B;  3X24 B;  4CH6 A;  1NYR A;  1M2O A;  5DLQ E;  4QVC A;  1YJN Q;  1QE0 A;  2QHT A;  4LVJ A;  3MPU B;  2HMA A;  3REX A;  1VYT A;  4A54 A;  2QHV A;  1WHM A;  4KR2 A;  1Z7N A;  3GNF B;  1EFW A;  5I21 A;  3CCS T;  5A0D A;  2LZ6 B;  3JCM f;  4UP9 A;  3GNG A;  2DJZ A;  5LJ5 d;  4M7D A;  3E9H A;  1IRE B;  2RK2 A;  2DO3 A;  2FRW A;  4XK8 E;  3PVL A;  4EO4 A;  2VWF A;  4H2X B;  4YDQ A;  3WVD B;  1YIJ Q;  1KC8 C;  3RGL A;  3RES A;  3HFN A;  1YI2 Q;  1LJO A;  4M75 D;  11AS A;  4BB7 A;  1EZZ B;  2EYQ A;  1NPP A;  4M7D B;  2P0Q A;  2QAZ A;  4H2X A;  4JZ3 A;  3AT1 B;  5GMK e;  1OPL A;  1WPY A;  1E1O A;  2C0T A;  4K87 A;  4HA8 A;  3M56 A;  12AS A;  2M51 A;  2YXY A;  1G3Y A;  2XMF A;  4YRN A;  4M77 G;  1M90 C;  2XDB A;  4WI1 A;  3GPL A;  1Q95 G;  1YHQ T;  1VQ7 Q;  1U8R A;  1WA7 A;  4EMH A;  1GCP A;  2F1L A;  1D0Z A;  3I9Q A;  1KQS A;  3OYJ A;  3RER A;  5FRN A;  4X1V A;  2ED1 A;  3HP9 A;  2JM8 A;  1AT1 B;  4YPF A;  4HKE A;  3CC7 T;  2EQM A;  3QDR B;  3CPF A;  2EFI A;  2KVQ G;  3TEE A;  2QGG A;  2M16 A;  1AHJ B;  2P4R A;  3PZC A;  2CZ1 B;  3MKD A;  2ZAE A;  5AT1 B;  3OYG A;  1YIJ T;  2KI7 A;  2ZCE A;  4BUG A;  4YRS A;  3QDF A;  1N6A A;  1M4Z A;  3BDU A;  3CCL T;  4RKU E;  3JCM V;  1Q82 C;  3M58 A;  4E6R A;  4M77 A;  2R58 A;  4II1 A;  1EOV A;  1PC0 A;  4M77 D;  5KCH A;  4IUT A;  3RKX A;  2RJF A;  2YT6 A;  3JB9 F;  1T0H A;  2FB7 A;  1OX9 A;  2CT3 A;  4PJO A;  2CJB A;  3Q1J A;  4GLK A;  5CKE A;  3IG2 A;  1CKB A;  2KGT A;  5CQY A;  2P4T A;  3N5B B;  3QO5 A;  1PSE A;  1I5L A;  1SG5 A;  2EYX A;  5GMK h;  2L0A A;  1GCQ A;  3FJ5 A;  1X69 A;  4OB2 B;  2YUP A;  5GAM f;  3P8T A;  5HY6 A;  3HSB A;  3OS0 A;  2E3I A;  4A4K A;  1H8K A;  1ATI A;  3UWN A;  2EQI A;  1VA7 A;  3MEU A;  3MCA B;  1AWW A;  2VAS A;  3A8G B;  3PIO A;  4BAC A;  2DDZ A;  2ZZE A;  1V29 B;  4FYV B;  2HSE B;  5CKB A;  2Y90 A;  3CCJ T;  3P8V A;  3HHT B;  4H2U A;  1NJI U;  1JXM A;  1FMK A;  2KR3 A;  2L8D A;  4H2W A;  4J6Y A;  2ZCF B;  4MZT A;  1TSF A;  1NYQ A;  1VQZ A;  3UA7 A;  2DU5 A;  3C94 A;  2HQE A; 
#chains in the Genus database with same CATH homology
 1Q81 U;  4QQG A;  3ASK A;  5E3I A;  4OB0 B;  3VKI A;  4XTX A;  4IUU A;  2KSS A;  4PNO A;  3QBY A;  1H4Q A;  5FU7 B;  2AKW B;  4EMK C;  2X4J A;  3I55 A;  1HTT A;  2D0Q B;  3CPW S;  3GOX A;  5GAM e;  3AHU A;  3T9N A;  3JAM E;  2ZT7 A;  3QHS A;  3M4G A;  4N0A C;  1UGR B;  5CKH A;  2VXF A;  3OYM A;  3CCE A;  1SER A;  4PJO F;  3J80 E;  3CBP A;  3HRS A;  3E1S A;  4JRP A;  3S3O A;  3QO7 A;  4JJN K;  2ZXF A;  2DPP B;  2DU7 A;  2ALY B;  2R57 A;  4ZN3 A;  4M7A B;  2D6F A;  1Q7Y U;  2IG0 A;  4M7A D;  3NFC A;  4P74 C;  5LJ3 d;  3LSQ A;  1YI2 T;  3CC4 A;  1VQ7 A;  5J39 A;  4XAX B;  3PMT A;  5KH6 A;  3S3M A;  1VQM A;  4XU3 A;  3QO3 A;  2K57 A;  4N4G A;  5LJ5 f;  3LGF A;  2BUD A;  2RO0 A;  1X2H A;  3MP8 A;  2Q7E A;  3A7U A;  1QP2 A;  4C5I A;  5GAN 8;  1VUB A;  1B7Y B;  3X25 B;  3OA6 A;  2IY5 B;  2DTO A;  2LT4 A;  4CH4 A;  2C8M A;  4IUV A;  1YJW A;  1SSF A;  1B7Y A;  2ART A;  2RD1 A;  4XU2 A;  1YFS A;  5FRM A;  4OF1 A;  5DLO A;  4RG2 A;  2O01 E;  2BKD N;  4IUP A;  3CME T;  1QP3 A;  1KHI A;  5KE2 A;  5EG2 A;  1B34 B;  3WQZ A;  4UPA A;  3FRN A;  4TTV A;  2RI2 A;  4QVD A;  4HWS A;  2CIM A;  3OBW A;  3OMC A;  2RI3 A;  3CC7 A;  2XTI A;  4M7D G;  1BKB A;  4K88 A;  4E7L A;  3RUX A;  3V8K A;  1VQ8 T;  2VV5 A;  5LJ5 h;  1UEB A;  3OYL A;  1K9M U;  1G5V A;  1J5W A;  4YRP A;  2ARU A;  2RHS B;  4XTZ A;  2HAX A;  2QA4 T;  4DOV A;  3QII A;  2MF2 A;  1OZ3 A;  1XQH A;  4WJ4 A;  4G84 A;  4J7F A;  5CQX A;  4C8Q A;  5LJ5 j;  5HKC A;  2ZPI B;  4YRQ A;  3X20 B;  3RMQ A;  3F70 A;  1S72 T;  4ZTZ B;  2ARS A;  3GP8 A;  5GAN h;  3CMA T;  2XHC A;  2QTX A;  4FT2 A;  3OQ5 A;  2DD4 A;  4M75 A;  4OGE A;  5HK3 A;  3A8O B;  1OZ2 A;  3QYH B;  3JB9 G;  2PQW A;  2JZ2 A;  1YIT A;  1PYS B;  1VQP A;  1QW1 A;  1M1G A;  3CC2 A;  1XOV A;  1QVG S;  4HT9 A;  3INZ A;  1FYF A;  1PSF A;  2XKO C;  2MWO A;  2M0O A;  4KBM B;  3I56 A;  3PCO B;  1VIF A;  3L2Q A;  3H6Z A;  3OYK A;  2PVO B;  3SFM A;  1G3T A;  1XTD A;  5GAN 6;  3VUB A;  2F69 A;  3X28 B;  3SWN A;  4C8Q D;  1WNL A;  2IY5 A;  1NPR A;  3OS2 A;  3CCV T;  2PU9 B;  4TVR A;  1Q86 U;  2E5A A;  5K1X A;  3VYH B;  3CC2 T;  2BIV A;  5GMK m;  1W4S A;  3M59 A;  5IAY A;  3HXV A;  2LCL A;  1UB4 A;  3V8J A;  1B70 A;  1N9W A;  3JCM X;  5GAO m;  4H2T A;  2RHU A;  4QQ6 A;  5GMK j;  5DM7 R;  4WF2 A;  2KDS A;  3KXT A;  5LJ3 f;  5LJ3 j;  2YLB A;  5C51 B;  5A0L A;  4ATO A;  2A8E A;  4X9D A;  5ELO A;  4RQF A;  5I2S A;  4MDW A;  5CVI A;  2XGT A;  5GAO l;  2RHZ A;  3NET A;  2Q5H A;  3OB9 A;  4MMK A;  4TVY A;  4CS3 A;  2EIF A;  3CBO A;  4M75 F;  3NEN A;  5HK0 A;  2XID A;  4YRO A;  2PMF A;  3HXW A;  4EMK A;  4M7A F;  2JUF A;  4LD6 A;  1E1T A;  4EPC A;  2B8A A;  4M78 B;  3CD6 T;  2RJC A;  3VBB A;  1Y07 A;  1KQS S;  1N8R U;  3UGT A;  3HPW A;  4EMG A;  4TVA A;  2RA2 A;  3DB4 A;  4TWA A;  3MEY A;  1VQO T;  1Q7Y C;  2DZ9 A;  1KD1 U;  3JCM c;  4L6V 5;  3LC0 A;  3W3S A;  4YP0 A;  2FYK A;  5C53 B;  3NTI A;  3MP6 A;  2MAM A;  2I2L A;  4KT0 E;  2GF7 A;  4M7D E;  1QVP A;  1G5H A;  3E9G A;  2EAY A;  4KUL A;  3QJY A;  3CCU A;  3CME A;  5FLX E;  3A7A A;  4ZIB A;  2K5L A;  3VYG A;  3G6E A;  2RI5 A;  3A5Z B;  4MDX A;  4M75 C;  2CZ6 B;  4YRI A;  1NJ5 A;  2X4W A;  3M57 A;  4BI3 A;  4YCV A;  1L0W A;  2PVD B;  4H02 A;  4P73 A;  1YJW T;  1KMM A;  4X5O A;  3JB9 J;  2DIG A;  1N9S A;  4Z02 A;  5GAO r;  1H64 1;  3R6O A;  4P72 A;  2Q5I A;  5FU6 C;  4VUB A;  3KBG A;  4P3O A;  1VIE A;  3MF2 A;  1M9S A;  2DXB A;  3G71 T;  2P0K A;  3EFS A;  4JDS A;  2ZT8 A;  2F5T X;  1X6O A;  3VQW A;  3MET A;  2K3X A;  3TEH B;  1K8A U;  3CBM A;  4P75 A;  2V8K A;  4C8Q C;  2DAQ A;  4C92 G;  4J6X A;  4PKC C;  4NCX A;  3NTK A;  3OBY A;  5DY9 A;  3LSS A;  3A7R A;  2P0L A;  2XIC A;  4OB3 B;  3M54 A;  4KQE A;  5A2Q E;  1YBY A;  2MMP A;  2EJF A;  4OP0 A;  1KHC A;  2OAU A;  2RHQ A;  3CMA A;  1M1K U;  3SWN B;  3CPW A;  4YRT A;  3ERR A;  3REU A;  3HXY A;  4NS5 A;  4BY6 B;  3JCM h;  2CS7 A;  4LD9 K;  4CS4 A;  4Y91 A;  4A4E A;  3CEY A;  3GF5 A;  1KC8 U;  4FL6 A;  2K2V A;  5LJ3 h;  2P0P A;  2E1H A;  1O75 A;  3BY7 A;  4HWP A;  2A7Y A;  1Y7X A;  2WSF E;  1HK9 A;  4IUQ A;  4C92 B;  3QYG B;  1KQ1 A;  1SES A;  4C0Z A;  3L2V A;  1G5I A;  4B9W A;  3CXC S;  4ZN1 A;  2FHD A;  1ZBX A;  1I81 A;  3L2Z A;  2DXC A;  4YRK A;  2GFA A;  2E70 A;  3I7F A;  4YTL A;  1Y96 A;  5AYF A;  3OYI A;  4YRL A;  1YGB A;  3A32 A;  5CIU A;  5J26 A;  2I4M A;  3ER0 A;  2ZR2 A;  3VQX A;  3X26 B;  4M78 A;  4CH5 A;  3G4S A;  4C5H A;  3IKL A;  4XU1 A;  3M5A A;  2I4L A;  1ZHI A;  2DEQ A;  4DPG A;  3VQY A;  3V7R A;  2CYZ B;  4EMK B;  1VQ9 A;  2K5F A;  3DKM A;  2P5I A;  5HGQ A;  4X34 A;  1FWZ A;  4C0D B;  3L2W A;  3JB9 I;  3FDR A;  4ZGE B;  3OSS C;  1H4S A;  2EL9 A;  1Q86 C;  2OTJ T;  4H2V A;  4AH6 A;  4M78 C;  3JCM P;  2R5A A;  2G4C A;  3FB9 A;  4ME7 A;  2YLC A;  4F7U B;  1E22 A;  2RHX A;  4E7J A;  4M75 E;  1EVK A;  2G3R A;  3M4Y A;  4OGC A;  1VQ7 T;  2A3L A;  1WU7 A;  4HWT A;  1X75 C;  2OTJ A;  5GMK i;  1RIQ A;  1EIY B;  1GGM A;  1M1K C;  4TVW A;  3HRI A;  2DXT A;  3LH0 A;  3RIR A;  1BI0 A;  4YRJ A;  3C4S A;  1VQ9 T;  3QZ9 B;  2AMC A;  4Q5W A;  4MZP A;  3L4G B;  3QZ5 B;  3WVE B;  2DTI A;  2LCC A;  4M77 F;  2ZGW A;  3FEO A;  1BI2 A;  3EAE A;  3NTH A;  3HRT A;  2D9T A;  1MGQ A;  2CJA A;  4NOY A;  4DOW A;  5GAN j;  2CGH A;  4XTY A;  4N4H A;  4L87 A;  1QVG A;  4RQE A;  3ZFJ A;  2ZNI A;  2Q7H A;  1DJ7 B;  1UGP B;  2PVG B;  2ZZD A;  1G51 A;  1W2B S;  3JCM J;  1HXD A;  3C12 A;  3S3N A;  1BI1 A;  4WJ3 M;  4HWR A;  2DD5 A;  5GAN g;  4OVA A;  1M1F A;  3JCM g;  1D3B B;  4RCC A;  3CCR T;  3CCR A;  3HFO A;  1K8A C;  3JB9 H;  1WGS A;  3L2U A;  1BIA A;  4QQD A;  4C5E A;  4PJO C;  4C92 E;  5GAM h;  3A31 A;  3IAL A;  5ELN A;  2VYT A;  5FRO A;  1WJS A;  3CCS A;  4J15 A;  2ZT5 A;  1JJ2 S;  4JUV A;  4O5V A;  4JS4 A;  3PMI A;  3OD1 A;  5LJ5 g;  4GY5 A;  2LDM A;  2XK0 A;  4JLI A;  5GAN 4;  1YIT T;  3LWI A;  2QHU A;  3OW2 S;  3TEG A;  2WAC A;  2VC8 A;  4BDY A;  4PLL A;  5GMK l;  4RDX A;  4H2S A;  2ZPG B;  3VUZ A;  3SWN C;  4E7I A;  1X01 A;  2EQU A;  5GAN 3;  2L89 A;  5C6S A;  5F5W A;  1N8R C;  3LLR A;  3QKJ A;  4PJO E;  3FIF A;  3G71 A;  3P8Y A;  2E6Z A;  4BI4 A;  2ZIN A;  3CCL A;  2L5Q A;  2MI6 A;  4P73 C;  3L42 A;  3M4Q A;  2GCX A;  5GAO n;  1Q81 C;  1EIY A;  5GAN e;  4BI8 B;  2M1H A;  5D6W A;  2ZZF A;  3FJP A;  3M53 A;  1G3S A;  2FVU A;  3MEA A;  1LYL A;  4HT8 A;  1VQ6 T;  1C0A A;  4KR3 A;  2LQK A;  2NLU A;  2ODR C;  2LQ8 A;  5IN1 A;  1M90 U;  1QVF A;  1LOJ A;  4O2D A;  3OYE A;  3QJ6 A;  3G4S T;  3A8M B;  3OYH A;  3RKW A;  4PLI A;  3HRK A;  4FT4 A;  4F7U F;  3GIB A;  2QXF A;  2K3Y A;  3QNE A;  4TQF A;  4G85 A;  4O6J A;  3ZEH A;  1VQL A;  1JB0 E;  1R8O B;  1YB3 A;  3A5Y A;  3M4P A;  2QQS A;  4P5N A;  1U1T A;  4JRK A;  3TRE A;  4J6W A;  4LDW A;  2RJE A;  4TQD A;  3RKY A;  4C0F A;  1KOG A;  4HCB A;  3BJU A;  2E65 A;  3R07 A;  3CD6 A;  3FC3 A;  3C95 A;  3G7Z A;  4XEO A;  3CXC A;  4ELY C;  1Y96 B;  4CH3 A;  3M55 A;  2V8J A;  4BY6 C;  4HCZ A;  4A53 A;  3TCJ A;  4M7A G;  4PJO D;  3OYN A;  5LL6 S;  2DQ0 A;  2VUB A;  4QVZ A;  4N0A A;  4E7H A;  2AKW A;  3HXZ A;  1JRI A;  1Y71 A;  1NJ2 A;  4YRE A;  3RAC A;  3NEL A;  4C5G A;  3HXX A;  3E19 A;  3JCM Q;  3OYC A;  2O4X B;  1WQ7 A;  4C92 C;  3HY0 A;  3VU3 C;  2EJG A;  3KFU A;  1M8V A;  3J7A F;  1X55 A;  4E7K A;  4QW2 A;  1SRY A;  4D6W A;  3DLM A;  4MZM A;  3BFM A;  5CK9 A;  2RHY A;  3HTZ A;  3CCM A;  4FSX A;  4C92 D;  1QF6 A;  1D3B A;  1W66 A;  2JTF A;  1YCY A;  1K73 U;  3WXM B;  2QQ9 A;  4FM4 B;  2PME A;  4A4G A;  3OS1 A;  1UGQ B;  4XEM A;  2LTO A;  5C0M A;  1FX7 A;  2JNG A;  1VQ5 A;  4LDU A;  2QA4 A;  3UPU A;  2I4N A;  5FU7 C;  4C8Q G;  4OMF B;  4XQ3 A;  4HWO A;  3VV0 A;  3H8Z A;  4NL2 A;  4Q6G A;  4B9X A;  1RL2 A;  2Q7G A;  2XDD A;  1E24 A;  2EKO A;  3G6E T;  3PIP A;  2MWP A;  1X56 A;  4M7A E;  1VQN T;  3L1A A;  3PNW C;  1B70 B;  2ZR3 A;  4EX5 A;  1NE8 A;  1ADY A;  3UT1 A;  2LX9 A;  4RCB A;  3TEH A;  4BWA A;  2PUK B;  2LNV A;  3QXE B;  4BW9 A;  4OLF A;  2RJD A;  2CZ0 B;  2QI2 A;  1VQ4 T;  4LVL A;  2XD0 A;  5C52 B;  3L2R A;  3V8L A;  1VQO A;  4F7U G;  1NJ6 A;  4XTU A;  3PT9 A;  3MHX A;  4M78 F;  1VQ6 A;  4M7A A;  3PCO A;  5GAO q;  1UGS B;  4YCW A;  2WSC E;  3NEM A;  1LNX A;  3G1Z A;  4LVI A;  4ZTJ A;  2JTM A;  4BE2 A;  4DQ2 A;  4RMO A;  1YJN A;  2RHI A;  1ADJ A;  4E47 A;  1HC7 A;  3QG1 A;  4ZTF A;  3S6W A;  3A5Z A;  5KCO A;  4KUI A;  1ASY A;  4M75 B;  4YRF A;  2ZIO A;  1N9R A;  2QQR A;  1YIJ A;  1X2G A;  3CC4 T;  1YI2 A;  2XDP A;  3QPH A;  3KUF A;  4JRI A;  2F5K A;  3DLL A;  3OYD A;  1YJ9 T;  4FIB A;  3BW1 A;  5CKD A;  5GAM g;  4L59 A;  1BYM A;  3QSU A;  4MML A;  3OYF A;  5CAI A;  3IKM B;  4C92 A;  1WYD A;  4RG8 A;  3J81 E;  1YFR A;  4LDV A;  3LYI A;  3CCE T;  2RHQ B;  4Q15 A;  4IUR A;  4N4I A;  5GAN f;  2E41 A;  1WJR A;  4J8O A;  4R56 A;  3JCM d;  2ZTG A;  5A0G A;  4C0D C;  5GAO p;  4M75 G;  1YFT A;  1BBU A;  1N27 A;  1USY A;  4CS2 A;  2V8I A;  2JN0 A;  4OB1 B;  3OY9 A;  3GLX A;  1VQP T;  1BBW A;  4A4F A;  4CRI A;  3QUI A;  3MQZ A;  3EFR A;  4PG3 A;  4CI0 C;  1ZQ1 A;  4C8Q F;  1NJ1 A;  3LGL A;  3FLG A;  1VQK A;  5K1P A;  3OYA A;  5IT9 E;  1GXI E;  4J7I A;  4UP8 A;  4P72 C;  1H4V B;  3JCM e;  3E9F A;  2E10 A;  2DIQ A;  2C7I A;  3RMS A;  3HRU A;  2ZPE B;  4F7U E;  3JRZ A;  1JJ2 A;  5CR2 A;  3OYY A;  2ZNJ A;  3DB3 A;  4C8Q E;  4YRC A;  1NJ8 A;  2WSE E;  2JOY A;  3PTA A;  2C06 A;  2M9U A;  3HKS A;  2OTL T;  3OW2 A;  2DTH A;  1K73 C;  1M5Q 1;  1BI3 A;  4RMF A;  2DKG A;  1PYS A;  3A8H B;  2VXE A;  2ZPB B;  1B8A A;  1KD1 C;  1VQ8 A;  1Z7M A;  3UFG A;  4ELZ C;  3OMG A;  2O4X A;  1W2B A;  2R5M A;  2KAF A;  2HNI A;  5KE3 A;  3JCM b;  4LDX A;  5D6Y A;  2KK4 A;  3OS5 A;  4K86 A;  3UH0 A;  4E51 A;  2H3J A;  1XNI A;  4V2S A;  2AHJ B;  2QQB A;  2QDY B;  1NJI C;  1H3Z A;  2RH2 A;  1U1S A;  3JSC A;  2GQV A;  4C92 F;  3OSV A;  2LVM A;  1KMN A;  1NNH A;  1IL2 A;  4TVA B;  4JRQ A;  2ZIM A;  3URG A;  2X4X A;  3MP1 A;  5LJ5 e;  2E64 A;  4BE1 A;  1YJN T;  2RM4 A;  2HQX A;  1MHN A;  2LT1 A;  4PJO G;  3LX7 A;  2XG8 D;  4M7A C;  4P3N A;  3HFZ A;  3TUP A;  2DK3 A;  4EDU A;  5LJ3 e;  1QVF S;  2YRV A;  1FXX A;  5GAN 2;  3UGQ A;  5CO7 A;  5CCA A;  2IVW A;  4A4H A;  2ZPH B;  4UC4 A;  5GAM j;  1VQ4 A;  4LVK A;  1VQM T;  3ZBD A;  4J5Y A;  5GAN 7;  4J83 A;  3CCQ A;  1VQK T;  4P71 A;  4LNS A;  5D6X A;  4DA4 A;  2QEX T;  3LW5 E;  3VQV A;  2DQ3 A;  2AMC B;  1WJQ A;  1OYX A;  2LRQ A;  4M78 D;  3RL6 A;  3JB9 D;  3P8B B;  5GAM d;  2QHS A;  1EIF A;  2EQK A;  1JJC A;  4M78 G;  4XU0 A;  2E12 A;  1JJC B;  2VGM A;  2K4Y A;  1G3W A;  2L3R A;  2XU8 A;  4PJO B;  1WQW A;  4FU6 A;  2PUO B;  2ZZG A;  2CZ7 B;  3V7C A;  2HBP A;  1OI1 A;  3UDC A;  4R55 A;  4JLG A;  3MF1 A;  3I55 T;  2RB6 A;  1P92 A;  2J3M A;  3CMQ A;  1IZ6 A;  4BDZ A;  4M7D C;  5LJ3 g;  2LC4 A;  2ODR D;  4PL6 A;  3A74 A;  2I4O A;  2DZC A;  2KMT A;  3SB2 A;  2J3L A;  3HXU A;  4M7D D;  2CKK A;  2HD0 A;  4X9C A;  1YJ9 A;  3HFZ B;  3SD4 A;  5CKF A;  4C8Q B;  2ALY A;  4P75 C;  3ME9 A;  3CCJ A;  1EVL A;  1USY C;  3HY1 A;  4BE0 A;  4NL3 A;  3TU4 K;  5M9O A;  4HVC A;  5I2M A;  1KQ2 A;  3M9Q A;  1Q82 U;  3LWH A;  4XTW A;  3CCU T;  3DSQ A;  2DXU A;  3SDZ A;  3MEW A;  4ZGD B;  2QEX A;  1O9S A;  1RI0 A;  4JS5 A;  4M78 E;  2K5I A;  2Y4Y A;  2RHS A;  3CCQ T;  1JBM A;  1I8F A;  3HFV A;  4Y28 E;  4YRG A;  1S72 A;  3O8V A;  1VQL T;  4XTV A;  3VJP A;  2QQA A;  4M77 E;  4BD3 A;  4IKF A;  5L8R E;  5J3B A;  4ZTU B;  2E6N A;  2KY9 A;  1NZ9 A;  3QTC A;  2JVV A;  4M7D F;  1B34 A;  3P8H A;  3OYB A;  1VQN A;  2VGN A;  2X4Y A;  2NS6 A;  5GAN 5;  1H4T A;  2X35 A;  4P71 C;  3BDL A;  1KG1 A;  5FU6 B;  3P8D A;  2CJ9 A;  2XI9 A;  1K9M C;  3PGG A;  1VQ5 T;  4M77 C;  1YHQ A;  4PHC A;  4YRR A;  4C0G A;  3L4G A;  2DVE A;  4L5G A;  2EWN A;  1EQR A;  4P74 A;  4YYE A;  3MO8 A;  4H2Y A;  1I4K 1;  4M77 B;  2FL7 A;  4LDY A;  4HT4 A;  2EQJ A;  5KNN A;  3V7S A;  2EJ9 A;  2ZT6 A;  3ICA A;  2YHT A;  1SET A;  2OTL A;  2E5Q A;  4KUD K;  3CCM T;  3CCV A;  4YCU A;  3MEV A;  2GFU A;  4ZGJ B;  3HL8 A;  3QO8 A;  4F7U A;  1ASZ A;  5GAN d;  1BIB A;  4HCC A;  3PFS A;  3JCM W;  3RF1 A;  4YRM A;  2KQW A;  4UP7 A;  3I56 T;  4P3P A;  1X54 A;  2Y4X A;  1TH7 A;  2ZPF B;  2E3C A;  2RK1 A;  1WLE A;  4LVM A;  3E9I A;  1B76 A;  3A8L B;  3X24 B;  4CH6 A;  1NYR A;  5DLQ E;  4QVC A;  2QHT A;  1QE0 A;  4LVJ A;  3REX A;  4A54 A;  2QHV A;  4KR2 A;  1Z7N A;  3GNF B;  1EFW A;  5I21 A;  3CCS T;  5A0D A;  3JCM f;  4UP9 A;  3GNG A;  2DJZ A;  5LJ5 d;  4M7D A;  3E9H A;  1IRE B;  2RK2 A;  2DO3 A;  4XK8 E;  4EO4 A;  4H2X B;  4YDQ A;  3WVD B;  1KC8 C;  3RGL A;  3RES A;  3HFN A;  1LJO A;  4M75 D;  11AS A;  4BB7 A;  4M7D B;  2EYQ A;  1NPP A;  2P0Q A;  4H2X A;  5GMK e;  1WPY A;  1E1O A;  4K87 A;  4HA8 A;  3M56 A;  12AS A;  1G3Y A;  4YRN A;  4M77 G;  1M90 C;  2XDB A;  4WI1 A;  3GPL A;  1YHQ T;  1U8R A;  4EMH A;  1KQS A;  3OYJ A;  3RER A;  5FRN A;  3HP9 A;  4YPF A;  4HKE A;  3CC7 T;  2EQM A;  3QDR B;  3CPF A;  2EFI A;  2KVQ G;  3TEE A;  2M16 A;  1AHJ B;  3PZC A;  2CZ1 B;  3OYG A;  1YIJ T;  2ZCE A;  4BUG A;  4YRS A;  1N6A A;  1M4Z A;  3BDU A;  3CCL T;  4RKU E;  3JCM V;  1Q82 C;  3M58 A;  4M77 A;  1EOV A;  2R58 A;  4II1 A;  4M77 D;  5KCH A;  4IUT A;  3RKX A;  2RJF A;  3JB9 F;  2FB7 A;  4PJO A;  2CJB A;  3Q1J A;  4GLK A;  5CKE A;  3IG2 A;  5CQY A;  2P4T A;  3N5B B;  3QO5 A;  1PSE A;  1I5L A;  5GMK h;  4OB2 B;  5GAM f;  3P8T A;  5HY6 A;  3HSB A;  3OS0 A;  4A4K A;  1ATI A;  3UWN A;  3MEU A;  3MCA B;  3A8G B;  3PIO A;  2DDZ A;  4BAC A;  2ZZE A;  1V29 B;  5CKB A;  2Y90 A;  3CCJ T;  3P8V A;  3HHT B;  4H2U A;  1NJI U;  2L8D A;  4H2W A;  4J6Y A;  2ZCF B;  4MZT A;  1NYQ A;  1VQZ A;  2DU5 A;  3C94 A;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...