4XTVA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 36 (n-({[(1r,3s)-3-(6-amino-9h-purin-9-yl)cyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 95
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtvA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtvA01
3HXZA 3V7CA 4H2YA 4H2UA 4HT9A 2RM4A 4DPGA 3RL6A 3VU3C 2P0LA 3PCOB 4YRNA 4JLIA 1X54A 5GAMf 2ZXFA 2CIMA 3HXWA 2DXTA 3CMQA 2DU7A 2I4OA 1JRIA 1YGBA 4TTVA 4F7UE 1GGMA 3P8YA 4YRRA 1EOVA 4TVAB 4TQDA 4KQEA 1JBMA 4N0AA 4C8QG 5GANj 4M7AD 4C92A 2DTHA 3TEGA 4F7UA 4YRSA 4M78B 4M77D 2RHQA 4TVAA 5GAN4 2G4CA 5GAMj 1MGQA 1LOJA 4XTYA 2ARUA 4KR3A 3HFZB 4M75F 4EX5A 5GAMh 1B70B 4EMKA 1KMNA 2I4NA 2E41A 3JCMX 3UH0A 2VXEA 4M77G 4H2XA 3FB9A 3P8TA 5GMKl 5ELNA 1M5Q1 5GANe 3BFMA 1H641 2FB7A 2DKGA 1NYRA 4XQ3A 5GMKm 5LJ3h 2ZGWA 4HA8A 2EJGA 4RDXA 4L87A 4M77F 5GANh 5LJ3j 1KMMA 4MMKA 4HWPA 3TEHB 5ELOA 3A31A 2AKWA 5LJ5d 4M7AE 1G51A 4RMFA 3A74A 3M4QA 3JB9G 4LNSA 3REUA 2CJAA 3JB9D 1ADYA 4F7UG 2XGTA 3HY0A 2QHSA 3RKXA 5GAN7 3IKLA 2Q7HA 4PJOG 2QTXA 4EMGA 4P75A 4YRTA 4M7AA 4YCWA 3RGLA 3V7SA 2ZZFA 4YRJA 3VQYA 3PCOA 4PG3A 4TVWA 1E22A 4YREA 4XTXA 4CS3A 4NL3A 2ZT5A 3L4GA 2DZ9A 2Q7EA 3QO3A 4X9DA 1YFRA 2Q7GA 4P71A 4O2DA 2QHTA 1KQ2A 2HNIA 4UP9A 5KNNA 4V2SA 1B34A 4H02A 1TH7A 3SB2A 2ZNIA 2Q5HA 4UPAA 1NJ1A 1BIBA 4PJOC 3IALA 2J3MA 4YRMA 1G5HA 2EAYA 1WQ7A 3VQXA 2RHSA 3QO8A 2FYKA 5GAOp 1NJ6A 3RIRA 5GAN2 3JCMP 4CS4A 4M77B 1YCYA 5LJ5f 4M7DA 2AKWB 4C92E 4Q15A 1H4TA 5GANg 1JJCB 3HXVA 4BWAA 4C8QB 5GAN8 4J6XA 1NJ8A 1G5IA 4P72A 4CH5A 4DQ2A 2CJBA 1M8VA 5GAMd 4RCBA 3JB9H 4XTWA 2E65A 3SWNB 3JCMg 1VQZA 3VQVA 3PZCA 3BY7A 2Q5IA 4YRGA 4K88A 3A7AA 4HWOA 4C92G 2AMCB 2DU5A 1SETA 2DQ0A 4N0AC 3FIFA 4J6WA 1ATIA 4EMHA 4MMLA 3VBBA 1C0AA 4M7AF 1JJCA 4M75E 1EQRA 4ZTUB 1B8AA 4PHCA 1WNLA 4UP8A 3HY1A 2JN0A 2VC8A 4M7DF 4Q6GA 2DZCA 1YFSA 1H4QA 4M77E 4M7AB 2DTOA 2ZCEA 4M78A 3INZA 3JCMb 2PMEA 3EFSA 4J5YA 2AMCA 3P8VA 1D3BA 4YRLA 4CH3A 4P73A 2DDZA 3BDUA 4TWAA 2YHTA 3TUPA 3JCMe 3QO7A 5HGQA 2RD1A 3UGQA 1EIYA 4RCCA 3L4GB 3M4PA 4KR2A 3M4GA 2EWNA 3JCMW 1QF6A 4M77C 3HSBA 4YROA 3A7UA 2ODRD 3L2ZA 4RQFA 2E5AA 4G84A 4K87A 4XTZA 3NEMA 1WU7A 3HXXA 4WI1A 2EL9A 4C92B 4PJOE 4XTVA 3HTZA 2CGHA 2ZTGA 2ODRC 1WQWA 1E24A 5GAOr 1ASYA 3SWNC 4X5OA 2DJZA 3GIBA 1U1TA 3NENA 1B70A 4H2WA 4YCVA 3HRIA 3QHSA 4C8QF 4C8QA 1QE0A 3IG2A 4XTUA 1YB3A 4P3PA 1I4K1 5K1XA 4C92D 3V7RA 1N9WA 4F7UB 4H2XB 4C8QD 5GMKj 4M7AG 3NELA 3JCMf 3DSQA 4P3NA 3RF1A 4CH6A 2K57A 1E1OA 5LJ5e 4JRIA 5GMKe 1ADJA 3RKYA 1X56A 3R07A 3JCMc 3REXA 4YRPA 4C92C 5I21A 1USYC 1H4SA 5GAMg 2RB6A 1SESA 3JCMQ 2DXUA 3JCMd 4M78F 3G1ZA 2I2LA 1SRYA 5C53B 4E51A 4YPFA 2YLBA 2E10A 4YDQA 5LJ5g 1YFTA 1WLEA 3L1AA 4C8QE 1NJ5A 4P74A 1U1SA 3BW1A 4M7DG 1Y96A 1PYSB 2I4LA 4TQFA 5GAN6 2CJ9A 3QNEA 1N9SA 4ZIBA 2XTIA 2ZT7A 1ASZA 1D3BB 3AHUA 4NCXA 3MEYA 5GANd 1J5WA 5LJ3d 12ASA 5E3IA 2ZT6A 5GAN5 1SERA 4M75G 4J15A 3ERRA 1EIYB 2ALYB 3A32A 3RESA 5GAOm 4YRCA 1L0WA 2ZZEA 4YCUA 3JB9F 4XU0A 1WPYA 3PGGA 4H2TA 4EO4A 2RA2A 1NJ2A 3A5YA 2ALYA 3UFGA 1B7YA 3JB9J 4PJOD 4M75C 4H2VA 4M7DD 1E1TA 4CH4A 4WJ4A 3HFVA 2ARTA 5C51B 1KQ1A 1KOGA 1X2HA 4QVCA 5CAIA 4P73C 2E3CA 4XU2A 1NNHA 5GMKh 5F5WA 4YRFA 4M7DE 2ZZGA 5GAOn 4Y91A 4A53A 4P3OA 4TVYA 2ZINA 2ZR2A 4YRKA 3KFUA 4XEMA 1BBUA 3V8LA 3WQZA 3JB9I 4OP0A 3QUIA 5K1PA 1Z7MA 3V8KA 5GMKi 4P75C 1LNXA 4PJOF 3EFRA 3LSSA 3QSUA 2E1HA 4M78E 3RKWA 3I7FA 1X55A 4EMKB 2I4MA 3MF2A 3W3SA 3RERA 5GAOl 3SWNA 4P71C 1EVLA 3ICAA 4HWSA 1LJOA 4G85A 4XU1A 4PNOA 3E9IA 1HXDA 1X01A 3RACA 4C8QC 4P72C 1NYQA 1HK9A 2DVEA 4HWRA 4AH6A 1B34B 2EJFA 3JCMJ 2ZT8A 1EVKA 2ZNJA 4BW9A 3HRKA 3HFOA 3HFNA 1Y96B 1PYSA 3MF1A 2C8MA 2QHVA 1EFWA 1HTTA 1LYLA 2RHSB 4EMKC 2YLCA 1B7YB 2IY5B 2P5IA 4XU3A 1H4VB 1HC7A 3QO5A 4M78D 1B76A 5C52B 1FYFA 1BBWA 3IKMB 3A5ZA 11ASA 4HWTA 4P74C 2ZR3A 4J6YA 4M7DB 3E9HA 4M78G 4XEOA 2ZIOA 4A54A 1W66A 4WF2A 2EJ9A 1BIAA 4HVCA 4JUVA 4CS2A 3HFZA 4WJ3M 3OD1A 5LJ3f 4X9CA 4OLFA 3BJUA 3LSQA 4M77A 5DY9A 2DTIA 3NETA 4C92F 4M7AC 4NOYA 3JCMV 5LJ3e 4ZTZB 4M78C 1WYDA 1Z7NA 2ZIMA 2J3LA 1RIQA 3FJPA 4YRIA 4YP0A 4M75A 2DEQA 3A7RA 1IL2A 4NL2A 4RQEA 5GAOq 4JRKA 4YRQA 2RHQB 4M75D 3QTCA 5GAMe 4M75B 4PJOB 4QVDA 3JCMh 1X2GA 4YYEA 4UP7A 3HXYA 3TEHA 2PMFA 2E64A 1I5LA 5GAN3 4PJOA 1I8FA 3RUXA 4F7UF 5GANf 2C7IA 3V8JA 2QHUA 1N9RA 3UGTA 2ARSA 2VXFA 4H2SA 4K86A 3VQWA 5LJ5h 5LJ3g 1USYA 4M7DC 5LJ5j 4HT8A 3LC0A 2Y90A 3HXUA 2IY5A 2DQ3A 1I81A
chains in the Genus database with same CATH superfamily
3MKDA 1C0MA 3OYFA 1KC8R 2DF6A 1VQPQ 1VIFA 3RL6A 1QQJA 3LX7A 4WTOB 1AEYA 1QVFP 2CREA 2DU7A 3CMQA 2K6DA 2EQMA 2MWPA 4TTVA 1KFZA 4YRRA 1QWFA 3QJ6A 4TVAB 2H3EB 1JBMA 1UEBA 4FYXB 2DTHA 4GLKA 3TEGA 1NG2A 3NGPA 3MEWA 4F7UA 2HDAA 3DB4A 5GAN4 5L8RE 5GAMj 4XTYA 4RKUE 3S3OA 3HFZB 4KUIA 1BKBA 2K7AA 1B70B 4EMKA 3A8MB 2W10A 2I4NA 5FRNA 2CS7A 2ATCB 4BI8B 3OYAA 3P8TA 3CCEA 4Y28E 3CCMT 1IHVA 2FHDA 4IUUA 1M5Q1 1RI9A 3F70A 1CKAA 1PWTA 1KC8U 1N8RU 2RO0A 2DKGA 4XQ3A 1ZQ1A 5LJ3h 2EJGA 1X27A 5GANh 4BI4A 1HD3A 2KI7A 1VYVA 2L3QA 2DAQA 1IB8A 2L3SA 3G1JA 4AT1B 4RMFA 1AOJA 2FZKB 2F2VA 2HL3A 3J7AF 1QP3A 2PQWA 3CMEA 4F7UG 1ZUUA 3IKLA 4J9EA 2DILA 2M0OA 3RGLA 1UGVA 2X51A 4TVWA 3L2QA 4CS3A 4VUBA 1VQMT 1RAEB 2P4RA 2NWMA 4C0DC 1WHHA 3G6EQ 1VQ6A 4A4HA 3OYDA 3GOXA 2HNIA 5L23A 4V2SA 4BE0A 4UPAA 1PD1A 2DNUA 5IXBA 1YCSB 4YRMA 1VQ7A 2ROTA 3DLLA 2P4TA 1G5HA 2EAYA 5CQYA 1QP2A 2JOYA 4AFSC 3VQXA 2O2OA 1TUCA 4ME7A 2RHSA 3QO8A 3RIRA 3JCMP 1N8RC 1XNIA 1MMDA 4M7DA 1VQMQ 5GANg 1JJCB 2V1RA 3RR6A 4OMMA 2MYSA 2DA9A 2OI3A 1K76A 5GAN8 3I56Q 4J6XA 4K11A 1NJ8A 1G5IA 1PG5B 4FW2A 2XG8D 2DK3A 4XTWA 2PVGB 2KE9A 3SWNB 4J9BA 3VQVA 2Q5IA 4K88A 5DLOA 2CP6A 3CMEQ 2Y4XA 2DU5A 3OYJA 4N0AC 4MMLA 3TU4K 4N4HA 2HEQA 4PL6A 2KNBB 4DBHA 4ANJA 4FT2A 2BZYA 1UUEA 1IZ6A 1LVKA 1T0HA 2X3XD 2QQBA 3BE3A 4OB1B 2OAWA 1OU8A 4Q5WA 4Q6GA 3NMZC 1H4QA 2L3RA 2DTOA 3CCST 1OV3A 4CH3A 3CCMA 1K9AA 4TWAA 3U23A 1PM3A 1JXOA 4J9DA 1QW1A 5HGQA 3MPUB 2XDBA 3M4PA 1W6XA 2JS0A 2GBQA 1WLPB 2EBPA 2LQKA 4PJMA 1QF6A 3A7UA 2ODRD 2E6ZA 2CDTA 2DERA 4G84A 3CCVQ 4K87A 2X4XA 3NEMA 4LDUA 2NUPA 1YWPA 3HXXA 5CVIA 4C5GA 4OB0B 2AT1B 4XTVA 1ZSZA 3X26B 3J80E 2GQVA 2CGHA 3C94A 4C5HA 3S3NA 1U8RA 1B3QA 3SWNC 2ABLA 4X5OA 2FVUA 1YI2T 1H3HA 4WCIA 1XQHA 1B70A 2SEMA 1RAFB 1G8XA 3QHSA 1VYUA 3HRIA 1I4K1 1KD1R 4C92D 3CCRA 3M0PA 5GMKj 4M7AG 3NELA 1C6VX 3JCMf 3UA6A 1GBRA 4CH6A 1Z9ZA 2XDPA 4YRPA 3VS6A 2JW4A 1SESA 2JMCA 1G5VA 4E7SA 2QYZA 4FU6A 3JCMd 3G1ZA 2I2LA 4E51A 2E10A 4C0FA 1WXUA 1RAHB 2OTJQ 1D0YA 3EFOB 2KR3A 3L1AA 4AFQC 4C8QE 1Y96A 4TQFA 4CRIA 2BTTA 3SHWA 4AG2C 1N9SA 5AT1B 1VQ8Q 2LJ1A 3AHUA 2R5AA 4RG2A 2FPFA 4J9CA 1VQOQ 12ASA 2E4HA 1VQ4A 1RL2A 2QEXT 3LLRA 2L2PA 5GJVB 4JS5A 1EIYB 3A32A 3RESA 5GAOm 2W0ZA 2E3IA 2ZZEA 4YCUA 1IGUA 2CSQA 3PGGA 2V8KA 2K2MA 8AT1B 4H2TA 3VRYA 2RA2A 3PIOA 3OYHA 3UFGA 3A5ZB 5HK0A 4M7DD 1O75A 3UF4A 2FRWA 2K79A 1X2HA 5J3BA 1K0XA 2E3CA 4XU2A 1FMVA 2KVQG 1YHQA 3MCAB 1Q7YU 2EQKA 1T3LA 1QVFS 1R0CB 4M7DE 2DIQA 3VS5A 4XEMA 4UC4A 2F2WA 3M9QA 1VQKT 3QUIA 4MDXA 2QTVA 1XTDA 2LVMA 2DO3A 4FM4B 3CPFA 3LSSA 2CP3A 3I7FA 2LQWA 2DLPA 3FLGA 2JM9A 9ATCB 3E1SA 2IIMA 1WDXA 2RI2A 1BI3A 3PT9A 5GAOl 1QKXA 4HWSA 2DBMA 1LJOA 1NE8A 3OS5A 2JTMA 1X01A 3RACA 3SDZA 1OOTA 3RDVA 3OYNA 3CCEQ 4AH6A 3JCMJ 3M0RA 1EVKA 5KH6A 2C0TA 3MEVA 3QWYA 1Y96B 2EQIA 3CBMA 2C8MA 1NYGA 1TUDA 1HTTA 2PU9B 1LYLA 2EYWA 1B7YB 2P5IA 4XU3A 3I56A 2YUOA 3X25B 1D0ZA 2L89A 3A5ZA 5KYXB 11ASA 1E6HA 5EG2A 1YIJT 1KD1U 4M7DB 4M78G 3BDLA 3E9FA 4XEOA 2LNHB 2ZIOA 2KROA 1VQ7Q 4HVCA 3HRSA 1PC0A 3H9NA 3TCJA 1YI2A 1YWOA 3CCJT 4F14A 4ZTJA 1ZX6A 3I5RA 5C0MA 3OD1A 1M3CA 2P0KA 2AIRB 1M1KC 3RBBB 3QXEB 3G6EA 1VQ6T 2CZ6B 3M0QA 4LDXA 4LXCA 2D0NA 4NOYA 1F1BB 4II1A 1M1KR 4ZTZB 4M78C 2ZIMA 5IT9E 2H8HA 2K2VA 5KE3A 2WSFE 1TS9A 2RQWA 1SRLA 3VYGA 1Y7XA 2X9HA 2L0AA 3S3MA 3HXYA 1BI2A 2KT1A 3A8LB 2E64A 2QDLA 1I8FA 4ORZA 1RACB 2BKDN 3V8JA 2CSIA 3DLMA 4OMNA 3GNFB 4KBMB 3UGTA 4HKEA 4H2SA 4K86A 3SEMA 1JJ2P 1UHCA 2LJ0A 3CCUT 3RNJA 4RTVA 3UPUA 1Y07A 5C53B 3HXZA 3V7CA 2GCXA 4H2YA 3TEEA 4H2UA 1VUBA 3C0CA 4HT9A 4B9XA 4LNPA 4QT7A 1WHKA 3VU3C 5GAMf 2P0PA 1QLYA 4KGZB 1E6GA 2P0QA 3O5ZA 3M0SA 1JRIA 1TSFA 4J9HA 4TVRA 1G83A 4RTXA 4TQDA 3QYHB 4KQEA 4F17A 5FLXE 3P8BB 4M7AD 4C92A 5FROA 2LP5A 3JV3A 3EGXB 3J81E 4BDYA 1K9MR 4M78B 4AG1C 2G4CA 1MGQA 5DLQE 4B9WA 2E5QA 5GAMh 1N27A 1YITA 1Q81C 1RAGB 3CC4Q 3CCQA 1GL5A 2GTOA 4JLGA 1WHGA 3FB9A 2P84A 2DX1A 5CKFA 3EFOA 2DL7A 5FU6C 2EPDA 2J6FA 1IHWA 3BFMA 4OMFB 4X34A 2RHXA 3H6ZA 1NYRA 2KRSA 2OAUA 3MP8A 5LJ3j 2HZYA 1MUZA 1JO8A 5IAYA 2M02A 2DYBA 3A74A 4XAXB 3JB9G 3REUA 2C0IA 3JB9D 3EGUA 3VS4A 1ADYA 4BACA 1PRMC 1HSQA 2XGTA 1MV3A 3RMQA 2JZ2A 1QVGP 2RJFA 1BYMA 2Q7HA 2QTXA 4KH1B 4YCWA 2CKKA 1AZEA 3V7SA 1R0BG 3PCOA 2DEUA 4XTXA 3UATA 1W2BA 2DPPB 2BUDA 3L4GA 2Q7EA 3QO3A 3VUBA 1VQ5T 3MHXA 4X9DA 2NUPB 2MF2A 3I56T 2Q7GA 2EGAA 4CC3A 1QVPA 2QHTA 1OZ3A 2EIFA 3VS1A 4Z89A 1NBEB 4H02A 1TH7A 3SB2A 1E7OA 3KXTA 2Q5HA 4BUGA 1WHLA 1BIBA 1NJ1A 3IALA 3OBWA 1WQ7A 5IXFA 1NJ6A 5GAN2 4CS4A 4M77B 2KQWA 1Z9QA 5LJ5f 2KGTA 2AKWB 4PJJA 1GRIA 3LWHA 1H4TA 4LDYA 2EYXA 4ZNXA 3X20B 3EG9B 4C0GA 1S72Q 2GGRA 4P72A 5KCHA 1X6BA 4J9GA 1OX8A 4E7LA 4JJCA 1M8VA 3GPLA 4RCBA 4Z88A 1YJWT 1ZSGA 4XK8E 1RAIB 3D7SB 3L42A 1VQZA 3M0UA 2A7YA 4FW1A 2J6OA 2D0QB 2DQ0A 3A8HB 3VBBA 2RQRA 1C0AA 4E7HA 4B6MA 3I55Q 1EQRA 3PNWC 2EW3A 4BD3A 1B8AA 2HD0A 2Z0WA 1NJIC 1YHQT 4AMCA 4MZMA 4F16A 3HY1A 5CQXA 2VC8A 5CKHA 4M77E 4O5VA 4FT4A 2MOXA 3QWXX 2BE7D 7AT1B 2CT4A 2RMOA 3PE0A 3P8VA 3WXMB 4P73A 1UJ0A 4ZN3A 1PHTA 1X69A 1QVFA 4OMPA 3JCMe 1UGSB 3VS7A 5FWCA 2PTKA 1YJ9T 1EX4A 1UECA 1NEBA 2KBTA 4PFPA 1WA7A 2AHJB 3M4GA 5FU6B 2YDLA 1AZGB 4M77C 4FSSA 3CD6A 1WI7A 3NTHA 1YHQQ 4HXJA 2LT1A 3CC2A 1WXTA 1K1ZA 3OYIA 5KYYB 3I55T 5KYNA 4C92B 1GXIE 1AWWA 1NJIU 1WQWA 2LCLA 2ZZDA 3QBYA 2WSCE 4KT0E 1ASYA 2DJZA 3GIBA 3EH1A 4H2WA 5KYUA 2SRCA 3OYYA 2RI5A 2KT8A 5CR2A 1UFFA 1VQPT 2KAFA 2C06A 3SD4A 2QG9B 2DXCA 1VQOA 1E1OA 5LJ5e 5GMKe 2CUBA 3JCMc 1YIJA 3CCET 3X24B 4C92C 1H4SA 5GAMg 2RB6A 3M57A 3RMSA 1VQ8A 1CSKA 2X4JA 1SRYA 2F5KA 3EG0A 3EG3A 1M3BA 1WLEA 4BDZA 2L5QA 4P74A 2RHZA 2A3LA 2JTFA 1B07A 5LL6S 2XTIA 4HCZA 3OW2P 1ASZA 1M90R 3QIIA 1SHFA 5CK9A 5FRMA 2LCSA 1AWJA 4PFOA 1YJ9A 2AZSA 3URGA 5GANd 3EG1A 1W4SA 5A0GA 5KYWA 5LJ3d 5D6XA 5E3IA 1LPLA 2MK5A 3DKMA 5GAN5 1SERA 3ME9A 3OYBA 4J15A 3ERRA 2VGNA 4C5EA 3HRUA 5CIUA 1M2VB 4YRCA 2ZPIB 2YUPA 1K9MC 3H8ZA 2IG0A 3JB9F 4EO4A 1NJ2A 1JJ2S 1FMWA 2ALYA 1B7YA 4PJOD 4JJBA 1E1TA 3OS0A 1OU9A 1KQ1A 1KOGA 5IHIA 1YJNA 4QVCA 5CAIA 3PIPA 4P73C 2RF0A 3CCVA 1YJ9Q 5F5WA 4YRFA 4C0DB 2QEXQ 2ZZGA 2ZPFB 4LDWA 4P3OA 4L5GA 3KFUA 4CI0C 1BBUA 3V8LA 1SEMA 3WQZA 4OMQA 1O9SA 2R5MA 3V8KA 2OTLQ 1X75C 2J7IA 1VQ8T 2AK5A 1NZ9A 3HPWA 4PJLA 2HQXA 2ZPGB 2CZ0B 3MF2A 3CBPA 2WACA 3RERA 1UE9A 1Q82C 1EVLA 3ICAA 3HKSA 2DVJA 2O01E 1M2OA 1QKWA 1AHJB 3E9IA 4C8QC 1HK9A 3REAB 4BI3A 2CYZB 4HWRA 1B34B 1Q95G 2FL7A 5HCKA 1ZHIA 2M0YA 2HAXA 1BU1A 3TVTA 3HFOA 1NEGA 3ZEHA 2GTJA 2JNGA 4EMKC 4QQDA 5CKEA 5EC7A 2IY5B 1YN8A 3LYIA 2ESWA 3QO5A 5I22A 4ESRA 1Q86C 3CCQT 1B76A 2VASA 3CPWS 1FYFA 2HCKA 3CD6T 5C6SA 1VQMA 4IKFA 3CC2Q 3ER0A 2CP7A 1MMGA 2ZR3A 2XMFA 1OI1A 2KK4A 4A4EA 1WJSA 1Y71A 4WF2A 3CCVT 1BIAA 4KRTA 5KCOA 3H0FA 1Q86U 3N5BB 2K5LA 3WVEB 3HFZA 1K73C 4E7ZA 3UT1A 2F2XA 5LJ3f 3BJUA 3LGFA 2KRNA 4M77A 1Q82U 1VQ6Q 5DY9A 3I5SA 2DTIA 4A63B 2QA4Q 2DYIA 3QKJA 3QYGB 1KK7A 4IIOA 1M3AA 3JCMV 5LJ3e 3CQTA 3OQ5A 3CCSQ 2A08A 1BCMA 1TXQA 1WYDA 2J3LA 4A4GA 2VUBA 3FJPA 2DEQA 3PMTA 1KD1C 1IL2A 5GAOq 2DRKA 2F5TX 4JRKA 1N5ZA 2QQ9A 1M1GA 4M75D 2MIOA 1X2QA 5GAMe 2O4XB 4M75B 3PTAA 2AKKA 3JCMh 2CT3A 3C4SA 3TEHA 1OPKA 1NYFA 2FEIA 5GAN3 2RNAA 2R58A 5HY6A 4KUDK 1D0XA 3FDRA 4PKCC 4RUGA 3GLXA 8ATCB 3C12A 1ZA2B 2KSSA 1GFDA 3HP9A 1PCXA 1USYA 4M7DC 3I35A 4HT8A 3LC0A 2PUOB 3CCRT 2K3XA 2ROLA 3HXUA 2D1XA 2IVWA 3DB3A 4BE2A 4JJDA 3E19A 1VQ4T 2RM4A 4DPGA 2CH4W 1N8RR 2P0LA 2K3YA 2FG0A 2CIMA 3HXWA 5KYXA 1PKSA 1YGBA 4F7UE 2DIGA 2RK1A 2HMAA 1P92A 3EHQA 1EOVA 2PNIA 2MAMA 2ZPHB 4A4FA 4N0AA 4GLMA 5GANj 2QGGA 1BI0A 1ZUYA 3MP1A 2HKNA 3OSSC 2XD0A 1IXDA 2ARUA 5HK3A 4KR3A 2M1HA 4M75F 2MCNA 2CUDA 1GBQA 4CC7A 3OYEA 2NUZA 1VQPA 4PJNA 3E9GA 4A4KA 2VXEA 4M77G 1FX7A 2VKNA 5GMKl 2FZGB 3G4SA 3NTKA 3S6WA 2DFUA 2NYSA 1H641 2FB7A 1ABOA 2DD4A 2VVKA 1ACMB 1Y0MA 4HA8A 2QK0A 4DA4A 1Q81U 4MMKA 2KY9A 4HWPA 4LVMA 1SPKA 2PVDB 1G3YA 2AKWA 2A36A 2LX9A 3M4QA 2KXCA 3P8HA 1XJWB 1UJYA 1QCOA 4LNSA 2CJAA 2OTLA 3CCQQ 3CC4A 2NLUA 2FPEA 2QHSA 5GAN7 3KFVA 1YITQ 4EMGA 4YRTA 4P75A 4M7AA 2ZZFA 3VQYA 1VQNA 4PG3A 3ZL7C 4GBQA 2M9UA 1N6AA 4X1VA 4NL3A 2ZT5A 1IGQA 2DZ9A 1VQKA 1YFRA 2F1LA 2VGMA 1A0NB 3GBQA 4PLLA 5IHKA 1OPLA 2RJDA 4UP9A 2MMPA 1B34A 1GCQC 2AZVA 2XKOC 2K9GA 2BZ8A 2JUFA 4E7JA 2NS6A 4OVAA 4LDVA 2BE9B 4F04B 1WXBA 1UGRB 2F69A 1EFNA 4C92E 2EQUA 3CCJA 1K8AC 1G2BA 4C8QB 1G3SA 3G4ST 3E2UA 3OBYA 4DQ2A 3M5AA 2RQUA 1I07A 2HBWA 3EGXA 3WVDB 3CCLQ 2K3BA 1K73R 4QW2A 3JB9H 1EIFA 3OB9A 2E65A 1NLPC 2XIDA 4YRGA 3PZCA 3BY7A 4HWOA 4ZGDB 2VYTA 2LQ8A 2QQRA 1SETA 4PFZA 4J6WA 2EFIA 1JJCA 1M8MA 1YBYA 4M75E 4D8KA 4DEXA 1GFCA 4PHCA 1WNLA 1M1FA 1YIJQ 4UP8A 4E7IA 1NPRA 3REBB 2JN0A 3FJ5A 2DZCA 3CMAT 2XHCA 4M7AB 1D1AA 3JCMb 2PMEA 4Z02A 5M9OA 2I0NA 2AMCA 2YRDA 1D3BA 4YRLA 4ATOA 3BDUA 1D1BA 2YHTA 2LC4A 1VQ5A 3QO7A 1U3OA 3QZ9B 2KRMA 2DE0X 4L59A 3A8GB 3CXCA 4RCCA 3CC7A 2X35A 4KR2A 2EWNA 4YROA 5I2MA 1VQ9A 4RMOA 3NFCA 2CZ7B 2E5AA 4FYYB 1MNEA 1VQLQ 5A0LA 4XTZA 2HQEA 2D9TA 4WI1A 2EL9A 3VS0A 1MNDA 1E24A 5GAOr 3TSZA 1K8AU 3CC7Q 1TUGB 4PLIA 1U1TA 1U5SA 3P8DA 3JSCA 2DRMA 4C8QF 3R6OA 1VQ5Q 2JS2A 3IG2A 2O88A 3OW2S 4F7UB 4H2XB 4C8QD 4HVVA 4EIKA 3DSQA 2K57A 1K0SA 1ADJA 1X56A 1V1CA 1KHIA 3RKYA 3R07A 1PD0A 4DOWA 3REXA 2JM8A 2PZ1A 3JCMQ 3X28B 1X6OA 1ZBJA 1M27C 4M78F 4R55A 2E6NA 5LJ5g 3A8OB 5DM7R 1YFTA 4O6JA 1OZ2A 3JRZA 1NJ5A 2HBPA 2I4LA 1PYSB 5GAN6 3EAEA 2CJ9A 3QNEA 2EYYA 3OY9A 2ZT7A 1X2KA 2YRCA 1WJQA 2V1QA 4DBRA 1VQNT 3MEYA 1WX6A 3LH0A 4LD6A 3OYCA 1J5WA 3H0IA 2ZT6A 4BY6C 1VOMA 4JJNK 1Q86R 2ALYB 1L0WA 2D8HA 2DL4A 4RTUA 2ED0A 4XU0A 1WPYA 4NS5A 3A5YA 1H3ZA 4LVIA 1I5OB 1WZOA 4M75C 2EGEA 1TOVA 4WJ4A 1WIEA 1MMAA 3G71T 3MEUA 1OULA 2ARTA 2YXYA 5FWBA 1SG5A 3ULRB 5CKBA 4DEYA 1TWBA 5GMKh 1M4ZA 1VQ9Q 2DJQA 3VRZA 2D6FA 2KYBA 5GAOn 4Y91A 4A53A 1UB4A 3M56A 1S72T 1OQKA 3CCUQ 2EVRA 4CC2A 5K1PA 4AFZC 5GMKi 2OTJA 1RABB 3QSUA 1AT1B 4M78E 4MDWA 1PSFA 4EMKB 4OF1A 3G71Q 1PNJA 1ZSZC 2CP2A 1FWZA 2I4MA 1UGPB 3W3SA 3ASKA 3QG1A 2VWFA 2YUNA 4KGVB 3SWNA 1TU0B 4P71C 3CMET 2LZ6B 1NM7A 1BBZA 4XU1A 1ARKA 2QAZA 2YT6A 2X4YA 3M0TA 3CCRQ 3MJXA 1BB9A 4RTTA 1RLPC 3M4YA 4HVWA 4BB7A 3HRKA 1PYSA 3L2WA 2QHVA 1EFWA 1BK2A 2RHSB 2YLCA 4LUEA 1ZBXA 1H4VB 4M78D 5C52B 3MQZA 3CCJQ 2ED1A 1M90C 3PVLA 1VQ9T 1BBWA 1M2VA 4RTWA 5KYUB 1WGSA 2G3RA 2CH4A 3UWNA 2XICA 3E9HA 2CZ1B 1WFWA 2RPNA 2GFAA 4A54A 2JT4A 5HKCA 3LWIA 2ZCFB 4RG8A 1W66A 3L2RA 4E6RA 2EJ9A 1QVGA 2RJEA 4FIBA 3QDFA 4CS2A 3EHRA 3META 1QWEA 3FC3A 5ECAA 5J39A 4CC4B 4OLFA 4HCCA 4ELYC 2NUTA 3NETA 5CO7A 2A37A 2X4WA 1NPPA 3NTIA 4JPBW 1ZA1B 4IUQA 1HJDA 4KULA 3VJPA 3QPHA 4N4GA 2ZPBB 1FYNA 3CXCS 1Z7NA 4OMLA 1VQNQ 3CC7T 4GY5A 4YRIA 2O4XA 4M75A 3A7RA 4IURA 4RQEA 3EH2A 2XI9A 1H8KA 1W2BS 4YRQA 2LRQA 2RHQB 2RH2A 2RHYA 4PJOB 1UGQB 1X2GA 2EYQA 3FRNA 4UP7A 2ENMA 2PMFA 4PK4A 2KMTA 1I5LA 4PJOA 3GF5A 1KQSS 2DXBA 5GANf 2C7IA 4HVUA 4J9FA 4MZPA 2DL3A 2HL5C 2QHUA 2LCCA 1S72A 5I11A 2VXFA 3VQWA 5LJ5h 3OW2A 3OYMA 2QA4T 5LJ5j 2KDSA 2QDYB 2IY5A 2DQ3A 2V8JA 2XU8A 5KYWB 3CXCP 1I0CA 4YRNA 3PCOB 3LW5E 4JLIA 2OX7A 1X54A 4OB3B 2ZXFA 2DMOA 2DXTA 2I4OA 2KYMA 1W2BP 2LX7A 1GGMA 1UTIA 3P8YA 4Y92A 2COWA 1K73U 2PVOB 4C8QG 4ELZC 3PMIA 2WSEE 3QJYA 3CC2T 4YRSA 1KHCA 4C5IA 4M77D 2RHQA 2A8EA 4TVAA 1KJWA 2XDDA 3OS2A 2EKOA 1D1CA 1LOJA 1S1NA 2YSQA 1KQSA 4BY6B 3CCLT 4EX5A 2BZXA 1KMNA 1BI1A 2CP0A 2AKLA 4KGXB 2E41A 2QI2A 3JCMX 3UH0A 1RADB 4LVKA 3NHNA 4H2XA 5ELNA 2YRVA 1WJRA 3TREA 4ZGEB 1RLQC 5GANe 2YWWA 2QXFA 4DBFA 2KEAA 1MHNA 2LNVA 2MWOA 1OYXA 2LJ3A 5GMKm 2ZGWA 4RDXA 4L87A 4M77F 2RI3A 3KBGA 1KMMA 3M55A 3TEHB 5ELOA 3HL8A 3A31A 5LJ5d 4M7AE 1G51A 1EZZB 1FMKA 3HY0A 1JB0E 3RKXA 4HCBA 1X43A 4PJOG 3ZBDA 1W1FA 1T0JA 4YRJA 4FYVB 1M30A 4RTYA 3Q1JA 4JRPA 1E22A 3CCSA 2GNCA 2JJ9A 4YREA 1BCOA 4JZ3A 4LE9A 2H3JA 3UA7A 1KQSP 1PRLC 4FL6A 2B8AA 1YJNQ 4P71A 2QQAA 2COZA 4O2DA 1KQ2A 2RN8A 4N4IA 2DETA 3EG9A 4P5NA 5KNNA 4ZTFA 1YNZA 1G3TA 2EKHA 2ZNIA 4JRQA 2A0FB 1SKUB 4PJOC 2J3MA 5A0DA 3MO8A 4J7FA 1FXXA 4L6V5 1RAAB 2RQVA 1R77A 2FYKA 1ZSZB 1KC8C 5CCAA 5GAOp 4DBQA 1K8AR 1YCYA 1J3TA 3M58A 4C0ZA 1M9SA 3GNGA 4JDSA 2JMAA 2L3PA 4OGEA 4R56A 4Q15A 4E47A 5GJWB 1VQKQ 3TQ7P 3HXVA 2L8DA 4BWAA 2EQJA 4IIMA 4FYWB 4MZTA 1QCFA 4CH5A 2CJBA 2O9SA 1X6GA 5GAMd 4OGCA 1D09B 3OYGA 3JCMg 1H92A 1ABQA 2OTJT 4J8OA 3A7AA 3SFMA 4C92G 3AT1B 2AMCB 3VS3A 1WYXA 1JXMA 3FIFA 1ATIA 2DL8A 4EMHA 1Q81R 3G7ZA 4M7AF 3THKA 1MMNA 4ZTUB 2LT4A 5KE2A 3PFSA 1MV0B 1AD5A 4JZ4A 4M7DF 3C95A 1YFSA 3G71A 4OB2B 1KIKA 2E70A 3UDCA 5D6YA 1Y57A 2C0OA 2ZCEA 4M78A 5FU7B 3INZA 2XK0A 2DBKA 3EFSA 4J5YA 2DDZA 3TUPA 4IUTA 1YI2Q 2VB6A 4YTLA 5IN1A 3HTRA 2RD1A 3UGQA 1XOVA 1EIYA 3CCUA 1UHFA 1U06A 3NPFA 1V29B 3L4GB 3JCMW 1IREB 2QEXA 3HSBA 3OYKA 3L2ZA 1JU5C 4Z8AA 4RQFA 1GCPA 4LN2A 2X3WD 2LDMA 4QVZA 3M53A 1WU7A 1QMCA 1C1AA 4E2FB 3HRTA 3GP8A 3FEOA 4PJOE 1WHMA 2QASA 3HTZA 5FU7C 3PVQA 2ZTGA 2ODRC 3LGLA 1AWOA 1NLOC 2VV5A 1V76A 3CMAA 1ZLMA 3NENA 3CPWA 4YCVA 2MPXC 2RK2A 4C8QA 1SF9A 3G6ET 1QE0A 1IRXA 3EGDB 1W70A 3I9QA 2LTOA 4XTUA 1TTHB 1YB3A 4P3PA 5K1XA 3M54A 3V7RA 1N9WA 4LD9K 1Q7YC 1YITT 4BE1A 4P3NA 2OJ2A 3RF1A 1I1JA 4JRIA 2M51A 2O31A 4RTZA 5I21A 1USYC 3JAME 4HCKA 2EGCA 3ZFJA 2DXUA 4YPFA 2YLBA 1Q82R 4YDQA 1VIEA 3CEYA 2M16A 1TG0A 3OA6A 1U1SA 1ZUKA 3BW1A 4J9IA 1NJIR 4M7DG 2JXBA 4LUDA 1YJNT 1PSEA 4ZIBA 2G6FX 2RQTA 3VKIA 1D3BB 1YJWQ 1AVZC 2LQNA 1DJ7B 1QVGS 5D6WA 2IPOB 4NCXA 1JEGA 2QA4A 1G3WA 1KG1A 2HQHA 5CKDA 2QQSA 3OYLA 4M75G 3CPWP 4FCYA 1T3SA 2GF7A 3EG2A 5I2SA 4QKUA 2DL5A 2J06A 1IO6A 3IQLA 3JB9J 2K5IA 3T9NA 4H2VA 4CH4A 3HFVA 3MEAA 1K4US 5C51B 1VQ4Q 1RI0A 2NUTB 3CBOA 1YFNA 2K4YA 3KUFA 4KH0B 1VQLA 1B7TA 2QGFB 3OS1A 4FSXA 3CC4T 1NNHA 1OX9A 2JTEA 3CD6Q 2DD5A 2A28A 3OSVA 1YJWA 1SHGA 4TVYA 2JVVA 2ZINA 2ZR2A 4YRKA 1HYOA 1SSFA 2O9VA 3H41A 1UG1A 2EYZA 3JB9I 4J83A 4OP0A 1VA7A 1Z7MA 3VYHB 4P75C 1LNXA 4IUPA 4PJOF 3EFRA 5FW9A 1M1KU 1CKBA 4EDUA 2HSPA 3OMGA 2E1HA 3QZ5B 5D7UA 3RKWA 1X55A 1R8OB 3MP6A 3H0HA 2R57A 2FPDA 3VV0A 1SRMA 4AFUC 3L2VA 1VQ7T 2GQIA 2J6KA 2MI6A 3M59A 4EPCA 1OEBA 2B86A 4G85A 4PNOA 1HXDA 3I55A 2FRYA 4P72C 1NYQA 4QQ6A 2DVEA 2Y4YA 2E12A 2EJFA 3VS2A 4DOVA 6AT1B 2ZT8A 2ZNJA 4BW9A 3TSWA 2OTLT 3HFNA 3MF1A 2DM1A 3CCLA 3CMAQ 5J26A 4HT4A 4D8DA 1LCKA 3L2UA 1HC7A 1JQQA 2CP5A 4ZGJB 4QQGA 3VUZA 3IKMB 2YUQA 4E7KA 4HWTA 4P74C 4J6YA 3A1PA 2ECZA 1UDLA 3O8VA 1VQLT 4ZN1A 4JUVA 1K9MU 2BIVA 2J05A 1RUWA 2KXDA 2HKQB 4WJ3M 2E5KA 2RHIA 2E3HA 3CCMQ 4X9CA 3OMCA 4J7IA 1QCNA 3LSQA 4R0KA 2D8JA 4C92F 1VYTA 4M7AC 1KSWA 1JJ2A 2RHUA 2V8IA 3R6NA 4LVLA 1RIQA 3HHTB 4YP0A 1SSHA 2K5FA 4NL2A 1M90U 5AYFA 1Q7YR 2FO0A 2RJCA 3LH5A 2FZCB 5IH2A 2HSEB 3EGDA 3QTCA 4QVDA 4OMOA 4YYEA 1GCQA 4D6WA 2PUKB 2V26A 4M4ZA 1WHJA 3RUXA 4F7UF 4LVJA 4IUVA 1N9RA 2ZPEB 5IHNA 3A98A 2ARSA 5A2QE 1YP5A 4JS4A 5KYYA 3QDRB 2ZAEA 5LJ3g 3G4SQ 2LMJA 1AWXA 1VQOT 2GFUA 2Y90A 1PKTA 2COYA 1I81A
chains in the Genus database with same CATH topology
3OYFA 1VIFA 3RL6A 3LX7A 3CMQA 2DU7A 2EQMA 2MWPA 4TTVA 4YRRA 3QJ6A 4TVAB 1JBMA 1UEBA 2DTHA 4GLKA 3TEGA 3MEWA 4F7UA 3DB4A 5GAN4 5L8RE 5GAMj 4XTYA 4RKUE 3S3OA 3HFZB 4KUIA 1BKBA 1B70B 4EMKA 3A8MB 2I4NA 5FRNA 2CS7A 4BI8B 3OYAA 3P8TA 3CCEA 4Y28E 3CCMT 2FHDA 4IUUA 1M5Q1 3F70A 1KC8U 1N8RU 2RO0A 2DKGA 4XQ3A 1ZQ1A 5LJ3h 2EJGA 5GANh 4BI4A 2DAQA 4RMFA 3J7AF 1QP3A 2PQWA 3CMEA 4F7UG 3IKLA 2M0OA 3RGLA 4TVWA 3L2QA 4CS3A 4VUBA 1VQMT 4C0DC 1VQ6A 4A4HA 3OYDA 3GOXA 2HNIA 4V2SA 4BE0A 4UPAA 4YRMA 1VQ7A 3DLLA 2P4TA 1G5HA 2EAYA 5CQYA 1QP2A 2JOYA 3VQXA 4ME7A 2RHSA 3QO8A 3RIRA 3JCMP 1N8RC 1XNIA 4M7DA 5GANg 1JJCB 5GAN8 4J6XA 1NJ8A 1G5IA 2XG8D 2DK3A 4XTWA 2PVGB 3SWNB 3VQVA 2Q5IA 4K88A 5DLOA 2Y4XA 2DU5A 3OYJA 4N0AC 4MMLA 3TU4K 4N4HA 4PL6A 4FT2A 1IZ6A 2QQBA 4OB1B 4Q5WA 4Q6GA 1H4QA 2L3RA 2DTOA 3CCST 4CH3A 3CCMA 4TWAA 1QW1A 5HGQA 2XDBA 3M4PA 1QF6A 2LQKA 3A7UA 2ODRD 2E6ZA 4G84A 4K87A 2X4XA 3NEMA 4LDUA 3HXXA 5CVIA 4C5GA 4OB0B 4XTVA 3X26B 3J80E 2GQVA 2CGHA 3C94A 4C5HA 3S3NA 1U8RA 3SWNC 4X5OA 2FVUA 1YI2T 1XQHA 1B70A 3HRIA 3QHSA 1I4K1 4C92D 3CCRA 4M7AG 5GMKj 3NELA 3JCMf 4CH6A 2XDPA 4YRPA 1SESA 1G5VA 3JCMd 4FU6A 3G1ZA 2I2LA 4E51A 2E10A 4C0FA 3L1AA 4C8QE 1Y96A 4TQFA 4CRIA 1N9SA 3AHUA 2R5AA 4RG2A 12ASA 1VQ4A 1RL2A 2QEXT 3LLRA 4JS5A 1EIYB 3A32A 3RESA 5GAOm 2ZZEA 4YCUA 3PGGA 2V8KA 4H2TA 2RA2A 3PIOA 3OYHA 3UFGA 3A5ZB 5HK0A 4M7DD 1O75A 1X2HA 5J3BA 2E3CA 4XU2A 2KVQG 1YHQA 3MCAB 1Q7YU 2EQKA 1QVFS 4M7DE 2DIQA 4XEMA 4UC4A 3M9QA 1VQKT 3QUIA 4MDXA 1XTDA 2LVMA 2DO3A 4FM4B 3CPFA 3LSSA 3I7FA 3FLGA 3E1SA 2RI2A 1BI3A 3PT9A 5GAOl 4HWSA 1LJOA 1NE8A 3OS5A 2JTMA 1X01A 3RACA 3SDZA 3OYNA 4AH6A 3JCMJ 1EVKA 5KH6A 3MEVA 1Y96B 3CBMA 2C8MA 1HTTA 2PU9B 1LYLA 1B7YB 2P5IA 4XU3A 3I56A 3X25B 2L89A 3A5ZA 11ASA 5EG2A 1YIJT 1KD1U 4M7DB 4M78G 3BDLA 3E9FA 4XEOA 2ZIOA 4HVCA 3HRSA 3TCJA 1YI2A 3CCJT 4ZTJA 5C0MA 3OD1A 2P0KA 1M1KC 3QXEB 3G6EA 1VQ6T 2CZ6B 4LDXA 4NOYA 4II1A 4ZTZB 4M78C 2ZIMA 5IT9E 2K2VA 5KE3A 2WSFE 3VYGA 1Y7XA 3S3MA 3HXYA 1BI2A 3A8LB 2E64A 1I8FA 2BKDN 3V8JA 3DLMA 3GNFB 4KBMB 3UGTA 4HKEA 4H2SA 4K86A 3CCUT 3UPUA 1Y07A 5C53B 3HXZA 3V7CA 2GCXA 4H2YA 3TEEA 4H2UA 1VUBA 4HT9A 4B9XA 3VU3C 5GAMf 2P0PA 2P0QA 1JRIA 4TVRA 4TQDA 3QYHB 4KQEA 5FLXE 3P8BB 4M7AD 4C92A 5FROA 3J81E 4BDYA 4M78B 2G4CA 1MGQA 5DLQE 4B9WA 2E5QA 5GAMh 1N27A 1YITA 1Q81C 3CCQA 4JLGA 3FB9A 5CKFA 5FU6C 3BFMA 4OMFB 4X34A 2RHXA 3H6ZA 1NYRA 2OAUA 3MP8A 5LJ3j 5IAYA 3A74A 4XAXB 3JB9G 3REUA 3JB9D 1ADYA 4BACA 2XGTA 3RMQA 2JZ2A 2RJFA 1BYMA 2Q7HA 2QTXA 4YCWA 2CKKA 3V7SA 3PCOA 4XTXA 1W2BA 2DPPB 2BUDA 3L4GA 2Q7EA 3QO3A 3VUBA 1VQ5T 3MHXA 4X9DA 2MF2A 3I56T 2Q7GA 1QVPA 2QHTA 1OZ3A 2EIFA 4H02A 1TH7A 3SB2A 3KXTA 2Q5HA 4BUGA 1BIBA 1NJ1A 3IALA 3OBWA 1WQ7A 1NJ6A 5GAN2 4CS4A 4M77B 2KQWA 5LJ5f 2AKWB 1H4TA 3LWHA 4LDYA 3X20B 4C0GA 4P72A 5KCHA 4E7LA 1M8VA 3GPLA 4RCBA 1YJWT 4XK8E 3L42A 1VQZA 2A7YA 2D0QB 2DQ0A 3A8HB 3VBBA 1C0AA 4E7HA 1EQRA 3PNWC 4BD3A 1B8AA 2HD0A 1NJIC 1YHQT 4MZMA 3HY1A 2VC8A 5CQXA 5CKHA 4M77E 4O5VA 4FT4A 3P8VA 3WXMB 4P73A 4ZN3A 1QVFA 3JCMe 1UGSB 1YJ9T 2AHJB 3M4GA 5FU6B 4M77C 3CD6A 3NTHA 2LT1A 3CC2A 3OYIA 3I55T 4C92B 1GXIE 1NJIU 1WQWA 2LCLA 2ZZDA 3QBYA 2WSCE 4KT0E 1ASYA 2DJZA 3GIBA 4H2WA 3OYYA 2RI5A 5CR2A 1VQPT 2KAFA 2C06A 3SD4A 2DXCA 1VQOA 1E1OA 5LJ5e 5GMKe 3JCMc 1YIJA 3CCET 3X24B 4C92C 1H4SA 5GAMg 2RB6A 3M57A 3RMSA 1VQ8A 2X4JA 1SRYA 2F5KA 1WLEA 4BDZA 2L5QA 4P74A 2RHZA 2A3LA 2JTFA 5LL6S 2XTIA 4HCZA 1ASZA 3QIIA 5CK9A 5FRMA 1YJ9A 3URGA 5GANd 1W4SA 5A0GA 5E3IA 5LJ3d 5D6XA 3DKMA 5GAN5 1SERA 3ME9A 3OYBA 4J15A 3ERRA 2VGNA 4C5EA 3HRUA 5CIUA 4YRCA 2ZPIB 1K9MC 3H8ZA 2IG0A 3JB9F 4EO4A 1NJ2A 1JJ2S 2ALYA 1B7YA 4PJOD 1E1TA 3OS0A 1KQ1A 1KOGA 1YJNA 4QVCA 5CAIA 3PIPA 4P73C 3CCVA 5F5WA 4YRFA 4C0DB 2ZZGA 2ZPFB 4LDWA 4P3OA 4L5GA 3KFUA 4CI0C 1BBUA 3V8LA 3WQZA 1O9SA 2R5MA 3V8KA 1X75C 1VQ8T 1NZ9A 3HPWA 2HQXA 2ZPGB 2CZ0B 3MF2A 3CBPA 2WACA 3RERA 1Q82C 1EVLA 3ICAA 3HKSA 2O01E 1AHJB 3E9IA 4C8QC 1HK9A 4BI3A 2CYZB 4HWRA 1B34B 2FL7A 1ZHIA 2HAXA 3HFOA 3ZEHA 2JNGA 4EMKC 4QQDA 5CKEA 2IY5B 3LYIA 3QO5A 1Q86C 3CCQT 1B76A 3CPWS 1FYFA 3CD6T 5C6SA 1VQMA 4IKFA 3ER0A 2ZR3A 1OI1A 2KK4A 4A4EA 1WJSA 1Y71A 4WF2A 3CCVT 1BIAA 5KCOA 1Q86U 3N5BB 2K5LA 3WVEB 3HFZA 1K73C 3UT1A 5LJ3f 3BJUA 3LGFA 4M77A 1Q82U 5DY9A 2DTIA 3QKJA 3QYGB 5LJ3e 3JCMV 3OQ5A 1WYDA 2J3LA 4A4GA 2VUBA 3FJPA 2DEQA 3PMTA 1KD1C 1IL2A 5GAOq 2F5TX 4JRKA 2QQ9A 1M1GA 4M75D 5GAMe 2O4XB 4M75B 3PTAA 3JCMh 3C4SA 3TEHA 5GAN3 2R58A 5HY6A 4KUDK 4PKCC 3FDRA 3GLXA 3C12A 2KSSA 3HP9A 1USYA 4M7DC 3LC0A 4HT8A 2PUOB 3CCRT 2K3XA 3HXUA 2IVWA 3DB3A 4BE2A 3E19A 1VQ4T 2RM4A 4DPGA 2P0LA 2K3YA 2CIMA 3HXWA 1YGBA 4F7UE 2DIGA 2RK1A 1P92A 1EOVA 2MAMA 2ZPHB 4A4FA 4N0AA 5GANj 1BI0A 3MP1A 3OSSC 2XD0A 2ARUA 5HK3A 4KR3A 2M1HA 4M75F 3OYEA 1VQPA 3E9GA 4A4KA 2VXEA 4M77G 1FX7A 5GMKl 3G4SA 3NTKA 3S6WA 1H641 2FB7A 2DD4A 4HA8A 4DA4A 1Q81U 4MMKA 2KY9A 4HWPA 4LVMA 2PVDB 1G3YA 2AKWA 2LX9A 3M4QA 3P8HA 4LNSA 2CJAA 2OTLA 3CC4A 2NLUA 2QHSA 5GAN7 4EMGA 4YRTA 4P75A 4M7AA 2ZZFA 3VQYA 1VQNA 4PG3A 2M9UA 1N6AA 4NL3A 2ZT5A 2DZ9A 1VQKA 1YFRA 2VGMA 4PLLA 4UP9A 2RJDA 2MMPA 1B34A 2XKOC 2JUFA 4E7JA 2NS6A 4OVAA 4LDVA 1UGRB 2F69A 4C92E 2EQUA 3CCJA 1K8AC 4C8QB 1G3SA 3G4ST 3OBYA 4DQ2A 3M5AA 3WVDB 3JB9H 4QW2A 1EIFA 3OB9A 2E65A 2XIDA 4YRGA 3PZCA 3BY7A 4HWOA 4ZGDB 2VYTA 2LQ8A 2QQRA 1SETA 4J6WA 2EFIA 1JJCA 1YBYA 4M75E 4PHCA 1WNLA 1M1FA 4UP8A 4E7IA 1NPRA 2JN0A 2DZCA 3CMAT 2XHCA 4M7AB 3JCMb 2PMEA 4Z02A 5M9OA 2AMCA 1D3BA 4YRLA 4ATOA 3BDUA 2YHTA 2LC4A 1VQ5A 3QO7A 3QZ9B 4L59A 3A8GB 3CXCA 4RCCA 3CC7A 2X35A 4KR2A 2EWNA 4YROA 5I2MA 1VQ9A 4RMOA 3NFCA 2CZ7B 2E5AA 5A0LA 4XTZA 2HQEA 2D9TA 4WI1A 2EL9A 1E24A 5GAOr 1K8AU 4PLIA 1U1TA 3P8DA 3JSCA 4C8QF 3R6OA 3IG2A 3OW2S 4F7UB 4H2XB 4C8QD 3DSQA 2K57A 1ADJA 1X56A 3RKYA 1KHIA 3R07A 4DOWA 3REXA 3JCMQ 3X28B 1X6OA 4M78F 4R55A 2E6NA 5LJ5g 3A8OB 5DM7R 1YFTA 4O6JA 1OZ2A 3JRZA 1NJ5A 2HBPA 2I4LA 1PYSB 5GAN6 3EAEA 2CJ9A 3QNEA 3OY9A 2ZT7A 1WJQA 1VQNT 3MEYA 3LH0A 4LD6A 3OYCA 1J5WA 2ZT6A 4BY6C 4JJNK 2ALYB 1L0WA 4XU0A 1WPYA 4NS5A 3A5YA 1H3ZA 4LVIA 4M75C 4WJ4A 3G71T 3MEUA 2ARTA 5CKBA 5GMKh 1M4ZA 2D6FA 5GAOn 4Y91A 4A53A 1UB4A 3M56A 1S72T 5K1PA 5GMKi 2OTJA 3QSUA 4M78E 4MDWA 1PSFA 4EMKB 4OF1A 2I4MA 1FWZA 1UGPB 3W3SA 3ASKA 3QG1A 3SWNA 4P71C 3CMET 4XU1A 2X4YA 3M4YA 4BB7A 3HRKA 1PYSA 3L2WA 2QHVA 1EFWA 2RHSB 2YLCA 1ZBXA 1H4VB 4M78D 5C52B 3MQZA 1M90C 1BBWA 1VQ9T 1WGSA 2G3RA 3UWNA 2XICA 3E9HA 2CZ1B 2GFAA 4A54A 5HKCA 1W66A 3LWIA 2ZCFB 4RG8A 3L2RA 2EJ9A 1QVGA 2RJEA 4FIBA 4CS2A 3META 3FC3A 5J39A 4OLFA 4HCCA 4ELYC 3NETA 5CO7A 2X4WA 1NPPA 3NTIA 4IUQA 4KULA 3VJPA 3QPHA 4N4GA 2ZPBB 3CXCS 1Z7NA 3CC7T 4GY5A 4YRIA 2O4XA 4M75A 3A7RA 4IURA 4RQEA 2XI9A 1W2BS 4YRQA 2LRQA 2RHQB 2RH2A 2RHYA 4PJOB 1UGQB 1X2GA 2EYQA 3FRNA 4UP7A 2PMFA 2KMTA 1I5LA 4PJOA 3GF5A 1KQSS 2DXBA 5GANf 2C7IA 4MZPA 2QHUA 2LCCA 1S72A 2VXFA 3VQWA 5LJ5h 3OW2A 3OYMA 2QA4T 5LJ5j 2KDSA 2QDYB 2IY5A 2DQ3A 2V8JA 2XU8A 4YRNA 3PCOB 3LW5E 4JLIA 1X54A 4OB3B 2ZXFA 2DXTA 2I4OA 1GGMA 3P8YA 1K73U 2PVOB 4C8QG 4ELZC 3PMIA 2WSEE 3QJYA 3CC2T 4YRSA 1KHCA 4C5IA 4M77D 2RHQA 2A8EA 4TVAA 2XDDA 3OS2A 2EKOA 1LOJA 1KQSA 4BY6B 3CCLT 4EX5A 1KMNA 1BI1A 2E41A 2QI2A 3JCMX 3UH0A 4LVKA 4H2XA 5ELNA 2YRVA 1WJRA 3TREA 4ZGEB 5GANe 2QXFA 1MHNA 2LNVA 2MWOA 1OYXA 5GMKm 2ZGWA 4RDXA 4L87A 4M77F 2RI3A 3KBGA 1KMMA 3M55A 3TEHB 5ELOA 3HL8A 3A31A 5LJ5d 4M7AE 1G51A 3HY0A 1JB0E 3RKXA 4HCBA 4PJOG 3ZBDA 4YRJA 3Q1JA 4JRPA 1E22A 3CCSA 4YREA 2H3JA 4FL6A 2B8AA 4P71A 2QQAA 4O2DA 1KQ2A 4N4IA 5KNNA 4P5NA 4ZTFA 1G3TA 2ZNIA 4JRQA 4PJOC 2J3MA 5A0DA 3MO8A 4J7FA 1FXXA 4L6V5 2FYKA 1KC8C 5CCAA 5GAOp 1YCYA 3M58A 4C0ZA 1M9SA 3GNGA 4JDSA 4R56A 4OGEA 4Q15A 4E47A 3HXVA 2L8DA 4BWAA 2EQJA 4MZTA 4CH5A 2CJBA 5GAMd 4OGCA 3OYGA 3JCMg 2OTJT 4J8OA 3A7AA 3SFMA 4C92G 2AMCB 3FIFA 1ATIA 4EMHA 3G7ZA 4M7AF 4ZTUB 2LT4A 5KE2A 3PFSA 4M7DF 3C95A 1YFSA 3G71A 4OB2B 2E70A 3UDCA 5D6YA 2ZCEA 4M78A 3INZA 5FU7B 2XK0A 3EFSA 4J5YA 2DDZA 3TUPA 4IUTA 4YTLA 5IN1A 2RD1A 3UGQA 1XOVA 1EIYA 3CCUA 3L4GB 1V29B 3JCMW 1IREB 2QEXA 3HSBA 3OYKA 3L2ZA 4RQFA 2LDMA 4QVZA 3M53A 1WU7A 3HRTA 3GP8A 3FEOA 4PJOE 3HTZA 5FU7C 2ZTGA 2ODRC 3LGLA 2VV5A 3CMAA 3NENA 3CPWA 4YCVA 2RK2A 4C8QA 3G6ET 1QE0A 2LTOA 4XTUA 1YB3A 4P3PA 5K1XA 3M54A 3V7RA 1N9WA 4LD9K 1Q7YC 1YITT 4BE1A 4P3NA 3RF1A 4JRIA 5I21A 1USYC 3JAME 3ZFJA 2DXUA 4YPFA 2YLBA 4YDQA 1VIEA 3CEYA 2M16A 3OA6A 1U1SA 3BW1A 4M7DG 1YJNT 1PSEA 4ZIBA 3VKIA 1D3BB 1DJ7B 1QVGS 5D6WA 4NCXA 2QA4A 1G3WA 1KG1A 5CKDA 2QQSA 3OYLA 4M75G 2GF7A 5I2SA 3JB9J 2K5IA 3T9NA 4H2VA 4CH4A 3HFVA 3MEAA 5C51B 1RI0A 3CBOA 2K4YA 3KUFA 1VQLA 3OS1A 3CC4T 4FSXA 1NNHA 2DD5A 3OSVA 1YJWA 4TVYA 2JVVA 2ZINA 2ZR2A 4YRKA 1SSFA 3JB9I 4J83A 4OP0A 1Z7MA 3VYHB 4P75C 1LNXA 4IUPA 4PJOF 3EFRA 1M1KU 4EDUA 3OMGA 2E1HA 3QZ5B 3RKWA 1X55A 1R8OB 3MP6A 2R57A 3VV0A 3L2VA 1VQ7T 4EPCA 2MI6A 3M59A 4G85A 4PNOA 1HXDA 3I55A 4P72C 1NYQA 4QQ6A 2DVEA 2Y4YA 2E12A 2EJFA 4DOVA 2ZT8A 2ZNJA 4BW9A 2OTLT 3HFNA 3MF1A 3CCLA 5J26A 4HT4A 3L2UA 1HC7A 4ZGJB 4QQGA 3VUZA 3IKMB 4E7KA 4HWTA 4P74C 4J6YA 3O8VA 1VQLT 4ZN1A 4JUVA 1K9MU 2BIVA 4WJ3M 2RHIA 4X9CA 3OMCA 4J7IA 3LSQA 4C92F 4M7AC 1JJ2A 2RHUA 2V8IA 4LVLA 1RIQA 3HHTB 4YP0A 2K5FA 4NL2A 1M90U 5AYFA 2RJCA 3QTCA 4QVDA 4YYEA 4D6WA 2PUKB 3RUXA 4F7UF 4LVJA 4IUVA 1N9RA 2ZPEB 2ARSA 5A2QE 4JS4A 3QDRB 5LJ3g 1VQOT 2GFUA 2Y90A 1I81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXZ A;  3V7C A;  4H2Y A;  4H2U A;  4HT9 A;  2RM4 A;  4DPG A;  3RL6 A;  3VU3 C;  2P0L A;  3PCO B;  4YRN A;  4JLI A;  1X54 A;  5GAM f;  2ZXF A;  2CIM A;  3HXW A;  2DXT A;  3CMQ A;  2DU7 A;  2I4O A;  1JRI A;  1YGB A;  4TTV A;  4F7U E;  1GGM A;  3P8Y A;  4YRR A;  1EOV A;  4TVA B;  4TQD A;  4KQE A;  1JBM A;  4N0A A;  4C8Q G;  5GAN j;  4M7A D;  4C92 A;  2DTH A;  3TEG A;  4F7U A;  4YRS A;  4M78 B;  4M77 D;  2RHQ A;  4TVA A;  5GAN 4;  2G4C A;  5GAM j;  1MGQ A;  1LOJ A;  4XTY A;  2ARU A;  4KR3 A;  3HFZ B;  4M75 F;  4EX5 A;  5GAM h;  1B70 B;  4EMK A;  1KMN A;  2I4N A;  2E41 A;  3JCM X;  3UH0 A;  2VXE A;  4M77 G;  4H2X A;  3FB9 A;  3P8T A;  5GMK l;  5ELN A;  1M5Q 1;  5GAN e;  3BFM A;  1H64 1;  2FB7 A;  2DKG A;  1NYR A;  4XQ3 A;  5GMK m;  5LJ3 h;  2ZGW A;  4HA8 A;  2EJG A;  4RDX A;  4L87 A;  4M77 F;  5GAN h;  5LJ3 j;  1KMM A;  4MMK A;  4HWP A;  3TEH B;  5ELO A;  3A31 A;  2AKW A;  5LJ5 d;  4M7A E;  1G51 A;  4RMF A;  3A74 A;  3M4Q A;  3JB9 G;  4LNS A;  3REU A;  2CJA A;  3JB9 D;  1ADY A;  4F7U G;  2XGT A;  3HY0 A;  2QHS A;  3RKX A;  5GAN 7;  3IKL A;  2Q7H A;  4PJO G;  2QTX A;  4EMG A;  4P75 A;  4YRT A;  4M7A A;  4YCW A;  3RGL A;  3V7S A;  2ZZF A;  4YRJ A;  3VQY A;  3PCO A;  4PG3 A;  4TVW A;  1E22 A;  4YRE A;  4XTX A;  4CS3 A;  4NL3 A;  2ZT5 A;  3L4G A;  2DZ9 A;  2Q7E A;  3QO3 A;  4X9D A;  1YFR A;  2Q7G A;  4P71 A;  4O2D A;  2QHT A;  1KQ2 A;  2HNI A;  4UP9 A;  5KNN A;  4V2S A;  1B34 A;  4H02 A;  1TH7 A;  3SB2 A;  2ZNI A;  2Q5H A;  4UPA A;  1NJ1 A;  1BIB A;  4PJO C;  3IAL A;  2J3M A;  4YRM A;  1G5H A;  2EAY A;  1WQ7 A;  3VQX A;  2RHS A;  3QO8 A;  2FYK A;  5GAO p;  1NJ6 A;  3RIR A;  5GAN 2;  3JCM P;  4CS4 A;  4M77 B;  1YCY A;  5LJ5 f;  4M7D A;  2AKW B;  4C92 E;  4Q15 A;  1H4T A;  5GAN g;  1JJC B;  3HXV A;  4BWA A;  4C8Q B;  5GAN 8;  4J6X A;  1NJ8 A;  1G5I A;  4P72 A;  4CH5 A;  4DQ2 A;  2CJB A;  1M8V A;  5GAM d;  4RCB A;  3JB9 H;  4XTW A;  2E65 A;  3SWN B;  3JCM g;  1VQZ A;  3VQV A;  3PZC A;  3BY7 A;  2Q5I A;  4YRG A;  4K88 A;  3A7A A;  4HWO A;  4C92 G;  2AMC B;  2DU5 A;  1SET A;  2DQ0 A;  4N0A C;  3FIF A;  4J6W A;  1ATI A;  4EMH A;  4MML A;  3VBB A;  1C0A A;  4M7A F;  1JJC A;  4M75 E;  1EQR A;  4ZTU B;  1B8A A;  4PHC A;  1WNL A;  4UP8 A;  3HY1 A;  2JN0 A;  2VC8 A;  4M7D F;  4Q6G A;  2DZC A;  1YFS A;  1H4Q A;  4M77 E;  4M7A B;  2DTO A;  2ZCE A;  4M78 A;  3INZ A;  3JCM b;  2PME A;  3EFS A;  4J5Y A;  2AMC A;  3P8V A;  1D3B A;  4YRL A;  4CH3 A;  4P73 A;  2DDZ A;  3BDU A;  4TWA A;  2YHT A;  3TUP A;  3JCM e;  3QO7 A;  5HGQ A;  2RD1 A;  3UGQ A;  1EIY A;  4RCC A;  3L4G B;  3M4P A;  4KR2 A;  3M4G A;  2EWN A;  3JCM W;  1QF6 A;  4M77 C;  3HSB A;  4YRO A;  3A7U A;  2ODR D;  3L2Z A;  4RQF A;  2E5A A;  4G84 A;  4K87 A;  4XTZ A;  3NEM A;  1WU7 A;  3HXX A;  4WI1 A;  2EL9 A;  4C92 B;  4PJO E;  4XTV A;  3HTZ A;  2CGH A;  2ZTG A;  2ODR C;  1WQW A;  1E24 A;  5GAO r;  1ASY A;  3SWN C;  4X5O A;  2DJZ A;  3GIB A;  1U1T A;  3NEN A;  1B70 A;  4H2W A;  4YCV A;  3HRI A;  3QHS A;  4C8Q F;  4C8Q A;  1QE0 A;  3IG2 A;  4XTU A;  1YB3 A;  4P3P A;  1I4K 1;  5K1X A;  4C92 D;  3V7R A;  1N9W A;  4F7U B;  4H2X B;  4C8Q D;  5GMK j;  4M7A G;  3NEL A;  3JCM f;  3DSQ A;  4P3N A;  3RF1 A;  4CH6 A;  2K57 A;  1E1O A;  5LJ5 e;  4JRI A;  5GMK e;  1ADJ A;  3RKY A;  1X56 A;  3R07 A;  3JCM c;  3REX A;  4YRP A;  4C92 C;  5I21 A;  1USY C;  1H4S A;  5GAM g;  2RB6 A;  1SES A;  3JCM Q;  2DXU A;  3JCM d;  4M78 F;  3G1Z A;  2I2L A;  1SRY A;  5C53 B;  4E51 A;  4YPF A;  2YLB A;  2E10 A;  4YDQ A;  5LJ5 g;  1YFT A;  1WLE A;  3L1A A;  4C8Q E;  1NJ5 A;  4P74 A;  1U1S A;  3BW1 A;  4M7D G;  1Y96 A;  1PYS B;  2I4L A;  4TQF A;  5GAN 6;  2CJ9 A;  3QNE A;  1N9S A;  4ZIB A;  2XTI A;  2ZT7 A;  1ASZ A;  1D3B B;  3AHU A;  4NCX A;  3MEY A;  5GAN d;  1J5W A;  5LJ3 d;  12AS A;  5E3I A;  2ZT6 A;  5GAN 5;  1SER A;  4M75 G;  4J15 A;  3ERR A;  1EIY B;  2ALY B;  3A32 A;  3RES A;  5GAO m;  4YRC A;  1L0W A;  2ZZE A;  4YCU A;  3JB9 F;  4XU0 A;  1WPY A;  3PGG A;  4H2T A;  4EO4 A;  2RA2 A;  1NJ2 A;  3A5Y A;  2ALY A;  3UFG A;  1B7Y A;  3JB9 J;  4PJO D;  4M75 C;  4H2V A;  4M7D D;  1E1T A;  4CH4 A;  4WJ4 A;  3HFV A;  2ART A;  5C51 B;  1KQ1 A;  1KOG A;  1X2H A;  4QVC A;  5CAI A;  4P73 C;  2E3C A;  4XU2 A;  1NNH A;  5GMK h;  5F5W A;  4YRF A;  4M7D E;  2ZZG A;  5GAO n;  4Y91 A;  4A53 A;  4P3O A;  4TVY A;  2ZIN A;  2ZR2 A;  4YRK A;  3KFU A;  4XEM A;  1BBU A;  3V8L A;  3WQZ A;  3JB9 I;  4OP0 A;  3QUI A;  5K1P A;  1Z7M A;  3V8K A;  5GMK i;  4P75 C;  1LNX A;  4PJO F;  3EFR A;  3LSS A;  3QSU A;  2E1H A;  4M78 E;  3RKW A;  3I7F A;  1X55 A;  4EMK B;  2I4M A;  3MF2 A;  3W3S A;  3RER A;  5GAO l;  3SWN A;  4P71 C;  1EVL A;  3ICA A;  4HWS A;  1LJO A;  4G85 A;  4XU1 A;  4PNO A;  3E9I A;  1HXD A;  1X01 A;  3RAC A;  4C8Q C;  4P72 C;  1NYQ A;  1HK9 A;  2DVE A;  4HWR A;  4AH6 A;  1B34 B;  2EJF A;  3JCM J;  2ZT8 A;  1EVK A;  2ZNJ A;  4BW9 A;  3HRK A;  3HFO A;  3HFN A;  1Y96 B;  1PYS A;  3MF1 A;  2C8M A;  2QHV A;  1EFW A;  1HTT A;  1LYL A;  2RHS B;  4EMK C;  2YLC A;  1B7Y B;  2IY5 B;  2P5I A;  4XU3 A;  1H4V B;  1HC7 A;  3QO5 A;  4M78 D;  1B76 A;  5C52 B;  1FYF A;  1BBW A;  3IKM B;  3A5Z A;  11AS A;  4HWT A;  4P74 C;  2ZR3 A;  4J6Y A;  4M7D B;  3E9H A;  4M78 G;  4XEO A;  2ZIO A;  4A54 A;  1W66 A;  4WF2 A;  2EJ9 A;  1BIA A;  4HVC A;  4JUV A;  4CS2 A;  3HFZ A;  4WJ3 M;  3OD1 A;  5LJ3 f;  4X9C A;  4OLF A;  3BJU A;  3LSQ A;  4M77 A;  5DY9 A;  2DTI A;  3NET A;  4C92 F;  4M7A C;  4NOY A;  3JCM V;  5LJ3 e;  4ZTZ B;  4M78 C;  1WYD A;  1Z7N A;  2ZIM A;  2J3L A;  1RIQ A;  3FJP A;  4YRI A;  4YP0 A;  4M75 A;  2DEQ A;  3A7R A;  1IL2 A;  4NL2 A;  4RQE A;  5GAO q;  4JRK A;  4YRQ A;  2RHQ B;  4M75 D;  3QTC A;  5GAM e;  4M75 B;  4PJO B;  4QVD A;  3JCM h;  1X2G A;  4YYE A;  4UP7 A;  3HXY A;  3TEH A;  2PMF A;  2E64 A;  1I5L A;  5GAN 3;  4PJO A;  1I8F A;  3RUX A;  4F7U F;  5GAN f;  2C7I A;  3V8J A;  2QHU A;  1N9R A;  3UGT A;  2ARS A;  2VXF A;  4H2S A;  4K86 A;  3VQW A;  5LJ5 h;  5LJ3 g;  1USY A;  4M7D C;  5LJ5 j;  4HT8 A;  3LC0 A;  2Y90 A;  3HXU A;  2IY5 A;  2DQ3 A;  1I81 A; 
#chains in the Genus database with same CATH topology
 3MKD A;  1C0M A;  3OYF A;  1KC8 R;  2DF6 A;  1VQP Q;  1VIF A;  3RL6 A;  1QQJ A;  3LX7 A;  4WTO B;  1AEY A;  1QVF P;  2CRE A;  2DU7 A;  3CMQ A;  2K6D A;  2EQM A;  2MWP A;  4TTV A;  1KFZ A;  4YRR A;  1QWF A;  3QJ6 A;  4TVA B;  2H3E B;  1JBM A;  1UEB A;  4FYX B;  2DTH A;  4GLK A;  3TEG A;  1NG2 A;  3NGP A;  3MEW A;  4F7U A;  2HDA A;  3DB4 A;  5GAN 4;  5L8R E;  5GAM j;  4XTY A;  4RKU E;  3S3O A;  3HFZ B;  4KUI A;  1BKB A;  2K7A A;  1B70 B;  4EMK A;  3A8M B;  2W10 A;  2I4N A;  5FRN A;  2CS7 A;  2ATC B;  4BI8 B;  3OYA A;  3P8T A;  3CCE A;  4Y28 E;  3CCM T;  1IHV A;  2FHD A;  4IUU A;  1M5Q 1;  1RI9 A;  3F70 A;  1CKA A;  1PWT A;  1KC8 U;  1N8R U;  2RO0 A;  2DKG A;  4XQ3 A;  1ZQ1 A;  5LJ3 h;  2EJG A;  1X27 A;  5GAN h;  4BI4 A;  1HD3 A;  2KI7 A;  1VYV A;  2L3Q A;  2DAQ A;  1IB8 A;  2L3S A;  3G1J A;  4AT1 B;  4RMF A;  1AOJ A;  2FZK B;  2F2V A;  2HL3 A;  3J7A F;  1QP3 A;  2PQW A;  3CME A;  4F7U G;  1ZUU A;  3IKL A;  4J9E A;  2DIL A;  2M0O A;  3RGL A;  1UGV A;  2X51 A;  4TVW A;  3L2Q A;  4CS3 A;  4VUB A;  1VQM T;  1RAE B;  2P4R A;  2NWM A;  4C0D C;  1WHH A;  3G6E Q;  1VQ6 A;  4A4H A;  3OYD A;  3GOX A;  2HNI A;  5L23 A;  4V2S A;  4BE0 A;  4UPA A;  1PD1 A;  2DNU A;  5IXB A;  1YCS B;  4YRM A;  1VQ7 A;  2ROT A;  3DLL A;  2P4T A;  1G5H A;  2EAY A;  5CQY A;  1QP2 A;  2JOY A;  4AFS C;  3VQX A;  2O2O A;  1TUC A;  4ME7 A;  2RHS A;  3QO8 A;  3RIR A;  3JCM P;  1N8R C;  1XNI A;  1MMD A;  4M7D A;  1VQM Q;  5GAN g;  1JJC B;  2V1R A;  3RR6 A;  4OMM A;  2MYS A;  2DA9 A;  2OI3 A;  1K76 A;  5GAN 8;  3I56 Q;  4J6X A;  4K11 A;  1NJ8 A;  1G5I A;  1PG5 B;  4FW2 A;  2XG8 D;  2DK3 A;  4XTW A;  2PVG B;  2KE9 A;  3SWN B;  4J9B A;  3VQV A;  2Q5I A;  4K88 A;  5DLO A;  2CP6 A;  3CME Q;  2Y4X A;  2DU5 A;  3OYJ A;  4N0A C;  4MML A;  3TU4 K;  4N4H A;  2HEQ A;  4PL6 A;  2KNB B;  4DBH A;  4ANJ A;  4FT2 A;  2BZY A;  1UUE A;  1IZ6 A;  1LVK A;  1T0H A;  2X3X D;  2QQB A;  3BE3 A;  4OB1 B;  2OAW A;  1OU8 A;  4Q5W A;  4Q6G A;  3NMZ C;  1H4Q A;  2L3R A;  2DTO A;  3CCS T;  1OV3 A;  4CH3 A;  3CCM A;  1K9A A;  4TWA A;  3U23 A;  1PM3 A;  1JXO A;  4J9D A;  1QW1 A;  5HGQ A;  3MPU B;  2XDB A;  3M4P A;  1W6X A;  2JS0 A;  2GBQ A;  1WLP B;  2EBP A;  2LQK A;  4PJM A;  1QF6 A;  3A7U A;  2ODR D;  2E6Z A;  2CDT A;  2DER A;  4G84 A;  3CCV Q;  4K87 A;  2X4X A;  3NEM A;  4LDU A;  2NUP A;  1YWP A;  3HXX A;  5CVI A;  4C5G A;  4OB0 B;  2AT1 B;  4XTV A;  1ZSZ A;  3X26 B;  3J80 E;  2GQV A;  2CGH A;  3C94 A;  4C5H A;  3S3N A;  1U8R A;  1B3Q A;  3SWN C;  2ABL A;  4X5O A;  2FVU A;  1YI2 T;  1H3H A;  4WCI A;  1XQH A;  1B70 A;  2SEM A;  1RAF B;  1G8X A;  3QHS A;  1VYU A;  3HRI A;  1I4K 1;  1KD1 R;  4C92 D;  3CCR A;  3M0P A;  5GMK j;  4M7A G;  3NEL A;  1C6V X;  3JCM f;  3UA6 A;  1GBR A;  4CH6 A;  1Z9Z A;  2XDP A;  4YRP A;  3VS6 A;  2JW4 A;  1SES A;  2JMC A;  1G5V A;  4E7S A;  2QYZ A;  4FU6 A;  3JCM d;  3G1Z A;  2I2L A;  4E51 A;  2E10 A;  4C0F A;  1WXU A;  1RAH B;  2OTJ Q;  1D0Y A;  3EFO B;  2KR3 A;  3L1A A;  4AFQ C;  4C8Q E;  1Y96 A;  4TQF A;  4CRI A;  2BTT A;  3SHW A;  4AG2 C;  1N9S A;  5AT1 B;  1VQ8 Q;  2LJ1 A;  3AHU A;  2R5A A;  4RG2 A;  2FPF A;  4J9C A;  1VQO Q;  12AS A;  2E4H A;  1VQ4 A;  1RL2 A;  2QEX T;  3LLR A;  2L2P A;  5GJV B;  4JS5 A;  1EIY B;  3A32 A;  3RES A;  5GAO m;  2W0Z A;  2E3I A;  2ZZE A;  4YCU A;  1IGU A;  2CSQ A;  3PGG A;  2V8K A;  2K2M A;  8AT1 B;  4H2T A;  3VRY A;  2RA2 A;  3PIO A;  3OYH A;  3UFG A;  3A5Z B;  5HK0 A;  4M7D D;  1O75 A;  3UF4 A;  2FRW A;  2K79 A;  1X2H A;  5J3B A;  1K0X A;  2E3C A;  4XU2 A;  1FMV A;  2KVQ G;  1YHQ A;  3MCA B;  1Q7Y U;  2EQK A;  1T3L A;  1QVF S;  1R0C B;  4M7D E;  2DIQ A;  3VS5 A;  4XEM A;  4UC4 A;  2F2W A;  3M9Q A;  1VQK T;  3QUI A;  4MDX A;  2QTV A;  1XTD A;  2LVM A;  2DO3 A;  4FM4 B;  3CPF A;  3LSS A;  2CP3 A;  3I7F A;  2LQW A;  2DLP A;  3FLG A;  2JM9 A;  9ATC B;  3E1S A;  2IIM A;  1WDX A;  2RI2 A;  1BI3 A;  3PT9 A;  5GAO l;  1QKX A;  4HWS A;  2DBM A;  1LJO A;  1NE8 A;  3OS5 A;  2JTM A;  1X01 A;  3RAC A;  3SDZ A;  1OOT A;  3RDV A;  3OYN A;  3CCE Q;  4AH6 A;  3JCM J;  3M0R A;  1EVK A;  5KH6 A;  2C0T A;  3MEV A;  3QWY A;  1Y96 B;  2EQI A;  3CBM A;  2C8M A;  1NYG A;  1TUD A;  1HTT A;  2PU9 B;  1LYL A;  2EYW A;  1B7Y B;  2P5I A;  4XU3 A;  3I56 A;  2YUO A;  3X25 B;  1D0Z A;  2L89 A;  3A5Z A;  5KYX B;  11AS A;  1E6H A;  5EG2 A;  1YIJ T;  1KD1 U;  4M7D B;  4M78 G;  3BDL A;  3E9F A;  4XEO A;  2LNH B;  2ZIO A;  2KRO A;  1VQ7 Q;  4HVC A;  3HRS A;  1PC0 A;  3H9N A;  3TCJ A;  1YI2 A;  1YWO A;  3CCJ T;  4F14 A;  4ZTJ A;  1ZX6 A;  3I5R A;  5C0M A;  3OD1 A;  1M3C A;  2P0K A;  2AIR B;  1M1K C;  3RBB B;  3QXE B;  3G6E A;  1VQ6 T;  2CZ6 B;  3M0Q A;  4LDX A;  4LXC A;  2D0N A;  4NOY A;  1F1B B;  4II1 A;  1M1K R;  4ZTZ B;  4M78 C;  2ZIM A;  5IT9 E;  2H8H A;  2K2V A;  5KE3 A;  2WSF E;  1TS9 A;  2RQW A;  1SRL A;  3VYG A;  1Y7X A;  2X9H A;  2L0A A;  3S3M A;  3HXY A;  1BI2 A;  2KT1 A;  3A8L B;  2E64 A;  2QDL A;  1I8F A;  4ORZ A;  1RAC B;  2BKD N;  3V8J A;  2CSI A;  3DLM A;  4OMN A;  3GNF B;  4KBM B;  3UGT A;  4HKE A;  4H2S A;  4K86 A;  3SEM A;  1JJ2 P;  1UHC A;  2LJ0 A;  3CCU T;  3RNJ A;  4RTV A;  3UPU A;  1Y07 A;  5C53 B;  3HXZ A;  3V7C A;  2GCX A;  4H2Y A;  3TEE A;  4H2U A;  1VUB A;  3C0C A;  4HT9 A;  4B9X A;  4LNP A;  4QT7 A;  1WHK A;  3VU3 C;  5GAM f;  2P0P A;  1QLY A;  4KGZ B;  1E6G A;  2P0Q A;  3O5Z A;  3M0S A;  1JRI A;  1TSF A;  4J9H A;  4TVR A;  1G83 A;  4RTX A;  4TQD A;  3QYH B;  4KQE A;  4F17 A;  5FLX E;  3P8B B;  4M7A D;  4C92 A;  5FRO A;  2LP5 A;  3JV3 A;  3EGX B;  3J81 E;  4BDY A;  1K9M R;  4M78 B;  4AG1 C;  2G4C A;  1MGQ A;  5DLQ E;  4B9W A;  2E5Q A;  5GAM h;  1N27 A;  1YIT A;  1Q81 C;  1RAG B;  3CC4 Q;  3CCQ A;  1GL5 A;  2GTO A;  4JLG A;  1WHG A;  3FB9 A;  2P84 A;  2DX1 A;  5CKF A;  3EFO A;  2DL7 A;  5FU6 C;  2EPD A;  2J6F A;  1IHW A;  3BFM A;  4OMF B;  4X34 A;  2RHX A;  3H6Z A;  1NYR A;  2KRS A;  2OAU A;  3MP8 A;  5LJ3 j;  2HZY A;  1MUZ A;  1JO8 A;  5IAY A;  2M02 A;  2DYB A;  3A74 A;  4XAX B;  3JB9 G;  3REU A;  2C0I A;  3JB9 D;  3EGU A;  3VS4 A;  1ADY A;  4BAC A;  1PRM C;  1HSQ A;  2XGT A;  1MV3 A;  3RMQ A;  2JZ2 A;  1QVG P;  2RJF A;  1BYM A;  2Q7H A;  2QTX A;  4KH1 B;  4YCW A;  2CKK A;  1AZE A;  3V7S A;  1R0B G;  3PCO A;  2DEU A;  4XTX A;  3UAT A;  1W2B A;  2DPP B;  2BUD A;  3L4G A;  2Q7E A;  3QO3 A;  3VUB A;  1VQ5 T;  3MHX A;  4X9D A;  2NUP B;  2MF2 A;  3I56 T;  2Q7G A;  2EGA A;  4CC3 A;  1QVP A;  2QHT A;  1OZ3 A;  2EIF A;  3VS1 A;  4Z89 A;  1NBE B;  4H02 A;  1TH7 A;  3SB2 A;  1E7O A;  3KXT A;  2Q5H A;  4BUG A;  1WHL A;  1BIB A;  1NJ1 A;  3IAL A;  3OBW A;  1WQ7 A;  5IXF A;  1NJ6 A;  5GAN 2;  4CS4 A;  4M77 B;  2KQW A;  1Z9Q A;  5LJ5 f;  2KGT A;  2AKW B;  4PJJ A;  1GRI A;  3LWH A;  1H4T A;  4LDY A;  2EYX A;  4ZNX A;  3X20 B;  3EG9 B;  4C0G A;  1S72 Q;  2GGR A;  4P72 A;  5KCH A;  1X6B A;  4J9G A;  1OX8 A;  4E7L A;  4JJC A;  1M8V A;  3GPL A;  4RCB A;  4Z88 A;  1YJW T;  1ZSG A;  4XK8 E;  1RAI B;  3D7S B;  3L42 A;  1VQZ A;  3M0U A;  2A7Y A;  4FW1 A;  2J6O A;  2D0Q B;  2DQ0 A;  3A8H B;  3VBB A;  2RQR A;  1C0A A;  4E7H A;  4B6M A;  3I55 Q;  1EQR A;  3PNW C;  2EW3 A;  4BD3 A;  1B8A A;  2HD0 A;  2Z0W A;  1NJI C;  1YHQ T;  4AMC A;  4MZM A;  4F16 A;  3HY1 A;  5CQX A;  2VC8 A;  5CKH A;  4M77 E;  4O5V A;  4FT4 A;  2MOX A;  3QWX X;  2BE7 D;  7AT1 B;  2CT4 A;  2RMO A;  3PE0 A;  3P8V A;  3WXM B;  4P73 A;  1UJ0 A;  4ZN3 A;  1PHT A;  1X69 A;  1QVF A;  4OMP A;  3JCM e;  1UGS B;  3VS7 A;  5FWC A;  2PTK A;  1YJ9 T;  1EX4 A;  1UEC A;  1NEB A;  2KBT A;  4PFP A;  1WA7 A;  2AHJ B;  3M4G A;  5FU6 B;  2YDL A;  1AZG B;  4M77 C;  4FSS A;  3CD6 A;  1WI7 A;  3NTH A;  1YHQ Q;  4HXJ A;  2LT1 A;  3CC2 A;  1WXT A;  1K1Z A;  3OYI A;  5KYY B;  3I55 T;  5KYN A;  4C92 B;  1GXI E;  1AWW A;  1NJI U;  1WQW A;  2LCL A;  2ZZD A;  3QBY A;  2WSC E;  4KT0 E;  1ASY A;  2DJZ A;  3GIB A;  3EH1 A;  4H2W A;  5KYU A;  2SRC A;  3OYY A;  2RI5 A;  2KT8 A;  5CR2 A;  1UFF A;  1VQP T;  2KAF A;  2C06 A;  3SD4 A;  2QG9 B;  2DXC A;  1VQO A;  1E1O A;  5LJ5 e;  5GMK e;  2CUB A;  3JCM c;  1YIJ A;  3CCE T;  3X24 B;  4C92 C;  1H4S A;  5GAM g;  2RB6 A;  3M57 A;  3RMS A;  1VQ8 A;  1CSK A;  2X4J A;  1SRY A;  2F5K A;  3EG0 A;  3EG3 A;  1M3B A;  1WLE A;  4BDZ A;  2L5Q A;  4P74 A;  2RHZ A;  2A3L A;  2JTF A;  1B07 A;  5LL6 S;  2XTI A;  4HCZ A;  3OW2 P;  1ASZ A;  1M90 R;  3QII A;  1SHF A;  5CK9 A;  5FRM A;  2LCS A;  1AWJ A;  4PFO A;  1YJ9 A;  2AZS A;  3URG A;  5GAN d;  3EG1 A;  1W4S A;  5A0G A;  5KYW A;  5LJ3 d;  5D6X A;  5E3I A;  1LPL A;  2MK5 A;  3DKM A;  5GAN 5;  1SER A;  3ME9 A;  3OYB A;  4J15 A;  3ERR A;  2VGN A;  4C5E A;  3HRU A;  5CIU A;  1M2V B;  4YRC A;  2ZPI B;  2YUP A;  1K9M C;  3H8Z A;  2IG0 A;  3JB9 F;  4EO4 A;  1NJ2 A;  1JJ2 S;  1FMW A;  2ALY A;  1B7Y A;  4PJO D;  4JJB A;  1E1T A;  3OS0 A;  1OU9 A;  1KQ1 A;  1KOG A;  5IHI A;  1YJN A;  4QVC A;  5CAI A;  3PIP A;  4P73 C;  2RF0 A;  3CCV A;  1YJ9 Q;  5F5W A;  4YRF A;  4C0D B;  2QEX Q;  2ZZG A;  2ZPF B;  4LDW A;  4P3O A;  4L5G A;  3KFU A;  4CI0 C;  1BBU A;  3V8L A;  1SEM A;  3WQZ A;  4OMQ A;  1O9S A;  2R5M A;  3V8K A;  2OTL Q;  1X75 C;  2J7I A;  1VQ8 T;  2AK5 A;  1NZ9 A;  3HPW A;  4PJL A;  2HQX A;  2ZPG B;  2CZ0 B;  3MF2 A;  3CBP A;  2WAC A;  3RER A;  1UE9 A;  1Q82 C;  1EVL A;  3ICA A;  3HKS A;  2DVJ A;  2O01 E;  1M2O A;  1QKW A;  1AHJ B;  3E9I A;  4C8Q C;  1HK9 A;  3REA B;  4BI3 A;  2CYZ B;  4HWR A;  1B34 B;  1Q95 G;  2FL7 A;  5HCK A;  1ZHI A;  2M0Y A;  2HAX A;  1BU1 A;  3TVT A;  3HFO A;  1NEG A;  3ZEH A;  2GTJ A;  2JNG A;  4EMK C;  4QQD A;  5CKE A;  5EC7 A;  2IY5 B;  1YN8 A;  3LYI A;  2ESW A;  3QO5 A;  5I22 A;  4ESR A;  1Q86 C;  3CCQ T;  1B76 A;  2VAS A;  3CPW S;  1FYF A;  2HCK A;  3CD6 T;  5C6S A;  1VQM A;  4IKF A;  3CC2 Q;  3ER0 A;  2CP7 A;  1MMG A;  2ZR3 A;  2XMF A;  1OI1 A;  2KK4 A;  4A4E A;  1WJS A;  1Y71 A;  4WF2 A;  3CCV T;  1BIA A;  4KRT A;  5KCO A;  3H0F A;  1Q86 U;  3N5B B;  2K5L A;  3WVE B;  3HFZ A;  1K73 C;  4E7Z A;  3UT1 A;  2F2X A;  5LJ3 f;  3BJU A;  3LGF A;  2KRN A;  4M77 A;  1Q82 U;  1VQ6 Q;  5DY9 A;  3I5S A;  2DTI A;  4A63 B;  2QA4 Q;  2DYI A;  3QKJ A;  3QYG B;  1KK7 A;  4IIO A;  1M3A A;  3JCM V;  5LJ3 e;  3CQT A;  3OQ5 A;  3CCS Q;  2A08 A;  1BCM A;  1TXQ A;  1WYD A;  2J3L A;  4A4G A;  2VUB A;  3FJP A;  2DEQ A;  3PMT A;  1KD1 C;  1IL2 A;  5GAO q;  2DRK A;  2F5T X;  4JRK A;  1N5Z A;  2QQ9 A;  1M1G A;  4M75 D;  2MIO A;  1X2Q A;  5GAM e;  2O4X B;  4M75 B;  3PTA A;  2AKK A;  3JCM h;  2CT3 A;  3C4S A;  3TEH A;  1OPK A;  1NYF A;  2FEI A;  5GAN 3;  2RNA A;  2R58 A;  5HY6 A;  4KUD K;  1D0X A;  3FDR A;  4PKC C;  4RUG A;  3GLX A;  8ATC B;  3C12 A;  1ZA2 B;  2KSS A;  1GFD A;  3HP9 A;  1PCX A;  1USY A;  4M7D C;  3I35 A;  4HT8 A;  3LC0 A;  2PUO B;  3CCR T;  2K3X A;  2ROL A;  3HXU A;  2D1X A;  2IVW A;  3DB3 A;  4BE2 A;  4JJD A;  3E19 A;  1VQ4 T;  2RM4 A;  4DPG A;  2CH4 W;  1N8R R;  2P0L A;  2K3Y A;  2FG0 A;  2CIM A;  3HXW A;  5KYX A;  1PKS A;  1YGB A;  4F7U E;  2DIG A;  2RK1 A;  2HMA A;  1P92 A;  3EHQ A;  1EOV A;  2PNI A;  2MAM A;  2ZPH B;  4A4F A;  4N0A A;  4GLM A;  5GAN j;  2QGG A;  1BI0 A;  1ZUY A;  3MP1 A;  2HKN A;  3OSS C;  2XD0 A;  1IXD A;  2ARU A;  5HK3 A;  4KR3 A;  2M1H A;  4M75 F;  2MCN A;  2CUD A;  1GBQ A;  4CC7 A;  3OYE A;  2NUZ A;  1VQP A;  4PJN A;  3E9G A;  4A4K A;  2VXE A;  4M77 G;  1FX7 A;  2VKN A;  5GMK l;  2FZG B;  3G4S A;  3NTK A;  3S6W A;  2DFU A;  2NYS A;  1H64 1;  2FB7 A;  1ABO A;  2DD4 A;  2VVK A;  1ACM B;  1Y0M A;  4HA8 A;  2QK0 A;  4DA4 A;  1Q81 U;  4MMK A;  2KY9 A;  4HWP A;  4LVM A;  1SPK A;  2PVD B;  1G3Y A;  2AKW A;  2A36 A;  2LX9 A;  3M4Q A;  2KXC A;  3P8H A;  1XJW B;  1UJY A;  1QCO A;  4LNS A;  2CJA A;  2OTL A;  3CCQ Q;  3CC4 A;  2NLU A;  2FPE A;  2QHS A;  5GAN 7;  3KFV A;  1YIT Q;  4EMG A;  4YRT A;  4P75 A;  4M7A A;  2ZZF A;  3VQY A;  1VQN A;  4PG3 A;  3ZL7 C;  4GBQ A;  2M9U A;  1N6A A;  4X1V A;  4NL3 A;  2ZT5 A;  1IGQ A;  2DZ9 A;  1VQK A;  1YFR A;  2F1L A;  2VGM A;  1A0N B;  3GBQ A;  4PLL A;  5IHK A;  1OPL A;  2RJD A;  4UP9 A;  2MMP A;  1B34 A;  1GCQ C;  2AZV A;  2XKO C;  2K9G A;  2BZ8 A;  2JUF A;  4E7J A;  2NS6 A;  4OVA A;  4LDV A;  2BE9 B;  4F04 B;  1WXB A;  1UGR B;  2F69 A;  1EFN A;  4C92 E;  2EQU A;  3CCJ A;  1K8A C;  1G2B A;  4C8Q B;  1G3S A;  3G4S T;  3E2U A;  3OBY A;  4DQ2 A;  3M5A A;  2RQU A;  1I07 A;  2HBW A;  3EGX A;  3WVD B;  3CCL Q;  2K3B A;  1K73 R;  4QW2 A;  3JB9 H;  1EIF A;  3OB9 A;  2E65 A;  1NLP C;  2XID A;  4YRG A;  3PZC A;  3BY7 A;  4HWO A;  4ZGD B;  2VYT A;  2LQ8 A;  2QQR A;  1SET A;  4PFZ A;  4J6W A;  2EFI A;  1JJC A;  1M8M A;  1YBY A;  4M75 E;  4D8K A;  4DEX A;  1GFC A;  4PHC A;  1WNL A;  1M1F A;  1YIJ Q;  4UP8 A;  4E7I A;  1NPR A;  3REB B;  2JN0 A;  3FJ5 A;  2DZC A;  3CMA T;  2XHC A;  4M7A B;  1D1A A;  3JCM b;  2PME A;  4Z02 A;  5M9O A;  2I0N A;  2AMC A;  2YRD A;  1D3B A;  4YRL A;  4ATO A;  3BDU A;  1D1B A;  2YHT A;  2LC4 A;  1VQ5 A;  3QO7 A;  1U3O A;  3QZ9 B;  2KRM A;  2DE0 X;  4L59 A;  3A8G B;  3CXC A;  4RCC A;  3CC7 A;  2X35 A;  4KR2 A;  2EWN A;  4YRO A;  5I2M A;  1VQ9 A;  4RMO A;  3NFC A;  2CZ7 B;  2E5A A;  4FYY B;  1MNE A;  1VQL Q;  5A0L A;  4XTZ A;  2HQE A;  2D9T A;  4WI1 A;  2EL9 A;  3VS0 A;  1MND A;  1E24 A;  5GAO r;  3TSZ A;  1K8A U;  3CC7 Q;  1TUG B;  4PLI A;  1U1T A;  1U5S A;  3P8D A;  3JSC A;  2DRM A;  4C8Q F;  3R6O A;  1VQ5 Q;  2JS2 A;  3IG2 A;  2O88 A;  3OW2 S;  4F7U B;  4H2X B;  4C8Q D;  4HVV A;  4EIK A;  3DSQ A;  2K57 A;  1K0S A;  1ADJ A;  1X56 A;  1V1C A;  1KHI A;  3RKY A;  3R07 A;  1PD0 A;  4DOW A;  3REX A;  2JM8 A;  2PZ1 A;  3JCM Q;  3X28 B;  1X6O A;  1ZBJ A;  1M27 C;  4M78 F;  4R55 A;  2E6N A;  5LJ5 g;  3A8O B;  5DM7 R;  1YFT A;  4O6J A;  1OZ2 A;  3JRZ A;  1NJ5 A;  2HBP A;  2I4L A;  1PYS B;  5GAN 6;  3EAE A;  2CJ9 A;  3QNE A;  2EYY A;  3OY9 A;  2ZT7 A;  1X2K A;  2YRC A;  1WJQ A;  2V1Q A;  4DBR A;  1VQN T;  3MEY A;  1WX6 A;  3LH0 A;  4LD6 A;  3OYC A;  1J5W A;  3H0I A;  2ZT6 A;  4BY6 C;  1VOM A;  4JJN K;  1Q86 R;  2ALY B;  1L0W A;  2D8H A;  2DL4 A;  4RTU A;  2ED0 A;  4XU0 A;  1WPY A;  4NS5 A;  3A5Y A;  1H3Z A;  4LVI A;  1I5O B;  1WZO A;  4M75 C;  2EGE A;  1TOV A;  4WJ4 A;  1WIE A;  1MMA A;  3G71 T;  3MEU A;  1OUL A;  2ART A;  2YXY A;  5FWB A;  1SG5 A;  3ULR B;  5CKB A;  4DEY A;  1TWB A;  5GMK h;  1M4Z A;  1VQ9 Q;  2DJQ A;  3VRZ A;  2D6F A;  2KYB A;  5GAO n;  4Y91 A;  4A53 A;  1UB4 A;  3M56 A;  1S72 T;  1OQK A;  3CCU Q;  2EVR A;  4CC2 A;  5K1P A;  4AFZ C;  5GMK i;  2OTJ A;  1RAB B;  3QSU A;  1AT1 B;  4M78 E;  4MDW A;  1PSF A;  4EMK B;  4OF1 A;  3G71 Q;  1PNJ A;  1ZSZ C;  2CP2 A;  1FWZ A;  2I4M A;  1UGP B;  3W3S A;  3ASK A;  3QG1 A;  2VWF A;  2YUN A;  4KGV B;  3SWN A;  1TU0 B;  4P71 C;  3CME T;  2LZ6 B;  1NM7 A;  1BBZ A;  4XU1 A;  1ARK A;  2QAZ A;  2YT6 A;  2X4Y A;  3M0T A;  3CCR Q;  3MJX A;  1BB9 A;  4RTT A;  1RLP C;  3M4Y A;  4HVW A;  4BB7 A;  3HRK A;  1PYS A;  3L2W A;  2QHV A;  1EFW A;  1BK2 A;  2RHS B;  2YLC A;  4LUE A;  1ZBX A;  1H4V B;  4M78 D;  5C52 B;  3MQZ A;  3CCJ Q;  2ED1 A;  1M90 C;  3PVL A;  1VQ9 T;  1BBW A;  1M2V A;  4RTW A;  5KYU B;  1WGS A;  2G3R A;  2CH4 A;  3UWN A;  2XIC A;  3E9H A;  2CZ1 B;  1WFW A;  2RPN A;  2GFA A;  4A54 A;  2JT4 A;  5HKC A;  3LWI A;  2ZCF B;  4RG8 A;  1W66 A;  3L2R A;  4E6R A;  2EJ9 A;  1QVG A;  2RJE A;  4FIB A;  3QDF A;  4CS2 A;  3EHR A;  3MET A;  1QWE A;  3FC3 A;  5ECA A;  5J39 A;  4CC4 B;  4OLF A;  4HCC A;  4ELY C;  2NUT A;  3NET A;  5CO7 A;  2A37 A;  2X4W A;  1NPP A;  3NTI A;  4JPB W;  1ZA1 B;  4IUQ A;  1HJD A;  4KUL A;  3VJP A;  3QPH A;  4N4G A;  2ZPB B;  1FYN A;  3CXC S;  1Z7N A;  4OML A;  1VQN Q;  3CC7 T;  4GY5 A;  4YRI A;  2O4X A;  4M75 A;  3A7R A;  4IUR A;  4RQE A;  3EH2 A;  2XI9 A;  1H8K A;  1W2B S;  4YRQ A;  2LRQ A;  2RHQ B;  2RH2 A;  2RHY A;  4PJO B;  1UGQ B;  1X2G A;  2EYQ A;  3FRN A;  4UP7 A;  2ENM A;  2PMF A;  4PK4 A;  2KMT A;  1I5L A;  4PJO A;  3GF5 A;  1KQS S;  2DXB A;  5GAN f;  2C7I A;  4HVU A;  4J9F A;  4MZP A;  2DL3 A;  2HL5 C;  2QHU A;  2LCC A;  1S72 A;  5I11 A;  2VXF A;  3VQW A;  5LJ5 h;  3OW2 A;  3OYM A;  2QA4 T;  5LJ5 j;  2KDS A;  2QDY B;  2IY5 A;  2DQ3 A;  2V8J A;  2XU8 A;  5KYW B;  3CXC P;  1I0C A;  4YRN A;  3PCO B;  3LW5 E;  4JLI A;  2OX7 A;  1X54 A;  4OB3 B;  2ZXF A;  2DMO A;  2DXT A;  2I4O A;  2KYM A;  1W2B P;  2LX7 A;  1GGM A;  1UTI A;  3P8Y A;  4Y92 A;  2COW A;  1K73 U;  2PVO B;  4C8Q G;  4ELZ C;  3PMI A;  2WSE E;  3QJY A;  3CC2 T;  4YRS A;  1KHC A;  4C5I A;  4M77 D;  2RHQ A;  2A8E A;  4TVA A;  1KJW A;  2XDD A;  3OS2 A;  2EKO A;  1D1C A;  1LOJ A;  1S1N A;  2YSQ A;  1KQS A;  4BY6 B;  3CCL T;  4EX5 A;  2BZX A;  1KMN A;  1BI1 A;  2CP0 A;  2AKL A;  4KGX B;  2E41 A;  2QI2 A;  3JCM X;  3UH0 A;  1RAD B;  4LVK A;  3NHN A;  4H2X A;  5ELN A;  2YRV A;  1WJR A;  3TRE A;  4ZGE B;  1RLQ C;  5GAN e;  2YWW A;  2QXF A;  4DBF A;  2KEA A;  1MHN A;  2LNV A;  2MWO A;  1OYX A;  2LJ3 A;  5GMK m;  2ZGW A;  4RDX A;  4L87 A;  4M77 F;  2RI3 A;  3KBG A;  1KMM A;  3M55 A;  3TEH B;  5ELO A;  3HL8 A;  3A31 A;  5LJ5 d;  4M7A E;  1G51 A;  1EZZ B;  1FMK A;  3HY0 A;  1JB0 E;  3RKX A;  4HCB A;  1X43 A;  4PJO G;  3ZBD A;  1W1F A;  1T0J A;  4YRJ A;  4FYV B;  1M30 A;  4RTY A;  3Q1J A;  4JRP A;  1E22 A;  3CCS A;  2GNC A;  2JJ9 A;  4YRE A;  1BCO A;  4JZ3 A;  4LE9 A;  2H3J A;  3UA7 A;  1KQS P;  1PRL C;  4FL6 A;  2B8A A;  1YJN Q;  4P71 A;  2QQA A;  2COZ A;  4O2D A;  1KQ2 A;  2RN8 A;  4N4I A;  2DET A;  3EG9 A;  4P5N A;  5KNN A;  4ZTF A;  1YNZ A;  1G3T A;  2EKH A;  2ZNI A;  4JRQ A;  2A0F B;  1SKU B;  4PJO C;  2J3M A;  5A0D A;  3MO8 A;  4J7F A;  1FXX A;  4L6V 5;  1RAA B;  2RQV A;  1R77 A;  2FYK A;  1ZSZ B;  1KC8 C;  5CCA A;  5GAO p;  4DBQ A;  1K8A R;  1YCY A;  1J3T A;  3M58 A;  4C0Z A;  1M9S A;  3GNG A;  4JDS A;  2JMA A;  2L3P A;  4OGE A;  4R56 A;  4Q15 A;  4E47 A;  5GJW B;  1VQK Q;  3TQ7 P;  3HXV A;  2L8D A;  4BWA A;  2EQJ A;  4IIM A;  4FYW B;  4MZT A;  1QCF A;  4CH5 A;  2CJB A;  2O9S A;  1X6G A;  5GAM d;  4OGC A;  1D09 B;  3OYG A;  3JCM g;  1H92 A;  1ABQ A;  2OTJ T;  4J8O A;  3A7A A;  3SFM A;  4C92 G;  3AT1 B;  2AMC B;  3VS3 A;  1WYX A;  1JXM A;  3FIF A;  1ATI A;  2DL8 A;  4EMH A;  1Q81 R;  3G7Z A;  4M7A F;  3THK A;  1MMN A;  4ZTU B;  2LT4 A;  5KE2 A;  3PFS A;  1MV0 B;  1AD5 A;  4JZ4 A;  4M7D F;  3C95 A;  1YFS A;  3G71 A;  4OB2 B;  1KIK A;  2E70 A;  3UDC A;  5D6Y A;  1Y57 A;  2C0O A;  2ZCE A;  4M78 A;  5FU7 B;  3INZ A;  2XK0 A;  2DBK A;  3EFS A;  4J5Y A;  2DDZ A;  3TUP A;  4IUT A;  1YI2 Q;  2VB6 A;  4YTL A;  5IN1 A;  3HTR A;  2RD1 A;  3UGQ A;  1XOV A;  1EIY A;  3CCU A;  1UHF A;  1U06 A;  3NPF A;  1V29 B;  3L4G B;  3JCM W;  1IRE B;  2QEX A;  3HSB A;  3OYK A;  3L2Z A;  1JU5 C;  4Z8A A;  4RQF A;  1GCP A;  4LN2 A;  2X3W D;  2LDM A;  4QVZ A;  3M53 A;  1WU7 A;  1QMC A;  1C1A A;  4E2F B;  3HRT A;  3GP8 A;  3FEO A;  4PJO E;  1WHM A;  2QAS A;  3HTZ A;  5FU7 C;  3PVQ A;  2ZTG A;  2ODR C;  3LGL A;  1AWO A;  1NLO C;  2VV5 A;  1V76 A;  3CMA A;  1ZLM A;  3NEN A;  3CPW A;  4YCV A;  2MPX C;  2RK2 A;  4C8Q A;  1SF9 A;  3G6E T;  1QE0 A;  1IRX A;  3EGD B;  1W70 A;  3I9Q A;  2LTO A;  4XTU A;  1TTH B;  1YB3 A;  4P3P A;  5K1X A;  3M54 A;  3V7R A;  1N9W A;  4LD9 K;  1Q7Y C;  1YIT T;  4BE1 A;  4P3N A;  2OJ2 A;  3RF1 A;  1I1J A;  4JRI A;  2M51 A;  2O31 A;  4RTZ A;  5I21 A;  1USY C;  3JAM E;  4HCK A;  2EGC A;  3ZFJ A;  2DXU A;  4YPF A;  2YLB A;  1Q82 R;  4YDQ A;  1VIE A;  3CEY A;  2M16 A;  1TG0 A;  3OA6 A;  1U1S A;  1ZUK A;  3BW1 A;  4J9I A;  1NJI R;  4M7D G;  2JXB A;  4LUD A;  1YJN T;  1PSE A;  4ZIB A;  2G6F X;  2RQT A;  3VKI A;  1D3B B;  1YJW Q;  1AVZ C;  2LQN A;  1DJ7 B;  1QVG S;  5D6W A;  2IPO B;  4NCX A;  1JEG A;  2QA4 A;  1G3W A;  1KG1 A;  2HQH A;  5CKD A;  2QQS A;  3OYL A;  4M75 G;  3CPW P;  4FCY A;  1T3S A;  2GF7 A;  3EG2 A;  5I2S A;  4QKU A;  2DL5 A;  2J06 A;  1IO6 A;  3IQL A;  3JB9 J;  2K5I A;  3T9N A;  4H2V A;  4CH4 A;  3HFV A;  3MEA A;  1K4U S;  5C51 B;  1VQ4 Q;  1RI0 A;  2NUT B;  3CBO A;  1YFN A;  2K4Y A;  3KUF A;  4KH0 B;  1VQL A;  1B7T A;  2QGF B;  3OS1 A;  4FSX A;  3CC4 T;  1NNH A;  1OX9 A;  2JTE A;  3CD6 Q;  2DD5 A;  2A28 A;  3OSV A;  1YJW A;  1SHG A;  4TVY A;  2JVV A;  2ZIN A;  2ZR2 A;  4YRK A;  1HYO A;  1SSF A;  2O9V A;  3H41 A;  1UG1 A;  2EYZ A;  3JB9 I;  4J83 A;  4OP0 A;  1VA7 A;  1Z7M A;  3VYH B;  4P75 C;  1LNX A;  4IUP A;  4PJO F;  3EFR A;  5FW9 A;  1M1K U;  1CKB A;  4EDU A;  2HSP A;  3OMG A;  2E1H A;  3QZ5 B;  5D7U A;  3RKW A;  1X55 A;  1R8O B;  3MP6 A;  3H0H A;  2R57 A;  2FPD A;  3VV0 A;  1SRM A;  4AFU C;  3L2V A;  1VQ7 T;  2GQI A;  2J6K A;  2MI6 A;  3M59 A;  4EPC A;  1OEB A;  2B86 A;  4G85 A;  4PNO A;  1HXD A;  3I55 A;  2FRY A;  4P72 C;  1NYQ A;  4QQ6 A;  2DVE A;  2Y4Y A;  2E12 A;  2EJF A;  3VS2 A;  4DOV A;  6AT1 B;  2ZT8 A;  2ZNJ A;  4BW9 A;  3TSW A;  2OTL T;  3HFN A;  3MF1 A;  2DM1 A;  3CCL A;  3CMA Q;  5J26 A;  4HT4 A;  4D8D A;  1LCK A;  3L2U A;  1HC7 A;  1JQQ A;  2CP5 A;  4ZGJ B;  4QQG A;  3VUZ A;  3IKM B;  2YUQ A;  4E7K A;  4HWT A;  4P74 C;  4J6Y A;  3A1P A;  2ECZ A;  1UDL A;  3O8V A;  1VQL T;  4ZN1 A;  4JUV A;  1K9M U;  2BIV A;  2J05 A;  1RUW A;  2KXD A;  2HKQ B;  4WJ3 M;  2E5K A;  2RHI A;  2E3H A;  3CCM Q;  4X9C A;  3OMC A;  4J7I A;  1QCN A;  3LSQ A;  4R0K A;  2D8J A;  4C92 F;  1VYT A;  4M7A C;  1KSW A;  1JJ2 A;  2RHU A;  2V8I A;  3R6N A;  4LVL A;  1RIQ A;  3HHT B;  4YP0 A;  1SSH A;  2K5F A;  4NL2 A;  1M90 U;  5AYF A;  1Q7Y R;  2FO0 A;  2RJC A;  3LH5 A;  2FZC B;  5IH2 A;  2HSE B;  3EGD A;  3QTC A;  4QVD A;  4OMO A;  4YYE A;  1GCQ A;  4D6W A;  2PUK B;  2V26 A;  4M4Z A;  1WHJ A;  3RUX A;  4F7U F;  4LVJ A;  4IUV A;  1N9R A;  2ZPE B;  5IHN A;  3A98 A;  2ARS A;  5A2Q E;  1YP5 A;  4JS4 A;  5KYY A;  3QDR B;  2ZAE A;  5LJ3 g;  3G4S Q;  2LMJ A;  1AWX A;  1VQO T;  2GFU A;  2Y90 A;  1PKT A;  2COY A;  1I81 A; 
#chains in the Genus database with same CATH homology
 3OYF A;  1VIF A;  3RL6 A;  3LX7 A;  3CMQ A;  2DU7 A;  2EQM A;  2MWP A;  4TTV A;  4YRR A;  3QJ6 A;  4TVA B;  1JBM A;  1UEB A;  2DTH A;  4GLK A;  3TEG A;  3MEW A;  4F7U A;  3DB4 A;  5GAN 4;  5L8R E;  5GAM j;  4XTY A;  4RKU E;  3S3O A;  3HFZ B;  4KUI A;  1BKB A;  1B70 B;  4EMK A;  3A8M B;  2I4N A;  5FRN A;  2CS7 A;  4BI8 B;  3OYA A;  3P8T A;  3CCE A;  4Y28 E;  3CCM T;  2FHD A;  4IUU A;  1M5Q 1;  3F70 A;  1KC8 U;  1N8R U;  2RO0 A;  2DKG A;  4XQ3 A;  1ZQ1 A;  5LJ3 h;  2EJG A;  5GAN h;  4BI4 A;  2DAQ A;  4RMF A;  3J7A F;  1QP3 A;  2PQW A;  3CME A;  4F7U G;  3IKL A;  2M0O A;  3RGL A;  4TVW A;  3L2Q A;  4CS3 A;  4VUB A;  1VQM T;  4C0D C;  1VQ6 A;  4A4H A;  3OYD A;  3GOX A;  2HNI A;  4V2S A;  4BE0 A;  4UPA A;  4YRM A;  1VQ7 A;  3DLL A;  2P4T A;  1G5H A;  2EAY A;  5CQY A;  1QP2 A;  2JOY A;  3VQX A;  4ME7 A;  2RHS A;  3QO8 A;  3RIR A;  3JCM P;  1N8R C;  1XNI A;  4M7D A;  5GAN g;  1JJC B;  5GAN 8;  4J6X A;  1NJ8 A;  1G5I A;  2XG8 D;  2DK3 A;  4XTW A;  2PVG B;  3SWN B;  3VQV A;  2Q5I A;  4K88 A;  5DLO A;  2Y4X A;  2DU5 A;  3OYJ A;  4N0A C;  4MML A;  3TU4 K;  4N4H A;  4PL6 A;  4FT2 A;  1IZ6 A;  2QQB A;  4OB1 B;  4Q5W A;  4Q6G A;  1H4Q A;  2L3R A;  2DTO A;  3CCS T;  4CH3 A;  3CCM A;  4TWA A;  1QW1 A;  5HGQ A;  2XDB A;  3M4P A;  1QF6 A;  2LQK A;  3A7U A;  2ODR D;  2E6Z A;  4G84 A;  4K87 A;  2X4X A;  3NEM A;  4LDU A;  3HXX A;  5CVI A;  4C5G A;  4OB0 B;  4XTV A;  3X26 B;  3J80 E;  2GQV A;  2CGH A;  3C94 A;  4C5H A;  3S3N A;  1U8R A;  3SWN C;  4X5O A;  2FVU A;  1YI2 T;  1XQH A;  1B70 A;  3HRI A;  3QHS A;  1I4K 1;  4C92 D;  3CCR A;  4M7A G;  5GMK j;  3NEL A;  3JCM f;  4CH6 A;  2XDP A;  4YRP A;  1SES A;  1G5V A;  3JCM d;  4FU6 A;  3G1Z A;  2I2L A;  4E51 A;  2E10 A;  4C0F A;  3L1A A;  4C8Q E;  1Y96 A;  4TQF A;  4CRI A;  1N9S A;  3AHU A;  2R5A A;  4RG2 A;  12AS A;  1VQ4 A;  1RL2 A;  2QEX T;  3LLR A;  4JS5 A;  1EIY B;  3A32 A;  3RES A;  5GAO m;  2ZZE A;  4YCU A;  3PGG A;  2V8K A;  4H2T A;  2RA2 A;  3PIO A;  3OYH A;  3UFG A;  3A5Z B;  5HK0 A;  4M7D D;  1O75 A;  1X2H A;  5J3B A;  2E3C A;  4XU2 A;  2KVQ G;  1YHQ A;  3MCA B;  1Q7Y U;  2EQK A;  1QVF S;  4M7D E;  2DIQ A;  4XEM A;  4UC4 A;  3M9Q A;  1VQK T;  3QUI A;  4MDX A;  1XTD A;  2LVM A;  2DO3 A;  4FM4 B;  3CPF A;  3LSS A;  3I7F A;  3FLG A;  3E1S A;  2RI2 A;  1BI3 A;  3PT9 A;  5GAO l;  4HWS A;  1LJO A;  1NE8 A;  3OS5 A;  2JTM A;  1X01 A;  3RAC A;  3SDZ A;  3OYN A;  4AH6 A;  3JCM J;  1EVK A;  5KH6 A;  3MEV A;  1Y96 B;  3CBM A;  2C8M A;  1HTT A;  2PU9 B;  1LYL A;  1B7Y B;  2P5I A;  4XU3 A;  3I56 A;  3X25 B;  2L89 A;  3A5Z A;  11AS A;  5EG2 A;  1YIJ T;  1KD1 U;  4M7D B;  4M78 G;  3BDL A;  3E9F A;  4XEO A;  2ZIO A;  4HVC A;  3HRS A;  3TCJ A;  1YI2 A;  3CCJ T;  4ZTJ A;  5C0M A;  3OD1 A;  2P0K A;  1M1K C;  3QXE B;  3G6E A;  1VQ6 T;  2CZ6 B;  4LDX A;  4NOY A;  4II1 A;  4ZTZ B;  4M78 C;  2ZIM A;  5IT9 E;  2K2V A;  5KE3 A;  2WSF E;  3VYG A;  1Y7X A;  3S3M A;  3HXY A;  1BI2 A;  3A8L B;  2E64 A;  1I8F A;  2BKD N;  3V8J A;  3DLM A;  3GNF B;  4KBM B;  3UGT A;  4HKE A;  4H2S A;  4K86 A;  3CCU T;  3UPU A;  1Y07 A;  5C53 B;  3HXZ A;  3V7C A;  2GCX A;  4H2Y A;  3TEE A;  4H2U A;  1VUB A;  4HT9 A;  4B9X A;  3VU3 C;  5GAM f;  2P0P A;  2P0Q A;  1JRI A;  4TVR A;  4TQD A;  3QYH B;  4KQE A;  5FLX E;  3P8B B;  4M7A D;  4C92 A;  5FRO A;  3J81 E;  4BDY A;  4M78 B;  2G4C A;  1MGQ A;  5DLQ E;  4B9W A;  2E5Q A;  5GAM h;  1N27 A;  1YIT A;  1Q81 C;  3CCQ A;  4JLG A;  3FB9 A;  5CKF A;  5FU6 C;  3BFM A;  4OMF B;  4X34 A;  2RHX A;  3H6Z A;  1NYR A;  2OAU A;  3MP8 A;  5LJ3 j;  5IAY A;  3A74 A;  4XAX B;  3JB9 G;  3REU A;  3JB9 D;  1ADY A;  4BAC A;  2XGT A;  3RMQ A;  2JZ2 A;  2RJF A;  1BYM A;  2Q7H A;  2QTX A;  4YCW A;  2CKK A;  3V7S A;  3PCO A;  4XTX A;  1W2B A;  2DPP B;  2BUD A;  3L4G A;  2Q7E A;  3QO3 A;  3VUB A;  1VQ5 T;  3MHX A;  4X9D A;  2MF2 A;  3I56 T;  2Q7G A;  1QVP A;  2QHT A;  1OZ3 A;  2EIF A;  4H02 A;  1TH7 A;  3SB2 A;  3KXT A;  2Q5H A;  4BUG A;  1BIB A;  1NJ1 A;  3IAL A;  3OBW A;  1WQ7 A;  1NJ6 A;  5GAN 2;  4CS4 A;  4M77 B;  2KQW A;  5LJ5 f;  2AKW B;  1H4T A;  3LWH A;  4LDY A;  3X20 B;  4C0G A;  4P72 A;  5KCH A;  4E7L A;  1M8V A;  3GPL A;  4RCB A;  1YJW T;  4XK8 E;  3L42 A;  1VQZ A;  2A7Y A;  2D0Q B;  2DQ0 A;  3A8H B;  3VBB A;  1C0A A;  4E7H A;  1EQR A;  3PNW C;  4BD3 A;  1B8A A;  2HD0 A;  1NJI C;  1YHQ T;  4MZM A;  3HY1 A;  2VC8 A;  5CQX A;  5CKH A;  4M77 E;  4O5V A;  4FT4 A;  3P8V A;  3WXM B;  4P73 A;  4ZN3 A;  1QVF A;  3JCM e;  1UGS B;  1YJ9 T;  2AHJ B;  3M4G A;  5FU6 B;  4M77 C;  3CD6 A;  3NTH A;  2LT1 A;  3CC2 A;  3OYI A;  3I55 T;  4C92 B;  1GXI E;  1NJI U;  1WQW A;  2LCL A;  2ZZD A;  3QBY A;  2WSC E;  4KT0 E;  1ASY A;  2DJZ A;  3GIB A;  4H2W A;  3OYY A;  2RI5 A;  5CR2 A;  1VQP T;  2KAF A;  2C06 A;  3SD4 A;  2DXC A;  1VQO A;  1E1O A;  5LJ5 e;  5GMK e;  3JCM c;  1YIJ A;  3CCE T;  3X24 B;  4C92 C;  1H4S A;  5GAM g;  2RB6 A;  3M57 A;  3RMS A;  1VQ8 A;  2X4J A;  1SRY A;  2F5K A;  1WLE A;  4BDZ A;  2L5Q A;  4P74 A;  2RHZ A;  2A3L A;  2JTF A;  5LL6 S;  2XTI A;  4HCZ A;  1ASZ A;  3QII A;  5CK9 A;  5FRM A;  1YJ9 A;  3URG A;  5GAN d;  1W4S A;  5A0G A;  5E3I A;  5LJ3 d;  5D6X A;  3DKM A;  5GAN 5;  1SER A;  3ME9 A;  3OYB A;  4J15 A;  3ERR A;  2VGN A;  4C5E A;  3HRU A;  5CIU A;  4YRC A;  2ZPI B;  1K9M C;  3H8Z A;  2IG0 A;  3JB9 F;  4EO4 A;  1NJ2 A;  1JJ2 S;  2ALY A;  1B7Y A;  4PJO D;  1E1T A;  3OS0 A;  1KQ1 A;  1KOG A;  1YJN A;  4QVC A;  5CAI A;  3PIP A;  4P73 C;  3CCV A;  5F5W A;  4YRF A;  4C0D B;  2ZZG A;  2ZPF B;  4LDW A;  4P3O A;  4L5G A;  3KFU A;  4CI0 C;  1BBU A;  3V8L A;  3WQZ A;  1O9S A;  2R5M A;  3V8K A;  1X75 C;  1VQ8 T;  1NZ9 A;  3HPW A;  2HQX A;  2ZPG B;  2CZ0 B;  3MF2 A;  3CBP A;  2WAC A;  3RER A;  1Q82 C;  1EVL A;  3ICA A;  3HKS A;  2O01 E;  1AHJ B;  3E9I A;  4C8Q C;  1HK9 A;  4BI3 A;  2CYZ B;  4HWR A;  1B34 B;  2FL7 A;  1ZHI A;  2HAX A;  3HFO A;  3ZEH A;  2JNG A;  4EMK C;  4QQD A;  5CKE A;  2IY5 B;  3LYI A;  3QO5 A;  1Q86 C;  3CCQ T;  1B76 A;  3CPW S;  1FYF A;  3CD6 T;  5C6S A;  1VQM A;  4IKF A;  3ER0 A;  2ZR3 A;  1OI1 A;  2KK4 A;  4A4E A;  1WJS A;  1Y71 A;  4WF2 A;  3CCV T;  1BIA A;  5KCO A;  1Q86 U;  3N5B B;  2K5L A;  3WVE B;  3HFZ A;  1K73 C;  3UT1 A;  5LJ3 f;  3BJU A;  3LGF A;  4M77 A;  1Q82 U;  5DY9 A;  2DTI A;  3QKJ A;  3QYG B;  5LJ3 e;  3JCM V;  3OQ5 A;  1WYD A;  2J3L A;  4A4G A;  2VUB A;  3FJP A;  2DEQ A;  3PMT A;  1KD1 C;  1IL2 A;  5GAO q;  2F5T X;  4JRK A;  2QQ9 A;  1M1G A;  4M75 D;  5GAM e;  2O4X B;  4M75 B;  3PTA A;  3JCM h;  3C4S A;  3TEH A;  5GAN 3;  2R58 A;  5HY6 A;  4KUD K;  4PKC C;  3FDR A;  3GLX A;  3C12 A;  2KSS A;  3HP9 A;  1USY A;  4M7D C;  3LC0 A;  4HT8 A;  2PUO B;  3CCR T;  2K3X A;  3HXU A;  2IVW A;  3DB3 A;  4BE2 A;  3E19 A;  1VQ4 T;  2RM4 A;  4DPG A;  2P0L A;  2K3Y A;  2CIM A;  3HXW A;  1YGB A;  4F7U E;  2DIG A;  2RK1 A;  1P92 A;  1EOV A;  2MAM A;  2ZPH B;  4A4F A;  4N0A A;  5GAN j;  1BI0 A;  3MP1 A;  3OSS C;  2XD0 A;  2ARU A;  5HK3 A;  4KR3 A;  2M1H A;  4M75 F;  3OYE A;  1VQP A;  3E9G A;  4A4K A;  2VXE A;  4M77 G;  1FX7 A;  5GMK l;  3G4S A;  3NTK A;  3S6W A;  1H64 1;  2FB7 A;  2DD4 A;  4HA8 A;  4DA4 A;  1Q81 U;  4MMK A;  2KY9 A;  4HWP A;  4LVM A;  2PVD B;  1G3Y A;  2AKW A;  2LX9 A;  3M4Q A;  3P8H A;  4LNS A;  2CJA A;  2OTL A;  3CC4 A;  2NLU A;  2QHS A;  5GAN 7;  4EMG A;  4YRT A;  4P75 A;  4M7A A;  2ZZF A;  3VQY A;  1VQN A;  4PG3 A;  2M9U A;  1N6A A;  4NL3 A;  2ZT5 A;  2DZ9 A;  1VQK A;  1YFR A;  2VGM A;  4PLL A;  4UP9 A;  2RJD A;  2MMP A;  1B34 A;  2XKO C;  2JUF A;  4E7J A;  2NS6 A;  4OVA A;  4LDV A;  1UGR B;  2F69 A;  4C92 E;  2EQU A;  3CCJ A;  1K8A C;  4C8Q B;  1G3S A;  3G4S T;  3OBY A;  4DQ2 A;  3M5A A;  3WVD B;  3JB9 H;  4QW2 A;  1EIF A;  3OB9 A;  2E65 A;  2XID A;  4YRG A;  3PZC A;  3BY7 A;  4HWO A;  4ZGD B;  2VYT A;  2LQ8 A;  2QQR A;  1SET A;  4J6W A;  2EFI A;  1JJC A;  1YBY A;  4M75 E;  4PHC A;  1WNL A;  1M1F A;  4UP8 A;  4E7I A;  1NPR A;  2JN0 A;  2DZC A;  3CMA T;  2XHC A;  4M7A B;  3JCM b;  2PME A;  4Z02 A;  5M9O A;  2AMC A;  1D3B A;  4YRL A;  4ATO A;  3BDU A;  2YHT A;  2LC4 A;  1VQ5 A;  3QO7 A;  3QZ9 B;  4L59 A;  3A8G B;  3CXC A;  4RCC A;  3CC7 A;  2X35 A;  4KR2 A;  2EWN A;  4YRO A;  5I2M A;  1VQ9 A;  4RMO A;  3NFC A;  2CZ7 B;  2E5A A;  5A0L A;  4XTZ A;  2HQE A;  2D9T A;  4WI1 A;  2EL9 A;  1E24 A;  5GAO r;  1K8A U;  4PLI A;  1U1T A;  3P8D A;  3JSC A;  4C8Q F;  3R6O A;  3IG2 A;  3OW2 S;  4F7U B;  4H2X B;  4C8Q D;  3DSQ A;  2K57 A;  1ADJ A;  1X56 A;  3RKY A;  1KHI A;  3R07 A;  4DOW A;  3REX A;  3JCM Q;  3X28 B;  1X6O A;  4M78 F;  4R55 A;  2E6N A;  5LJ5 g;  3A8O B;  5DM7 R;  1YFT A;  4O6J A;  1OZ2 A;  3JRZ A;  1NJ5 A;  2HBP A;  2I4L A;  1PYS B;  5GAN 6;  3EAE A;  2CJ9 A;  3QNE A;  3OY9 A;  2ZT7 A;  1WJQ A;  1VQN T;  3MEY A;  3LH0 A;  4LD6 A;  3OYC A;  1J5W A;  2ZT6 A;  4BY6 C;  4JJN K;  2ALY B;  1L0W A;  4XU0 A;  1WPY A;  4NS5 A;  3A5Y A;  1H3Z A;  4LVI A;  4M75 C;  4WJ4 A;  3G71 T;  3MEU A;  2ART A;  5CKB A;  5GMK h;  1M4Z A;  2D6F A;  5GAO n;  4Y91 A;  4A53 A;  1UB4 A;  3M56 A;  1S72 T;  5K1P A;  5GMK i;  2OTJ A;  3QSU A;  4M78 E;  4MDW A;  1PSF A;  4EMK B;  4OF1 A;  2I4M A;  1FWZ A;  1UGP B;  3W3S A;  3ASK A;  3QG1 A;  3SWN A;  4P71 C;  3CME T;  4XU1 A;  2X4Y A;  3M4Y A;  4BB7 A;  3HRK A;  1PYS A;  3L2W A;  2QHV A;  1EFW A;  2RHS B;  2YLC A;  1ZBX A;  1H4V B;  4M78 D;  5C52 B;  3MQZ A;  1M90 C;  1BBW A;  1VQ9 T;  1WGS A;  2G3R A;  3UWN A;  2XIC A;  3E9H A;  2CZ1 B;  2GFA A;  4A54 A;  5HKC A;  1W66 A;  3LWI A;  2ZCF B;  4RG8 A;  3L2R A;  2EJ9 A;  1QVG A;  2RJE A;  4FIB A;  4CS2 A;  3MET A;  3FC3 A;  5J39 A;  4OLF A;  4HCC A;  4ELY C;  3NET A;  5CO7 A;  2X4W A;  1NPP A;  3NTI A;  4IUQ A;  4KUL A;  3VJP A;  3QPH A;  4N4G A;  2ZPB B;  3CXC S;  1Z7N A;  3CC7 T;  4GY5 A;  4YRI A;  2O4X A;  4M75 A;  3A7R A;  4IUR A;  4RQE A;  2XI9 A;  1W2B S;  4YRQ A;  2LRQ A;  2RHQ B;  2RH2 A;  2RHY A;  4PJO B;  1UGQ B;  1X2G A;  2EYQ A;  3FRN A;  4UP7 A;  2PMF A;  2KMT A;  1I5L A;  4PJO A;  3GF5 A;  1KQS S;  2DXB A;  5GAN f;  2C7I A;  4MZP A;  2QHU A;  2LCC A;  1S72 A;  2VXF A;  3VQW A;  5LJ5 h;  3OW2 A;  3OYM A;  2QA4 T;  5LJ5 j;  2KDS A;  2QDY B;  2IY5 A;  2DQ3 A;  2V8J A;  2XU8 A;  4YRN A;  3PCO B;  3LW5 E;  4JLI A;  1X54 A;  4OB3 B;  2ZXF A;  2DXT A;  2I4O A;  1GGM A;  3P8Y A;  1K73 U;  2PVO B;  4C8Q G;  4ELZ C;  3PMI A;  2WSE E;  3QJY A;  3CC2 T;  4YRS A;  1KHC A;  4C5I A;  4M77 D;  2RHQ A;  2A8E A;  4TVA A;  2XDD A;  3OS2 A;  2EKO A;  1LOJ A;  1KQS A;  4BY6 B;  3CCL T;  4EX5 A;  1KMN A;  1BI1 A;  2E41 A;  2QI2 A;  3JCM X;  3UH0 A;  4LVK A;  4H2X A;  5ELN A;  2YRV A;  1WJR A;  3TRE A;  4ZGE B;  5GAN e;  2QXF A;  1MHN A;  2LNV A;  2MWO A;  1OYX A;  5GMK m;  2ZGW A;  4RDX A;  4L87 A;  4M77 F;  2RI3 A;  3KBG A;  1KMM A;  3M55 A;  3TEH B;  5ELO A;  3HL8 A;  3A31 A;  5LJ5 d;  4M7A E;  1G51 A;  3HY0 A;  1JB0 E;  3RKX A;  4HCB A;  4PJO G;  3ZBD A;  4YRJ A;  3Q1J A;  4JRP A;  1E22 A;  3CCS A;  4YRE A;  2H3J A;  4FL6 A;  2B8A A;  4P71 A;  2QQA A;  4O2D A;  1KQ2 A;  4N4I A;  5KNN A;  4P5N A;  4ZTF A;  1G3T A;  2ZNI A;  4JRQ A;  4PJO C;  2J3M A;  5A0D A;  3MO8 A;  4J7F A;  1FXX A;  4L6V 5;  2FYK A;  1KC8 C;  5CCA A;  5GAO p;  1YCY A;  3M58 A;  4C0Z A;  1M9S A;  3GNG A;  4JDS A;  4R56 A;  4OGE A;  4Q15 A;  4E47 A;  3HXV A;  2L8D A;  4BWA A;  2EQJ A;  4MZT A;  4CH5 A;  2CJB A;  5GAM d;  4OGC A;  3OYG A;  3JCM g;  2OTJ T;  4J8O A;  3A7A A;  3SFM A;  4C92 G;  2AMC B;  3FIF A;  1ATI A;  4EMH A;  3G7Z A;  4M7A F;  4ZTU B;  2LT4 A;  5KE2 A;  3PFS A;  4M7D F;  3C95 A;  1YFS A;  3G71 A;  4OB2 B;  2E70 A;  3UDC A;  5D6Y A;  2ZCE A;  4M78 A;  3INZ A;  5FU7 B;  2XK0 A;  3EFS A;  4J5Y A;  2DDZ A;  3TUP A;  4IUT A;  4YTL A;  5IN1 A;  2RD1 A;  3UGQ A;  1XOV A;  1EIY A;  3CCU A;  3L4G B;  1V29 B;  3JCM W;  1IRE B;  2QEX A;  3HSB A;  3OYK A;  3L2Z A;  4RQF A;  2LDM A;  4QVZ A;  3M53 A;  1WU7 A;  3HRT A;  3GP8 A;  3FEO A;  4PJO E;  3HTZ A;  5FU7 C;  2ZTG A;  2ODR C;  3LGL A;  2VV5 A;  3CMA A;  3NEN A;  3CPW A;  4YCV A;  2RK2 A;  4C8Q A;  3G6E T;  1QE0 A;  2LTO A;  4XTU A;  1YB3 A;  4P3P A;  5K1X A;  3M54 A;  3V7R A;  1N9W A;  4LD9 K;  1Q7Y C;  1YIT T;  4BE1 A;  4P3N A;  3RF1 A;  4JRI A;  5I21 A;  1USY C;  3JAM E;  3ZFJ A;  2DXU A;  4YPF A;  2YLB A;  4YDQ A;  1VIE A;  3CEY A;  2M16 A;  3OA6 A;  1U1S A;  3BW1 A;  4M7D G;  1YJN T;  1PSE A;  4ZIB A;  3VKI A;  1D3B B;  1DJ7 B;  1QVG S;  5D6W A;  4NCX A;  2QA4 A;  1G3W A;  1KG1 A;  5CKD A;  2QQS A;  3OYL A;  4M75 G;  2GF7 A;  5I2S A;  3JB9 J;  2K5I A;  3T9N A;  4H2V A;  4CH4 A;  3HFV A;  3MEA A;  5C51 B;  1RI0 A;  3CBO A;  2K4Y A;  3KUF A;  1VQL A;  3OS1 A;  3CC4 T;  4FSX A;  1NNH A;  2DD5 A;  3OSV A;  1YJW A;  4TVY A;  2JVV A;  2ZIN A;  2ZR2 A;  4YRK A;  1SSF A;  3JB9 I;  4J83 A;  4OP0 A;  1Z7M A;  3VYH B;  4P75 C;  1LNX A;  4IUP A;  4PJO F;  3EFR A;  1M1K U;  4EDU A;  3OMG A;  2E1H A;  3QZ5 B;  3RKW A;  1X55 A;  1R8O B;  3MP6 A;  2R57 A;  3VV0 A;  3L2V A;  1VQ7 T;  4EPC A;  2MI6 A;  3M59 A;  4G85 A;  4PNO A;  1HXD A;  3I55 A;  4P72 C;  1NYQ A;  4QQ6 A;  2DVE A;  2Y4Y A;  2E12 A;  2EJF A;  4DOV A;  2ZT8 A;  2ZNJ A;  4BW9 A;  2OTL T;  3HFN A;  3MF1 A;  3CCL A;  5J26 A;  4HT4 A;  3L2U A;  1HC7 A;  4ZGJ B;  4QQG A;  3VUZ A;  3IKM B;  4E7K A;  4HWT A;  4P74 C;  4J6Y A;  3O8V A;  1VQL T;  4ZN1 A;  4JUV A;  1K9M U;  2BIV A;  4WJ3 M;  2RHI A;  4X9C A;  3OMC A;  4J7I A;  3LSQ A;  4C92 F;  4M7A C;  1JJ2 A;  2RHU A;  2V8I A;  4LVL A;  1RIQ A;  3HHT B;  4YP0 A;  2K5F A;  4NL2 A;  1M90 U;  5AYF A;  2RJC A;  3QTC A;  4QVD A;  4YYE A;  4D6W A;  2PUK B;  3RUX A;  4F7U F;  4LVJ A;  4IUV A;  1N9R A;  2ZPE B;  2ARS A;  5A2Q E;  4JS4 A;  3QDR B;  5LJ3 g;  1VQO T;  2GFU A;  2Y90 A;  1I81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...