4XTVA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 36 (n-({[(1r,3s)-3-(6-amino-9h-purin-9-yl)cyclopentyl]methyl}sulfamoyl)-5-[(3as,4s,6ar)-2-oxohexahydro-1h-thieno[3,4-d]imidazol-4-yl]pentanamide)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtvA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtvA01
4C8QG 5GAOq 3JB9G 4TTVA 4M75F 1YFSA 2HNIA 3E9IA 4RCBA 1GGMA 1SERA 4CS3A 3A7UA 4YROA 4NL3A 4EX5A 1J5WA 2DTIA 3JCMf 4YP0A 3A5ZA 3R07A 3VQVA 1ASYA 2ODRC 5C53B 3BJUA 1LNXA 1BIBA 4J5YA 4M7AC 3P8TA 4XQ3A 3UGQA 2VXEA 5LJ5j 5GAN6 3HFZA 4P73C 2IY5B 3HFZB 3JCMJ 3A32A 4YRRA 4H2SA 3RERA 1YFTA 2E3CA 3MF2A 4JRIA 1B76A 4C8QB 5GAN7 3UH0A 2E5AA 2YLCA 5LJ5g 4C8QC 4TQDA 3VQXA 2ZTGA 4XU1A 2DKGA 5ELNA 1NJ6A 2AMCA 3JCMX 3WQZA 2AMCB 4CS4A 1B7YA 3MF1A 1ATIA 5GAN2 1B7YB 2ODRD 2DEQA 5GAMf 4YRSA 4QVDA 4HWTA 4KR2A 3QO3A 4TVWA 4YREA 3JB9J 4PHCA 4OP0A 1HXDA 2VC8A 2ZZFA 1NNHA 2XTIA 3RKWA 1H4QA 4YDQA 1E1TA 3QO7A 3REUA 3JCMQ 1WQ7A 1TH7A 3LC0A 5GANe 1WPYA 5GANf 1KOGA 3M4QA 1SETA 4JUVA 5GAN8 1X56A 4M7DA 5LJ5d 1BBUA 4M7DB 4C8QD 4M78A 4M77A 3LSSA 4M78B 4M77B 4HWPA 2ZINA 4G85A 3ERRA 4C8QE 4J6YA 1C0AA 4F7UA 2ZNJA 4XEOA 1ASZA 1NJ8A 4F7UB 2CJBA 3JCMh 4Q15A 4CH6A 4C8QF 1E24A 3JB9F 3PCOA 5GAN4 1WYDA 3PCOB 3RF1A 4YRKA 4CH3A 2EWNA 1B34A 4CS2A 4UP9A 1B34B 3RGLA 1X55A 3VQYA 1BBWA 1VQZA 3RIRA 1H641 1KMNA 1EIYA 1WQWA 1YGBA 4M7DD 4P72C 1EIYB 3L1AA 2CJ9A 4BWAA 3JB9I 4M78D 4P3OA 1LOJA 4M77D 5GAN3 3JCMP 2XGTA 1NJ2A 4NCXA 1EFWA 1IL2A 4HWOA 4M7DE 3A31A 1N9RA 1KMMA 11ASA 2DTOA 1Z7NA 4M78E 3QNEA 4M77E 2ZXFA 5C52B 3QTCA 4H2VA 3MEYA 3V8KA 3V7CA 4F7UE 3QO5A 2RD1A 3HFNA 5LJ5e 2I4LA 4WJ4A 3BDUA 4C92A 5LJ5f 12ASA 2RHQA 4CH4A 2YHTA 1I8FA 2RHQB 5GAOl 3HY0A 2DXTA 4MMLA 2ZCEA 1EVLA 3NETA 4TVYA 3HXVA 4XTUA 3A5YA 2Q7HA 2P5IA 1MGQA 4J15A 5LJ3h 3IG2A 2G4CA 2ARUA 3KFUA 4V2SA 1EOVA 1G5HA 4YPFA 3JCMc 4EMHA 3TEHA 2Q5HA 3CMQA 3VQWA 2QHSA 4WF2A 5GMKl 2I4OA 4YCVA 1EQRA 1W66A 2QHTA 4YRPA 3L4GA 4Y91A 5GMKh 2EJFA 3VU3C 3L4GB 1L0WA 1NJ5A 1PYSA 3RL6A 4RQFA 1E22A 3P8VA 1PYSB 4M7DG 4J6WA 5GMKi 2E64A 3G1ZA 4M78G 4M77G 4ZIBA 4C92D 3FJPA 4P75A 2ZNIA 4H2TA 1ADJA 3HFOA 2EL9A 4XU0A 3A74A 2CGHA 1WU7A 2DQ3A 1KQ1A 1NJ1A 5C51B 2EAYA 4F7UG 1YFRA 2YLBA 2K57A 4NL2A 4XTWA 4OLFA 4ZTUB 4XU2A 4UPAA 2RB6A 3HXUA 1I81A 2ARTA 3GIBA 1SRYA 1U1TA 3JCMg 4JLIA 4H2UA 1NYRA 3QUIA 4RDXA 3UGTA 3FIFA 3HXXA 2RA2A 4HT8A 1X54A 4X9CA 1FYFA 4XTYA 1USYA 4M7DC 2EJGA 4P71A 1M8VA 3HXWA 3QSUA 3REXA 4M78C 4YRQA 4M77C 1ADYA 1X01A 4H2WA 3NENA 3NEMA 4WI1A 3BY7A 4UP7A 3W3SA 4O2DA 4KR3A 1E1OA 2J3MA 3PZCA 1LJOA 1NYQA 2ZT6A 3BFMA 4LNSA 4PJOA 2DTHA 1LYLA 3JCMd 2Q7GA 4PJOB 3V7RA 3JCMV 4M75A 4H2XA 4YCWA 5GAMg 1D3BA 4M75B 4H2XB 5ELOA 1H4TA 1D3BB 2I4NA 3EFRA 4C92G 1EVKA 4TVAA 4YRMA 3INZA 5LJ3j 5DY9A 3QHSA 3AHUA 4P74A 5KNNA 2ZZGA 3RUXA 5GAMh 2I2LA 3HY1A 4N0AA 2QTXA 4M7DF 4YRFA 5GMKj 4NOYA 4M78F 2RM4A 4M77F 5GAOn 5LJ3g 4ZTZB 4PG3A 3V8LA 5GAOm 2J3LA 3HRIA 4TWAA 2Y90A 4Q6GA 2DU7A 4HWRA 1H4VB 4PJOD 2E65A 2RHSA 1QF6A 2DJZA 2ZR3A 5GANh 4F7UF 4C92B 3HFVA 2RHSB 3HXZA 4P3PA 2ZIOA 4YYEA 4M75D 4C92C 1JBMA 3HTZA 4X5OA 1YCYA 4L87A 1KQ2A 2E1HA 4PJOE 2DVEA 1QE0A 2ALYA 1WNLA 3RACA 2ALYB 4M75E 4G84A 3UFGA 1HC7A 2C7IA 4DQ2A 2QHUA 1Y96A 1H4SA 4XEMA 2ZT5A 4DPGA 1Y96B 3TEHB 4CH5A 2ZZEA 3VBBA 3JCMe 3JCMW 4M7AA 5LJ3d 1B8AA 4UP8A 1SESA 5E3IA 4M7AB 2FYKA 3RKXA 2CJAA 4YRGA 4XTXA 4P73A 3HSBA 2ZR2A 5CAIA 4XTVA 3SB2A 2IY5A 3BW1A 4HVCA 2C8MA 4TQFA 3L2ZA 5GAOr 4PNOA 3JB9H 4P75C 2DZ9A 3IKMB 4C8QA 4C92E 2QHVA 3A7AA 1Z7MA 1JRIA 3IALA 3HXYA 4X9DA 2JN0A 4YRJA 1RIQA 4C92F 5I21A 3JCMb 4K88A 4PJOG 3TUPA 1G5IA 5GAMe 3IKLA 3M4PA 2PMEA 1X2HA 4EMKA 1M5Q1 4M75G 1B70A 4M7AD 4YRCA 4EMKB 1B70B 2P0LA 3HRKA 4EMKC 5LJ5h 4HWSA 4A54A 5GAN5 1USYC 4YRIA 4P71C 3V8JA 4M7AE 1HTTA 3V7SA 3PGGA 2ARSA 2ZIMA 1BIAA 2I4MA 5GAMj 3NELA 2DQ0A 4K87A 3A7RA 4BW9A 4H2YA 4MMKA 4M7AF 1X2GA 2VXFA 5GAOp 3JB9D 2FB7A 4EMGA 5LJ3e 3EFSA 3FB9A 4QVCA 2Q7EA 3ICAA 5LJ3f 5GANj 4PJOC 4YRLA 4A53A 4XU3A 4AH6A 4M75C 4HT9A 2PMFA 3OD1A 2EJ9A 4H02A 3RESA 5GMKe 4JRKA 4RMFA 3RKYA 4RQEA 2E41A 2CIMA 4TVAB 4WJ3M 1I5LA 4YCUA 2ZGWA 3P8YA 1I4K1 5GANg 3E9HA 4E51A 4YRNA 3DSQA 4XTZA 1G51A 3M4GA 2DXUA 4RCCA 4P72A 1U1SA 4P74C 2ZT8A 1WLEA 5K1PA 4K86A 3I7FA 4N0AC 2E10A 2AKWA 4KQEA 4M7AG 2DU5A 2AKWB 5GAMd 1HK9A 3SWNA 3QO8A 2ZT7A 2DDZA 3SWNB 5F5WA 2DZCA 4EO4A 3SWNC 1N9WA 1N9SA 5HGQA 3LSQA 4YRTA 5K1XA 1YB3A 4HA8A 3TEGA 4P3NA 1JJCA 5GMKm 5GANd 1JJCB 2Q5IA 4J6XA 4PJOF
chains in the Genus database with same CATH superfamily
5GAOq 4OMLA 1ARKA 3G71Q 3G6EQ 5IAYA 2EGAA 4RUGA 3I56A 2AZSA 1HYOA 3OSVA 4RCBA 1SERA 1WLPB 3S3OA 1NJIC 2D8JA 3OW2P 3VQVA 1VQKQ 3R07A 1ASYA 5C53B 1LNXA 4M7AC 3P8TA 4XQ3A 3VKIA 2NUPA 3RBBB 2IY5B 1ZSGA 3CD6Q 4LE9A 1VQMQ 3QWXX 2YLCA 1TUGB 2DM1A 4JJNK 2ZTGA 4LDYA 2Y4YA 1NJ6A 2AMCA 1KC8R 3WQZA 3TVTA 4IUTA 4CC2A 2CZ7B 1D0XA 3EGDA 2E5KA 2P0QA 2X3XD 2HAXA 2QQAA 2EYZA 4XK8E 1OPKA 2ODRD 1VOMA 2O2OA 4QVDA 4KR2A 2OI3A 3JB9J 1VQ5A 3VS7A 4PFPA 3QO7A 1H3HA 3JCMQ 1VQ7T 2F2XA 3M59A 1QVGA 2A0FB 5GANf 2ECZA 1RABB 1KHCA 5CQYA 3P8BB 4M7DA 2V8IA 3NTIA 3GBQA 4C8QD 4M78A 4M77A 1JQQA 4G85A 2F5KA 1YIJQ 3ERRA 1JEGA 4D6WA 1M90U 4O5VA 4ESRA 2XK0A 2JT4A 4PJJA 2CT3A 2VV5A 4C8QF 2ROTA 3EG0A 2K7AA 1ABQA 3QYHB 1VQNT 1B34A 4FIBA 4CS2A 1X55A 4HCZA 3CCSA 4X34A 4GY5A 3MQZA 3I55Q 2E6ZA 1H641 1BI0A 4J9IA 1WQWA 3E2UA 3O5ZA 1U8RA 4M7DD 2ZZDA 2XG8D 1WXTA 3L1AA 2X4XA 3MEVA 1IGQA 4BWAA 3JB9I 4M78D 4PJMA 1LOJA 4M77D 2JUFA 1IL2A 4NCXA 1QVFA 3TSWA 1N8RR 2DL3A 1WHJA 2WSEE 4HWOA 2LZ6B 1W2BA 3CMET 4DBFA 1WFWA 2E3IA 2E70A 1G3SA 4JJCA 2L3SA 1EZZB 2QGGA 4PL6A 3QYGB 3H8ZA 4Z8AA 4F7UE 4LD6A 4HCCA 3CCUA 2EYWA 4LXCA 4NS5A 1TSFA 3CEYA 2DERA 2YHTA 1I8FA 2ZCFB 2RHQB 1LCKA 3ZFJA 2RI2A 1H3ZA 4KRTA 2E6NA 3PIOA 3CCRT 2NUZA 3SDZA 2Q7HA 3DB4A 4QT7A 2P5IA 1MGQA 1M27C 3IG2A 2KVQG 3KFUA 3RDVA 2E5QA 4RTZA 1G5HA 4YPFA 3JCMc 3TEHA 1VQ9A 1WXBA 2KROA 5GMKl 4DA4A 1RAGB 1V29B 4RTVA 5HK0A 3CCQQ 1EQRA 1W66A 4OB1B 4YCVA 1CSKA 1VQ6Q 5GMKh 2EJFA 3VU3C 5J39A 3OS1A 4KUIA 1AT1B 1M9SA 4JJBA 1PYSA 2DRKA 1JXOA 4RQFA 3GNFB 4AFSC 3WVEB 3P8VA 5CQXA 4RTWA 5IHIA 4LDWA 3CXCS 4ZGJB 3CPWA 3FJPA 3UT1A 5KYXA 3HRTA 3CQTA 1ADJA 3HFOA 4C5EA 3A74A 1WU7A 4FYXB 2L5QA 3UA6A 4KUDK 2F2VA 2XMFA 1Q7YC 4OLFA 1G3YA 4UPAA 1Y57A 2CS7A 2F1LA 1UG1A 2DETA 1PNJA 5GJWB 1KD1U 3CC4Q 3OMCA 2KRSA 1SRYA 1OZ2A 4H2UA 2H8HA 4PKCC 3TCJA 4CC3A 3KBGA 3VV0A 2GFUA 2JM9A 2B86A 3HXXA 2J6KA 4XTYA 1FYNA 4M7DC 1USYA 2EJGA 3LLRA 3HXWA 2DEUA 4M78C 4BE1A 4YRQA 2KAFA 4M77C 3R6OA 1HJDA 4IUVA 1GCQA 2EQKA 3NENA 3E19A 3EAEA 2SEMA 2RJDA 2DD4A 2BTTA 2FL7A 3G71T 3VJPA 3JV3A 4OB2B 3G6ET 2YWWA 5DM7R 1D1CA 1LJOA 3OS0A 2RF0A 2ZT6A 3BFMA 1M1KU 4ZGDB 2DTHA 2G3RA 2O4XB 1VQKT 3G4SA 4E7HA 3H0HA 2JW4A 4ZNXA 5HCKA 5GAMg 3OSSC 2GNCA 3VS1A 2A37A 3EFRA 1YITQ 2COZA 4TVAA 2OAUA 4PFZA 1IB8A 1M3CA 2PUKB 1UECA 1VYTA 4DBRA 2RHZA 3CD6T 1VQMT 1M1KR 1NBEB 4P74A 5KNNA 2RQTA 2ZZGA 1K0SA 1YJNQ 2DAQA 2JZ2A 3HY1A 4FSSA 3CCMA 1GFDA 2FPDA 2QTXA 5CK9A 1M1FA 5GMKj 1SHFA 1M90C 2KI7A 4NOYA 3MKDA 5GAOn 3V8LA 2ZPEB 2J3LA 1B07A 3HRIA 2KNBB 1IO6A 3RMSA 2E65A 1RACB 5GANh 1J3TA 4C92B 1XOVA 2RHSB 3HFVA 2NYSA 3CMAQ 4P3PA 2ZIOA 3I5SA 2VYTA 3OS2A 1NPRA 4PJOE 2DVEA 1TTHB 5A2QE 2ALYA 3RACA 3L2QA 5IT9E 1G5VA 1T3SA 2FO0A 4ATOA 1IGUA 4OF1A 1PD1A 2RHIA 2ZT5A 4XEMA 3VYGA 1K76A 3H41A 3E9GA 1QCNA 4CH5A 1D1BA 1RL2A 3S3NA 2R5MA 4X1VA 3OQ5A 1YIJT 1PKTA 1FMVA 1M4ZA 1Q81R 2OTLQ 1VQ8A 2JVVA 1G3WA 4M7AB 4BB7A 3A8HB 2X4WA 1QKXA 1PD0A 2KMTA 3A8LB 2QQ9A 3SB2A 3OYAA 4HVCA 1WHGA 2DZ9A 1SRMA 1WA7A 2PQWA 3PIPA 3C4SA 1VA7A 2HQXA 2MWOA 4Z88A 3M4YA 4AT1B 3IALA 2YUQA 4PLIA 3OMGA 2DE0X 1WDXA 1M8MA 1JJ2S 2GTJA 2LQ8A 4J7IA 1SKUB 2RQVA 2DBMA 2EGEA 3JAME 1M5Q1 4M75G 1UGVA 1WJSA 1B70B 3HRKA 3HHTB 4EMKC 1USYC 3SD4A 4YRIA 1QVPA 2FVUA 2ENMA 2ZIMA 1GCQC 1CKBA 3NELA 5KCOA 1SG5A 3CCEA 1Q82C 3X25B 1BU1A 2VXFA 5GAOp 2M0YA 1VQ7A 1K73U 1NYGA 4JS4A 4QVCA 1JXMA 2ZPFB 5GANj 2GGRA 2VKNA 4EDUA 1Y07A 2GBQA 1UGRB 3NTKA 2PMFA 3OD1A 1W4SA 2R57A 4Y28E 3RESA 4H02A 3CC2T 5GMKe 2HL3A 3RKYA 2OX7A 4YCUA 3S6WA 1OZ3A 2FPFA 2XI9A 3LH5A 4J9FA 1NJIU 3P8HA 3CCQT 2JM8A 2LQWA 1VQ6T 1PSFA 3I9QA 3OBYA 3META 1O75A 4Q5WA 3T9NA 1K73R 2M51A 4XTZA 1WX6A 2MI6A 3M4GA 2DXUA 4RCCA 4P74C 2GQIA 2KT1A 5K1PA 4P5NA 3I7FA 4KQEA 4ME7A 1G2BA 3EGXB 5CKFA 3SWNA 2LJ0A 2ZT7A 2HL5C 5HGQA 4CRIA 4IIMA 3CC4T 1B7TA 2QG9B 2FRWA 1C0MA 1JJCA 5CKHA 2DL8A 2AIRB 4RTUA 4FW1A 3JB9G 1QP2A 1Z9ZA 3E9IA 1U5SA 4YROA 4NL3A 4EX5A 2DTIA 3BJUA 4J5YA 2ZAEA 1FX7A 5GAN6 4J7FA 2NUPB 1SRLA 3CXCP 4IURA 1X6GA 3JCMJ 4RTYA 4H2SA 3G7ZA 1H92A 2E3CA 4JRIA 3GPLA 1B76A 4C8QB 1OU8A 2BUDA 3UH0A 5LJ5g 3VQXA 3CCLQ 2DKGA 1YITT 1K9MC 2EBPA 2AMCB 4CS4A 4E7SA 3MF1A 5A0DA 2DPPB 3M0TA 3EGDB 4YRSA 1VQPQ 1UB4A 2K5LA 2CP2A 3AT1B 1YJNT 1UHCA 4ANJA 2ZZFA 3TQ7P 3HP9A 5D6XA 1K8AC 1E1TA 1H4QA 2HQHA 1TH7A 5GANe 2CKKA 4JZ3A 1WPYA 1K9AA 3M4QA 5D7UA 2QXFA 2HCKA 1YN8A 1M2VA 1OEBA 3KUFA 5LJ5d 1QVFP 5I2SA 1IREB 1BBUA 1UDLA 4M7DB 1WHLA 4BD3A 2JS2A 4C0FA 3CMAT 3LSSA 5FU6C 4M78B 4M77B 1JB0E 2P84A 4HWPA 5ECAA 5EG2A 2W0ZA 2ZNJA 2RHYA 1CKAA 4Q15A 3VS2A 4CH6A 4OMFB 4GBQA 1NG2A 2EPDA 3CC7Q 3RF1A 4BI3A 2VVKA 4CH3A 4E7ZA 1BYMA 3GOXA 3X24B 3RGLA 1B34B 1QCFA 2EGCA 2OTLT 1PCXA 2HBWA 4C0GA 5KE2A 4AG1C 1S72Q 1KMNA 2QK0A 1R0CB 3NHNA 4RTTA 1EFWA 1NJ2A 2Z0WA 2OTJA 1P92A 1ZA2B 1Z7NA 3QNEA 1ZLMA 2ZXFA 1UJ0A 4H2VA 1D0ZA 1TUCA 1YJWQ 2RJFA 4RG2A 3LWIA 2CP7A 3QO5A 2EKOA 1VQMA 3CPWP 2JMAA 3E1SA 3HFNA 1NM7A 2QEXQ 3BDUA 3CBOA 5LJ5f 1NE8A 3REBB 1Q7YU 3M58A 3QZ9B 4BE0A 4MMLA 1EVLA 3NETA 2KEAA 4TVYA 3ZEHA 5I22A 1G3TA 1UJYA 3PMIA 4J15A 2ESWA 3VUBA 1WIEA 2EVRA 2P4TA 2G4CA 4FU6A 1EOVA 2K5IA 2EYXA 4BACA 2I0NA 3VQWA 2QHSA 4WF2A 3CCVQ 2QHTA 1Q7YR 4Y92A 4B6MA 4R56A 4ZTJA 4PK4A 1YI2A 1AWWA 3RL6A 1PYSB 3G1JA 2K3YA 1TU0B 3PVQA 4ZTFA 3M5AA 3X26B 2E64A 3G1ZA 4LUEA 2P0PA 2FG0A 5HKCA 4E7JA 1SEMA 1JJ2P 2DNUA 2FPEA 5KYXB 1KQ1A 1NJ1A 2EAYA 4F7UG 1YFRA 1FWZA 1RAHB 5KYYA 2RB6A 2NUTA 2CSIA 1I81A 2DX1A 3I56Q 2PU9B 1OYXA 2DXCA 1U1TA 3JCMg 2JTEA 2HSEB 3QUIA 3UGTA 1HD3A 2RN8A 3GLXA 3UDCA 3CXCA 2O9SA 4JZ4A 1A0NB 3ME9A 2VGNA 2A7YA 1UFFA 2KRMA 3SFMA 2F5TX 3OY9A 5KYNA 2KDSA 1ADYA 3DKMA 4H2WA 1AD5A 3NEMA 1UGPB 3BY7A 4RG8A 3OA6A 4O2DA 1U3OA 1HSQA 2D0NA 2J3MA 3PZCA 1C6VX 3N5BB 4PJLA 4KULA 2DVJA 2KR3A 5IH2A 1WHHA 1XQHA 3JCMd 1BI1A 4LVKA 1PRLC 2H3EB 4M75A 4KH0B 1M90R 4LD9K 4C92G 2CZ6B 2IPOB 3H6ZA 2GFAA 4A4EA 5FW9A 4BY6C 5KYUA 4MZPA 1T0JA 2EQJA 4BE2A 1WHMA 3EGUA 5DY9A 1N27A 3CCJQ 5CO7A 2LX9A 4KGVB 4LUDA 3IQLA 3CC2A 3CCLT 1VQ4A 2EQMA 2XDBA 2GF7A 4M7DF 2DLPA 3L2WA 2BE9B 3VS0A 1V76A 1UHFA 4M78F 1R0BG 4M77F 1X75C 2C0IA 2RHUA 4PG3A 5KH6A 2DU7A 5FWBA 1VQPT 1H4VB 3TSZA 2CYZB 2ZR3A 3HXZA 4A4GA 1NEGA 4M75D 1JBMA 1YCYA 4L87A 1KQ2A 1EFNA 1KK7A 1VQOQ 1QE0A 2HDAA 1YJ9T 4QW2A 2ALYB 2MWPA 4FL6A 3OYMA 3UFGA 1HC7A 3OYBA 1ABOA 4MDXA 3CCSQ 1Y96A 2YRCA 1OX9A 2ZPGB 2K79A 3OS5A 2ZZEA 3M55A 3JCMW 1PSEA 1E6HA 3RKXA 2R58A 2CJAA 3QJ6A 1IHWA 4P73A 1Q82U 1O9SA 3E9FA 3URGA 3UF4A 4XTVA 3OYCA 2IY5A 2J6FA 4IUPA 1OOTA 4OMQA 2C8MA 2QDYB 4UC4A 4TQFA 3L2ZA 3CC7T 5FWCA 8AT1B 2YSQA 4O6JA 4C92E 5J26A 3CCUQ 2JTMA 3HXYA 1SHGA 3EFOA 2X9HA 1S72T 3MEAA 2JN0A 4LN2A 3EG9A 1Q82R 1W6XA 2QA4T 2LCCA 4PJOG 3TUPA 2MAMA 1G5IA 5GAMe 3IKLA 3M4PA 2PMEA 3U23A 4EMKA 2KYMA 2WACA 4HCKA 1VQLA 1Z9QA 2C0OA 5LJ5h 2DRMA 1YJWT 4KGXB 3V8JA 1AWOA 1VQ9Q 4M7AE 1IRXA 1QMCA 3HKSA 1BCOA 1KD1R 1PWTA 2HKQB 4BW9A 3A7RA 4MMKA 2QEXT 1X2GA 3J7AF 4E7KA 1JJ2A 1UGQB 2BZ8A 1WJRA 1MV3A 4QQDA 1AVZC 3JB9D 2YT6A 2HKNA 2JMCA 2X35A 4JS5A 2Q7EA 4LVMA 2CREA 1X6OA 4M75C 5FU7B 2EJ9A 2QQBA 2O31A 4JRKA 2KSSA 4FYVB 4OMOA 1GBQA 2E41A 1LPLA 3UWNA 4C0ZA 2ZGWA 3CCVT 4QKUA 1Y0MA 4WCIA 1I4K1 2DXBA 3E9HA 4E51A 4PJNA 4YRNA 2M0OA 4LVLA 3VRYA 4C5IA 2D0QB 2HD0A 1AEYA 4JJDA 2EYYA 2QI2A 5HY6A 4JRQA 2OTLA 2AKWA 2DU5A 2ATCB 3ZL7C 3TU4K 5GAMd 1AZEA 1X69A 2K5FA 2WSCE 3SWNB 3O8VA 5CCAA 5CKDA 2MIOA 3I56T 1K9MU 3NTHA 2H3JA 4PFOA 3LSQA 4R0KA 4YRTA 1YB3A 5K1XA 4HA8A 3VRZA 2BIVA 5KYWA 4B9XA 4BDZA 5GMKm 2Q5IA 1JJCB 2FZKB 2Q7GA 3L2UA 2KE9A 3TREA 3G4SQ 4C8QG 1X43A 4TTVA 2L8DA 1YFSA 2HNIA 2YRDA 3M0QA 2LDMA 1GGMA 2VB6A 3A7UA 1K8AU 2LNVA 3X20B 1J5WA 4YP0A 3A5ZA 2AKLA 2RPNA 1FMKA 2X4YA 3UGQA 1K9MR 2VXEA 5C0MA 5LJ5j 3HFZA 2X51A 4P73C 1RI0A 3L2VA 1QKWA 4CC7A 3CCMQ 3A32A 2KBTA 3OW2S 1UGSB 3MF2A 4DEYA 3I55T 4TQDA 4XU1A 5ELNA 2CZ1B 3JCMX 3MP8A 1WI7A 1B7YA 4N4GA 5A0LA 1ATIA 1C1AA 1NPPA 1ZHIA 2V1QA 2DEQA 2XKOC 5GAMf 4HWTA 3CCJT 4YREA 3D7SB 4PHCA 4OP0A 2V8KA 1NNHA 4YDQA 3REUA 1WQ7A 3LC0A 3L2RA 5GAN8 1VYUA 1VQ8Q 1X56A 2F2WA 2RH2A 1M2VB 2M16A 2XIDA 1YHQQ 4HT4A 1PHTA 5IHKA 3RR6A 3NMZC 2MYSA 1VQOT 4C8QE 1K0XA 1C0AA 4RKUE 4F7UA 3L42A 1NJ8A 1ASZA 3JCMh 1ZX6A 3CCST 4HVVA 4L59A 3MHXA 3HRSA 1E24A 3PCOA 1MUZA 3NGPA 5GAN4 1WYDA 4F16A 1GBRA 4DBHA 1BBWA 1VQZA 3LX7A 3RIRA 3GP8A 4GLMA 1BK2A 1VQNA 1EIYA 1YGBA 3MEWA 2K3XA 4P3OA 4F17A 3JCMP 3GF5A 4M7DE 3A31A 1NJIR 1N9RA 3QKJA 2KK4A 2PVGB 3CCEQ 4M78E 4M77E 1ACMB 5C52B 1ZUKA 3QTCA 1XJWB 2DYBA 1UE9A 1MNDA 1M3AA 2LC4A 4ZN3A 3LW5E 4FCYA 1UTIA 4KH1B 3I5RA 5LJ5e 1VYVA 3CMEA 2I4LA 2DBKA 5AYFA 1TOVA 4C92A 1MV0B 3FJ5A 12ASA 1BB9A 4CH4A 2ZPIB 2ZCEA 1LVKA 1VQ9T 3A5YA 1BI3A 1Q86U 5CR2A 1D0YA 2PVDB 1AOJA 2RJEA 2ARUA 3Q1JA 2QDLA 2J06A 3SEMA 1I0CA 3QIIA 4EMHA 2Q5HA 4L5GA 4OB3B 5LL6S 3CCRA 2I4OA 1YJ9A 1RAFB 1D1AA 1R8OB 1RAAB 1RUWA 2E4HA 3L4GA 3DLLA 4Y91A 2LP5A 5FROA 1B3QA 2EIFA 1RLQC 2Y4XA 5IHNA 5GMKi 4ZIBA 4C92D 4P75A 2ZNIA 4H2TA 1NZ9A 2A3LA 2RQUA 4IKFA 2EL9A 4XU0A 2EQUA 2DK3A 3PNWC 2RK2A 3J80E 2DQ3A 3A8MB 1BCMA 2EW3A 4XTWA 4ZTUB 1QW1A 2MF2A 2D1XA 2QAZA 4Z02A 4R55A 1NLPC 6AT1B 3J81E 3HXUA 5KYYB 2ARTA 3CC7A 4IIOA 1SPKA 4LDXA 3GIBA 3M0RA 2BZYA 2ED0A 4J9DA 4LNPA 4RDXA 1UEBA 1QQJA 1TUDA 1W70A 4AG2C 1S72A 1RLPC 1FYFA 2L3PA 4P71A 3QZ5B 3REXA 4HXJA 2QA4A 1X01A 3R6NA 2ZPHB 3W3SA 3M0SA 2J05A 1PG5B 3C12A 3P8DA 4KR3A 1E1OA 1KQSS 1M2OA 3EG2A 4OGCA 5M9OA 1YJWA 4HVWA 1NYQA 1GFCA 1TS9A 2K3BA 4PJOA 2YRVA 3V7RA 3JCMV 3G71A 4H2XA 3G6EA 3ER0A 2QEXA 1D3BA 4M75B 2LJ1A 5ELOA 2K6DA 1H4TA 2JNGA 2I4NA 2QASA 2A8EA 1EVKA 2CP5A 1VQKA 2QTVA 3CCMT 4YRMA 4KT0E 5KYUB 3TEEA 1PC0A 3THKA 1X2KA 4DOWA 3QHSA 1ZBXA 5L23A 1BBZA 5GAMh 2I2LA 1IHVA 4N0AA 4YRFA 3A98A 5I2MA 2O01E 2RM4A 3CD6A 3HPWA 5LJ3g 4ZTZB 4ELZC 3VS5A 1OX8A 3H0IA 3UA7A 1GCPA 1YBYA 4Q6GA 3OYNA 4N4HA 2M1HA 4PJOD 2CP0A 3SHWA 3FDRA 1ZUUA 1ZA1B 4C92C 3HTZA 3OYEA 2E1HA 2RK1A 1WNLA 2J7IA 5KCHA 4OGEA 2C7IA 2WSFE 4OVAA 1H4SA 2AT1B 1Y96B 3TEHB 1T3LA 1YFNA 2K2VA 1YHQT 1AWJA 3VBBA 3JCMe 4D8DA 2CP3A 2P4RA 2A28A 5LJ3d 1X27A 4UP8A 5E3IA 3JSCA 4YRGA 4MDWA 4XTXA 1KC8U 3HSBA 2ZR2A 1OV3A 5C6SA 3RMQA 3BW1A 2OTJQ 1YIJA 1WZOA 2XDDA 3FC3A 4EIKA 4E2FB 5GAOr 4PNOA 3JB9H 4J9EA 4P75C 1I1JA 2LT1A 4C0DC 3IKMB 4AFZC 1TXQA 1ZSZA 4C8QA 5CKBA 2QHVA 4QQ6A 4FT4A 4B9WA 2R5AA 1JU5C 4X9DA 4YRJA 5D6YA 3EFOB 2C06A 5I21A 4C5HA 4K88A 3DLMA 1QP3A 3PT9A 3QPHA 3EG9B 1Q86C 3I55A 1UUEA 1QLYA 4A63B 1X2HA 1MMNA 4AFQC 4A4FA 4EMKB 2P0LA 3CCET 3PVLA 4HWSA 4MZTA 4A54A 3QDRB 4P71C 1V1CA 2GTOA 2ABLA 3GNGA 4JDSA 1FXXA 3CBMA 3CCJA 5GAMj 2I4MA 4H2YA 2L0AA 1YI2Q 1OULA 4XAXB 3VS6A 4WTOB 4LVJA 2K9GA 2FB7A 4EMGA 3EFSA 3FB9A 1I5OB 5LJ3f 1G8XA 2JOYA 4PJOC 2L3QA 2DD5A 4A53A 4CC4B 4II1A 4HT9A 2ED1A 4BUGA 1VQ5Q 4AFUC 5FRNA 2DJQA 1GL5A 2F69A 2L2PA 4TVAB 1N8RU 1VQOA 4WJ3M 2ZPBB 1QWFA 2XD0A 4N4IA 3PTAA 2K2MA 5GJVB 1MMDA 2RQRA 3ASKA 1W1FA 4P72A 1U1SA 2YXYA 2ZT8A 1WLEA 2LNHB 3CCQA 4K86A 1VQ6A 1G83A 1RI9A 4N0AC 2E10A 2QQRA 3EG3A 2PZ1A 2IIMA 3VYHB 4M7AG 3PFSA 2AKWB 1F1BB 1HK9A 1NEBA 3QO8A 2DDZA 2AHJB 2RHXA 3ZBDA 5F5WA 1N9WA 3OYGA 2LTOA 2K4YA 1MNEA 3TEGA 1AHJB 1WJQA 4P3NA 5HK3A 5AT1B 3JRZA 2LQKA 4M4ZA 4J6XA 5KYWB 1QWEA 1YP5A 5I11A 1EIFA 4RTXA 3MCAB 4M75F 1DJ7B 3CC4A 2BE7D 4ZGEB 3OYJA 1WXUA 4CS3A 4AMCA 3JCMf 2EYQA 2CZ0B 2PUOB 4A4KA 1ZUYA 2ODRC 2KXCA 3CPFA 1BIBA 3A5ZB 1ZBJA 3LH0A 2DL7A 3KFVA 3HFZB 1M1GA 3CC2Q 2CT4A 4J83A 3UATA 1VQ4Q 2IG0A 4YRRA 3QJYA 3RERA 1YFTA 2M02A 1RADB 1QCOA 5GAN7 2E5AA 3MP6A 1ZSZC 4C8QC 1QVGS 2JS0A 2XDPA 1OU9A 2LT4A 1KSWA 5GAN2 1B7YB 1XTDA 2KQWA 2PNIA 3QO3A 4TVWA 1YITA 1HXDA 2VC8A 2XTIA 3OW2A 3RKWA 1KHIA 2DA9A 5CIUA 1WGSA 4C5GA 1KC8C 3FEOA 1E7OA 1KOGA 1SETA 4JUVA 1YJNA 3S3MA 5FU6B 5D6WA 2M9UA 4A4HA 1KQSP 2IVWA 1WYXA 5KE3A 2DILA 4HCBA 2ZINA 4YTLA 2RQWA 4J6YA 1XNIA 4XEOA 1NLOC 1E6GA 4F7UB 2CJBA 3CMAA 2DL4A 1QVFS 3JB9F 4CI0C 5FRMA 1Y71A 3PCOB 1K1ZA 1W2BS 4YRKA 2EWNA 2VUBA 4J9GA 1EX4A 4UP9A 1OQKA 4E7LA 3A8GB 3VQYA 2KYBA 1MHNA 2DIGA 4LDUA 3LYIA 3EH2A 2OAWA 4KGZB 2LMJA 2OTJT 2YUNA 4J9BA 5J3BA 3H0FA 2JXBA 4FT2A 2MCNA 1VQLQ 4P72C 2CJ9A 1EIYB 2DFUA 5GAN3 2XGTA 3X28B 2CP6A 1N6AA 2MPXC 2L89A 3OYYA 3ULRB 1KMMA 2PVOB 11ASA 2DTOA 4JRPA 3OB9A 2CH4A 1YCSB 3MEYA 2HEQA 2RNAA 1SSFA 3V8KA 3V7CA 3M9QA 1SSHA 3MJXA 4FYWB 3BDLA 2HSPA 2RD1A 4OB0B 4E47A 2LVMA 4WJ4A 2X4JA 2RHQA 3EH1A 4QVZA 1ZQ1A 1N8RC 2D6FA 3DB3A 1PRMC 3VUZA 1Q81U 3HY0A 5GAOl 2DXTA 2YUOA 3HXVA 2RJCA 3BE3A 1BI2A 4XTUA 3CPWS 2XHCA 4FM4B 4BI8B 4JPBW 1KFZA 4OMMA 3OYDA 5LJ3h 1YI2T 4V2SA 4GLKA 1H8KA 2RI5A 2FZCB 1MMGA 3CMQA 4YRPA 1N5ZA 5IXBA 2GCXA 1L0WA 3L4GB 2HQEA 1K8AR 3HTRA 2CDTA 1NJ5A 4RMOA 2DYIA 2XU8A 1E22A 5DLQE 2E12A 4MZMA 4M7DG 1VQ5T 1YHQA 1Y7XA 2CSQA 4J6WA 2FZGB 4M78G 2FEIA 4M77G 4JLGA 3C94A 2X3WD 2MMPA 2FHDA 2A08A 2CGHA 4C0DB 4J9CA 3I35A 5C51B 3EHRA 2YLBA 2K57A 4NL2A 4XU2A 1X6BA 3F70A 2VWFA 8ATCB 4JLIA 1YNZA 1VIFA 2RO0A 5A0GA 1NYRA 3EG1A 4OMPA 3M0UA 3FIFA 2RA2A 4HT8A 1X54A 4X9CA 4FYYB 1Q95G 1M8VA 3QSUA 2V8JA 5EC7A 3M0PA 4BI4A 2LCSA 4WI1A 4UP7A 2AZVA 4LDVA 2HBPA 4E6RA 1VIEA 4F04B 3H9NA 2O4XA 3M53A 4LNSA 2D9TA 3OBWA 2RMOA 1LYLA 1U06A 3M56A 4PJOB 2LCLA 4EPCA 2LX7A 2CUDA 1NYFA 4YCWA 4H2XB 9ATCB 1D3BB 2V1RA 1YWOA 2GQVA 3M54A 4BY6B 2O88A 1KD1C 1AZGB 4ZN1A 1VQ4T 3INZA 2NLUA 3OYKA 2LJ3A 1K4US 5LJ3j 4FSXA 3CBPA 3MO8A 1KQSA 2XICA 1BKBA 3QWYA 2RI3A 3CCUT 3AHUA 1JO8A 5CVIA 3RUXA 2KT8A 2PTKA 3VS3A 2QQSA 1WHKA 2L3RA 4LVIA 2SRCA 2CH4W 1VQ7Q 2KRNA 4PLLA 1RAIB 2JTFA 2LRQA 5GAOm 4TWAA 2Y90A 2B8AA 4J9HA 1KJWA 3CCLA 4HWRA 2RHSA 1QF6A 2DJZA 3FLGA 3EHQA 4F7UF 2COYA 4YYEA 4X5OA 1M1KC 3OYLA 2QGFB 1TWBA 2BKDN 1VQPA 2J6OA 4M75E 4G84A 2E3HA 2DF6A 4D8KA 4QQGA 4DEXA 4DQ2A 2AKKA 1SF9A 2QHUA 4DPGA 2HZYA 3WVDB 1VQNQ 2FRYA 3QG1A 4M7AA 1IXDA 4E7IA 1GXIE 2G6FX 1KG1A 2KGTA 3UPUA 2VGMA 1B8AA 1SESA 2FYKA 1I07A 2MOXA 3NFCA 1QVGP 1VUBA 1YWPA 5CAIA 1Q86R 2EKHA 3PMTA 3LWHA 3LGFA 2ROLA 3QXEB 2VASA 4K11A 1M30A 3C95A 2HMAA 2DO3A 3A7AA 1ZSZB 1Z7MA 1JRIA 1R77A 3CMEQ 1Q81C 1S1NA 1OPLA 2NUTB 2COWA 4VUBA 3VS4A 1RIQA 3NPFA 4C92F 3JCMb 1MMAA 2DL5A 1RAEB 1VQLT 3OYIA 1PM3A 2V26A 2OJ2A 4HVUA 3MPUB 2YUPA 3A1PA 3FRNA 1B70A 3MEUA 4M7AD 4J8OA 7AT1B 2JJ9A 2EFIA 4L6V5 4YRCA 3PE0A 3HRUA 3QBYA 1IZ6A 4ORZA 5GAN5 2A36A 3CCRQ 1HTTA 3V7SA 3PGGA 1YJ9Q 2ARSA 4OMNA 5CKEA 1BIAA 3KXTA 3G4ST 2DQ0A 5IXFA 2LQNA 4K87A 4M7AF 2EQIA 4Z89A 3WXMB 3LGLA 5LJ3e 1W2BP 2MK5A 2DIQA 3ICAA 4YRLA 2KXDA 2NS6A 2C0TA 4XU3A 3A8OB 3REAB 4AH6A 1GRIA 4KBMB 3QDFA 5FU7C 4FW2A 4TVRA 1OI1A 4RMFA 4RQEA 2CIMA 5DLOA 1I5LA 3RNJA 3M57A 4IUQA 4ELYC 3P8YA 3HL8A 5GANg 2AK5A 2DMOA 1X2QA 1TG0A 4IUUA 3DSQA 2W10A 4BDYA 2NWMA 1G51A 1FMWA 1PKSA 3C0CA 1D09B 3CCVA 1AWXA 4F14A 1T0HA 5FLXE 3EGXA 2CUBA 2QYZA 2QA4Q 3OYHA 5L8RE 4DOVA 2BZXA 1KIKA 2DZCA 4EO4A 1M3BA 4HKEA 3SWNC 5IN1A 1N9SA 1K73C 2P0KA 3MP1A 2KY9A 2YDLA 5GANd 3OYFA 4DBQA 4PJOF 2O9VA 1VQ8T 2D8HA
chains in the Genus database with same CATH topology
5GAOq 5IAYA 3I56A 4RCBA 3OSVA 1SERA 1NJIC 3S3OA 3VQVA 3R07A 1ASYA 5C53B 1LNXA 4M7AC 3P8TA 4XQ3A 3VKIA 2IY5B 2YLCA 4JJNK 2ZTGA 4LDYA 2Y4YA 1NJ6A 2AMCA 3WQZA 4IUTA 2CZ7B 2P0QA 2HAXA 2QQAA 4XK8E 2ODRD 4QVDA 4KR2A 3JB9J 1VQ5A 3QO7A 3JCMQ 1VQ7T 3M59A 1QVGA 5GANf 1KHCA 5CQYA 3P8BB 4M7DA 2V8IA 3NTIA 4C8QD 4M78A 4M77A 4G85A 2F5KA 3ERRA 4D6WA 1M90U 4O5VA 2XK0A 2VV5A 4C8QF 3QYHB 1VQNT 1B34A 4FIBA 4CS2A 1X55A 4HCZA 3CCSA 4X34A 4GY5A 3MQZA 2E6ZA 1H641 1BI0A 1WQWA 1U8RA 4M7DD 2ZZDA 2XG8D 3L1AA 2X4XA 3MEVA 4BWAA 3JB9I 4M78D 1LOJA 4M77D 2JUFA 1IL2A 4NCXA 1QVFA 2WSEE 4HWOA 1W2BA 3CMET 2E70A 1G3SA 4PL6A 4F7UE 3QYGB 3H8ZA 4LD6A 4HCCA 3CCUA 4NS5A 3CEYA 2YHTA 1I8FA 2ZCFB 2RHQB 3ZFJA 2RI2A 1H3ZA 2E6NA 3PIOA 3CCRT 3SDZA 2Q7HA 3DB4A 2P5IA 1MGQA 3IG2A 2KVQG 3KFUA 2E5QA 1G5HA 4YPFA 3JCMc 3TEHA 1VQ9A 5GMKl 4DA4A 4YCVA 1V29B 5HK0A 1EQRA 1W66A 4OB1B 5GMKh 2EJFA 3VU3C 5J39A 3OS1A 4KUIA 1M9SA 1PYSA 4RQFA 3GNFB 3WVEB 3P8VA 5CQXA 4LDWA 3CXCS 4ZGJB 3CPWA 3FJPA 3UT1A 3HRTA 1ADJA 3HFOA 4C5EA 3A74A 1WU7A 2L5QA 4KUDK 4OLFA 1Q7YC 1G3YA 4UPAA 2CS7A 1KD1U 3OMCA 1SRYA 1OZ2A 4H2UA 4PKCC 3TCJA 3KBGA 3VV0A 2GFUA 3HXXA 4XTYA 1USYA 4M7DC 2EJGA 3LLRA 3HXWA 4M78C 4BE1A 4YRQA 2KAFA 4M77C 3R6OA 4IUVA 2EQKA 3NENA 3E19A 3EAEA 2RJDA 2DD4A 2FL7A 3G71T 3VJPA 3G6ET 4OB2B 5DM7R 1LJOA 3OS0A 2ZT6A 3BFMA 1M1KU 4ZGDB 2DTHA 2G3RA 2O4XB 1VQKT 3G4SA 4E7HA 5GAMg 3OSSC 3EFRA 4TVAA 2OAUA 2PUKB 2RHZA 3CD6T 1VQMT 4P74A 5KNNA 2ZZGA 2DAQA 2JZ2A 3HY1A 3CCMA 2QTXA 5CK9A 1M1FA 5GMKj 1M90C 4NOYA 5GAOn 3V8LA 2ZPEB 2J3LA 3HRIA 3RMSA 2E65A 5GANh 3HFVA 4C92B 1XOVA 2RHSB 4P3PA 2ZIOA 2VYTA 3OS2A 1NPRA 4PJOE 2DVEA 5A2QE 2ALYA 3RACA 3L2QA 5IT9E 1G5VA 4ATOA 4OF1A 2RHIA 2ZT5A 4XEMA 3VYGA 3E9GA 4CH5A 1RL2A 3S3NA 2R5MA 3OQ5A 1YIJT 1M4ZA 1VQ8A 2JVVA 1G3WA 4M7AB 4BB7A 3A8HB 2X4WA 2KMTA 3A8LB 2QQ9A 3SB2A 3OYAA 4HVCA 2DZ9A 2PQWA 3PIPA 3C4SA 2HQXA 2MWOA 3M4YA 3IALA 4PLIA 3OMGA 1JJ2S 2LQ8A 4J7IA 3JAME 1M5Q1 4M75G 1WJSA 1B70B 3HRKA 3HHTB 4EMKC 1USYC 3SD4A 4YRIA 1QVPA 2FVUA 2ZIMA 3NELA 5KCOA 1Q82C 3CCEA 3X25B 2VXFA 5GAOp 1VQ7A 1K73U 4JS4A 4QVCA 2ZPFB 5GANj 4EDUA 1Y07A 3NTKA 1UGRB 2PMFA 3OD1A 1W4SA 2R57A 4Y28E 3RESA 4H02A 3CC2T 5GMKe 3RKYA 4YCUA 3S6WA 1OZ3A 2XI9A 1NJIU 3P8HA 3CCQT 1VQ6T 1PSFA 3OBYA 3META 1O75A 4Q5WA 3T9NA 4XTZA 2MI6A 3M4GA 2DXUA 4RCCA 4P74C 5K1PA 4P5NA 3I7FA 4KQEA 4ME7A 5CKFA 3SWNA 2ZT7A 5HGQA 4CRIA 3CC4T 1JJCA 5CKHA 3JB9G 1QP2A 3E9IA 4YROA 4NL3A 4EX5A 2DTIA 3BJUA 4J5YA 1FX7A 5GAN6 4J7FA 4IURA 3JCMJ 4H2SA 3G7ZA 2E3CA 4JRIA 3GPLA 1B76A 4C8QB 3UH0A 2BUDA 5LJ5g 3VQXA 2DKGA 1YITT 1K9MC 2AMCB 4CS4A 3MF1A 5A0DA 2DPPB 4YRSA 1UB4A 2K5LA 1YJNT 2ZZFA 1H4QA 3HP9A 5D6XA 1K8AC 1E1TA 1TH7A 5GANe 2CKKA 1WPYA 3M4QA 2QXFA 3KUFA 5LJ5d 5I2SA 1IREB 1BBUA 4M7DB 4BD3A 4C0FA 3CMAT 3LSSA 5FU6C 4M78B 4M77B 1JB0E 4HWPA 5EG2A 2ZNJA 2RHYA 4Q15A 4CH6A 4OMFB 3RF1A 4BI3A 4CH3A 1BYMA 3GOXA 3X24B 3RGLA 1B34B 2OTLT 4C0GA 5KE2A 1KMNA 1EFWA 1NJ2A 2OTJA 1P92A 1Z7NA 3QNEA 2ZXFA 4H2VA 2RJFA 4RG2A 3LWIA 3QO5A 2EKOA 1VQMA 3E1SA 3HFNA 3BDUA 3CBOA 5LJ5f 1NE8A 1Q7YU 3M58A 3QZ9B 4BE0A 4MMLA 1EVLA 3NETA 4TVYA 3ZEHA 1G3TA 3PMIA 4J15A 3VUBA 2P4TA 2G4CA 4FU6A 1EOVA 2K5IA 4BACA 3VQWA 2QHSA 4WF2A 2QHTA 4R56A 4ZTJA 1YI2A 3RL6A 1PYSB 2K3YA 4ZTFA 3M5AA 3X26B 2E64A 3G1ZA 2P0PA 5HKCA 4E7JA 1KQ1A 1NJ1A 2EAYA 4F7UG 1YFRA 1FWZA 2RB6A 1I81A 2PU9B 1OYXA 2DXCA 1U1TA 3JCMg 3QUIA 3UGTA 3GLXA 3UDCA 3CXCA 3ME9A 2VGNA 2A7YA 3SFMA 2F5TX 3OY9A 1ADYA 2KDSA 3DKMA 4H2WA 3NEMA 1UGPB 3BY7A 4RG8A 3OA6A 4O2DA 2J3MA 3PZCA 3N5BB 4KULA 1XQHA 3JCMd 1BI1A 4LVKA 4M75A 4LD9K 4C92G 2CZ6B 3H6ZA 2GFAA 4A4EA 4BY6C 4MZPA 2EQJA 4BE2A 5DY9A 1N27A 5CO7A 2LX9A 3CC2A 3CCLT 1VQ4A 2EQMA 2XDBA 2GF7A 4M7DF 3L2WA 4M78F 4M77F 1X75C 2RHUA 4PG3A 5KH6A 2DU7A 1VQPT 1H4VB 2CYZB 2ZR3A 3HXZA 4A4GA 4M75D 1JBMA 1YCYA 4L87A 1KQ2A 1QE0A 1YJ9T 4QW2A 2ALYB 2MWPA 4FL6A 3OYMA 3UFGA 1HC7A 3OYBA 4MDXA 1Y96A 2ZPGB 3OS5A 2ZZEA 3M55A 3JCMW 1PSEA 2CJAA 2R58A 3RKXA 3QJ6A 4P73A 1Q82U 1O9SA 3E9FA 3URGA 4XTVA 3OYCA 2IY5A 4IUPA 2C8MA 2QDYB 4UC4A 4TQFA 3L2ZA 3CC7T 4O6JA 4C92E 5J26A 2JTMA 3HXYA 1S72T 3MEAA 2JN0A 2QA4T 2LCCA 4PJOG 3TUPA 2MAMA 1G5IA 5GAMe 3IKLA 3M4PA 2PMEA 4EMKA 2WACA 1VQLA 5LJ5h 1YJWT 3V8JA 4M7AE 3HKSA 4BW9A 3A7RA 4MMKA 2QEXT 1X2GA 3J7AF 4E7KA 1JJ2A 1UGQB 1WJRA 4QQDA 3JB9D 2X35A 4JS5A 2Q7EA 4LVMA 1X6OA 4M75C 5FU7B 2EJ9A 2QQBA 4JRKA 2KSSA 2E41A 4C0ZA 3UWNA 2ZGWA 3CCVT 1I4K1 2DXBA 3E9HA 4E51A 4YRNA 2M0OA 4LVLA 4C5IA 2D0QB 2HD0A 2QI2A 5HY6A 4JRQA 2OTLA 2AKWA 2DU5A 3TU4K 5GAMd 2K5FA 2WSCE 3SWNB 3O8VA 5CCAA 5CKDA 3I56T 1K9MU 3NTHA 2H3JA 3LSQA 4YRTA 5K1XA 1YB3A 4HA8A 2BIVA 4BDZA 4B9XA 5GMKm 2Q5IA 1JJCB 2Q7GA 3L2UA 3TREA 4C8QG 4TTVA 2L8DA 1YFSA 2HNIA 2LDMA 1GGMA 3A7UA 1K8AU 2LNVA 3X20B 1J5WA 4YP0A 3A5ZA 2X4YA 3UGQA 2VXEA 5C0MA 5LJ5j 3HFZA 4P73C 1RI0A 3L2VA 3A32A 3OW2S 1UGSB 3MF2A 3I55T 4TQDA 4XU1A 5ELNA 2CZ1B 3JCMX 3MP8A 1B7YA 4N4GA 5A0LA 1ATIA 1NPPA 1ZHIA 2DEQA 2XKOC 5GAMf 4HWTA 3CCJT 4YREA 4PHCA 4OP0A 2V8KA 1NNHA 4YDQA 3REUA 1WQ7A 3LC0A 3L2RA 5GAN8 1X56A 2RH2A 2M16A 2XIDA 4HT4A 1VQOT 4C8QE 1C0AA 4RKUE 4F7UA 3L42A 1NJ8A 1ASZA 3JCMh 3CCST 4L59A 3MHXA 3HRSA 1E24A 3PCOA 5GAN4 1WYDA 1BBWA 1VQZA 3LX7A 3RIRA 3GP8A 1VQNA 1EIYA 1YGBA 3MEWA 2K3XA 4P3OA 3JCMP 3GF5A 4M7DE 3A31A 1N9RA 3QKJA 2KK4A 2PVGB 4M78E 4M77E 5C52B 3QTCA 2LC4A 4ZN3A 3LW5E 5LJ5e 3CMEA 2I4LA 5AYFA 4C92A 12ASA 4CH4A 2ZPIB 2ZCEA 1VQ9T 3A5YA 1BI3A 1Q86U 5CR2A 2PVDB 2RJEA 2ARUA 3Q1JA 3QIIA 4EMHA 2Q5HA 4L5GA 4OB3B 5LL6S 3CCRA 2I4OA 1YJ9A 1R8OB 3L4GA 3DLLA 4Y91A 5FROA 2EIFA 2Y4XA 5GMKi 4ZIBA 4C92D 4P75A 2ZNIA 4H2TA 1NZ9A 2A3LA 4IKFA 2EL9A 4XU0A 2EQUA 2DK3A 3PNWC 2RK2A 3J80E 2DQ3A 3A8MB 4XTWA 4ZTUB 1QW1A 2MF2A 4Z02A 4R55A 3J81E 3HXUA 2ARTA 3CC7A 4LDXA 3GIBA 4RDXA 1UEBA 1S72A 1FYFA 4P71A 3QZ5B 3REXA 2QA4A 1X01A 2ZPHB 3W3SA 3C12A 3P8DA 4KR3A 1E1OA 1KQSS 1YJWA 4OGCA 5M9OA 1NYQA 4PJOA 2YRVA 3V7RA 3JCMV 3G71A 4H2XA 3G6EA 3ER0A 2QEXA 1D3BA 4M75B 5ELOA 1H4TA 2JNGA 2I4NA 2A8EA 1EVKA 1VQKA 3CCMT 4YRMA 4KT0E 3TEEA 4DOWA 3QHSA 1ZBXA 5GAMh 2I2LA 4N0AA 4YRFA 5I2MA 2O01E 2RM4A 3CD6A 3HPWA 5LJ3g 4ZTZB 4ELZC 1YBYA 4Q6GA 3OYNA 4N4HA 2M1HA 4PJOD 3FDRA 4C92C 3HTZA 3OYEA 2E1HA 2RK1A 1WNLA 5KCHA 4OGEA 2C7IA 2WSFE 4OVAA 1H4SA 1Y96B 3TEHB 2K2VA 1YHQT 3VBBA 3JCMe 5LJ3d 4UP8A 5E3IA 3JSCA 4YRGA 4MDWA 4XTXA 1KC8U 3HSBA 2ZR2A 5C6SA 3RMQA 3BW1A 1YIJA 2XDDA 3FC3A 5GAOr 4PNOA 3JB9H 4P75C 2LT1A 4C0DC 3IKMB 4C8QA 5CKBA 2QHVA 4QQ6A 4FT4A 4B9WA 2R5AA 4X9DA 4YRJA 5D6YA 2C06A 5I21A 4C5HA 4K88A 3DLMA 1QP3A 3PT9A 3QPHA 1Q86C 3I55A 1X2HA 4A4FA 4EMKB 2P0LA 3CCET 4HWSA 4MZTA 4A54A 3QDRB 4P71C 3GNGA 4JDSA 1FXXA 3CBMA 2I4MA 5GAMj 3CCJA 4H2YA 4XAXB 4LVJA 2FB7A 4EMGA 3EFSA 3FB9A 5LJ3f 2JOYA 4PJOC 2DD5A 4A53A 4II1A 4HT9A 4BUGA 5FRNA 2F69A 4TVAB 4WJ3M 1N8RU 1VQOA 2ZPBB 2XD0A 4N4IA 3PTAA 3ASKA 4P72A 1U1SA 2ZT8A 1WLEA 3CCQA 4K86A 1VQ6A 4N0AC 2E10A 2QQRA 3VYHB 4M7AG 3PFSA 2AKWB 1HK9A 3QO8A 2DDZA 2AHJB 2RHXA 3ZBDA 5F5WA 1N9WA 3OYGA 2LTOA 2K4YA 3TEGA 1AHJB 1WJQA 4P3NA 5HK3A 3JRZA 2LQKA 4J6XA 1EIFA 3MCAB 4M75F 1DJ7B 3CC4A 4ZGEB 3OYJA 4CS3A 3JCMf 2EYQA 2CZ0B 2PUOB 4A4KA 2ODRC 3CPFA 1BIBA 3A5ZB 3LH0A 3HFZB 1M1GA 4J83A 2IG0A 4YRRA 3QJYA 3RERA 1YFTA 5GAN7 2E5AA 3MP6A 4C8QC 1QVGS 2XDPA 2LT4A 5GAN2 1B7YB 1XTDA 2KQWA 3QO3A 4TVWA 1YITA 1HXDA 2VC8A 2XTIA 3OW2A 3RKWA 1KHIA 5CIUA 1WGSA 4C5GA 1KC8C 3FEOA 1KOGA 1SETA 4JUVA 1YJNA 3S3MA 5FU6B 5D6WA 2M9UA 4A4HA 2IVWA 5KE3A 4HCBA 2ZINA 4YTLA 4J6YA 1XNIA 4XEOA 4F7UB 2CJBA 3CMAA 1QVFS 3JB9F 4CI0C 5FRMA 1Y71A 3PCOB 1W2BS 4YRKA 2EWNA 2VUBA 4UP9A 4E7LA 3A8GB 3VQYA 1MHNA 2DIGA 4LDUA 3LYIA 2OTJT 5J3BA 4FT2A 4P72C 1EIYB 2CJ9A 5GAN3 2XGTA 3X28B 1N6AA 2L89A 3OYYA 11ASA 1KMMA 2PVOB 2DTOA 4JRPA 3OB9A 3MEYA 3V8KA 1SSFA 3V7CA 3M9QA 3BDLA 2RD1A 4OB0B 4E47A 2LVMA 4WJ4A 2X4JA 2RHQA 4QVZA 1ZQ1A 1N8RC 2D6FA 3DB3A 3VUZA 1Q81U 3HY0A 5GAOl 2DXTA 3HXVA 2RJCA 1BI2A 4XTUA 3CPWS 2XHCA 4FM4B 4BI8B 3OYDA 5LJ3h 1YI2T 4V2SA 4GLKA 2RI5A 3CMQA 4YRPA 2GCXA 1L0WA 3L4GB 2HQEA 1NJ5A 4RMOA 2XU8A 1E22A 5DLQE 2E12A 4MZMA 4M7DG 1VQ5T 1YHQA 1Y7XA 4J6WA 4M78G 4M77G 4JLGA 3C94A 2MMPA 2FHDA 2CGHA 4C0DB 5C51B 2YLBA 2K57A 4NL2A 4XU2A 3F70A 4JLIA 1VIFA 2RO0A 5A0GA 1NYRA 3FIFA 2RA2A 4HT8A 1X54A 4X9CA 1M8VA 3QSUA 2V8JA 4BI4A 4WI1A 4UP7A 4LDVA 2HBPA 1VIEA 2O4XA 3M53A 4LNSA 2D9TA 3OBWA 1LYLA 3M56A 4PJOB 2LCLA 4EPCA 4YCWA 4H2XB 1D3BB 2GQVA 3M54A 4BY6B 1KD1C 4ZN1A 1VQ4T 3INZA 2NLUA 3OYKA 5LJ3j 4FSXA 3CBPA 3MO8A 1KQSA 2XICA 1BKBA 2RI3A 3CCUT 3AHUA 5CVIA 3RUXA 2QQSA 2L3RA 4LVIA 4PLLA 2JTFA 2LRQA 5GAOm 4TWAA 2Y90A 2B8AA 4HWRA 3CCLA 2RHSA 1QF6A 2DJZA 3FLGA 4F7UF 4YYEA 4X5OA 1M1KC 3OYLA 2BKDN 1VQPA 4M75E 4G84A 4QQGA 4DQ2A 2QHUA 4DPGA 3WVDB 3QG1A 4M7AA 4E7IA 1GXIE 1KG1A 3UPUA 2VGMA 1SESA 1B8AA 2FYKA 3NFCA 1VUBA 5CAIA 3PMTA 3LWHA 3LGFA 3QXEB 3C95A 2DO3A 3A7AA 1Z7MA 1JRIA 1Q81C 4VUBA 1RIQA 4C92F 3JCMb 1VQLT 3OYIA 3FRNA 1B70A 3MEUA 4M7AD 4J8OA 4YRCA 2EFIA 4L6V5 3HRUA 3QBYA 1IZ6A 5GAN5 1HTTA 3V7SA 2ARSA 3PGGA 5CKEA 1BIAA 3KXTA 3G4ST 2DQ0A 4K87A 4M7AF 3WXMB 3LGLA 5LJ3e 2DIQA 3ICAA 4YRLA 2NS6A 4XU3A 3A8OB 4AH6A 4KBMB 5FU7C 4TVRA 1OI1A 4RMFA 4RQEA 2CIMA 1I5LA 5DLOA 3M57A 4IUQA 4ELYC 3P8YA 3HL8A 5GANg 4IUUA 3DSQA 4BDYA 1G51A 3CCVA 5FLXE 3OYHA 5L8RE 4DOVA 2DZCA 4EO4A 4HKEA 3SWNC 5IN1A 1N9SA 1K73C 2P0KA 3MP1A 2KY9A 5GANd 3OYFA 4PJOF 1VQ8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  5GAO q;  3JB9 G;  4TTV A;  4M75 F;  1YFS A;  2HNI A;  3E9I A;  4RCB A;  1GGM A;  1SER A;  4CS3 A;  3A7U A;  4YRO A;  4NL3 A;  4EX5 A;  1J5W A;  2DTI A;  3JCM f;  4YP0 A;  3A5Z A;  3R07 A;  3VQV A;  1ASY A;  2ODR C;  5C53 B;  3BJU A;  1LNX A;  1BIB A;  4J5Y A;  4M7A C;  3P8T A;  4XQ3 A;  3UGQ A;  2VXE A;  5LJ5 j;  5GAN 6;  3HFZ A;  4P73 C;  2IY5 B;  3HFZ B;  3JCM J;  3A32 A;  4YRR A;  4H2S A;  3RER A;  1YFT A;  2E3C A;  3MF2 A;  4JRI A;  1B76 A;  4C8Q B;  5GAN 7;  3UH0 A;  2E5A A;  2YLC A;  5LJ5 g;  4C8Q C;  4TQD A;  3VQX A;  2ZTG A;  4XU1 A;  2DKG A;  5ELN A;  1NJ6 A;  2AMC A;  3JCM X;  3WQZ A;  2AMC B;  4CS4 A;  1B7Y A;  3MF1 A;  1ATI A;  5GAN 2;  1B7Y B;  2ODR D;  2DEQ A;  5GAM f;  4YRS A;  4QVD A;  4HWT A;  4KR2 A;  3QO3 A;  4TVW A;  4YRE A;  3JB9 J;  4PHC A;  4OP0 A;  1HXD A;  2VC8 A;  2ZZF A;  1NNH A;  2XTI A;  3RKW A;  1H4Q A;  4YDQ A;  1E1T A;  3QO7 A;  3REU A;  3JCM Q;  1WQ7 A;  1TH7 A;  3LC0 A;  5GAN e;  1WPY A;  5GAN f;  1KOG A;  3M4Q A;  1SET A;  4JUV A;  5GAN 8;  1X56 A;  4M7D A;  5LJ5 d;  1BBU A;  4M7D B;  4C8Q D;  4M78 A;  4M77 A;  3LSS A;  4M78 B;  4M77 B;  4HWP A;  2ZIN A;  4G85 A;  3ERR A;  4C8Q E;  4J6Y A;  1C0A A;  4F7U A;  2ZNJ A;  4XEO A;  1ASZ A;  1NJ8 A;  4F7U B;  2CJB A;  3JCM h;  4Q15 A;  4CH6 A;  4C8Q F;  1E24 A;  3JB9 F;  3PCO A;  5GAN 4;  1WYD A;  3PCO B;  3RF1 A;  4YRK A;  4CH3 A;  2EWN A;  1B34 A;  4CS2 A;  4UP9 A;  1B34 B;  3RGL A;  1X55 A;  3VQY A;  1BBW A;  1VQZ A;  3RIR A;  1H64 1;  1KMN A;  1EIY A;  1WQW A;  1YGB A;  4M7D D;  4P72 C;  1EIY B;  3L1A A;  2CJ9 A;  4BWA A;  3JB9 I;  4M78 D;  4P3O A;  1LOJ A;  4M77 D;  5GAN 3;  3JCM P;  2XGT A;  1NJ2 A;  4NCX A;  1EFW A;  1IL2 A;  4HWO A;  4M7D E;  3A31 A;  1N9R A;  1KMM A;  11AS A;  2DTO A;  1Z7N A;  4M78 E;  3QNE A;  4M77 E;  2ZXF A;  5C52 B;  3QTC A;  4H2V A;  3MEY A;  3V8K A;  3V7C A;  4F7U E;  3QO5 A;  2RD1 A;  3HFN A;  5LJ5 e;  2I4L A;  4WJ4 A;  3BDU A;  4C92 A;  5LJ5 f;  12AS A;  2RHQ A;  4CH4 A;  2YHT A;  1I8F A;  2RHQ B;  5GAO l;  3HY0 A;  2DXT A;  4MML A;  2ZCE A;  1EVL A;  3NET A;  4TVY A;  3HXV A;  4XTU A;  3A5Y A;  2Q7H A;  2P5I A;  1MGQ A;  4J15 A;  5LJ3 h;  3IG2 A;  2G4C A;  2ARU A;  3KFU A;  4V2S A;  1EOV A;  1G5H A;  4YPF A;  3JCM c;  4EMH A;  3TEH A;  2Q5H A;  3CMQ A;  3VQW A;  2QHS A;  4WF2 A;  5GMK l;  2I4O A;  4YCV A;  1EQR A;  1W66 A;  2QHT A;  4YRP A;  3L4G A;  4Y91 A;  5GMK h;  2EJF A;  3VU3 C;  3L4G B;  1L0W A;  1NJ5 A;  1PYS A;  3RL6 A;  4RQF A;  1E22 A;  3P8V A;  1PYS B;  4M7D G;  4J6W A;  5GMK i;  2E64 A;  3G1Z A;  4M78 G;  4M77 G;  4ZIB A;  4C92 D;  3FJP A;  4P75 A;  2ZNI A;  4H2T A;  1ADJ A;  3HFO A;  2EL9 A;  4XU0 A;  3A74 A;  2CGH A;  1WU7 A;  2DQ3 A;  1KQ1 A;  1NJ1 A;  5C51 B;  2EAY A;  4F7U G;  1YFR A;  2YLB A;  2K57 A;  4NL2 A;  4XTW A;  4OLF A;  4ZTU B;  4XU2 A;  4UPA A;  2RB6 A;  3HXU A;  1I81 A;  2ART A;  3GIB A;  1SRY A;  1U1T A;  3JCM g;  4JLI A;  4H2U A;  1NYR A;  3QUI A;  4RDX A;  3UGT A;  3FIF A;  3HXX A;  2RA2 A;  4HT8 A;  1X54 A;  4X9C A;  1FYF A;  4XTY A;  1USY A;  4M7D C;  2EJG A;  4P71 A;  1M8V A;  3HXW A;  3QSU A;  3REX A;  4M78 C;  4YRQ A;  4M77 C;  1ADY A;  1X01 A;  4H2W A;  3NEN A;  3NEM A;  4WI1 A;  3BY7 A;  4UP7 A;  3W3S A;  4O2D A;  4KR3 A;  1E1O A;  2J3M A;  3PZC A;  1LJO A;  1NYQ A;  2ZT6 A;  3BFM A;  4LNS A;  4PJO A;  2DTH A;  1LYL A;  3JCM d;  2Q7G A;  4PJO B;  3V7R A;  3JCM V;  4M75 A;  4H2X A;  4YCW A;  5GAM g;  1D3B A;  4M75 B;  4H2X B;  5ELO A;  1H4T A;  1D3B B;  2I4N A;  3EFR A;  4C92 G;  1EVK A;  4TVA A;  4YRM A;  3INZ A;  5LJ3 j;  5DY9 A;  3QHS A;  3AHU A;  4P74 A;  5KNN A;  2ZZG A;  3RUX A;  5GAM h;  2I2L A;  3HY1 A;  4N0A A;  2QTX A;  4M7D F;  4YRF A;  5GMK j;  4NOY A;  4M78 F;  2RM4 A;  4M77 F;  5GAO n;  5LJ3 g;  4ZTZ B;  4PG3 A;  3V8L A;  5GAO m;  2J3L A;  3HRI A;  4TWA A;  2Y90 A;  4Q6G A;  2DU7 A;  4HWR A;  1H4V B;  4PJO D;  2E65 A;  2RHS A;  1QF6 A;  2DJZ A;  2ZR3 A;  5GAN h;  4F7U F;  4C92 B;  3HFV A;  2RHS B;  3HXZ A;  4P3P A;  2ZIO A;  4YYE A;  4M75 D;  4C92 C;  1JBM A;  3HTZ A;  4X5O A;  1YCY A;  4L87 A;  1KQ2 A;  2E1H A;  4PJO E;  2DVE A;  1QE0 A;  2ALY A;  1WNL A;  3RAC A;  2ALY B;  4M75 E;  4G84 A;  3UFG A;  1HC7 A;  2C7I A;  4DQ2 A;  2QHU A;  1Y96 A;  1H4S A;  4XEM A;  2ZT5 A;  4DPG A;  1Y96 B;  3TEH B;  4CH5 A;  2ZZE A;  3VBB A;  3JCM e;  3JCM W;  4M7A A;  5LJ3 d;  1B8A A;  4UP8 A;  1SES A;  5E3I A;  4M7A B;  2FYK A;  3RKX A;  2CJA A;  4YRG A;  4XTX A;  4P73 A;  3HSB A;  2ZR2 A;  5CAI A;  4XTV A;  3SB2 A;  2IY5 A;  3BW1 A;  4HVC A;  2C8M A;  4TQF A;  3L2Z A;  5GAO r;  4PNO A;  3JB9 H;  4P75 C;  2DZ9 A;  3IKM B;  4C8Q A;  4C92 E;  2QHV A;  3A7A A;  1Z7M A;  1JRI A;  3IAL A;  3HXY A;  4X9D A;  2JN0 A;  4YRJ A;  1RIQ A;  4C92 F;  5I21 A;  3JCM b;  4K88 A;  4PJO G;  3TUP A;  1G5I A;  5GAM e;  3IKL A;  3M4P A;  2PME A;  1X2H A;  4EMK A;  1M5Q 1;  4M75 G;  1B70 A;  4M7A D;  4YRC A;  4EMK B;  1B70 B;  2P0L A;  3HRK A;  4EMK C;  5LJ5 h;  4HWS A;  4A54 A;  5GAN 5;  1USY C;  4YRI A;  4P71 C;  3V8J A;  4M7A E;  1HTT A;  3V7S A;  3PGG A;  2ARS A;  2ZIM A;  1BIA A;  2I4M A;  5GAM j;  3NEL A;  2DQ0 A;  4K87 A;  3A7R A;  4BW9 A;  4H2Y A;  4MMK A;  4M7A F;  1X2G A;  2VXF A;  5GAO p;  3JB9 D;  2FB7 A;  4EMG A;  5LJ3 e;  3EFS A;  3FB9 A;  4QVC A;  2Q7E A;  3ICA A;  5LJ3 f;  5GAN j;  4PJO C;  4YRL A;  4A53 A;  4XU3 A;  4AH6 A;  4M75 C;  4HT9 A;  2PMF A;  3OD1 A;  2EJ9 A;  4H02 A;  3RES A;  5GMK e;  4JRK A;  4RMF A;  3RKY A;  4RQE A;  2E41 A;  2CIM A;  4TVA B;  4WJ3 M;  1I5L A;  4YCU A;  2ZGW A;  3P8Y A;  1I4K 1;  5GAN g;  3E9H A;  4E51 A;  4YRN A;  3DSQ A;  4XTZ A;  1G51 A;  3M4G A;  2DXU A;  4RCC A;  4P72 A;  1U1S A;  4P74 C;  2ZT8 A;  1WLE A;  5K1P A;  4K86 A;  3I7F A;  4N0A C;  2E10 A;  2AKW A;  4KQE A;  4M7A G;  2DU5 A;  2AKW B;  5GAM d;  1HK9 A;  3SWN A;  3QO8 A;  2ZT7 A;  2DDZ A;  3SWN B;  5F5W A;  2DZC A;  4EO4 A;  3SWN C;  1N9W A;  1N9S A;  5HGQ A;  3LSQ A;  4YRT A;  5K1X A;  1YB3 A;  4HA8 A;  3TEG A;  4P3N A;  1JJC A;  5GMK m;  5GAN d;  1JJC B;  2Q5I A;  4J6X A;  4PJO F; 
#chains in the Genus database with same CATH topology
 5GAO q;  4OML A;  1ARK A;  3G71 Q;  3G6E Q;  5IAY A;  2EGA A;  4RUG A;  3I56 A;  2AZS A;  1HYO A;  3OSV A;  4RCB A;  1SER A;  1WLP B;  3S3O A;  1NJI C;  2D8J A;  3OW2 P;  3VQV A;  1VQK Q;  3R07 A;  1ASY A;  5C53 B;  1LNX A;  4M7A C;  3P8T A;  4XQ3 A;  3VKI A;  2NUP A;  3RBB B;  2IY5 B;  1ZSG A;  3CD6 Q;  4LE9 A;  1VQM Q;  3QWX X;  2YLC A;  1TUG B;  2DM1 A;  4JJN K;  2ZTG A;  4LDY A;  2Y4Y A;  1NJ6 A;  2AMC A;  1KC8 R;  3WQZ A;  3TVT A;  4IUT A;  4CC2 A;  2CZ7 B;  1D0X A;  3EGD A;  2E5K A;  2P0Q A;  2X3X D;  2HAX A;  2QQA A;  2EYZ A;  4XK8 E;  1OPK A;  2ODR D;  1VOM A;  2O2O A;  4QVD A;  4KR2 A;  2OI3 A;  3JB9 J;  1VQ5 A;  3VS7 A;  4PFP A;  3QO7 A;  1H3H A;  3JCM Q;  1VQ7 T;  2F2X A;  3M59 A;  1QVG A;  2A0F B;  5GAN f;  2ECZ A;  1RAB B;  1KHC A;  5CQY A;  3P8B B;  4M7D A;  2V8I A;  3NTI A;  3GBQ A;  4C8Q D;  4M78 A;  4M77 A;  1JQQ A;  4G85 A;  2F5K A;  1YIJ Q;  3ERR A;  1JEG A;  4D6W A;  1M90 U;  4O5V A;  4ESR A;  2XK0 A;  2JT4 A;  4PJJ A;  2CT3 A;  2VV5 A;  4C8Q F;  2ROT A;  3EG0 A;  2K7A A;  1ABQ A;  3QYH B;  1VQN T;  1B34 A;  4FIB A;  4CS2 A;  1X55 A;  4HCZ A;  3CCS A;  4X34 A;  4GY5 A;  3MQZ A;  3I55 Q;  2E6Z A;  1H64 1;  1BI0 A;  4J9I A;  1WQW A;  3E2U A;  3O5Z A;  1U8R A;  4M7D D;  2ZZD A;  2XG8 D;  1WXT A;  3L1A A;  2X4X A;  3MEV A;  1IGQ A;  4BWA A;  3JB9 I;  4M78 D;  4PJM A;  1LOJ A;  4M77 D;  2JUF A;  1IL2 A;  4NCX A;  1QVF A;  3TSW A;  1N8R R;  2DL3 A;  1WHJ A;  2WSE E;  4HWO A;  2LZ6 B;  1W2B A;  3CME T;  4DBF A;  1WFW A;  2E3I A;  2E70 A;  1G3S A;  4JJC A;  2L3S A;  1EZZ B;  2QGG A;  4PL6 A;  3QYG B;  3H8Z A;  4Z8A A;  4F7U E;  4LD6 A;  4HCC A;  3CCU A;  2EYW A;  4LXC A;  4NS5 A;  1TSF A;  3CEY A;  2DER A;  2YHT A;  1I8F A;  2ZCF B;  2RHQ B;  1LCK A;  3ZFJ A;  2RI2 A;  1H3Z A;  4KRT A;  2E6N A;  3PIO A;  3CCR T;  2NUZ A;  3SDZ A;  2Q7H A;  3DB4 A;  4QT7 A;  2P5I A;  1MGQ A;  1M27 C;  3IG2 A;  2KVQ G;  3KFU A;  3RDV A;  2E5Q A;  4RTZ A;  1G5H A;  4YPF A;  3JCM c;  3TEH A;  1VQ9 A;  1WXB A;  2KRO A;  5GMK l;  4DA4 A;  1RAG B;  1V29 B;  4RTV A;  5HK0 A;  3CCQ Q;  1EQR A;  1W66 A;  4OB1 B;  4YCV A;  1CSK A;  1VQ6 Q;  5GMK h;  2EJF A;  3VU3 C;  5J39 A;  3OS1 A;  4KUI A;  1AT1 B;  1M9S A;  4JJB A;  1PYS A;  2DRK A;  1JXO A;  4RQF A;  3GNF B;  4AFS C;  3WVE B;  3P8V A;  5CQX A;  4RTW A;  5IHI A;  4LDW A;  3CXC S;  4ZGJ B;  3CPW A;  3FJP A;  3UT1 A;  5KYX A;  3HRT A;  3CQT A;  1ADJ A;  3HFO A;  4C5E A;  3A74 A;  1WU7 A;  4FYX B;  2L5Q A;  3UA6 A;  4KUD K;  2F2V A;  2XMF A;  1Q7Y C;  4OLF A;  1G3Y A;  4UPA A;  1Y57 A;  2CS7 A;  2F1L A;  1UG1 A;  2DET A;  1PNJ A;  5GJW B;  1KD1 U;  3CC4 Q;  3OMC A;  2KRS A;  1SRY A;  1OZ2 A;  4H2U A;  2H8H A;  4PKC C;  3TCJ A;  4CC3 A;  3KBG A;  3VV0 A;  2GFU A;  2JM9 A;  2B86 A;  3HXX A;  2J6K A;  4XTY A;  1FYN A;  4M7D C;  1USY A;  2EJG A;  3LLR A;  3HXW A;  2DEU A;  4M78 C;  4BE1 A;  4YRQ A;  2KAF A;  4M77 C;  3R6O A;  1HJD A;  4IUV A;  1GCQ A;  2EQK A;  3NEN A;  3E19 A;  3EAE A;  2SEM A;  2RJD A;  2DD4 A;  2BTT A;  2FL7 A;  3G71 T;  3VJP A;  3JV3 A;  4OB2 B;  3G6E T;  2YWW A;  5DM7 R;  1D1C A;  1LJO A;  3OS0 A;  2RF0 A;  2ZT6 A;  3BFM A;  1M1K U;  4ZGD B;  2DTH A;  2G3R A;  2O4X B;  1VQK T;  3G4S A;  4E7H A;  3H0H A;  2JW4 A;  4ZNX A;  5HCK A;  5GAM g;  3OSS C;  2GNC A;  3VS1 A;  2A37 A;  3EFR A;  1YIT Q;  2COZ A;  4TVA A;  2OAU A;  4PFZ A;  1IB8 A;  1M3C A;  2PUK B;  1UEC A;  1VYT A;  4DBR A;  2RHZ A;  3CD6 T;  1VQM T;  1M1K R;  1NBE B;  4P74 A;  5KNN A;  2RQT A;  2ZZG A;  1K0S A;  1YJN Q;  2DAQ A;  2JZ2 A;  3HY1 A;  4FSS A;  3CCM A;  1GFD A;  2FPD A;  2QTX A;  5CK9 A;  1M1F A;  5GMK j;  1SHF A;  1M90 C;  2KI7 A;  4NOY A;  3MKD A;  5GAO n;  3V8L A;  2ZPE B;  2J3L A;  1B07 A;  3HRI A;  2KNB B;  1IO6 A;  3RMS A;  2E65 A;  1RAC B;  5GAN h;  1J3T A;  4C92 B;  1XOV A;  2RHS B;  3HFV A;  2NYS A;  3CMA Q;  4P3P A;  2ZIO A;  3I5S A;  2VYT A;  3OS2 A;  1NPR A;  4PJO E;  2DVE A;  1TTH B;  5A2Q E;  2ALY A;  3RAC A;  3L2Q A;  5IT9 E;  1G5V A;  1T3S A;  2FO0 A;  4ATO A;  1IGU A;  4OF1 A;  1PD1 A;  2RHI A;  2ZT5 A;  4XEM A;  3VYG A;  1K76 A;  3H41 A;  3E9G A;  1QCN A;  4CH5 A;  1D1B A;  1RL2 A;  3S3N A;  2R5M A;  4X1V A;  3OQ5 A;  1YIJ T;  1PKT A;  1FMV A;  1M4Z A;  1Q81 R;  2OTL Q;  1VQ8 A;  2JVV A;  1G3W A;  4M7A B;  4BB7 A;  3A8H B;  2X4W A;  1QKX A;  1PD0 A;  2KMT A;  3A8L B;  2QQ9 A;  3SB2 A;  3OYA A;  4HVC A;  1WHG A;  2DZ9 A;  1SRM A;  1WA7 A;  2PQW A;  3PIP A;  3C4S A;  1VA7 A;  2HQX A;  2MWO A;  4Z88 A;  3M4Y A;  4AT1 B;  3IAL A;  2YUQ A;  4PLI A;  3OMG A;  2DE0 X;  1WDX A;  1M8M A;  1JJ2 S;  2GTJ A;  2LQ8 A;  4J7I A;  1SKU B;  2RQV A;  2DBM A;  2EGE A;  3JAM E;  1M5Q 1;  4M75 G;  1UGV A;  1WJS A;  1B70 B;  3HRK A;  3HHT B;  4EMK C;  1USY C;  3SD4 A;  4YRI A;  1QVP A;  2FVU A;  2ENM A;  2ZIM A;  1GCQ C;  1CKB A;  3NEL A;  5KCO A;  1SG5 A;  3CCE A;  1Q82 C;  3X25 B;  1BU1 A;  2VXF A;  5GAO p;  2M0Y A;  1VQ7 A;  1K73 U;  1NYG A;  4JS4 A;  4QVC A;  1JXM A;  2ZPF B;  5GAN j;  2GGR A;  2VKN A;  4EDU A;  1Y07 A;  2GBQ A;  1UGR B;  3NTK A;  2PMF A;  3OD1 A;  1W4S A;  2R57 A;  4Y28 E;  3RES A;  4H02 A;  3CC2 T;  5GMK e;  2HL3 A;  3RKY A;  2OX7 A;  4YCU A;  3S6W A;  1OZ3 A;  2FPF A;  2XI9 A;  3LH5 A;  4J9F A;  1NJI U;  3P8H A;  3CCQ T;  2JM8 A;  2LQW A;  1VQ6 T;  1PSF A;  3I9Q A;  3OBY A;  3MET A;  1O75 A;  4Q5W A;  3T9N A;  1K73 R;  2M51 A;  4XTZ A;  1WX6 A;  2MI6 A;  3M4G A;  2DXU A;  4RCC A;  4P74 C;  2GQI A;  2KT1 A;  5K1P A;  4P5N A;  3I7F A;  4KQE A;  4ME7 A;  1G2B A;  3EGX B;  5CKF A;  3SWN A;  2LJ0 A;  2ZT7 A;  2HL5 C;  5HGQ A;  4CRI A;  4IIM A;  3CC4 T;  1B7T A;  2QG9 B;  2FRW A;  1C0M A;  1JJC A;  5CKH A;  2DL8 A;  2AIR B;  4RTU A;  4FW1 A;  3JB9 G;  1QP2 A;  1Z9Z A;  3E9I A;  1U5S A;  4YRO A;  4NL3 A;  4EX5 A;  2DTI A;  3BJU A;  4J5Y A;  2ZAE A;  1FX7 A;  5GAN 6;  4J7F A;  2NUP B;  1SRL A;  3CXC P;  4IUR A;  1X6G A;  3JCM J;  4RTY A;  4H2S A;  3G7Z A;  1H92 A;  2E3C A;  4JRI A;  3GPL A;  1B76 A;  4C8Q B;  1OU8 A;  2BUD A;  3UH0 A;  5LJ5 g;  3VQX A;  3CCL Q;  2DKG A;  1YIT T;  1K9M C;  2EBP A;  2AMC B;  4CS4 A;  4E7S A;  3MF1 A;  5A0D A;  2DPP B;  3M0T A;  3EGD B;  4YRS A;  1VQP Q;  1UB4 A;  2K5L A;  2CP2 A;  3AT1 B;  1YJN T;  1UHC A;  4ANJ A;  2ZZF A;  3TQ7 P;  3HP9 A;  5D6X A;  1K8A C;  1E1T A;  1H4Q A;  2HQH A;  1TH7 A;  5GAN e;  2CKK A;  4JZ3 A;  1WPY A;  1K9A A;  3M4Q A;  5D7U A;  2QXF A;  2HCK A;  1YN8 A;  1M2V A;  1OEB A;  3KUF A;  5LJ5 d;  1QVF P;  5I2S A;  1IRE B;  1BBU A;  1UDL A;  4M7D B;  1WHL A;  4BD3 A;  2JS2 A;  4C0F A;  3CMA T;  3LSS A;  5FU6 C;  4M78 B;  4M77 B;  1JB0 E;  2P84 A;  4HWP A;  5ECA A;  5EG2 A;  2W0Z A;  2ZNJ A;  2RHY A;  1CKA A;  4Q15 A;  3VS2 A;  4CH6 A;  4OMF B;  4GBQ A;  1NG2 A;  2EPD A;  3CC7 Q;  3RF1 A;  4BI3 A;  2VVK A;  4CH3 A;  4E7Z A;  1BYM A;  3GOX A;  3X24 B;  3RGL A;  1B34 B;  1QCF A;  2EGC A;  2OTL T;  1PCX A;  2HBW A;  4C0G A;  5KE2 A;  4AG1 C;  1S72 Q;  1KMN A;  2QK0 A;  1R0C B;  3NHN A;  4RTT A;  1EFW A;  1NJ2 A;  2Z0W A;  2OTJ A;  1P92 A;  1ZA2 B;  1Z7N A;  3QNE A;  1ZLM A;  2ZXF A;  1UJ0 A;  4H2V A;  1D0Z A;  1TUC A;  1YJW Q;  2RJF A;  4RG2 A;  3LWI A;  2CP7 A;  3QO5 A;  2EKO A;  1VQM A;  3CPW P;  2JMA A;  3E1S A;  3HFN A;  1NM7 A;  2QEX Q;  3BDU A;  3CBO A;  5LJ5 f;  1NE8 A;  3REB B;  1Q7Y U;  3M58 A;  3QZ9 B;  4BE0 A;  4MML A;  1EVL A;  3NET A;  2KEA A;  4TVY A;  3ZEH A;  5I22 A;  1G3T A;  1UJY A;  3PMI A;  4J15 A;  2ESW A;  3VUB A;  1WIE A;  2EVR A;  2P4T A;  2G4C A;  4FU6 A;  1EOV A;  2K5I A;  2EYX A;  4BAC A;  2I0N A;  3VQW A;  2QHS A;  4WF2 A;  3CCV Q;  2QHT A;  1Q7Y R;  4Y92 A;  4B6M A;  4R56 A;  4ZTJ A;  4PK4 A;  1YI2 A;  1AWW A;  3RL6 A;  1PYS B;  3G1J A;  2K3Y A;  1TU0 B;  3PVQ A;  4ZTF A;  3M5A A;  3X26 B;  2E64 A;  3G1Z A;  4LUE A;  2P0P A;  2FG0 A;  5HKC A;  4E7J A;  1SEM A;  1JJ2 P;  2DNU A;  2FPE A;  5KYX B;  1KQ1 A;  1NJ1 A;  2EAY A;  4F7U G;  1YFR A;  1FWZ A;  1RAH B;  5KYY A;  2RB6 A;  2NUT A;  2CSI A;  1I81 A;  2DX1 A;  3I56 Q;  2PU9 B;  1OYX A;  2DXC A;  1U1T A;  3JCM g;  2JTE A;  2HSE B;  3QUI A;  3UGT A;  1HD3 A;  2RN8 A;  3GLX A;  3UDC A;  3CXC A;  2O9S A;  4JZ4 A;  1A0N B;  3ME9 A;  2VGN A;  2A7Y A;  1UFF A;  2KRM A;  3SFM A;  2F5T X;  3OY9 A;  5KYN A;  2KDS A;  1ADY A;  3DKM A;  4H2W A;  1AD5 A;  3NEM A;  1UGP B;  3BY7 A;  4RG8 A;  3OA6 A;  4O2D A;  1U3O A;  1HSQ A;  2D0N A;  2J3M A;  3PZC A;  1C6V X;  3N5B B;  4PJL A;  4KUL A;  2DVJ A;  2KR3 A;  5IH2 A;  1WHH A;  1XQH A;  3JCM d;  1BI1 A;  4LVK A;  1PRL C;  2H3E B;  4M75 A;  4KH0 B;  1M90 R;  4LD9 K;  4C92 G;  2CZ6 B;  2IPO B;  3H6Z A;  2GFA A;  4A4E A;  5FW9 A;  4BY6 C;  5KYU A;  4MZP A;  1T0J A;  2EQJ A;  4BE2 A;  1WHM A;  3EGU A;  5DY9 A;  1N27 A;  3CCJ Q;  5CO7 A;  2LX9 A;  4KGV B;  4LUD A;  3IQL A;  3CC2 A;  3CCL T;  1VQ4 A;  2EQM A;  2XDB A;  2GF7 A;  4M7D F;  2DLP A;  3L2W A;  2BE9 B;  3VS0 A;  1V76 A;  1UHF A;  4M78 F;  1R0B G;  4M77 F;  1X75 C;  2C0I A;  2RHU A;  4PG3 A;  5KH6 A;  2DU7 A;  5FWB A;  1VQP T;  1H4V B;  3TSZ A;  2CYZ B;  2ZR3 A;  3HXZ A;  4A4G A;  1NEG A;  4M75 D;  1JBM A;  1YCY A;  4L87 A;  1KQ2 A;  1EFN A;  1KK7 A;  1VQO Q;  1QE0 A;  2HDA A;  1YJ9 T;  4QW2 A;  2ALY B;  2MWP A;  4FL6 A;  3OYM A;  3UFG A;  1HC7 A;  3OYB A;  1ABO A;  4MDX A;  3CCS Q;  1Y96 A;  2YRC A;  1OX9 A;  2ZPG B;  2K79 A;  3OS5 A;  2ZZE A;  3M55 A;  3JCM W;  1PSE A;  1E6H A;  3RKX A;  2R58 A;  2CJA A;  3QJ6 A;  1IHW A;  4P73 A;  1Q82 U;  1O9S A;  3E9F A;  3URG A;  3UF4 A;  4XTV A;  3OYC A;  2IY5 A;  2J6F A;  4IUP A;  1OOT A;  4OMQ A;  2C8M A;  2QDY B;  4UC4 A;  4TQF A;  3L2Z A;  3CC7 T;  5FWC A;  8AT1 B;  2YSQ A;  4O6J A;  4C92 E;  5J26 A;  3CCU Q;  2JTM A;  3HXY A;  1SHG A;  3EFO A;  2X9H A;  1S72 T;  3MEA A;  2JN0 A;  4LN2 A;  3EG9 A;  1Q82 R;  1W6X A;  2QA4 T;  2LCC A;  4PJO G;  3TUP A;  2MAM A;  1G5I A;  5GAM e;  3IKL A;  3M4P A;  2PME A;  3U23 A;  4EMK A;  2KYM A;  2WAC A;  4HCK A;  1VQL A;  1Z9Q A;  2C0O A;  5LJ5 h;  2DRM A;  1YJW T;  4KGX B;  3V8J A;  1AWO A;  1VQ9 Q;  4M7A E;  1IRX A;  1QMC A;  3HKS A;  1BCO A;  1KD1 R;  1PWT A;  2HKQ B;  4BW9 A;  3A7R A;  4MMK A;  2QEX T;  1X2G A;  3J7A F;  4E7K A;  1JJ2 A;  1UGQ B;  2BZ8 A;  1WJR A;  1MV3 A;  4QQD A;  1AVZ C;  3JB9 D;  2YT6 A;  2HKN A;  2JMC A;  2X35 A;  4JS5 A;  2Q7E A;  4LVM A;  2CRE A;  1X6O A;  4M75 C;  5FU7 B;  2EJ9 A;  2QQB A;  2O31 A;  4JRK A;  2KSS A;  4FYV B;  4OMO A;  1GBQ A;  2E41 A;  1LPL A;  3UWN A;  4C0Z A;  2ZGW A;  3CCV T;  4QKU A;  1Y0M A;  4WCI A;  1I4K 1;  2DXB A;  3E9H A;  4E51 A;  4PJN A;  4YRN A;  2M0O A;  4LVL A;  3VRY A;  4C5I A;  2D0Q B;  2HD0 A;  1AEY A;  4JJD A;  2EYY A;  2QI2 A;  5HY6 A;  4JRQ A;  2OTL A;  2AKW A;  2DU5 A;  2ATC B;  3ZL7 C;  3TU4 K;  5GAM d;  1AZE A;  1X69 A;  2K5F A;  2WSC E;  3SWN B;  3O8V A;  5CCA A;  5CKD A;  2MIO A;  3I56 T;  1K9M U;  3NTH A;  2H3J A;  4PFO A;  3LSQ A;  4R0K A;  4YRT A;  1YB3 A;  5K1X A;  4HA8 A;  3VRZ A;  2BIV A;  5KYW A;  4B9X A;  4BDZ A;  5GMK m;  2Q5I A;  1JJC B;  2FZK B;  2Q7G A;  3L2U A;  2KE9 A;  3TRE A;  3G4S Q;  4C8Q G;  1X43 A;  4TTV A;  2L8D A;  1YFS A;  2HNI A;  2YRD A;  3M0Q A;  2LDM A;  1GGM A;  2VB6 A;  3A7U A;  1K8A U;  2LNV A;  3X20 B;  1J5W A;  4YP0 A;  3A5Z A;  2AKL A;  2RPN A;  1FMK A;  2X4Y A;  3UGQ A;  1K9M R;  2VXE A;  5C0M A;  5LJ5 j;  3HFZ A;  2X51 A;  4P73 C;  1RI0 A;  3L2V A;  1QKW A;  4CC7 A;  3CCM Q;  3A32 A;  2KBT A;  3OW2 S;  1UGS B;  3MF2 A;  4DEY A;  3I55 T;  4TQD A;  4XU1 A;  5ELN A;  2CZ1 B;  3JCM X;  3MP8 A;  1WI7 A;  1B7Y A;  4N4G A;  5A0L A;  1ATI A;  1C1A A;  1NPP A;  1ZHI A;  2V1Q A;  2DEQ A;  2XKO C;  5GAM f;  4HWT A;  3CCJ T;  4YRE A;  3D7S B;  4PHC A;  4OP0 A;  2V8K A;  1NNH A;  4YDQ A;  3REU A;  1WQ7 A;  3LC0 A;  3L2R A;  5GAN 8;  1VYU A;  1VQ8 Q;  1X56 A;  2F2W A;  2RH2 A;  1M2V B;  2M16 A;  2XID A;  1YHQ Q;  4HT4 A;  1PHT A;  5IHK A;  3RR6 A;  3NMZ C;  2MYS A;  1VQO T;  4C8Q E;  1K0X A;  1C0A A;  4RKU E;  4F7U A;  3L42 A;  1NJ8 A;  1ASZ A;  3JCM h;  1ZX6 A;  3CCS T;  4HVV A;  4L59 A;  3MHX A;  3HRS A;  1E24 A;  3PCO A;  1MUZ A;  3NGP A;  5GAN 4;  1WYD A;  4F16 A;  1GBR A;  4DBH A;  1BBW A;  1VQZ A;  3LX7 A;  3RIR A;  3GP8 A;  4GLM A;  1BK2 A;  1VQN A;  1EIY A;  1YGB A;  3MEW A;  2K3X A;  4P3O A;  4F17 A;  3JCM P;  3GF5 A;  4M7D E;  3A31 A;  1NJI R;  1N9R A;  3QKJ A;  2KK4 A;  2PVG B;  3CCE Q;  4M78 E;  4M77 E;  1ACM B;  5C52 B;  1ZUK A;  3QTC A;  1XJW B;  2DYB A;  1UE9 A;  1MND A;  1M3A A;  2LC4 A;  4ZN3 A;  3LW5 E;  4FCY A;  1UTI A;  4KH1 B;  3I5R A;  5LJ5 e;  1VYV A;  3CME A;  2I4L A;  2DBK A;  5AYF A;  1TOV A;  4C92 A;  1MV0 B;  3FJ5 A;  12AS A;  1BB9 A;  4CH4 A;  2ZPI B;  2ZCE A;  1LVK A;  1VQ9 T;  3A5Y A;  1BI3 A;  1Q86 U;  5CR2 A;  1D0Y A;  2PVD B;  1AOJ A;  2RJE A;  2ARU A;  3Q1J A;  2QDL A;  2J06 A;  3SEM A;  1I0C A;  3QII A;  4EMH A;  2Q5H A;  4L5G A;  4OB3 B;  5LL6 S;  3CCR A;  2I4O A;  1YJ9 A;  1RAF B;  1D1A A;  1R8O B;  1RAA B;  1RUW A;  2E4H A;  3L4G A;  3DLL A;  4Y91 A;  2LP5 A;  5FRO A;  1B3Q A;  2EIF A;  1RLQ C;  2Y4X A;  5IHN A;  5GMK i;  4ZIB A;  4C92 D;  4P75 A;  2ZNI A;  4H2T A;  1NZ9 A;  2A3L A;  2RQU A;  4IKF A;  2EL9 A;  4XU0 A;  2EQU A;  2DK3 A;  3PNW C;  2RK2 A;  3J80 E;  2DQ3 A;  3A8M B;  1BCM A;  2EW3 A;  4XTW A;  4ZTU B;  1QW1 A;  2MF2 A;  2D1X A;  2QAZ A;  4Z02 A;  4R55 A;  1NLP C;  6AT1 B;  3J81 E;  3HXU A;  5KYY B;  2ART A;  3CC7 A;  4IIO A;  1SPK A;  4LDX A;  3GIB A;  3M0R A;  2BZY A;  2ED0 A;  4J9D A;  4LNP A;  4RDX A;  1UEB A;  1QQJ A;  1TUD A;  1W70 A;  4AG2 C;  1S72 A;  1RLP C;  1FYF A;  2L3P A;  4P71 A;  3QZ5 B;  3REX A;  4HXJ A;  2QA4 A;  1X01 A;  3R6N A;  2ZPH B;  3W3S A;  3M0S A;  2J05 A;  1PG5 B;  3C12 A;  3P8D A;  4KR3 A;  1E1O A;  1KQS S;  1M2O A;  3EG2 A;  4OGC A;  5M9O A;  1YJW A;  4HVW A;  1NYQ A;  1GFC A;  1TS9 A;  2K3B A;  4PJO A;  2YRV A;  3V7R A;  3JCM V;  3G71 A;  4H2X A;  3G6E A;  3ER0 A;  2QEX A;  1D3B A;  4M75 B;  2LJ1 A;  5ELO A;  2K6D A;  1H4T A;  2JNG A;  2I4N A;  2QAS A;  2A8E A;  1EVK A;  2CP5 A;  1VQK A;  2QTV A;  3CCM T;  4YRM A;  4KT0 E;  5KYU B;  3TEE A;  1PC0 A;  3THK A;  1X2K A;  4DOW A;  3QHS A;  1ZBX A;  5L23 A;  1BBZ A;  5GAM h;  2I2L A;  1IHV A;  4N0A A;  4YRF A;  3A98 A;  5I2M A;  2O01 E;  2RM4 A;  3CD6 A;  3HPW A;  5LJ3 g;  4ZTZ B;  4ELZ C;  3VS5 A;  1OX8 A;  3H0I A;  3UA7 A;  1GCP A;  1YBY A;  4Q6G A;  3OYN A;  4N4H A;  2M1H A;  4PJO D;  2CP0 A;  3SHW A;  3FDR A;  1ZUU A;  1ZA1 B;  4C92 C;  3HTZ A;  3OYE A;  2E1H A;  2RK1 A;  1WNL A;  2J7I A;  5KCH A;  4OGE A;  2C7I A;  2WSF E;  4OVA A;  1H4S A;  2AT1 B;  1Y96 B;  3TEH B;  1T3L A;  1YFN A;  2K2V A;  1YHQ T;  1AWJ A;  3VBB A;  3JCM e;  4D8D A;  2CP3 A;  2P4R A;  2A28 A;  5LJ3 d;  1X27 A;  4UP8 A;  5E3I A;  3JSC A;  4YRG A;  4MDW A;  4XTX A;  1KC8 U;  3HSB A;  2ZR2 A;  1OV3 A;  5C6S A;  3RMQ A;  3BW1 A;  2OTJ Q;  1YIJ A;  1WZO A;  2XDD A;  3FC3 A;  4EIK A;  4E2F B;  5GAO r;  4PNO A;  3JB9 H;  4J9E A;  4P75 C;  1I1J A;  2LT1 A;  4C0D C;  3IKM B;  4AFZ C;  1TXQ A;  1ZSZ A;  4C8Q A;  5CKB A;  2QHV A;  4QQ6 A;  4FT4 A;  4B9W A;  2R5A A;  1JU5 C;  4X9D A;  4YRJ A;  5D6Y A;  3EFO B;  2C06 A;  5I21 A;  4C5H A;  4K88 A;  3DLM A;  1QP3 A;  3PT9 A;  3QPH A;  3EG9 B;  1Q86 C;  3I55 A;  1UUE A;  1QLY A;  4A63 B;  1X2H A;  1MMN A;  4AFQ C;  4A4F A;  4EMK B;  2P0L A;  3CCE T;  3PVL A;  4HWS A;  4MZT A;  4A54 A;  3QDR B;  4P71 C;  1V1C A;  2GTO A;  2ABL A;  3GNG A;  4JDS A;  1FXX A;  3CBM A;  3CCJ A;  5GAM j;  2I4M A;  4H2Y A;  2L0A A;  1YI2 Q;  1OUL A;  4XAX B;  3VS6 A;  4WTO B;  4LVJ A;  2K9G A;  2FB7 A;  4EMG A;  3EFS A;  3FB9 A;  1I5O B;  5LJ3 f;  1G8X A;  2JOY A;  4PJO C;  2L3Q A;  2DD5 A;  4A53 A;  4CC4 B;  4II1 A;  4HT9 A;  2ED1 A;  4BUG A;  1VQ5 Q;  4AFU C;  5FRN A;  2DJQ A;  1GL5 A;  2F69 A;  2L2P A;  4TVA B;  1N8R U;  1VQO A;  4WJ3 M;  2ZPB B;  1QWF A;  2XD0 A;  4N4I A;  3PTA A;  2K2M A;  5GJV B;  1MMD A;  2RQR A;  3ASK A;  1W1F A;  4P72 A;  1U1S A;  2YXY A;  2ZT8 A;  1WLE A;  2LNH B;  3CCQ A;  4K86 A;  1VQ6 A;  1G83 A;  1RI9 A;  4N0A C;  2E10 A;  2QQR A;  3EG3 A;  2PZ1 A;  2IIM A;  3VYH B;  4M7A G;  3PFS A;  2AKW B;  1F1B B;  1HK9 A;  1NEB A;  3QO8 A;  2DDZ A;  2AHJ B;  2RHX A;  3ZBD A;  5F5W A;  1N9W A;  3OYG A;  2LTO A;  2K4Y A;  1MNE A;  3TEG A;  1AHJ B;  1WJQ A;  4P3N A;  5HK3 A;  5AT1 B;  3JRZ A;  2LQK A;  4M4Z A;  4J6X A;  5KYW B;  1QWE A;  1YP5 A;  5I11 A;  1EIF A;  4RTX A;  3MCA B;  4M75 F;  1DJ7 B;  3CC4 A;  2BE7 D;  4ZGE B;  3OYJ A;  1WXU A;  4CS3 A;  4AMC A;  3JCM f;  2EYQ A;  2CZ0 B;  2PUO B;  4A4K A;  1ZUY A;  2ODR C;  2KXC A;  3CPF A;  1BIB A;  3A5Z B;  1ZBJ A;  3LH0 A;  2DL7 A;  3KFV A;  3HFZ B;  1M1G A;  3CC2 Q;  2CT4 A;  4J83 A;  3UAT A;  1VQ4 Q;  2IG0 A;  4YRR A;  3QJY A;  3RER A;  1YFT A;  2M02 A;  1RAD B;  1QCO A;  5GAN 7;  2E5A A;  3MP6 A;  1ZSZ C;  4C8Q C;  1QVG S;  2JS0 A;  2XDP A;  1OU9 A;  2LT4 A;  1KSW A;  5GAN 2;  1B7Y B;  1XTD A;  2KQW A;  2PNI A;  3QO3 A;  4TVW A;  1YIT A;  1HXD A;  2VC8 A;  2XTI A;  3OW2 A;  3RKW A;  1KHI A;  2DA9 A;  5CIU A;  1WGS A;  4C5G A;  1KC8 C;  3FEO A;  1E7O A;  1KOG A;  1SET A;  4JUV A;  1YJN A;  3S3M A;  5FU6 B;  5D6W A;  2M9U A;  4A4H A;  1KQS P;  2IVW A;  1WYX A;  5KE3 A;  2DIL A;  4HCB A;  2ZIN A;  4YTL A;  2RQW A;  4J6Y A;  1XNI A;  4XEO A;  1NLO C;  1E6G A;  4F7U B;  2CJB A;  3CMA A;  2DL4 A;  1QVF S;  3JB9 F;  4CI0 C;  5FRM A;  1Y71 A;  3PCO B;  1K1Z A;  1W2B S;  4YRK A;  2EWN A;  2VUB A;  4J9G A;  1EX4 A;  4UP9 A;  1OQK A;  4E7L A;  3A8G B;  3VQY A;  2KYB A;  1MHN A;  2DIG A;  4LDU A;  3LYI A;  3EH2 A;  2OAW A;  4KGZ B;  2LMJ A;  2OTJ T;  2YUN A;  4J9B A;  5J3B A;  3H0F A;  2JXB A;  4FT2 A;  2MCN A;  1VQL Q;  4P72 C;  2CJ9 A;  1EIY B;  2DFU A;  5GAN 3;  2XGT A;  3X28 B;  2CP6 A;  1N6A A;  2MPX C;  2L89 A;  3OYY A;  3ULR B;  1KMM A;  2PVO B;  11AS A;  2DTO A;  4JRP A;  3OB9 A;  2CH4 A;  1YCS B;  3MEY A;  2HEQ A;  2RNA A;  1SSF A;  3V8K A;  3V7C A;  3M9Q A;  1SSH A;  3MJX A;  4FYW B;  3BDL A;  2HSP A;  2RD1 A;  4OB0 B;  4E47 A;  2LVM A;  4WJ4 A;  2X4J A;  2RHQ A;  3EH1 A;  4QVZ A;  1ZQ1 A;  1N8R C;  2D6F A;  3DB3 A;  1PRM C;  3VUZ A;  1Q81 U;  3HY0 A;  5GAO l;  2DXT A;  2YUO A;  3HXV A;  2RJC A;  3BE3 A;  1BI2 A;  4XTU A;  3CPW S;  2XHC A;  4FM4 B;  4BI8 B;  4JPB W;  1KFZ A;  4OMM A;  3OYD A;  5LJ3 h;  1YI2 T;  4V2S A;  4GLK A;  1H8K A;  2RI5 A;  2FZC B;  1MMG A;  3CMQ A;  4YRP A;  1N5Z A;  5IXB A;  2GCX A;  1L0W A;  3L4G B;  2HQE A;  1K8A R;  3HTR A;  2CDT A;  1NJ5 A;  4RMO A;  2DYI A;  2XU8 A;  1E22 A;  5DLQ E;  2E12 A;  4MZM A;  4M7D G;  1VQ5 T;  1YHQ A;  1Y7X A;  2CSQ A;  4J6W A;  2FZG B;  4M78 G;  2FEI A;  4M77 G;  4JLG A;  3C94 A;  2X3W D;  2MMP A;  2FHD A;  2A08 A;  2CGH A;  4C0D B;  4J9C A;  3I35 A;  5C51 B;  3EHR A;  2YLB A;  2K57 A;  4NL2 A;  4XU2 A;  1X6B A;  3F70 A;  2VWF A;  8ATC B;  4JLI A;  1YNZ A;  1VIF A;  2RO0 A;  5A0G A;  1NYR A;  3EG1 A;  4OMP A;  3M0U A;  3FIF A;  2RA2 A;  4HT8 A;  1X54 A;  4X9C A;  4FYY B;  1Q95 G;  1M8V A;  3QSU A;  2V8J A;  5EC7 A;  3M0P A;  4BI4 A;  2LCS A;  4WI1 A;  4UP7 A;  2AZV A;  4LDV A;  2HBP A;  4E6R A;  1VIE A;  4F04 B;  3H9N A;  2O4X A;  3M53 A;  4LNS A;  2D9T A;  3OBW A;  2RMO A;  1LYL A;  1U06 A;  3M56 A;  4PJO B;  2LCL A;  4EPC A;  2LX7 A;  2CUD A;  1NYF A;  4YCW A;  4H2X B;  9ATC B;  1D3B B;  2V1R A;  1YWO A;  2GQV A;  3M54 A;  4BY6 B;  2O88 A;  1KD1 C;  1AZG B;  4ZN1 A;  1VQ4 T;  3INZ A;  2NLU A;  3OYK A;  2LJ3 A;  1K4U S;  5LJ3 j;  4FSX A;  3CBP A;  3MO8 A;  1KQS A;  2XIC A;  1BKB A;  3QWY A;  2RI3 A;  3CCU T;  3AHU A;  1JO8 A;  5CVI A;  3RUX A;  2KT8 A;  2PTK A;  3VS3 A;  2QQS A;  1WHK A;  2L3R A;  4LVI A;  2SRC A;  2CH4 W;  1VQ7 Q;  2KRN A;  4PLL A;  1RAI B;  2JTF A;  2LRQ A;  5GAO m;  4TWA A;  2Y90 A;  2B8A A;  4J9H A;  1KJW A;  3CCL A;  4HWR A;  2RHS A;  1QF6 A;  2DJZ A;  3FLG A;  3EHQ A;  4F7U F;  2COY A;  4YYE A;  4X5O A;  1M1K C;  3OYL A;  2QGF B;  1TWB A;  2BKD N;  1VQP A;  2J6O A;  4M75 E;  4G84 A;  2E3H A;  2DF6 A;  4D8K A;  4QQG A;  4DEX A;  4DQ2 A;  2AKK A;  1SF9 A;  2QHU A;  4DPG A;  2HZY A;  3WVD B;  1VQN Q;  2FRY A;  3QG1 A;  4M7A A;  1IXD A;  4E7I A;  1GXI E;  2G6F X;  1KG1 A;  2KGT A;  3UPU A;  2VGM A;  1B8A A;  1SES A;  2FYK A;  1I07 A;  2MOX A;  3NFC A;  1QVG P;  1VUB A;  1YWP A;  5CAI A;  1Q86 R;  2EKH A;  3PMT A;  3LWH A;  3LGF A;  2ROL A;  3QXE B;  2VAS A;  4K11 A;  1M30 A;  3C95 A;  2HMA A;  2DO3 A;  3A7A A;  1ZSZ B;  1Z7M A;  1JRI A;  1R77 A;  3CME Q;  1Q81 C;  1S1N A;  1OPL A;  2NUT B;  2COW A;  4VUB A;  3VS4 A;  1RIQ A;  3NPF A;  4C92 F;  3JCM b;  1MMA A;  2DL5 A;  1RAE B;  1VQL T;  3OYI A;  1PM3 A;  2V26 A;  2OJ2 A;  4HVU A;  3MPU B;  2YUP A;  3A1P A;  3FRN A;  1B70 A;  3MEU A;  4M7A D;  4J8O A;  7AT1 B;  2JJ9 A;  2EFI A;  4L6V 5;  4YRC A;  3PE0 A;  3HRU A;  3QBY A;  1IZ6 A;  4ORZ A;  5GAN 5;  2A36 A;  3CCR Q;  1HTT A;  3V7S A;  3PGG A;  1YJ9 Q;  2ARS A;  4OMN A;  5CKE A;  1BIA A;  3KXT A;  3G4S T;  2DQ0 A;  5IXF A;  2LQN A;  4K87 A;  4M7A F;  2EQI A;  4Z89 A;  3WXM B;  3LGL A;  5LJ3 e;  1W2B P;  2MK5 A;  2DIQ A;  3ICA A;  4YRL A;  2KXD A;  2NS6 A;  2C0T A;  4XU3 A;  3A8O B;  3REA B;  4AH6 A;  1GRI A;  4KBM B;  3QDF A;  5FU7 C;  4FW2 A;  4TVR A;  1OI1 A;  4RMF A;  4RQE A;  2CIM A;  5DLO A;  1I5L A;  3RNJ A;  3M57 A;  4IUQ A;  4ELY C;  3P8Y A;  3HL8 A;  5GAN g;  2AK5 A;  2DMO A;  1X2Q A;  1TG0 A;  4IUU A;  3DSQ A;  2W10 A;  4BDY A;  2NWM A;  1G51 A;  1FMW A;  1PKS A;  3C0C A;  1D09 B;  3CCV A;  1AWX A;  4F14 A;  1T0H A;  5FLX E;  3EGX A;  2CUB A;  2QYZ A;  2QA4 Q;  3OYH A;  5L8R E;  4DOV A;  2BZX A;  1KIK A;  2DZC A;  4EO4 A;  1M3B A;  4HKE A;  3SWN C;  5IN1 A;  1N9S A;  1K73 C;  2P0K A;  3MP1 A;  2KY9 A;  2YDL A;  5GAN d;  3OYF A;  4DBQ A;  4PJO F;  2O9V A;  1VQ8 T;  2D8H A; 
#chains in the Genus database with same CATH homology
 5GAO q;  5IAY A;  3I56 A;  4RCB A;  3OSV A;  1SER A;  1NJI C;  3S3O A;  3VQV A;  3R07 A;  1ASY A;  5C53 B;  1LNX A;  4M7A C;  3P8T A;  4XQ3 A;  3VKI A;  2IY5 B;  2YLC A;  4JJN K;  2ZTG A;  4LDY A;  2Y4Y A;  1NJ6 A;  2AMC A;  3WQZ A;  4IUT A;  2CZ7 B;  2P0Q A;  2HAX A;  2QQA A;  4XK8 E;  2ODR D;  4QVD A;  4KR2 A;  3JB9 J;  1VQ5 A;  3QO7 A;  3JCM Q;  1VQ7 T;  3M59 A;  1QVG A;  5GAN f;  1KHC A;  5CQY A;  3P8B B;  4M7D A;  2V8I A;  3NTI A;  4C8Q D;  4M78 A;  4M77 A;  4G85 A;  2F5K A;  3ERR A;  4D6W A;  1M90 U;  4O5V A;  2XK0 A;  2VV5 A;  4C8Q F;  3QYH B;  1VQN T;  1B34 A;  4FIB A;  4CS2 A;  1X55 A;  4HCZ A;  3CCS A;  4X34 A;  4GY5 A;  3MQZ A;  2E6Z A;  1H64 1;  1BI0 A;  1WQW A;  1U8R A;  4M7D D;  2ZZD A;  2XG8 D;  3L1A A;  2X4X A;  3MEV A;  4BWA A;  3JB9 I;  4M78 D;  1LOJ A;  4M77 D;  2JUF A;  1IL2 A;  4NCX A;  1QVF A;  2WSE E;  4HWO A;  1W2B A;  3CME T;  2E70 A;  1G3S A;  4PL6 A;  4F7U E;  3QYG B;  3H8Z A;  4LD6 A;  4HCC A;  3CCU A;  4NS5 A;  3CEY A;  2YHT A;  1I8F A;  2ZCF B;  2RHQ B;  3ZFJ A;  2RI2 A;  1H3Z A;  2E6N A;  3PIO A;  3CCR T;  3SDZ A;  2Q7H A;  3DB4 A;  2P5I A;  1MGQ A;  3IG2 A;  2KVQ G;  3KFU A;  2E5Q A;  1G5H A;  4YPF A;  3JCM c;  3TEH A;  1VQ9 A;  5GMK l;  4DA4 A;  4YCV A;  1V29 B;  5HK0 A;  1EQR A;  1W66 A;  4OB1 B;  5GMK h;  2EJF A;  3VU3 C;  5J39 A;  3OS1 A;  4KUI A;  1M9S A;  1PYS A;  4RQF A;  3GNF B;  3WVE B;  3P8V A;  5CQX A;  4LDW A;  3CXC S;  4ZGJ B;  3CPW A;  3FJP A;  3UT1 A;  3HRT A;  1ADJ A;  3HFO A;  4C5E A;  3A74 A;  1WU7 A;  2L5Q A;  4KUD K;  4OLF A;  1Q7Y C;  1G3Y A;  4UPA A;  2CS7 A;  1KD1 U;  3OMC A;  1SRY A;  1OZ2 A;  4H2U A;  4PKC C;  3TCJ A;  3KBG A;  3VV0 A;  2GFU A;  3HXX A;  4XTY A;  1USY A;  4M7D C;  2EJG A;  3LLR A;  3HXW A;  4M78 C;  4BE1 A;  4YRQ A;  2KAF A;  4M77 C;  3R6O A;  4IUV A;  2EQK A;  3NEN A;  3E19 A;  3EAE A;  2RJD A;  2DD4 A;  2FL7 A;  3G71 T;  3VJP A;  3G6E T;  4OB2 B;  5DM7 R;  1LJO A;  3OS0 A;  2ZT6 A;  3BFM A;  1M1K U;  4ZGD B;  2DTH A;  2G3R A;  2O4X B;  1VQK T;  3G4S A;  4E7H A;  5GAM g;  3OSS C;  3EFR A;  4TVA A;  2OAU A;  2PUK B;  2RHZ A;  3CD6 T;  1VQM T;  4P74 A;  5KNN A;  2ZZG A;  2DAQ A;  2JZ2 A;  3HY1 A;  3CCM A;  2QTX A;  5CK9 A;  1M1F A;  5GMK j;  1M90 C;  4NOY A;  5GAO n;  3V8L A;  2ZPE B;  2J3L A;  3HRI A;  3RMS A;  2E65 A;  5GAN h;  3HFV A;  4C92 B;  1XOV A;  2RHS B;  4P3P A;  2ZIO A;  2VYT A;  3OS2 A;  1NPR A;  4PJO E;  2DVE A;  5A2Q E;  2ALY A;  3RAC A;  3L2Q A;  5IT9 E;  1G5V A;  4ATO A;  4OF1 A;  2RHI A;  2ZT5 A;  4XEM A;  3VYG A;  3E9G A;  4CH5 A;  1RL2 A;  3S3N A;  2R5M A;  3OQ5 A;  1YIJ T;  1M4Z A;  1VQ8 A;  2JVV A;  1G3W A;  4M7A B;  4BB7 A;  3A8H B;  2X4W A;  2KMT A;  3A8L B;  2QQ9 A;  3SB2 A;  3OYA A;  4HVC A;  2DZ9 A;  2PQW A;  3PIP A;  3C4S A;  2HQX A;  2MWO A;  3M4Y A;  3IAL A;  4PLI A;  3OMG A;  1JJ2 S;  2LQ8 A;  4J7I A;  3JAM E;  1M5Q 1;  4M75 G;  1WJS A;  1B70 B;  3HRK A;  3HHT B;  4EMK C;  1USY C;  3SD4 A;  4YRI A;  1QVP A;  2FVU A;  2ZIM A;  3NEL A;  5KCO A;  1Q82 C;  3CCE A;  3X25 B;  2VXF A;  5GAO p;  1VQ7 A;  1K73 U;  4JS4 A;  4QVC A;  2ZPF B;  5GAN j;  4EDU A;  1Y07 A;  3NTK A;  1UGR B;  2PMF A;  3OD1 A;  1W4S A;  2R57 A;  4Y28 E;  3RES A;  4H02 A;  3CC2 T;  5GMK e;  3RKY A;  4YCU A;  3S6W A;  1OZ3 A;  2XI9 A;  1NJI U;  3P8H A;  3CCQ T;  1VQ6 T;  1PSF A;  3OBY A;  3MET A;  1O75 A;  4Q5W A;  3T9N A;  4XTZ A;  2MI6 A;  3M4G A;  2DXU A;  4RCC A;  4P74 C;  5K1P A;  4P5N A;  3I7F A;  4KQE A;  4ME7 A;  5CKF A;  3SWN A;  2ZT7 A;  5HGQ A;  4CRI A;  3CC4 T;  1JJC A;  5CKH A;  3JB9 G;  1QP2 A;  3E9I A;  4YRO A;  4NL3 A;  4EX5 A;  2DTI A;  3BJU A;  4J5Y A;  1FX7 A;  5GAN 6;  4J7F A;  4IUR A;  3JCM J;  4H2S A;  3G7Z A;  2E3C A;  4JRI A;  3GPL A;  1B76 A;  4C8Q B;  3UH0 A;  2BUD A;  5LJ5 g;  3VQX A;  2DKG A;  1YIT T;  1K9M C;  2AMC B;  4CS4 A;  3MF1 A;  5A0D A;  2DPP B;  4YRS A;  1UB4 A;  2K5L A;  1YJN T;  2ZZF A;  1H4Q A;  3HP9 A;  5D6X A;  1K8A C;  1E1T A;  1TH7 A;  5GAN e;  2CKK A;  1WPY A;  3M4Q A;  2QXF A;  3KUF A;  5LJ5 d;  5I2S A;  1IRE B;  1BBU A;  4M7D B;  4BD3 A;  4C0F A;  3CMA T;  3LSS A;  5FU6 C;  4M78 B;  4M77 B;  1JB0 E;  4HWP A;  5EG2 A;  2ZNJ A;  2RHY A;  4Q15 A;  4CH6 A;  4OMF B;  3RF1 A;  4BI3 A;  4CH3 A;  1BYM A;  3GOX A;  3X24 B;  3RGL A;  1B34 B;  2OTL T;  4C0G A;  5KE2 A;  1KMN A;  1EFW A;  1NJ2 A;  2OTJ A;  1P92 A;  1Z7N A;  3QNE A;  2ZXF A;  4H2V A;  2RJF A;  4RG2 A;  3LWI A;  3QO5 A;  2EKO A;  1VQM A;  3E1S A;  3HFN A;  3BDU A;  3CBO A;  5LJ5 f;  1NE8 A;  1Q7Y U;  3M58 A;  3QZ9 B;  4BE0 A;  4MML A;  1EVL A;  3NET A;  4TVY A;  3ZEH A;  1G3T A;  3PMI A;  4J15 A;  3VUB A;  2P4T A;  2G4C A;  4FU6 A;  1EOV A;  2K5I A;  4BAC A;  3VQW A;  2QHS A;  4WF2 A;  2QHT A;  4R56 A;  4ZTJ A;  1YI2 A;  3RL6 A;  1PYS B;  2K3Y A;  4ZTF A;  3M5A A;  3X26 B;  2E64 A;  3G1Z A;  2P0P A;  5HKC A;  4E7J A;  1KQ1 A;  1NJ1 A;  2EAY A;  4F7U G;  1YFR A;  1FWZ A;  2RB6 A;  1I81 A;  2PU9 B;  1OYX A;  2DXC A;  1U1T A;  3JCM g;  3QUI A;  3UGT A;  3GLX A;  3UDC A;  3CXC A;  3ME9 A;  2VGN A;  2A7Y A;  3SFM A;  2F5T X;  3OY9 A;  1ADY A;  2KDS A;  3DKM A;  4H2W A;  3NEM A;  1UGP B;  3BY7 A;  4RG8 A;  3OA6 A;  4O2D A;  2J3M A;  3PZC A;  3N5B B;  4KUL A;  1XQH A;  3JCM d;  1BI1 A;  4LVK A;  4M75 A;  4LD9 K;  4C92 G;  2CZ6 B;  3H6Z A;  2GFA A;  4A4E A;  4BY6 C;  4MZP A;  2EQJ A;  4BE2 A;  5DY9 A;  1N27 A;  5CO7 A;  2LX9 A;  3CC2 A;  3CCL T;  1VQ4 A;  2EQM A;  2XDB A;  2GF7 A;  4M7D F;  3L2W A;  4M78 F;  4M77 F;  1X75 C;  2RHU A;  4PG3 A;  5KH6 A;  2DU7 A;  1VQP T;  1H4V B;  2CYZ B;  2ZR3 A;  3HXZ A;  4A4G A;  4M75 D;  1JBM A;  1YCY A;  4L87 A;  1KQ2 A;  1QE0 A;  1YJ9 T;  4QW2 A;  2ALY B;  2MWP A;  4FL6 A;  3OYM A;  3UFG A;  1HC7 A;  3OYB A;  4MDX A;  1Y96 A;  2ZPG B;  3OS5 A;  2ZZE A;  3M55 A;  3JCM W;  1PSE A;  2CJA A;  2R58 A;  3RKX A;  3QJ6 A;  4P73 A;  1Q82 U;  1O9S A;  3E9F A;  3URG A;  4XTV A;  3OYC A;  2IY5 A;  4IUP A;  2C8M A;  2QDY B;  4UC4 A;  4TQF A;  3L2Z A;  3CC7 T;  4O6J A;  4C92 E;  5J26 A;  2JTM A;  3HXY A;  1S72 T;  3MEA A;  2JN0 A;  2QA4 T;  2LCC A;  4PJO G;  3TUP A;  2MAM A;  1G5I A;  5GAM e;  3IKL A;  3M4P A;  2PME A;  4EMK A;  2WAC A;  1VQL A;  5LJ5 h;  1YJW T;  3V8J A;  4M7A E;  3HKS A;  4BW9 A;  3A7R A;  4MMK A;  2QEX T;  1X2G A;  3J7A F;  4E7K A;  1JJ2 A;  1UGQ B;  1WJR A;  4QQD A;  3JB9 D;  2X35 A;  4JS5 A;  2Q7E A;  4LVM A;  1X6O A;  4M75 C;  5FU7 B;  2EJ9 A;  2QQB A;  4JRK A;  2KSS A;  2E41 A;  4C0Z A;  3UWN A;  2ZGW A;  3CCV T;  1I4K 1;  2DXB A;  3E9H A;  4E51 A;  4YRN A;  2M0O A;  4LVL A;  4C5I A;  2D0Q B;  2HD0 A;  2QI2 A;  5HY6 A;  4JRQ A;  2OTL A;  2AKW A;  2DU5 A;  3TU4 K;  5GAM d;  2K5F A;  2WSC E;  3SWN B;  3O8V A;  5CCA A;  5CKD A;  3I56 T;  1K9M U;  3NTH A;  2H3J A;  3LSQ A;  4YRT A;  5K1X A;  1YB3 A;  4HA8 A;  2BIV A;  4BDZ A;  4B9X A;  5GMK m;  2Q5I A;  1JJC B;  2Q7G A;  3L2U A;  3TRE A;  4C8Q G;  4TTV A;  2L8D A;  1YFS A;  2HNI A;  2LDM A;  1GGM A;  3A7U A;  1K8A U;  2LNV A;  3X20 B;  1J5W A;  4YP0 A;  3A5Z A;  2X4Y A;  3UGQ A;  2VXE A;  5C0M A;  5LJ5 j;  3HFZ A;  4P73 C;  1RI0 A;  3L2V A;  3A32 A;  3OW2 S;  1UGS B;  3MF2 A;  3I55 T;  4TQD A;  4XU1 A;  5ELN A;  2CZ1 B;  3JCM X;  3MP8 A;  1B7Y A;  4N4G A;  5A0L A;  1ATI A;  1NPP A;  1ZHI A;  2DEQ A;  2XKO C;  5GAM f;  4HWT A;  3CCJ T;  4YRE A;  4PHC A;  4OP0 A;  2V8K A;  1NNH A;  4YDQ A;  3REU A;  1WQ7 A;  3LC0 A;  3L2R A;  5GAN 8;  1X56 A;  2RH2 A;  2M16 A;  2XID A;  4HT4 A;  1VQO T;  4C8Q E;  1C0A A;  4RKU E;  4F7U A;  3L42 A;  1NJ8 A;  1ASZ A;  3JCM h;  3CCS T;  4L59 A;  3MHX A;  3HRS A;  1E24 A;  3PCO A;  5GAN 4;  1WYD A;  1BBW A;  1VQZ A;  3LX7 A;  3RIR A;  3GP8 A;  1VQN A;  1EIY A;  1YGB A;  3MEW A;  2K3X A;  4P3O A;  3JCM P;  3GF5 A;  4M7D E;  3A31 A;  1N9R A;  3QKJ A;  2KK4 A;  2PVG B;  4M78 E;  4M77 E;  5C52 B;  3QTC A;  2LC4 A;  4ZN3 A;  3LW5 E;  5LJ5 e;  3CME A;  2I4L A;  5AYF A;  4C92 A;  12AS A;  4CH4 A;  2ZPI B;  2ZCE A;  1VQ9 T;  3A5Y A;  1BI3 A;  1Q86 U;  5CR2 A;  2PVD B;  2RJE A;  2ARU A;  3Q1J A;  3QII A;  4EMH A;  2Q5H A;  4L5G A;  4OB3 B;  5LL6 S;  3CCR A;  2I4O A;  1YJ9 A;  1R8O B;  3L4G A;  3DLL A;  4Y91 A;  5FRO A;  2EIF A;  2Y4X A;  5GMK i;  4ZIB A;  4C92 D;  4P75 A;  2ZNI A;  4H2T A;  1NZ9 A;  2A3L A;  4IKF A;  2EL9 A;  4XU0 A;  2EQU A;  2DK3 A;  3PNW C;  2RK2 A;  3J80 E;  2DQ3 A;  3A8M B;  4XTW A;  4ZTU B;  1QW1 A;  2MF2 A;  4Z02 A;  4R55 A;  3J81 E;  3HXU A;  2ART A;  3CC7 A;  4LDX A;  3GIB A;  4RDX A;  1UEB A;  1S72 A;  1FYF A;  4P71 A;  3QZ5 B;  3REX A;  2QA4 A;  1X01 A;  2ZPH B;  3W3S A;  3C12 A;  3P8D A;  4KR3 A;  1E1O A;  1KQS S;  1YJW A;  4OGC A;  5M9O A;  1NYQ A;  4PJO A;  2YRV A;  3V7R A;  3JCM V;  3G71 A;  4H2X A;  3G6E A;  3ER0 A;  2QEX A;  1D3B A;  4M75 B;  5ELO A;  1H4T A;  2JNG A;  2I4N A;  2A8E A;  1EVK A;  1VQK A;  3CCM T;  4YRM A;  4KT0 E;  3TEE A;  4DOW A;  3QHS A;  1ZBX A;  5GAM h;  2I2L A;  4N0A A;  4YRF A;  5I2M A;  2O01 E;  2RM4 A;  3CD6 A;  3HPW A;  5LJ3 g;  4ZTZ B;  4ELZ C;  1YBY A;  4Q6G A;  3OYN A;  4N4H A;  2M1H A;  4PJO D;  3FDR A;  4C92 C;  3HTZ A;  3OYE A;  2E1H A;  2RK1 A;  1WNL A;  5KCH A;  4OGE A;  2C7I A;  2WSF E;  4OVA A;  1H4S A;  1Y96 B;  3TEH B;  2K2V A;  1YHQ T;  3VBB A;  3JCM e;  5LJ3 d;  4UP8 A;  5E3I A;  3JSC A;  4YRG A;  4MDW A;  4XTX A;  1KC8 U;  3HSB A;  2ZR2 A;  5C6S A;  3RMQ A;  3BW1 A;  1YIJ A;  2XDD A;  3FC3 A;  5GAO r;  4PNO A;  3JB9 H;  4P75 C;  2LT1 A;  4C0D C;  3IKM B;  4C8Q A;  5CKB A;  2QHV A;  4QQ6 A;  4FT4 A;  4B9W A;  2R5A A;  4X9D A;  4YRJ A;  5D6Y A;  2C06 A;  5I21 A;  4C5H A;  4K88 A;  3DLM A;  1QP3 A;  3PT9 A;  3QPH A;  1Q86 C;  3I55 A;  1X2H A;  4A4F A;  4EMK B;  2P0L A;  3CCE T;  4HWS A;  4MZT A;  4A54 A;  3QDR B;  4P71 C;  3GNG A;  4JDS A;  1FXX A;  3CBM A;  2I4M A;  5GAM j;  3CCJ A;  4H2Y A;  4XAX B;  4LVJ A;  2FB7 A;  4EMG A;  3EFS A;  3FB9 A;  5LJ3 f;  2JOY A;  4PJO C;  2DD5 A;  4A53 A;  4II1 A;  4HT9 A;  4BUG A;  5FRN A;  2F69 A;  4TVA B;  4WJ3 M;  1N8R U;  1VQO A;  2ZPB B;  2XD0 A;  4N4I A;  3PTA A;  3ASK A;  4P72 A;  1U1S A;  2ZT8 A;  1WLE A;  3CCQ A;  4K86 A;  1VQ6 A;  4N0A C;  2E10 A;  2QQR A;  3VYH B;  4M7A G;  3PFS A;  2AKW B;  1HK9 A;  3QO8 A;  2DDZ A;  2AHJ B;  2RHX A;  3ZBD A;  5F5W A;  1N9W A;  3OYG A;  2LTO A;  2K4Y A;  3TEG A;  1AHJ B;  1WJQ A;  4P3N A;  5HK3 A;  3JRZ A;  2LQK A;  4J6X A;  1EIF A;  3MCA B;  4M75 F;  1DJ7 B;  3CC4 A;  4ZGE B;  3OYJ A;  4CS3 A;  3JCM f;  2EYQ A;  2CZ0 B;  2PUO B;  4A4K A;  2ODR C;  3CPF A;  1BIB A;  3A5Z B;  3LH0 A;  3HFZ B;  1M1G A;  4J83 A;  2IG0 A;  4YRR A;  3QJY A;  3RER A;  1YFT A;  5GAN 7;  2E5A A;  3MP6 A;  4C8Q C;  1QVG S;  2XDP A;  2LT4 A;  5GAN 2;  1B7Y B;  1XTD A;  2KQW A;  3QO3 A;  4TVW A;  1YIT A;  1HXD A;  2VC8 A;  2XTI A;  3OW2 A;  3RKW A;  1KHI A;  5CIU A;  1WGS A;  4C5G A;  1KC8 C;  3FEO A;  1KOG A;  1SET A;  4JUV A;  1YJN A;  3S3M A;  5FU6 B;  5D6W A;  2M9U A;  4A4H A;  2IVW A;  5KE3 A;  4HCB A;  2ZIN A;  4YTL A;  4J6Y A;  1XNI A;  4XEO A;  4F7U B;  2CJB A;  3CMA A;  1QVF S;  3JB9 F;  4CI0 C;  5FRM A;  1Y71 A;  3PCO B;  1W2B S;  4YRK A;  2EWN A;  2VUB A;  4UP9 A;  4E7L A;  3A8G B;  3VQY A;  1MHN A;  2DIG A;  4LDU A;  3LYI A;  2OTJ T;  5J3B A;  4FT2 A;  4P72 C;  1EIY B;  2CJ9 A;  5GAN 3;  2XGT A;  3X28 B;  1N6A A;  2L89 A;  3OYY A;  11AS A;  1KMM A;  2PVO B;  2DTO A;  4JRP A;  3OB9 A;  3MEY A;  3V8K A;  1SSF A;  3V7C A;  3M9Q A;  3BDL A;  2RD1 A;  4OB0 B;  4E47 A;  2LVM A;  4WJ4 A;  2X4J A;  2RHQ A;  4QVZ A;  1ZQ1 A;  1N8R C;  2D6F A;  3DB3 A;  3VUZ A;  1Q81 U;  3HY0 A;  5GAO l;  2DXT A;  3HXV A;  2RJC A;  1BI2 A;  4XTU A;  3CPW S;  2XHC A;  4FM4 B;  4BI8 B;  3OYD A;  5LJ3 h;  1YI2 T;  4V2S A;  4GLK A;  2RI5 A;  3CMQ A;  4YRP A;  2GCX A;  1L0W A;  3L4G B;  2HQE A;  1NJ5 A;  4RMO A;  2XU8 A;  1E22 A;  5DLQ E;  2E12 A;  4MZM A;  4M7D G;  1VQ5 T;  1YHQ A;  1Y7X A;  4J6W A;  4M78 G;  4M77 G;  4JLG A;  3C94 A;  2MMP A;  2FHD A;  2CGH A;  4C0D B;  5C51 B;  2YLB A;  2K57 A;  4NL2 A;  4XU2 A;  3F70 A;  4JLI A;  1VIF A;  2RO0 A;  5A0G A;  1NYR A;  3FIF A;  2RA2 A;  4HT8 A;  1X54 A;  4X9C A;  1M8V A;  3QSU A;  2V8J A;  4BI4 A;  4WI1 A;  4UP7 A;  4LDV A;  2HBP A;  1VIE A;  2O4X A;  3M53 A;  4LNS A;  2D9T A;  3OBW A;  1LYL A;  3M56 A;  4PJO B;  2LCL A;  4EPC A;  4YCW A;  4H2X B;  1D3B B;  2GQV A;  3M54 A;  4BY6 B;  1KD1 C;  4ZN1 A;  1VQ4 T;  3INZ A;  2NLU A;  3OYK A;  5LJ3 j;  4FSX A;  3CBP A;  3MO8 A;  1KQS A;  2XIC A;  1BKB A;  2RI3 A;  3CCU T;  3AHU A;  5CVI A;  3RUX A;  2QQS A;  2L3R A;  4LVI A;  4PLL A;  2JTF A;  2LRQ A;  5GAO m;  4TWA A;  2Y90 A;  2B8A A;  4HWR A;  3CCL A;  2RHS A;  1QF6 A;  2DJZ A;  3FLG A;  4F7U F;  4YYE A;  4X5O A;  1M1K C;  3OYL A;  2BKD N;  1VQP A;  4M75 E;  4G84 A;  4QQG A;  4DQ2 A;  2QHU A;  4DPG A;  3WVD B;  3QG1 A;  4M7A A;  4E7I A;  1GXI E;  1KG1 A;  3UPU A;  2VGM A;  1SES A;  1B8A A;  2FYK A;  3NFC A;  1VUB A;  5CAI A;  3PMT A;  3LWH A;  3LGF A;  3QXE B;  3C95 A;  2DO3 A;  3A7A A;  1Z7M A;  1JRI A;  1Q81 C;  4VUB A;  1RIQ A;  4C92 F;  3JCM b;  1VQL T;  3OYI A;  3FRN A;  1B70 A;  3MEU A;  4M7A D;  4J8O A;  4YRC A;  2EFI A;  4L6V 5;  3HRU A;  3QBY A;  1IZ6 A;  5GAN 5;  1HTT A;  3V7S A;  2ARS A;  3PGG A;  5CKE A;  1BIA A;  3KXT A;  3G4S T;  2DQ0 A;  4K87 A;  4M7A F;  3WXM B;  3LGL A;  5LJ3 e;  2DIQ A;  3ICA A;  4YRL A;  2NS6 A;  4XU3 A;  3A8O B;  4AH6 A;  4KBM B;  5FU7 C;  4TVR A;  1OI1 A;  4RMF A;  4RQE A;  2CIM A;  1I5L A;  5DLO A;  3M57 A;  4IUQ A;  4ELY C;  3P8Y A;  3HL8 A;  5GAN g;  4IUU A;  3DSQ A;  4BDY A;  1G51 A;  3CCV A;  5FLX E;  3OYH A;  5L8R E;  4DOV A;  2DZC A;  4EO4 A;  4HKE A;  3SWN C;  5IN1 A;  1N9S A;  1K73 C;  2P0K A;  3MP1 A;  2KY9 A;  5GAN d;  3OYF A;  4PJO F;  1VQ8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...