4XTXA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 57 with azide in place of ribose 2'oh
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtxA01
3P8TA 4P74A 2E41A 2RD1A 1I4K1 3V8LA 2EL9A 2YHTA 4YRSA 5GAMe 4ZTUB 4HA8A 5GMKh 4ZIBA 2JN0A 3L1AA 4PJOD 1ADJA 1YFRA 4YRQA 4YRGA 3PGGA 2DXUA 5LJ3g 5GAMf 1PYSB 2ZIMA 1U1TA 4TVAB 4M75F 3JB9F 1NJ6A 2DJZA 2DQ3A 4XTXA 1SESA 1NYQA 5CAIA 4X9DA 4G84A 1ATIA 3HFZB 5GAOp 5GAMj 4NL3A 2ZNJA 4P74C 2ZZFA 3IG2A 3JB9I 2DTOA 4YDQA 4XU2A 4HWTA 4XTZA 4EMKB 3R07A 4YRKA 3MEYA 4PJOB 3BW1A 1G5IA 4M7DF 3HXUA 5ELOA 4XQ3A 4CH6A 4HT8A 1BBWA 1E1OA 2ODRC 1B7YA 4WI1A 4JRKA 4M7DA 2CIMA 2CJ9A 2C8MA 3UGQA 4M75C 1WYDA 2Q5IA 2QHUA 4H2WA 1EOVA 2E3CA 3QO7A 1M5Q1 1MGQA 1ASYA 1WQWA 3JCMP 1J5WA 2I4OA 2E10A 1U1SA 1E1TA 3JCMd 3EFRA 2ZZGA 2XGTA 2CGHA 3JCMc 1H641 1Y96B 2ZNIA 2AMCA 4EMGA 4JUVA 4TQDA 4J15A 3GIBA 4H2UA 4O2DA 4TVWA 4M75B 5GMKl 2DU7A 3VU3C 3RF1A 1WPYA 4C8QG 4C8QE 2CJAA 4AH6A 4WJ3M 4P3OA 1I8FA 4C92A 4XU1A 2EJGA 4F7UG 3M4QA 4TWAA 2FYKA 5GAN2 5GANd 1JJCB 1NJ8A 1B70B 3HSBA 4XEOA 5GAOl 3BFMA 4M78G 4HWOA 4KQEA 3M4GA 5GMKm 1SETA 1NNHA 3INZA 4MMLA 3UH0A 4TVAA 2EWNA 2RHQB 4H2XB 11ASA 2DEQA 3IKMB 2QTXA 5LJ5d 4UP7A 3HRKA 3JCMW 1H4TA 2ZR3A 3WQZA 3HFZA 3IKLA 5GAOm 3NETA 1E24A 1SERA 4P71A 3REXA 5GAMg 2E5AA 2YLBA 3HXWA 4J5YA 2ALYB 1IL2A 1KQ1A 3A5YA 5GAN5 4PJOF 5LJ3d 2P5IA 3VQWA 4P3PA 3QO8A 4M77G 4EMKA 1BIAA 4M77E 2ZR2A 3A7UA 4PJOA 2P0LA 4XU3A 4H2VA 2PMEA 1YFTA 1EVKA 2ZIOA 1KOGA 2HNIA 3E9IA 4QVCA 4RQFA 5GAOn 1H4VB 1YCYA 4HWPA 2DKGA 3VBBA 3HFOA 3UFGA 1YB3A 4YRFA 5GMKe 4P71C 4C8QD 3P8YA 2ZT7A 1YGBA 2I4NA 2I2LA 4RCCA 1H4QA 3SB2A 4J6WA 1Y96A 3RESA 5GANh 5K1XA 4M75A 4EMKC 2E65A 2DZ9A 2Q7EA 4HVCA 1NJ1A 4PJOC 1M8VA 4K87A 4M78D 3P8VA 1QF6A 3A74A 3QSUA 3SWNB 1ASZA 3BJUA 4YREA 2YLCA 2EJFA 4P72A 3M4PA 1NYRA 4YCVA 5GMKj 2ZT8A 4RDXA 5C53B 1JJCA 1N9RA 1HC7A 2DXTA 3HTZA 1B34B 3RACA 1B70A 3E9HA 4HWRA 1SRYA 2DZCA 5LJ5h 2VXEA 2Q5HA 3V8JA 4C8QB 3V7RA 4V2SA 1LJOA 4M7AG 3L4GB 1TH7A 4F7UB 4K88A 3FIFA 1NJ5A 4P73A 2RHQA 4H2XA 2K57A 4TTVA 3NEMA 3JCMV 4YRLA 3HXVA 1KMMA 1G5HA 2E64A 5LJ3h 2FB7A 4YROA 4M78B 4YRPA 2DVEA 4XU0A 4M77D 4P72C 3JCMJ 3CMQA 3V8KA 4YCWA 5LJ5j 3JB9H 2ZINA 4YPFA 3HXXA 2ALYA 1H4SA 4YRNA 5HGQA 4H2SA 4UPAA 4YRMA 4WF2A 1Z7MA 3A31A 2QHSA 2I4MA 4P73C 4F7UE 5I21A 2RA2A 3NENA 4OLFA 5GAN6 4CS3A 1X54A 5GAN4 4H02A 4YRCA 3NELA 3PCOB 4M78E 5GAOq 1EVLA 4M77B 2CJBA 2VXFA 1Z7NA 4YP0A 1W66A 1EFWA 1ADYA 2J3LA 2IY5B 2ZCEA 3JCMg 2J3MA 2ZTGA 3RKWA 2EAYA 2ARSA 1HK9A 2E1HA 2RHSB 2Q7GA 3FJPA 1WU7A 3QNEA 1E22A 4XTVA 1RIQA 3SWNA 4M7AD 1X56A 3JCMQ 2ZZEA 4PHCA 3QUIA 4C92D 4CH5A 1B34A 2QHTA 4CS4A 1EIYB 3HXYA 4A53A 4C8QF 4XTYA 1N9WA 4F7UF 4C8QA 1WQ7A 1KMNA 3JCMe 4RCBA 3L4GA 4F7UA 2Y90A 3QTCA 4H2TA 1BIBA 1NJ2A 1KQ2A 4M78F 3JCMf 3QHSA 4YRRA 4HWSA 3REUA 2ZT5A 3ICAA 4M78A 3SWNC 3HXZA 4N0AA 3JCMX 2AKWB 3I7FA 4M7AB 5GAN8 3RGLA 4DPGA 2C7IA 1WNLA 1B76A 1HTTA 4M7DG 12ASA 4M7DE 5GANe 1X55A 4XEMA 4BW9A 2RM4A 3A32A 2I4LA 4C8QC 3EFSA 5GAMh 4H2YA 3TEGA 3RIRA 2ARTA 5GANf 4JLIA 4XTUA 3ERRA 3TEHB 1WLEA 4EO4A 4A54A 2ZGWA 4EMHA 4M78C 4M77F 4UP8A 5KNNA 1L0WA 4N0AC 3HFVA 3PCOA 5LJ5e 4M77A 2EJ9A 3JB9J 4WJ4A 5GANj 2ARUA 3JCMb 2Q7HA 4M7AE 3LC0A 3UGTA 3RKYA 1B8AA 5LJ5f 4C92G 4C92E 3RL6A 1JRIA 3G1ZA 1EQRA 3PZCA 3BY7A 1X2HA 2ODRD 4XTWA 2IY5A 5GAN3 4K86A 3HY0A 1D3BA 5GAN7 4M75D 3JB9D 5LJ3e 3RERA 2RHSA 3VQVA 2G4CA 2DTIA 3FB9A 1LYLA 4ZTZB 5LJ3f 4P75A 4EX5A 4Q15A 5F5WA 4TQFA 3HY1A 3A5ZA 4CH4A 1EIYA 4M77C 3BDUA 3VQYA 4QVDA 3QO3A 2XTIA 5ELNA 3V7SA 3VQXA 4NOYA 1N9SA 4J6YA 4NCXA 4NL2A 5LJ3j 1YFSA 2QHVA 4M7DD 4YRJA 1QE0A 3OD1A 2ZT6A 4YRTA 5GAMd 1G51A 4J6XA 1X2GA 4M7AF 4MMKA 1VQZA 4RMFA 2AKWA 3A7RA 4CH3A 4C92F 4KR2A 4P75C 4PJOG 4M7AA 4PJOE 2DU5A 1LOJA 4M7DC 1X01A 4HT9A 1USYA 3A7AA 1C0AA 2RB6A 2PMFA 4X9CA 1BBUA 5DY9A 4Y91A 1D3BB 4DQ2A 4KR3A 5E3IA 2DTHA 3W3SA 3L2ZA 4L87A 3TEHA 3MF1A 1HXDA 4PNOA 1B7YB 3HRIA 4X5OA 1I5LA 4M7DB 3RUXA 1PYSA 3V7CA 3TUPA 2VC8A 5GAOr 4YCUA 4M75G 3JB9G 4M75E 5K1PA 4M7AC 5GANg 3DSQA 4YYEA 1USYC 4C92C 2DDZA 2DQ0A 3LSQA 4Q6GA 4BWAA 1FYFA 4OP0A 4JRIA 3HFNA 1I81A 3AHUA 1GGMA 2AMCB 3MF2A 4RQEA 5GMKi 3LSSA 1LNXA 4P3NA 4E51A 5C52B 3RKXA 3KFUA 4G85A 5C51B 4TVYA 2ZXFA 3IALA 4YRIA 3JCMh 4C92B 5LJ5g 4LNSA 4CS2A 1JBMA 4PG3A 4UP9A 3QO5A
chains in the Genus database with same CATH superfamily
1W4SA 3CEYA 1Q81C 2OI3A 1I4K1 2YHTA 1RAEB 1K8AR 4ZTUB 2KRMA 4FYXB 2GTJA 4ZIBA 2COYA 3ZFJA 4PJOD 4YRGA 5CKHA 1MV0B 1TUCA 2ZPGB 5CO7A 5GAMf 1WJQA 2VASA 1PYSB 1U1TA 4TVAB 4FT4A 3JB9F 2IVWA 4MZPA 2YUQA 2DQ3A 1RUWA 5CAIA 5FU6B 2KT1A 4PJNA 1JXMA 1AOJA 2X9HA 4CC2A 4BY6B 2DVJA 2L3SA 2ZNJA 4P74C 4JLGA 1T0JA 3QG1A 1TUGB 4NS5A 1RI0A 4HWTA 3J81E 2YUNA 4EMKB 1H3ZA 3R07A 3E19A 1G5IA 5ELOA 4CH6A 4J7IA 2MWPA 1E1OA 4WI1A 4JRKA 2CIMA 4J9HA 3X26B 2ENMA 3QKJA 4MZTA 1MGQA 4F04B 2RO0A 1RAIB 1WQWA 1X69A 1BKBA 4HVVA 1G3SA 1J5WA 2D0QB 2E10A 1YNZA 3G6EQ 1A0NB 2RQWA 1UJ0A 2E6NA 1NLOC 2KXCA 2DYIA 4M75B 1N8RU 2KMTA 2VYTA 3VU3C 3X28B 2JVVA 1BI0A 1WPYA 3CC4A 2XI9A 3VJPA 2D9TA 1U3OA 4F7UG 1CKBA 2DILA 1WJRA 2FYKA 3QZ5B 1B70B 4A4HA 4TVRA 3SD4A 1ZA1B 3HSBA 4GY5A 2QG9B 3BFMA 5IHNA 4HWOA 4IUPA 2E5KA 4R0KA 1KQSA 4A4EA 3S6WA 4HT4A 1NNHA 4IUTA 2OTJQ 1M9SA 1RL2A 4N4GA 2PZ1A 3HRTA 2GQVA 3JCMW 3SFMA 2ZR3A 1ZSZB 3WQZA 3HFZA 3IKLA 5FLXE 2SEMA 1SERA 3REXA 4J5YA 1VQNT 3TVTA 1JQQA 3EGDA 2LT4A 4PJOF 1AZEA 2KNBB 3MEAA 1YJWQ 1YJ9T 1MMGA 5CVIA 2RQVA 2ZR2A 4PJOA 2P0LA 3ASKA 1KOGA 3E9IA 1AWJA 4RQFA 5CCAA 3UWNA 2ED1A 2V1QA 2VUBA 1BCOA 5GMKe 3FLGA 4P71C 1GXIE 4L5GA 4FW2A 2O9VA 1VQNA 2I2LA 1H4QA 4LVMA 1VQ4T 1Q86U 1Y96A 5GANh 2A8EA 1NEGA 3CCLA 1YJ9A 5K1XA 3PIOA 4EMKC 2DZ9A 3OS2A 1QP2A 1N8RR 1YN8A 4K87A 4M78D 1EFNA 2ZPBB 3A74A 3EH2A 4J9FA 2LDMA 3OYBA 2YLCA 1M1KC 3CD6A 3H0FA 1S1NA 1VQOA 2GCXA 1YIJA 5C53B 1N9RA 4BACA 1HC7A 2IIMA 1B34B 2ABLA 3OW2S 1X6OA 4VUBA 1X27A 2KBTA 1LCKA 4GLMA 3MO8A 4C8QB 1VQ4A 4V2SA 4IIOA 3OYLA 4RUGA 1TH7A 5KE2A 3P8BB 1AD5A 4E7KA 5HK0A 1WXTA 4H2XA 4TTVA 3JCMV 4YRLA 1M90U 1KMMA 4ELYC 1G5HA 4BD3A 2FB7A 1PNJA 2DVEA 3CCQT 1VQ5Q 2P0QA 1PRLC 4HVWA 3CMQA 3V8KA 3VRYA 2RJCA 1W1FA 1OX8A 2ZCFB 3NHNA 4LN2A 2JW4A 1HSQA 2COZA 2RJFA 1Q82C 2XDDA 4UPAA 1GBQA 2RHYA 2FHDA 3AT1B 2JM8A 1AEYA 2BE9B 4P73C 1RACB 2RA2A 1VIFA 2RJEA 4ZN1A 4CS3A 4M4ZA 2LNHB 1KJWA 1FYNA 3CCQA 3NELA 3PCOB 1C1AA 2G3RA 4M78E 4PLIA 2LQ8A 4M77B 3GPLA 2QQRA 1OX9A 1KSWA 4ATOA 2VXFA 1K1ZA 4KH1B 2LVMA 4YP0A 1K0SA 2EYXA 3VRZA 2DPPB 1YI2T 1Q86R 2AT1B 1E6HA 1ADYA 3JCMg 3E1SA 1KQSP 2EAYA 2MIOA 4R55A 3FJPA 4J8OA 4C5GA 3S3OA 3SWNA 2M02A 1VQMT 1X56A 4MZMA 2GTOA 3H6ZA 4FU6A 5CKEA 4C92D 4C0ZA 4FW1A 3OB9A 1D1BA 1WA7A 1DJ7B 3ZEHA 2F1LA 3H41A 1J3TA 4LVJA 1KMNA 1YI2A 4L59A 3JCMe 1UTIA 4KULA 1XTDA 3QTCA 4O6JA 1BIBA 4M78F 4OMQA 4Y92A 3QHSA 2HQHA 1IGUA 2NUPB 1M90R 3I55Q 1VQMA 4M78A 3CCVA 1X6BA 5IXBA 1Y0MA 1YITT 4M7AB 3RGLA 4LVKA 1B76A 2HBPA 2DLPA 2HKQB 4M7DG 12ASA 4M7DE 2NUTA 2CZ6B 4C8QC 4H2YA 1WXUA 3ERRA 4UC4A 3VS4A 4ZTFA 4AFUC 1OPLA 2O9SA 1TTHB 2XICA 2YUOA 5KNNA 1YITA 4FSSA 1L0WA 5LJ5e 4AMCA 4WJ4A 2EJ9A 3VYGA 4LDXA 5AYFA 2Q7HA 2LJ0A 1YI2Q 3L42A 4JJCA 1NG2A 4C92G 2DETA 4C92E 5CKDA 2MAMA 4J9CA 1EQRA 3BY7A 2E6ZA 1X2HA 1TWBA 1ZHIA 3OBYA 1WIEA 4LDWA 4M75D 1VQMQ 4RTTA 3I5SA 4OMNA 5EC7A 5HY6A 2K2MA 2G4CA 1XOVA 2K3YA 3OS5A 2DTIA 2QXFA 3FB9A 4DBHA 1S72Q 5LJ3f 3IQLA 2H3EB 2CP7A 5F5WA 3HY1A 2ZAEA 1EX4A 2LQNA 4M77C 3BDUA 1JJ2A 5I2MA 1WLPB 3M54A 4NOYA 4OMLA 2LP5A 4DEXA 1IHWA 2ESWA 3L2QA 4NCXA 3CMEQ 1YFSA 4YRJA 1WXBA 1R8OB 1SF9A 2L3RA 4C0FA 1VQPA 1UGQB 3OYHA 1BU1A 1PM3A 1YITQ 2E70A 4LUEA 4JDSA 1I07A 1VQZA 1PHTA 1M2VA 3A7RA 4CH3A 4C92F 4KR2A 2O88A 1MMAA 2L0AA 1XNIA 1PRMC 2DU5A 1LOJA 1USYA 1IGQA 1C0AA 1SSFA 1OPKA 1SRMA 2HKNA 2YRDA 1VYTA 1BBUA 1K73U 4KR3A 1UEBA 3TREA 4HCZA 2RI3A 3HTRA 1QCFA 2R57A 4FT2A 2JNGA 2EW3A 3RNJA 2F69A 1U06A 2OTLT 1PYSA 1QCOA 1Y71A 2X35A 2VC8A 2P4RA 4M75G 4M75E 2DL8A 2J6KA 4M7AC 5GANg 2WACA 1BCMA 2DQ0A 4P5NA 4Q6GA 1FYFA 3FDRA 3DKMA 3HFNA 2AMCB 1GGMA 5DLOA 4P3NA 1LNXA 3CXCS 2J6OA 4DOVA 1VQKA 4E47A 1W2BS 2RHXA 3KFUA 4G85A 5C51B 2P4TA 5IT9E 2OTLA 1MNEA 3L2RA 1PCXA 1SRLA 4Q5WA 4CS2A 1GFCA 1N27A 4L6V5 4HCKA 1XQHA 2LNVA 5GAMe 4HA8A 5GMKh 2JS0A 1ZQ1A 3NTKA 2O4XA 1OQKA 4E2FB 2FPFA 5KYUA 2ZIMA 4DOWA 2E3HA 2I0NA 4M75F 2DERA 2L5QA 4ZN3A 2KI7A 4X9DA 2RHUA 4J9IA 1ATIA 4KH0B 4RG8A 3OYCA 2COWA 1N8RC 3WVEB 2YWWA 1QW1A 4R56A 1ABOA 2ECZA 3VS7A 2DTOA 3GP8A 1K73R 5I22A 3I56A 1ZBXA 3BW1A 3G71T 1PSEA 2ODRC 2CT3A 1B7YA 5IH2A 3UGQA 1EOVA 2E3CA 2LTOA 3M0RA 3JCMP 3C4SA 2BTTA 3T9NA 2CGHA 2DBMA 4KT0E 2ZNIA 1OV3A 4EMGA 4ME7A 5IHKA 1JJ2P 4TQDA 3CQTA 3GF5A 3GIBA 4O2DA 3CCMA 4TVWA 3ME9A 3G71A 3RF1A 2QEXQ 4C8QG 4C8QE 1YWOA 5D6YA 1R0CB 3OYYA 1UJYA 1O75A 2QK0A 3A8LB 1NEBA 2DL5A 4TWAA 2SRCA 5GANd 1CKAA 2KDSA 3OW2P 2RI2A 1BB9A 2KRSA 1TSFA 5D6XA 1NM7A 4KQEA 3M4GA 1SETA 4GBQA 1KD1U 2EWNA 2RHQB 11ASA 2AKKA 3IKMB 4J7FA 5CQXA 2LCCA 1H4TA 3EGXB 2CSQA 5J3BA 1YCSB 3NETA 1GBRA 5L8RE 4JZ3A 3QYGB 2LRQA 3G6ET 3RR6A 2E5AA 3HXWA 1M1FA 1VQ6Q 2QASA 1M30A 3HL8A 1KQ1A 9ATCB 4M77G 4M77E 1IO6A 5KYWB 1VQ7Q 4ELZC 1T3LA 2HNIA 3LGLA 4CRIA 2K5LA 2KRNA 3UFGA 2HDAA 3G6EA 2Y4XA 4JJNK 1M90C 1YGBA 4RCCA 4J6WA 3A8MB 3D7SB 3RESA 4AG2C 1M4ZA 2GNCA 2OTJT 4LDVA 4OVAA 4D8DA 2D1XA 3TCJA 1M8VA 1UUEA 3LWIA 1QF6A 1Y7XA 3Q1JA 1ZUUA 1MNDA 2CYZB 5KYYA 1NYRA 1QVPA 1VQLT 1JJCA 4KBMB 2C06A 3RACA 5LJ5h 2EIFA 2LX7A 3CBPA 3CXCA 3CCJT 1T0HA 1PKTA 3V7RA 1YJWT 1D1CA 4M7AG 3FEOA 2OTJA 4K88A 3CPWS 4PKCC 3FIFA 1NJ5A 2PVOB 4OB2B 1KD1R 2K57A 2AKLA 3MPUB 3X24B 3HXVA 5FU7B 2E64A 4YROA 3EG0A 3CCSQ 5FWBA 1OZ2A 4P72C 1KC8R 3N5BB 3MEVA 2NYSA 3VYHB 3C0CA 5LJ5j 4LVLA 2ZINA 4LUDA 1ZBJA 2OX7A 2KGTA 4OMMA 2ALYA 3MEUA 3CCJA 4YRMA 1YJWA 1Z7MA 2XDPA 3A31A 2K6DA 4JRPA 2EQKA 1SEMA 2I4MA 4Z89A 1YHQQ 4F7UE 5I21A 3QBYA 3PMIA 1FX7A 4KUIA 1X54A 2CP6A 4YRCA 4D8KA 3GLXA 3I35A 1PD1A 4LDUA 4DEYA 2CKKA 2HL3A 2VB6A 3OYEA 3SEMA 1W66A 1EFWA 1QWFA 1NJIU 3M0TA 4FIBA 2IY5B 2V1RA 2ZCEA 1WFWA 2J3MA 2MI6A 1HK9A 2RHSB 4IUQA 4E6RA 1OYXA 1VQLQ 3G4ST 4PHCA 5FRMA 1VQ5T 3QUIA 3CPFA 3MKDA 3A5ZB 1AZGB 2CP5A 3CCJQ 2P0KA 2QDLA 4A53A 2EGEA 1N9WA 5CIUA 4F7UF 3JAME 2B86A 2ZPEB 2YRCA 4LD9K 4RCBA 3L4GA 2GFAA 4F7UA 2Y90A 4RMOA 2A28A 4BB7A 1VQ8Q 1KQ2A 2PVGB 4HWSA 3WXMB 2ZT5A 3HXZA 2HL5C 4N0AA 2AKWB 4MDWA 1VQ5A 3I7FA 3ULRB 5GAN8 2AZSA 2RMOA 4DBRA 1WHGA 1HTTA 4BW9A 4QQ6A 1TXQA 1B3QA 3OYDA 3EFSA 1JXOA 4AG1C 5GAMh 3OSVA 1EIFA 1ACMB 2HEQA 1NYFA 3CCUQ 1IXDA 4XTUA 1NLPC 1WLEA 4EO4A 2DD4A 1QVFS 2ZGWA 5FU7C 2MMPA 4EMHA 2DL7A 2X4YA 1KG1A 3JB9J 5GANj 3EG1A 2MOXA 1PKSA 4KGZB 3EHRA 3QZ9B 5D7UA 1FWZA 2FZKB 3RL6A 4QT7A 1K4US 1JRIA 3G1ZA 3CMAT 3PZCA 2EBPA 1GCQC 1NJIR 3H8ZA 1QVGS 4K86A 3C94A 3CXCP 2FG0A 3G4SQ 8AT1B 5LJ3e 1W2BP 3E2UA 3I55T 2RNAA 4ZTZB 1Q81U 4P75A 3OSSC 1OOTA 2CT4A 4CH4A 3SHWA 3M0SA 1EIYA 2E5QA 3A8GB 4QVDA 1IZ6A 3OYMA 2E3IA 4BI3A 1H3HA 3V7SA 1UHCA 3CMAA 2QA4Q 4J6YA 2F2XA 2KE9A 3J7AF 4A4FA 4M7DD 3M53A 1QE0A 3R6OA 1Q7YU 1TUDA 4YRTA 3I55A 2EYQA 4RMFA 3G7ZA 2VKNA 5CR2A 2NUZA 5KYXA 2MF2A 1WGSA 4HT9A 2C0TA 3TSZA 1KFZA 2AIRB 4DQ2A 5E3IA 2DO3A 2V8KA 2J06A 2XG8D 3W3SA 3L2ZA 2JT4A 3TEHA 1Z9ZA 2K9GA 2DA9A 3MF1A 4PNOA 3HRIA 1I5LA 1IRXA 3RUXA 1S72T 2FEIA 1IHVA 5GAOr 5IHIA 4C5EA 2P0PA 3M5AA 1I5OB 1AWXA 2KR3A 3J80E 3CMAQ 1QQJA 1TU0B 3UT1A 3LSQA 4BWAA 5CQYA 2A7YA 2E4HA 2YT6A 2KYBA 3CMET 3UA7A 3LSSA 1QKWA 2DBKA 2YRVA 2QGFB 1UE9A 1M3CA 3EG9A 2H3JA 3IALA 3OQ5A 1S72A 1N6AA 4JJBA 4YRIA 5LJ5g 1FMWA 4LNSA 2L3PA 1Q81R 3L2VA 3QO5A 4P74A 5GJVB 2EPDA 2RD1A 3V8LA 2EL9A 4PJLA 1Q95G 4YRSA 2G6FX 3NFCA 1G83A 2DXCA 4E7ZA 1OI1A 3L1AA 2K4YA 2GQIA 1K8AC 1YFRA 4YRQA 3PGGA 3CMEA 2DXUA 2FZCB 2RPNA 2EYYA 1NJ6A 4XK8E 1Q7YR 2DX1A 4G84A 4F16A 1AT1B 3HRUA 2C0OA 3HFZB 3H0IA 4OB0B 1MHNA 2JMCA 4NL3A 3PE0A 2QDYB 4E7JA 2ZZFA 3IG2A 3JB9I 3OYGA 4YTLA 4ANJA 3EGDB 4XU2A 3EHQA 2EKHA 2D6FA 3PVLA 4YRKA 4PJOB 3HXUA 4M7DF 1SHFA 1RLPC 2K2VA 2NLUA 2KYMA 3GNFB 3O8VA 4M7DA 1RAFB 4DA4A 3VS0A 2H8HA 2QHUA 4H2WA 1M5Q1 1ASYA 2CP3A 2K5IA 3MP6A 3CC7T 1OU9A 2XKOC 1U8RA 2RF0A 1U1SA 1E1TA 1TS9A 3CCRQ 3M55A 3JCMd 3EFRA 4X1VA 2ZZGA 2XGTA 3PMTA 3JCMc 1H641 1QCNA 1Y96B 3P8DA 2RHZA 1KC8C 1PG5B 1WHHA 4JUVA 4J15A 2NWMA 2DU7A 5GMKl 1QVFA 2K3BA 3OW2A 3OS1A 1R0BG 2DE0X 2F5TX 2XK0A 4AH6A 2KSSA 4P3OA 1AHJB 4ESRA 4WJ3M 1I8FA 4J9DA 4XU1A 4C92A 4C5HA 3RMQA 5GAN2 5FRNA 1NJ8A 4HCCA 3CC7A 3RMSA 1FMKA 4BI4A 2CZ7B 2DMOA 2YXYA 4KGVB 2RN8A 5GMKm 2HCKA 2BZ8A 3UH0A 4TVAA 4H2XB 2DEQA 2QQ9A 2QTXA 5LJ5d 1QLYA 2PTKA 1B07A 3S3NA 3CC2Q 2K79A 2JS2A 1E24A 3LWHA 4P71A 1P92A 5GAMg 4E7SA 3KUFA 1Q82U 1MMNA 1G3WA 1D1AA 1CSKA 1E6GA 3MCAB 3OYKA 2OJ2A 3DLLA 3A5YA 1AVZC 1SPKA 2P5IA 4P3PA 2RK2A 3QO8A 4EMKA 3PNWC 5FWCA 4XU3A 4H2VA 3FRNA 4A4KA 2QEXT 4CI0C 1EVKA 2ZIOA 1WHJA 1LVKA 1X6GA 3CCET 1H8KA 2DIQA 2VGNA 2VVKA 3CC7Q 1BBZA 1H4VB 1YCYA 4HWPA 4O5VA 1UG1A 3HFOA 1PSFA 3META 4OB3B 2KXDA 1FXXA 2WSEE 1UGSB 3ER0A 4C8QD 3KFVA 1GL5A 2I4NA 1UGVA 2CREA 3SB2A 2ZPHB 4BUGA 4M75A 2BZYA 2E65A 4EDUA 2Q7EA 3FJ5A 4PJOC 2QEXA 3P8VA 3VS2A 4LDYA 1NPRA 1TOVA 3SWNB 1I1JA 4YREA 4XAXB 3M4PA 1H92A 2WSCE 5GMKj 1SHGA 2ZT8A 4RDXA 3LW5E 2L2PA 1B70A 4HWRA 4PK4A 1VQ6T 2DZCA 4HVUA 2VXEA 1QMCA 3HHTB 3V8JA 2F5KA 3RDVA 3OBWA 1TG0A 2JMAA 1SKUB 2L8DA 3ZL7C 2VWFA 1VQ7T 2DK3A 1WI7A 4P73A 1YJNQ 2EFIA 1MV3A 4DBFA 3PTAA 3NEMA 1MUZA 4A63B 1KQSS 5KE3A 5LJ3h 3VS6A 4M78B 3E9GA 1Y07A 2M1HA 4PLLA 4M77D 1NJIC 1ZSZA 1GFDA 1K9MU 3HKSA 3JCMJ 2A37A 1VQ6A 2O01E 5AT1B 2AZVA 2J05A 2NUTB 3HXXA 1K9AA 2XU8A 5HGQA 4H2SA 4IKFA 1OZ3A 1D0YA 1VQ7A 3CCEQ 1M2OA 3M0QA 3NENA 4OLFA 3EAEA 2DXBA 4J9EA 2FVUA 2FRYA 1QVFP 5A0GA 3JSCA 3GOXA 5GAOq 2M0YA 1EVLA 3CBMA 3DLMA 1VQ9T 1N5ZA 2CJBA 1JB0E 1Z7NA 5IAYA 4RTZA 4AFQC 1RAHB 2J3LA 4B9XA 1AWOA 1W6XA 2F2WA 1HD3A 3RKWA 1Q86C 1QVGP 2ARSA 2Q7GA 3QNEA 1E22A 4XTVA 1Y57A 1RIQA 4C5IA 3CCST 4M7AD 2ZZEA 2QQBA 1X2QA 2EQIA 2LX9A 4IIMA 2KQWA 4E7LA 3MQZA 5CKBA 2XDBA 1B34A 2J6FA 1O9SA 2QHTA 3M58A 4CS4A 1VQ9A 4N4IA 3OYAA 2PUKB 2HBWA 4C8QF 4EIKA 4KUDK 2X51A 2ROTA 4BDZA 1PD0A 1G2BA 2DRMA 3G1JA 2MPXC 2CUDA 4C8QA 3TU4K 2B8AA 2DNUA 2KEAA 2CSIA 2K5FA 4LVIA 1T3SA 1IB8A 1YHQT 3KXTA 3DB4A 2XMFA 2V8JA 2M9UA 1WJSA 4MDXA 5DM7R 3REUA 3QDFA 2BZXA 3CCSA 3SWNC 4JJDA 1M2VB 3MJXA 4ZNXA 3JRZA 2QQSA 3A8HB 4KGXB 2OAWA 3OMCA 1K9MR 4DPGA 3QPHA 2FPEA 1WNLA 1IREB 2BIVA 1X55A 4XEMA 2RM4A 2I4LA 1NYGA 2LCSA 3TEGA 4PFOA 3RIRA 2ARTA 5GANf 2RH2A 4WTOB 2RHIA 1YHQA 4JLIA 2BKDN 3OS0A 2EVRA 4A54A 1ZLMA 2C0IA 2PU9B 4J9BA 3PFSA 1M1GA 4E7HA 4M78C 4M77F 3S3MA 1VQ9Q 3HFVA 3PCOA 3TQ7P 4M77A 4ZGEB 1W2BA 2ARUA 2Y4YA 3JCMb 4M7AE 3LC0A 1Q7YC 3RKYA 1B8AA 2W0ZA 2D0NA 3QIIA 3UPUA 4PJMA 4RTVA 3L2UA 2ODRD 4XTWA 4DBQA 5FROA 3RBBB 1SSHA 1VQ8T 3HY0A 1U5SA 3VKIA 1VQLA 4CC7A 5DLQE 3HRSA 7AT1B 3CC4T 1JEGA 4K11A 4D6WA 2XTIA 5ELNA 5CK9A 2O4XB 1N9SA 1BI2A 2R5AA 3CCUT 3NPFA 2QAZA 5KYUB 2RQRA 4II1A 1VQ8A 2IG0A 3OD1A 2ED0A 2ZT6A 3C95A 2GBQA 1OEBA 1OULA 2NUPA 4J6XA 4M7AF 1RLQC 3I9QA 2CUBA 1QP3A 3UATA 4PJOG 4M7AA 3THKA 4PJOE 2HSPA 2HZYA 4M7DC 1X01A 2DJQA 3EFOB 1UFFA 4X9CA 1D3BB 4GLKA 1V29B 2EQUA 4RTYA 3WVDB 3CCUA 2O31A 4L87A 1VYUA 4QQDA 3X25B 2QTVA 1HXDA 1B7YB 4LD6A 3O5ZA 2CS7A 2JM9A 3TUPA 2GGRA 4JS5A 2LQWA 3DSQA 2V8IA 4JRQA 1WHMA 5J39A 4YYEA 1ZA2B 1USYC 3NTIA 4C92C 1XJWB 2DDZA 2FPDA 3CBOA 3P8HA 2ATCB 4OP0A 2QA4T 2CZ1B 2RQTA 1I81A 2CH4W 3GNGA 1RAGB 1HJDA 1X75C 4RTWA 4E51A 3MHXA 3OA6A 3G4SA 5FW9A 2L3QA 1BYMA 3M56A 3CCLT 4TVYA 3CC4Q 2BUDA 2ZXFA 2ROLA 3L2WA 3PT9A 2NS6A 1G3TA 3HP9A 1JBMA 2KAFA 1BK2A 1UB4A 3P8TA 3CD6T 2LCLA 2E41A 5FU6C 2FO0A 2L89A 1VQOT 1YIJT 1ZUYA 2A0FB 2DF6A 2JN0A 3MP8A 3REAB 2XIDA 2QA4A 4BY6C 1ADJA 2R58A 4OGCA 2A36A 5LJ3g 1OU8A 1UDLA 3LLRA 1JJ2S 2LT1A 4ZGDB 4B9WA 2DJZA 4XTXA 1SESA 2JTEA 1NYQA 5LL6S 5CKFA 4RTXA 3LX7A 3QJYA 3LH0A 5GAOp 5GAMj 4JS4A 4QW2A 2RK1A 2LC4A 3PIPA 2DAQA 4YDQA 1W70A 4XTZA 2KVQG 4Y28E 2PVDB 1D0XA 1K73C 3MEYA 1KHCA 2MYSA 4OMOA 5I11A 4XQ3A 2DEUA 4HT8A 3H0HA 1BBWA 3EG3A 2CJ9A 2DL4A 4B6MA 4PFPA 2C8MA 4M75C 4E7IA 1WYDA 2PNIA 1EZZB 2Q5IA 4A4GA 3QO7A 3LH5A 1WZOA 1KHIA 3EGUA 3QWXX 2I4OA 3BE3A 2VGMA 4PJJA 4IUVA 4IUUA 1VQNQ 4BI8B 4BE0A 4Z88A 4PL6A 2AMCA 4F17A 1ZUKA 4HCBA 4H2UA 3CCLQ 1YJ9Q 4ZGJB 3HPWA 1R77A 4JZ4A 2R5MA 3C12A 2CJAA 5KCOA 2EJGA 2JUFA 3OMGA 5KYYB 3CD6Q 2VV5A 3M4QA 2LQKA 4JPBW 1JJCB 1VQOQ 1YIJQ 3CPWA 4CC4B 2M51A 4XEOA 5GAOl 1G8XA 2HSEB 4F14A 1D09B 1PWTA 4M78G 1ZSZC 2A08A 2F2VA 3MEWA 1RAAB 1VQ4Q 3INZA 4MMLA 2FRWA 1B7TA 1X43A 2EYZA 6AT1B 1WHLA 2YSQA 4RG2A 3UDCA 4UP7A 3HRKA 1GRIA 2X4WA 3A1PA 2AK5A 3NTHA 2GF7A 5GAOm 3CCVT 2D8JA 2YLBA 4HKEA 3CCRT 3OY9A 1VIEA 1G3YA 3VS1A 2ALYB 1IL2A 2LJ1A 3FC3A 5GAN5 5LJ3d 3VQWA 1BIAA 4RKUE 3A7UA 1JU5C 2PMEA 1YFTA 4C0GA 2QQAA 3DB3A 4QVCA 2JTFA 5GAOn 3OYJA 1UGPB 3VUZA 2KK4A 2ZPIB 2DKGA 4X34A 2XD0A 3VBBA 2DD5A 1K76A 3CCQQ 3PVQA 1YB3A 1ARKA 4YRFA 4C0DB 2X4JA 1LPLA 3CCRA 1YWPA 3QJ6A 5J26A 2ZT7A 3P8YA 5L23A 2YUPA 1VOMA 2LMJA 4OMPA 3GBQA 1K9MC 3TEEA 2WSFE 1Z9QA 3NMZC 1NE8A 2JJ9A 4HVCA 1NJ1A 3MP1A 3URGA 3NGPA 4QKUA 3QSUA 1ASZA 1MMDA 3CC2T 3BJUA 1HYOA 2EJFA 4P72A 1C6VX 4PFZA 3UA6A 8ATCB 4YCVA 1ZSGA 2QI2A 3HTZA 2DXTA 4AT1B 3E9HA 2PQWA 1SRYA 1D0ZA 2ZPFB 3M0PA 2CP0A 2HAXA 5IXFA 2Q5HA 1NPPA 2D8HA 2V26A 2CDTA 1LJOA 2RJDA 3L4GB 2LJ3A 4F7UB 3I5RA 2MWOA 2RHQA 4J9GA 1JO8A 3M59A 2Z0WA 4CC3A 1RABB 3KBGA 1KD1C 4YRPA 2HQXA 4XU0A 5HK3A 2M16A 1VQPT 3CCVQ 3CC2A 3ZBDA 3OYNA 3EGXA 1VYVA 3LYIA 5D6WA 1VA7A 4YCWA 3JB9H 2IPOB 5M9OA 2EQMA 4YPFA 2CZ0B 1H4SA 4YRNA 2X3XD 2CH4A 4WF2A 1M1KU 2JTMA 3A98A 2QHSA 3E9FA 5KYWA 1PC0A 1V76A 3REBB 2KY9A 5GAN6 3VS5A 4H02A 5GAN4 2JXBA 2P84A 3EH1A 1RADB 1X2KA 5EG2A 1WHKA 1QVGA 5I2SA 1M8MA 4HXJA 4WCIA 2J7IA 3CPWP 1YP5A 5KYNA 1NBEB 4FSXA 1RI9A 1I0CA 1YJNT 5C6SA 2ZTGA 1NZ9A 2E1HA 1WU7A 1VQKT 2JZ2A 3JCMQ 2EYWA 5A0LA 4LNPA 1UHFA 1KK7A 4CH5A 2HMAA 4QQGA 1EIYB 3HXYA 4C0DC 1GCPA 4ZTJA 4XTYA 2KROA 3VV0A 5ECAA 3X20B 1WQ7A 1M3AA 5IN1A 3SDZA 1YFNA 1FMVA 2PUOB 1YJNA 2RQUA 1QWEA 3VUBA 3M57A 4H2TA 1K0XA 2DRKA 2O2OA 1VQPQ 2FZGB 1NJ2A 3JCMf 4YRRA 2DIGA 2YDLA 2EGAA 1WDXA 3VS3A 3ICAA 3JCMX 2MK5A 5KYXB 2C7IA 4AFZC 4FM4B 1UECA 2A3LA 1AWWA 5GANe 3A32A 2LZ6B 2XHCA 1GCQA 1M1KR 3BDLA 2X4XA 2HD0A 3CCEA 3TEHB 4Z02A 3QDRB 3I56T 3QXEB 3OYIA 3EG2A 2EKOA 2GFUA 1V1CA 4UP8A 3A8OB 4N0AC 2MCNA 5A0DA 1UGRB 5KCHA 2QYZA 2DL3A 4FL6A 1M3BA 3UGTA 5KH6A 5LJ5f 4N4HA 2W10A 4FYYB 2E12A 3H9NA 1G5VA 2IY5A 5GAN3 3EFOA 2FL7A 2QGGA 2DM1A 1VQKQ 2K7AA 1D3BA 5GAN7 3JB9D 3EG9B 3RERA 5A2QE 4OMFB 2RHSA 3VQVA 3CCMT 2OTLQ 3OYFA 4FYVB 1LYLA 4EX5A 1Q82R 4Q15A 4TQFA 1M27C 2DFUA 4J83A 3A5ZA 2KT8A 2RI5A 3JV3A 4LE9A 4KRTA 3VQYA 5HKCA 3QO3A 1K8AU 2ZZDA 3VQXA 1YBYA 3QYHB 3UF4A 2EGCA 4NL2A 5LJ3j 4OB1B 4LXCA 2QHVA 2BE7D 1ABQA 2JOYA 3QWYA 1F1BB 4AFSC 5GAMd 2EQJA 1G51A 1X2GA 4MMKA 3TSWA 4BE2A 2AKWA 1QKXA 4P75C 1SG5A 3A7AA 2CP2A 1BI1A 5C0MA 2RB6A 2PMFA 2K3XA 2HQEA 5DY9A 4Y91A 1E7OA 4Z8AA 4RTUA 2DTHA 3I56Q 2AHJB 3M0UA 4X5OA 1WX6A 3R6NA 4M7DB 3V7CA 4ORZA 4YCUA 3JB9G 5GJWB 5K1PA 1WYXA 4OF1A 4FCYA 1KC8U 5HCKA 4IURA 2M0OA 4FYWB 4JRIA 3AHUA 4RQEA 3MF2A 3LGFA 4OGEA 5GMKi 3F70A 1KIKA 5C52B 1BI3A 3CCMQ 3RKXA 1C0MA 3G71Q 4QVZA 2DYBA 2OAUA 3U23A 3JCMh 4C92B 4BE1A 4BDYA 3M4YA 1VUBA 2X3WD 4PG3A 4UP9A 3M9QA 4EPCA 1ZX6A
chains in the Genus database with same CATH topology
1W4SA 3CEYA 1Q81C 1I4K1 2YHTA 4ZTUB 4ZIBA 3ZFJA 4PJOD 4YRGA 5CKHA 2ZPGB 5CO7A 5GAMf 1WJQA 1PYSB 1U1TA 4TVAB 4FT4A 3JB9F 2IVWA 4MZPA 2DQ3A 5CAIA 5FU6B 4BY6B 2ZNJA 4P74C 4JLGA 3QG1A 4NS5A 1RI0A 4HWTA 3J81E 4EMKB 1H3ZA 3R07A 3E19A 1G5IA 5ELOA 4CH6A 4J7IA 2MWPA 1E1OA 4WI1A 4JRKA 2CIMA 3X26B 3QKJA 4MZTA 1MGQA 2RO0A 1WQWA 1BKBA 1G3SA 1J5WA 2D0QB 2E10A 2E6NA 4M75B 1N8RU 2KMTA 2VYTA 3VU3C 3X28B 2JVVA 1BI0A 1WPYA 3CC4A 2XI9A 3VJPA 2D9TA 4F7UG 1WJRA 2FYKA 3QZ5B 1B70B 4A4HA 4TVRA 3SD4A 3HSBA 4GY5A 3BFMA 4HWOA 4IUPA 1KQSA 4A4EA 3S6WA 4HT4A 1NNHA 4IUTA 1M9SA 1RL2A 4N4GA 3HRTA 2GQVA 3JCMW 3SFMA 2ZR3A 3WQZA 3HFZA 3IKLA 5FLXE 1SERA 3REXA 4J5YA 1VQNT 2LT4A 4PJOF 3MEAA 1YJ9T 5CVIA 2ZR2A 4PJOA 2P0LA 3ASKA 1KOGA 3E9IA 4RQFA 5CCAA 3UWNA 2VUBA 5GMKe 3FLGA 4P71C 1GXIE 4L5GA 1VQNA 2I2LA 1H4QA 4LVMA 1VQ4T 1Q86U 1Y96A 5GANh 2A8EA 3CCLA 1YJ9A 5K1XA 3PIOA 4EMKC 2DZ9A 3OS2A 1QP2A 4K87A 4M78D 2ZPBB 3A74A 3CD6A 2LDMA 3OYBA 2YLCA 1M1KC 1VQOA 2GCXA 1YIJA 5C53B 1N9RA 4BACA 1HC7A 1B34B 3OW2S 1X6OA 4VUBA 3MO8A 4C8QB 1VQ4A 4V2SA 3OYLA 1TH7A 5KE2A 3P8BB 4E7KA 5HK0A 4H2XA 4TTVA 3JCMV 4YRLA 1M90U 1KMMA 4ELYC 1G5HA 4BD3A 2FB7A 2DVEA 3CCQT 2P0QA 3CMQA 3V8KA 2RJCA 2ZCFB 2RJFA 1Q82C 2XDDA 4UPAA 2RHYA 2FHDA 4P73C 2RA2A 1VIFA 2RJEA 4ZN1A 4CS3A 3CCQA 3NELA 3PCOB 2G3RA 4M78E 4PLIA 2LQ8A 4M77B 3GPLA 2QQRA 4ATOA 2VXFA 2LVMA 4YP0A 2DPPB 1YI2T 1ADYA 3JCMg 3E1SA 2EAYA 4R55A 3FJPA 4J8OA 4C5GA 3S3OA 3SWNA 1VQMT 1X56A 4MZMA 3H6ZA 4FU6A 5CKEA 4C92D 4C0ZA 3OB9A 1DJ7B 3ZEHA 4LVJA 1KMNA 1YI2A 4L59A 3JCMe 4KULA 1XTDA 3QTCA 4O6JA 1BIBA 4M78F 3QHSA 1VQMA 4M78A 3CCVA 1YITT 4M7AB 3RGLA 4LVKA 1B76A 2HBPA 4M7DG 12ASA 4M7DE 2CZ6B 4C8QC 4H2YA 3ERRA 4UC4A 4ZTFA 2XICA 5KNNA 1YITA 1L0WA 5LJ5e 4WJ4A 2EJ9A 3VYGA 4LDXA 5AYFA 2Q7HA 3L42A 4C92G 4C92E 5CKDA 2MAMA 1EQRA 3BY7A 2E6ZA 1X2HA 1ZHIA 3OBYA 4LDWA 4M75D 5HY6A 2G4CA 1XOVA 2K3YA 3OS5A 2DTIA 2QXFA 3FB9A 5LJ3f 5F5WA 3HY1A 4M77C 3BDUA 1JJ2A 5I2MA 3M54A 4NOYA 3L2QA 4NCXA 1YFSA 4YRJA 1R8OB 4C0FA 2L3RA 1VQPA 1UGQB 3OYHA 2E70A 4JDSA 1VQZA 3A7RA 4CH3A 4C92F 4KR2A 1XNIA 2DU5A 1LOJA 1USYA 1C0AA 1SSFA 1BBUA 1K73U 4KR3A 1UEBA 3TREA 4HCZA 2RI3A 2R57A 4FT2A 2JNGA 2F69A 2OTLT 1PYSA 1Y71A 2X35A 2VC8A 4M75G 4M75E 4M7AC 5GANg 2WACA 2DQ0A 4P5NA 4Q6GA 1FYFA 3FDRA 3DKMA 3HFNA 2AMCB 1GGMA 5DLOA 4P3NA 1LNXA 3CXCS 1VQKA 4DOVA 4E47A 1W2BS 2RHXA 3KFUA 4G85A 5C51B 2P4TA 5IT9E 2OTLA 3L2RA 4Q5WA 4CS2A 1N27A 4L6V5 1XQHA 2LNVA 5GAMe 4HA8A 5GMKh 1ZQ1A 3NTKA 2O4XA 2ZIMA 4DOWA 4M75F 2L5QA 4ZN3A 4X9DA 2RHUA 1ATIA 4RG8A 3OYCA 1N8RC 3WVEB 1QW1A 4R56A 2DTOA 3GP8A 3I56A 1ZBXA 3BW1A 3G71T 1PSEA 2ODRC 1B7YA 3UGQA 1EOVA 2E3CA 2LTOA 3JCMP 3C4SA 3T9NA 2CGHA 4KT0E 2ZNIA 4EMGA 4ME7A 4TQDA 3GF5A 3GIBA 4O2DA 3CCMA 4TVWA 3ME9A 3G71A 3RF1A 4C8QG 4C8QE 5D6YA 3OYYA 1O75A 3A8LB 4TWAA 5GANd 2KDSA 2RI2A 5D6XA 4KQEA 3M4GA 1SETA 1KD1U 2EWNA 2RHQB 11ASA 3IKMB 4J7FA 5CQXA 2LCCA 1H4TA 5J3BA 3NETA 5L8RE 3G6ET 3QYGB 2LRQA 2E5AA 3HXWA 1M1FA 3HL8A 1KQ1A 4M77G 4M77E 4ELZC 2HNIA 3LGLA 4CRIA 2K5LA 3UFGA 3G6EA 2Y4XA 4JJNK 1M90C 1YGBA 4RCCA 4J6WA 3A8MB 3RESA 1M4ZA 2OTJT 4LDVA 4OVAA 3TCJA 1M8VA 3LWIA 1QF6A 1Y7XA 3Q1JA 2CYZB 1NYRA 1QVPA 1VQLT 1JJCA 4KBMB 2C06A 3RACA 5LJ5h 2EIFA 3CBPA 3CXCA 3CCJT 3V7RA 1YJWT 4M7AG 3FEOA 2OTJA 4K88A 3CPWS 4PKCC 3FIFA 1NJ5A 2PVOB 4OB2B 2K57A 3X24B 3HXVA 5FU7B 2E64A 4YROA 1OZ2A 4P72C 3N5BB 3MEVA 3VYHB 5LJ5j 4LVLA 2ZINA 2ALYA 3MEUA 3CCJA 4YRMA 1YJWA 1Z7MA 2XDPA 3A31A 4JRPA 2EQKA 2I4MA 4F7UE 5I21A 3QBYA 3PMIA 1FX7A 4KUIA 1X54A 4YRCA 3GLXA 4LDUA 2CKKA 3OYEA 1W66A 1EFWA 1NJIU 4FIBA 2IY5B 2ZCEA 2J3MA 2MI6A 1HK9A 2RHSB 4IUQA 1OYXA 3G4ST 4PHCA 5FRMA 1VQ5T 3QUIA 3CPFA 3A5ZB 2P0KA 4A53A 1N9WA 5CIUA 4F7UF 3JAME 2ZPEB 4LD9K 4RCBA 3L4GA 2GFAA 4F7UA 2Y90A 4RMOA 4BB7A 1KQ2A 2PVGB 4HWSA 3WXMB 2ZT5A 3HXZA 4N0AA 2AKWB 4MDWA 1VQ5A 3I7FA 5GAN8 1HTTA 4BW9A 4QQ6A 3OYDA 3EFSA 5GAMh 3OSVA 1EIFA 4XTUA 1WLEA 4EO4A 2DD4A 1QVFS 2ZGWA 5FU7C 2MMPA 4EMHA 2X4YA 1KG1A 3JB9J 5GANj 3QZ9B 1FWZA 3RL6A 1JRIA 3G1ZA 3CMAT 3PZCA 3H8ZA 1QVGS 4K86A 3C94A 5LJ3e 3I55T 4ZTZB 1Q81U 4P75A 3OSSC 4CH4A 1EIYA 2E5QA 3A8GB 4QVDA 1IZ6A 3OYMA 4BI3A 3V7SA 3CMAA 4J6YA 3J7AF 4A4FA 4M7DD 3M53A 1QE0A 3R6OA 1Q7YU 4YRTA 3I55A 2EYQA 4RMFA 3G7ZA 5CR2A 2MF2A 1WGSA 4HT9A 4DQ2A 5E3IA 2DO3A 2V8KA 2XG8D 3W3SA 3L2ZA 3TEHA 3MF1A 4PNOA 3HRIA 1I5LA 3RUXA 1S72T 5GAOr 4C5EA 2P0PA 3M5AA 3J80E 3UT1A 3LSQA 4BWAA 5CQYA 2A7YA 3CMET 3LSSA 2YRVA 2H3JA 3IALA 3OQ5A 1S72A 1N6AA 4YRIA 5LJ5g 4LNSA 3L2VA 3QO5A 4P74A 2RD1A 3V8LA 2EL9A 4YRSA 3NFCA 2DXCA 1OI1A 3L1AA 2K4YA 1K8AC 1YFRA 4YRQA 3PGGA 3CMEA 2DXUA 1NJ6A 4XK8E 4G84A 3HRUA 3HFZB 4OB0B 1MHNA 4NL3A 2QDYB 4E7JA 2ZZFA 3IG2A 3JB9I 3OYGA 4YTLA 4XU2A 2D6FA 4YRKA 4PJOB 3HXUA 4M7DF 2K2VA 2NLUA 3GNFB 3O8VA 4M7DA 4DA4A 2QHUA 4H2WA 1M5Q1 1ASYA 2K5IA 3MP6A 3CC7T 2XKOC 1U8RA 1U1SA 1E1TA 3M55A 3JCMd 3EFRA 2ZZGA 2XGTA 3PMTA 3JCMc 1H641 1Y96B 3P8DA 2RHZA 1KC8C 4JUVA 4J15A 2DU7A 5GMKl 1QVFA 3OW2A 3OS1A 2F5TX 2XK0A 4AH6A 2KSSA 4P3OA 1AHJB 4WJ3M 1I8FA 4C92A 4XU1A 4C5HA 3RMQA 5GAN2 5FRNA 1NJ8A 4HCCA 3CC7A 3RMSA 4BI4A 2CZ7B 5GMKm 3UH0A 4TVAA 4H2XB 2DEQA 2QQ9A 2QTXA 5LJ5d 3S3NA 1E24A 3LWHA 4P71A 1P92A 5GAMg 3KUFA 1Q82U 1G3WA 3MCAB 3OYKA 3DLLA 3A5YA 2P5IA 4P3PA 2RK2A 3QO8A 4EMKA 3PNWC 4XU3A 4H2VA 3FRNA 4A4KA 2QEXT 4CI0C 1EVKA 2ZIOA 3CCET 2DIQA 2VGNA 1H4VB 1YCYA 4HWPA 4O5VA 3HFOA 4OB3B 1PSFA 3META 1FXXA 2WSEE 1UGSB 3ER0A 4C8QD 2I4NA 3SB2A 2ZPHB 4BUGA 4M75A 2E65A 4EDUA 2Q7EA 4PJOC 2QEXA 3P8VA 4LDYA 1NPRA 3SWNB 4YREA 4XAXB 3M4PA 2WSCE 5GMKj 2ZT8A 4RDXA 3LW5E 1B70A 4HWRA 1VQ6T 2DZCA 2VXEA 3HHTB 3V8JA 2F5KA 3OBWA 2L8DA 1VQ7T 2DK3A 4P73A 2EFIA 3PTAA 3NEMA 1KQSS 5KE3A 5LJ3h 4M78B 3E9GA 1Y07A 2M1HA 4PLLA 4M77D 1NJIC 1K9MU 3HKSA 3JCMJ 1VQ6A 2O01E 3HXXA 2XU8A 5HGQA 4H2SA 4IKFA 1OZ3A 1VQ7A 3NENA 4OLFA 3EAEA 2DXBA 2FVUA 5A0GA 3JSCA 3GOXA 5GAOq 1EVLA 3CBMA 3DLMA 1VQ9T 2CJBA 1JB0E 1Z7NA 5IAYA 2J3LA 4B9XA 1Q86C 3RKWA 2ARSA 2Q7GA 3QNEA 1E22A 4XTVA 1RIQA 4C5IA 3CCST 4M7AD 2ZZEA 2QQBA 2LX9A 2KQWA 4E7LA 3MQZA 5CKBA 2XDBA 1B34A 1O9SA 2QHTA 3M58A 4CS4A 1VQ9A 4N4IA 3OYAA 2PUKB 4C8QF 4KUDK 4BDZA 4C8QA 3TU4K 2B8AA 4LVIA 2K5FA 1YHQT 3KXTA 3DB4A 2V8JA 2M9UA 1WJSA 4MDXA 5DM7R 3REUA 3CCSA 3SWNC 3JRZA 2QQSA 3A8HB 3OMCA 4DPGA 3QPHA 1WNLA 1IREB 2BIVA 1X55A 4XEMA 2RM4A 2I4LA 3TEGA 3RIRA 2ARTA 5GANf 2RH2A 2RHIA 1YHQA 4JLIA 2BKDN 3OS0A 4A54A 2PU9B 3PFSA 1M1GA 4E7HA 4M78C 4M77F 3S3MA 3HFVA 3PCOA 4M77A 4ZGEB 1W2BA 2ARUA 2Y4YA 3JCMb 4M7AE 3LC0A 1Q7YC 3RKYA 1B8AA 3QIIA 3UPUA 3L2UA 2ODRD 4XTWA 5FROA 1VQ8T 3HY0A 3VKIA 1VQLA 5DLQE 3HRSA 3CC4T 4D6WA 2XTIA 5ELNA 5CK9A 2O4XB 1N9SA 1BI2A 2R5AA 3CCUT 4II1A 1VQ8A 2IG0A 3OD1A 2ZT6A 3C95A 4J6XA 4M7AF 1QP3A 4PJOG 4M7AA 4PJOE 4M7DC 1X01A 4X9CA 1D3BB 4GLKA 1V29B 2EQUA 3WVDB 3CCUA 4L87A 4QQDA 3X25B 1HXDA 1B7YB 4LD6A 2CS7A 3TUPA 4JS5A 3DSQA 2V8IA 4JRQA 5J39A 4YYEA 1USYC 3NTIA 4C92C 2DDZA 3CBOA 3P8HA 4OP0A 2QA4T 2CZ1B 1I81A 3GNGA 1X75C 4E51A 3MHXA 3OA6A 3G4SA 1BYMA 3M56A 3CCLT 4TVYA 2BUDA 2ZXFA 3L2WA 3PT9A 2NS6A 1G3TA 3HP9A 1JBMA 2KAFA 1UB4A 3P8TA 3CD6T 2LCLA 2E41A 5FU6C 2L89A 1VQOT 1YIJT 2JN0A 3MP8A 2QA4A 2XIDA 4BY6C 1ADJA 2R58A 4OGCA 5LJ3g 3LLRA 1JJ2S 2LT1A 4ZGDB 4B9WA 2DJZA 4XTXA 1SESA 1NYQA 5LL6S 5CKFA 3LX7A 3QJYA 3LH0A 5GAOp 5GAMj 4JS4A 4QW2A 2RK1A 2LC4A 3PIPA 2DAQA 4YDQA 4XTZA 2KVQG 4Y28E 2PVDB 1K73C 3MEYA 1KHCA 4XQ3A 4HT8A 1BBWA 2CJ9A 2C8MA 4M75C 4E7IA 1WYDA 2Q5IA 4A4GA 3QO7A 1KHIA 2I4OA 2VGMA 4IUVA 4IUUA 4BI8B 4BE0A 4PL6A 2AMCA 4HCBA 4H2UA 4ZGJB 3HPWA 2R5MA 3C12A 2CJAA 5KCOA 2EJGA 2JUFA 3OMGA 3M4QA 2VV5A 2LQKA 1JJCB 3CPWA 4XEOA 5GAOl 4M78G 3MEWA 3INZA 4MMLA 4RG2A 3UDCA 4UP7A 3HRKA 2X4WA 3NTHA 2GF7A 5GAOm 3CCVT 2YLBA 4HKEA 3CCRT 3OY9A 1VIEA 1G3YA 2ALYB 1IL2A 3FC3A 5GAN5 5LJ3d 3VQWA 1BIAA 4RKUE 3A7UA 2PMEA 1YFTA 4C0GA 2QQAA 3DB3A 4QVCA 2JTFA 5GAOn 3OYJA 1UGPB 3VUZA 2KK4A 2ZPIB 2DKGA 4X34A 2XD0A 3VBBA 2DD5A 1YB3A 4YRFA 4C0DB 2X4JA 3CCRA 3QJ6A 3P8YA 5J26A 2ZT7A 1K9MC 3TEEA 2WSFE 1NE8A 4HVCA 1NJ1A 3MP1A 3URGA 3QSUA 1ASZA 3CC2T 3BJUA 2EJFA 4P72A 4YCVA 2QI2A 3HTZA 2DXTA 3E9HA 2PQWA 1SRYA 2ZPFB 2HAXA 2Q5HA 1NPPA 1LJOA 2RJDA 3L4GB 4F7UB 2MWOA 2RHQA 3M59A 1KD1C 3KBGA 4YRPA 3CC2A 2HQXA 4XU0A 1VQPT 2M16A 5HK3A 3ZBDA 3OYNA 3LYIA 5D6WA 4YCWA 3JB9H 5M9OA 2EQMA 4YPFA 2CZ0B 1H4SA 4YRNA 4WF2A 1M1KU 2JTMA 2QHSA 3E9FA 2KY9A 5GAN6 4H02A 5GAN4 5EG2A 1QVGA 5I2SA 4FSXA 1YJNT 5C6SA 2ZTGA 1NZ9A 2E1HA 1WU7A 1VQKT 2JZ2A 3JCMQ 5A0LA 4CH5A 4QQGA 1EIYB 3HXYA 4C0DC 4ZTJA 4XTYA 3VV0A 3X20B 1WQ7A 5IN1A 3SDZA 2PUOB 1YJNA 3VUBA 4H2TA 3M57A 1NJ2A 3JCMf 4YRRA 2DIGA 3ICAA 3JCMX 2C7IA 4FM4B 2A3LA 5GANe 3A32A 2XHCA 3BDLA 2X4XA 2HD0A 3CCEA 3TEHB 4Z02A 3QDRB 3I56T 3QXEB 3OYIA 2EKOA 2GFUA 4UP8A 3A8OB 4N0AC 5A0DA 1UGRB 5KCHA 4FL6A 3UGTA 5KH6A 5LJ5f 4N4HA 2E12A 1G5VA 2IY5A 5GAN3 2FL7A 1D3BA 5GAN7 3JB9D 3RERA 5A2QE 4OMFB 2RHSA 3VQVA 3CCMT 3OYFA 1LYLA 4EX5A 4Q15A 4TQFA 4J83A 3A5ZA 2RI5A 3VQYA 5HKCA 3QO3A 1K8AU 2ZZDA 3VQXA 1YBYA 3QYHB 4NL2A 5LJ3j 4OB1B 2QHVA 2JOYA 5GAMd 1G51A 2EQJA 1X2GA 4MMKA 4BE2A 2AKWA 4P75C 3A7AA 1BI1A 5C0MA 2RB6A 2PMFA 2K3XA 2HQEA 5DY9A 4Y91A 2DTHA 2AHJB 4X5OA 4M7DB 3V7CA 4YCUA 3JB9G 5K1PA 4OF1A 1KC8U 4IURA 2M0OA 4JRIA 3AHUA 4RQEA 3MF2A 3LGFA 4OGEA 5GMKi 3F70A 5C52B 1BI3A 3RKXA 4QVZA 2OAUA 3JCMh 4C92B 4BE1A 4BDYA 3M4YA 1VUBA 4PG3A 4UP9A 3M9QA 4EPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8T A;  4P74 A;  2E41 A;  2RD1 A;  1I4K 1;  3V8L A;  2EL9 A;  2YHT A;  4YRS A;  5GAM e;  4ZTU B;  4HA8 A;  5GMK h;  4ZIB A;  2JN0 A;  3L1A A;  4PJO D;  1ADJ A;  1YFR A;  4YRQ A;  4YRG A;  3PGG A;  2DXU A;  5LJ3 g;  5GAM f;  1PYS B;  2ZIM A;  1U1T A;  4TVA B;  4M75 F;  3JB9 F;  1NJ6 A;  2DJZ A;  2DQ3 A;  4XTX A;  1SES A;  1NYQ A;  5CAI A;  4X9D A;  4G84 A;  1ATI A;  3HFZ B;  5GAO p;  5GAM j;  4NL3 A;  2ZNJ A;  4P74 C;  2ZZF A;  3IG2 A;  3JB9 I;  2DTO A;  4YDQ A;  4XU2 A;  4HWT A;  4XTZ A;  4EMK B;  3R07 A;  4YRK A;  3MEY A;  4PJO B;  3BW1 A;  1G5I A;  4M7D F;  3HXU A;  5ELO A;  4XQ3 A;  4CH6 A;  4HT8 A;  1BBW A;  1E1O A;  2ODR C;  1B7Y A;  4WI1 A;  4JRK A;  4M7D A;  2CIM A;  2CJ9 A;  2C8M A;  3UGQ A;  4M75 C;  1WYD A;  2Q5I A;  2QHU A;  4H2W A;  1EOV A;  2E3C A;  3QO7 A;  1M5Q 1;  1MGQ A;  1ASY A;  1WQW A;  3JCM P;  1J5W A;  2I4O A;  2E10 A;  1U1S A;  1E1T A;  3JCM d;  3EFR A;  2ZZG A;  2XGT A;  2CGH A;  3JCM c;  1H64 1;  1Y96 B;  2ZNI A;  2AMC A;  4EMG A;  4JUV A;  4TQD A;  4J15 A;  3GIB A;  4H2U A;  4O2D A;  4TVW A;  4M75 B;  5GMK l;  2DU7 A;  3VU3 C;  3RF1 A;  1WPY A;  4C8Q G;  4C8Q E;  2CJA A;  4AH6 A;  4WJ3 M;  4P3O A;  1I8F A;  4C92 A;  4XU1 A;  2EJG A;  4F7U G;  3M4Q A;  4TWA A;  2FYK A;  5GAN 2;  5GAN d;  1JJC B;  1NJ8 A;  1B70 B;  3HSB A;  4XEO A;  5GAO l;  3BFM A;  4M78 G;  4HWO A;  4KQE A;  3M4G A;  5GMK m;  1SET A;  1NNH A;  3INZ A;  4MML A;  3UH0 A;  4TVA A;  2EWN A;  2RHQ B;  4H2X B;  11AS A;  2DEQ A;  3IKM B;  2QTX A;  5LJ5 d;  4UP7 A;  3HRK A;  3JCM W;  1H4T A;  2ZR3 A;  3WQZ A;  3HFZ A;  3IKL A;  5GAO m;  3NET A;  1E24 A;  1SER A;  4P71 A;  3REX A;  5GAM g;  2E5A A;  2YLB A;  3HXW A;  4J5Y A;  2ALY B;  1IL2 A;  1KQ1 A;  3A5Y A;  5GAN 5;  4PJO F;  5LJ3 d;  2P5I A;  3VQW A;  4P3P A;  3QO8 A;  4M77 G;  4EMK A;  1BIA A;  4M77 E;  2ZR2 A;  3A7U A;  4PJO A;  2P0L A;  4XU3 A;  4H2V A;  2PME A;  1YFT A;  1EVK A;  2ZIO A;  1KOG A;  2HNI A;  3E9I A;  4QVC A;  4RQF A;  5GAO n;  1H4V B;  1YCY A;  4HWP A;  2DKG A;  3VBB A;  3HFO A;  3UFG A;  1YB3 A;  4YRF A;  5GMK e;  4P71 C;  4C8Q D;  3P8Y A;  2ZT7 A;  1YGB A;  2I4N A;  2I2L A;  4RCC A;  1H4Q A;  3SB2 A;  4J6W A;  1Y96 A;  3RES A;  5GAN h;  5K1X A;  4M75 A;  4EMK C;  2E65 A;  2DZ9 A;  2Q7E A;  4HVC A;  1NJ1 A;  4PJO C;  1M8V A;  4K87 A;  4M78 D;  3P8V A;  1QF6 A;  3A74 A;  3QSU A;  3SWN B;  1ASZ A;  3BJU A;  4YRE A;  2YLC A;  2EJF A;  4P72 A;  3M4P A;  1NYR A;  4YCV A;  5GMK j;  2ZT8 A;  4RDX A;  5C53 B;  1JJC A;  1N9R A;  1HC7 A;  2DXT A;  3HTZ A;  1B34 B;  3RAC A;  1B70 A;  3E9H A;  4HWR A;  1SRY A;  2DZC A;  5LJ5 h;  2VXE A;  2Q5H A;  3V8J A;  4C8Q B;  3V7R A;  4V2S A;  1LJO A;  4M7A G;  3L4G B;  1TH7 A;  4F7U B;  4K88 A;  3FIF A;  1NJ5 A;  4P73 A;  2RHQ A;  4H2X A;  2K57 A;  4TTV A;  3NEM A;  3JCM V;  4YRL A;  3HXV A;  1KMM A;  1G5H A;  2E64 A;  5LJ3 h;  2FB7 A;  4YRO A;  4M78 B;  4YRP A;  2DVE A;  4XU0 A;  4M77 D;  4P72 C;  3JCM J;  3CMQ A;  3V8K A;  4YCW A;  5LJ5 j;  3JB9 H;  2ZIN A;  4YPF A;  3HXX A;  2ALY A;  1H4S A;  4YRN A;  5HGQ A;  4H2S A;  4UPA A;  4YRM A;  4WF2 A;  1Z7M A;  3A31 A;  2QHS A;  2I4M A;  4P73 C;  4F7U E;  5I21 A;  2RA2 A;  3NEN A;  4OLF A;  5GAN 6;  4CS3 A;  1X54 A;  5GAN 4;  4H02 A;  4YRC A;  3NEL A;  3PCO B;  4M78 E;  5GAO q;  1EVL A;  4M77 B;  2CJB A;  2VXF A;  1Z7N A;  4YP0 A;  1W66 A;  1EFW A;  1ADY A;  2J3L A;  2IY5 B;  2ZCE A;  3JCM g;  2J3M A;  2ZTG A;  3RKW A;  2EAY A;  2ARS A;  1HK9 A;  2E1H A;  2RHS B;  2Q7G A;  3FJP A;  1WU7 A;  3QNE A;  1E22 A;  4XTV A;  1RIQ A;  3SWN A;  4M7A D;  1X56 A;  3JCM Q;  2ZZE A;  4PHC A;  3QUI A;  4C92 D;  4CH5 A;  1B34 A;  2QHT A;  4CS4 A;  1EIY B;  3HXY A;  4A53 A;  4C8Q F;  4XTY A;  1N9W A;  4F7U F;  4C8Q A;  1WQ7 A;  1KMN A;  3JCM e;  4RCB A;  3L4G A;  4F7U A;  2Y90 A;  3QTC A;  4H2T A;  1BIB A;  1NJ2 A;  1KQ2 A;  4M78 F;  3JCM f;  3QHS A;  4YRR A;  4HWS A;  3REU A;  2ZT5 A;  3ICA A;  4M78 A;  3SWN C;  3HXZ A;  4N0A A;  3JCM X;  2AKW B;  3I7F A;  4M7A B;  5GAN 8;  3RGL A;  4DPG A;  2C7I A;  1WNL A;  1B76 A;  1HTT A;  4M7D G;  12AS A;  4M7D E;  5GAN e;  1X55 A;  4XEM A;  4BW9 A;  2RM4 A;  3A32 A;  2I4L A;  4C8Q C;  3EFS A;  5GAM h;  4H2Y A;  3TEG A;  3RIR A;  2ART A;  5GAN f;  4JLI A;  4XTU A;  3ERR A;  3TEH B;  1WLE A;  4EO4 A;  4A54 A;  2ZGW A;  4EMH A;  4M78 C;  4M77 F;  4UP8 A;  5KNN A;  1L0W A;  4N0A C;  3HFV A;  3PCO A;  5LJ5 e;  4M77 A;  2EJ9 A;  3JB9 J;  4WJ4 A;  5GAN j;  2ARU A;  3JCM b;  2Q7H A;  4M7A E;  3LC0 A;  3UGT A;  3RKY A;  1B8A A;  5LJ5 f;  4C92 G;  4C92 E;  3RL6 A;  1JRI A;  3G1Z A;  1EQR A;  3PZC A;  3BY7 A;  1X2H A;  2ODR D;  4XTW A;  2IY5 A;  5GAN 3;  4K86 A;  3HY0 A;  1D3B A;  5GAN 7;  4M75 D;  3JB9 D;  5LJ3 e;  3RER A;  2RHS A;  3VQV A;  2G4C A;  2DTI A;  3FB9 A;  1LYL A;  4ZTZ B;  5LJ3 f;  4P75 A;  4EX5 A;  4Q15 A;  5F5W A;  4TQF A;  3HY1 A;  3A5Z A;  4CH4 A;  1EIY A;  4M77 C;  3BDU A;  3VQY A;  4QVD A;  3QO3 A;  2XTI A;  5ELN A;  3V7S A;  3VQX A;  4NOY A;  1N9S A;  4J6Y A;  4NCX A;  4NL2 A;  5LJ3 j;  1YFS A;  2QHV A;  4M7D D;  4YRJ A;  1QE0 A;  3OD1 A;  2ZT6 A;  4YRT A;  5GAM d;  1G51 A;  4J6X A;  1X2G A;  4M7A F;  4MMK A;  1VQZ A;  4RMF A;  2AKW A;  3A7R A;  4CH3 A;  4C92 F;  4KR2 A;  4P75 C;  4PJO G;  4M7A A;  4PJO E;  2DU5 A;  1LOJ A;  4M7D C;  1X01 A;  4HT9 A;  1USY A;  3A7A A;  1C0A A;  2RB6 A;  2PMF A;  4X9C A;  1BBU A;  5DY9 A;  4Y91 A;  1D3B B;  4DQ2 A;  4KR3 A;  5E3I A;  2DTH A;  3W3S A;  3L2Z A;  4L87 A;  3TEH A;  3MF1 A;  1HXD A;  4PNO A;  1B7Y B;  3HRI A;  4X5O A;  1I5L A;  4M7D B;  3RUX A;  1PYS A;  3V7C A;  3TUP A;  2VC8 A;  5GAO r;  4YCU A;  4M75 G;  3JB9 G;  4M75 E;  5K1P A;  4M7A C;  5GAN g;  3DSQ A;  4YYE A;  1USY C;  4C92 C;  2DDZ A;  2DQ0 A;  3LSQ A;  4Q6G A;  4BWA A;  1FYF A;  4OP0 A;  4JRI A;  3HFN A;  1I81 A;  3AHU A;  1GGM A;  2AMC B;  3MF2 A;  4RQE A;  5GMK i;  3LSS A;  1LNX A;  4P3N A;  4E51 A;  5C52 B;  3RKX A;  3KFU A;  4G85 A;  5C51 B;  4TVY A;  2ZXF A;  3IAL A;  4YRI A;  3JCM h;  4C92 B;  5LJ5 g;  4LNS A;  4CS2 A;  1JBM A;  4PG3 A;  4UP9 A;  3QO5 A; 
#chains in the Genus database with same CATH topology
 1W4S A;  3CEY A;  1Q81 C;  2OI3 A;  1I4K 1;  2YHT A;  1RAE B;  1K8A R;  4ZTU B;  2KRM A;  4FYX B;  2GTJ A;  4ZIB A;  2COY A;  3ZFJ A;  4PJO D;  4YRG A;  5CKH A;  1MV0 B;  1TUC A;  2ZPG B;  5CO7 A;  5GAM f;  1WJQ A;  2VAS A;  1PYS B;  1U1T A;  4TVA B;  4FT4 A;  3JB9 F;  2IVW A;  4MZP A;  2YUQ A;  2DQ3 A;  1RUW A;  5CAI A;  5FU6 B;  2KT1 A;  4PJN A;  1JXM A;  1AOJ A;  2X9H A;  4CC2 A;  4BY6 B;  2DVJ A;  2L3S A;  2ZNJ A;  4P74 C;  4JLG A;  1T0J A;  3QG1 A;  1TUG B;  4NS5 A;  1RI0 A;  4HWT A;  3J81 E;  2YUN A;  4EMK B;  1H3Z A;  3R07 A;  3E19 A;  1G5I A;  5ELO A;  4CH6 A;  4J7I A;  2MWP A;  1E1O A;  4WI1 A;  4JRK A;  2CIM A;  4J9H A;  3X26 B;  2ENM A;  3QKJ A;  4MZT A;  1MGQ A;  4F04 B;  2RO0 A;  1RAI B;  1WQW A;  1X69 A;  1BKB A;  4HVV A;  1G3S A;  1J5W A;  2D0Q B;  2E10 A;  1YNZ A;  3G6E Q;  1A0N B;  2RQW A;  1UJ0 A;  2E6N A;  1NLO C;  2KXC A;  2DYI A;  4M75 B;  1N8R U;  2KMT A;  2VYT A;  3VU3 C;  3X28 B;  2JVV A;  1BI0 A;  1WPY A;  3CC4 A;  2XI9 A;  3VJP A;  2D9T A;  1U3O A;  4F7U G;  1CKB A;  2DIL A;  1WJR A;  2FYK A;  3QZ5 B;  1B70 B;  4A4H A;  4TVR A;  3SD4 A;  1ZA1 B;  3HSB A;  4GY5 A;  2QG9 B;  3BFM A;  5IHN A;  4HWO A;  4IUP A;  2E5K A;  4R0K A;  1KQS A;  4A4E A;  3S6W A;  4HT4 A;  1NNH A;  4IUT A;  2OTJ Q;  1M9S A;  1RL2 A;  4N4G A;  2PZ1 A;  3HRT A;  2GQV A;  3JCM W;  3SFM A;  2ZR3 A;  1ZSZ B;  3WQZ A;  3HFZ A;  3IKL A;  5FLX E;  2SEM A;  1SER A;  3REX A;  4J5Y A;  1VQN T;  3TVT A;  1JQQ A;  3EGD A;  2LT4 A;  4PJO F;  1AZE A;  2KNB B;  3MEA A;  1YJW Q;  1YJ9 T;  1MMG A;  5CVI A;  2RQV A;  2ZR2 A;  4PJO A;  2P0L A;  3ASK A;  1KOG A;  3E9I A;  1AWJ A;  4RQF A;  5CCA A;  3UWN A;  2ED1 A;  2V1Q A;  2VUB A;  1BCO A;  5GMK e;  3FLG A;  4P71 C;  1GXI E;  4L5G A;  4FW2 A;  2O9V A;  1VQN A;  2I2L A;  1H4Q A;  4LVM A;  1VQ4 T;  1Q86 U;  1Y96 A;  5GAN h;  2A8E A;  1NEG A;  3CCL A;  1YJ9 A;  5K1X A;  3PIO A;  4EMK C;  2DZ9 A;  3OS2 A;  1QP2 A;  1N8R R;  1YN8 A;  4K87 A;  4M78 D;  1EFN A;  2ZPB B;  3A74 A;  3EH2 A;  4J9F A;  2LDM A;  3OYB A;  2YLC A;  1M1K C;  3CD6 A;  3H0F A;  1S1N A;  1VQO A;  2GCX A;  1YIJ A;  5C53 B;  1N9R A;  4BAC A;  1HC7 A;  2IIM A;  1B34 B;  2ABL A;  3OW2 S;  1X6O A;  4VUB A;  1X27 A;  2KBT A;  1LCK A;  4GLM A;  3MO8 A;  4C8Q B;  1VQ4 A;  4V2S A;  4IIO A;  3OYL A;  4RUG A;  1TH7 A;  5KE2 A;  3P8B B;  1AD5 A;  4E7K A;  5HK0 A;  1WXT A;  4H2X A;  4TTV A;  3JCM V;  4YRL A;  1M90 U;  1KMM A;  4ELY C;  1G5H A;  4BD3 A;  2FB7 A;  1PNJ A;  2DVE A;  3CCQ T;  1VQ5 Q;  2P0Q A;  1PRL C;  4HVW A;  3CMQ A;  3V8K A;  3VRY A;  2RJC A;  1W1F A;  1OX8 A;  2ZCF B;  3NHN A;  4LN2 A;  2JW4 A;  1HSQ A;  2COZ A;  2RJF A;  1Q82 C;  2XDD A;  4UPA A;  1GBQ A;  2RHY A;  2FHD A;  3AT1 B;  2JM8 A;  1AEY A;  2BE9 B;  4P73 C;  1RAC B;  2RA2 A;  1VIF A;  2RJE A;  4ZN1 A;  4CS3 A;  4M4Z A;  2LNH B;  1KJW A;  1FYN A;  3CCQ A;  3NEL A;  3PCO B;  1C1A A;  2G3R A;  4M78 E;  4PLI A;  2LQ8 A;  4M77 B;  3GPL A;  2QQR A;  1OX9 A;  1KSW A;  4ATO A;  2VXF A;  1K1Z A;  4KH1 B;  2LVM A;  4YP0 A;  1K0S A;  2EYX A;  3VRZ A;  2DPP B;  1YI2 T;  1Q86 R;  2AT1 B;  1E6H A;  1ADY A;  3JCM g;  3E1S A;  1KQS P;  2EAY A;  2MIO A;  4R55 A;  3FJP A;  4J8O A;  4C5G A;  3S3O A;  3SWN A;  2M02 A;  1VQM T;  1X56 A;  4MZM A;  2GTO A;  3H6Z A;  4FU6 A;  5CKE A;  4C92 D;  4C0Z A;  4FW1 A;  3OB9 A;  1D1B A;  1WA7 A;  1DJ7 B;  3ZEH A;  2F1L A;  3H41 A;  1J3T A;  4LVJ A;  1KMN A;  1YI2 A;  4L59 A;  3JCM e;  1UTI A;  4KUL A;  1XTD A;  3QTC A;  4O6J A;  1BIB A;  4M78 F;  4OMQ A;  4Y92 A;  3QHS A;  2HQH A;  1IGU A;  2NUP B;  1M90 R;  3I55 Q;  1VQM A;  4M78 A;  3CCV A;  1X6B A;  5IXB A;  1Y0M A;  1YIT T;  4M7A B;  3RGL A;  4LVK A;  1B76 A;  2HBP A;  2DLP A;  2HKQ B;  4M7D G;  12AS A;  4M7D E;  2NUT A;  2CZ6 B;  4C8Q C;  4H2Y A;  1WXU A;  3ERR A;  4UC4 A;  3VS4 A;  4ZTF A;  4AFU C;  1OPL A;  2O9S A;  1TTH B;  2XIC A;  2YUO A;  5KNN A;  1YIT A;  4FSS A;  1L0W A;  5LJ5 e;  4AMC A;  4WJ4 A;  2EJ9 A;  3VYG A;  4LDX A;  5AYF A;  2Q7H A;  2LJ0 A;  1YI2 Q;  3L42 A;  4JJC A;  1NG2 A;  4C92 G;  2DET A;  4C92 E;  5CKD A;  2MAM A;  4J9C A;  1EQR A;  3BY7 A;  2E6Z A;  1X2H A;  1TWB A;  1ZHI A;  3OBY A;  1WIE A;  4LDW A;  4M75 D;  1VQM Q;  4RTT A;  3I5S A;  4OMN A;  5EC7 A;  5HY6 A;  2K2M A;  2G4C A;  1XOV A;  2K3Y A;  3OS5 A;  2DTI A;  2QXF A;  3FB9 A;  4DBH A;  1S72 Q;  5LJ3 f;  3IQL A;  2H3E B;  2CP7 A;  5F5W A;  3HY1 A;  2ZAE A;  1EX4 A;  2LQN A;  4M77 C;  3BDU A;  1JJ2 A;  5I2M A;  1WLP B;  3M54 A;  4NOY A;  4OML A;  2LP5 A;  4DEX A;  1IHW A;  2ESW A;  3L2Q A;  4NCX A;  3CME Q;  1YFS A;  4YRJ A;  1WXB A;  1R8O B;  1SF9 A;  2L3R A;  4C0F A;  1VQP A;  1UGQ B;  3OYH A;  1BU1 A;  1PM3 A;  1YIT Q;  2E70 A;  4LUE A;  4JDS A;  1I07 A;  1VQZ A;  1PHT A;  1M2V A;  3A7R A;  4CH3 A;  4C92 F;  4KR2 A;  2O88 A;  1MMA A;  2L0A A;  1XNI A;  1PRM C;  2DU5 A;  1LOJ A;  1USY A;  1IGQ A;  1C0A A;  1SSF A;  1OPK A;  1SRM A;  2HKN A;  2YRD A;  1VYT A;  1BBU A;  1K73 U;  4KR3 A;  1UEB A;  3TRE A;  4HCZ A;  2RI3 A;  3HTR A;  1QCF A;  2R57 A;  4FT2 A;  2JNG A;  2EW3 A;  3RNJ A;  2F69 A;  1U06 A;  2OTL T;  1PYS A;  1QCO A;  1Y71 A;  2X35 A;  2VC8 A;  2P4R A;  4M75 G;  4M75 E;  2DL8 A;  2J6K A;  4M7A C;  5GAN g;  2WAC A;  1BCM A;  2DQ0 A;  4P5N A;  4Q6G A;  1FYF A;  3FDR A;  3DKM A;  3HFN A;  2AMC B;  1GGM A;  5DLO A;  4P3N A;  1LNX A;  3CXC S;  2J6O A;  4DOV A;  1VQK A;  4E47 A;  1W2B S;  2RHX A;  3KFU A;  4G85 A;  5C51 B;  2P4T A;  5IT9 E;  2OTL A;  1MNE A;  3L2R A;  1PCX A;  1SRL A;  4Q5W A;  4CS2 A;  1GFC A;  1N27 A;  4L6V 5;  4HCK A;  1XQH A;  2LNV A;  5GAM e;  4HA8 A;  5GMK h;  2JS0 A;  1ZQ1 A;  3NTK A;  2O4X A;  1OQK A;  4E2F B;  2FPF A;  5KYU A;  2ZIM A;  4DOW A;  2E3H A;  2I0N A;  4M75 F;  2DER A;  2L5Q A;  4ZN3 A;  2KI7 A;  4X9D A;  2RHU A;  4J9I A;  1ATI A;  4KH0 B;  4RG8 A;  3OYC A;  2COW A;  1N8R C;  3WVE B;  2YWW A;  1QW1 A;  4R56 A;  1ABO A;  2ECZ A;  3VS7 A;  2DTO A;  3GP8 A;  1K73 R;  5I22 A;  3I56 A;  1ZBX A;  3BW1 A;  3G71 T;  1PSE A;  2ODR C;  2CT3 A;  1B7Y A;  5IH2 A;  3UGQ A;  1EOV A;  2E3C A;  2LTO A;  3M0R A;  3JCM P;  3C4S A;  2BTT A;  3T9N A;  2CGH A;  2DBM A;  4KT0 E;  2ZNI A;  1OV3 A;  4EMG A;  4ME7 A;  5IHK A;  1JJ2 P;  4TQD A;  3CQT A;  3GF5 A;  3GIB A;  4O2D A;  3CCM A;  4TVW A;  3ME9 A;  3G71 A;  3RF1 A;  2QEX Q;  4C8Q G;  4C8Q E;  1YWO A;  5D6Y A;  1R0C B;  3OYY A;  1UJY A;  1O75 A;  2QK0 A;  3A8L B;  1NEB A;  2DL5 A;  4TWA A;  2SRC A;  5GAN d;  1CKA A;  2KDS A;  3OW2 P;  2RI2 A;  1BB9 A;  2KRS A;  1TSF A;  5D6X A;  1NM7 A;  4KQE A;  3M4G A;  1SET A;  4GBQ A;  1KD1 U;  2EWN A;  2RHQ B;  11AS A;  2AKK A;  3IKM B;  4J7F A;  5CQX A;  2LCC A;  1H4T A;  3EGX B;  2CSQ A;  5J3B A;  1YCS B;  3NET A;  1GBR A;  5L8R E;  4JZ3 A;  3QYG B;  2LRQ A;  3G6E T;  3RR6 A;  2E5A A;  3HXW A;  1M1F A;  1VQ6 Q;  2QAS A;  1M30 A;  3HL8 A;  1KQ1 A;  9ATC B;  4M77 G;  4M77 E;  1IO6 A;  5KYW B;  1VQ7 Q;  4ELZ C;  1T3L A;  2HNI A;  3LGL A;  4CRI A;  2K5L A;  2KRN A;  3UFG A;  2HDA A;  3G6E A;  2Y4X A;  4JJN K;  1M90 C;  1YGB A;  4RCC A;  4J6W A;  3A8M B;  3D7S B;  3RES A;  4AG2 C;  1M4Z A;  2GNC A;  2OTJ T;  4LDV A;  4OVA A;  4D8D A;  2D1X A;  3TCJ A;  1M8V A;  1UUE A;  3LWI A;  1QF6 A;  1Y7X A;  3Q1J A;  1ZUU A;  1MND A;  2CYZ B;  5KYY A;  1NYR A;  1QVP A;  1VQL T;  1JJC A;  4KBM B;  2C06 A;  3RAC A;  5LJ5 h;  2EIF A;  2LX7 A;  3CBP A;  3CXC A;  3CCJ T;  1T0H A;  1PKT A;  3V7R A;  1YJW T;  1D1C A;  4M7A G;  3FEO A;  2OTJ A;  4K88 A;  3CPW S;  4PKC C;  3FIF A;  1NJ5 A;  2PVO B;  4OB2 B;  1KD1 R;  2K57 A;  2AKL A;  3MPU B;  3X24 B;  3HXV A;  5FU7 B;  2E64 A;  4YRO A;  3EG0 A;  3CCS Q;  5FWB A;  1OZ2 A;  4P72 C;  1KC8 R;  3N5B B;  3MEV A;  2NYS A;  3VYH B;  3C0C A;  5LJ5 j;  4LVL A;  2ZIN A;  4LUD A;  1ZBJ A;  2OX7 A;  2KGT A;  4OMM A;  2ALY A;  3MEU A;  3CCJ A;  4YRM A;  1YJW A;  1Z7M A;  2XDP A;  3A31 A;  2K6D A;  4JRP A;  2EQK A;  1SEM A;  2I4M A;  4Z89 A;  1YHQ Q;  4F7U E;  5I21 A;  3QBY A;  3PMI A;  1FX7 A;  4KUI A;  1X54 A;  2CP6 A;  4YRC A;  4D8K A;  3GLX A;  3I35 A;  1PD1 A;  4LDU A;  4DEY A;  2CKK A;  2HL3 A;  2VB6 A;  3OYE A;  3SEM A;  1W66 A;  1EFW A;  1QWF A;  1NJI U;  3M0T A;  4FIB A;  2IY5 B;  2V1R A;  2ZCE A;  1WFW A;  2J3M A;  2MI6 A;  1HK9 A;  2RHS B;  4IUQ A;  4E6R A;  1OYX A;  1VQL Q;  3G4S T;  4PHC A;  5FRM A;  1VQ5 T;  3QUI A;  3CPF A;  3MKD A;  3A5Z B;  1AZG B;  2CP5 A;  3CCJ Q;  2P0K A;  2QDL A;  4A53 A;  2EGE A;  1N9W A;  5CIU A;  4F7U F;  3JAM E;  2B86 A;  2ZPE B;  2YRC A;  4LD9 K;  4RCB A;  3L4G A;  2GFA A;  4F7U A;  2Y90 A;  4RMO A;  2A28 A;  4BB7 A;  1VQ8 Q;  1KQ2 A;  2PVG B;  4HWS A;  3WXM B;  2ZT5 A;  3HXZ A;  2HL5 C;  4N0A A;  2AKW B;  4MDW A;  1VQ5 A;  3I7F A;  3ULR B;  5GAN 8;  2AZS A;  2RMO A;  4DBR A;  1WHG A;  1HTT A;  4BW9 A;  4QQ6 A;  1TXQ A;  1B3Q A;  3OYD A;  3EFS A;  1JXO A;  4AG1 C;  5GAM h;  3OSV A;  1EIF A;  1ACM B;  2HEQ A;  1NYF A;  3CCU Q;  1IXD A;  4XTU A;  1NLP C;  1WLE A;  4EO4 A;  2DD4 A;  1QVF S;  2ZGW A;  5FU7 C;  2MMP A;  4EMH A;  2DL7 A;  2X4Y A;  1KG1 A;  3JB9 J;  5GAN j;  3EG1 A;  2MOX A;  1PKS A;  4KGZ B;  3EHR A;  3QZ9 B;  5D7U A;  1FWZ A;  2FZK B;  3RL6 A;  4QT7 A;  1K4U S;  1JRI A;  3G1Z A;  3CMA T;  3PZC A;  2EBP A;  1GCQ C;  1NJI R;  3H8Z A;  1QVG S;  4K86 A;  3C94 A;  3CXC P;  2FG0 A;  3G4S Q;  8AT1 B;  5LJ3 e;  1W2B P;  3E2U A;  3I55 T;  2RNA A;  4ZTZ B;  1Q81 U;  4P75 A;  3OSS C;  1OOT A;  2CT4 A;  4CH4 A;  3SHW A;  3M0S A;  1EIY A;  2E5Q A;  3A8G B;  4QVD A;  1IZ6 A;  3OYM A;  2E3I A;  4BI3 A;  1H3H A;  3V7S A;  1UHC A;  3CMA A;  2QA4 Q;  4J6Y A;  2F2X A;  2KE9 A;  3J7A F;  4A4F A;  4M7D D;  3M53 A;  1QE0 A;  3R6O A;  1Q7Y U;  1TUD A;  4YRT A;  3I55 A;  2EYQ A;  4RMF A;  3G7Z A;  2VKN A;  5CR2 A;  2NUZ A;  5KYX A;  2MF2 A;  1WGS A;  4HT9 A;  2C0T A;  3TSZ A;  1KFZ A;  2AIR B;  4DQ2 A;  5E3I A;  2DO3 A;  2V8K A;  2J06 A;  2XG8 D;  3W3S A;  3L2Z A;  2JT4 A;  3TEH A;  1Z9Z A;  2K9G A;  2DA9 A;  3MF1 A;  4PNO A;  3HRI A;  1I5L A;  1IRX A;  3RUX A;  1S72 T;  2FEI A;  1IHV A;  5GAO r;  5IHI A;  4C5E A;  2P0P A;  3M5A A;  1I5O B;  1AWX A;  2KR3 A;  3J80 E;  3CMA Q;  1QQJ A;  1TU0 B;  3UT1 A;  3LSQ A;  4BWA A;  5CQY A;  2A7Y A;  2E4H A;  2YT6 A;  2KYB A;  3CME T;  3UA7 A;  3LSS A;  1QKW A;  2DBK A;  2YRV A;  2QGF B;  1UE9 A;  1M3C A;  3EG9 A;  2H3J A;  3IAL A;  3OQ5 A;  1S72 A;  1N6A A;  4JJB A;  4YRI A;  5LJ5 g;  1FMW A;  4LNS A;  2L3P A;  1Q81 R;  3L2V A;  3QO5 A;  4P74 A;  5GJV B;  2EPD A;  2RD1 A;  3V8L A;  2EL9 A;  4PJL A;  1Q95 G;  4YRS A;  2G6F X;  3NFC A;  1G83 A;  2DXC A;  4E7Z A;  1OI1 A;  3L1A A;  2K4Y A;  2GQI A;  1K8A C;  1YFR A;  4YRQ A;  3PGG A;  3CME A;  2DXU A;  2FZC B;  2RPN A;  2EYY A;  1NJ6 A;  4XK8 E;  1Q7Y R;  2DX1 A;  4G84 A;  4F16 A;  1AT1 B;  3HRU A;  2C0O A;  3HFZ B;  3H0I A;  4OB0 B;  1MHN A;  2JMC A;  4NL3 A;  3PE0 A;  2QDY B;  4E7J A;  2ZZF A;  3IG2 A;  3JB9 I;  3OYG A;  4YTL A;  4ANJ A;  3EGD B;  4XU2 A;  3EHQ A;  2EKH A;  2D6F A;  3PVL A;  4YRK A;  4PJO B;  3HXU A;  4M7D F;  1SHF A;  1RLP C;  2K2V A;  2NLU A;  2KYM A;  3GNF B;  3O8V A;  4M7D A;  1RAF B;  4DA4 A;  3VS0 A;  2H8H A;  2QHU A;  4H2W A;  1M5Q 1;  1ASY A;  2CP3 A;  2K5I A;  3MP6 A;  3CC7 T;  1OU9 A;  2XKO C;  1U8R A;  2RF0 A;  1U1S A;  1E1T A;  1TS9 A;  3CCR Q;  3M55 A;  3JCM d;  3EFR A;  4X1V A;  2ZZG A;  2XGT A;  3PMT A;  3JCM c;  1H64 1;  1QCN A;  1Y96 B;  3P8D A;  2RHZ A;  1KC8 C;  1PG5 B;  1WHH A;  4JUV A;  4J15 A;  2NWM A;  2DU7 A;  5GMK l;  1QVF A;  2K3B A;  3OW2 A;  3OS1 A;  1R0B G;  2DE0 X;  2F5T X;  2XK0 A;  4AH6 A;  2KSS A;  4P3O A;  1AHJ B;  4ESR A;  4WJ3 M;  1I8F A;  4J9D A;  4XU1 A;  4C92 A;  4C5H A;  3RMQ A;  5GAN 2;  5FRN A;  1NJ8 A;  4HCC A;  3CC7 A;  3RMS A;  1FMK A;  4BI4 A;  2CZ7 B;  2DMO A;  2YXY A;  4KGV B;  2RN8 A;  5GMK m;  2HCK A;  2BZ8 A;  3UH0 A;  4TVA A;  4H2X B;  2DEQ A;  2QQ9 A;  2QTX A;  5LJ5 d;  1QLY A;  2PTK A;  1B07 A;  3S3N A;  3CC2 Q;  2K79 A;  2JS2 A;  1E24 A;  3LWH A;  4P71 A;  1P92 A;  5GAM g;  4E7S A;  3KUF A;  1Q82 U;  1MMN A;  1G3W A;  1D1A A;  1CSK A;  1E6G A;  3MCA B;  3OYK A;  2OJ2 A;  3DLL A;  3A5Y A;  1AVZ C;  1SPK A;  2P5I A;  4P3P A;  2RK2 A;  3QO8 A;  4EMK A;  3PNW C;  5FWC A;  4XU3 A;  4H2V A;  3FRN A;  4A4K A;  2QEX T;  4CI0 C;  1EVK A;  2ZIO A;  1WHJ A;  1LVK A;  1X6G A;  3CCE T;  1H8K A;  2DIQ A;  2VGN A;  2VVK A;  3CC7 Q;  1BBZ A;  1H4V B;  1YCY A;  4HWP A;  4O5V A;  1UG1 A;  3HFO A;  1PSF A;  3MET A;  4OB3 B;  2KXD A;  1FXX A;  2WSE E;  1UGS B;  3ER0 A;  4C8Q D;  3KFV A;  1GL5 A;  2I4N A;  1UGV A;  2CRE A;  3SB2 A;  2ZPH B;  4BUG A;  4M75 A;  2BZY A;  2E65 A;  4EDU A;  2Q7E A;  3FJ5 A;  4PJO C;  2QEX A;  3P8V A;  3VS2 A;  4LDY A;  1NPR A;  1TOV A;  3SWN B;  1I1J A;  4YRE A;  4XAX B;  3M4P A;  1H92 A;  2WSC E;  5GMK j;  1SHG A;  2ZT8 A;  4RDX A;  3LW5 E;  2L2P A;  1B70 A;  4HWR A;  4PK4 A;  1VQ6 T;  2DZC A;  4HVU A;  2VXE A;  1QMC A;  3HHT B;  3V8J A;  2F5K A;  3RDV A;  3OBW A;  1TG0 A;  2JMA A;  1SKU B;  2L8D A;  3ZL7 C;  2VWF A;  1VQ7 T;  2DK3 A;  1WI7 A;  4P73 A;  1YJN Q;  2EFI A;  1MV3 A;  4DBF A;  3PTA A;  3NEM A;  1MUZ A;  4A63 B;  1KQS S;  5KE3 A;  5LJ3 h;  3VS6 A;  4M78 B;  3E9G A;  1Y07 A;  2M1H A;  4PLL A;  4M77 D;  1NJI C;  1ZSZ A;  1GFD A;  1K9M U;  3HKS A;  3JCM J;  2A37 A;  1VQ6 A;  2O01 E;  5AT1 B;  2AZV A;  2J05 A;  2NUT B;  3HXX A;  1K9A A;  2XU8 A;  5HGQ A;  4H2S A;  4IKF A;  1OZ3 A;  1D0Y A;  1VQ7 A;  3CCE Q;  1M2O A;  3M0Q A;  3NEN A;  4OLF A;  3EAE A;  2DXB A;  4J9E A;  2FVU A;  2FRY A;  1QVF P;  5A0G A;  3JSC A;  3GOX A;  5GAO q;  2M0Y A;  1EVL A;  3CBM A;  3DLM A;  1VQ9 T;  1N5Z A;  2CJB A;  1JB0 E;  1Z7N A;  5IAY A;  4RTZ A;  4AFQ C;  1RAH B;  2J3L A;  4B9X A;  1AWO A;  1W6X A;  2F2W A;  1HD3 A;  3RKW A;  1Q86 C;  1QVG P;  2ARS A;  2Q7G A;  3QNE A;  1E22 A;  4XTV A;  1Y57 A;  1RIQ A;  4C5I A;  3CCS T;  4M7A D;  2ZZE A;  2QQB A;  1X2Q A;  2EQI A;  2LX9 A;  4IIM A;  2KQW A;  4E7L A;  3MQZ A;  5CKB A;  2XDB A;  1B34 A;  2J6F A;  1O9S A;  2QHT A;  3M58 A;  4CS4 A;  1VQ9 A;  4N4I A;  3OYA A;  2PUK B;  2HBW A;  4C8Q F;  4EIK A;  4KUD K;  2X51 A;  2ROT A;  4BDZ A;  1PD0 A;  1G2B A;  2DRM A;  3G1J A;  2MPX C;  2CUD A;  4C8Q A;  3TU4 K;  2B8A A;  2DNU A;  2KEA A;  2CSI A;  2K5F A;  4LVI A;  1T3S A;  1IB8 A;  1YHQ T;  3KXT A;  3DB4 A;  2XMF A;  2V8J A;  2M9U A;  1WJS A;  4MDX A;  5DM7 R;  3REU A;  3QDF A;  2BZX A;  3CCS A;  3SWN C;  4JJD A;  1M2V B;  3MJX A;  4ZNX A;  3JRZ A;  2QQS A;  3A8H B;  4KGX B;  2OAW A;  3OMC A;  1K9M R;  4DPG A;  3QPH A;  2FPE A;  1WNL A;  1IRE B;  2BIV A;  1X55 A;  4XEM A;  2RM4 A;  2I4L A;  1NYG A;  2LCS A;  3TEG A;  4PFO A;  3RIR A;  2ART A;  5GAN f;  2RH2 A;  4WTO B;  2RHI A;  1YHQ A;  4JLI A;  2BKD N;  3OS0 A;  2EVR A;  4A54 A;  1ZLM A;  2C0I A;  2PU9 B;  4J9B A;  3PFS A;  1M1G A;  4E7H A;  4M78 C;  4M77 F;  3S3M A;  1VQ9 Q;  3HFV A;  3PCO A;  3TQ7 P;  4M77 A;  4ZGE B;  1W2B A;  2ARU A;  2Y4Y A;  3JCM b;  4M7A E;  3LC0 A;  1Q7Y C;  3RKY A;  1B8A A;  2W0Z A;  2D0N A;  3QII A;  3UPU A;  4PJM A;  4RTV A;  3L2U A;  2ODR D;  4XTW A;  4DBQ A;  5FRO A;  3RBB B;  1SSH A;  1VQ8 T;  3HY0 A;  1U5S A;  3VKI A;  1VQL A;  4CC7 A;  5DLQ E;  3HRS A;  7AT1 B;  3CC4 T;  1JEG A;  4K11 A;  4D6W A;  2XTI A;  5ELN A;  5CK9 A;  2O4X B;  1N9S A;  1BI2 A;  2R5A A;  3CCU T;  3NPF A;  2QAZ A;  5KYU B;  2RQR A;  4II1 A;  1VQ8 A;  2IG0 A;  3OD1 A;  2ED0 A;  2ZT6 A;  3C95 A;  2GBQ A;  1OEB A;  1OUL A;  2NUP A;  4J6X A;  4M7A F;  1RLQ C;  3I9Q A;  2CUB A;  1QP3 A;  3UAT A;  4PJO G;  4M7A A;  3THK A;  4PJO E;  2HSP A;  2HZY A;  4M7D C;  1X01 A;  2DJQ A;  3EFO B;  1UFF A;  4X9C A;  1D3B B;  4GLK A;  1V29 B;  2EQU A;  4RTY A;  3WVD B;  3CCU A;  2O31 A;  4L87 A;  1VYU A;  4QQD A;  3X25 B;  2QTV A;  1HXD A;  1B7Y B;  4LD6 A;  3O5Z A;  2CS7 A;  2JM9 A;  3TUP A;  2GGR A;  4JS5 A;  2LQW A;  3DSQ A;  2V8I A;  4JRQ A;  1WHM A;  5J39 A;  4YYE A;  1ZA2 B;  1USY C;  3NTI A;  4C92 C;  1XJW B;  2DDZ A;  2FPD A;  3CBO A;  3P8H A;  2ATC B;  4OP0 A;  2QA4 T;  2CZ1 B;  2RQT A;  1I81 A;  2CH4 W;  3GNG A;  1RAG B;  1HJD A;  1X75 C;  4RTW A;  4E51 A;  3MHX A;  3OA6 A;  3G4S A;  5FW9 A;  2L3Q A;  1BYM A;  3M56 A;  3CCL T;  4TVY A;  3CC4 Q;  2BUD A;  2ZXF A;  2ROL A;  3L2W A;  3PT9 A;  2NS6 A;  1G3T A;  3HP9 A;  1JBM A;  2KAF A;  1BK2 A;  1UB4 A;  3P8T A;  3CD6 T;  2LCL A;  2E41 A;  5FU6 C;  2FO0 A;  2L89 A;  1VQO T;  1YIJ T;  1ZUY A;  2A0F B;  2DF6 A;  2JN0 A;  3MP8 A;  3REA B;  2XID A;  2QA4 A;  4BY6 C;  1ADJ A;  2R58 A;  4OGC A;  2A36 A;  5LJ3 g;  1OU8 A;  1UDL A;  3LLR A;  1JJ2 S;  2LT1 A;  4ZGD B;  4B9W A;  2DJZ A;  4XTX A;  1SES A;  2JTE A;  1NYQ A;  5LL6 S;  5CKF A;  4RTX A;  3LX7 A;  3QJY A;  3LH0 A;  5GAO p;  5GAM j;  4JS4 A;  4QW2 A;  2RK1 A;  2LC4 A;  3PIP A;  2DAQ A;  4YDQ A;  1W70 A;  4XTZ A;  2KVQ G;  4Y28 E;  2PVD B;  1D0X A;  1K73 C;  3MEY A;  1KHC A;  2MYS A;  4OMO A;  5I11 A;  4XQ3 A;  2DEU A;  4HT8 A;  3H0H A;  1BBW A;  3EG3 A;  2CJ9 A;  2DL4 A;  4B6M A;  4PFP A;  2C8M A;  4M75 C;  4E7I A;  1WYD A;  2PNI A;  1EZZ B;  2Q5I A;  4A4G A;  3QO7 A;  3LH5 A;  1WZO A;  1KHI A;  3EGU A;  3QWX X;  2I4O A;  3BE3 A;  2VGM A;  4PJJ A;  4IUV A;  4IUU A;  1VQN Q;  4BI8 B;  4BE0 A;  4Z88 A;  4PL6 A;  2AMC A;  4F17 A;  1ZUK A;  4HCB A;  4H2U A;  3CCL Q;  1YJ9 Q;  4ZGJ B;  3HPW A;  1R77 A;  4JZ4 A;  2R5M A;  3C12 A;  2CJA A;  5KCO A;  2EJG A;  2JUF A;  3OMG A;  5KYY B;  3CD6 Q;  2VV5 A;  3M4Q A;  2LQK A;  4JPB W;  1JJC B;  1VQO Q;  1YIJ Q;  3CPW A;  4CC4 B;  2M51 A;  4XEO A;  5GAO l;  1G8X A;  2HSE B;  4F14 A;  1D09 B;  1PWT A;  4M78 G;  1ZSZ C;  2A08 A;  2F2V A;  3MEW A;  1RAA B;  1VQ4 Q;  3INZ A;  4MML A;  2FRW A;  1B7T A;  1X43 A;  2EYZ A;  6AT1 B;  1WHL A;  2YSQ A;  4RG2 A;  3UDC A;  4UP7 A;  3HRK A;  1GRI A;  2X4W A;  3A1P A;  2AK5 A;  3NTH A;  2GF7 A;  5GAO m;  3CCV T;  2D8J A;  2YLB A;  4HKE A;  3CCR T;  3OY9 A;  1VIE A;  1G3Y A;  3VS1 A;  2ALY B;  1IL2 A;  2LJ1 A;  3FC3 A;  5GAN 5;  5LJ3 d;  3VQW A;  1BIA A;  4RKU E;  3A7U A;  1JU5 C;  2PME A;  1YFT A;  4C0G A;  2QQA A;  3DB3 A;  4QVC A;  2JTF A;  5GAO n;  3OYJ A;  1UGP B;  3VUZ A;  2KK4 A;  2ZPI B;  2DKG A;  4X34 A;  2XD0 A;  3VBB A;  2DD5 A;  1K76 A;  3CCQ Q;  3PVQ A;  1YB3 A;  1ARK A;  4YRF A;  4C0D B;  2X4J A;  1LPL A;  3CCR A;  1YWP A;  3QJ6 A;  5J26 A;  2ZT7 A;  3P8Y A;  5L23 A;  2YUP A;  1VOM A;  2LMJ A;  4OMP A;  3GBQ A;  1K9M C;  3TEE A;  2WSF E;  1Z9Q A;  3NMZ C;  1NE8 A;  2JJ9 A;  4HVC A;  1NJ1 A;  3MP1 A;  3URG A;  3NGP A;  4QKU A;  3QSU A;  1ASZ A;  1MMD A;  3CC2 T;  3BJU A;  1HYO A;  2EJF A;  4P72 A;  1C6V X;  4PFZ A;  3UA6 A;  8ATC B;  4YCV A;  1ZSG A;  2QI2 A;  3HTZ A;  2DXT A;  4AT1 B;  3E9H A;  2PQW A;  1SRY A;  1D0Z A;  2ZPF B;  3M0P A;  2CP0 A;  2HAX A;  5IXF A;  2Q5H A;  1NPP A;  2D8H A;  2V26 A;  2CDT A;  1LJO A;  2RJD A;  3L4G B;  2LJ3 A;  4F7U B;  3I5R A;  2MWO A;  2RHQ A;  4J9G A;  1JO8 A;  3M59 A;  2Z0W A;  4CC3 A;  1RAB B;  3KBG A;  1KD1 C;  4YRP A;  2HQX A;  4XU0 A;  5HK3 A;  2M16 A;  1VQP T;  3CCV Q;  3CC2 A;  3ZBD A;  3OYN A;  3EGX A;  1VYV A;  3LYI A;  5D6W A;  1VA7 A;  4YCW A;  3JB9 H;  2IPO B;  5M9O A;  2EQM A;  4YPF A;  2CZ0 B;  1H4S A;  4YRN A;  2X3X D;  2CH4 A;  4WF2 A;  1M1K U;  2JTM A;  3A98 A;  2QHS A;  3E9F A;  5KYW A;  1PC0 A;  1V76 A;  3REB B;  2KY9 A;  5GAN 6;  3VS5 A;  4H02 A;  5GAN 4;  2JXB A;  2P84 A;  3EH1 A;  1RAD B;  1X2K A;  5EG2 A;  1WHK A;  1QVG A;  5I2S A;  1M8M A;  4HXJ A;  4WCI A;  2J7I A;  3CPW P;  1YP5 A;  5KYN A;  1NBE B;  4FSX A;  1RI9 A;  1I0C A;  1YJN T;  5C6S A;  2ZTG A;  1NZ9 A;  2E1H A;  1WU7 A;  1VQK T;  2JZ2 A;  3JCM Q;  2EYW A;  5A0L A;  4LNP A;  1UHF A;  1KK7 A;  4CH5 A;  2HMA A;  4QQG A;  1EIY B;  3HXY A;  4C0D C;  1GCP A;  4ZTJ A;  4XTY A;  2KRO A;  3VV0 A;  5ECA A;  3X20 B;  1WQ7 A;  1M3A A;  5IN1 A;  3SDZ A;  1YFN A;  1FMV A;  2PUO B;  1YJN A;  2RQU A;  1QWE A;  3VUB A;  3M57 A;  4H2T A;  1K0X A;  2DRK A;  2O2O A;  1VQP Q;  2FZG B;  1NJ2 A;  3JCM f;  4YRR A;  2DIG A;  2YDL A;  2EGA A;  1WDX A;  3VS3 A;  3ICA A;  3JCM X;  2MK5 A;  5KYX B;  2C7I A;  4AFZ C;  4FM4 B;  1UEC A;  2A3L A;  1AWW A;  5GAN e;  3A32 A;  2LZ6 B;  2XHC A;  1GCQ A;  1M1K R;  3BDL A;  2X4X A;  2HD0 A;  3CCE A;  3TEH B;  4Z02 A;  3QDR B;  3I56 T;  3QXE B;  3OYI A;  3EG2 A;  2EKO A;  2GFU A;  1V1C A;  4UP8 A;  3A8O B;  4N0A C;  2MCN A;  5A0D A;  1UGR B;  5KCH A;  2QYZ A;  2DL3 A;  4FL6 A;  1M3B A;  3UGT A;  5KH6 A;  5LJ5 f;  4N4H A;  2W10 A;  4FYY B;  2E12 A;  3H9N A;  1G5V A;  2IY5 A;  5GAN 3;  3EFO A;  2FL7 A;  2QGG A;  2DM1 A;  1VQK Q;  2K7A A;  1D3B A;  5GAN 7;  3JB9 D;  3EG9 B;  3RER A;  5A2Q E;  4OMF B;  2RHS A;  3VQV A;  3CCM T;  2OTL Q;  3OYF A;  4FYV B;  1LYL A;  4EX5 A;  1Q82 R;  4Q15 A;  4TQF A;  1M27 C;  2DFU A;  4J83 A;  3A5Z A;  2KT8 A;  2RI5 A;  3JV3 A;  4LE9 A;  4KRT A;  3VQY A;  5HKC A;  3QO3 A;  1K8A U;  2ZZD A;  3VQX A;  1YBY A;  3QYH B;  3UF4 A;  2EGC A;  4NL2 A;  5LJ3 j;  4OB1 B;  4LXC A;  2QHV A;  2BE7 D;  1ABQ A;  2JOY A;  3QWY A;  1F1B B;  4AFS C;  5GAM d;  2EQJ A;  1G51 A;  1X2G A;  4MMK A;  3TSW A;  4BE2 A;  2AKW A;  1QKX A;  4P75 C;  1SG5 A;  3A7A A;  2CP2 A;  1BI1 A;  5C0M A;  2RB6 A;  2PMF A;  2K3X A;  2HQE A;  5DY9 A;  4Y91 A;  1E7O A;  4Z8A A;  4RTU A;  2DTH A;  3I56 Q;  2AHJ B;  3M0U A;  4X5O A;  1WX6 A;  3R6N A;  4M7D B;  3V7C A;  4ORZ A;  4YCU A;  3JB9 G;  5GJW B;  5K1P A;  1WYX A;  4OF1 A;  4FCY A;  1KC8 U;  5HCK A;  4IUR A;  2M0O A;  4FYW B;  4JRI A;  3AHU A;  4RQE A;  3MF2 A;  3LGF A;  4OGE A;  5GMK i;  3F70 A;  1KIK A;  5C52 B;  1BI3 A;  3CCM Q;  3RKX A;  1C0M A;  3G71 Q;  4QVZ A;  2DYB A;  2OAU A;  3U23 A;  3JCM h;  4C92 B;  4BE1 A;  4BDY A;  3M4Y A;  1VUB A;  2X3W D;  4PG3 A;  4UP9 A;  3M9Q A;  4EPC A;  1ZX6 A; 
#chains in the Genus database with same CATH homology
 1W4S A;  3CEY A;  1Q81 C;  1I4K 1;  2YHT A;  4ZTU B;  4ZIB A;  3ZFJ A;  4PJO D;  4YRG A;  5CKH A;  2ZPG B;  5CO7 A;  5GAM f;  1WJQ A;  1PYS B;  1U1T A;  4TVA B;  4FT4 A;  3JB9 F;  2IVW A;  4MZP A;  2DQ3 A;  5CAI A;  5FU6 B;  4BY6 B;  2ZNJ A;  4P74 C;  4JLG A;  3QG1 A;  4NS5 A;  1RI0 A;  4HWT A;  3J81 E;  4EMK B;  1H3Z A;  3R07 A;  3E19 A;  1G5I A;  5ELO A;  4CH6 A;  4J7I A;  2MWP A;  1E1O A;  4WI1 A;  4JRK A;  2CIM A;  3X26 B;  3QKJ A;  4MZT A;  1MGQ A;  2RO0 A;  1WQW A;  1BKB A;  1G3S A;  1J5W A;  2D0Q B;  2E10 A;  2E6N A;  4M75 B;  1N8R U;  2KMT A;  2VYT A;  3VU3 C;  3X28 B;  2JVV A;  1BI0 A;  1WPY A;  3CC4 A;  2XI9 A;  3VJP A;  2D9T A;  4F7U G;  1WJR A;  2FYK A;  3QZ5 B;  1B70 B;  4A4H A;  4TVR A;  3SD4 A;  3HSB A;  4GY5 A;  3BFM A;  4HWO A;  4IUP A;  1KQS A;  4A4E A;  3S6W A;  4HT4 A;  1NNH A;  4IUT A;  1M9S A;  1RL2 A;  4N4G A;  3HRT A;  2GQV A;  3JCM W;  3SFM A;  2ZR3 A;  3WQZ A;  3HFZ A;  3IKL A;  5FLX E;  1SER A;  3REX A;  4J5Y A;  1VQN T;  2LT4 A;  4PJO F;  3MEA A;  1YJ9 T;  5CVI A;  2ZR2 A;  4PJO A;  2P0L A;  3ASK A;  1KOG A;  3E9I A;  4RQF A;  5CCA A;  3UWN A;  2VUB A;  5GMK e;  3FLG A;  4P71 C;  1GXI E;  4L5G A;  1VQN A;  2I2L A;  1H4Q A;  4LVM A;  1VQ4 T;  1Q86 U;  1Y96 A;  5GAN h;  2A8E A;  3CCL A;  1YJ9 A;  5K1X A;  3PIO A;  4EMK C;  2DZ9 A;  3OS2 A;  1QP2 A;  4K87 A;  4M78 D;  2ZPB B;  3A74 A;  3CD6 A;  2LDM A;  3OYB A;  2YLC A;  1M1K C;  1VQO A;  2GCX A;  1YIJ A;  5C53 B;  1N9R A;  4BAC A;  1HC7 A;  1B34 B;  3OW2 S;  1X6O A;  4VUB A;  3MO8 A;  4C8Q B;  1VQ4 A;  4V2S A;  3OYL A;  1TH7 A;  5KE2 A;  3P8B B;  4E7K A;  5HK0 A;  4H2X A;  4TTV A;  3JCM V;  4YRL A;  1M90 U;  1KMM A;  4ELY C;  1G5H A;  4BD3 A;  2FB7 A;  2DVE A;  3CCQ T;  2P0Q A;  3CMQ A;  3V8K A;  2RJC A;  2ZCF B;  2RJF A;  1Q82 C;  2XDD A;  4UPA A;  2RHY A;  2FHD A;  4P73 C;  2RA2 A;  1VIF A;  2RJE A;  4ZN1 A;  4CS3 A;  3CCQ A;  3NEL A;  3PCO B;  2G3R A;  4M78 E;  4PLI A;  2LQ8 A;  4M77 B;  3GPL A;  2QQR A;  4ATO A;  2VXF A;  2LVM A;  4YP0 A;  2DPP B;  1YI2 T;  1ADY A;  3JCM g;  3E1S A;  2EAY A;  4R55 A;  3FJP A;  4J8O A;  4C5G A;  3S3O A;  3SWN A;  1VQM T;  1X56 A;  4MZM A;  3H6Z A;  4FU6 A;  5CKE A;  4C92 D;  4C0Z A;  3OB9 A;  1DJ7 B;  3ZEH A;  4LVJ A;  1KMN A;  1YI2 A;  4L59 A;  3JCM e;  4KUL A;  1XTD A;  3QTC A;  4O6J A;  1BIB A;  4M78 F;  3QHS A;  1VQM A;  4M78 A;  3CCV A;  1YIT T;  4M7A B;  3RGL A;  4LVK A;  1B76 A;  2HBP A;  4M7D G;  12AS A;  4M7D E;  2CZ6 B;  4C8Q C;  4H2Y A;  3ERR A;  4UC4 A;  4ZTF A;  2XIC A;  5KNN A;  1YIT A;  1L0W A;  5LJ5 e;  4WJ4 A;  2EJ9 A;  3VYG A;  4LDX A;  5AYF A;  2Q7H A;  3L42 A;  4C92 G;  4C92 E;  5CKD A;  2MAM A;  1EQR A;  3BY7 A;  2E6Z A;  1X2H A;  1ZHI A;  3OBY A;  4LDW A;  4M75 D;  5HY6 A;  2G4C A;  1XOV A;  2K3Y A;  3OS5 A;  2DTI A;  2QXF A;  3FB9 A;  5LJ3 f;  5F5W A;  3HY1 A;  4M77 C;  3BDU A;  1JJ2 A;  5I2M A;  3M54 A;  4NOY A;  3L2Q A;  4NCX A;  1YFS A;  4YRJ A;  1R8O B;  4C0F A;  2L3R A;  1VQP A;  1UGQ B;  3OYH A;  2E70 A;  4JDS A;  1VQZ A;  3A7R A;  4CH3 A;  4C92 F;  4KR2 A;  1XNI A;  2DU5 A;  1LOJ A;  1USY A;  1C0A A;  1SSF A;  1BBU A;  1K73 U;  4KR3 A;  1UEB A;  3TRE A;  4HCZ A;  2RI3 A;  2R57 A;  4FT2 A;  2JNG A;  2F69 A;  2OTL T;  1PYS A;  1Y71 A;  2X35 A;  2VC8 A;  4M75 G;  4M75 E;  4M7A C;  5GAN g;  2WAC A;  2DQ0 A;  4P5N A;  4Q6G A;  1FYF A;  3FDR A;  3DKM A;  3HFN A;  2AMC B;  1GGM A;  5DLO A;  4P3N A;  1LNX A;  3CXC S;  1VQK A;  4DOV A;  4E47 A;  1W2B S;  2RHX A;  3KFU A;  4G85 A;  5C51 B;  2P4T A;  5IT9 E;  2OTL A;  3L2R A;  4Q5W A;  4CS2 A;  1N27 A;  4L6V 5;  1XQH A;  2LNV A;  5GAM e;  4HA8 A;  5GMK h;  1ZQ1 A;  3NTK A;  2O4X A;  2ZIM A;  4DOW A;  4M75 F;  2L5Q A;  4ZN3 A;  4X9D A;  2RHU A;  1ATI A;  4RG8 A;  3OYC A;  1N8R C;  3WVE B;  1QW1 A;  4R56 A;  2DTO A;  3GP8 A;  3I56 A;  1ZBX A;  3BW1 A;  3G71 T;  1PSE A;  2ODR C;  1B7Y A;  3UGQ A;  1EOV A;  2E3C A;  2LTO A;  3JCM P;  3C4S A;  3T9N A;  2CGH A;  4KT0 E;  2ZNI A;  4EMG A;  4ME7 A;  4TQD A;  3GF5 A;  3GIB A;  4O2D A;  3CCM A;  4TVW A;  3ME9 A;  3G71 A;  3RF1 A;  4C8Q G;  4C8Q E;  5D6Y A;  3OYY A;  1O75 A;  3A8L B;  4TWA A;  5GAN d;  2KDS A;  2RI2 A;  5D6X A;  4KQE A;  3M4G A;  1SET A;  1KD1 U;  2EWN A;  2RHQ B;  11AS A;  3IKM B;  4J7F A;  5CQX A;  2LCC A;  1H4T A;  5J3B A;  3NET A;  5L8R E;  3G6E T;  3QYG B;  2LRQ A;  2E5A A;  3HXW A;  1M1F A;  3HL8 A;  1KQ1 A;  4M77 G;  4M77 E;  4ELZ C;  2HNI A;  3LGL A;  4CRI A;  2K5L A;  3UFG A;  3G6E A;  2Y4X A;  4JJN K;  1M90 C;  1YGB A;  4RCC A;  4J6W A;  3A8M B;  3RES A;  1M4Z A;  2OTJ T;  4LDV A;  4OVA A;  3TCJ A;  1M8V A;  3LWI A;  1QF6 A;  1Y7X A;  3Q1J A;  2CYZ B;  1NYR A;  1QVP A;  1VQL T;  1JJC A;  4KBM B;  2C06 A;  3RAC A;  5LJ5 h;  2EIF A;  3CBP A;  3CXC A;  3CCJ T;  3V7R A;  1YJW T;  4M7A G;  3FEO A;  2OTJ A;  4K88 A;  3CPW S;  4PKC C;  3FIF A;  1NJ5 A;  2PVO B;  4OB2 B;  2K57 A;  3X24 B;  3HXV A;  5FU7 B;  2E64 A;  4YRO A;  1OZ2 A;  4P72 C;  3N5B B;  3MEV A;  3VYH B;  5LJ5 j;  4LVL A;  2ZIN A;  2ALY A;  3MEU A;  3CCJ A;  4YRM A;  1YJW A;  1Z7M A;  2XDP A;  3A31 A;  4JRP A;  2EQK A;  2I4M A;  4F7U E;  5I21 A;  3QBY A;  3PMI A;  1FX7 A;  4KUI A;  1X54 A;  4YRC A;  3GLX A;  4LDU A;  2CKK A;  3OYE A;  1W66 A;  1EFW A;  1NJI U;  4FIB A;  2IY5 B;  2ZCE A;  2J3M A;  2MI6 A;  1HK9 A;  2RHS B;  4IUQ A;  1OYX A;  3G4S T;  4PHC A;  5FRM A;  1VQ5 T;  3QUI A;  3CPF A;  3A5Z B;  2P0K A;  4A53 A;  1N9W A;  5CIU A;  4F7U F;  3JAM E;  2ZPE B;  4LD9 K;  4RCB A;  3L4G A;  2GFA A;  4F7U A;  2Y90 A;  4RMO A;  4BB7 A;  1KQ2 A;  2PVG B;  4HWS A;  3WXM B;  2ZT5 A;  3HXZ A;  4N0A A;  2AKW B;  4MDW A;  1VQ5 A;  3I7F A;  5GAN 8;  1HTT A;  4BW9 A;  4QQ6 A;  3OYD A;  3EFS A;  5GAM h;  3OSV A;  1EIF A;  4XTU A;  1WLE A;  4EO4 A;  2DD4 A;  1QVF S;  2ZGW A;  5FU7 C;  2MMP A;  4EMH A;  2X4Y A;  1KG1 A;  3JB9 J;  5GAN j;  3QZ9 B;  1FWZ A;  3RL6 A;  1JRI A;  3G1Z A;  3CMA T;  3PZC A;  3H8Z A;  1QVG S;  4K86 A;  3C94 A;  5LJ3 e;  3I55 T;  4ZTZ B;  1Q81 U;  4P75 A;  3OSS C;  4CH4 A;  1EIY A;  2E5Q A;  3A8G B;  4QVD A;  1IZ6 A;  3OYM A;  4BI3 A;  3V7S A;  3CMA A;  4J6Y A;  3J7A F;  4A4F A;  4M7D D;  3M53 A;  1QE0 A;  3R6O A;  1Q7Y U;  4YRT A;  3I55 A;  2EYQ A;  4RMF A;  3G7Z A;  5CR2 A;  2MF2 A;  1WGS A;  4HT9 A;  4DQ2 A;  5E3I A;  2DO3 A;  2V8K A;  2XG8 D;  3W3S A;  3L2Z A;  3TEH A;  3MF1 A;  4PNO A;  3HRI A;  1I5L A;  3RUX A;  1S72 T;  5GAO r;  4C5E A;  2P0P A;  3M5A A;  3J80 E;  3UT1 A;  3LSQ A;  4BWA A;  5CQY A;  2A7Y A;  3CME T;  3LSS A;  2YRV A;  2H3J A;  3IAL A;  3OQ5 A;  1S72 A;  1N6A A;  4YRI A;  5LJ5 g;  4LNS A;  3L2V A;  3QO5 A;  4P74 A;  2RD1 A;  3V8L A;  2EL9 A;  4YRS A;  3NFC A;  2DXC A;  1OI1 A;  3L1A A;  2K4Y A;  1K8A C;  1YFR A;  4YRQ A;  3PGG A;  3CME A;  2DXU A;  1NJ6 A;  4XK8 E;  4G84 A;  3HRU A;  3HFZ B;  4OB0 B;  1MHN A;  4NL3 A;  2QDY B;  4E7J A;  2ZZF A;  3IG2 A;  3JB9 I;  3OYG A;  4YTL A;  4XU2 A;  2D6F A;  4YRK A;  4PJO B;  3HXU A;  4M7D F;  2K2V A;  2NLU A;  3GNF B;  3O8V A;  4M7D A;  4DA4 A;  2QHU A;  4H2W A;  1M5Q 1;  1ASY A;  2K5I A;  3MP6 A;  3CC7 T;  2XKO C;  1U8R A;  1U1S A;  1E1T A;  3M55 A;  3JCM d;  3EFR A;  2ZZG A;  2XGT A;  3PMT A;  3JCM c;  1H64 1;  1Y96 B;  3P8D A;  2RHZ A;  1KC8 C;  4JUV A;  4J15 A;  2DU7 A;  5GMK l;  1QVF A;  3OW2 A;  3OS1 A;  2F5T X;  2XK0 A;  4AH6 A;  2KSS A;  4P3O A;  1AHJ B;  4WJ3 M;  1I8F A;  4C92 A;  4XU1 A;  4C5H A;  3RMQ A;  5GAN 2;  5FRN A;  1NJ8 A;  4HCC A;  3CC7 A;  3RMS A;  4BI4 A;  2CZ7 B;  5GMK m;  3UH0 A;  4TVA A;  4H2X B;  2DEQ A;  2QQ9 A;  2QTX A;  5LJ5 d;  3S3N A;  1E24 A;  3LWH A;  4P71 A;  1P92 A;  5GAM g;  3KUF A;  1Q82 U;  1G3W A;  3MCA B;  3OYK A;  3DLL A;  3A5Y A;  2P5I A;  4P3P A;  2RK2 A;  3QO8 A;  4EMK A;  3PNW C;  4XU3 A;  4H2V A;  3FRN A;  4A4K A;  2QEX T;  4CI0 C;  1EVK A;  2ZIO A;  3CCE T;  2DIQ A;  2VGN A;  1H4V B;  1YCY A;  4HWP A;  4O5V A;  3HFO A;  4OB3 B;  1PSF A;  3MET A;  1FXX A;  2WSE E;  1UGS B;  3ER0 A;  4C8Q D;  2I4N A;  3SB2 A;  2ZPH B;  4BUG A;  4M75 A;  2E65 A;  4EDU A;  2Q7E A;  4PJO C;  2QEX A;  3P8V A;  4LDY A;  1NPR A;  3SWN B;  4YRE A;  4XAX B;  3M4P A;  2WSC E;  5GMK j;  2ZT8 A;  4RDX A;  3LW5 E;  1B70 A;  4HWR A;  1VQ6 T;  2DZC A;  2VXE A;  3HHT B;  3V8J A;  2F5K A;  3OBW A;  2L8D A;  1VQ7 T;  2DK3 A;  4P73 A;  2EFI A;  3PTA A;  3NEM A;  1KQS S;  5KE3 A;  5LJ3 h;  4M78 B;  3E9G A;  1Y07 A;  2M1H A;  4PLL A;  4M77 D;  1NJI C;  1K9M U;  3HKS A;  3JCM J;  1VQ6 A;  2O01 E;  3HXX A;  2XU8 A;  5HGQ A;  4H2S A;  4IKF A;  1OZ3 A;  1VQ7 A;  3NEN A;  4OLF A;  3EAE A;  2DXB A;  2FVU A;  5A0G A;  3JSC A;  3GOX A;  5GAO q;  1EVL A;  3CBM A;  3DLM A;  1VQ9 T;  2CJB A;  1JB0 E;  1Z7N A;  5IAY A;  2J3L A;  4B9X A;  1Q86 C;  3RKW A;  2ARS A;  2Q7G A;  3QNE A;  1E22 A;  4XTV A;  1RIQ A;  4C5I A;  3CCS T;  4M7A D;  2ZZE A;  2QQB A;  2LX9 A;  2KQW A;  4E7L A;  3MQZ A;  5CKB A;  2XDB A;  1B34 A;  1O9S A;  2QHT A;  3M58 A;  4CS4 A;  1VQ9 A;  4N4I A;  3OYA A;  2PUK B;  4C8Q F;  4KUD K;  4BDZ A;  4C8Q A;  3TU4 K;  2B8A A;  4LVI A;  2K5F A;  1YHQ T;  3KXT A;  3DB4 A;  2V8J A;  2M9U A;  1WJS A;  4MDX A;  5DM7 R;  3REU A;  3CCS A;  3SWN C;  3JRZ A;  2QQS A;  3A8H B;  3OMC A;  4DPG A;  3QPH A;  1WNL A;  1IRE B;  2BIV A;  1X55 A;  4XEM A;  2RM4 A;  2I4L A;  3TEG A;  3RIR A;  2ART A;  5GAN f;  2RH2 A;  2RHI A;  1YHQ A;  4JLI A;  2BKD N;  3OS0 A;  4A54 A;  2PU9 B;  3PFS A;  1M1G A;  4E7H A;  4M78 C;  4M77 F;  3S3M A;  3HFV A;  3PCO A;  4M77 A;  4ZGE B;  1W2B A;  2ARU A;  2Y4Y A;  3JCM b;  4M7A E;  3LC0 A;  1Q7Y C;  3RKY A;  1B8A A;  3QII A;  3UPU A;  3L2U A;  2ODR D;  4XTW A;  5FRO A;  1VQ8 T;  3HY0 A;  3VKI A;  1VQL A;  5DLQ E;  3HRS A;  3CC4 T;  4D6W A;  2XTI A;  5ELN A;  5CK9 A;  2O4X B;  1N9S A;  1BI2 A;  2R5A A;  3CCU T;  4II1 A;  1VQ8 A;  2IG0 A;  3OD1 A;  2ZT6 A;  3C95 A;  4J6X A;  4M7A F;  1QP3 A;  4PJO G;  4M7A A;  4PJO E;  4M7D C;  1X01 A;  4X9C A;  1D3B B;  4GLK A;  1V29 B;  2EQU A;  3WVD B;  3CCU A;  4L87 A;  4QQD A;  3X25 B;  1HXD A;  1B7Y B;  4LD6 A;  2CS7 A;  3TUP A;  4JS5 A;  3DSQ A;  2V8I A;  4JRQ A;  5J39 A;  4YYE A;  1USY C;  3NTI A;  4C92 C;  2DDZ A;  3CBO A;  3P8H A;  4OP0 A;  2QA4 T;  2CZ1 B;  1I81 A;  3GNG A;  1X75 C;  4E51 A;  3MHX A;  3OA6 A;  3G4S A;  1BYM A;  3M56 A;  3CCL T;  4TVY A;  2BUD A;  2ZXF A;  3L2W A;  3PT9 A;  2NS6 A;  1G3T A;  3HP9 A;  1JBM A;  2KAF A;  1UB4 A;  3P8T A;  3CD6 T;  2LCL A;  2E41 A;  5FU6 C;  2L89 A;  1VQO T;  1YIJ T;  2JN0 A;  3MP8 A;  2QA4 A;  2XID A;  4BY6 C;  1ADJ A;  2R58 A;  4OGC A;  5LJ3 g;  3LLR A;  1JJ2 S;  2LT1 A;  4ZGD B;  4B9W A;  2DJZ A;  4XTX A;  1SES A;  1NYQ A;  5LL6 S;  5CKF A;  3LX7 A;  3QJY A;  3LH0 A;  5GAO p;  5GAM j;  4JS4 A;  4QW2 A;  2RK1 A;  2LC4 A;  3PIP A;  2DAQ A;  4YDQ A;  4XTZ A;  2KVQ G;  4Y28 E;  2PVD B;  1K73 C;  3MEY A;  1KHC A;  4XQ3 A;  4HT8 A;  1BBW A;  2CJ9 A;  2C8M A;  4M75 C;  4E7I A;  1WYD A;  2Q5I A;  4A4G A;  3QO7 A;  1KHI A;  2I4O A;  2VGM A;  4IUV A;  4IUU A;  4BI8 B;  4BE0 A;  4PL6 A;  2AMC A;  4HCB A;  4H2U A;  4ZGJ B;  3HPW A;  2R5M A;  3C12 A;  2CJA A;  5KCO A;  2EJG A;  2JUF A;  3OMG A;  3M4Q A;  2VV5 A;  2LQK A;  1JJC B;  3CPW A;  4XEO A;  5GAO l;  4M78 G;  3MEW A;  3INZ A;  4MML A;  4RG2 A;  3UDC A;  4UP7 A;  3HRK A;  2X4W A;  3NTH A;  2GF7 A;  5GAO m;  3CCV T;  2YLB A;  4HKE A;  3CCR T;  3OY9 A;  1VIE A;  1G3Y A;  2ALY B;  1IL2 A;  3FC3 A;  5GAN 5;  5LJ3 d;  3VQW A;  1BIA A;  4RKU E;  3A7U A;  2PME A;  1YFT A;  4C0G A;  2QQA A;  3DB3 A;  4QVC A;  2JTF A;  5GAO n;  3OYJ A;  1UGP B;  3VUZ A;  2KK4 A;  2ZPI B;  2DKG A;  4X34 A;  2XD0 A;  3VBB A;  2DD5 A;  1YB3 A;  4YRF A;  4C0D B;  2X4J A;  3CCR A;  3QJ6 A;  3P8Y A;  5J26 A;  2ZT7 A;  1K9M C;  3TEE A;  2WSF E;  1NE8 A;  4HVC A;  1NJ1 A;  3MP1 A;  3URG A;  3QSU A;  1ASZ A;  3CC2 T;  3BJU A;  2EJF A;  4P72 A;  4YCV A;  2QI2 A;  3HTZ A;  2DXT A;  3E9H A;  2PQW A;  1SRY A;  2ZPF B;  2HAX A;  2Q5H A;  1NPP A;  1LJO A;  2RJD A;  3L4G B;  4F7U B;  2MWO A;  2RHQ A;  3M59 A;  1KD1 C;  3KBG A;  4YRP A;  3CC2 A;  2HQX A;  4XU0 A;  1VQP T;  2M16 A;  5HK3 A;  3ZBD A;  3OYN A;  3LYI A;  5D6W A;  4YCW A;  3JB9 H;  5M9O A;  2EQM A;  4YPF A;  2CZ0 B;  1H4S A;  4YRN A;  4WF2 A;  1M1K U;  2JTM A;  2QHS A;  3E9F A;  2KY9 A;  5GAN 6;  4H02 A;  5GAN 4;  5EG2 A;  1QVG A;  5I2S A;  4FSX A;  1YJN T;  5C6S A;  2ZTG A;  1NZ9 A;  2E1H A;  1WU7 A;  1VQK T;  2JZ2 A;  3JCM Q;  5A0L A;  4CH5 A;  4QQG A;  1EIY B;  3HXY A;  4C0D C;  4ZTJ A;  4XTY A;  3VV0 A;  3X20 B;  1WQ7 A;  5IN1 A;  3SDZ A;  2PUO B;  1YJN A;  3VUB A;  4H2T A;  3M57 A;  1NJ2 A;  3JCM f;  4YRR A;  2DIG A;  3ICA A;  3JCM X;  2C7I A;  4FM4 B;  2A3L A;  5GAN e;  3A32 A;  2XHC A;  3BDL A;  2X4X A;  2HD0 A;  3CCE A;  3TEH B;  4Z02 A;  3QDR B;  3I56 T;  3QXE B;  3OYI A;  2EKO A;  2GFU A;  4UP8 A;  3A8O B;  4N0A C;  5A0D A;  1UGR B;  5KCH A;  4FL6 A;  3UGT A;  5KH6 A;  5LJ5 f;  4N4H A;  2E12 A;  1G5V A;  2IY5 A;  5GAN 3;  2FL7 A;  1D3B A;  5GAN 7;  3JB9 D;  3RER A;  5A2Q E;  4OMF B;  2RHS A;  3VQV A;  3CCM T;  3OYF A;  1LYL A;  4EX5 A;  4Q15 A;  4TQF A;  4J83 A;  3A5Z A;  2RI5 A;  3VQY A;  5HKC A;  3QO3 A;  1K8A U;  2ZZD A;  3VQX A;  1YBY A;  3QYH B;  4NL2 A;  5LJ3 j;  4OB1 B;  2QHV A;  2JOY A;  5GAM d;  1G51 A;  2EQJ A;  1X2G A;  4MMK A;  4BE2 A;  2AKW A;  4P75 C;  3A7A A;  1BI1 A;  5C0M A;  2RB6 A;  2PMF A;  2K3X A;  2HQE A;  5DY9 A;  4Y91 A;  2DTH A;  2AHJ B;  4X5O A;  4M7D B;  3V7C A;  4YCU A;  3JB9 G;  5K1P A;  4OF1 A;  1KC8 U;  4IUR A;  2M0O A;  4JRI A;  3AHU A;  4RQE A;  3MF2 A;  3LGF A;  4OGE A;  5GMK i;  3F70 A;  5C52 B;  1BI3 A;  3RKX A;  4QVZ A;  2OAU A;  3JCM h;  4C92 B;  4BE1 A;  4BDY A;  3M4Y A;  1VUB A;  4PG3 A;  4UP9 A;  3M9Q A;  4EPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...