4XTXA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 57 with azide in place of ribose 2'oh
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
b'VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtxA01
5LJ5e 5GMKm 4N0AC 5LJ5g 5GAN5 1USYA 3JB9I 5GANe 4RQFA 5GANg 4M7DA 4YRRA 4LNSA 1BBWA 4C92C 3V8JA 1NJ8A 4EMKA 4WJ4A 4M7DD 2ZIOA 2QHSA 2XGTA 2RB6A 4XTVA 5LJ5f 3SB2A 3NETA 5LJ3e 1M5Q1 4PHCA 5LJ3g 5GANf 4M77D 3L2ZA 4JUVA 4P75A 3REXA 3RACA 1KQ1A 5LJ5h 4H2VA 3PZCA 3JCMJ 4UPAA 5GANh 3RIRA 5I21A 2ZINA 1ATIA 2P5IA 4PJOE 3I7FA 1GGMA 4N0AA 1LYLA 2CJ9A 5ELNA 3A31A 1EIYB 1EVLA 4H2TA 4DQ2A 4XU1A 2EAYA 4C92A 3IKMB 2EWNA 5LJ3h 3V7CA 2QHTA 4YRLA 1JJCB 1SESA 2DTIA 1WYDA 3A5YA 5GAMj 3M4PA 3RL6A 1WLEA 4PJOB 2CJBA 5GMKj 2DJZA 4QVCA 5GAN2 4CH5A 2DXUA 1KMMA 5KNNA 4TVWA 2EJ9A 3JB9J 2ZIMA 4F7UE 3PCOA 2YLCA 4HT8A 2EJFA 2C7IA 5GAOm 1PYSB 4UP7A 4A54A 3AHUA 4YREA 2ZNJA 3OD1A 4X5OA 2ZTGA 5GAMe 3QSUA 5GAMg 2CGHA 1ASYA 4M7AE 5GAOn 2DVEA 4F7UB 4KR3A 4TQDA 4XEMA 3JCMQ 1NJ6A 4YROA 3V8KA 4OP0A 4X9CA 3ERRA 2ODRC 1RIQA 1NJ1A 3VU3C 5GAN4 1HTTA 1WNLA 2DEQA 2FYKA 3DSQA 2PMFA 3HXXA 5GAMf 3HY1A 4UP9A 3EFSA 5K1XA 2DTHA 4PJOC 2DKGA 3QHSA 2VXEA 4WI1A 1YGBA 5GAMh 4M7AB 2AKWB 3QO7A 4YRFA 4EMHA 4Q6GA 2E3CA 3HXUA 1E1TA 1NYQA 4P74C 4M7DF 4XTXA 1H4SA 4YRJA 1HK9A 4YCWA 1WQ7A 1ASZA 1B34B 3VQXA 1NYRA 3QUIA 4XU0A 4M75E 4C92G 3GIBA 3QO8A 1EIYA 4XTUA 4XTZA 3JCMe 3BFMA 2DXTA 1KOGA 3JCMg 4KR2A 3A5ZA 2FB7A 5LJ3j 1JJCA 1WU7A 3HSBA 1G5HA 3HRIA 2Y90A 1NJ5A 1QE0A 4G84A 1NNHA 1Y96B 3VQYA 3NELA 1B8AA 4YRMA 4H2UA 2Q7HA 4M75B 1YFRA 4P74A 4YRCA 3V7RA 4J6WA 1FYFA 3RGLA 3JCMh 3BJUA 4HWSA 1X54A 1D3BB 3M4GA 5DY9A 5C52B 5LJ5d 4C92F 3SWNB 3CMQA 4XQ3A 4M7AC 1ADYA 1PYSA 1I5LA 3RKXA 4YCVA 4M78E 4HT9A 1HC7A 2DQ3A 2ZT8A 3TEHB 3JB9G 1EVKA 1YFSA 2VXFA 4X9DA 3MEYA 2RM4A 3ICAA 3HRKA 3JB9H 4NOYA 1I81A 4YCUA 2DQ0A 2RA2A 4F7UA 2ARSA 3RKWA 2CJAA 1U1SA 5LJ3f 3L1AA 1Z7MA 2IY5B 3E9HA 1LNXA 4HA8A 4C8QE 5GMKi 4M78B 4P72C 2E41A 1N9WA 2E5AA 4WJ3M 3G1ZA 4ZTUB 4C92D 4DPGA 1X56A 4M7AA 2HNIA 2AKWA 1B70B 4M75C 3HTZA 3JB9F 4PG3A 1I8FA 4K88A 2PMEA 4M7DE 3SWNC 1ADJA 1B34A 4C8QB 2Q5IA 2XTIA 3JCMb 4V2SA 1QF6A 1IL2A 4P73C 4HVCA 4YRKA 1WQWA 4M77E 4L87A 3UGTA 5GMKl 1W66A 4HWRA 1X2HA 4PJOG 3BW1A 4P72A 5E3IA 2J3MA 3L4GB 2ARUA 4UP8A 1JRIA 1BBUA 1N9SA 4JRIA 1Y96A 4BW9A 3JCMX 3RUXA 4KQEA 2DDZA 4M75A 3RKYA 5GAN6 1MGQA 4RCBA 3JB9D 3W3SA 4M78C 4HWTA 4EX5A 4M77B 1D3BA 4NCXA 3HFOA 3SWNA 4CS3A 5C53B 1KMNA 1L0WA 2AMCB 3QNEA 4P73A 3TEHA 3UH0A 1Z7NA 3NEMA 4YDQA 4PJOF 4F7UG 5GAN3 5GAOp 2DU5A 4C8QC 3A7UA 1J5WA 2ZT6A 4RQEA 4TVAB 4YRPA 1KQ2A 1HXDA 3TEGA 2ZT7A 2ARTA 2IY5A 3V7SA 1N9RA 4H2SA 4E51A 3HFZB 4M78A 1X2GA 2ZGWA 3RERA 4M7AG 2RHQB 3QO5A 4Y91A 1H641 1B70A 5HGQA 2ODRD 4YRSA 4EMKC 2G4CA 2E10A 4PJOA 1SERA 4TQFA 5K1PA 3JCMf 4F7UF 3BDUA 4M77C 2DU7A 3HXZA 3WQZA 3FB9A 3A32A 4PJOD 4TWAA 11ASA 4H2YA 4C8QA 3JCMP 1EQRA 5GAOq 4AH6A 1LJOA 4RCCA 5GAOl 4G85A 3HXYA 1EOVA 2J3LA 3VQVA 4YRGA 3FJPA 5GANd 12ASA 1I4K1 1M8VA 2ZT5A 3PGGA 2JN0A 4J5YA 3INZA 4M7AF 3IKLA 3VQWA 2I2LA 3HXVA 4CS2A 3L4GA 4JLIA 4P71C 4Q15A 4M75G 4H2WA 4BWAA 3IG2A 4CH3A 2ZNIA 1H4QA 5LJ3d 4ZIBA 3MF1A 2YLBA 2K57A 5F5WA 5GAN7 4M77A 4K87A 4CH4A 3A7AA 1BIBA 3A7RA 3TUPA 3HXWA 1YCYA 1YB3A 2QHVA 3P8VA 3BY7A 3JCMc 2AMCA 3P8TA 3JCMW 1B7YB 4EMGA 2ALYB 4O2DA 4HWOA 2ZZGA 4M7AD 2E65A 1H4TA 1YFTA 3QO3A 4M75F 4P71A 3HFVA 3NENA 4TVAA 3E9IA 1H4VB 2EJGA 1E24A 4P3OA 5GAOr 4M78G 1SRYA 4H2XB 4YRTA 1U1TA 3M4QA 4NL3A 3HFZA 3REUA 2RHSB 3KFUA 3JCMV 3EFRA 2RHQA 1B76A 4XU2A 2QTXA 3LSSA 4HWPA 4XTYA 4YP0A 2Q7GA 1X55A 1C0AA 3V8LA 4M7DB 1NJ2A 2QHUA 4ZTZB 4C8QG 1VQZA 2EL9A 4EMKB 1E1OA 1WPYA 3P8YA 3QTCA 2VC8A 4QVDA 2YHTA 5GAMd 3HY0A 4M75D 1LOJA 3UFGA 4YRIA 3IALA 4M78F 4MMKA 4PNOA 1E22A 4C92E 2ZZFA 4K86A 3R07A 4P3PA 2I4MA 3LSQA 4TVYA 4YRQA 4M7DG 2E64A 4NL2A 5GMKe 3RF1A 2ZR2A 5ELOA 5GAN8 2RD1A 2I4OA 1TH7A 4RMFA 3A74A 1JBMA 4TTVA 4M77G 3HFNA 4C8QF 3RESA 2I4LA 3VBBA 2ZXFA 4C92B 2Q5HA 2CIMA 2ZCEA 2E1HA 4XEOA 1USYC 4J6YA 3FIFA 2DZ9A 4A53A 1BIAA 2DTOA 4CS4A 4XTWA 5LJ5j 4M7DC 5C51B 4M78D 5GMKh 2ZZEA 1G51A 3JCMd 4WF2A 5GANj 1B7YA 4YRNA 1X01A 2ALYA 3UGQA 4YYEA 5CAIA 3PCOB 3MF2A 2Q7EA 4MMLA 4CH6A 4J15A 4RDXA 4H02A 4EO4A 2I4NA 4M77F 2P0LA 1EFWA 4P75C 4H2XA 2C8MA 1SETA 4OLFA 4C8QD 2DZCA 2RHSA 4YPFA 3LC0A 4XU3A 4J6XA 1G5IA 4P3NA 2ZR3A 4JRKA
chains in the Genus database with same CATH superfamily
3I5RA 1OYXA 2VGMA 2M9UA 4QQGA 5LJ5g 2FZCB 1WLPB 1RAGB 3PNWC 2XIDA 4LNSA 4DBHA 3V8JA 2RQUA 1OPLA 4BE2A 3JV3A 3OW2S 3CCJQ 2AKLA 3SB2A 3OYBA 1VQ8A 4FSXA 5LJ3e 1M5Q1 1WA7A 1UJYA 3L2ZA 1KQ1A 1E6GA 4ME7A 2L89A 1BBZA 3GNGA 4KUIA 1ATIA 1K73C 2JJ9A 2P5IA 3I7FA 2RJCA 4ZGEB 5ELNA 3A31A 2JOYA 2YRCA 1YCSB 2OTLQ 3CBMA 4F14A 4Z02A 5CVIA 4IIOA 2EWNA 2DE0X 1IZ6A 2LTOA 1JJCB 1GRIA 2E3IA 3CPFA 4E47A 1I0CA 1VYUA 5GAMj 2P0QA 3M4PA 4LD6A 3RL6A 2X3WD 4PJOB 1QW1A 4DBFA 1M9SA 1UG1A 2DXUA 1K9MU 1M1KR 4TVWA 3FLGA 3CPWP 2YUQA 2HEQA 4PJJA 2YLCA 3S3MA 1KC8R 4GLMA 4P5NA 5L8RE 4OB1B 2P0KA 5J26A 5GAOm 1UUEA 4A54A 3AHUA 3UPUA 1KD1U 2A28A 3CCST 3QSUA 3G71Q 1BB9A 1QQJA 1O9SA 2RHXA 3X26B 5GAOn 3DLLA 5C6SA 3OYDA 4TQDA 1YJNQ 3CC7T 1B7TA 1GFCA 3CCVT 3ERRA 1NJ1A 3CCMT 1SKUB 3M59A 3EG3A 1W70A 3EGXB 4UP9A 3P8BB 3RDVA 4PJOC 4RTVA 3H6ZA 1WDXA 4M7AB 2AKWB 1ZUUA 4EMHA 1VQ4T 5KE2A 1E1TA 1ZSGA 4P74C 4AFZC 5FRMA 1WI7A 5M9OA 2KNBB 1MV3A 4XTXA 4YRJA 1KG1A 3CCEA 1B07A 1B34B 3GIBA 4XTZA 2DXTA 3BFMA 4C0GA 2O2OA 3VS0A 1TSFA 3CPWA 3DB4A 1JJCA 1VQ9Q 2HL5C 2HL3A 3HRIA 3URGA 1CKAA 3OB9A 1NJ5A 1MNDA 1WX6A 2LCSA 4YRMA 2H3JA 1LPLA 1KSWA 3CCJT 5IXFA 1EZZB 1SRMA 3NTIA 4P74A 3VS4A 3OYFA 3RGLA 4HWSA 3KFVA 3MO8A 5LJ5d 2FVUA 4OB3B 2RI2A 3CMQA 2V8JA 4M7AC 5LL6S 2CZ0B 2ED1A 4YCVA 3CPWS 4M78E 4HT9A 2DQ3A 1XTDA 1EVKA 1OOTA 4A4GA 2EQIA 5EG2A 3MEYA 3ICAA 3KXTA 2XU8A 2EQJA 2OTLT 1A0NB 2CZ6B 4F16A 1K1ZA 1RUWA 2KRSA 3A8HB 3L1AA 2X4XA 2IY5B 3E9HA 1T3LA 4HA8A 4DA4A 5GMKi 1G3WA 3EGXA 2O31A 2E5AA 4FM4B 4WJ3M 4ZTUB 1RACB 1MMAA 1X56A 4M7AA 2AKWA 3CCQA 3CC4Q 2K9GA 1S1NA 4FYYB 1RLQC 3QZ9B 4GBQA 2AK5A 3CMEQ 1B34A 1JB0E 4KGZB 4C8QB 4CI0C 3OYGA 3JCMb 3MP1A 1IL2A 3OQ5A 4HVCA 1IB8A 4M77E 3FC3A 3N5BB 2K3BA 1Q7YR 1YJNT 2JXBA 4F17A 3EG1A 5E3IA 1KD1C 2KAFA 1YIJA 1WFWA 3OYEA 1UDLA 4KH0B 4N4IA 3JCMX 3EG9B 2WSFE 1VQPQ 1J3TA 1PKTA 2RQTA 2K6DA 2JW4A 2RMOA 3UA7A 2P0PA 3OY9A 4LVKA 2D1XA 5C53B 2CT3A 2EYWA 4HCZA 2AMCB 3OMCA 2RK2A 1YITA 1WIEA 2AHJB 1Z7NA 2WSCE 3VS1A 5EC7A 2G6FX 4BB7A 4C8QC 3MQZA 3A7UA 2ZT6A 1VA7A 2JMAA 3M56A 2KR3A 4OMNA 3UATA 2JNGA 4YRPA 1VQ9T 3REBB 3TEGA 1HXDA 1G3TA 4HCCA 2IY5A 3V7SA 1N9RA 2DPPB 2DL5A 3P8HA 3CCRQ 1GFDA 3QO5A 1H641 1TTHB 4RTYA 2GQIA 2LNVA 2O88A 1PD1A 2EPDA 4J7IA 4F7UF 3BDUA 3HXZA 1LCKA 4J9GA 2HCKA 2A36A 4PJOD 4TWAA 4IUUA 2XKOC 4C8QA 2E12A 1F1BB 1Z9ZA 4AH6A 2ABLA 3HP9A 1IHWA 8ATCB 3H8ZA 12ASA 2XI9A 4HCBA 3PGGA 2K2MA 2JN0A 2L8DA 3GNFB 1Y7XA 1SF9A 3HRTA 4Z8AA 3L2RA 3INZA 3OBYA 4CS2A 2XDDA 3PMIA 4RTXA 4DEYA 3G7ZA 1GBQA 4FYVB 3A8LB 4M75G 4BWAA 3EG9A 4CH3A 2JTFA 2GCXA 5KE3A 2E4HA 5LJ3d 3R6OA 1NE8A 1IRXA 2K57A 1AWWA 3JSCA 1PM3A 4CH4A 3CC4T 3X20B 1BIBA 2LRQA 3UT1A 3A7RA 3OYHA 3TUPA 1NBEB 2QDYB 2XK0A 2QYZA 4ATOA 2AMCA 2NUZA 2YDLA 2F5TX 3CMET 3GF5A 3P8TA 2FRYA 3G6EA 1YJWT 1NG2A 2HKQB 4EMGA 2OAWA 4ELYC 4M7AD 2K5LA 3AT1B 2P4RA 1OU9A 2DK3A 1H4VB 2D8HA 4AMCA 2KMTA 2D0QB 4H2XB 2MYSA 1HYOA 4FYXB 1U1TA 3M4QA 4ELZC 4NL3A 2PVOB 3REUA 3KFUA 2BTTA 3H41A 3CCSA 1VQPT 2QTXA 1UGVA 3LSSA 1MHNA 1BKBA 1UHFA 4HWPA 2PVDB 4C0FA 2GGRA 3OSVA 2CP2A 4R0KA 2QQBA 3JRZA 4AG2C 9ATCB 2KY9A 1WPYA 1M27C 3QTCA 4QVDA 3HY0A 3FDRA 4LDUA 3NMZC 4J7FA 5CO7A 5IN1A 1D1BA 2ZAEA 4RTZA 4II1A 1AEYA 3ULRB 1V76A 1UECA 3EGDB 4NL2A 2SRCA 3MHXA 1TH7A 5GJVB 3M55A 4JZ4A 3QDFA 3VBBA 4N4HA 2CT4A 5D6XA 5D6YA 2LQ8A 2O4XB 5C0MA 4Z89A 3M0RA 2EVRA 1QWEA 3C95A 4XEOA 4EIKA 1USYC 2DEUA 1RAFB 2HBPA 4XTWA 2IPOB 3PTAA 3L42A 5C51B 1ABOA 1AVZC 3QYGB 3QDRB 4JS5A 4WF2A 1YP5A 2VWFA 1ZBXA 1X01A 1G51A 1UB4A 4YRNA 2HBWA 3CCJA 3UGQA 3RNJA 1O75A 1YHQA 1K8AU 2A37A 3NTKA 1ZQ1A 2GBQA 3VS2A 4C5EA 3PCOB 2VB6A 4EDUA 1OX9A 4EO4A 2KT8A 4NS5A 4P75C 5CK9A 4LN2A 4M4ZA 4H2XA 4OLFA 4C8QD 2EYZA 3MEVA 2RQVA 1WHLA 5IH2A 2DLPA 5LJ5e 2OTLA 4N0AC 1USYA 3VS5A 3J81E 1UFFA 2HDAA 5GANg 1BBWA 3LLRA 2RI3A 2GF7A 1K0XA 2QGGA 3HL8A 4FW1A 1NJ8A 1BI3A 1VQMT 4WJ4A 2ZIOA 1LVKA 1ZBJA 3LH0A 4PKCC 2XGTA 4OB2B 4XTVA 5LJ5f 5ECAA 3NETA 1IHVA 3MJXA 4KT0E 2J7IA 4JUVA 2V1RA 4P75A 3RACA 1VQ7A 2JS0A 1WXUA 4BY6B 3PZCA 4L6V5 4UPAA 1WXBA 2EQUA 3EGDA 3RIRA 2NUTB 2ZINA 4LVLA 2RHIA 2KYBA 3RBBB 3CCUQ 1GGMA 1Y71A 4N0AA 5KYUB 1YJ9Q 1LYLA 2KYMA 3M54A 2ROTA 4HT4A 8AT1B 3A8GB 3M53A 4XU1A 2FRWA 3G71A 2LVMA 3IKMB 2O4XA 5LJ3h 3VUZA 1PKSA 1YJNA 1V1CA 3UWNA 1EX4A 3TEEA 2X4JA 1X6BA 2CJBA 2HQHA 4QVCA 1HSQA 1DJ7B 2M0YA 2ATCB 2RJDA 3TU4K 3JB9J 1VQOA 2ZIMA 3PCOA 1UTIA 3F70A 2IG0A 4HT8A 2RJFA 2C7IA 1K9MR 1PYSB 4BY6C 4UP7A 1ABQA 2A08A 2PU9B 4JJCA 2XHCA 3OD1A 4X5OA 2ZTGA 5GAMg 2CGHA 3QXEB 2L3SA 1VQ6Q 1ASYA 1KD1R 4F7UB 4XEMA 1H3HA 3V8KA 1VQ9A 1ARKA 5A0LA 5D7UA 1RIQA 3NPFA 1WNLA 2DEQA 2PUKB 2CKKA 1QCFA 2B86A 3CC7Q 2DTHA 4KULA 3QHSA 2VXEA 3L2UA 4Q6GA 3QG1A 2E3CA 1SPKA 3CCMQ 1ACMB 2KBTA 2VV5A 4X34A 4DEXA 2NUTA 1H4SA 1W6XA 5HCKA 1HK9A 6AT1B 2DMOA 2FPDA 3OW2A 5KYUA 4D6WA 1RADB 1K8AC 1QP2A 2D6FA 1K0SA 2PUOB 2AIRB 4M75E 3QO8A 1KOGA 3JCMg 1Y0MA 3MEAA 4KR2A 3DLMA 4XK8E 2HQXA 4MDXA 1QVPA 3PFSA 3HSBA 3X24B 4QQ6A 4G84A 1Y96B 1PRMC 2EGAA 2LT4A 5FW9A 4B9WA 5CIUA 4C5HA 3I56A 1Q86U 1B8AA 3NELA 2Q7HA 2K5FA 1YFRA 5I2MA 3G4SQ 2J6OA 3MP8A 1ZUKA 1FYFA 3BJUA 1X54A 5C52B 3JAME 3CC4A 2LJ3A 4C92F 3SWNB 1K9AA 4XQ3A 5KYXB 1WGSA 1PYSA 4J9HA 1I5LA 1VQKA 3CCUT 4LDYA 3TEHB 2ZT8A 3CMEA 1VQ5Q 2VKNA 1YJ9T 4X9DA 2RM4A 4YCUA 3UA6A 1XNIA 2RA2A 2MI6A 4F7UA 2ARSA 1NZ9A 1TXQA 2K79A 4CRIA 1U1SA 5A0DA 5LJ3f 4OMLA 2GQVA 1E6HA 1C0MA 1T0HA 1LNXA 2DO3A 4E7LA 2QQRA 4BI4A 2KEAA 4AFSC 1FXXA 1VQPA 1VQLQ 2LC4A 4DPGA 2J06A 4RUGA 2HNIA 5CQYA 3T9NA 1UGRB 4BE0A 3JB9F 2HQEA 2L5QA 4FT4A 4AT1B 1I8FA 1X69A 2CP0A 3SEMA 3EHRA 3SWNC 1ADJA 2ZPFB 2Q5IA 4J83A 2XTIA 3ZBDA 4V2SA 1QF6A 5HK0A 3MPUB 5FWBA 3OYMA 3X25B 1VQ6T 1WQWA 1G83A 4E7KA 1FMKA 4CC7A 3UGTA 5GMKl 1W66A 4HWRA 4PJOG 1W2BP 2LQWA 1PSEA 3L4GB 2COZA 2DL8A 2IIMA 1BBUA 4JRIA 2KE9A 3WVEB 1Y96A 3TQ7P 4E2FB 4BW9A 3CMAQ 2AKKA 2DDZA 2XDPA 3RKYA 3CCRA 2O9SA 2PZ1A 4EX5A 1ZA1B 2DAQA 3R6NA 4AFQC 1QCOA 1R0CB 4NCXA 3HFOA 3SWNA 4CS3A 4PLIA 5KYXA 1UGQB 1NEBA 1PNJA 3TEHA 4YDQA 1PCXA 3CC2T 3WVDB 5GAOp 1JJ2P 5HK3A 1XOVA 1R8OB 2KDSA 4RQEA 3META 1M4ZA 4TVAB 3A8OB 1KQ2A 1AWJA 2ZT7A 3E9FA 4RG8A 2DM1A 3HFZB 1X2GA 4QVZA 2ZGWA 5IHKA 3EH1A 4M7AG 2HMAA 3OS2A 3GP8A 4QKUA 3G4ST 1IGQA 3NTHA 4A4KA 4OMQA 1D09B 4RTTA 4EMKC 2G4CA 4PJOA 5KCHA 4TQFA 1RI0A 1W2BA 3OMGA 1G2BA 2DU7A 4O6JA 5IT9E 3FB9A 2OTJA 2CYZB 4CC4B 3JCMP 4RCCA 4G85A 1VQ5T 1EOVA 2M0OA 2J3LA 3CD6T 3VQVA 2YUPA 2JVVA 4FSSA 3SFMA 4BDZA 2K4YA 1KFZA 2ZT5A 4IURA 3OS1A 1X75C 3QPHA 4QT7A 2I2LA 3HXVA 1NLPC 3L4GA 1N27A 2ZPIB 4H2WA 1TS9A 3SDZA 4HVWA 3MF1A 1VQLT 1W2BS 2DNUA 1XJWB 2ROLA 3FRNA 3HXWA 4OVAA 1YB3A 2O01E 2LQKA 2GTJA 7AT1B 2MOXA 3HHTB 1KQSP 4O2DA 3SHWA 2ZZGA 1YFTA 1M3BA 4BI3A 2EW3A 1RLPC 1M1FA 3OYLA 3E9IA 3NENA 4TVAA 1K9MC 2JS2A 2X4WA 1YJWQ 3D7SB 3HFZA 3PT9A 1NJIU 5FU6B 4BD3A 3CMAT 3LX7A 4XU2A 1ZSZB 3HRSA 4OMFB 3OYYA 1SHGA 5KYYB 4IUQA 1X55A 3V8LA 2BZYA 4C8QG 3L2QA 1VYTA 4E7HA 5AT1B 3P8YA 5CKBA 2JZ2A 3ER0A 3IALA 4M78F 4MMKA 4PNOA 4LD9K 2DA9A 3R07A 3VKIA 2V8IA 1N8RU 4P3PA 3VYGA 1YI2A 2JM8A 2DYBA 3LWIA 3M0PA 4YRQA 2EIFA 2ZR2A 1EIFA 1BCOA 1JBMA 1H3ZA 3J80E 4KGVB 2ZXFA 4C92B 3H0IA 5FU6C 3TSZA 3A8MB 1NEGA 1PHTA 2Q5HA 2LCLA 1ZSZC 3M0TA 1OEBA 1WZOA 2DERA 1KJWA 4J6YA 2CZ7B 3FIFA 1BIAA 1SHFA 1AOJA 2CS7A 2GFAA 2ZZEA 4PJNA 1PG5B 4PJLA 1PSFA 2PVGB 2D9TA 1JXMA 1TWBA 3QJYA 4J9IA 3VUBA 3J7AF 2I4NA 4M77F 1OZ2A 1EFWA 1K8AR 3VV0A 1E7OA 4A63B 4DBRA 2DZCA 4AFUC 3CCUA 2FL7A 1U5SA 1RL2A 4JJDA 1S72T 3I9QA 1YJ9A 5CKEA 4JRKA 2EFIA 4ZNXA 1ZSZA 4LVMA 5GMKm 4A4FA 5GAN5 2BZ8A 3A98A 5KYYA 3JB9I 5GANe 4RQFA 4YRRA 4C92C 4E6RA 2OAUA 2BKDN 4M7DD 2QHSA 3E19A 1KIKA 2VGNA 1X2KA 1VUBA 2RB6A 2W0ZA 5KCOA 3CCLQ 2QTVA 3DKMA 5GANf 4ZTFA 1VQMQ 5LJ5h 3TREA 4H2VA 4XAXB 3JCMJ 1WXTA 1GBRA 4R55A 4BE1A 2A8EA 1M90U 4Q5WA 4PJOE 4E7IA 2CJ9A 1Q95G 2QQAA 3LGLA 4MZPA 1R77A 4JPBW 3BDLA 4C92A 3OYKA 2CREA 4YRLA 2DTIA 1AZEA 3A5YA 1NJIC 2CP7A 2HKNA 1WLEA 2YUOA 3QIIA 5GMKj 5GAN2 4LUEA 1AWXA 1G5VA 3CC7A 2EJ9A 5HKCA 3CCVA 2CUBA 2ENMA 2EJFA 4UC4A 3CCMA 2RPNA 2DILA 2RNAA 3PE0A 1WHGA 2KQWA 1BK2A 2KRNA 1VQNQ 4GY5A 3MKDA 5IHNA 2ZNJA 1VQ4A 4DOVA 4J9BA 5GAMe 2QDLA 1OULA 1N8RC 4M7AE 1D0XA 3JCMQ 2RH2A 2LT1A 4YROA 3OYNA 3CCQQ 1FYNA 3C12A 2MPXC 4X9CA 2ODRC 4EPCA 5GAN4 2KROA 3HXXA 5GAMf 4FL6A 2LJ1A 3VJPA 5K1XA 3EFSA 3U23A 2D8JA 3MEWA 2KXDA 2DKGA 4LVJA 3QO7A 5KYWB 1YBYA 3I55Q 1UJ0A 3HXUA 3ZFJA 1RAHB 1QCNA 5AYFA 1PD0A 2QQSA 5FWCA 2EYXA 1QVGP 4M7DF 4YCWA 1WQ7A 1ASZA 4ZGDB 2OX7A 4JJNK 3VQXA 1YIJQ 2E6ZA 3QUIA 1VQ5A 2CZ1B 3JCMe 3O8VA 2CP3A 3FEOA 4FCYA 2AT1B 1BI2A 2FB7A 2CP5A 1WU7A 3DB3A 5D6WA 5J39A 2Y90A 1QE0A 2FZGB 2O9VA 3VQYA 2HSEB 2X3XD 2GTOA 5CR2A 1VIFA 4J6WA 1T3SA 3C4SA 4RTUA 3CCLT 3I5SA 1BYMA 1FMWA 1Q86R 2OI3A 1X2QA 2XD0A 2RI5A 3C94A 1ADYA 3H9NA 1NYFA 2M16A 3UDCA 2ZPHB 4RG2A 3RKXA 5IAYA 2JMCA 4PJMA 2VXFA 1W4SA 2FO0A 3PVLA 3CXCP 5FRNA 2DFUA 2DBMA 2MF2A 3NFCA 2MIOA 1KHIA 3L2VA 2RF0A 2JTEA 2CJAA 2X35A 1OU8A 2EYYA 2Z0WA 4FW2A 4C8QE 2P84A 2L3RA 4M78B 1AD5A 2V8KA 4P72C 2E41A 1N9WA 1EFNA 2R57A 4C92D 5KYNA 2QEXQ 2KI7A 5KYWA 2DIQA 4Y28E 1K73U 4PG3A 2E5KA 2PMEA 2PQWA 2F69A 2MK5A 4B6MA 2E3HA 1SG5A 1VQNT 5HY6A 3M0QA 1SEMA 4P73C 2QK0A 1GCPA 3HPWA 2EKOA 4L87A 4FIBA 2SEMA 1MUZA 1X2HA 3BW1A 4KRTA 4P72A 3CCQT 2J3MA 4UP8A 1JRIA 2DD5A 2DF6A 2DL4A 3UF4A 3RUXA 1JEGA 3LYIA 4OF1A 2HSPA 2F2WA 4LDWA 5GAN6 3CXCA 3JB9D 2VVKA 4M78C 4HWTA 3G6EQ 4M77B 1U8RA 3I55T 1HD3A 1KMNA 2M51A 1L0WA 1MV0B 2RHYA 2YXYA 4IUPA 4ZN1A 3QNEA 4P73A 4J9EA 3UH0A 3NEMA 4BUGA 1YIJT 4F7UG 5GAN3 3OYAA 2YSQA 4JJBA 1J5WA 2DBKA 1RABB 1IREB 2DD4A 1TUGB 1TG0A 2J05A 3CXCS 3CC2Q 2ARTA 2FEIA 1YFNA 2RQRA 4WCIA 1QWFA 4M78A 1WHMA 3QJ6A 2RHQB 4C0DB 1C6VX 3S6WA 5I11A 4HVVA 1D0YA 4JZ3A 3VS7A 2ODRD 3SD4A 4YRSA 1SERA 2E10A 4AG1C 4TVRA 5K1PA 4JRPA 1NM7A 4M77C 3GOXA 4H2YA 1EQRA 5GAOq 1LJOA 1MMGA 2DL7A 2AZVA 2ECZA 1P92A 1R0BG 4YRGA 1U06A 5GANd 1I4K1 3MEUA 1M8VA 2WSEE 4J5YA 2DJQA 2NLUA 3OS0A 3THKA 4C0ZA 3IKLA 3VQWA 4JLIA 3VS3A 3CD6Q 4P71C 1YJWA 1JO8A 1ZLMA 2IVWA 1XQHA 4FT2A 2XDBA 3IG2A 3ASKA 3M57A 2ZPEB 4JLGA 4X1VA 2K7AA 2HAXA 5F5WA 2HD0A 4OB0B 4M77A 2QEXT 4K87A 1PRLC 4C0DC 1YHQQ 2VASA 1QVFP 3LH5A 1YCYA 2QHVA 3P8VA 2F1LA 3BY7A 1RAIB 2K5IA 2D0NA 3JCMc 2NWMA 3EHQA 4RMOA 2BUDA 4LXCA 2V1QA 4IKFA 3JCMW 2X51A 2I0NA 2EKHA 3E9GA 5J3BA 2LX7A 2ALYB 2P4TA 2E65A 4IUTA 2X4YA 1H4TA 3M58A 3VS6A 4M75F 3EAEA 3EGUA 4C5GA 4P71A 3LW5E 2R5MA 5I22A 2DXCA 1C1AA 1Q81U 2QAZA 3OYJA 4P3OA 5GAOr 1SRYA 1JXOA 1MMDA 1YN8A 4HVUA 2RHQA 1FX7A 4XTYA 4L5GA 3G6ET 2FPFA 1NJIR 2Q7GA 4YP0A 1C0AA 4M7DB 2QHUA 4ZTZB 1QKXA 4BDYA 1FWZA 2BE7D 3RR6A 1VQ7Q 1VQZA 2LQNA 1I07A 1IXDA 4EMKB 3OYIA 1T0JA 1WJSA 2VC8A 1WHJA 5GAMd 2JM9A 5L23A 4YRIA 4RTWA 1M1GA 2F2XA 3CBPA 1E22A 2ZZFA 4K86A 3CBOA 1OV3A 3LGFA 3TSWA 2I4MA 5IHIA 4ESRA 1QVFA 3HKSA 4M7DG 3OS5A 5GMKe 3RF1A 2OJ2A 5ELOA 3WXMB 1N8RR 2RD1A 4QQDA 4RMFA 2QA4Q 4PL6A 1Q82R 1OQKA 2NUPB 3RESA 2I4LA 3CEYA 4ZGJB 2MWOA 4L59A 3ME9A 2ZCEA 2EBPA 1QLYA 5CKHA 4ZTJA 1VQOQ 1KK7A 2DL3A 4A53A 2HZYA 4M7DC 5LJ5j 4LUDA 4M78D 5FROA 2E5QA 3JCMd 2ALYA 1QVFS 2PNIA 2L2PA 3CCLA 2X9HA 5CAIA 1Q86C 3MF2A 1VQMA 5CQXA 4CH6A 4MMLA 1MNEA 2F2VA 4J15A 4H02A 2BIVA 2VYTA 5A0GA 1OI1A 1PWTA 2RK1A 3QBYA 1BI0A 2Y4XA 4HXJA 1GL5A 3LC0A 4XU3A 1KHCA 1AZGB 2R5AA 2DVJA 3S3NA 2ZR3A 4P3NA 1VIEA 3BE3A 2COYA 4K11A 4M7DA 5I2SA 3REAB 1YHQT 1S72Q 5FLXE 1RAEB 2XICA 4EMKA 5IXBA 1JJ2A 1ZHIA 3FJ5A 2RHUA 1UHCA 2K2VA 2LZ6B 4O5VA 1K4US 1SSFA 4OMPA 3M0SA 4PHCA 3TCJA 5LJ3g 4M77D 3REXA 1VYVA 4JDSA 4OGCA 2L0AA 3VYHB 2RQWA 5GANh 2CH4W 5I21A 4MZMA 1PC0A 3EG0A 1RAAB 1VQNA 1EIYB 2NUPA 1EVLA 4H2TA 2LJ0A 4DQ2A 3I56Q 1N5ZA 1M90R 2EAYA 2ED0A 4R56A 1SSHA 1V29B 2E70A 1Q81C 1JJ2S 3A5ZB 1D0ZA 2DX1A 3V7CA 2QHTA 1SESA 2AZSA 2DYIA 1WYDA 1VQ7T 4KH1B 1M1KU 1OX8A 2CDTA 2DJZA 4CH5A 3PMTA 1VQ8Q 1VQKQ 4C5IA 1KC8U 4J9CA 1KMMA 4PFZA 5KNNA 1JU5C 2GNCA 2RN8A 2VUBA 4HCKA 4F7UE 3I55A 3O5ZA 3G71T 4JS4A 1X27A 3EG2A 3GLXA 2C06A 1Y57A 4YREA 2LP5A 2QA4T 2CP6A 2G3RA 3E1SA 1GCQC 1B3QA 4J9DA 2YRVA 1IGUA 1Z9QA 1Q82U 2FZKB 2DVEA 4KR3A 3GBQA 3I35A 1NJ6A 4F04B 1H8KA 3NHNA 1VQOT 1KQSA 4OP0A 2QG9B 2QQ9A 3QWYA 1WYXA 3VU3C 2WACA 5KH6A 1HTTA 2FYKA 1OPKA 4OMMA 2PMFA 3DSQA 3HY1A 1UE9A 4WI1A 1YGBA 4OGEA 5GAMh 1TUCA 4YRFA 4E7ZA 5DM7R 3QZ5B 1NYQA 2V26A 3OBWA 2LNHB 1GCQA 2J6KA 4J9FA 4PFPA 4A4EA 4DOWA 2Y4YA 1M3AA 1NYRA 4XU0A 4C92G 5CKDA 1EIYA 4XTUA 1M30A 1KQSS 3A5ZA 5LJ3j 3OSSC 1ZUYA 4ORZA 2EYQA 1G5HA 2MWPA 4ZN3A 1NNHA 2C0TA 4H2UA 2H3EB 4M75B 2DXBA 5CKFA 4YRCA 3V7RA 1G3YA 1VOMA 2A0FB 3JCMh 2GFUA 2QEXA 1D3BB 3M4GA 5DY9A 3KUFA 4YTLA 2L3QA 4PLLA 4VUBA 3CCEQ 2DETA 3P8DA 1I1JA 1HC7A 3RMSA 4MZTA 2XMFA 2XG8D 5GJWB 3JB9G 1YFSA 3HTRA 3HRKA 3JB9H 2KVQG 4NOYA 1I81A 3Q1JA 2DQ0A 1ZA2B 3I56T 1K76A 3M9QA 3RKWA 4BACA 1BU1A 3OA6A 1WJRA 1Z7MA 1FMVA 2DIGA 2CUDA 2M02A 1ZX6A 1VQ6A 4LDVA 1VQ8T 2OTJQ 1VQKT 3PIOA 3M4YA 1Y07A 2ZPBB 3G1ZA 1NPPA 1G8XA 2CH4A 2RHZA 1B70B 4M75C 3HTZA 2QI2A 2JTMA 1M1KC 1MMNA 4B9XA 4K88A 1NLOC 3RMQA 4M7DE 1K73R 1W1FA 1KC8C 1UGSB 1M2VB 3OYCA 1Q7YU 1U3OA 4D8DA 2J6FA 1YNZA 4YRKA 3MCAB 4BI8B 1TU0B 3E2UA 2C0IA 2ARUA 4Z88A 1N9SA 3H0HA 3CC2A 4KGXB 4KQEA 2EQMA 4M75A 1Q82C 1QP3A 1MGQA 4RCBA 4Y92A 3W3SA 4KUDK 1D3BA 1WHHA 1M2OA 2KGTA 1X6GA 2M1HA 3C0CA 1AT1B 2MCNA 3G4SA 3EFOB 2KSSA 4PJOF 1BI1A 2K3YA 1BCMA 1TUDA 2DU5A 2LDMA 3VRYA 3KBGA 4MDWA 1TOVA 4GLKA 2R58A 2W10A 3CCRT 2KXCA 3IQLA 4H2SA 4E51A 1IO6A 3CD6A 4D8KA 2KT1A 1WJQA 3RERA 4CC3A 4IUVA 4Y91A 3EH2A 1B70A 5HGQA 2H8HA 4HKEA 2NYSA 3JCMf 4E7JA 3VRZA 3CQTA 4ANJA 1YI2Q 1YITQ 3WQZA 3CCET 3A32A 1VQLA 11ASA 2K3XA 1M2VA 4LDXA 2FHDA 2ZZDA 5GAOl 3HXYA 1QMCA 4J8OA 1M8MA 3MP6A 1N6AA 3FJPA 1NPRA 1D1AA 2E6NA 4M7AF 1X6OA 2EGCA 2C0OA 3ZL7C 3TVTA 1AHJB 4Q15A 3HRUA 4KBMB 2ZNIA 1H4QA 2NS6A 2OTJT 2DRKA 4ZIBA 1QKWA 1M90C 2YLBA 1UGPB 2LX9A 5GAN7 1QVGA 3A7AA 3L2WA 1HJDA 2A3LA 3CMAA 4FU6A 4IIMA 1M3CA 3EFOA 2YUNA 2CSIA 3H0FA 2PTKA 1B7YB 3LWHA 4HWOA 1SRLA 3QO3A 2COWA 3M5AA 2QXFA 3HFVA 4LE9A 2YT6A 3PVQA 1G3SA 2EGEA 1UEBA 2EJGA 1E24A 1YWPA 4M78G 1Q7YC 4YRTA 2QASA 2RJEA 1QVGS 2RHSB 3S3OA 2ESWA 3JCMV 1Q81R 3EFRA 5FU7B 2QA4A 1B76A 1I5OB 2LMJA 4DBQA 4WTOB 3X28B 3OW2P 3QWXX 2DRMA 1OZ3A 2ZCFB 1NJ2A 1NYGA 1AWOA 3G1JA 2FG0A 4LVIA 3A1PA 3GPLA 2YWWA 2EL9A 2QGFB 2L3PA 1E1OA 5DLQE 1WHKA 2MAMA 2YHTA 1YWOA 4M75D 1LOJA 4N4GA 3QYHB 2JUFA 5A2QE 3UFGA 2BE9B 4RKUE 4FYWB 4C92E 2MMPA 2FPEA 2RO0A 3LSQA 1CSKA 2BZXA 4TVYA 2LCCA 4PK4A 5CCAA 2E64A 3ZEHA 5GAN8 1X43A 2I4OA 4QW2A 3PIPA 3CCSQ 3A74A 4TTVA 4M77G 3HFNA 2KRMA 4PFOA 1CKBA 2CSQA 4C8QF 3M0UA 2YRDA 4OMOA 5FU7C 2CIMA 2E1HA 4CC2A 4E7SA 3CCVQ 1S72A 2DZ9A 2DTOA 1YI2T 1YITT 4CS4A 1JQQA 2F5KA 4LNPA 5GMKh 3NGPA 5GANj 1B7YA 2EQKA 3QKJA 1H92A 2JT4A 2ZPGB 1D1CA 1RI9A 4YYEA 1VQ4Q 5DLOA 2Q7EA 4RDXA 1GXIE 2A7YA 2P0LA 2C8MA 1SETA 2KK4A 4A4HA 2RHSA 4YPFA 2B8AA 4J6XA 4JRQA 1G5IA
chains in the Genus database with same CATH topology
1OYXA 2VGMA 2M9UA 4QQGA 5LJ5g 3PNWC 2XIDA 4LNSA 3V8JA 4BE2A 3OW2S 3SB2A 3OYBA 1VQ8A 4FSXA 5LJ3e 1M5Q1 3L2ZA 1KQ1A 4ME7A 2L89A 3GNGA 4KUIA 1ATIA 1K73C 2P5IA 3I7FA 2RJCA 4ZGEB 5ELNA 3A31A 2JOYA 3CBMA 4Z02A 5CVIA 2EWNA 1IZ6A 2LTOA 1JJCB 3CPFA 4E47A 5GAMj 2P0QA 3M4PA 4LD6A 3RL6A 4PJOB 1QW1A 1M9SA 2DXUA 1K9MU 4TVWA 3FLGA 2YLCA 3S3MA 4P5NA 5L8RE 4OB1B 2P0KA 5J26A 5GAOm 4A54A 3AHUA 3UPUA 1KD1U 3CCST 3QSUA 2RHXA 1O9SA 3X26B 5GAOn 3DLLA 5C6SA 3OYDA 4TQDA 3CC7T 3CCVT 3ERRA 1NJ1A 3CCMT 3M59A 4UP9A 3P8BB 4PJOC 3H6ZA 4M7AB 2AKWB 4EMHA 1VQ4T 5KE2A 1E1TA 4P74C 5FRMA 5M9OA 4XTXA 4YRJA 1KG1A 3CCEA 1B34B 3GIBA 4XTZA 2DXTA 3BFMA 4C0GA 3CPWA 3DB4A 1JJCA 3HRIA 3URGA 3OB9A 1NJ5A 4YRMA 2H3JA 3CCJT 3NTIA 4P74A 3OYFA 3RGLA 4HWSA 3MO8A 5LJ5d 2FVUA 4OB3B 2RI2A 3CMQA 2V8JA 4M7AC 5LL6S 2CZ0B 4YCVA 3CPWS 4M78E 4HT9A 2DQ3A 1XTDA 1EVKA 4A4GA 5EG2A 3MEYA 3ICAA 3KXTA 2XU8A 2EQJA 2OTLT 2CZ6B 3A8HB 3L1AA 2X4XA 2IY5B 3E9HA 4HA8A 4DA4A 5GMKi 1G3WA 2E5AA 4FM4B 4WJ3M 4ZTUB 1X56A 4M7AA 2AKWA 3CCQA 3QZ9B 1B34A 1JB0E 4C8QB 4CI0C 3OYGA 3JCMb 3MP1A 1IL2A 3OQ5A 4HVCA 4M77E 3FC3A 3N5BB 1YJNT 5E3IA 1KD1C 2KAFA 1YIJA 3OYEA 4N4IA 3JCMX 2WSFE 2P0PA 3OY9A 4LVKA 5C53B 4HCZA 2AMCB 3OMCA 2RK2A 1YITA 2AHJB 1Z7NA 2WSCE 4BB7A 4C8QC 3MQZA 3A7UA 2ZT6A 3M56A 2JNGA 4YRPA 1VQ9T 3TEGA 1HXDA 1G3TA 4HCCA 2IY5A 3V7SA 1N9RA 2DPPB 3P8HA 3QO5A 1H641 2LNVA 4J7IA 4F7UF 3BDUA 3HXZA 4PJOD 4TWAA 4IUUA 2XKOC 4C8QA 2E12A 4AH6A 3HP9A 3H8ZA 12ASA 2XI9A 4HCBA 3PGGA 2JN0A 2L8DA 3GNFB 1Y7XA 3HRTA 3L2RA 3INZA 3OBYA 4CS2A 2XDDA 3PMIA 3G7ZA 3A8LB 4M75G 4BWAA 4CH3A 2JTFA 2GCXA 5KE3A 5LJ3d 3R6OA 1NE8A 2K57A 3JSCA 4CH4A 3CC4T 3X20B 1BIBA 2LRQA 3UT1A 3A7RA 3OYHA 3TUPA 2QDYB 2XK0A 4ATOA 2AMCA 2F5TX 3CMET 3GF5A 3P8TA 3G6EA 1YJWT 4EMGA 4ELYC 4M7AD 2K5LA 2DK3A 1H4VB 2KMTA 2D0QB 4H2XB 1U1TA 3M4QA 4ELZC 4NL3A 2PVOB 3REUA 3KFUA 3CCSA 1VQPT 2QTXA 3LSSA 1MHNA 1BKBA 4HWPA 2PVDB 4C0FA 3OSVA 2QQBA 3JRZA 2KY9A 1WPYA 3QTCA 4QVDA 3HY0A 3FDRA 4LDUA 4J7FA 5CO7A 5IN1A 4II1A 4NL2A 3MHXA 1TH7A 3M55A 3VBBA 4N4HA 5D6XA 5D6YA 2LQ8A 2O4XB 5C0MA 3C95A 4XEOA 1USYC 2HBPA 4XTWA 3PTAA 3L42A 5C51B 1G51A 3QYGB 3QDRB 4WF2A 4JS5A 4YRNA 1ZBXA 1X01A 1UB4A 3CCJA 3UGQA 1YHQA 1O75A 1K8AU 3NTKA 1ZQ1A 4C5EA 3PCOB 4EDUA 4EO4A 4NS5A 4P75C 5CK9A 4H2XA 4OLFA 4C8QD 3MEVA 5LJ5e 2OTLA 4N0AC 1USYA 3J81E 5GANg 1BBWA 3LLRA 2RI3A 2GF7A 3HL8A 1NJ8A 1BI3A 1VQMT 4WJ4A 2ZIOA 3LH0A 4PKCC 2XGTA 4OB2B 4XTVA 5LJ5f 3NETA 4KT0E 4JUVA 4P75A 3RACA 1VQ7A 4BY6B 3PZCA 4L6V5 4UPAA 2EQUA 3RIRA 2ZINA 4LVLA 2RHIA 1GGMA 1Y71A 4N0AA 1LYLA 3M54A 4HT4A 3A8GB 3M53A 4XU1A 3G71A 2LVMA 3IKMB 2O4XA 5LJ3h 3VUZA 1YJNA 3UWNA 3TEEA 2X4JA 2CJBA 4QVCA 1DJ7B 2RJDA 3TU4K 3JB9J 1VQOA 2ZIMA 3PCOA 3F70A 2IG0A 4HT8A 2RJFA 2C7IA 1PYSB 4BY6C 4UP7A 2PU9B 2XHCA 3OD1A 4X5OA 2ZTGA 5GAMg 2CGHA 3QXEB 1ASYA 4F7UB 4XEMA 3V8KA 1VQ9A 5A0LA 1RIQA 1WNLA 2DEQA 2PUKB 2CKKA 2DTHA 4KULA 3QHSA 2VXEA 3L2UA 4Q6GA 3QG1A 2E3CA 2VV5A 4X34A 1H4SA 1HK9A 3OW2A 2D6FA 4D6WA 1K8AC 1QP2A 2PUOB 4M75E 3QO8A 1KOGA 3JCMg 3MEAA 4KR2A 3DLMA 4XK8E 2HQXA 4MDXA 1QVPA 3PFSA 3HSBA 3X24B 4QQ6A 4G84A 1Y96B 2LT4A 3I56A 4B9WA 5CIUA 4C5HA 1Q86U 1B8AA 3NELA 2Q7HA 2K5FA 1YFRA 5I2MA 3MP8A 1FYFA 3BJUA 1X54A 5C52B 3JAME 3CC4A 4C92F 3SWNB 4XQ3A 1WGSA 1PYSA 1VQKA 1I5LA 3CCUT 4LDYA 3TEHB 2ZT8A 3CMEA 1YJ9T 4X9DA 2RM4A 4YCUA 1XNIA 2RA2A 2MI6A 4F7UA 2ARSA 1NZ9A 4CRIA 1U1SA 5A0DA 5LJ3f 2GQVA 1LNXA 2DO3A 4E7LA 2QQRA 4BI4A 1VQPA 1FXXA 2LC4A 4DPGA 2HNIA 5CQYA 3T9NA 1UGRB 4BE0A 3JB9F 2HQEA 2L5QA 4FT4A 1I8FA 3SWNC 1ADJA 2ZPFB 2Q5IA 4J83A 2XTIA 3ZBDA 4V2SA 1QF6A 5HK0A 3OYMA 3X25B 1VQ6T 1WQWA 4E7KA 3UGTA 5GMKl 1W66A 4HWRA 4PJOG 1PSEA 3L4GB 1BBUA 4JRIA 3WVEB 1Y96A 4BW9A 2DDZA 2XDPA 3RKYA 3CCRA 4EX5A 2DAQA 4NCXA 3HFOA 3SWNA 4CS3A 4PLIA 1UGQB 3TEHA 4YDQA 3CC2T 3WVDB 5GAOp 5HK3A 1XOVA 1R8OB 2KDSA 4RQEA 3META 1M4ZA 4TVAB 3A8OB 1KQ2A 2ZT7A 3E9FA 4RG8A 3HFZB 1X2GA 4QVZA 2ZGWA 4M7AG 3OS2A 3GP8A 3G4ST 3NTHA 4A4KA 4EMKC 2G4CA 4PJOA 5KCHA 4TQFA 1RI0A 1W2BA 3OMGA 2DU7A 4O6JA 5IT9E 3FB9A 2OTJA 2CYZB 3JCMP 4RCCA 4G85A 1VQ5T 1EOVA 2M0OA 2J3LA 3CD6T 3VQVA 2JVVA 3SFMA 4BDZA 2K4YA 2ZT5A 4IURA 3OS1A 1X75C 3QPHA 2I2LA 3HXVA 3L4GA 1N27A 2ZPIB 4H2WA 3SDZA 3MF1A 1VQLT 1W2BS 3FRNA 3HXWA 4OVAA 1YB3A 2O01E 2LQKA 3HHTB 4O2DA 2ZZGA 1YFTA 4BI3A 1M1FA 3OYLA 3E9IA 3NENA 4TVAA 1K9MC 2X4WA 3HFZA 3PT9A 1NJIU 5FU6B 4BD3A 3CMAT 3LX7A 4XU2A 4OMFB 3HRSA 3OYYA 4IUQA 1X55A 3V8LA 4C8QG 3L2QA 4E7HA 3P8YA 5CKBA 2JZ2A 3ER0A 3IALA 4M78F 4MMKA 4PNOA 4LD9K 3R07A 3VKIA 2V8IA 1N8RU 4P3PA 3VYGA 1YI2A 3LWIA 4YRQA 2EIFA 2ZR2A 1EIFA 1JBMA 1H3ZA 3J80E 2ZXFA 4C92B 5FU6C 3A8MB 2Q5HA 2LCLA 4J6YA 2CZ7B 3FIFA 1BIAA 2CS7A 2GFAA 2ZZEA 1PSFA 2PVGB 2D9TA 3QJYA 3VUBA 3J7AF 2I4NA 4M77F 1OZ2A 1EFWA 3VV0A 2DZCA 3CCUA 2FL7A 1RL2A 1S72T 1YJ9A 5CKEA 4JRKA 2EFIA 4LVMA 5GMKm 4A4FA 5GAN5 3JB9I 5GANe 4RQFA 4YRRA 4C92C 2OAUA 2BKDN 4M7DD 2QHSA 3E19A 2VGNA 1VUBA 2RB6A 5KCOA 3DKMA 5GANf 4ZTFA 5LJ5h 3TREA 4H2VA 4XAXB 3JCMJ 4R55A 4BE1A 2A8EA 1M90U 4Q5WA 4PJOE 4E7IA 2CJ9A 2QQAA 3LGLA 4MZPA 3BDLA 4C92A 3OYKA 4YRLA 2DTIA 3A5YA 1NJIC 1WLEA 3QIIA 5GMKj 5GAN2 1G5VA 3CC7A 2EJ9A 5HKCA 3CCVA 2EJFA 4UC4A 3CCMA 2KQWA 4GY5A 2ZNJA 1VQ4A 4DOVA 5GAMe 1N8RC 4M7AE 3JCMQ 2RH2A 2LT1A 4YROA 3OYNA 3C12A 4X9CA 2ODRC 4EPCA 5GAN4 3HXXA 5GAMf 4FL6A 3VJPA 5K1XA 3EFSA 3MEWA 2DKGA 4LVJA 3QO7A 1YBYA 3HXUA 3ZFJA 5AYFA 2QQSA 4M7DF 4YCWA 1WQ7A 1ASZA 4ZGDB 4JJNK 3VQXA 2E6ZA 3QUIA 1VQ5A 2CZ1B 3JCMe 3O8VA 3FEOA 1BI2A 2FB7A 1WU7A 3DB3A 5D6WA 5J39A 2Y90A 1QE0A 3VQYA 5CR2A 1VIFA 4J6WA 3CCLT 3C4SA 1BYMA 2XD0A 2RI5A 3C94A 1ADYA 2M16A 3UDCA 2ZPHB 4RG2A 3RKXA 5IAYA 2VXFA 1W4SA 5FRNA 2MF2A 3NFCA 1KHIA 3L2VA 2CJAA 2X35A 4C8QE 2L3RA 4M78B 2V8KA 4P72C 2E41A 1N9WA 2R57A 4C92D 2DIQA 4Y28E 1K73U 4PG3A 2PMEA 2PQWA 2F69A 1VQNT 5HY6A 4P73C 3HPWA 2EKOA 4L87A 4FIBA 1X2HA 3BW1A 4P72A 3CCQT 2J3MA 4UP8A 1JRIA 2DD5A 3RUXA 3LYIA 4OF1A 4LDWA 5GAN6 3CXCA 3JB9D 4M78C 4HWTA 4M77B 1U8RA 3I55T 1KMNA 1L0WA 2RHYA 4IUPA 4ZN1A 3QNEA 4P73A 3UH0A 3NEMA 4BUGA 1YIJT 4F7UG 5GAN3 3OYAA 1J5WA 1IREB 2DD4A 3CXCS 2ARTA 4M78A 3QJ6A 2RHQB 4C0DB 3S6WA 2ODRD 3SD4A 4YRSA 1SERA 2E10A 4TVRA 5K1PA 4JRPA 4M77C 3GOXA 4H2YA 1EQRA 5GAOq 1LJOA 1P92A 4YRGA 5GANd 1I4K1 3MEUA 1M8VA 2WSEE 4J5YA 2NLUA 3OS0A 4C0ZA 3IKLA 3VQWA 4JLIA 4P71C 1YJWA 2IVWA 1XQHA 4FT2A 2XDBA 3IG2A 3ASKA 3M57A 2ZPEB 4JLGA 5F5WA 2HAXA 2HD0A 4OB0B 4M77A 2QEXT 4K87A 4C0DC 1YCYA 2QHVA 3P8VA 3BY7A 2K5IA 3JCMc 4RMOA 2BUDA 4IKFA 3JCMW 3E9GA 5J3BA 2ALYB 2P4TA 2E65A 4IUTA 2X4YA 1H4TA 3M58A 4M75F 3EAEA 4C5GA 4P71A 3LW5E 2R5MA 2DXCA 1Q81U 3OYJA 4P3OA 5GAOr 1SRYA 2RHQA 1FX7A 4XTYA 4L5GA 3G6ET 4YP0A 2Q7GA 1C0AA 4M7DB 2QHUA 4ZTZB 4BDYA 1FWZA 1VQZA 4EMKB 3OYIA 1WJSA 2VC8A 5GAMd 4YRIA 1M1GA 3CBPA 1E22A 2ZZFA 4K86A 3CBOA 3LGFA 2I4MA 1QVFA 3HKSA 4M7DG 3OS5A 5GMKe 3RF1A 5ELOA 3WXMB 2RD1A 4QQDA 4RMFA 4PL6A 3RESA 2I4LA 3CEYA 4ZGJB 2MWOA 4L59A 3ME9A 2ZCEA 5CKHA 4ZTJA 4A53A 4M7DC 5LJ5j 4M78D 5FROA 2E5QA 3JCMd 2ALYA 1QVFS 3CCLA 5CAIA 1Q86C 3MF2A 1VQMA 5CQXA 4CH6A 4MMLA 4J15A 4H02A 2BIVA 2VYTA 5A0GA 1OI1A 2RK1A 3QBYA 1BI0A 2Y4XA 3LC0A 4XU3A 1KHCA 2R5AA 4P3NA 3S3NA 2ZR3A 1VIEA 4M7DA 5I2SA 1YHQT 5FLXE 2XICA 4EMKA 1JJ2A 1ZHIA 2RHUA 2K2VA 4O5VA 1SSFA 4PHCA 3TCJA 5LJ3g 4M77D 3REXA 4JDSA 4OGCA 3VYHB 5GANh 5I21A 4MZMA 1VQNA 1EIYB 1EVLA 4H2TA 4DQ2A 2EAYA 4R56A 1V29B 2E70A 1Q81C 1JJ2S 3A5ZB 3V7CA 2QHTA 1SESA 1WYDA 1VQ7T 1M1KU 2DJZA 4CH5A 3PMTA 4C5IA 1KC8U 1KMMA 5KNNA 2VUBA 4F7UE 3I55A 3G71T 4JS4A 3GLXA 2C06A 4YREA 2QA4T 2G3RA 3E1SA 2YRVA 1Q82U 2DVEA 4KR3A 1NJ6A 1VQOT 1KQSA 4OP0A 2QQ9A 3VU3C 2WACA 5KH6A 1HTTA 2FYKA 3DSQA 2PMFA 3HY1A 4WI1A 1YGBA 4OGEA 5GAMh 4YRFA 5DM7R 3QZ5B 1NYQA 3OBWA 4A4EA 4DOWA 2Y4YA 1NYRA 4XU0A 4C92G 5CKDA 1EIYA 4XTUA 1KQSS 3A5ZA 5LJ3j 3OSSC 2EYQA 1G5HA 2MWPA 4ZN3A 1NNHA 4H2UA 4M75B 2DXBA 5CKFA 4YRCA 3V7RA 1G3YA 3JCMh 2GFUA 2QEXA 1D3BB 3M4GA 5DY9A 3KUFA 4YTLA 4PLLA 4VUBA 3P8DA 1HC7A 3RMSA 4MZTA 2XG8D 3JB9G 1YFSA 3HRKA 3JB9H 2KVQG 4NOYA 1I81A 3Q1JA 2DQ0A 3I56T 3M9QA 3RKWA 4BACA 3OA6A 1WJRA 1Z7MA 2DIGA 1VQ6A 4LDVA 1VQ8T 1VQKT 3PIOA 3M4YA 1Y07A 2ZPBB 3G1ZA 1NPPA 2RHZA 1B70B 4M75C 3HTZA 2QI2A 2JTMA 1M1KC 4B9XA 4K88A 3RMQA 4M7DE 1KC8C 1UGSB 3OYCA 1Q7YU 4YRKA 3MCAB 4BI8B 2ARUA 1N9SA 3CC2A 4KQEA 2EQMA 4M75A 1Q82C 1QP3A 1MGQA 4RCBA 3W3SA 4KUDK 1D3BA 2M1HA 3G4SA 2KSSA 4PJOF 1BI1A 2K3YA 2DU5A 2LDMA 3KBGA 4MDWA 4GLKA 2R58A 3CCRT 4H2SA 4E51A 3CD6A 1WJQA 3RERA 4IUVA 4Y91A 1B70A 5HGQA 4HKEA 3JCMf 4E7JA 3WQZA 3CCET 3A32A 1VQLA 11ASA 2K3XA 4LDXA 2FHDA 2ZZDA 5GAOl 3HXYA 4J8OA 3MP6A 1N6AA 3FJPA 1NPRA 2E6NA 4M7AF 1X6OA 1AHJB 4Q15A 3HRUA 4KBMB 2ZNIA 1H4QA 2NS6A 2OTJT 4ZIBA 1M90C 2YLBA 1UGPB 2LX9A 5GAN7 1QVGA 3A7AA 3L2WA 2A3LA 3CMAA 4FU6A 1B7YB 3LWHA 4HWOA 3M5AA 3QO3A 2QXFA 3HFVA 1G3SA 1UEBA 2EJGA 1E24A 4M78G 1Q7YC 4YRTA 2RJEA 1QVGS 2RHSB 3S3OA 3JCMV 3EFRA 5FU7B 2QA4A 1B76A 3X28B 1OZ3A 2ZCFB 1NJ2A 4LVIA 3GPLA 2EL9A 1E1OA 5DLQE 2MAMA 2YHTA 4M75D 1LOJA 4N4GA 3QYHB 2JUFA 5A2QE 3UFGA 4RKUE 4C92E 2MMPA 2RO0A 3LSQA 4TVYA 2LCCA 5CCAA 2E64A 3ZEHA 5GAN8 2I4OA 4QW2A 3PIPA 3A74A 4TTVA 4M77G 3HFNA 4C8QF 5FU7C 2CIMA 2E1HA 1S72A 2DZ9A 2DTOA 1YI2T 1YITT 4CS4A 2F5KA 5GMKh 5GANj 1B7YA 2EQKA 3QKJA 2ZPGB 4YYEA 5DLOA 2Q7EA 4RDXA 1GXIE 2A7YA 2P0LA 2C8MA 1SETA 2KK4A 4A4HA 2RHSA 4YPFA 2B8AA 4J6XA 4JRQA 1G5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 e;  5GMK m;  4N0A C;  5LJ5 g;  5GAN 5;  1USY A;  3JB9 I;  5GAN e;  4RQF A;  5GAN g;  4M7D A;  4YRR A;  4LNS A;  1BBW A;  4C92 C;  3V8J A;  1NJ8 A;  4EMK A;  4WJ4 A;  4M7D D;  2ZIO A;  2QHS A;  2XGT A;  2RB6 A;  4XTV A;  5LJ5 f;  3SB2 A;  3NET A;  5LJ3 e;  1M5Q 1;  4PHC A;  5LJ3 g;  5GAN f;  4M77 D;  3L2Z A;  4JUV A;  4P75 A;  3REX A;  3RAC A;  1KQ1 A;  5LJ5 h;  4H2V A;  3PZC A;  3JCM J;  4UPA A;  5GAN h;  3RIR A;  5I21 A;  2ZIN A;  1ATI A;  2P5I A;  4PJO E;  3I7F A;  1GGM A;  4N0A A;  1LYL A;  2CJ9 A;  5ELN A;  3A31 A;  1EIY B;  1EVL A;  4H2T A;  4DQ2 A;  4XU1 A;  2EAY A;  4C92 A;  3IKM B;  2EWN A;  5LJ3 h;  3V7C A;  2QHT A;  4YRL A;  1JJC B;  1SES A;  2DTI A;  1WYD A;  3A5Y A;  5GAM j;  3M4P A;  3RL6 A;  1WLE A;  4PJO B;  2CJB A;  5GMK j;  2DJZ A;  4QVC A;  5GAN 2;  4CH5 A;  2DXU A;  1KMM A;  5KNN A;  4TVW A;  2EJ9 A;  3JB9 J;  2ZIM A;  4F7U E;  3PCO A;  2YLC A;  4HT8 A;  2EJF A;  2C7I A;  5GAO m;  1PYS B;  4UP7 A;  4A54 A;  3AHU A;  4YRE A;  2ZNJ A;  3OD1 A;  4X5O A;  2ZTG A;  5GAM e;  3QSU A;  5GAM g;  2CGH A;  1ASY A;  4M7A E;  5GAO n;  2DVE A;  4F7U B;  4KR3 A;  4TQD A;  4XEM A;  3JCM Q;  1NJ6 A;  4YRO A;  3V8K A;  4OP0 A;  4X9C A;  3ERR A;  2ODR C;  1RIQ A;  1NJ1 A;  3VU3 C;  5GAN 4;  1HTT A;  1WNL A;  2DEQ A;  2FYK A;  3DSQ A;  2PMF A;  3HXX A;  5GAM f;  3HY1 A;  4UP9 A;  3EFS A;  5K1X A;  2DTH A;  4PJO C;  2DKG A;  3QHS A;  2VXE A;  4WI1 A;  1YGB A;  5GAM h;  4M7A B;  2AKW B;  3QO7 A;  4YRF A;  4EMH A;  4Q6G A;  2E3C A;  3HXU A;  1E1T A;  1NYQ A;  4P74 C;  4M7D F;  4XTX A;  1H4S A;  4YRJ A;  1HK9 A;  4YCW A;  1WQ7 A;  1ASZ A;  1B34 B;  3VQX A;  1NYR A;  3QUI A;  4XU0 A;  4M75 E;  4C92 G;  3GIB A;  3QO8 A;  1EIY A;  4XTU A;  4XTZ A;  3JCM e;  3BFM A;  2DXT A;  1KOG A;  3JCM g;  4KR2 A;  3A5Z A;  2FB7 A;  5LJ3 j;  1JJC A;  1WU7 A;  3HSB A;  1G5H A;  3HRI A;  2Y90 A;  1NJ5 A;  1QE0 A;  4G84 A;  1NNH A;  1Y96 B;  3VQY A;  3NEL A;  1B8A A;  4YRM A;  4H2U A;  2Q7H A;  4M75 B;  1YFR A;  4P74 A;  4YRC A;  3V7R A;  4J6W A;  1FYF A;  3RGL A;  3JCM h;  3BJU A;  4HWS A;  1X54 A;  1D3B B;  3M4G A;  5DY9 A;  5C52 B;  5LJ5 d;  4C92 F;  3SWN B;  3CMQ A;  4XQ3 A;  4M7A C;  1ADY A;  1PYS A;  1I5L A;  3RKX A;  4YCV A;  4M78 E;  4HT9 A;  1HC7 A;  2DQ3 A;  2ZT8 A;  3TEH B;  3JB9 G;  1EVK A;  1YFS A;  2VXF A;  4X9D A;  3MEY A;  2RM4 A;  3ICA A;  3HRK A;  3JB9 H;  4NOY A;  1I81 A;  4YCU A;  2DQ0 A;  2RA2 A;  4F7U A;  2ARS A;  3RKW A;  2CJA A;  1U1S A;  5LJ3 f;  3L1A A;  1Z7M A;  2IY5 B;  3E9H A;  1LNX A;  4HA8 A;  4C8Q E;  5GMK i;  4M78 B;  4P72 C;  2E41 A;  1N9W A;  2E5A A;  4WJ3 M;  3G1Z A;  4ZTU B;  4C92 D;  4DPG A;  1X56 A;  4M7A A;  2HNI A;  2AKW A;  1B70 B;  4M75 C;  3HTZ A;  3JB9 F;  4PG3 A;  1I8F A;  4K88 A;  2PME A;  4M7D E;  3SWN C;  1ADJ A;  1B34 A;  4C8Q B;  2Q5I A;  2XTI A;  3JCM b;  4V2S A;  1QF6 A;  1IL2 A;  4P73 C;  4HVC A;  4YRK A;  1WQW A;  4M77 E;  4L87 A;  3UGT A;  5GMK l;  1W66 A;  4HWR A;  1X2H A;  4PJO G;  3BW1 A;  4P72 A;  5E3I A;  2J3M A;  3L4G B;  2ARU A;  4UP8 A;  1JRI A;  1BBU A;  1N9S A;  4JRI A;  1Y96 A;  4BW9 A;  3JCM X;  3RUX A;  4KQE A;  2DDZ A;  4M75 A;  3RKY A;  5GAN 6;  1MGQ A;  4RCB A;  3JB9 D;  3W3S A;  4M78 C;  4HWT A;  4EX5 A;  4M77 B;  1D3B A;  4NCX A;  3HFO A;  3SWN A;  4CS3 A;  5C53 B;  1KMN A;  1L0W A;  2AMC B;  3QNE A;  4P73 A;  3TEH A;  3UH0 A;  1Z7N A;  3NEM A;  4YDQ A;  4PJO F;  4F7U G;  5GAN 3;  5GAO p;  2DU5 A;  4C8Q C;  3A7U A;  1J5W A;  2ZT6 A;  4RQE A;  4TVA B;  4YRP A;  1KQ2 A;  1HXD A;  3TEG A;  2ZT7 A;  2ART A;  2IY5 A;  3V7S A;  1N9R A;  4H2S A;  4E51 A;  3HFZ B;  4M78 A;  1X2G A;  2ZGW A;  3RER A;  4M7A G;  2RHQ B;  3QO5 A;  4Y91 A;  1H64 1;  1B70 A;  5HGQ A;  2ODR D;  4YRS A;  4EMK C;  2G4C A;  2E10 A;  4PJO A;  1SER A;  4TQF A;  5K1P A;  3JCM f;  4F7U F;  3BDU A;  4M77 C;  2DU7 A;  3HXZ A;  3WQZ A;  3FB9 A;  3A32 A;  4PJO D;  4TWA A;  11AS A;  4H2Y A;  4C8Q A;  3JCM P;  1EQR A;  5GAO q;  4AH6 A;  1LJO A;  4RCC A;  5GAO l;  4G85 A;  3HXY A;  1EOV A;  2J3L A;  3VQV A;  4YRG A;  3FJP A;  5GAN d;  12AS A;  1I4K 1;  1M8V A;  2ZT5 A;  3PGG A;  2JN0 A;  4J5Y A;  3INZ A;  4M7A F;  3IKL A;  3VQW A;  2I2L A;  3HXV A;  4CS2 A;  3L4G A;  4JLI A;  4P71 C;  4Q15 A;  4M75 G;  4H2W A;  4BWA A;  3IG2 A;  4CH3 A;  2ZNI A;  1H4Q A;  5LJ3 d;  4ZIB A;  3MF1 A;  2YLB A;  2K57 A;  5F5W A;  5GAN 7;  4M77 A;  4K87 A;  4CH4 A;  3A7A A;  1BIB A;  3A7R A;  3TUP A;  3HXW A;  1YCY A;  1YB3 A;  2QHV A;  3P8V A;  3BY7 A;  3JCM c;  2AMC A;  3P8T A;  3JCM W;  1B7Y B;  4EMG A;  2ALY B;  4O2D A;  4HWO A;  2ZZG A;  4M7A D;  2E65 A;  1H4T A;  1YFT A;  3QO3 A;  4M75 F;  4P71 A;  3HFV A;  3NEN A;  4TVA A;  3E9I A;  1H4V B;  2EJG A;  1E24 A;  4P3O A;  5GAO r;  4M78 G;  1SRY A;  4H2X B;  4YRT A;  1U1T A;  3M4Q A;  4NL3 A;  3HFZ A;  3REU A;  2RHS B;  3KFU A;  3JCM V;  3EFR A;  2RHQ A;  1B76 A;  4XU2 A;  2QTX A;  3LSS A;  4HWP A;  4XTY A;  4YP0 A;  2Q7G A;  1X55 A;  1C0A A;  3V8L A;  4M7D B;  1NJ2 A;  2QHU A;  4ZTZ B;  4C8Q G;  1VQZ A;  2EL9 A;  4EMK B;  1E1O A;  1WPY A;  3P8Y A;  3QTC A;  2VC8 A;  4QVD A;  2YHT A;  5GAM d;  3HY0 A;  4M75 D;  1LOJ A;  3UFG A;  4YRI A;  3IAL A;  4M78 F;  4MMK A;  4PNO A;  1E22 A;  4C92 E;  2ZZF A;  4K86 A;  3R07 A;  4P3P A;  2I4M A;  3LSQ A;  4TVY A;  4YRQ A;  4M7D G;  2E64 A;  4NL2 A;  5GMK e;  3RF1 A;  2ZR2 A;  5ELO A;  5GAN 8;  2RD1 A;  2I4O A;  1TH7 A;  4RMF A;  3A74 A;  1JBM A;  4TTV A;  4M77 G;  3HFN A;  4C8Q F;  3RES A;  2I4L A;  3VBB A;  2ZXF A;  4C92 B;  2Q5H A;  2CIM A;  2ZCE A;  2E1H A;  4XEO A;  1USY C;  4J6Y A;  3FIF A;  2DZ9 A;  4A53 A;  1BIA A;  2DTO A;  4CS4 A;  4XTW A;  5LJ5 j;  4M7D C;  5C51 B;  4M78 D;  5GMK h;  2ZZE A;  1G51 A;  3JCM d;  4WF2 A;  5GAN j;  1B7Y A;  4YRN A;  1X01 A;  2ALY A;  3UGQ A;  4YYE A;  5CAI A;  3PCO B;  3MF2 A;  2Q7E A;  4MML A;  4CH6 A;  4J15 A;  4RDX A;  4H02 A;  4EO4 A;  2I4N A;  4M77 F;  2P0L A;  1EFW A;  4P75 C;  4H2X A;  2C8M A;  1SET A;  4OLF A;  4C8Q D;  2DZC A;  2RHS A;  4YPF A;  3LC0 A;  4XU3 A;  4J6X A;  1G5I A;  4P3N A;  2ZR3 A;  4JRK A; 
#chains in the Genus database with same CATH topology
 3I5R A;  1OYX A;  2VGM A;  2M9U A;  4QQG A;  5LJ5 g;  2FZC B;  1WLP B;  1RAG B;  3PNW C;  2XID A;  4LNS A;  4DBH A;  3V8J A;  2RQU A;  1OPL A;  4BE2 A;  3JV3 A;  3OW2 S;  3CCJ Q;  2AKL A;  3SB2 A;  3OYB A;  1VQ8 A;  4FSX A;  5LJ3 e;  1M5Q 1;  1WA7 A;  1UJY A;  3L2Z A;  1KQ1 A;  1E6G A;  4ME7 A;  2L89 A;  1BBZ A;  3GNG A;  4KUI A;  1ATI A;  1K73 C;  2JJ9 A;  2P5I A;  3I7F A;  2RJC A;  4ZGE B;  5ELN A;  3A31 A;  2JOY A;  2YRC A;  1YCS B;  2OTL Q;  3CBM A;  4F14 A;  4Z02 A;  5CVI A;  4IIO A;  2EWN A;  2DE0 X;  1IZ6 A;  2LTO A;  1JJC B;  1GRI A;  2E3I A;  3CPF A;  4E47 A;  1I0C A;  1VYU A;  5GAM j;  2P0Q A;  3M4P A;  4LD6 A;  3RL6 A;  2X3W D;  4PJO B;  1QW1 A;  4DBF A;  1M9S A;  1UG1 A;  2DXU A;  1K9M U;  1M1K R;  4TVW A;  3FLG A;  3CPW P;  2YUQ A;  2HEQ A;  4PJJ A;  2YLC A;  3S3M A;  1KC8 R;  4GLM A;  4P5N A;  5L8R E;  4OB1 B;  2P0K A;  5J26 A;  5GAO m;  1UUE A;  4A54 A;  3AHU A;  3UPU A;  1KD1 U;  2A28 A;  3CCS T;  3QSU A;  3G71 Q;  1BB9 A;  1QQJ A;  1O9S A;  2RHX A;  3X26 B;  5GAO n;  3DLL A;  5C6S A;  3OYD A;  4TQD A;  1YJN Q;  3CC7 T;  1B7T A;  1GFC A;  3CCV T;  3ERR A;  1NJ1 A;  3CCM T;  1SKU B;  3M59 A;  3EG3 A;  1W70 A;  3EGX B;  4UP9 A;  3P8B B;  3RDV A;  4PJO C;  4RTV A;  3H6Z A;  1WDX A;  4M7A B;  2AKW B;  1ZUU A;  4EMH A;  1VQ4 T;  5KE2 A;  1E1T A;  1ZSG A;  4P74 C;  4AFZ C;  5FRM A;  1WI7 A;  5M9O A;  2KNB B;  1MV3 A;  4XTX A;  4YRJ A;  1KG1 A;  3CCE A;  1B07 A;  1B34 B;  3GIB A;  4XTZ A;  2DXT A;  3BFM A;  4C0G A;  2O2O A;  3VS0 A;  1TSF A;  3CPW A;  3DB4 A;  1JJC A;  1VQ9 Q;  2HL5 C;  2HL3 A;  3HRI A;  3URG A;  1CKA A;  3OB9 A;  1NJ5 A;  1MND A;  1WX6 A;  2LCS A;  4YRM A;  2H3J A;  1LPL A;  1KSW A;  3CCJ T;  5IXF A;  1EZZ B;  1SRM A;  3NTI A;  4P74 A;  3VS4 A;  3OYF A;  3RGL A;  4HWS A;  3KFV A;  3MO8 A;  5LJ5 d;  2FVU A;  4OB3 B;  2RI2 A;  3CMQ A;  2V8J A;  4M7A C;  5LL6 S;  2CZ0 B;  2ED1 A;  4YCV A;  3CPW S;  4M78 E;  4HT9 A;  2DQ3 A;  1XTD A;  1EVK A;  1OOT A;  4A4G A;  2EQI A;  5EG2 A;  3MEY A;  3ICA A;  3KXT A;  2XU8 A;  2EQJ A;  2OTL T;  1A0N B;  2CZ6 B;  4F16 A;  1K1Z A;  1RUW A;  2KRS A;  3A8H B;  3L1A A;  2X4X A;  2IY5 B;  3E9H A;  1T3L A;  4HA8 A;  4DA4 A;  5GMK i;  1G3W A;  3EGX A;  2O31 A;  2E5A A;  4FM4 B;  4WJ3 M;  4ZTU B;  1RAC B;  1MMA A;  1X56 A;  4M7A A;  2AKW A;  3CCQ A;  3CC4 Q;  2K9G A;  1S1N A;  4FYY B;  1RLQ C;  3QZ9 B;  4GBQ A;  2AK5 A;  3CME Q;  1B34 A;  1JB0 E;  4KGZ B;  4C8Q B;  4CI0 C;  3OYG A;  3JCM b;  3MP1 A;  1IL2 A;  3OQ5 A;  4HVC A;  1IB8 A;  4M77 E;  3FC3 A;  3N5B B;  2K3B A;  1Q7Y R;  1YJN T;  2JXB A;  4F17 A;  3EG1 A;  5E3I A;  1KD1 C;  2KAF A;  1YIJ A;  1WFW A;  3OYE A;  1UDL A;  4KH0 B;  4N4I A;  3JCM X;  3EG9 B;  2WSF E;  1VQP Q;  1J3T A;  1PKT A;  2RQT A;  2K6D A;  2JW4 A;  2RMO A;  3UA7 A;  2P0P A;  3OY9 A;  4LVK A;  2D1X A;  5C53 B;  2CT3 A;  2EYW A;  4HCZ A;  2AMC B;  3OMC A;  2RK2 A;  1YIT A;  1WIE A;  2AHJ B;  1Z7N A;  2WSC E;  3VS1 A;  5EC7 A;  2G6F X;  4BB7 A;  4C8Q C;  3MQZ A;  3A7U A;  2ZT6 A;  1VA7 A;  2JMA A;  3M56 A;  2KR3 A;  4OMN A;  3UAT A;  2JNG A;  4YRP A;  1VQ9 T;  3REB B;  3TEG A;  1HXD A;  1G3T A;  4HCC A;  2IY5 A;  3V7S A;  1N9R A;  2DPP B;  2DL5 A;  3P8H A;  3CCR Q;  1GFD A;  3QO5 A;  1H64 1;  1TTH B;  4RTY A;  2GQI A;  2LNV A;  2O88 A;  1PD1 A;  2EPD A;  4J7I A;  4F7U F;  3BDU A;  3HXZ A;  1LCK A;  4J9G A;  2HCK A;  2A36 A;  4PJO D;  4TWA A;  4IUU A;  2XKO C;  4C8Q A;  2E12 A;  1F1B B;  1Z9Z A;  4AH6 A;  2ABL A;  3HP9 A;  1IHW A;  8ATC B;  3H8Z A;  12AS A;  2XI9 A;  4HCB A;  3PGG A;  2K2M A;  2JN0 A;  2L8D A;  3GNF B;  1Y7X A;  1SF9 A;  3HRT A;  4Z8A A;  3L2R A;  3INZ A;  3OBY A;  4CS2 A;  2XDD A;  3PMI A;  4RTX A;  4DEY A;  3G7Z A;  1GBQ A;  4FYV B;  3A8L B;  4M75 G;  4BWA A;  3EG9 A;  4CH3 A;  2JTF A;  2GCX A;  5KE3 A;  2E4H A;  5LJ3 d;  3R6O A;  1NE8 A;  1IRX A;  2K57 A;  1AWW A;  3JSC A;  1PM3 A;  4CH4 A;  3CC4 T;  3X20 B;  1BIB A;  2LRQ A;  3UT1 A;  3A7R A;  3OYH A;  3TUP A;  1NBE B;  2QDY B;  2XK0 A;  2QYZ A;  4ATO A;  2AMC A;  2NUZ A;  2YDL A;  2F5T X;  3CME T;  3GF5 A;  3P8T A;  2FRY A;  3G6E A;  1YJW T;  1NG2 A;  2HKQ B;  4EMG A;  2OAW A;  4ELY C;  4M7A D;  2K5L A;  3AT1 B;  2P4R A;  1OU9 A;  2DK3 A;  1H4V B;  2D8H A;  4AMC A;  2KMT A;  2D0Q B;  4H2X B;  2MYS A;  1HYO A;  4FYX B;  1U1T A;  3M4Q A;  4ELZ C;  4NL3 A;  2PVO B;  3REU A;  3KFU A;  2BTT A;  3H41 A;  3CCS A;  1VQP T;  2QTX A;  1UGV A;  3LSS A;  1MHN A;  1BKB A;  1UHF A;  4HWP A;  2PVD B;  4C0F A;  2GGR A;  3OSV A;  2CP2 A;  4R0K A;  2QQB A;  3JRZ A;  4AG2 C;  9ATC B;  2KY9 A;  1WPY A;  1M27 C;  3QTC A;  4QVD A;  3HY0 A;  3FDR A;  4LDU A;  3NMZ C;  4J7F A;  5CO7 A;  5IN1 A;  1D1B A;  2ZAE A;  4RTZ A;  4II1 A;  1AEY A;  3ULR B;  1V76 A;  1UEC A;  3EGD B;  4NL2 A;  2SRC A;  3MHX A;  1TH7 A;  5GJV B;  3M55 A;  4JZ4 A;  3QDF A;  3VBB A;  4N4H A;  2CT4 A;  5D6X A;  5D6Y A;  2LQ8 A;  2O4X B;  5C0M A;  4Z89 A;  3M0R A;  2EVR A;  1QWE A;  3C95 A;  4XEO A;  4EIK A;  1USY C;  2DEU A;  1RAF B;  2HBP A;  4XTW A;  2IPO B;  3PTA A;  3L42 A;  5C51 B;  1ABO A;  1AVZ C;  3QYG B;  3QDR B;  4JS5 A;  4WF2 A;  1YP5 A;  2VWF A;  1ZBX A;  1X01 A;  1G51 A;  1UB4 A;  4YRN A;  2HBW A;  3CCJ A;  3UGQ A;  3RNJ A;  1O75 A;  1YHQ A;  1K8A U;  2A37 A;  3NTK A;  1ZQ1 A;  2GBQ A;  3VS2 A;  4C5E A;  3PCO B;  2VB6 A;  4EDU A;  1OX9 A;  4EO4 A;  2KT8 A;  4NS5 A;  4P75 C;  5CK9 A;  4LN2 A;  4M4Z A;  4H2X A;  4OLF A;  4C8Q D;  2EYZ A;  3MEV A;  2RQV A;  1WHL A;  5IH2 A;  2DLP A;  5LJ5 e;  2OTL A;  4N0A C;  1USY A;  3VS5 A;  3J81 E;  1UFF A;  2HDA A;  5GAN g;  1BBW A;  3LLR A;  2RI3 A;  2GF7 A;  1K0X A;  2QGG A;  3HL8 A;  4FW1 A;  1NJ8 A;  1BI3 A;  1VQM T;  4WJ4 A;  2ZIO A;  1LVK A;  1ZBJ A;  3LH0 A;  4PKC C;  2XGT A;  4OB2 B;  4XTV A;  5LJ5 f;  5ECA A;  3NET A;  1IHV A;  3MJX A;  4KT0 E;  2J7I A;  4JUV A;  2V1R A;  4P75 A;  3RAC A;  1VQ7 A;  2JS0 A;  1WXU A;  4BY6 B;  3PZC A;  4L6V 5;  4UPA A;  1WXB A;  2EQU A;  3EGD A;  3RIR A;  2NUT B;  2ZIN A;  4LVL A;  2RHI A;  2KYB A;  3RBB B;  3CCU Q;  1GGM A;  1Y71 A;  4N0A A;  5KYU B;  1YJ9 Q;  1LYL A;  2KYM A;  3M54 A;  2ROT A;  4HT4 A;  8AT1 B;  3A8G B;  3M53 A;  4XU1 A;  2FRW A;  3G71 A;  2LVM A;  3IKM B;  2O4X A;  5LJ3 h;  3VUZ A;  1PKS A;  1YJN A;  1V1C A;  3UWN A;  1EX4 A;  3TEE A;  2X4J A;  1X6B A;  2CJB A;  2HQH A;  4QVC A;  1HSQ A;  1DJ7 B;  2M0Y A;  2ATC B;  2RJD A;  3TU4 K;  3JB9 J;  1VQO A;  2ZIM A;  3PCO A;  1UTI A;  3F70 A;  2IG0 A;  4HT8 A;  2RJF A;  2C7I A;  1K9M R;  1PYS B;  4BY6 C;  4UP7 A;  1ABQ A;  2A08 A;  2PU9 B;  4JJC A;  2XHC A;  3OD1 A;  4X5O A;  2ZTG A;  5GAM g;  2CGH A;  3QXE B;  2L3S A;  1VQ6 Q;  1ASY A;  1KD1 R;  4F7U B;  4XEM A;  1H3H A;  3V8K A;  1VQ9 A;  1ARK A;  5A0L A;  5D7U A;  1RIQ A;  3NPF A;  1WNL A;  2DEQ A;  2PUK B;  2CKK A;  1QCF A;  2B86 A;  3CC7 Q;  2DTH A;  4KUL A;  3QHS A;  2VXE A;  3L2U A;  4Q6G A;  3QG1 A;  2E3C A;  1SPK A;  3CCM Q;  1ACM B;  2KBT A;  2VV5 A;  4X34 A;  4DEX A;  2NUT A;  1H4S A;  1W6X A;  5HCK A;  1HK9 A;  6AT1 B;  2DMO A;  2FPD A;  3OW2 A;  5KYU A;  4D6W A;  1RAD B;  1K8A C;  1QP2 A;  2D6F A;  1K0S A;  2PUO B;  2AIR B;  4M75 E;  3QO8 A;  1KOG A;  3JCM g;  1Y0M A;  3MEA A;  4KR2 A;  3DLM A;  4XK8 E;  2HQX A;  4MDX A;  1QVP A;  3PFS A;  3HSB A;  3X24 B;  4QQ6 A;  4G84 A;  1Y96 B;  1PRM C;  2EGA A;  2LT4 A;  5FW9 A;  4B9W A;  5CIU A;  4C5H A;  3I56 A;  1Q86 U;  1B8A A;  3NEL A;  2Q7H A;  2K5F A;  1YFR A;  5I2M A;  3G4S Q;  2J6O A;  3MP8 A;  1ZUK A;  1FYF A;  3BJU A;  1X54 A;  5C52 B;  3JAM E;  3CC4 A;  2LJ3 A;  4C92 F;  3SWN B;  1K9A A;  4XQ3 A;  5KYX B;  1WGS A;  1PYS A;  4J9H A;  1I5L A;  1VQK A;  3CCU T;  4LDY A;  3TEH B;  2ZT8 A;  3CME A;  1VQ5 Q;  2VKN A;  1YJ9 T;  4X9D A;  2RM4 A;  4YCU A;  3UA6 A;  1XNI A;  2RA2 A;  2MI6 A;  4F7U A;  2ARS A;  1NZ9 A;  1TXQ A;  2K79 A;  4CRI A;  1U1S A;  5A0D A;  5LJ3 f;  4OML A;  2GQV A;  1E6H A;  1C0M A;  1T0H A;  1LNX A;  2DO3 A;  4E7L A;  2QQR A;  4BI4 A;  2KEA A;  4AFS C;  1FXX A;  1VQP A;  1VQL Q;  2LC4 A;  4DPG A;  2J06 A;  4RUG A;  2HNI A;  5CQY A;  3T9N A;  1UGR B;  4BE0 A;  3JB9 F;  2HQE A;  2L5Q A;  4FT4 A;  4AT1 B;  1I8F A;  1X69 A;  2CP0 A;  3SEM A;  3EHR A;  3SWN C;  1ADJ A;  2ZPF B;  2Q5I A;  4J83 A;  2XTI A;  3ZBD A;  4V2S A;  1QF6 A;  5HK0 A;  3MPU B;  5FWB A;  3OYM A;  3X25 B;  1VQ6 T;  1WQW A;  1G83 A;  4E7K A;  1FMK A;  4CC7 A;  3UGT A;  5GMK l;  1W66 A;  4HWR A;  4PJO G;  1W2B P;  2LQW A;  1PSE A;  3L4G B;  2COZ A;  2DL8 A;  2IIM A;  1BBU A;  4JRI A;  2KE9 A;  3WVE B;  1Y96 A;  3TQ7 P;  4E2F B;  4BW9 A;  3CMA Q;  2AKK A;  2DDZ A;  2XDP A;  3RKY A;  3CCR A;  2O9S A;  2PZ1 A;  4EX5 A;  1ZA1 B;  2DAQ A;  3R6N A;  4AFQ C;  1QCO A;  1R0C B;  4NCX A;  3HFO A;  3SWN A;  4CS3 A;  4PLI A;  5KYX A;  1UGQ B;  1NEB A;  1PNJ A;  3TEH A;  4YDQ A;  1PCX A;  3CC2 T;  3WVD B;  5GAO p;  1JJ2 P;  5HK3 A;  1XOV A;  1R8O B;  2KDS A;  4RQE A;  3MET A;  1M4Z A;  4TVA B;  3A8O B;  1KQ2 A;  1AWJ A;  2ZT7 A;  3E9F A;  4RG8 A;  2DM1 A;  3HFZ B;  1X2G A;  4QVZ A;  2ZGW A;  5IHK A;  3EH1 A;  4M7A G;  2HMA A;  3OS2 A;  3GP8 A;  4QKU A;  3G4S T;  1IGQ A;  3NTH A;  4A4K A;  4OMQ A;  1D09 B;  4RTT A;  4EMK C;  2G4C A;  4PJO A;  5KCH A;  4TQF A;  1RI0 A;  1W2B A;  3OMG A;  1G2B A;  2DU7 A;  4O6J A;  5IT9 E;  3FB9 A;  2OTJ A;  2CYZ B;  4CC4 B;  3JCM P;  4RCC A;  4G85 A;  1VQ5 T;  1EOV A;  2M0O A;  2J3L A;  3CD6 T;  3VQV A;  2YUP A;  2JVV A;  4FSS A;  3SFM A;  4BDZ A;  2K4Y A;  1KFZ A;  2ZT5 A;  4IUR A;  3OS1 A;  1X75 C;  3QPH A;  4QT7 A;  2I2L A;  3HXV A;  1NLP C;  3L4G A;  1N27 A;  2ZPI B;  4H2W A;  1TS9 A;  3SDZ A;  4HVW A;  3MF1 A;  1VQL T;  1W2B S;  2DNU A;  1XJW B;  2ROL A;  3FRN A;  3HXW A;  4OVA A;  1YB3 A;  2O01 E;  2LQK A;  2GTJ A;  7AT1 B;  2MOX A;  3HHT B;  1KQS P;  4O2D A;  3SHW A;  2ZZG A;  1YFT A;  1M3B A;  4BI3 A;  2EW3 A;  1RLP C;  1M1F A;  3OYL A;  3E9I A;  3NEN A;  4TVA A;  1K9M C;  2JS2 A;  2X4W A;  1YJW Q;  3D7S B;  3HFZ A;  3PT9 A;  1NJI U;  5FU6 B;  4BD3 A;  3CMA T;  3LX7 A;  4XU2 A;  1ZSZ B;  3HRS A;  4OMF B;  3OYY A;  1SHG A;  5KYY B;  4IUQ A;  1X55 A;  3V8L A;  2BZY A;  4C8Q G;  3L2Q A;  1VYT A;  4E7H A;  5AT1 B;  3P8Y A;  5CKB A;  2JZ2 A;  3ER0 A;  3IAL A;  4M78 F;  4MMK A;  4PNO A;  4LD9 K;  2DA9 A;  3R07 A;  3VKI A;  2V8I A;  1N8R U;  4P3P A;  3VYG A;  1YI2 A;  2JM8 A;  2DYB A;  3LWI A;  3M0P A;  4YRQ A;  2EIF A;  2ZR2 A;  1EIF A;  1BCO A;  1JBM A;  1H3Z A;  3J80 E;  4KGV B;  2ZXF A;  4C92 B;  3H0I A;  5FU6 C;  3TSZ A;  3A8M B;  1NEG A;  1PHT A;  2Q5H A;  2LCL A;  1ZSZ C;  3M0T A;  1OEB A;  1WZO A;  2DER A;  1KJW A;  4J6Y A;  2CZ7 B;  3FIF A;  1BIA A;  1SHF A;  1AOJ A;  2CS7 A;  2GFA A;  2ZZE A;  4PJN A;  1PG5 B;  4PJL A;  1PSF A;  2PVG B;  2D9T A;  1JXM A;  1TWB A;  3QJY A;  4J9I A;  3VUB A;  3J7A F;  2I4N A;  4M77 F;  1OZ2 A;  1EFW A;  1K8A R;  3VV0 A;  1E7O A;  4A63 B;  4DBR A;  2DZC A;  4AFU C;  3CCU A;  2FL7 A;  1U5S A;  1RL2 A;  4JJD A;  1S72 T;  3I9Q A;  1YJ9 A;  5CKE A;  4JRK A;  2EFI A;  4ZNX A;  1ZSZ A;  4LVM A;  5GMK m;  4A4F A;  5GAN 5;  2BZ8 A;  3A98 A;  5KYY A;  3JB9 I;  5GAN e;  4RQF A;  4YRR A;  4C92 C;  4E6R A;  2OAU A;  2BKD N;  4M7D D;  2QHS A;  3E19 A;  1KIK A;  2VGN A;  1X2K A;  1VUB A;  2RB6 A;  2W0Z A;  5KCO A;  3CCL Q;  2QTV A;  3DKM A;  5GAN f;  4ZTF A;  1VQM Q;  5LJ5 h;  3TRE A;  4H2V A;  4XAX B;  3JCM J;  1WXT A;  1GBR A;  4R55 A;  4BE1 A;  2A8E A;  1M90 U;  4Q5W A;  4PJO E;  4E7I A;  2CJ9 A;  1Q95 G;  2QQA A;  3LGL A;  4MZP A;  1R77 A;  4JPB W;  3BDL A;  4C92 A;  3OYK A;  2CRE A;  4YRL A;  2DTI A;  1AZE A;  3A5Y A;  1NJI C;  2CP7 A;  2HKN A;  1WLE A;  2YUO A;  3QII A;  5GMK j;  5GAN 2;  4LUE A;  1AWX A;  1G5V A;  3CC7 A;  2EJ9 A;  5HKC A;  3CCV A;  2CUB A;  2ENM A;  2EJF A;  4UC4 A;  3CCM A;  2RPN A;  2DIL A;  2RNA A;  3PE0 A;  1WHG A;  2KQW A;  1BK2 A;  2KRN A;  1VQN Q;  4GY5 A;  3MKD A;  5IHN A;  2ZNJ A;  1VQ4 A;  4DOV A;  4J9B A;  5GAM e;  2QDL A;  1OUL A;  1N8R C;  4M7A E;  1D0X A;  3JCM Q;  2RH2 A;  2LT1 A;  4YRO A;  3OYN A;  3CCQ Q;  1FYN A;  3C12 A;  2MPX C;  4X9C A;  2ODR C;  4EPC A;  5GAN 4;  2KRO A;  3HXX A;  5GAM f;  4FL6 A;  2LJ1 A;  3VJP A;  5K1X A;  3EFS A;  3U23 A;  2D8J A;  3MEW A;  2KXD A;  2DKG A;  4LVJ A;  3QO7 A;  5KYW B;  1YBY A;  3I55 Q;  1UJ0 A;  3HXU A;  3ZFJ A;  1RAH B;  1QCN A;  5AYF A;  1PD0 A;  2QQS A;  5FWC A;  2EYX A;  1QVG P;  4M7D F;  4YCW A;  1WQ7 A;  1ASZ A;  4ZGD B;  2OX7 A;  4JJN K;  3VQX A;  1YIJ Q;  2E6Z A;  3QUI A;  1VQ5 A;  2CZ1 B;  3JCM e;  3O8V A;  2CP3 A;  3FEO A;  4FCY A;  2AT1 B;  1BI2 A;  2FB7 A;  2CP5 A;  1WU7 A;  3DB3 A;  5D6W A;  5J39 A;  2Y90 A;  1QE0 A;  2FZG B;  2O9V A;  3VQY A;  2HSE B;  2X3X D;  2GTO A;  5CR2 A;  1VIF A;  4J6W A;  1T3S A;  3C4S A;  4RTU A;  3CCL T;  3I5S A;  1BYM A;  1FMW A;  1Q86 R;  2OI3 A;  1X2Q A;  2XD0 A;  2RI5 A;  3C94 A;  1ADY A;  3H9N A;  1NYF A;  2M16 A;  3UDC A;  2ZPH B;  4RG2 A;  3RKX A;  5IAY A;  2JMC A;  4PJM A;  2VXF A;  1W4S A;  2FO0 A;  3PVL A;  3CXC P;  5FRN A;  2DFU A;  2DBM A;  2MF2 A;  3NFC A;  2MIO A;  1KHI A;  3L2V A;  2RF0 A;  2JTE A;  2CJA A;  2X35 A;  1OU8 A;  2EYY A;  2Z0W A;  4FW2 A;  4C8Q E;  2P84 A;  2L3R A;  4M78 B;  1AD5 A;  2V8K A;  4P72 C;  2E41 A;  1N9W A;  1EFN A;  2R57 A;  4C92 D;  5KYN A;  2QEX Q;  2KI7 A;  5KYW A;  2DIQ A;  4Y28 E;  1K73 U;  4PG3 A;  2E5K A;  2PME A;  2PQW A;  2F69 A;  2MK5 A;  4B6M A;  2E3H A;  1SG5 A;  1VQN T;  5HY6 A;  3M0Q A;  1SEM A;  4P73 C;  2QK0 A;  1GCP A;  3HPW A;  2EKO A;  4L87 A;  4FIB A;  2SEM A;  1MUZ A;  1X2H A;  3BW1 A;  4KRT A;  4P72 A;  3CCQ T;  2J3M A;  4UP8 A;  1JRI A;  2DD5 A;  2DF6 A;  2DL4 A;  3UF4 A;  3RUX A;  1JEG A;  3LYI A;  4OF1 A;  2HSP A;  2F2W A;  4LDW A;  5GAN 6;  3CXC A;  3JB9 D;  2VVK A;  4M78 C;  4HWT A;  3G6E Q;  4M77 B;  1U8R A;  3I55 T;  1HD3 A;  1KMN A;  2M51 A;  1L0W A;  1MV0 B;  2RHY A;  2YXY A;  4IUP A;  4ZN1 A;  3QNE A;  4P73 A;  4J9E A;  3UH0 A;  3NEM A;  4BUG A;  1YIJ T;  4F7U G;  5GAN 3;  3OYA A;  2YSQ A;  4JJB A;  1J5W A;  2DBK A;  1RAB B;  1IRE B;  2DD4 A;  1TUG B;  1TG0 A;  2J05 A;  3CXC S;  3CC2 Q;  2ART A;  2FEI A;  1YFN A;  2RQR A;  4WCI A;  1QWF A;  4M78 A;  1WHM A;  3QJ6 A;  2RHQ B;  4C0D B;  1C6V X;  3S6W A;  5I11 A;  4HVV A;  1D0Y A;  4JZ3 A;  3VS7 A;  2ODR D;  3SD4 A;  4YRS A;  1SER A;  2E10 A;  4AG1 C;  4TVR A;  5K1P A;  4JRP A;  1NM7 A;  4M77 C;  3GOX A;  4H2Y A;  1EQR A;  5GAO q;  1LJO A;  1MMG A;  2DL7 A;  2AZV A;  2ECZ A;  1P92 A;  1R0B G;  4YRG A;  1U06 A;  5GAN d;  1I4K 1;  3MEU A;  1M8V A;  2WSE E;  4J5Y A;  2DJQ A;  2NLU A;  3OS0 A;  3THK A;  4C0Z A;  3IKL A;  3VQW A;  4JLI A;  3VS3 A;  3CD6 Q;  4P71 C;  1YJW A;  1JO8 A;  1ZLM A;  2IVW A;  1XQH A;  4FT2 A;  2XDB A;  3IG2 A;  3ASK A;  3M57 A;  2ZPE B;  4JLG A;  4X1V A;  2K7A A;  2HAX A;  5F5W A;  2HD0 A;  4OB0 B;  4M77 A;  2QEX T;  4K87 A;  1PRL C;  4C0D C;  1YHQ Q;  2VAS A;  1QVF P;  3LH5 A;  1YCY A;  2QHV A;  3P8V A;  2F1L A;  3BY7 A;  1RAI B;  2K5I A;  2D0N A;  3JCM c;  2NWM A;  3EHQ A;  4RMO A;  2BUD A;  4LXC A;  2V1Q A;  4IKF A;  3JCM W;  2X51 A;  2I0N A;  2EKH A;  3E9G A;  5J3B A;  2LX7 A;  2ALY B;  2P4T A;  2E65 A;  4IUT A;  2X4Y A;  1H4T A;  3M58 A;  3VS6 A;  4M75 F;  3EAE A;  3EGU A;  4C5G A;  4P71 A;  3LW5 E;  2R5M A;  5I22 A;  2DXC A;  1C1A A;  1Q81 U;  2QAZ A;  3OYJ A;  4P3O A;  5GAO r;  1SRY A;  1JXO A;  1MMD A;  1YN8 A;  4HVU A;  2RHQ A;  1FX7 A;  4XTY A;  4L5G A;  3G6E T;  2FPF A;  1NJI R;  2Q7G A;  4YP0 A;  1C0A A;  4M7D B;  2QHU A;  4ZTZ B;  1QKX A;  4BDY A;  1FWZ A;  2BE7 D;  3RR6 A;  1VQ7 Q;  1VQZ A;  2LQN A;  1I07 A;  1IXD A;  4EMK B;  3OYI A;  1T0J A;  1WJS A;  2VC8 A;  1WHJ A;  5GAM d;  2JM9 A;  5L23 A;  4YRI A;  4RTW A;  1M1G A;  2F2X A;  3CBP A;  1E22 A;  2ZZF A;  4K86 A;  3CBO A;  1OV3 A;  3LGF A;  3TSW A;  2I4M A;  5IHI A;  4ESR A;  1QVF A;  3HKS A;  4M7D G;  3OS5 A;  5GMK e;  3RF1 A;  2OJ2 A;  5ELO A;  3WXM B;  1N8R R;  2RD1 A;  4QQD A;  4RMF A;  2QA4 Q;  4PL6 A;  1Q82 R;  1OQK A;  2NUP B;  3RES A;  2I4L A;  3CEY A;  4ZGJ B;  2MWO A;  4L59 A;  3ME9 A;  2ZCE A;  2EBP A;  1QLY A;  5CKH A;  4ZTJ A;  1VQO Q;  1KK7 A;  2DL3 A;  4A53 A;  2HZY A;  4M7D C;  5LJ5 j;  4LUD A;  4M78 D;  5FRO A;  2E5Q A;  3JCM d;  2ALY A;  1QVF S;  2PNI A;  2L2P A;  3CCL A;  2X9H A;  5CAI A;  1Q86 C;  3MF2 A;  1VQM A;  5CQX A;  4CH6 A;  4MML A;  1MNE A;  2F2V A;  4J15 A;  4H02 A;  2BIV A;  2VYT A;  5A0G A;  1OI1 A;  1PWT A;  2RK1 A;  3QBY A;  1BI0 A;  2Y4X A;  4HXJ A;  1GL5 A;  3LC0 A;  4XU3 A;  1KHC A;  1AZG B;  2R5A A;  2DVJ A;  3S3N A;  2ZR3 A;  4P3N A;  1VIE A;  3BE3 A;  2COY A;  4K11 A;  4M7D A;  5I2S A;  3REA B;  1YHQ T;  1S72 Q;  5FLX E;  1RAE B;  2XIC A;  4EMK A;  5IXB A;  1JJ2 A;  1ZHI A;  3FJ5 A;  2RHU A;  1UHC A;  2K2V A;  2LZ6 B;  4O5V A;  1K4U S;  1SSF A;  4OMP A;  3M0S A;  4PHC A;  3TCJ A;  5LJ3 g;  4M77 D;  3REX A;  1VYV A;  4JDS A;  4OGC A;  2L0A A;  3VYH B;  2RQW A;  5GAN h;  2CH4 W;  5I21 A;  4MZM A;  1PC0 A;  3EG0 A;  1RAA B;  1VQN A;  1EIY B;  2NUP A;  1EVL A;  4H2T A;  2LJ0 A;  4DQ2 A;  3I56 Q;  1N5Z A;  1M90 R;  2EAY A;  2ED0 A;  4R56 A;  1SSH A;  1V29 B;  2E70 A;  1Q81 C;  1JJ2 S;  3A5Z B;  1D0Z A;  2DX1 A;  3V7C A;  2QHT A;  1SES A;  2AZS A;  2DYI A;  1WYD A;  1VQ7 T;  4KH1 B;  1M1K U;  1OX8 A;  2CDT A;  2DJZ A;  4CH5 A;  3PMT A;  1VQ8 Q;  1VQK Q;  4C5I A;  1KC8 U;  4J9C A;  1KMM A;  4PFZ A;  5KNN A;  1JU5 C;  2GNC A;  2RN8 A;  2VUB A;  4HCK A;  4F7U E;  3I55 A;  3O5Z A;  3G71 T;  4JS4 A;  1X27 A;  3EG2 A;  3GLX A;  2C06 A;  1Y57 A;  4YRE A;  2LP5 A;  2QA4 T;  2CP6 A;  2G3R A;  3E1S A;  1GCQ C;  1B3Q A;  4J9D A;  2YRV A;  1IGU A;  1Z9Q A;  1Q82 U;  2FZK B;  2DVE A;  4KR3 A;  3GBQ A;  3I35 A;  1NJ6 A;  4F04 B;  1H8K A;  3NHN A;  1VQO T;  1KQS A;  4OP0 A;  2QG9 B;  2QQ9 A;  3QWY A;  1WYX A;  3VU3 C;  2WAC A;  5KH6 A;  1HTT A;  2FYK A;  1OPK A;  4OMM A;  2PMF A;  3DSQ A;  3HY1 A;  1UE9 A;  4WI1 A;  1YGB A;  4OGE A;  5GAM h;  1TUC A;  4YRF A;  4E7Z A;  5DM7 R;  3QZ5 B;  1NYQ A;  2V26 A;  3OBW A;  2LNH B;  1GCQ A;  2J6K A;  4J9F A;  4PFP A;  4A4E A;  4DOW A;  2Y4Y A;  1M3A A;  1NYR A;  4XU0 A;  4C92 G;  5CKD A;  1EIY A;  4XTU A;  1M30 A;  1KQS S;  3A5Z A;  5LJ3 j;  3OSS C;  1ZUY A;  4ORZ A;  2EYQ A;  1G5H A;  2MWP A;  4ZN3 A;  1NNH A;  2C0T A;  4H2U A;  2H3E B;  4M75 B;  2DXB A;  5CKF A;  4YRC A;  3V7R A;  1G3Y A;  1VOM A;  2A0F B;  3JCM h;  2GFU A;  2QEX A;  1D3B B;  3M4G A;  5DY9 A;  3KUF A;  4YTL A;  2L3Q A;  4PLL A;  4VUB A;  3CCE Q;  2DET A;  3P8D A;  1I1J A;  1HC7 A;  3RMS A;  4MZT A;  2XMF A;  2XG8 D;  5GJW B;  3JB9 G;  1YFS A;  3HTR A;  3HRK A;  3JB9 H;  2KVQ G;  4NOY A;  1I81 A;  3Q1J A;  2DQ0 A;  1ZA2 B;  3I56 T;  1K76 A;  3M9Q A;  3RKW A;  4BAC A;  1BU1 A;  3OA6 A;  1WJR A;  1Z7M A;  1FMV A;  2DIG A;  2CUD A;  2M02 A;  1ZX6 A;  1VQ6 A;  4LDV A;  1VQ8 T;  2OTJ Q;  1VQK T;  3PIO A;  3M4Y A;  1Y07 A;  2ZPB B;  3G1Z A;  1NPP A;  1G8X A;  2CH4 A;  2RHZ A;  1B70 B;  4M75 C;  3HTZ A;  2QI2 A;  2JTM A;  1M1K C;  1MMN A;  4B9X A;  4K88 A;  1NLO C;  3RMQ A;  4M7D E;  1K73 R;  1W1F A;  1KC8 C;  1UGS B;  1M2V B;  3OYC A;  1Q7Y U;  1U3O A;  4D8D A;  2J6F A;  1YNZ A;  4YRK A;  3MCA B;  4BI8 B;  1TU0 B;  3E2U A;  2C0I A;  2ARU A;  4Z88 A;  1N9S A;  3H0H A;  3CC2 A;  4KGX B;  4KQE A;  2EQM A;  4M75 A;  1Q82 C;  1QP3 A;  1MGQ A;  4RCB A;  4Y92 A;  3W3S A;  4KUD K;  1D3B A;  1WHH A;  1M2O A;  2KGT A;  1X6G A;  2M1H A;  3C0C A;  1AT1 B;  2MCN A;  3G4S A;  3EFO B;  2KSS A;  4PJO F;  1BI1 A;  2K3Y A;  1BCM A;  1TUD A;  2DU5 A;  2LDM A;  3VRY A;  3KBG A;  4MDW A;  1TOV A;  4GLK A;  2R58 A;  2W10 A;  3CCR T;  2KXC A;  3IQL A;  4H2S A;  4E51 A;  1IO6 A;  3CD6 A;  4D8K A;  2KT1 A;  1WJQ A;  3RER A;  4CC3 A;  4IUV A;  4Y91 A;  3EH2 A;  1B70 A;  5HGQ A;  2H8H A;  4HKE A;  2NYS A;  3JCM f;  4E7J A;  3VRZ A;  3CQT A;  4ANJ A;  1YI2 Q;  1YIT Q;  3WQZ A;  3CCE T;  3A32 A;  1VQL A;  11AS A;  2K3X A;  1M2V A;  4LDX A;  2FHD A;  2ZZD A;  5GAO l;  3HXY A;  1QMC A;  4J8O A;  1M8M A;  3MP6 A;  1N6A A;  3FJP A;  1NPR A;  1D1A A;  2E6N A;  4M7A F;  1X6O A;  2EGC A;  2C0O A;  3ZL7 C;  3TVT A;  1AHJ B;  4Q15 A;  3HRU A;  4KBM B;  2ZNI A;  1H4Q A;  2NS6 A;  2OTJ T;  2DRK A;  4ZIB A;  1QKW A;  1M90 C;  2YLB A;  1UGP B;  2LX9 A;  5GAN 7;  1QVG A;  3A7A A;  3L2W A;  1HJD A;  2A3L A;  3CMA A;  4FU6 A;  4IIM A;  1M3C A;  3EFO A;  2YUN A;  2CSI A;  3H0F A;  2PTK A;  1B7Y B;  3LWH A;  4HWO A;  1SRL A;  3QO3 A;  2COW A;  3M5A A;  2QXF A;  3HFV A;  4LE9 A;  2YT6 A;  3PVQ A;  1G3S A;  2EGE A;  1UEB A;  2EJG A;  1E24 A;  1YWP A;  4M78 G;  1Q7Y C;  4YRT A;  2QAS A;  2RJE A;  1QVG S;  2RHS B;  3S3O A;  2ESW A;  3JCM V;  1Q81 R;  3EFR A;  5FU7 B;  2QA4 A;  1B76 A;  1I5O B;  2LMJ A;  4DBQ A;  4WTO B;  3X28 B;  3OW2 P;  3QWX X;  2DRM A;  1OZ3 A;  2ZCF B;  1NJ2 A;  1NYG A;  1AWO A;  3G1J A;  2FG0 A;  4LVI A;  3A1P A;  3GPL A;  2YWW A;  2EL9 A;  2QGF B;  2L3P A;  1E1O A;  5DLQ E;  1WHK A;  2MAM A;  2YHT A;  1YWO A;  4M75 D;  1LOJ A;  4N4G A;  3QYH B;  2JUF A;  5A2Q E;  3UFG A;  2BE9 B;  4RKU E;  4FYW B;  4C92 E;  2MMP A;  2FPE A;  2RO0 A;  3LSQ A;  1CSK A;  2BZX A;  4TVY A;  2LCC A;  4PK4 A;  5CCA A;  2E64 A;  3ZEH A;  5GAN 8;  1X43 A;  2I4O A;  4QW2 A;  3PIP A;  3CCS Q;  3A74 A;  4TTV A;  4M77 G;  3HFN A;  2KRM A;  4PFO A;  1CKB A;  2CSQ A;  4C8Q F;  3M0U A;  2YRD A;  4OMO A;  5FU7 C;  2CIM A;  2E1H A;  4CC2 A;  4E7S A;  3CCV Q;  1S72 A;  2DZ9 A;  2DTO A;  1YI2 T;  1YIT T;  4CS4 A;  1JQQ A;  2F5K A;  4LNP A;  5GMK h;  3NGP A;  5GAN j;  1B7Y A;  2EQK A;  3QKJ A;  1H92 A;  2JT4 A;  2ZPG B;  1D1C A;  1RI9 A;  4YYE A;  1VQ4 Q;  5DLO A;  2Q7E A;  4RDX A;  1GXI E;  2A7Y A;  2P0L A;  2C8M A;  1SET A;  2KK4 A;  4A4H A;  2RHS A;  4YPF A;  2B8A A;  4J6X A;  4JRQ A;  1G5I A; 
#chains in the Genus database with same CATH homology
 1OYX A;  2VGM A;  2M9U A;  4QQG A;  5LJ5 g;  3PNW C;  2XID A;  4LNS A;  3V8J A;  4BE2 A;  3OW2 S;  3SB2 A;  3OYB A;  1VQ8 A;  4FSX A;  5LJ3 e;  1M5Q 1;  3L2Z A;  1KQ1 A;  4ME7 A;  2L89 A;  3GNG A;  4KUI A;  1ATI A;  1K73 C;  2P5I A;  3I7F A;  2RJC A;  4ZGE B;  5ELN A;  3A31 A;  2JOY A;  3CBM A;  4Z02 A;  5CVI A;  2EWN A;  1IZ6 A;  2LTO A;  1JJC B;  3CPF A;  4E47 A;  5GAM j;  2P0Q A;  3M4P A;  4LD6 A;  3RL6 A;  4PJO B;  1QW1 A;  1M9S A;  2DXU A;  1K9M U;  4TVW A;  3FLG A;  2YLC A;  3S3M A;  4P5N A;  5L8R E;  4OB1 B;  2P0K A;  5J26 A;  5GAO m;  4A54 A;  3AHU A;  3UPU A;  1KD1 U;  3CCS T;  3QSU A;  2RHX A;  1O9S A;  3X26 B;  5GAO n;  3DLL A;  5C6S A;  3OYD A;  4TQD A;  3CC7 T;  3CCV T;  3ERR A;  1NJ1 A;  3CCM T;  3M59 A;  4UP9 A;  3P8B B;  4PJO C;  3H6Z A;  4M7A B;  2AKW B;  4EMH A;  1VQ4 T;  5KE2 A;  1E1T A;  4P74 C;  5FRM A;  5M9O A;  4XTX A;  4YRJ A;  1KG1 A;  3CCE A;  1B34 B;  3GIB A;  4XTZ A;  2DXT A;  3BFM A;  4C0G A;  3CPW A;  3DB4 A;  1JJC A;  3HRI A;  3URG A;  3OB9 A;  1NJ5 A;  4YRM A;  2H3J A;  3CCJ T;  3NTI A;  4P74 A;  3OYF A;  3RGL A;  4HWS A;  3MO8 A;  5LJ5 d;  2FVU A;  4OB3 B;  2RI2 A;  3CMQ A;  2V8J A;  4M7A C;  5LL6 S;  2CZ0 B;  4YCV A;  3CPW S;  4M78 E;  4HT9 A;  2DQ3 A;  1XTD A;  1EVK A;  4A4G A;  5EG2 A;  3MEY A;  3ICA A;  3KXT A;  2XU8 A;  2EQJ A;  2OTL T;  2CZ6 B;  3A8H B;  3L1A A;  2X4X A;  2IY5 B;  3E9H A;  4HA8 A;  4DA4 A;  5GMK i;  1G3W A;  2E5A A;  4FM4 B;  4WJ3 M;  4ZTU B;  1X56 A;  4M7A A;  2AKW A;  3CCQ A;  3QZ9 B;  1B34 A;  1JB0 E;  4C8Q B;  4CI0 C;  3OYG A;  3JCM b;  3MP1 A;  1IL2 A;  3OQ5 A;  4HVC A;  4M77 E;  3FC3 A;  3N5B B;  1YJN T;  5E3I A;  1KD1 C;  2KAF A;  1YIJ A;  3OYE A;  4N4I A;  3JCM X;  2WSF E;  2P0P A;  3OY9 A;  4LVK A;  5C53 B;  4HCZ A;  2AMC B;  3OMC A;  2RK2 A;  1YIT A;  2AHJ B;  1Z7N A;  2WSC E;  4BB7 A;  4C8Q C;  3MQZ A;  3A7U A;  2ZT6 A;  3M56 A;  2JNG A;  4YRP A;  1VQ9 T;  3TEG A;  1HXD A;  1G3T A;  4HCC A;  2IY5 A;  3V7S A;  1N9R A;  2DPP B;  3P8H A;  3QO5 A;  1H64 1;  2LNV A;  4J7I A;  4F7U F;  3BDU A;  3HXZ A;  4PJO D;  4TWA A;  4IUU A;  2XKO C;  4C8Q A;  2E12 A;  4AH6 A;  3HP9 A;  3H8Z A;  12AS A;  2XI9 A;  4HCB A;  3PGG A;  2JN0 A;  2L8D A;  3GNF B;  1Y7X A;  3HRT A;  3L2R A;  3INZ A;  3OBY A;  4CS2 A;  2XDD A;  3PMI A;  3G7Z A;  3A8L B;  4M75 G;  4BWA A;  4CH3 A;  2JTF A;  2GCX A;  5KE3 A;  5LJ3 d;  3R6O A;  1NE8 A;  2K57 A;  3JSC A;  4CH4 A;  3CC4 T;  3X20 B;  1BIB A;  2LRQ A;  3UT1 A;  3A7R A;  3OYH A;  3TUP A;  2QDY B;  2XK0 A;  4ATO A;  2AMC A;  2F5T X;  3CME T;  3GF5 A;  3P8T A;  3G6E A;  1YJW T;  4EMG A;  4ELY C;  4M7A D;  2K5L A;  2DK3 A;  1H4V B;  2KMT A;  2D0Q B;  4H2X B;  1U1T A;  3M4Q A;  4ELZ C;  4NL3 A;  2PVO B;  3REU A;  3KFU A;  3CCS A;  1VQP T;  2QTX A;  3LSS A;  1MHN A;  1BKB A;  4HWP A;  2PVD B;  4C0F A;  3OSV A;  2QQB A;  3JRZ A;  2KY9 A;  1WPY A;  3QTC A;  4QVD A;  3HY0 A;  3FDR A;  4LDU A;  4J7F A;  5CO7 A;  5IN1 A;  4II1 A;  4NL2 A;  3MHX A;  1TH7 A;  3M55 A;  3VBB A;  4N4H A;  5D6X A;  5D6Y A;  2LQ8 A;  2O4X B;  5C0M A;  3C95 A;  4XEO A;  1USY C;  2HBP A;  4XTW A;  3PTA A;  3L42 A;  5C51 B;  1G51 A;  3QYG B;  3QDR B;  4WF2 A;  4JS5 A;  4YRN A;  1ZBX A;  1X01 A;  1UB4 A;  3CCJ A;  3UGQ A;  1YHQ A;  1O75 A;  1K8A U;  3NTK A;  1ZQ1 A;  4C5E A;  3PCO B;  4EDU A;  4EO4 A;  4NS5 A;  4P75 C;  5CK9 A;  4H2X A;  4OLF A;  4C8Q D;  3MEV A;  5LJ5 e;  2OTL A;  4N0A C;  1USY A;  3J81 E;  5GAN g;  1BBW A;  3LLR A;  2RI3 A;  2GF7 A;  3HL8 A;  1NJ8 A;  1BI3 A;  1VQM T;  4WJ4 A;  2ZIO A;  3LH0 A;  4PKC C;  2XGT A;  4OB2 B;  4XTV A;  5LJ5 f;  3NET A;  4KT0 E;  4JUV A;  4P75 A;  3RAC A;  1VQ7 A;  4BY6 B;  3PZC A;  4L6V 5;  4UPA A;  2EQU A;  3RIR A;  2ZIN A;  4LVL A;  2RHI A;  1GGM A;  1Y71 A;  4N0A A;  1LYL A;  3M54 A;  4HT4 A;  3A8G B;  3M53 A;  4XU1 A;  3G71 A;  2LVM A;  3IKM B;  2O4X A;  5LJ3 h;  3VUZ A;  1YJN A;  3UWN A;  3TEE A;  2X4J A;  2CJB A;  4QVC A;  1DJ7 B;  2RJD A;  3TU4 K;  3JB9 J;  1VQO A;  2ZIM A;  3PCO A;  3F70 A;  2IG0 A;  4HT8 A;  2RJF A;  2C7I A;  1PYS B;  4BY6 C;  4UP7 A;  2PU9 B;  2XHC A;  3OD1 A;  4X5O A;  2ZTG A;  5GAM g;  2CGH A;  3QXE B;  1ASY A;  4F7U B;  4XEM A;  3V8K A;  1VQ9 A;  5A0L A;  1RIQ A;  1WNL A;  2DEQ A;  2PUK B;  2CKK A;  2DTH A;  4KUL A;  3QHS A;  2VXE A;  3L2U A;  4Q6G A;  3QG1 A;  2E3C A;  2VV5 A;  4X34 A;  1H4S A;  1HK9 A;  3OW2 A;  2D6F A;  4D6W A;  1K8A C;  1QP2 A;  2PUO B;  4M75 E;  3QO8 A;  1KOG A;  3JCM g;  3MEA A;  4KR2 A;  3DLM A;  4XK8 E;  2HQX A;  4MDX A;  1QVP A;  3PFS A;  3HSB A;  3X24 B;  4QQ6 A;  4G84 A;  1Y96 B;  2LT4 A;  3I56 A;  4B9W A;  5CIU A;  4C5H A;  1Q86 U;  1B8A A;  3NEL A;  2Q7H A;  2K5F A;  1YFR A;  5I2M A;  3MP8 A;  1FYF A;  3BJU A;  1X54 A;  5C52 B;  3JAM E;  3CC4 A;  4C92 F;  3SWN B;  4XQ3 A;  1WGS A;  1PYS A;  1VQK A;  1I5L A;  3CCU T;  4LDY A;  3TEH B;  2ZT8 A;  3CME A;  1YJ9 T;  4X9D A;  2RM4 A;  4YCU A;  1XNI A;  2RA2 A;  2MI6 A;  4F7U A;  2ARS A;  1NZ9 A;  4CRI A;  1U1S A;  5A0D A;  5LJ3 f;  2GQV A;  1LNX A;  2DO3 A;  4E7L A;  2QQR A;  4BI4 A;  1VQP A;  1FXX A;  2LC4 A;  4DPG A;  2HNI A;  5CQY A;  3T9N A;  1UGR B;  4BE0 A;  3JB9 F;  2HQE A;  2L5Q A;  4FT4 A;  1I8F A;  3SWN C;  1ADJ A;  2ZPF B;  2Q5I A;  4J83 A;  2XTI A;  3ZBD A;  4V2S A;  1QF6 A;  5HK0 A;  3OYM A;  3X25 B;  1VQ6 T;  1WQW A;  4E7K A;  3UGT A;  5GMK l;  1W66 A;  4HWR A;  4PJO G;  1PSE A;  3L4G B;  1BBU A;  4JRI A;  3WVE B;  1Y96 A;  4BW9 A;  2DDZ A;  2XDP A;  3RKY A;  3CCR A;  4EX5 A;  2DAQ A;  4NCX A;  3HFO A;  3SWN A;  4CS3 A;  4PLI A;  1UGQ B;  3TEH A;  4YDQ A;  3CC2 T;  3WVD B;  5GAO p;  5HK3 A;  1XOV A;  1R8O B;  2KDS A;  4RQE A;  3MET A;  1M4Z A;  4TVA B;  3A8O B;  1KQ2 A;  2ZT7 A;  3E9F A;  4RG8 A;  3HFZ B;  1X2G A;  4QVZ A;  2ZGW A;  4M7A G;  3OS2 A;  3GP8 A;  3G4S T;  3NTH A;  4A4K A;  4EMK C;  2G4C A;  4PJO A;  5KCH A;  4TQF A;  1RI0 A;  1W2B A;  3OMG A;  2DU7 A;  4O6J A;  5IT9 E;  3FB9 A;  2OTJ A;  2CYZ B;  3JCM P;  4RCC A;  4G85 A;  1VQ5 T;  1EOV A;  2M0O A;  2J3L A;  3CD6 T;  3VQV A;  2JVV A;  3SFM A;  4BDZ A;  2K4Y A;  2ZT5 A;  4IUR A;  3OS1 A;  1X75 C;  3QPH A;  2I2L A;  3HXV A;  3L4G A;  1N27 A;  2ZPI B;  4H2W A;  3SDZ A;  3MF1 A;  1VQL T;  1W2B S;  3FRN A;  3HXW A;  4OVA A;  1YB3 A;  2O01 E;  2LQK A;  3HHT B;  4O2D A;  2ZZG A;  1YFT A;  4BI3 A;  1M1F A;  3OYL A;  3E9I A;  3NEN A;  4TVA A;  1K9M C;  2X4W A;  3HFZ A;  3PT9 A;  1NJI U;  5FU6 B;  4BD3 A;  3CMA T;  3LX7 A;  4XU2 A;  4OMF B;  3HRS A;  3OYY A;  4IUQ A;  1X55 A;  3V8L A;  4C8Q G;  3L2Q A;  4E7H A;  3P8Y A;  5CKB A;  2JZ2 A;  3ER0 A;  3IAL A;  4M78 F;  4MMK A;  4PNO A;  4LD9 K;  3R07 A;  3VKI A;  2V8I A;  1N8R U;  4P3P A;  3VYG A;  1YI2 A;  3LWI A;  4YRQ A;  2EIF A;  2ZR2 A;  1EIF A;  1JBM A;  1H3Z A;  3J80 E;  2ZXF A;  4C92 B;  5FU6 C;  3A8M B;  2Q5H A;  2LCL A;  4J6Y A;  2CZ7 B;  3FIF A;  1BIA A;  2CS7 A;  2GFA A;  2ZZE A;  1PSF A;  2PVG B;  2D9T A;  3QJY A;  3VUB A;  3J7A F;  2I4N A;  4M77 F;  1OZ2 A;  1EFW A;  3VV0 A;  2DZC A;  3CCU A;  2FL7 A;  1RL2 A;  1S72 T;  1YJ9 A;  5CKE A;  4JRK A;  2EFI A;  4LVM A;  5GMK m;  4A4F A;  5GAN 5;  3JB9 I;  5GAN e;  4RQF A;  4YRR A;  4C92 C;  2OAU A;  2BKD N;  4M7D D;  2QHS A;  3E19 A;  2VGN A;  1VUB A;  2RB6 A;  5KCO A;  3DKM A;  5GAN f;  4ZTF A;  5LJ5 h;  3TRE A;  4H2V A;  4XAX B;  3JCM J;  4R55 A;  4BE1 A;  2A8E A;  1M90 U;  4Q5W A;  4PJO E;  4E7I A;  2CJ9 A;  2QQA A;  3LGL A;  4MZP A;  3BDL A;  4C92 A;  3OYK A;  4YRL A;  2DTI A;  3A5Y A;  1NJI C;  1WLE A;  3QII A;  5GMK j;  5GAN 2;  1G5V A;  3CC7 A;  2EJ9 A;  5HKC A;  3CCV A;  2EJF A;  4UC4 A;  3CCM A;  2KQW A;  4GY5 A;  2ZNJ A;  1VQ4 A;  4DOV A;  5GAM e;  1N8R C;  4M7A E;  3JCM Q;  2RH2 A;  2LT1 A;  4YRO A;  3OYN A;  3C12 A;  4X9C A;  2ODR C;  4EPC A;  5GAN 4;  3HXX A;  5GAM f;  4FL6 A;  3VJP A;  5K1X A;  3EFS A;  3MEW A;  2DKG A;  4LVJ A;  3QO7 A;  1YBY A;  3HXU A;  3ZFJ A;  5AYF A;  2QQS A;  4M7D F;  4YCW A;  1WQ7 A;  1ASZ A;  4ZGD B;  4JJN K;  3VQX A;  2E6Z A;  3QUI A;  1VQ5 A;  2CZ1 B;  3JCM e;  3O8V A;  3FEO A;  1BI2 A;  2FB7 A;  1WU7 A;  3DB3 A;  5D6W A;  5J39 A;  2Y90 A;  1QE0 A;  3VQY A;  5CR2 A;  1VIF A;  4J6W A;  3CCL T;  3C4S A;  1BYM A;  2XD0 A;  2RI5 A;  3C94 A;  1ADY A;  2M16 A;  3UDC A;  2ZPH B;  4RG2 A;  3RKX A;  5IAY A;  2VXF A;  1W4S A;  5FRN A;  2MF2 A;  3NFC A;  1KHI A;  3L2V A;  2CJA A;  2X35 A;  4C8Q E;  2L3R A;  4M78 B;  2V8K A;  4P72 C;  2E41 A;  1N9W A;  2R57 A;  4C92 D;  2DIQ A;  4Y28 E;  1K73 U;  4PG3 A;  2PME A;  2PQW A;  2F69 A;  1VQN T;  5HY6 A;  4P73 C;  3HPW A;  2EKO A;  4L87 A;  4FIB A;  1X2H A;  3BW1 A;  4P72 A;  3CCQ T;  2J3M A;  4UP8 A;  1JRI A;  2DD5 A;  3RUX A;  3LYI A;  4OF1 A;  4LDW A;  5GAN 6;  3CXC A;  3JB9 D;  4M78 C;  4HWT A;  4M77 B;  1U8R A;  3I55 T;  1KMN A;  1L0W A;  2RHY A;  4IUP A;  4ZN1 A;  3QNE A;  4P73 A;  3UH0 A;  3NEM A;  4BUG A;  1YIJ T;  4F7U G;  5GAN 3;  3OYA A;  1J5W A;  1IRE B;  2DD4 A;  3CXC S;  2ART A;  4M78 A;  3QJ6 A;  2RHQ B;  4C0D B;  3S6W A;  2ODR D;  3SD4 A;  4YRS A;  1SER A;  2E10 A;  4TVR A;  5K1P A;  4JRP A;  4M77 C;  3GOX A;  4H2Y A;  1EQR A;  5GAO q;  1LJO A;  1P92 A;  4YRG A;  5GAN d;  1I4K 1;  3MEU A;  1M8V A;  2WSE E;  4J5Y A;  2NLU A;  3OS0 A;  4C0Z A;  3IKL A;  3VQW A;  4JLI A;  4P71 C;  1YJW A;  2IVW A;  1XQH A;  4FT2 A;  2XDB A;  3IG2 A;  3ASK A;  3M57 A;  2ZPE B;  4JLG A;  5F5W A;  2HAX A;  2HD0 A;  4OB0 B;  4M77 A;  2QEX T;  4K87 A;  4C0D C;  1YCY A;  2QHV A;  3P8V A;  3BY7 A;  2K5I A;  3JCM c;  4RMO A;  2BUD A;  4IKF A;  3JCM W;  3E9G A;  5J3B A;  2ALY B;  2P4T A;  2E65 A;  4IUT A;  2X4Y A;  1H4T A;  3M58 A;  4M75 F;  3EAE A;  4C5G A;  4P71 A;  3LW5 E;  2R5M A;  2DXC A;  1Q81 U;  3OYJ A;  4P3O A;  5GAO r;  1SRY A;  2RHQ A;  1FX7 A;  4XTY A;  4L5G A;  3G6E T;  4YP0 A;  2Q7G A;  1C0A A;  4M7D B;  2QHU A;  4ZTZ B;  4BDY A;  1FWZ A;  1VQZ A;  4EMK B;  3OYI A;  1WJS A;  2VC8 A;  5GAM d;  4YRI A;  1M1G A;  3CBP A;  1E22 A;  2ZZF A;  4K86 A;  3CBO A;  3LGF A;  2I4M A;  1QVF A;  3HKS A;  4M7D G;  3OS5 A;  5GMK e;  3RF1 A;  5ELO A;  3WXM B;  2RD1 A;  4QQD A;  4RMF A;  4PL6 A;  3RES A;  2I4L A;  3CEY A;  4ZGJ B;  2MWO A;  4L59 A;  3ME9 A;  2ZCE A;  5CKH A;  4ZTJ A;  4A53 A;  4M7D C;  5LJ5 j;  4M78 D;  5FRO A;  2E5Q A;  3JCM d;  2ALY A;  1QVF S;  3CCL A;  5CAI A;  1Q86 C;  3MF2 A;  1VQM A;  5CQX A;  4CH6 A;  4MML A;  4J15 A;  4H02 A;  2BIV A;  2VYT A;  5A0G A;  1OI1 A;  2RK1 A;  3QBY A;  1BI0 A;  2Y4X A;  3LC0 A;  4XU3 A;  1KHC A;  2R5A A;  4P3N A;  3S3N A;  2ZR3 A;  1VIE A;  4M7D A;  5I2S A;  1YHQ T;  5FLX E;  2XIC A;  4EMK A;  1JJ2 A;  1ZHI A;  2RHU A;  2K2V A;  4O5V A;  1SSF A;  4PHC A;  3TCJ A;  5LJ3 g;  4M77 D;  3REX A;  4JDS A;  4OGC A;  3VYH B;  5GAN h;  5I21 A;  4MZM A;  1VQN A;  1EIY B;  1EVL A;  4H2T A;  4DQ2 A;  2EAY A;  4R56 A;  1V29 B;  2E70 A;  1Q81 C;  1JJ2 S;  3A5Z B;  3V7C A;  2QHT A;  1SES A;  1WYD A;  1VQ7 T;  1M1K U;  2DJZ A;  4CH5 A;  3PMT A;  4C5I A;  1KC8 U;  1KMM A;  5KNN A;  2VUB A;  4F7U E;  3I55 A;  3G71 T;  4JS4 A;  3GLX A;  2C06 A;  4YRE A;  2QA4 T;  2G3R A;  3E1S A;  2YRV A;  1Q82 U;  2DVE A;  4KR3 A;  1NJ6 A;  1VQO T;  1KQS A;  4OP0 A;  2QQ9 A;  3VU3 C;  2WAC A;  5KH6 A;  1HTT A;  2FYK A;  3DSQ A;  2PMF A;  3HY1 A;  4WI1 A;  1YGB A;  4OGE A;  5GAM h;  4YRF A;  5DM7 R;  3QZ5 B;  1NYQ A;  3OBW A;  4A4E A;  4DOW A;  2Y4Y A;  1NYR A;  4XU0 A;  4C92 G;  5CKD A;  1EIY A;  4XTU A;  1KQS S;  3A5Z A;  5LJ3 j;  3OSS C;  2EYQ A;  1G5H A;  2MWP A;  4ZN3 A;  1NNH A;  4H2U A;  4M75 B;  2DXB A;  5CKF A;  4YRC A;  3V7R A;  1G3Y A;  3JCM h;  2GFU A;  2QEX A;  1D3B B;  3M4G A;  5DY9 A;  3KUF A;  4YTL A;  4PLL A;  4VUB A;  3P8D A;  1HC7 A;  3RMS A;  4MZT A;  2XG8 D;  3JB9 G;  1YFS A;  3HRK A;  3JB9 H;  2KVQ G;  4NOY A;  1I81 A;  3Q1J A;  2DQ0 A;  3I56 T;  3M9Q A;  3RKW A;  4BAC A;  3OA6 A;  1WJR A;  1Z7M A;  2DIG A;  1VQ6 A;  4LDV A;  1VQ8 T;  1VQK T;  3PIO A;  3M4Y A;  1Y07 A;  2ZPB B;  3G1Z A;  1NPP A;  2RHZ A;  1B70 B;  4M75 C;  3HTZ A;  2QI2 A;  2JTM A;  1M1K C;  4B9X A;  4K88 A;  3RMQ A;  4M7D E;  1KC8 C;  1UGS B;  3OYC A;  1Q7Y U;  4YRK A;  3MCA B;  4BI8 B;  2ARU A;  1N9S A;  3CC2 A;  4KQE A;  2EQM A;  4M75 A;  1Q82 C;  1QP3 A;  1MGQ A;  4RCB A;  3W3S A;  4KUD K;  1D3B A;  2M1H A;  3G4S A;  2KSS A;  4PJO F;  1BI1 A;  2K3Y A;  2DU5 A;  2LDM A;  3KBG A;  4MDW A;  4GLK A;  2R58 A;  3CCR T;  4H2S A;  4E51 A;  3CD6 A;  1WJQ A;  3RER A;  4IUV A;  4Y91 A;  1B70 A;  5HGQ A;  4HKE A;  3JCM f;  4E7J A;  3WQZ A;  3CCE T;  3A32 A;  1VQL A;  11AS A;  2K3X A;  4LDX A;  2FHD A;  2ZZD A;  5GAO l;  3HXY A;  4J8O A;  3MP6 A;  1N6A A;  3FJP A;  1NPR A;  2E6N A;  4M7A F;  1X6O A;  1AHJ B;  4Q15 A;  3HRU A;  4KBM B;  2ZNI A;  1H4Q A;  2NS6 A;  2OTJ T;  4ZIB A;  1M90 C;  2YLB A;  1UGP B;  2LX9 A;  5GAN 7;  1QVG A;  3A7A A;  3L2W A;  2A3L A;  3CMA A;  4FU6 A;  1B7Y B;  3LWH A;  4HWO A;  3M5A A;  3QO3 A;  2QXF A;  3HFV A;  1G3S A;  1UEB A;  2EJG A;  1E24 A;  4M78 G;  1Q7Y C;  4YRT A;  2RJE A;  1QVG S;  2RHS B;  3S3O A;  3JCM V;  3EFR A;  5FU7 B;  2QA4 A;  1B76 A;  3X28 B;  1OZ3 A;  2ZCF B;  1NJ2 A;  4LVI A;  3GPL A;  2EL9 A;  1E1O A;  5DLQ E;  2MAM A;  2YHT A;  4M75 D;  1LOJ A;  4N4G A;  3QYH B;  2JUF A;  5A2Q E;  3UFG A;  4RKU E;  4C92 E;  2MMP A;  2RO0 A;  3LSQ A;  4TVY A;  2LCC A;  5CCA A;  2E64 A;  3ZEH A;  5GAN 8;  2I4O A;  4QW2 A;  3PIP A;  3A74 A;  4TTV A;  4M77 G;  3HFN A;  4C8Q F;  5FU7 C;  2CIM A;  2E1H A;  1S72 A;  2DZ9 A;  2DTO A;  1YI2 T;  1YIT T;  4CS4 A;  2F5K A;  5GMK h;  5GAN j;  1B7Y A;  2EQK A;  3QKJ A;  2ZPG B;  4YYE A;  5DLO A;  2Q7E A;  4RDX A;  1GXI E;  2A7Y A;  2P0L A;  2C8M A;  1SET A;  2KK4 A;  4A4H A;  2RHS A;  4YPF A;  2B8A A;  4J6X A;  4JRQ A;  1G5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...