4XTXA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 57 with azide in place of ribose 2'oh
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtxA01
3GIBA 2QTXA 2FYKA 3V7RA 3L4GA 4M7DG 1G51A 3A7AA 2IY5A 2DU5A 1SERA 2PMEA 1G5HA 2YLBA 4KR2A 1PYSA 4H2XB 4M78E 4M77E 2ZTGA 4C8QD 4JLIA 2ARUA 5LJ5d 5GAN5 2ZT7A 4HWRA 1YB3A 3L4GB 1E24A 5LJ3j 1B70B 3AHUA 2ZGWA 3EFRA 5GAN8 3QO5A 4E51A 3NENA 4N0AA 4M75C 4PNOA 4YROA 4YRTA 4XTVA 4M7DD 1GGMA 3TEHA 4UP7A 3RL6A 1NJ1A 4F7UG 1HTTA 4TTVA 3A31A 4YDQA 5C52B 1EIYA 1NJ5A 1WQ7A 4C92D 4TVWA 5LJ3h 3P8VA 4YCUA 4P3OA 1EVKA 5HGQA 4DQ2A 1QE0A 2ZR3A 1J5WA 1EFWA 5GAMj 3JCMc 3EFSA 1USYA 2DXTA 5GAOl 4P3NA 4M78A 4YPFA 4OP0A 4M77A 3IALA 1NNHA 4EMGA 4M75B 5GANj 2DU7A 4M7AC 1D3BB 1NJ6A 3KFUA 5LJ5f 3JCMb 5GAMh 1EIYB 1E1TA 2DQ3A 5GAN6 1EOVA 1LNXA 2JN0A 1Y96A 4P75A 1MGQA 5ELNA 2I4NA 4ZIBA 2J3MA 4PJOE 4RCBA 5GANh 4C8QF 1HC7A 1X2GA 4ZTUB 4M75G 4M78B 3M4GA 1H4TA 2RM4A 3VQVA 2ZINA 2ZIOA 4HWPA 5GAOm 4UP8A 4RQFA 2Q5HA 2XGTA 1LOJA 2HNIA 2E5AA 4WJ4A 4YYEA 4Q15A 4KQEA 4HVCA 3HXYA 3HXXA 4Q6GA 4M7DF 3JCMQ 4C8QC 4HWOA 4WI1A 1Y96B 2Y90A 1SESA 3QO8A 4M78G 4C92F 1X55A 1NJ8A 2RHSA 2DZ9A 5LJ5e 4P71C 2YHTA 4XU1A 2VXFA 4MMLA 4ZTZB 3ERRA 2G4CA 3VU3C 3NEMA 3JCMV 4H2WA 4C92C 5GMKi 4X9DA 1X54A 4QVDA 3VBBA 4YRIA 4H2VA 2DKGA 3G1ZA 3JB9D 1E22A 1X01A 3V8JA 3HRKA 3QNEA 3LC0A 1B7YB 5C51B 2J3LA 1C0AA 4M75E 2C8MA 3RGLA 4F7UF 4UP9A 2ODRD 1B70A 4M78D 5I21A 5GMKl 4M77D 2ZIMA 4EMHA 4PJOB 4J6WA 3RKYA 1H4SA 3RERA 2DZCA 3FJPA 3VQWA 5GAN3 3HXUA 3QO7A 3WQZA 3RESA 3UGTA 1M5Q1 3JCMJ 2RHQA 5DY9A 4XTYA 1BBUA 3PZCA 4P73C 5GMKe 3TEGA 3RKXA 4YCWA 4YRLA 3JCMd 1E1OA 3MF1A 5E3IA 4M7AE 4HWSA 4BWAA 2QHSA 2RA2A 4PJOG 2EJGA 2AMCA 1YFSA 3JCMX 4P72A 3FB9A 1WYDA 2DEQA 4XEOA 4TQFA 3VQYA 4M75A 1VQZA 3RACA 4X9CA 1D3BA 5GMKm 3HXWA 2VXEA 4JUVA 5LJ5g 2E41A 2RHQB 2CJAA 2CJBA 4JRIA 2ARSA 3V8KA 2QHVA 2DTIA 2ZNIA 1NJ2A 1NYQA 3JB9F 5KNNA 3M4PA 1Z7MA 3PCOB 2AMCB 1H4VB 2ZT5A 2I4LA 1JBMA 1U1SA 1B76A 1ATIA 4C8QE 3SWNC 3V7CA 5LJ3d 2E1HA 1WLEA 1FYFA 3UGQA 2Q7EA 1SRYA 1KQ2A 4M78F 4M7AA 3P8YA 4M77F 4YRCA 4XQ3A 4L87A 2PMFA 3JCMf 2E64A 3A7RA 1U1TA 4KR3A 3RIRA 4P3PA 4WF2A 4YRKA 4O2DA 1X56A 1WQWA 4YRJA 4XTZA 2YLCA 5GMKh 2AKWA 5GAMd 4XTXA 4C92E 4RQEA 1H4QA 4TVAB 3HY0A 2C7IA 3QTCA 1KMMA 4UPAA 3JCMW 4CH4A 4M7AB 2ARTA 1LYLA 4CH5A 4EMKC 2QHTA 3LSSA 5GANd 1Z7NA 4MMKA 4X5OA 2FB7A 5GAOr 3NELA 4V2SA 4NL2A 1TH7A 5K1PA 2K57A 4XTUA 3VQXA 1I8FA 1QF6A 1HK9A 2EJFA 1KMNA 4TQDA 5LJ3f 3TUPA 1I5LA 4JRKA 1B7YA 3A5YA 4H2YA 4QVCA 3JCMe 2EJ9A 3REUA 1M8VA 3A5ZA 2AKWB 3V7SA 3I7FA 4P71A 4M7AG 3HFZB 4M7DC 4P74C 3DSQA 12ASA 4XEMA 4PJOA 1EQRA 1W66A 1YFRA 4TVYA 4J15A 2ZT8A 4M75D 4Y91A 3HTZA 4HWTA 2ZR2A 4A53A 1ADJA 1I81A 3RKWA 4YRMA 4C8QB 4RMFA 5GAMf 5GAN7 1N9WA 2DTHA 1YFTA 3A7UA 1B34B 2EAYA 5GAOn 1KQ1A 5F5WA 3JB9I 2ZZEA 1H641 2ZZGA 1B8AA 4M7DB 1WPYA 3INZA 4PG3A 5K1XA 1HXDA 1EVLA 3PGGA 5LJ3e 4H2SA 4C8QG 4M7AD 11ASA 2Q7GA 4HT9A 4A54A 4XU0A 4C92B 3E9IA 1BIBA 5LJ5j 3HSBA 4P73A 3FIFA 3A32A 1BBWA 3QSUA 4J6YA 3BY7A 4CS3A 3MEYA 4H2TA 2DVEA 3PCOA 4H2UA 4EX5A 3UFGA 4G85A 2XTIA 5GAMe 3HXZA 2EWNA 3JCMh 4C92G 5LJ5h 1SETA 2ZXFA 4K88A 3JCMg 4K87A 1N9RA 5C53B 1JRIA 5GANe 4M75F 3HXVA 4F7UB 4J5YA 4XTWA 4YRNA 3HFNA 2CJ9A 4YP0A 3BDUA 2DDZA 2CIMA 3E9HA 4K86A 5GAOp 4P72C 4BW9A 2IY5B 3RF1A 1ADYA 4N0AC 3BW1A 2QHUA 4YRGA 1X2HA 3SWNA 4TVAA 3L1AA 5GAN2 5CAIA 4PJOD 4XU3A 5GMKj 3IG2A 3IKMB 3P8TA 2DXUA 1PYSB 4J6XA 3QO3A 2ZCEA 4M7AF 2ZZFA 2CGHA 3W3SA 2DTOA 2E3CA 2RB6A 5LJ3g 4M7DE 1USYC 2DQ0A 2ODRC 3REXA 2EL9A 4M78C 4M77C 4CS2A 2ZT6A 4EO4A 3V8LA 3JCMP 1LJOA 1KOGA 3OD1A 4AH6A 3SWNB 4NL3A 3HFZA 4G84A 2ALYA 3TEHB 3UH0A 4HA8A 2I4OA 4LNSA 2DJZA 4EMKA 4CH6A 4YRRA 5GAN4 1YCYA 4RDXA 1ASZA 4C8QA 1RIQA 4P75C 5GAMg 3L2ZA 3JB9J 3LSQA 1WU7A 4OLFA 1G5IA 2P5IA 3BFMA 1B34A 1WNLA 1BIAA 2RD1A 1JJCA 4M77B 3JB9H 4YREA 5GANg 1NYRA 3HRIA 2E10A 4YRQA 1I4K1 4NCXA 4M7DA 4P74A 3HFVA 4XU2A 4F7UE 2ALYB 4WJ3M 3HY1A 2I4MA 3JB9G 4YRFA 4EMKB 4TWAA 3QUIA 2Q7HA 4C92A 4PJOF 3IKLA 3BJUA 4HT8A 4RCCA 3M4QA 4M77G 1L0WA 4PHCA 3R07A 4YCVA 2I2LA 1JJCB 3A74A 1IL2A 3SB2A 2Q5IA 5GANf 2ZNJA 3QHSA 4CS4A 3RUXA 5ELOA 4PJOC 1ASYA 3CMQA 4H02A 4YRSA 4DPGA 3HFOA 4YRPA 2E65A 1N9SA 5GAOq 4H2XA 2P0LA 3ICAA 4F7UA 1YGBA 4CH3A 4NOYA 3MF2A 2VC8A 2RHSB 3NETA
chains in the Genus database with same CATH superfamily
3MP6A 2DETA 2FYKA 2RK1A 2KYMA 3L4GA 5CKEA 1G51A 2OTJT 1KD1R 2V8IA 1WGSA 1KD1C 3A7AA 2A0FB 4RTYA 2RJCA 3LH5A 3LYIA 2DXBA 2CUDA 2PMEA 1R77A 1G5HA 2DL8A 1NLOC 4QQDA 5KYXB 1UGSB 3OMCA 2BE7D 3L42A 2J05A 1AWJA 2ZPFB 4C8QD 4L6V5 1SRLA 4QW2A 3X26B 1QWEA 1VIFA 1RAGB 2ZT7A 2D1XA 1B70B 2FRWA 4N0AA 3VS6A 2R57A 2ZPBB 4XTVA 3TEHA 3CC2A 3LWHA 2DRKA 2NUPB 3QDRB 4ANJA 4YDQA 5C52B 1D0XA 2VB6A 3P8BB 1WQ7A 1EIYA 4TVWA 3HTRA 5LJ3h 1YJNQ 2KXDA 4MZMA 4F17A 4YCUA 1WIEA 4DOWA 5HGQA 5FU6C 1PCXA 3JCMc 1USYA 1DJ7B 2GBQA 4P3NA 4M78A 2HQEA 4EMGA 1OULA 1UGQB 4M75B 3CC2T 2DU7A 1D3BB 3OYIA 3ZEHA 2KR3A 2MWPA 1W70A 1E1TA 1WYXA 4ZTFA 4KH0B 2KI7A 2XD0A 2KQWA 2LVMA 2I4NA 4ZIBA 5A0LA 2A36A 2F2VA 1K0SA 3VRZA 2V26A 3CPWS 5GANh 5C6SA 1ZBJA 3M4GA 1H4TA 2RM4A 3VQVA 2A28A 3TVTA 5GAOm 4MDXA 4UP8A 2Q5HA 2EW3A 2I0NA 2Z0WA 3CCMA 4HVCA 1RL2A 4Q6GA 2XMFA 4FL6A 3JCMQ 4M7DF 2G3RA 3VUBA 1RLQC 2KRMA 2QK0A 2CUBA 3VS3A 1K73R 1K73C 2OI3A 1E6HA 4GY5A 4M78G 2CP3A 1NJ8A 1KIKA 5LJ5e 2MI6A 1JQQA 3HL8A 4MMLA 1QVGS 3ERRA 2JS0A 2CYZB 3CCMT 3VS4A 3NEMA 3E9FA 5D6XA 3JCMV 5IH2A 5A2QE 5M9OA 1MV0B 1QCFA 2SEMA 2YRVA 3JB9D 4PFZA 1B7YB 2R58A 4F7UF 1TUCA 1YIJA 3CC7A 4JJCA 1MUZA 5I21A 1ZHIA 1VQOA 1H4SA 2QQBA 3RERA 2D8JA 2DM1A 2FPDA 5CKFA 2QASA 1M5Q1 1HJDA 4ESRA 2FVUA 2RPNA 1D1AA 1BU1A 1PHTA 1VQLQ 1E1OA 5E3IA 1QVPA 2JM9A 4D6WA 2VASA 2COYA 1VQOT 3GF5A 3KXTA 4XEOA 3E19A 1XOVA 3S3OA 1AD5A 5CR2A 1EIFA 1K9MR 4DBHA 5GMKm 1K9MC 1PM3A 2VXEA 3CXCS 2DBKA 4OMNA 5LJ5g 2E41A 1GRIA 2CJAA 2RHQB 1W2BS 3G71A 2VKNA 2DPPB 1TXQA 4JRIA 3V8KA 3VS1A 1MV3A 1KD1U 2QEXQ 2RQTA 3HRTA 4J7IA 2EYQA 3EG3A 3HRUA 1ATIA 3SWNC 3OW2A 4C5GA 2ZPIB 3QDFA 4ZNXA 3P8YA 4XQ3A 2CT4A 2PQWA 3JCMf 3G71T 2E64A 1VYUA 2EVRA 3EFOA 4P3PA 1SF9A 2FHDA 4O2DA 1X56A 1WQWA 1BI2A 2YLCA 2AKWA 1NE8A 2C7IA 2LX7A 2L5QA 1KMMA 4UPAA 4CH4A 4M7AB 3A8GB 3H8ZA 4N4HA 3CBPA 4MMKA 1NLPC 3L2UA 2FB7A 2RI5A 1TH7A 5K1PA 8AT1B 4XTUA 4BE2A 3VQXA 2L3QA 1IZ6A 2DYBA 3A5YA 2BTTA 4H2YA 4QVCA 2EJ9A 4AT1B 3REUA 4K11A 1QCNA 4QT7A 3OA6A 4M7DC 1SPKA 2RN8A 4J9EA 4PJOA 1W66A 1Z9ZA 2HEQA 1KQSA 4J15A 2OTJQ 5KYUB 1IB8A 2JMCA 3H9NA 3RKWA 2O9SA 4J9HA 5GAMf 4HKEA 4FYVB 1XJWB 2DTHA 1BKBA 2EAYA 2D0QB 4C5EA 1IGQA 1KQ1A 1FMKA 3C95A 2GF7A 2FZCB 2HBPA 2LNVA 1B8AA 1WPYA 1ZQ1A 4KBMB 4FSSA 2PTKA 5LJ3e 2HDAA 2EQIA 5KE2A 4HT9A 3FLGA 4XU0A 4C92B 1OU8A 2LRQA 4RUGA 3RMSA 1K73U 3E9IA 3NPFA 5LJ5j 2YSQA 2K3BA 3A32A 3ZL7C 1PRMC 2DVJA 3BY7A 2B8AA 4Z88A 3WVEB 3I5RA 5J26A 4EX5A 4A4GA 4G85A 1QKXA 4WCIA 3JCMh 3FJ5A 5AYFA 4HVUA 4PK4A 4K87A 3CC2Q 2LCSA 5GANe 4LDXA 4J5YA 8ATCB 4XTWA 9ATCB 2CJ9A 4HVVA 2RHYA 2DDZA 1X6OA 5GAOp 2M16A 1X6BA 4CC7A 1JJ2A 1PKTA 2CP7A 3C0CA 3R6OA 3OQ5A 1G2BA 4N4GA 4A63B 2EKOA 2L3RA 2HSEB 2ZZDA 1X2HA 4TVAA 1LPLA 1QLYA 2EKHA 2J7IA 3M56A 2WACA 3P8TA 3IG2A 2OAWA 4J6XA 2DJQA 3QO3A 4E2FB 1Q81R 4M7AF 2E6ZA 4EIKA 1Q81C 2CGHA 3JV3A 2RB6A 2QQ9A 5LJ3g 4M7DE 2DQ0A 2ODRC 1M2OA 4IURA 1VIEA 4RMOA 1TOVA 3GOXA 3MO8A 4C0GA 5FROA 4NL3A 1K9MU 3TEHB 3M0RA 2I4OA 3G6EA 2EGEA 3UDCA 4EMKA 4DEYA 1Y57A 2CZ6B 1KHCA 1YCYA 4WTOB 1ASZA 4C8QA 4P75C 1YWOA 1NZ9A 4BY6B 4PL6A 3E9GA 1WU7A 2RQVA 4RKUE 1B34A 1RAEB 4PFPA 2JS2A 2DF6A 1BIAA 1OU9A 2DD4A 4O6JA 3JB9H 4YREA 5GANg 2IIMA 2KT1A 3G6ET 4P74A 3HFVA 1BBZA 4XU2A 4F7UE 2ALYB 1X2KA 3EGXA 2I4MA 2JTFA 3A98A 1YITQ 2Q7HA 3REAB 4AG2C 4RTVA 4IUVA 4XK8E 3BJUA 2ABLA 4RCCA 1MNEA 3PTAA 4HCCA 1L0WA 1AWOA 2DO3A 1O9SA 3R07A 1IL2A 3UA6A 2VGNA 2GGRA 2P4TA 3CMAA 1YI2T 1VQOQ 3GP8A 2E65A 2FPEA 1M2VB 2JOYA 2NUTA 1AVZC 4H2XA 2P0LA 1YHQA 4J9CA 2EQMA 3CCJA 2VC8A 3NETA 4FIBA 3C4SA 1FX7A 4RTZA 2A3LA 1R0CB 2MF2A 3CMAT 2O2OA 2DU5A 2YRDA 1PC0A 1ZX6A 4LXCA 2MAMA 2NYSA 2LT4A 1YHQT 1M8MA 3CCJT 3CCVT 2ZTGA 2HKNA 3I56A 3G71Q 3UPUA 3NMZC 3MCAB 3GNFB 2ARUA 5LJ5d 1X75C 4HWRA 4KGZB 4PJMA 3M0PA 1YB3A 3ZBDA 4DBQA 1OYXA 5LJ3j 2ZGWA 2BZYA 5IXFA 1MMNA 3FRNA 2RHXA 2LJ3A 2HMAA 3HRSA 2VGMA 4YROA 4YRTA 4M7DD 2KROA 3OYEA 1D0ZA 3CEYA 4ORZA 3RL6A 4HT4A 4TTVA 3EG9A 3KFVA 1WHJA 5KCHA 2RJEA 1VQ6T 2DNUA 1NJ5A 3I56T 1H8KA 2X4JA 2O88A 5HK3A 2H3EB 2LJ0A 1QMCA 4AFZC 1QP2A 3NTKA 2PNIA 4LDYA 3WXMB 5GAOl 3CMEQ 4YPFA 2MIOA 4OP0A 3IALA 2X4YA 2NUZA 1KQSP 3CPWA 3EH1A 5GJVB 5CKDA 5GANj 2RMOA 4L5GA 5FU7C 2RQWA 4Z8AA 4M7AC 2BUDA 4KGXB 1IXDA 2DQ3A 1LNXA 4M4ZA 4O5VA 1Y96A 2EYZA 2XI9A 4Y28E 1SHGA 2J3MA 2PUKB 4Z02A 2DL3A 3CQTA 2K3YA 1HC7A 2D6FA 3RMQA 2ZIOA 4A4HA 1LOJA 3M57A 2E5AA 1OX8A 2AKLA 4WJ4A 3OMGA 3PFSA 4Q15A 4KQEA 1QVGA 1S1NA 3HXXA 2HD0A 4PJJA 1Q81U 3LX7A 1CSKA 4JZ4A 2F2WA 4IKFA 1T0HA 3EFOB 2DE0X 2JNGA 4ATOA 3QO8A 3QZ9B 1AOJA 1X55A 1XTDA 3I55A 4LDUA 2VYTA 4P71C 4E7ZA 1ZSZB 2MPXC 4XU1A 1H3ZA 2ZPHB 3MJXA 2RHZA 2RJFA 4ZTZB 1NPRA 2FEIA 2HKQB 1OPLA 2RNAA 5HKCA 4PJNA 4H2WA 5FRNA 4C92C 4DOVA 1X54A 2KSSA 4QVDA 2DYIA 4H2VA 3OSSC 3UA7A 3G1ZA 2JZ2A 1VQ4A 3V8JA 3I55T 5FRMA 1WLPB 4GLKA 3OY9A 2EBPA 2J3LA 3RGLA 2LQKA 2ODRD 5ECAA 4NS5A 3J81E 5GMKl 4E7HA 1K8AU 2K79A 4PJOB 1TTHB 3RKYA 3FEOA 3FJPA 3VQWA 3MP8A 3RESA 3JCMJ 4XTYA 3OBYA 1VQ4T 3SDZA 4BDZA 3OYFA 3CXCA 2RK2A 3T9NA 5GMKe 3TEGA 4E6RA 5IHNA 4YCWA 1UUEA 1W2BA 2DXCA 1D0YA 4M7AE 2W10A 1T3LA 1FMWA 2QHSA 2EJGA 2AMCA 3JCMX 2JTMA 2ROTA 1S72A 1WYDA 1M27C 4TQFA 4F04B 3VQYA 5DM7R 4JS5A 4Q5WA 3A8HB 2YXYA 1IRXA 1BI3A 3E1SA 1M3CA 1GCQA 3OBWA 1ZUKA 4ZGJB 2H3JA 1X6GA 1NJIU 4J9BA 2CJBA 2ESWA 2P4RA 2ZNIA 1NJ2A 3PMIA 2J6OA 3MEUA 1UGVA 4BI3A 1Q86R 1S72T 1Q86C 5HCKA 1N5ZA 1QCOA 3CC4A 1H4VB 2I4LA 1JBMA 3VYGA 3V7CA 2VVKA 5LJ3d 2C0TA 2HQXA 3QJYA 1WLEA 3UGQA 2F5KA 1KK7A 4ELZC 4M77F 5IN1A 4L87A 3M58A 2PMFA 4C5IA 3A7RA 2EQUA 3LGFA 1M1KR 3X20B 1M1KC 3RIRA 2EYWA 5CQXA 2JXBA 3CC4T 1W4SA 4YRJA 3REBB 4EPCA 1EX4A 3MEWA 4XTXA 4C92E 1WZOA 4TVAB 1H92A 4QKUA 5GJWB 2EQKA 3JCMW 5KYWA 1LYLA 2ROLA 2QHTA 5GANd 2XKOC 4X5OA 5GAOr 2KEAA 4NL2A 1YI2Q 3QIIA 2P0KA 4HVWA 5HK0A 3A8LB 5D6WA 2DEUA 1OOTA 3VUZA 4UC4A 3QYGB 5KYYA 2M0OA 3U23A 12ASA 1BYMA 1EQRA 4TVYA 1WA7A 1ZLMA 1MMAA 5AT1B 4A4EA 1EZZB 2ZR2A 4A53A 3CMAQ 6AT1B 3Q1JA 4JJBA 1ADJA 2W0ZA 4YRMA 4C8QB 3QJ6A 2D9TA 2CP6A 1ZA1B 1YHQQ 3A7UA 1B34B 3VKIA 5GAOn 1JXMA 1D1CA 2RF0A 3DLMA 3CCVQ 1SG5A 2J06A 3A5ZB 1H641 1UE9A 3TEEA 3GBQA 4E7IA 1BCOA 2F1LA 3OS2A 5K1XA 3PGGA 1T0JA 2F5TX 2P84A 4M7AD 1X43A 2LDMA 2Q7GA 4BE1A 2BKDN 2FZGB 2O31A 2A8EA 3CD6A 2YDLA 2NLUA 1G5VA 1VQ6Q 3QXEB 1YIJT 3I56Q 3CC7T 3BE3A 3CPWP 4H2TA 3PCOA 1RUWA 3UFGA 4BI8B 1TG0A 4JLGA 1X69A 1B7TA 2EWNA 2KE9A 2QA4A 2NUTB 2V8KA 1JRIA 4M75F 3G1JA 3HXVA 4E7JA 2RHUA 4YRNA 3HFNA 2EIFA 2DA9A 3BDUA 1QWFA 2LC4A 3E9HA 3MEAA 3ULRB 2DAQA 2MOXA 3MQZA 1FXXA 3M0TA 3BW1A 3CCRA 1QVGP 1HD3A 3SWNA 2QA4T 4DBRA 5GAN2 2JTEA 5CAIA 4OB2B 5GMKj 4LN2A 1E6GA 1GFCA 2COZA 2DXUA 1AWWA 2Y4XA 4JRQA 2ZZFA 2ZPEB 4KUIA 3H0HA 1QVFS 1IO6A 1AHJB 1V76A 1ZUYA 4M77C 2EFIA 4LVMA 2HQHA 3CCRT 2AHJB 1KC8R 5EG2A 1KC8C 1KOGA 4OMMA 3OD1A 1Q82R 3HFZA 1Q82C 5KCOA 2JW4A 2DJZA 4D8DA 2PZ1A 3QYHB 4YRRA 2RQRA 4RTUA 1U06A 2K2VA 3L2ZA 4E7LA 3LSQA 3OS1A 2QDLA 1UGPB 4VUBA 1Q86U 1RABB 1JJCA 3OYKA 1ZSZC 1KJWA 4BB7A 2XDDA 1NYRA 3HRIA 3I55Q 5IT9E 2GQIA 4E47A 4M7DA 4BE0A 1OX9A 2VV5A 3M59A 3ME9A 1T3SA 3OYBA 4BACA 4C5HA 3QUIA 2X4WA 4B9WA 3CXCP 4TWAA 1AWXA 4CI0C 1M1KU 1W2BP 4CC3A 4DEXA 4YTLA 2EYXA 2J6FA 2LT1A 4M77G 2F69A 1YJWA 2L8DA 3G4SA 4PHCA 2MMPA 1RAFB 1W1FA 4GLMA 2RH2A 3F70A 2AK5A 2KRSA 2FG0A 2ZNJA 3QHSA 4CS4A 3SHWA 2DL4A 2L3PA 3EGDA 4PJOC 1YP5A 3CMQA 1ASYA 1N27A 4DA4A 1I5OB 4OMFB 1GBQA 2X51A 1ARKA 4F7UA 1ZA2B 1YJWT 3NTIA 3G7ZA 3GIBA 4KT0E 2QTXA 4KULA 3V7RA 4PKCC 4ZN1A 4M7DG 2K3XA 1FYNA 1ABOA 2IY5A 3VJPA 2ZCFB 4FU6A 2DBMA 1S72Q 1SERA 2QQAA 2YUOA 3X28B 1G3SA 3CCSA 2EQJA 5D7UA 3H41A 2IG0A 1PYSA 2J6KA 2NUPA 2KGTA 4LDWA 1I0CA 3AT1B 3SD4A 4M77E 3JSCA 4JLIA 1UJYA 3MP1A 1UDLA 2GFAA 2XIDA 3L4GB 1E24A 1MMDA 1IREB 3TSWA 3AHUA 4KUDK 3EFRA 1C6VX 3NENA 1JB0E 4M75C 5IAYA 4PNOA 3S6WA 3CCST 1LCKA 4OGCA 4UP7A 4QQGA 1PG5B 2QGFB 4D8KA 1NJ1A 4F7UG 5KH6A 4LNPA 1HTTA 3S3NA 1KHIA 4DQ2A 1QE0A 2ZR3A 1J5WA 1EFWA 2L0AA 3EFSA 2V1RA 2DXTA 2M02A 1M1GA 1NYGA 4B9XA 1OV3A 3RR6A 1C0MA 1NG2A 2CZ0B 1QKWA 1N8RR 1WFWA 3I5SA 1N8RC 3EG2A 1NJ6A 1Y0MA 4C0ZA 5LJ5f 3JCMb 2PUOB 3JAME 2X3XD 2LCLA 5GAMh 1EIYB 5GAN6 4QQ6A 1EOVA 2JN0A 3CCMQ 4P75A 4PFOA 2KT8A 5FU6B 4PJOE 4IIOA 2QTVA 4ZTUB 1X2GA 2OAUA 1WJRA 4M75G 4M78B 4LE9A 4HWPA 4RQFA 2E3IA 1XQHA 1JU5C 4YYEA 1VQNA 3MPUB 4C8QC 4IUPA 4HWOA 2AT1B 2XICA 1SESA 1NYFA 3QWXX 4C92F 1Q95G 3QZ5B 2LNHB 2RHSA 2CDTA 4OMQA 3PNWC 2SRCA 5J39A 2YHTA 1D1BA 2VXFA 3OS5A 5C0MA 1YIJQ 2E6NA 2MK5A 3CC7Q 3X24B 1VQNT 1PSFA 2PVGB 5GMKi 4AG1C 4ELYC 5L23A 5DLOA 4YRIA 2JMAA 1E22A 1X01A 3HRKA 3QNEA 1VOMA 3BDLA 3X25B 1C0AA 4M75E 5LL6S 3P8DA 3VV0A 5KYYB 2RQUA 1WHMA 2E12A 2OX7A 4M77D 4OMPA 1JO8A 2ED0A 2DZCA 5GAN3 1MMGA 3NFCA 2KAFA 2RHQA 2CSIA 4P73C 4YRLA 3CBOA 4ZN3A 5D6YA 4LVKA 2CS7A 1MHNA 2KYBA 4HWSA 2RA2A 1RAAB 1YFSA 3A8MB 4P72A 3LLRA 2CH4W 2XG8D 1VQZA 1NPPA 3RACA 4X9CA 2ATCB 3CCRQ 2CZ7B 2CSQA 4C0FA 4JPBW 2XDBA 1GXIE 1IHWA 1AEYA 5FWCA 4MDWA 1K76A 4E7KA 2DLPA 2ARSA 3O8VA 2QHVA 2DTIA 3OYHA 3LW5E 4HCKA 5KNNA 3M4PA 1Z7MA 3PCOB 3P8HA 1GL5A 1YFNA 4OMLA 1U1SA 2XHCA 2DERA 1B76A 4C8QE 2RI3A 1UB4A 1WHHA 1FYFA 2Q7EA 1KQ2A 4ZTJA 4M78F 4M7AA 2EGAA 3M9QA 3GLXA 1Q7YR 2MWOA 5CCAA 2P0PA 3H0FA 4KGVB 3TREA 1Q7YC 2EPDA 3UT1A 3DLLA 3M54A 4KR3A 1VQ8A 1TUDA 2DIGA 1Y07A 4YRKA 3TSZA 3I9QA 2KDSA 2LZ6B 5FLXE 1VYVA 1Y7XA 1GFDA 3RNJA 4LD9K 3SEMA 1M1FA 3IQLA 3QTCA 2ARTA 4CH5A 3OYGA 2LQ8A 4KRTA 3QWYA 1Z7NA 2NS6A 1VQ8T 3NELA 1G3WA 2K57A 3M0QA 1I8FA 2EJFA 3J7AF 1FWZA 2K6DA 5LJ3f 1I5LA 2GCXA 3MEVA 3JCMe 1YJWQ 2AKWB 4P71A 1I1JA 3FC3A 1J3TA 4M7AG 4RTWA 3HFZB 1N8RU 2L2PA 4M75D 4RG8A 4Y91A 4HWTA 1TU0B 1VYTA 1I81A 2QGGA 4IUUA 1AZEA 1VQKA 2ZPGB 2IVWA 1OPKA 1N9WA 2O4XA 4J9FA 1NBEB 1VQPA 1OZ3A 3QBYA 1G3TA 5F5WA 3JB9I 5IHKA 2ZZEA 2VUBA 4C0DB 3CCQA 2C06A 2ZZGA 2DILA 3EG1A 4M7DB 1G3YA 4FT2A 1TWBA 4AFSC 4PG3A 2CZ1B 1HXDA 1EVLA 4LVLA 3HKSA 11ASA 2BE9B 2M9UA 1VQKT 4OGEA 3CCSQ 1KG1A 4ZGDB 3M0UA 1VQPT 1ABQA 2FRYA 1M90R 2XDPA 3PVQA 1BBWA 2WSCE 1M90C 3QSUA 4AFQC 1U8RA 3CCQT 2QI2A 3S3MA 1YWPA 2LX9A 3MEYA 2DVEA 2JVVA 3EGDB 2OTLA 2ZAEA 3HXZA 5GAMe 3PT9A 4C92G 2EGCA 4DBFA 4K88A 2KBTA 2E5KA 3JCMg 4F7UB 2CKKA 2CIMA 3HPWA 2KNBB 2PVOB 2IPOB 3OSVA 2OTLT 4BW9A 1QVFA 2IY5B 4N0AC 2QHUA 1VQMA 3LGLA 2FPFA 4CC2A 3QG1A 1PYSB 1GCQC 1W6XA 2ZCEA 3G6EQ 4HCZA 4JJNK 1Z9QA 2E3CA 4BY6C 3L2VA 2YUQA 3OYYA 1USYC 4J9GA 5KYNA 4PJLA 3REXA 2RO0A 2EL9A 4M78C 2RI2A 4CS2A 4EO4A 1VQMT 4F14A 3V8LA 3JCMP 3O5ZA 3J80E 4AH6A 3SFMA 4G84A 3PMTA 2ALYA 3UH0A 1QP3A 4X34A 4LNSA 1M4ZA 5FWBA 4CH6A 3CCLA 5GAN4 1YJ9A 1VQNQ 3MHXA 1RIQA 2EYYA 2YT6A 5GAMg 3OYAA 1V29B 1OI1A 3JB9J 1UJ0A 4OB3B 4ZGEB 2RD1A 1WDXA 4N4IA 2QQRA 1RADB 1I4K1 4NCXA 5I11A 2CP2A 1X2QA 2HZYA 1V1CA 1N6AA 2BIVA 1Q7YU 3HY1A 3CCLT 4WJ3M 4EMKB 1YJ9T 1VQ5A 4P5NA 1M2VA 5CKHA 4BI4A 4PJOF 3IKLA 4OVAA 1KSWA 5CVIA 2AKKA 1BI0A 4HT8A 2LCCA 2JM8A 3OB9A 2DK3A 1K1ZA 2BZXA 2OJ2A 2I2LA 3CCJQ 3A74A 2XK0A 4HXJA 2Q5IA 3M53A 3RUXA 5ELOA 3EGUA 1YITA 4Z89A 1VQ5T 3WVDB 3EGXB 4H02A 1TUGB 1WXTA 4DPGA 3HFOA 2KXCA 4YRSA 4YRPA 1N9SA 1ZUUA 1VQ7A 1IHVA 3THKA 1YGBA 1PD0A 4CH3A 2K2MA 3MF2A 1R0BG 1CKAA 2RHSB 1YN8A 3H0IA 4J83A 1WX6A 3KUFA 1NEGA 1B3QA 3OYDA 4BUGA 1YITT 1VA7A 1ZSGA 2DMOA 4A4FA 4PLLA 4L59A 3C94A 2YLBA 1VQ7T 3CD6T 2K7AA 4KR2A 3EG0A 4H2XB 2E3HA 4M78E 2GNCA 2HSPA 3FDRA 1VQ9A 5GAN5 1X27A 2Y4YA 1U3OA 2B86A 4EDUA 5GAN8 3QO5A 3CBMA 4E51A 4FCYA 1SEMA 5FW9A 2A37A 1F1BB 4R0KA 1GGMA 4RTTA 5KE3A 1BK2A 1AZGB 1VUBA 3UF4A 1A0NB 3A31A 4OMOA 1WJSA 4FYYB 4C92D 1VQ9T 1M90U 3P8VA 4OB0B 1CKBA 4P3OA 3CCUA 2GTOA 1EVKA 2COWA 1RI9A 1LVKA 1VQ8Q 5GAMj 3RBBB 3CCEA 1EFNA 2QG9B 2QQSA 5CIUA 3OYNA 3OYLA 3META 3ER0A 4M77A 3M4YA 1ZBXA 1NNHA 2CH4A 1M3BA 1OZ2A 3A8OB 5DLQE 3M55A 2MCNA 4OB1B 1HSQA 3EG9B 3KFUA 3M5AA 5CKBA 2HL5C 3CPFA 3CCUT 2FO0A 3ASKA 1NM7A 1MGQA 3CCET 3L2WA 3D7SB 2RJDA 3CMEA 5ELNA 1K0XA 2E70A 2LTOA 4RCBA 4C8QF 4HCBA 4FM4B 3PVLA 1UTIA 1ZSZA 4BD3A 4R55A 2AZSA 2JT4A 2ZINA 5FU7B 1SRMA 2XGTA 2HNIA 1GBRA 3HXYA 1WHGA 4JDSA 2FL7A 3OYCA 4WI1A 3CMET 4FW2A 1Y96B 2Y90A 1SHFA 1K9AA 1OEBA 2K4YA 1VQKQ 3OYJA 2RHIA 4MZPA 2DZ9A 1VQ4Q 1VQPQ 2R5AA 3VS0A 4C0DC 4LVJA 3CCQQ 2KMTA 2G4CA 3VU3C 2A7YA 2M1HA 4X9DA 2DD5A 4FT4A 2L3SA 5KYXA 1B07A 4Y92A 3VBBA 2DKGA 2G6FX 3LC0A 1UHFA 3G4ST 5IXBA 1UFFA 5C51B 3TQ7P 1QVFP 2C8MA 1U5SA 4UP9A 2O01E 1UG1A 1OQKA 1B70A 4M78D 2ZIMA 4EMHA 2K5FA 4J6WA 2OTLQ 4XAXB 1RACB 5A0DA 4AMCA 3QO7A 2C0OA 2DIQA 2YUNA 4JRPA 1PSEA 2KK4A 3HXUA 3UGTA 3WQZA 3VS5A 5DY9A 1BBUA 3NGPA 1M9SA 3MKDA 3PZCA 2O4XB 4OF1A 2HAXA 4IUTA 3OYMA 3RKXA 1PNJA 2CREA 3JCMd 3MF1A 4BWAA 2ENMA 4PJOG 4CC4B 1PKSA 2L89A 3FB9A 2QAZA 2X35A 2XU8A 2DEQA 4J8OA 2X4XA 3QKJA 1P92A 4M75A 3CC4Q 4RG2A 2WSEE 1D3BA 1RAHB 2PU9B 1VQMQ 3HXWA 4IUQA 1K4US 4JUVA 4KH1B 1WXUA 4LUDA 1D09B 4X1VA 4RTXA 2VWFA 1YCSB 1NYQA 2D8HA 3JB9F 2ECZA 2QYZA 1I07A 2CP5A 4FYWB 2AMCB 1BCMA 2ZT5A 5CQYA 2NWMA 3C12A 2E1HA 3A1PA 2LJ1A 4R56A 2R5MA 7AT1B 1SRYA 4YRCA 2DL5A 2WSFE 2A08A 3DB4A 5I22A 1YJNA 2M51A 1U1TA 2AIRB 2YRCA 3CCLQ 5J3BA 1YJ9Q 4WF2A 1PWTA 5A0GA 1PRLC 4AFUC 2PVDB 3OW2S 4XTZA 5GMKh 5GAMd 4FW1A 4RQEA 1H4QA 1RAIB 3HY0A 2HBWA 2DRMA 4EMKC 1YJNT 3LSSA 3PIOA 4TVRA 4V2SA 1VQ5Q 4JS4A 4FSXA 4LVIA 1AT1B 1QF6A 3EH2A 1HK9A 1KMNA 4TQDA 3TUPA 4JRKA 3EHRA 1B7YA 1WXBA 3KBGA 3QPHA 2K9GA 4J9DA 1M8VA 1PD1A 3A5ZA 3I7FA 3V7SA 1MNDA 1KC8U 1BI1A 2DFUA 2C0IA 1Q82U 1K8AR 4P74C 3DSQA 4XEMA 1K8AC 3DKMA 1YFRA 5KYWB 3GPLA 2ZT8A 3HTZA 5I2MA 1YI2A 1QW1A 1UHCA 5EC7A 2DX1A 4LD6A 3VS7A 4RMFA 5GAN7 4CRIA 2X3WD 1VQ7Q 1YFTA 4E7SA 3CD6Q 1SKUB 4JJDA 3EAEA 2HL3A 4IIMA 3E2UA 1KQSS 3N5BB 3M0SA 4B6MA 2LMJA 1IGUA 3H6ZA 3INZA 4H2SA 4C8QG 3GNGA 3UWNA 2LQNA 2ED1A 2QDYB 4A54A 5HY6A 4LUEA 2K5IA 2QA4Q 1BIBA 2K5LA 3PIPA 3HSBA 4J7FA 1NJIR 4P73A 3CCVA 2X9HA 3FIFA 3VS2A 1NJIC 1R8OB 2GTJA 1M30A 3PE0A 4J6YA 3OW2P 1VQ9Q 4CS3A 5I2SA 1NEBA 1RLPC 4H2UA 2H8HA 2XTIA 1E7OA 5LJ5h 1SETA 2ZXFA 2YUPA 2YWWA 1SSFA 2KVQG 2JJ9A 1N9RA 5C53B 4FYXB 1VQ6A 2P0QA 4LDVA 1YNZA 2MYSA 3TU4K 4YP0A 1VQLA 1QQJA 2JUFA 4PLIA 3NTHA 3UATA 2V8JA 2M0YA 3CCUQ 4K86A 1YBYA 2HCKA 4P72C 3CCEQ 4JZ3A 3RF1A 1ADYA 4YRGA 3I35A 2CP0A 2GFUA 3LWIA 3L1AA 1BB9A 4PJOD 4XU3A 2O9VA 3IKMB 1RI0A 1VQLT 1M3AA 2F2XA 5CO7A 1ACMB 2E4HA 3W3SA 2DTOA 5IHIA 1UGRB 1WHLA 1JJ2S 2QEXA 4F16A 1O75A 2FZKB 2ZT6A 2QXFA 3EHQA 3OS0A 1LJOA 2BZ8A 1WHKA 3SWNB 4HA8A 2DL7A 3TCJA 4II1A 1GCPA 5KYUA 1C1AA 1TS9A 4RDXA 2CT3A 2LP5A 2QEXT 3RDVA 4OLFA 3HP9A 1G5IA 2P5IA 1Y71A 3BFMA 4QVZA 1WNLA 4M77B 2E5QA 5CK9A 2KRNA 3G4SQ 2E10A 3LH0A 4YRQA 1XNIA 1H3HA 1HYOA 4BDYA 2KY9A 1WJQA 1TSFA 3L2QA 1JEGA 3JB9G 4YRFA 3VRYA 1WI7A 4MZTA 3R6NA 4C92A 2LQWA 1JXOA 3NHNA 2AZVA 3HHTB 3M4QA 1SSHA 3ZFJA 5L8RE 4YCVA 1JJCB 3SB2A 4ME7A 5GANf 4A4KA 3URGA 1KFZA 2OTJA 4GBQA 4J9IA 3DB3A 2D0NA 3VYHB 3L2RA 1FMVA 5GAOq 1UEBA 3ICAA 1G8XA 2GQVA 1G83A 2V1QA 4NOYA 1JJ2P 3JRZA 1UECA
chains in the Genus database with same CATH topology
3MP6A 2FYKA 2RK1A 3L4GA 5CKEA 1G51A 2OTJT 2V8IA 1WGSA 1KD1C 3A7AA 2RJCA 3LYIA 2DXBA 2PMEA 1G5HA 4QQDA 1UGSB 3OMCA 3L42A 2ZPFB 4C8QD 4L6V5 4QW2A 3X26B 1VIFA 2ZT7A 1B70B 4N0AA 2R57A 2ZPBB 4XTVA 3TEHA 3CC2A 3LWHA 3QDRB 4YDQA 5C52B 1EIYA 3P8BB 1WQ7A 4TVWA 5LJ3h 4MZMA 4YCUA 4DOWA 5HGQA 5FU6C 3JCMc 1USYA 1DJ7B 4P3NA 4M78A 2HQEA 4EMGA 1UGQB 4M75B 3CC2T 2DU7A 1D3BB 3OYIA 3ZEHA 2MWPA 1E1TA 4ZTFA 2XD0A 2KQWA 2LVMA 2I4NA 4ZIBA 5A0LA 3CPWS 5GANh 5C6SA 3M4GA 1H4TA 2RM4A 3VQVA 5GAOm 4MDXA 4UP8A 2Q5HA 3CCMA 4HVCA 1RL2A 4Q6GA 4FL6A 3JCMQ 4M7DF 2G3RA 3VUBA 1K73C 4GY5A 4M78G 1NJ8A 5LJ5e 2MI6A 3HL8A 4MMLA 1QVGS 3ERRA 2CYZB 3CCMT 3NEMA 3E9FA 5D6XA 3JCMV 5A2QE 5M9OA 2YRVA 3JB9D 1B7YB 2R58A 4F7UF 1YIJA 3CC7A 5I21A 1ZHIA 1VQOA 1H4SA 2QQBA 3RERA 5CKFA 1M5Q1 2FVUA 1E1OA 5E3IA 1QVPA 4D6WA 1VQOT 3GF5A 3KXTA 4XEOA 3E19A 1XOVA 3S3OA 5CR2A 1EIFA 5GMKm 1K9MC 2VXEA 3CXCS 5LJ5g 2E41A 2RHQB 2CJAA 1W2BS 3G71A 2DPPB 4JRIA 3V8KA 1KD1U 3HRTA 4J7IA 2EYQA 3HRUA 1ATIA 3SWNC 3OW2A 4C5GA 2ZPIB 3P8YA 4XQ3A 3JCMf 2PQWA 3G71T 2E64A 4P3PA 2FHDA 4O2DA 1X56A 1WQWA 1BI2A 2YLCA 2AKWA 1NE8A 2C7IA 2L5QA 1KMMA 4UPAA 4CH4A 4M7AB 3A8GB 3H8ZA 4N4HA 3CBPA 4MMKA 3L2UA 2FB7A 2RI5A 1TH7A 5K1PA 4XTUA 4BE2A 3VQXA 1IZ6A 3A5YA 4H2YA 4QVCA 2EJ9A 3REUA 3OA6A 4M7DC 4PJOA 1W66A 1KQSA 4J15A 3RKWA 5GAMf 4HKEA 2DTHA 1BKBA 2EAYA 2D0QB 4C5EA 1KQ1A 3C95A 2GF7A 2HBPA 2LNVA 1B8AA 1WPYA 1ZQ1A 4KBMB 5LJ3e 5KE2A 4HT9A 3FLGA 4XU0A 4C92B 2LRQA 3RMSA 1K73U 3E9IA 5LJ5j 3A32A 3BY7A 2B8AA 3WVEB 5J26A 4EX5A 4A4GA 4G85A 3JCMh 5AYFA 4K87A 5GANe 4LDXA 4J5YA 4XTWA 2CJ9A 2RHYA 2DDZA 1X6OA 5GAOp 2M16A 1JJ2A 3R6OA 3OQ5A 4N4GA 2EKOA 2L3RA 2ZZDA 1X2HA 4TVAA 3M56A 2WACA 3P8TA 3IG2A 4J6XA 3QO3A 4M7AF 2E6ZA 1Q81C 2CGHA 2RB6A 2QQ9A 5LJ3g 4M7DE 2DQ0A 2ODRC 4IURA 1VIEA 4RMOA 3GOXA 3MO8A 4C0GA 5FROA 4NL3A 1K9MU 3TEHB 2I4OA 3G6EA 3UDCA 4EMKA 2CZ6B 1KHCA 1YCYA 1ASZA 4C8QA 4P75C 4BY6B 1NZ9A 4PL6A 3E9GA 1WU7A 4RKUE 1B34A 1BIAA 2DD4A 4O6JA 3JB9H 4YREA 5GANg 3G6ET 4P74A 3HFVA 4XU2A 4F7UE 2ALYB 2I4MA 2JTFA 2Q7HA 4IUVA 4XK8E 3BJUA 4RCCA 3PTAA 4HCCA 1L0WA 2DO3A 1O9SA 3R07A 1IL2A 2VGNA 2P4TA 3CMAA 1YI2T 3GP8A 2E65A 2JOYA 4H2XA 2P0LA 1YHQA 2EQMA 3CCJA 2VC8A 3NETA 4FIBA 3C4SA 1FX7A 2A3LA 2MF2A 3CMAT 2DU5A 2MAMA 2LT4A 1YHQT 3CCJT 3CCVT 2ZTGA 3I56A 3UPUA 3MCAB 3GNFB 2ARUA 5LJ5d 1X75C 4HWRA 1YB3A 3ZBDA 5LJ3j 1OYXA 2ZGWA 3FRNA 2RHXA 3HRSA 4YROA 2VGMA 4YRTA 4M7DD 3OYEA 3CEYA 4HT4A 3RL6A 4TTVA 1VQ6T 5KCHA 2RJEA 1NJ5A 3I56T 2X4JA 5HK3A 1QP2A 3NTKA 4LDYA 3WXMB 5GAOl 4YPFA 4OP0A 3IALA 2X4YA 3CPWA 5CKDA 5GANj 4L5GA 5FU7C 4M7AC 2BUDA 2DQ3A 1LNXA 4O5VA 1Y96A 2XI9A 4Y28E 2J3MA 2PUKB 4Z02A 2K3YA 1HC7A 2D6FA 3RMQA 2ZIOA 4A4HA 1LOJA 3M57A 2E5AA 4WJ4A 3OMGA 3PFSA 4Q15A 4KQEA 1QVGA 3HXXA 2HD0A 1Q81U 3LX7A 4IKFA 2JNGA 4ATOA 3QO8A 3QZ9B 1X55A 1XTDA 3I55A 4LDUA 2VYTA 4P71C 4XU1A 1H3ZA 2ZPHB 2RHZA 2RJFA 4ZTZB 1NPRA 5HKCA 4H2WA 5FRNA 4C92C 4DOVA 1X54A 2KSSA 4QVDA 4H2VA 3OSSC 3G1ZA 2JZ2A 1VQ4A 3V8JA 3I55T 5FRMA 4GLKA 3OY9A 2J3LA 3RGLA 2LQKA 2ODRD 4NS5A 3J81E 5GMKl 4E7HA 1K8AU 4PJOB 3RKYA 3FEOA 3FJPA 3VQWA 3MP8A 3RESA 3JCMJ 4XTYA 3OBYA 1VQ4T 3SDZA 4BDZA 3OYFA 3CXCA 2RK2A 3T9NA 5GMKe 3TEGA 4YCWA 1W2BA 2DXCA 4M7AE 2QHSA 2EJGA 2AMCA 3JCMX 2JTMA 1S72A 1WYDA 4TQFA 3VQYA 5DM7R 4JS5A 4Q5WA 3A8HB 1BI3A 3E1SA 3OBWA 4ZGJB 2H3JA 1NJIU 2CJBA 2ZNIA 1NJ2A 3PMIA 3MEUA 4BI3A 1S72T 1Q86C 3CC4A 1H4VB 2I4LA 1JBMA 3VYGA 3V7CA 5LJ3d 2HQXA 3QJYA 1WLEA 3UGQA 2F5KA 4ELZC 4M77F 5IN1A 4L87A 3M58A 2PMFA 4C5IA 3A7RA 2EQUA 3LGFA 3X20B 1M1KC 3RIRA 5CQXA 3CC4T 4YRJA 1W4SA 4EPCA 3MEWA 4XTXA 4C92E 4TVAB 2EQKA 3JCMW 1LYLA 2QHTA 5GANd 2XKOC 4X5OA 5GAOr 4NL2A 3QIIA 2P0KA 5HK0A 3A8LB 5D6WA 3VUZA 4UC4A 3QYGB 2M0OA 12ASA 1BYMA 1EQRA 4TVYA 4A4EA 2ZR2A 4A53A 3Q1JA 1ADJA 4YRMA 4C8QB 3QJ6A 2D9TA 3A7UA 1B34B 3VKIA 5GAOn 3DLMA 3A5ZB 1H641 3TEEA 4E7IA 3OS2A 5K1XA 3PGGA 2F5TX 4M7AD 2LDMA 2Q7GA 4BE1A 2BKDN 2A8EA 3CD6A 2NLUA 1G5VA 3QXEB 1YIJT 3CC7T 4H2TA 3PCOA 3UFGA 4BI8B 4JLGA 2EWNA 2QA4A 2V8KA 1JRIA 4M75F 3HXVA 4E7JA 2RHUA 4YRNA 3HFNA 2EIFA 3BDUA 2LC4A 3E9HA 3MEAA 2DAQA 3MQZA 1FXXA 3BW1A 3CCRA 3SWNA 2QA4T 5GAN2 5CAIA 4OB2B 5GMKj 2DXUA 2Y4XA 4JRQA 2ZZFA 2ZPEB 4KUIA 1QVFS 1AHJB 4M77C 2EFIA 4LVMA 3CCRT 2AHJB 5EG2A 1KC8C 1KOGA 3OD1A 3HFZA 1Q82C 5KCOA 2DJZA 4YRRA 3QYHB 2K2VA 3L2ZA 4E7LA 3LSQA 3OS1A 1UGPB 4VUBA 1Q86U 1JJCA 3OYKA 4BB7A 2XDDA 1NYRA 3HRIA 5IT9E 4E47A 4M7DA 4BE0A 2VV5A 3M59A 3ME9A 3OYBA 4BACA 4C5HA 3QUIA 2X4WA 4B9WA 4TWAA 1M1KU 4CI0C 4YTLA 2LT1A 4M77G 2F69A 1YJWA 2L8DA 3G4SA 4PHCA 2MMPA 2RH2A 3F70A 2ZNJA 3QHSA 4CS4A 4PJOC 1ASYA 3CMQA 1N27A 4DA4A 4OMFB 4F7UA 1YJWT 3NTIA 3G7ZA 3GIBA 4KT0E 2QTXA 4KULA 3V7RA 4PKCC 4ZN1A 4M7DG 2K3XA 2IY5A 3VJPA 2ZCFB 4FU6A 1SERA 2QQAA 3X28B 1G3SA 3CCSA 2EQJA 2IG0A 1PYSA 4LDWA 3SD4A 4M77E 3JSCA 4JLIA 3MP1A 2GFAA 2XIDA 3L4GB 1E24A 1IREB 3AHUA 4KUDK 3EFRA 3NENA 1JB0E 4M75C 5IAYA 4PNOA 3S6WA 3CCST 4OGCA 4UP7A 4QQGA 1NJ1A 4F7UG 5KH6A 1HTTA 3S3NA 1KHIA 4DQ2A 1QE0A 2ZR3A 1J5WA 1EFWA 3EFSA 2DXTA 1M1GA 4B9XA 2CZ0B 1N8RC 1NJ6A 4C0ZA 5LJ5f 3JCMb 2PUOB 3JAME 2LCLA 5GAMh 1EIYB 5GAN6 4QQ6A 1EOVA 2JN0A 4P75A 5FU6B 4PJOE 4ZTUB 1X2GA 2OAUA 1WJRA 4M75G 4M78B 4HWPA 4RQFA 1XQHA 4YYEA 1VQNA 4C8QC 4IUPA 4HWOA 2XICA 1SESA 4C92F 3QZ5B 2RHSA 3PNWC 5J39A 2YHTA 2VXFA 3OS5A 5C0MA 2E6NA 3X24B 1VQNT 1PSFA 2PVGB 5GMKi 4ELYC 5DLOA 4YRIA 1E22A 1X01A 3HRKA 3QNEA 3BDLA 3X25B 1C0AA 4M75E 5LL6S 3P8DA 3VV0A 2E12A 4M77D 2DZCA 5GAN3 3NFCA 2KAFA 2RHQA 4P73C 4YRLA 3CBOA 4ZN3A 5D6YA 4LVKA 2CS7A 1MHNA 4HWSA 2RA2A 1YFSA 3A8MB 4P72A 3LLRA 2XG8D 1VQZA 1NPPA 3RACA 4X9CA 2CZ7B 4C0FA 2XDBA 1GXIE 4MDWA 4E7KA 2ARSA 3O8VA 2QHVA 2DTIA 3OYHA 3LW5E 5KNNA 3M4PA 1Z7MA 3PCOB 3P8HA 1U1SA 2XHCA 1B76A 4C8QE 2RI3A 1UB4A 1FYFA 2Q7EA 1KQ2A 4ZTJA 4M78F 4M7AA 3M9QA 3GLXA 2MWOA 5CCAA 2P0PA 3TREA 1Q7YC 3UT1A 3DLLA 3M54A 4KR3A 1VQ8A 2DIGA 1Y07A 4YRKA 2KDSA 5FLXE 1Y7XA 4LD9K 1M1FA 3QTCA 2ARTA 4CH5A 3OYGA 2LQ8A 1Z7NA 2NS6A 1VQ8T 3NELA 1G3WA 2K57A 1I8FA 2EJFA 3J7AF 1FWZA 5LJ3f 1I5LA 2GCXA 3MEVA 3JCMe 2AKWB 4P71A 3FC3A 4M7AG 3HFZB 1N8RU 4M75D 4RG8A 4Y91A 4HWTA 1I81A 4IUUA 1VQKA 2ZPGB 2IVWA 1N9WA 2O4XA 1VQPA 1OZ3A 3QBYA 1G3TA 5F5WA 3JB9I 2ZZEA 2VUBA 4C0DB 3CCQA 2C06A 2ZZGA 4M7DB 1G3YA 4FT2A 4PG3A 2CZ1B 1HXDA 1EVLA 4LVLA 3HKSA 11ASA 2M9UA 1VQKT 4OGEA 1KG1A 4ZGDB 1VQPT 2XDPA 1BBWA 2WSCE 1M90C 3QSUA 1U8RA 3CCQT 2QI2A 3S3MA 2LX9A 3MEYA 2DVEA 2JVVA 2OTLA 3HXZA 5GAMe 3PT9A 4C92G 4K88A 3JCMg 4F7UB 2CKKA 2CIMA 3HPWA 2PVOB 3OSVA 2OTLT 4BW9A 1QVFA 2IY5B 4N0AC 2QHUA 1VQMA 3LGLA 3QG1A 1PYSB 2ZCEA 4HCZA 4JJNK 2E3CA 4BY6C 3L2VA 3OYYA 1USYC 3REXA 2RO0A 2EL9A 4M78C 2RI2A 4CS2A 4EO4A 1VQMT 3V8LA 3JCMP 3J80E 4AH6A 3SFMA 4G84A 3PMTA 2ALYA 3UH0A 1QP3A 4X34A 4LNSA 1M4ZA 4CH6A 3CCLA 5GAN4 1YJ9A 3MHXA 1RIQA 5GAMg 3OYAA 1V29B 3JB9J 1OI1A 4OB3B 4ZGEB 2RD1A 4N4IA 2QQRA 1I4K1 4NCXA 1N6AA 2BIVA 1Q7YU 3HY1A 3CCLT 4WJ3M 4EMKB 1YJ9T 1VQ5A 4P5NA 5CKHA 4BI4A 4PJOF 3IKLA 4OVAA 5CVIA 1BI0A 4HT8A 2LCCA 3OB9A 2DK3A 2I2LA 3A74A 2XK0A 2Q5IA 3M53A 3RUXA 5ELOA 1YITA 1VQ5T 3WVDB 4H02A 4YRSA 4DPGA 3HFOA 4YRPA 1N9SA 1VQ7A 1YGBA 4CH3A 3MF2A 2RHSB 4J83A 3KUFA 3OYDA 4BUGA 1YITT 4A4FA 4PLLA 4L59A 3C94A 2YLBA 1VQ7T 3CD6T 4KR2A 4H2XB 4M78E 3FDRA 1VQ9A 5GAN5 2Y4YA 4EDUA 5GAN8 3QO5A 3CBMA 4E51A 1GGMA 5KE3A 1VUBA 3A31A 1WJSA 4C92D 1VQ9T 1M90U 3P8VA 4OB0B 4P3OA 3CCUA 1EVKA 5GAMj 3CCEA 2QQSA 5CIUA 3OYNA 3OYLA 3META 3ER0A 4M77A 3M4YA 1ZBXA 1NNHA 1OZ2A 3A8OB 5DLQE 3M55A 4OB1B 3KFUA 3M5AA 5CKBA 3CPFA 3CCUT 3ASKA 1MGQA 3CCET 3L2WA 3CMEA 2RJDA 5ELNA 2E70A 2LTOA 4RCBA 4C8QF 4HCBA 4FM4B 4BD3A 4R55A 2ZINA 5FU7B 2XGTA 2HNIA 3HXYA 4JDSA 2FL7A 3OYCA 4WI1A 3CMET 1Y96B 2Y90A 2K4YA 3OYJA 2RHIA 4MZPA 2DZ9A 2R5AA 4C0DC 4LVJA 2KMTA 2G4CA 3VU3C 2A7YA 2M1HA 4X9DA 2DD5A 4FT4A 3VBBA 2DKGA 3LC0A 3G4ST 5C51B 2C8MA 4UP9A 2O01E 1B70A 4M78D 2ZIMA 4EMHA 2K5FA 4J6WA 4XAXB 5A0DA 3QO7A 3HXUA 2DIQA 4JRPA 3WQZA 1PSEA 2KK4A 3UGTA 5DY9A 1BBUA 1M9SA 3PZCA 2O4XB 4OF1A 2HAXA 4IUTA 3OYMA 3RKXA 3JCMd 3MF1A 4BWAA 4PJOG 2L89A 3FB9A 2X35A 2XU8A 2DEQA 4J8OA 2X4XA 3QKJA 1P92A 4M75A 4RG2A 2WSEE 1D3BA 2PU9B 3HXWA 4IUQA 4JUVA 1NYQA 3JB9F 2AMCB 2ZT5A 5CQYA 3C12A 2E1HA 1SRYA 4R56A 2R5MA 4YRCA 2WSFE 3DB4A 1YJNA 1U1TA 5J3BA 4WF2A 5A0GA 2PVDB 3OW2S 4XTZA 5GMKh 5GAMd 4RQEA 1H4QA 3HY0A 4EMKC 1YJNT 3LSSA 3PIOA 4TVRA 4V2SA 4JS4A 4FSXA 4LVIA 1QF6A 1KMNA 1HK9A 4TQDA 3TUPA 4JRKA 1B7YA 3KBGA 3QPHA 1M8VA 3A5ZA 3I7FA 3V7SA 1KC8U 1BI1A 1Q82U 4P74C 3DSQA 4XEMA 1K8AC 3DKMA 1YFRA 3GPLA 2ZT8A 3HTZA 5I2MA 1YI2A 1QW1A 4LD6A 4RMFA 5GAN7 4CRIA 1YFTA 3EAEA 1KQSS 3N5BB 3H6ZA 3INZA 4H2SA 4C8QG 3GNGA 3UWNA 2QDYB 4A54A 5HY6A 2K5IA 1BIBA 2K5LA 3PIPA 3HSBA 4J7FA 4P73A 3CCVA 3FIFA 1NJIC 1R8OB 4J6YA 4CS3A 5I2SA 4H2UA 2XTIA 5LJ5h 1SETA 2ZXFA 1SSFA 2KVQG 1N9RA 5C53B 1VQ6A 2P0QA 4LDVA 3TU4K 4YP0A 1VQLA 2JUFA 4PLIA 3NTHA 2V8JA 4K86A 1YBYA 4P72C 3RF1A 1ADYA 4YRGA 2GFUA 3LWIA 3L1AA 4PJOD 4XU3A 3IKMB 1RI0A 1VQLT 5CO7A 3W3SA 2DTOA 1UGRB 1JJ2S 2QEXA 1O75A 2ZT6A 2QXFA 3OS0A 1LJOA 3SWNB 4HA8A 3TCJA 4II1A 4RDXA 2QEXT 4OLFA 3HP9A 1G5IA 2P5IA 1Y71A 3BFMA 1WNLA 4QVZA 4M77B 2E5QA 5CK9A 2E10A 3LH0A 4YRQA 1XNIA 4BDYA 1WJQA 2KY9A 3L2QA 3JB9G 4YRFA 4MZTA 4C92A 3HHTB 3M4QA 3ZFJA 5L8RE 4YCVA 1JJCB 3SB2A 4ME7A 5GANf 4A4KA 3URGA 2OTJA 3DB3A 3VYHB 3L2RA 5GAOq 1UEBA 3ICAA 2GQVA 4NOYA 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIB A;  2QTX A;  2FYK A;  3V7R A;  3L4G A;  4M7D G;  1G51 A;  3A7A A;  2IY5 A;  2DU5 A;  1SER A;  2PME A;  1G5H A;  2YLB A;  4KR2 A;  1PYS A;  4H2X B;  4M78 E;  4M77 E;  2ZTG A;  4C8Q D;  4JLI A;  2ARU A;  5LJ5 d;  5GAN 5;  2ZT7 A;  4HWR A;  1YB3 A;  3L4G B;  1E24 A;  5LJ3 j;  1B70 B;  3AHU A;  2ZGW A;  3EFR A;  5GAN 8;  3QO5 A;  4E51 A;  3NEN A;  4N0A A;  4M75 C;  4PNO A;  4YRO A;  4YRT A;  4XTV A;  4M7D D;  1GGM A;  3TEH A;  4UP7 A;  3RL6 A;  1NJ1 A;  4F7U G;  1HTT A;  4TTV A;  3A31 A;  4YDQ A;  5C52 B;  1EIY A;  1NJ5 A;  1WQ7 A;  4C92 D;  4TVW A;  5LJ3 h;  3P8V A;  4YCU A;  4P3O A;  1EVK A;  5HGQ A;  4DQ2 A;  1QE0 A;  2ZR3 A;  1J5W A;  1EFW A;  5GAM j;  3JCM c;  3EFS A;  1USY A;  2DXT A;  5GAO l;  4P3N A;  4M78 A;  4YPF A;  4OP0 A;  4M77 A;  3IAL A;  1NNH A;  4EMG A;  4M75 B;  5GAN j;  2DU7 A;  4M7A C;  1D3B B;  1NJ6 A;  3KFU A;  5LJ5 f;  3JCM b;  5GAM h;  1EIY B;  1E1T A;  2DQ3 A;  5GAN 6;  1EOV A;  1LNX A;  2JN0 A;  1Y96 A;  4P75 A;  1MGQ A;  5ELN A;  2I4N A;  4ZIB A;  2J3M A;  4PJO E;  4RCB A;  5GAN h;  4C8Q F;  1HC7 A;  1X2G A;  4ZTU B;  4M75 G;  4M78 B;  3M4G A;  1H4T A;  2RM4 A;  3VQV A;  2ZIN A;  2ZIO A;  4HWP A;  5GAO m;  4UP8 A;  4RQF A;  2Q5H A;  2XGT A;  1LOJ A;  2HNI A;  2E5A A;  4WJ4 A;  4YYE A;  4Q15 A;  4KQE A;  4HVC A;  3HXY A;  3HXX A;  4Q6G A;  4M7D F;  3JCM Q;  4C8Q C;  4HWO A;  4WI1 A;  1Y96 B;  2Y90 A;  1SES A;  3QO8 A;  4M78 G;  4C92 F;  1X55 A;  1NJ8 A;  2RHS A;  2DZ9 A;  5LJ5 e;  4P71 C;  2YHT A;  4XU1 A;  2VXF A;  4MML A;  4ZTZ B;  3ERR A;  2G4C A;  3VU3 C;  3NEM A;  3JCM V;  4H2W A;  4C92 C;  5GMK i;  4X9D A;  1X54 A;  4QVD A;  3VBB A;  4YRI A;  4H2V A;  2DKG A;  3G1Z A;  3JB9 D;  1E22 A;  1X01 A;  3V8J A;  3HRK A;  3QNE A;  3LC0 A;  1B7Y B;  5C51 B;  2J3L A;  1C0A A;  4M75 E;  2C8M A;  3RGL A;  4F7U F;  4UP9 A;  2ODR D;  1B70 A;  4M78 D;  5I21 A;  5GMK l;  4M77 D;  2ZIM A;  4EMH A;  4PJO B;  4J6W A;  3RKY A;  1H4S A;  3RER A;  2DZC A;  3FJP A;  3VQW A;  5GAN 3;  3HXU A;  3QO7 A;  3WQZ A;  3RES A;  3UGT A;  1M5Q 1;  3JCM J;  2RHQ A;  5DY9 A;  4XTY A;  1BBU A;  3PZC A;  4P73 C;  5GMK e;  3TEG A;  3RKX A;  4YCW A;  4YRL A;  3JCM d;  1E1O A;  3MF1 A;  5E3I A;  4M7A E;  4HWS A;  4BWA A;  2QHS A;  2RA2 A;  4PJO G;  2EJG A;  2AMC A;  1YFS A;  3JCM X;  4P72 A;  3FB9 A;  1WYD A;  2DEQ A;  4XEO A;  4TQF A;  3VQY A;  4M75 A;  1VQZ A;  3RAC A;  4X9C A;  1D3B A;  5GMK m;  3HXW A;  2VXE A;  4JUV A;  5LJ5 g;  2E41 A;  2RHQ B;  2CJA A;  2CJB A;  4JRI A;  2ARS A;  3V8K A;  2QHV A;  2DTI A;  2ZNI A;  1NJ2 A;  1NYQ A;  3JB9 F;  5KNN A;  3M4P A;  1Z7M A;  3PCO B;  2AMC B;  1H4V B;  2ZT5 A;  2I4L A;  1JBM A;  1U1S A;  1B76 A;  1ATI A;  4C8Q E;  3SWN C;  3V7C A;  5LJ3 d;  2E1H A;  1WLE A;  1FYF A;  3UGQ A;  2Q7E A;  1SRY A;  1KQ2 A;  4M78 F;  4M7A A;  3P8Y A;  4M77 F;  4YRC A;  4XQ3 A;  4L87 A;  2PMF A;  3JCM f;  2E64 A;  3A7R A;  1U1T A;  4KR3 A;  3RIR A;  4P3P A;  4WF2 A;  4YRK A;  4O2D A;  1X56 A;  1WQW A;  4YRJ A;  4XTZ A;  2YLC A;  5GMK h;  2AKW A;  5GAM d;  4XTX A;  4C92 E;  4RQE A;  1H4Q A;  4TVA B;  3HY0 A;  2C7I A;  3QTC A;  1KMM A;  4UPA A;  3JCM W;  4CH4 A;  4M7A B;  2ART A;  1LYL A;  4CH5 A;  4EMK C;  2QHT A;  3LSS A;  5GAN d;  1Z7N A;  4MMK A;  4X5O A;  2FB7 A;  5GAO r;  3NEL A;  4V2S A;  4NL2 A;  1TH7 A;  5K1P A;  2K57 A;  4XTU A;  3VQX A;  1I8F A;  1QF6 A;  1HK9 A;  2EJF A;  1KMN A;  4TQD A;  5LJ3 f;  3TUP A;  1I5L A;  4JRK A;  1B7Y A;  3A5Y A;  4H2Y A;  4QVC A;  3JCM e;  2EJ9 A;  3REU A;  1M8V A;  3A5Z A;  2AKW B;  3V7S A;  3I7F A;  4P71 A;  4M7A G;  3HFZ B;  4M7D C;  4P74 C;  3DSQ A;  12AS A;  4XEM A;  4PJO A;  1EQR A;  1W66 A;  1YFR A;  4TVY A;  4J15 A;  2ZT8 A;  4M75 D;  4Y91 A;  3HTZ A;  4HWT A;  2ZR2 A;  4A53 A;  1ADJ A;  1I81 A;  3RKW A;  4YRM A;  4C8Q B;  4RMF A;  5GAM f;  5GAN 7;  1N9W A;  2DTH A;  1YFT A;  3A7U A;  1B34 B;  2EAY A;  5GAO n;  1KQ1 A;  5F5W A;  3JB9 I;  2ZZE A;  1H64 1;  2ZZG A;  1B8A A;  4M7D B;  1WPY A;  3INZ A;  4PG3 A;  5K1X A;  1HXD A;  1EVL A;  3PGG A;  5LJ3 e;  4H2S A;  4C8Q G;  4M7A D;  11AS A;  2Q7G A;  4HT9 A;  4A54 A;  4XU0 A;  4C92 B;  3E9I A;  1BIB A;  5LJ5 j;  3HSB A;  4P73 A;  3FIF A;  3A32 A;  1BBW A;  3QSU A;  4J6Y A;  3BY7 A;  4CS3 A;  3MEY A;  4H2T A;  2DVE A;  3PCO A;  4H2U A;  4EX5 A;  3UFG A;  4G85 A;  2XTI A;  5GAM e;  3HXZ A;  2EWN A;  3JCM h;  4C92 G;  5LJ5 h;  1SET A;  2ZXF A;  4K88 A;  3JCM g;  4K87 A;  1N9R A;  5C53 B;  1JRI A;  5GAN e;  4M75 F;  3HXV A;  4F7U B;  4J5Y A;  4XTW A;  4YRN A;  3HFN A;  2CJ9 A;  4YP0 A;  3BDU A;  2DDZ A;  2CIM A;  3E9H A;  4K86 A;  5GAO p;  4P72 C;  4BW9 A;  2IY5 B;  3RF1 A;  1ADY A;  4N0A C;  3BW1 A;  2QHU A;  4YRG A;  1X2H A;  3SWN A;  4TVA A;  3L1A A;  5GAN 2;  5CAI A;  4PJO D;  4XU3 A;  5GMK j;  3IG2 A;  3IKM B;  3P8T A;  2DXU A;  1PYS B;  4J6X A;  3QO3 A;  2ZCE A;  4M7A F;  2ZZF A;  2CGH A;  3W3S A;  2DTO A;  2E3C A;  2RB6 A;  5LJ3 g;  4M7D E;  1USY C;  2DQ0 A;  2ODR C;  3REX A;  2EL9 A;  4M78 C;  4M77 C;  4CS2 A;  2ZT6 A;  4EO4 A;  3V8L A;  3JCM P;  1LJO A;  1KOG A;  3OD1 A;  4AH6 A;  3SWN B;  4NL3 A;  3HFZ A;  4G84 A;  2ALY A;  3TEH B;  3UH0 A;  4HA8 A;  2I4O A;  4LNS A;  2DJZ A;  4EMK A;  4CH6 A;  4YRR A;  5GAN 4;  1YCY A;  4RDX A;  1ASZ A;  4C8Q A;  1RIQ A;  4P75 C;  5GAM g;  3L2Z A;  3JB9 J;  3LSQ A;  1WU7 A;  4OLF A;  1G5I A;  2P5I A;  3BFM A;  1B34 A;  1WNL A;  1BIA A;  2RD1 A;  1JJC A;  4M77 B;  3JB9 H;  4YRE A;  5GAN g;  1NYR A;  3HRI A;  2E10 A;  4YRQ A;  1I4K 1;  4NCX A;  4M7D A;  4P74 A;  3HFV A;  4XU2 A;  4F7U E;  2ALY B;  4WJ3 M;  3HY1 A;  2I4M A;  3JB9 G;  4YRF A;  4EMK B;  4TWA A;  3QUI A;  2Q7H A;  4C92 A;  4PJO F;  3IKL A;  3BJU A;  4HT8 A;  4RCC A;  3M4Q A;  4M77 G;  1L0W A;  4PHC A;  3R07 A;  4YCV A;  2I2L A;  1JJC B;  3A74 A;  1IL2 A;  3SB2 A;  2Q5I A;  5GAN f;  2ZNJ A;  3QHS A;  4CS4 A;  3RUX A;  5ELO A;  4PJO C;  1ASY A;  3CMQ A;  4H02 A;  4YRS A;  4DPG A;  3HFO A;  4YRP A;  2E65 A;  1N9S A;  5GAO q;  4H2X A;  2P0L A;  3ICA A;  4F7U A;  1YGB A;  4CH3 A;  4NOY A;  3MF2 A;  2VC8 A;  2RHS B;  3NET A; 
#chains in the Genus database with same CATH topology
 3MP6 A;  2DET A;  2FYK A;  2RK1 A;  2KYM A;  3L4G A;  5CKE A;  1G51 A;  2OTJ T;  1KD1 R;  2V8I A;  1WGS A;  1KD1 C;  3A7A A;  2A0F B;  4RTY A;  2RJC A;  3LH5 A;  3LYI A;  2DXB A;  2CUD A;  2PME A;  1R77 A;  1G5H A;  2DL8 A;  1NLO C;  4QQD A;  5KYX B;  1UGS B;  3OMC A;  2BE7 D;  3L42 A;  2J05 A;  1AWJ A;  2ZPF B;  4C8Q D;  4L6V 5;  1SRL A;  4QW2 A;  3X26 B;  1QWE A;  1VIF A;  1RAG B;  2ZT7 A;  2D1X A;  1B70 B;  2FRW A;  4N0A A;  3VS6 A;  2R57 A;  2ZPB B;  4XTV A;  3TEH A;  3CC2 A;  3LWH A;  2DRK A;  2NUP B;  3QDR B;  4ANJ A;  4YDQ A;  5C52 B;  1D0X A;  2VB6 A;  3P8B B;  1WQ7 A;  1EIY A;  4TVW A;  3HTR A;  5LJ3 h;  1YJN Q;  2KXD A;  4MZM A;  4F17 A;  4YCU A;  1WIE A;  4DOW A;  5HGQ A;  5FU6 C;  1PCX A;  3JCM c;  1USY A;  1DJ7 B;  2GBQ A;  4P3N A;  4M78 A;  2HQE A;  4EMG A;  1OUL A;  1UGQ B;  4M75 B;  3CC2 T;  2DU7 A;  1D3B B;  3OYI A;  3ZEH A;  2KR3 A;  2MWP A;  1W70 A;  1E1T A;  1WYX A;  4ZTF A;  4KH0 B;  2KI7 A;  2XD0 A;  2KQW A;  2LVM A;  2I4N A;  4ZIB A;  5A0L A;  2A36 A;  2F2V A;  1K0S A;  3VRZ A;  2V26 A;  3CPW S;  5GAN h;  5C6S A;  1ZBJ A;  3M4G A;  1H4T A;  2RM4 A;  3VQV A;  2A28 A;  3TVT A;  5GAO m;  4MDX A;  4UP8 A;  2Q5H A;  2EW3 A;  2I0N A;  2Z0W A;  3CCM A;  4HVC A;  1RL2 A;  4Q6G A;  2XMF A;  4FL6 A;  3JCM Q;  4M7D F;  2G3R A;  3VUB A;  1RLQ C;  2KRM A;  2QK0 A;  2CUB A;  3VS3 A;  1K73 R;  1K73 C;  2OI3 A;  1E6H A;  4GY5 A;  4M78 G;  2CP3 A;  1NJ8 A;  1KIK A;  5LJ5 e;  2MI6 A;  1JQQ A;  3HL8 A;  4MML A;  1QVG S;  3ERR A;  2JS0 A;  2CYZ B;  3CCM T;  3VS4 A;  3NEM A;  3E9F A;  5D6X A;  3JCM V;  5IH2 A;  5A2Q E;  5M9O A;  1MV0 B;  1QCF A;  2SEM A;  2YRV A;  3JB9 D;  4PFZ A;  1B7Y B;  2R58 A;  4F7U F;  1TUC A;  1YIJ A;  3CC7 A;  4JJC A;  1MUZ A;  5I21 A;  1ZHI A;  1VQO A;  1H4S A;  2QQB A;  3RER A;  2D8J A;  2DM1 A;  2FPD A;  5CKF A;  2QAS A;  1M5Q 1;  1HJD A;  4ESR A;  2FVU A;  2RPN A;  1D1A A;  1BU1 A;  1PHT A;  1VQL Q;  1E1O A;  5E3I A;  1QVP A;  2JM9 A;  4D6W A;  2VAS A;  2COY A;  1VQO T;  3GF5 A;  3KXT A;  4XEO A;  3E19 A;  1XOV A;  3S3O A;  1AD5 A;  5CR2 A;  1EIF A;  1K9M R;  4DBH A;  5GMK m;  1K9M C;  1PM3 A;  2VXE A;  3CXC S;  2DBK A;  4OMN A;  5LJ5 g;  2E41 A;  1GRI A;  2CJA A;  2RHQ B;  1W2B S;  3G71 A;  2VKN A;  2DPP B;  1TXQ A;  4JRI A;  3V8K A;  3VS1 A;  1MV3 A;  1KD1 U;  2QEX Q;  2RQT A;  3HRT A;  4J7I A;  2EYQ A;  3EG3 A;  3HRU A;  1ATI A;  3SWN C;  3OW2 A;  4C5G A;  2ZPI B;  3QDF A;  4ZNX A;  3P8Y A;  4XQ3 A;  2CT4 A;  2PQW A;  3JCM f;  3G71 T;  2E64 A;  1VYU A;  2EVR A;  3EFO A;  4P3P A;  1SF9 A;  2FHD A;  4O2D A;  1X56 A;  1WQW A;  1BI2 A;  2YLC A;  2AKW A;  1NE8 A;  2C7I A;  2LX7 A;  2L5Q A;  1KMM A;  4UPA A;  4CH4 A;  4M7A B;  3A8G B;  3H8Z A;  4N4H A;  3CBP A;  4MMK A;  1NLP C;  3L2U A;  2FB7 A;  2RI5 A;  1TH7 A;  5K1P A;  8AT1 B;  4XTU A;  4BE2 A;  3VQX A;  2L3Q A;  1IZ6 A;  2DYB A;  3A5Y A;  2BTT A;  4H2Y A;  4QVC A;  2EJ9 A;  4AT1 B;  3REU A;  4K11 A;  1QCN A;  4QT7 A;  3OA6 A;  4M7D C;  1SPK A;  2RN8 A;  4J9E A;  4PJO A;  1W66 A;  1Z9Z A;  2HEQ A;  1KQS A;  4J15 A;  2OTJ Q;  5KYU B;  1IB8 A;  2JMC A;  3H9N A;  3RKW A;  2O9S A;  4J9H A;  5GAM f;  4HKE A;  4FYV B;  1XJW B;  2DTH A;  1BKB A;  2EAY A;  2D0Q B;  4C5E A;  1IGQ A;  1KQ1 A;  1FMK A;  3C95 A;  2GF7 A;  2FZC B;  2HBP A;  2LNV A;  1B8A A;  1WPY A;  1ZQ1 A;  4KBM B;  4FSS A;  2PTK A;  5LJ3 e;  2HDA A;  2EQI A;  5KE2 A;  4HT9 A;  3FLG A;  4XU0 A;  4C92 B;  1OU8 A;  2LRQ A;  4RUG A;  3RMS A;  1K73 U;  3E9I A;  3NPF A;  5LJ5 j;  2YSQ A;  2K3B A;  3A32 A;  3ZL7 C;  1PRM C;  2DVJ A;  3BY7 A;  2B8A A;  4Z88 A;  3WVE B;  3I5R A;  5J26 A;  4EX5 A;  4A4G A;  4G85 A;  1QKX A;  4WCI A;  3JCM h;  3FJ5 A;  5AYF A;  4HVU A;  4PK4 A;  4K87 A;  3CC2 Q;  2LCS A;  5GAN e;  4LDX A;  4J5Y A;  8ATC B;  4XTW A;  9ATC B;  2CJ9 A;  4HVV A;  2RHY A;  2DDZ A;  1X6O A;  5GAO p;  2M16 A;  1X6B A;  4CC7 A;  1JJ2 A;  1PKT A;  2CP7 A;  3C0C A;  3R6O A;  3OQ5 A;  1G2B A;  4N4G A;  4A63 B;  2EKO A;  2L3R A;  2HSE B;  2ZZD A;  1X2H A;  4TVA A;  1LPL A;  1QLY A;  2EKH A;  2J7I A;  3M56 A;  2WAC A;  3P8T A;  3IG2 A;  2OAW A;  4J6X A;  2DJQ A;  3QO3 A;  4E2F B;  1Q81 R;  4M7A F;  2E6Z A;  4EIK A;  1Q81 C;  2CGH A;  3JV3 A;  2RB6 A;  2QQ9 A;  5LJ3 g;  4M7D E;  2DQ0 A;  2ODR C;  1M2O A;  4IUR A;  1VIE A;  4RMO A;  1TOV A;  3GOX A;  3MO8 A;  4C0G A;  5FRO A;  4NL3 A;  1K9M U;  3TEH B;  3M0R A;  2I4O A;  3G6E A;  2EGE A;  3UDC A;  4EMK A;  4DEY A;  1Y57 A;  2CZ6 B;  1KHC A;  1YCY A;  4WTO B;  1ASZ A;  4C8Q A;  4P75 C;  1YWO A;  1NZ9 A;  4BY6 B;  4PL6 A;  3E9G A;  1WU7 A;  2RQV A;  4RKU E;  1B34 A;  1RAE B;  4PFP A;  2JS2 A;  2DF6 A;  1BIA A;  1OU9 A;  2DD4 A;  4O6J A;  3JB9 H;  4YRE A;  5GAN g;  2IIM A;  2KT1 A;  3G6E T;  4P74 A;  3HFV A;  1BBZ A;  4XU2 A;  4F7U E;  2ALY B;  1X2K A;  3EGX A;  2I4M A;  2JTF A;  3A98 A;  1YIT Q;  2Q7H A;  3REA B;  4AG2 C;  4RTV A;  4IUV A;  4XK8 E;  3BJU A;  2ABL A;  4RCC A;  1MNE A;  3PTA A;  4HCC A;  1L0W A;  1AWO A;  2DO3 A;  1O9S A;  3R07 A;  1IL2 A;  3UA6 A;  2VGN A;  2GGR A;  2P4T A;  3CMA A;  1YI2 T;  1VQO Q;  3GP8 A;  2E65 A;  2FPE A;  1M2V B;  2JOY A;  2NUT A;  1AVZ C;  4H2X A;  2P0L A;  1YHQ A;  4J9C A;  2EQM A;  3CCJ A;  2VC8 A;  3NET A;  4FIB A;  3C4S A;  1FX7 A;  4RTZ A;  2A3L A;  1R0C B;  2MF2 A;  3CMA T;  2O2O A;  2DU5 A;  2YRD A;  1PC0 A;  1ZX6 A;  4LXC A;  2MAM A;  2NYS A;  2LT4 A;  1YHQ T;  1M8M A;  3CCJ T;  3CCV T;  2ZTG A;  2HKN A;  3I56 A;  3G71 Q;  3UPU A;  3NMZ C;  3MCA B;  3GNF B;  2ARU A;  5LJ5 d;  1X75 C;  4HWR A;  4KGZ B;  4PJM A;  3M0P A;  1YB3 A;  3ZBD A;  4DBQ A;  1OYX A;  5LJ3 j;  2ZGW A;  2BZY A;  5IXF A;  1MMN A;  3FRN A;  2RHX A;  2LJ3 A;  2HMA A;  3HRS A;  2VGM A;  4YRO A;  4YRT A;  4M7D D;  2KRO A;  3OYE A;  1D0Z A;  3CEY A;  4ORZ A;  3RL6 A;  4HT4 A;  4TTV A;  3EG9 A;  3KFV A;  1WHJ A;  5KCH A;  2RJE A;  1VQ6 T;  2DNU A;  1NJ5 A;  3I56 T;  1H8K A;  2X4J A;  2O88 A;  5HK3 A;  2H3E B;  2LJ0 A;  1QMC A;  4AFZ C;  1QP2 A;  3NTK A;  2PNI A;  4LDY A;  3WXM B;  5GAO l;  3CME Q;  4YPF A;  2MIO A;  4OP0 A;  3IAL A;  2X4Y A;  2NUZ A;  1KQS P;  3CPW A;  3EH1 A;  5GJV B;  5CKD A;  5GAN j;  2RMO A;  4L5G A;  5FU7 C;  2RQW A;  4Z8A A;  4M7A C;  2BUD A;  4KGX B;  1IXD A;  2DQ3 A;  1LNX A;  4M4Z A;  4O5V A;  1Y96 A;  2EYZ A;  2XI9 A;  4Y28 E;  1SHG A;  2J3M A;  2PUK B;  4Z02 A;  2DL3 A;  3CQT A;  2K3Y A;  1HC7 A;  2D6F A;  3RMQ A;  2ZIO A;  4A4H A;  1LOJ A;  3M57 A;  2E5A A;  1OX8 A;  2AKL A;  4WJ4 A;  3OMG A;  3PFS A;  4Q15 A;  4KQE A;  1QVG A;  1S1N A;  3HXX A;  2HD0 A;  4PJJ A;  1Q81 U;  3LX7 A;  1CSK A;  4JZ4 A;  2F2W A;  4IKF A;  1T0H A;  3EFO B;  2DE0 X;  2JNG A;  4ATO A;  3QO8 A;  3QZ9 B;  1AOJ A;  1X55 A;  1XTD A;  3I55 A;  4LDU A;  2VYT A;  4P71 C;  4E7Z A;  1ZSZ B;  2MPX C;  4XU1 A;  1H3Z A;  2ZPH B;  3MJX A;  2RHZ A;  2RJF A;  4ZTZ B;  1NPR A;  2FEI A;  2HKQ B;  1OPL A;  2RNA A;  5HKC A;  4PJN A;  4H2W A;  5FRN A;  4C92 C;  4DOV A;  1X54 A;  2KSS A;  4QVD A;  2DYI A;  4H2V A;  3OSS C;  3UA7 A;  3G1Z A;  2JZ2 A;  1VQ4 A;  3V8J A;  3I55 T;  5FRM A;  1WLP B;  4GLK A;  3OY9 A;  2EBP A;  2J3L A;  3RGL A;  2LQK A;  2ODR D;  5ECA A;  4NS5 A;  3J81 E;  5GMK l;  4E7H A;  1K8A U;  2K79 A;  4PJO B;  1TTH B;  3RKY A;  3FEO A;  3FJP A;  3VQW A;  3MP8 A;  3RES A;  3JCM J;  4XTY A;  3OBY A;  1VQ4 T;  3SDZ A;  4BDZ A;  3OYF A;  3CXC A;  2RK2 A;  3T9N A;  5GMK e;  3TEG A;  4E6R A;  5IHN A;  4YCW A;  1UUE A;  1W2B A;  2DXC A;  1D0Y A;  4M7A E;  2W10 A;  1T3L A;  1FMW A;  2QHS A;  2EJG A;  2AMC A;  3JCM X;  2JTM A;  2ROT A;  1S72 A;  1WYD A;  1M27 C;  4TQF A;  4F04 B;  3VQY A;  5DM7 R;  4JS5 A;  4Q5W A;  3A8H B;  2YXY A;  1IRX A;  1BI3 A;  3E1S A;  1M3C A;  1GCQ A;  3OBW A;  1ZUK A;  4ZGJ B;  2H3J A;  1X6G A;  1NJI U;  4J9B A;  2CJB A;  2ESW A;  2P4R A;  2ZNI A;  1NJ2 A;  3PMI A;  2J6O A;  3MEU A;  1UGV A;  4BI3 A;  1Q86 R;  1S72 T;  1Q86 C;  5HCK A;  1N5Z A;  1QCO A;  3CC4 A;  1H4V B;  2I4L A;  1JBM A;  3VYG A;  3V7C A;  2VVK A;  5LJ3 d;  2C0T A;  2HQX A;  3QJY A;  1WLE A;  3UGQ A;  2F5K A;  1KK7 A;  4ELZ C;  4M77 F;  5IN1 A;  4L87 A;  3M58 A;  2PMF A;  4C5I A;  3A7R A;  2EQU A;  3LGF A;  1M1K R;  3X20 B;  1M1K C;  3RIR A;  2EYW A;  5CQX A;  2JXB A;  3CC4 T;  1W4S A;  4YRJ A;  3REB B;  4EPC A;  1EX4 A;  3MEW A;  4XTX A;  4C92 E;  1WZO A;  4TVA B;  1H92 A;  4QKU A;  5GJW B;  2EQK A;  3JCM W;  5KYW A;  1LYL A;  2ROL A;  2QHT A;  5GAN d;  2XKO C;  4X5O A;  5GAO r;  2KEA A;  4NL2 A;  1YI2 Q;  3QII A;  2P0K A;  4HVW A;  5HK0 A;  3A8L B;  5D6W A;  2DEU A;  1OOT A;  3VUZ A;  4UC4 A;  3QYG B;  5KYY A;  2M0O A;  3U23 A;  12AS A;  1BYM A;  1EQR A;  4TVY A;  1WA7 A;  1ZLM A;  1MMA A;  5AT1 B;  4A4E A;  1EZZ B;  2ZR2 A;  4A53 A;  3CMA Q;  6AT1 B;  3Q1J A;  4JJB A;  1ADJ A;  2W0Z A;  4YRM A;  4C8Q B;  3QJ6 A;  2D9T A;  2CP6 A;  1ZA1 B;  1YHQ Q;  3A7U A;  1B34 B;  3VKI A;  5GAO n;  1JXM A;  1D1C A;  2RF0 A;  3DLM A;  3CCV Q;  1SG5 A;  2J06 A;  3A5Z B;  1H64 1;  1UE9 A;  3TEE A;  3GBQ A;  4E7I A;  1BCO A;  2F1L A;  3OS2 A;  5K1X A;  3PGG A;  1T0J A;  2F5T X;  2P84 A;  4M7A D;  1X43 A;  2LDM A;  2Q7G A;  4BE1 A;  2BKD N;  2FZG B;  2O31 A;  2A8E A;  3CD6 A;  2YDL A;  2NLU A;  1G5V A;  1VQ6 Q;  3QXE B;  1YIJ T;  3I56 Q;  3CC7 T;  3BE3 A;  3CPW P;  4H2T A;  3PCO A;  1RUW A;  3UFG A;  4BI8 B;  1TG0 A;  4JLG A;  1X69 A;  1B7T A;  2EWN A;  2KE9 A;  2QA4 A;  2NUT B;  2V8K A;  1JRI A;  4M75 F;  3G1J A;  3HXV A;  4E7J A;  2RHU A;  4YRN A;  3HFN A;  2EIF A;  2DA9 A;  3BDU A;  1QWF A;  2LC4 A;  3E9H A;  3MEA A;  3ULR B;  2DAQ A;  2MOX A;  3MQZ A;  1FXX A;  3M0T A;  3BW1 A;  3CCR A;  1QVG P;  1HD3 A;  3SWN A;  2QA4 T;  4DBR A;  5GAN 2;  2JTE A;  5CAI A;  4OB2 B;  5GMK j;  4LN2 A;  1E6G A;  1GFC A;  2COZ A;  2DXU A;  1AWW A;  2Y4X A;  4JRQ A;  2ZZF A;  2ZPE B;  4KUI A;  3H0H A;  1QVF S;  1IO6 A;  1AHJ B;  1V76 A;  1ZUY A;  4M77 C;  2EFI A;  4LVM A;  2HQH A;  3CCR T;  2AHJ B;  1KC8 R;  5EG2 A;  1KC8 C;  1KOG A;  4OMM A;  3OD1 A;  1Q82 R;  3HFZ A;  1Q82 C;  5KCO A;  2JW4 A;  2DJZ A;  4D8D A;  2PZ1 A;  3QYH B;  4YRR A;  2RQR A;  4RTU A;  1U06 A;  2K2V A;  3L2Z A;  4E7L A;  3LSQ A;  3OS1 A;  2QDL A;  1UGP B;  4VUB A;  1Q86 U;  1RAB B;  1JJC A;  3OYK A;  1ZSZ C;  1KJW A;  4BB7 A;  2XDD A;  1NYR A;  3HRI A;  3I55 Q;  5IT9 E;  2GQI A;  4E47 A;  4M7D A;  4BE0 A;  1OX9 A;  2VV5 A;  3M59 A;  3ME9 A;  1T3S A;  3OYB A;  4BAC A;  4C5H A;  3QUI A;  2X4W A;  4B9W A;  3CXC P;  4TWA A;  1AWX A;  4CI0 C;  1M1K U;  1W2B P;  4CC3 A;  4DEX A;  4YTL A;  2EYX A;  2J6F A;  2LT1 A;  4M77 G;  2F69 A;  1YJW A;  2L8D A;  3G4S A;  4PHC A;  2MMP A;  1RAF B;  1W1F A;  4GLM A;  2RH2 A;  3F70 A;  2AK5 A;  2KRS A;  2FG0 A;  2ZNJ A;  3QHS A;  4CS4 A;  3SHW A;  2DL4 A;  2L3P A;  3EGD A;  4PJO C;  1YP5 A;  3CMQ A;  1ASY A;  1N27 A;  4DA4 A;  1I5O B;  4OMF B;  1GBQ A;  2X51 A;  1ARK A;  4F7U A;  1ZA2 B;  1YJW T;  3NTI A;  3G7Z A;  3GIB A;  4KT0 E;  2QTX A;  4KUL A;  3V7R A;  4PKC C;  4ZN1 A;  4M7D G;  2K3X A;  1FYN A;  1ABO A;  2IY5 A;  3VJP A;  2ZCF B;  4FU6 A;  2DBM A;  1S72 Q;  1SER A;  2QQA A;  2YUO A;  3X28 B;  1G3S A;  3CCS A;  2EQJ A;  5D7U A;  3H41 A;  2IG0 A;  1PYS A;  2J6K A;  2NUP A;  2KGT A;  4LDW A;  1I0C A;  3AT1 B;  3SD4 A;  4M77 E;  3JSC A;  4JLI A;  1UJY A;  3MP1 A;  1UDL A;  2GFA A;  2XID A;  3L4G B;  1E24 A;  1MMD A;  1IRE B;  3TSW A;  3AHU A;  4KUD K;  3EFR A;  1C6V X;  3NEN A;  1JB0 E;  4M75 C;  5IAY A;  4PNO A;  3S6W A;  3CCS T;  1LCK A;  4OGC A;  4UP7 A;  4QQG A;  1PG5 B;  2QGF B;  4D8K A;  1NJ1 A;  4F7U G;  5KH6 A;  4LNP A;  1HTT A;  3S3N A;  1KHI A;  4DQ2 A;  1QE0 A;  2ZR3 A;  1J5W A;  1EFW A;  2L0A A;  3EFS A;  2V1R A;  2DXT A;  2M02 A;  1M1G A;  1NYG A;  4B9X A;  1OV3 A;  3RR6 A;  1C0M A;  1NG2 A;  2CZ0 B;  1QKW A;  1N8R R;  1WFW A;  3I5S A;  1N8R C;  3EG2 A;  1NJ6 A;  1Y0M A;  4C0Z A;  5LJ5 f;  3JCM b;  2PUO B;  3JAM E;  2X3X D;  2LCL A;  5GAM h;  1EIY B;  5GAN 6;  4QQ6 A;  1EOV A;  2JN0 A;  3CCM Q;  4P75 A;  4PFO A;  2KT8 A;  5FU6 B;  4PJO E;  4IIO A;  2QTV A;  4ZTU B;  1X2G A;  2OAU A;  1WJR A;  4M75 G;  4M78 B;  4LE9 A;  4HWP A;  4RQF A;  2E3I A;  1XQH A;  1JU5 C;  4YYE A;  1VQN A;  3MPU B;  4C8Q C;  4IUP A;  4HWO A;  2AT1 B;  2XIC A;  1SES A;  1NYF A;  3QWX X;  4C92 F;  1Q95 G;  3QZ5 B;  2LNH B;  2RHS A;  2CDT A;  4OMQ A;  3PNW C;  2SRC A;  5J39 A;  2YHT A;  1D1B A;  2VXF A;  3OS5 A;  5C0M A;  1YIJ Q;  2E6N A;  2MK5 A;  3CC7 Q;  3X24 B;  1VQN T;  1PSF A;  2PVG B;  5GMK i;  4AG1 C;  4ELY C;  5L23 A;  5DLO A;  4YRI A;  2JMA A;  1E22 A;  1X01 A;  3HRK A;  3QNE A;  1VOM A;  3BDL A;  3X25 B;  1C0A A;  4M75 E;  5LL6 S;  3P8D A;  3VV0 A;  5KYY B;  2RQU A;  1WHM A;  2E12 A;  2OX7 A;  4M77 D;  4OMP A;  1JO8 A;  2ED0 A;  2DZC A;  5GAN 3;  1MMG A;  3NFC A;  2KAF A;  2RHQ A;  2CSI A;  4P73 C;  4YRL A;  3CBO A;  4ZN3 A;  5D6Y A;  4LVK A;  2CS7 A;  1MHN A;  2KYB A;  4HWS A;  2RA2 A;  1RAA B;  1YFS A;  3A8M B;  4P72 A;  3LLR A;  2CH4 W;  2XG8 D;  1VQZ A;  1NPP A;  3RAC A;  4X9C A;  2ATC B;  3CCR Q;  2CZ7 B;  2CSQ A;  4C0F A;  4JPB W;  2XDB A;  1GXI E;  1IHW A;  1AEY A;  5FWC A;  4MDW A;  1K76 A;  4E7K A;  2DLP A;  2ARS A;  3O8V A;  2QHV A;  2DTI A;  3OYH A;  3LW5 E;  4HCK A;  5KNN A;  3M4P A;  1Z7M A;  3PCO B;  3P8H A;  1GL5 A;  1YFN A;  4OML A;  1U1S A;  2XHC A;  2DER A;  1B76 A;  4C8Q E;  2RI3 A;  1UB4 A;  1WHH A;  1FYF A;  2Q7E A;  1KQ2 A;  4ZTJ A;  4M78 F;  4M7A A;  2EGA A;  3M9Q A;  3GLX A;  1Q7Y R;  2MWO A;  5CCA A;  2P0P A;  3H0F A;  4KGV B;  3TRE A;  1Q7Y C;  2EPD A;  3UT1 A;  3DLL A;  3M54 A;  4KR3 A;  1VQ8 A;  1TUD A;  2DIG A;  1Y07 A;  4YRK A;  3TSZ A;  3I9Q A;  2KDS A;  2LZ6 B;  5FLX E;  1VYV A;  1Y7X A;  1GFD A;  3RNJ A;  4LD9 K;  3SEM A;  1M1F A;  3IQL A;  3QTC A;  2ART A;  4CH5 A;  3OYG A;  2LQ8 A;  4KRT A;  3QWY A;  1Z7N A;  2NS6 A;  1VQ8 T;  3NEL A;  1G3W A;  2K57 A;  3M0Q A;  1I8F A;  2EJF A;  3J7A F;  1FWZ A;  2K6D A;  5LJ3 f;  1I5L A;  2GCX A;  3MEV A;  3JCM e;  1YJW Q;  2AKW B;  4P71 A;  1I1J A;  3FC3 A;  1J3T A;  4M7A G;  4RTW A;  3HFZ B;  1N8R U;  2L2P A;  4M75 D;  4RG8 A;  4Y91 A;  4HWT A;  1TU0 B;  1VYT A;  1I81 A;  2QGG A;  4IUU A;  1AZE A;  1VQK A;  2ZPG B;  2IVW A;  1OPK A;  1N9W A;  2O4X A;  4J9F A;  1NBE B;  1VQP A;  1OZ3 A;  3QBY A;  1G3T A;  5F5W A;  3JB9 I;  5IHK A;  2ZZE A;  2VUB A;  4C0D B;  3CCQ A;  2C06 A;  2ZZG A;  2DIL A;  3EG1 A;  4M7D B;  1G3Y A;  4FT2 A;  1TWB A;  4AFS C;  4PG3 A;  2CZ1 B;  1HXD A;  1EVL A;  4LVL A;  3HKS A;  11AS A;  2BE9 B;  2M9U A;  1VQK T;  4OGE A;  3CCS Q;  1KG1 A;  4ZGD B;  3M0U A;  1VQP T;  1ABQ A;  2FRY A;  1M90 R;  2XDP A;  3PVQ A;  1BBW A;  2WSC E;  1M90 C;  3QSU A;  4AFQ C;  1U8R A;  3CCQ T;  2QI2 A;  3S3M A;  1YWP A;  2LX9 A;  3MEY A;  2DVE A;  2JVV A;  3EGD B;  2OTL A;  2ZAE A;  3HXZ A;  5GAM e;  3PT9 A;  4C92 G;  2EGC A;  4DBF A;  4K88 A;  2KBT A;  2E5K A;  3JCM g;  4F7U B;  2CKK A;  2CIM A;  3HPW A;  2KNB B;  2PVO B;  2IPO B;  3OSV A;  2OTL T;  4BW9 A;  1QVF A;  2IY5 B;  4N0A C;  2QHU A;  1VQM A;  3LGL A;  2FPF A;  4CC2 A;  3QG1 A;  1PYS B;  1GCQ C;  1W6X A;  2ZCE A;  3G6E Q;  4HCZ A;  4JJN K;  1Z9Q A;  2E3C A;  4BY6 C;  3L2V A;  2YUQ A;  3OYY A;  1USY C;  4J9G A;  5KYN A;  4PJL A;  3REX A;  2RO0 A;  2EL9 A;  4M78 C;  2RI2 A;  4CS2 A;  4EO4 A;  1VQM T;  4F14 A;  3V8L A;  3JCM P;  3O5Z A;  3J80 E;  4AH6 A;  3SFM A;  4G84 A;  3PMT A;  2ALY A;  3UH0 A;  1QP3 A;  4X34 A;  4LNS A;  1M4Z A;  5FWB A;  4CH6 A;  3CCL A;  5GAN 4;  1YJ9 A;  1VQN Q;  3MHX A;  1RIQ A;  2EYY A;  2YT6 A;  5GAM g;  3OYA A;  1V29 B;  1OI1 A;  3JB9 J;  1UJ0 A;  4OB3 B;  4ZGE B;  2RD1 A;  1WDX A;  4N4I A;  2QQR A;  1RAD B;  1I4K 1;  4NCX A;  5I11 A;  2CP2 A;  1X2Q A;  2HZY A;  1V1C A;  1N6A A;  2BIV A;  1Q7Y U;  3HY1 A;  3CCL T;  4WJ3 M;  4EMK B;  1YJ9 T;  1VQ5 A;  4P5N A;  1M2V A;  5CKH A;  4BI4 A;  4PJO F;  3IKL A;  4OVA A;  1KSW A;  5CVI A;  2AKK A;  1BI0 A;  4HT8 A;  2LCC A;  2JM8 A;  3OB9 A;  2DK3 A;  1K1Z A;  2BZX A;  2OJ2 A;  2I2L A;  3CCJ Q;  3A74 A;  2XK0 A;  4HXJ A;  2Q5I A;  3M53 A;  3RUX A;  5ELO A;  3EGU A;  1YIT A;  4Z89 A;  1VQ5 T;  3WVD B;  3EGX B;  4H02 A;  1TUG B;  1WXT A;  4DPG A;  3HFO A;  2KXC A;  4YRS A;  4YRP A;  1N9S A;  1ZUU A;  1VQ7 A;  1IHV A;  3THK A;  1YGB A;  1PD0 A;  4CH3 A;  2K2M A;  3MF2 A;  1R0B G;  1CKA A;  2RHS B;  1YN8 A;  3H0I A;  4J83 A;  1WX6 A;  3KUF A;  1NEG A;  1B3Q A;  3OYD A;  4BUG A;  1YIT T;  1VA7 A;  1ZSG A;  2DMO A;  4A4F A;  4PLL A;  4L59 A;  3C94 A;  2YLB A;  1VQ7 T;  3CD6 T;  2K7A A;  4KR2 A;  3EG0 A;  4H2X B;  2E3H A;  4M78 E;  2GNC A;  2HSP A;  3FDR A;  1VQ9 A;  5GAN 5;  1X27 A;  2Y4Y A;  1U3O A;  2B86 A;  4EDU A;  5GAN 8;  3QO5 A;  3CBM A;  4E51 A;  4FCY A;  1SEM A;  5FW9 A;  2A37 A;  1F1B B;  4R0K A;  1GGM A;  4RTT A;  5KE3 A;  1BK2 A;  1AZG B;  1VUB A;  3UF4 A;  1A0N B;  3A31 A;  4OMO A;  1WJS A;  4FYY B;  4C92 D;  1VQ9 T;  1M90 U;  3P8V A;  4OB0 B;  1CKB A;  4P3O A;  3CCU A;  2GTO A;  1EVK A;  2COW A;  1RI9 A;  1LVK A;  1VQ8 Q;  5GAM j;  3RBB B;  3CCE A;  1EFN A;  2QG9 B;  2QQS A;  5CIU A;  3OYN A;  3OYL A;  3MET A;  3ER0 A;  4M77 A;  3M4Y A;  1ZBX A;  1NNH A;  2CH4 A;  1M3B A;  1OZ2 A;  3A8O B;  5DLQ E;  3M55 A;  2MCN A;  4OB1 B;  1HSQ A;  3EG9 B;  3KFU A;  3M5A A;  5CKB A;  2HL5 C;  3CPF A;  3CCU T;  2FO0 A;  3ASK A;  1NM7 A;  1MGQ A;  3CCE T;  3L2W A;  3D7S B;  2RJD A;  3CME A;  5ELN A;  1K0X A;  2E70 A;  2LTO A;  4RCB A;  4C8Q F;  4HCB A;  4FM4 B;  3PVL A;  1UTI A;  1ZSZ A;  4BD3 A;  4R55 A;  2AZS A;  2JT4 A;  2ZIN A;  5FU7 B;  1SRM A;  2XGT A;  2HNI A;  1GBR A;  3HXY A;  1WHG A;  4JDS A;  2FL7 A;  3OYC A;  4WI1 A;  3CME T;  4FW2 A;  1Y96 B;  2Y90 A;  1SHF A;  1K9A A;  1OEB A;  2K4Y A;  1VQK Q;  3OYJ A;  2RHI A;  4MZP A;  2DZ9 A;  1VQ4 Q;  1VQP Q;  2R5A A;  3VS0 A;  4C0D C;  4LVJ A;  3CCQ Q;  2KMT A;  2G4C A;  3VU3 C;  2A7Y A;  2M1H A;  4X9D A;  2DD5 A;  4FT4 A;  2L3S A;  5KYX A;  1B07 A;  4Y92 A;  3VBB A;  2DKG A;  2G6F X;  3LC0 A;  1UHF A;  3G4S T;  5IXB A;  1UFF A;  5C51 B;  3TQ7 P;  1QVF P;  2C8M A;  1U5S A;  4UP9 A;  2O01 E;  1UG1 A;  1OQK A;  1B70 A;  4M78 D;  2ZIM A;  4EMH A;  2K5F A;  4J6W A;  2OTL Q;  4XAX B;  1RAC B;  5A0D A;  4AMC A;  3QO7 A;  2C0O A;  2DIQ A;  2YUN A;  4JRP A;  1PSE A;  2KK4 A;  3HXU A;  3UGT A;  3WQZ A;  3VS5 A;  5DY9 A;  1BBU A;  3NGP A;  1M9S A;  3MKD A;  3PZC A;  2O4X B;  4OF1 A;  2HAX A;  4IUT A;  3OYM A;  3RKX A;  1PNJ A;  2CRE A;  3JCM d;  3MF1 A;  4BWA A;  2ENM A;  4PJO G;  4CC4 B;  1PKS A;  2L89 A;  3FB9 A;  2QAZ A;  2X35 A;  2XU8 A;  2DEQ A;  4J8O A;  2X4X A;  3QKJ A;  1P92 A;  4M75 A;  3CC4 Q;  4RG2 A;  2WSE E;  1D3B A;  1RAH B;  2PU9 B;  1VQM Q;  3HXW A;  4IUQ A;  1K4U S;  4JUV A;  4KH1 B;  1WXU A;  4LUD A;  1D09 B;  4X1V A;  4RTX A;  2VWF A;  1YCS B;  1NYQ A;  2D8H A;  3JB9 F;  2ECZ A;  2QYZ A;  1I07 A;  2CP5 A;  4FYW B;  2AMC B;  1BCM A;  2ZT5 A;  5CQY A;  2NWM A;  3C12 A;  2E1H A;  3A1P A;  2LJ1 A;  4R56 A;  2R5M A;  7AT1 B;  1SRY A;  4YRC A;  2DL5 A;  2WSF E;  2A08 A;  3DB4 A;  5I22 A;  1YJN A;  2M51 A;  1U1T A;  2AIR B;  2YRC A;  3CCL Q;  5J3B A;  1YJ9 Q;  4WF2 A;  1PWT A;  5A0G A;  1PRL C;  4AFU C;  2PVD B;  3OW2 S;  4XTZ A;  5GMK h;  5GAM d;  4FW1 A;  4RQE A;  1H4Q A;  1RAI B;  3HY0 A;  2HBW A;  2DRM A;  4EMK C;  1YJN T;  3LSS A;  3PIO A;  4TVR A;  4V2S A;  1VQ5 Q;  4JS4 A;  4FSX A;  4LVI A;  1AT1 B;  1QF6 A;  3EH2 A;  1HK9 A;  1KMN A;  4TQD A;  3TUP A;  4JRK A;  3EHR A;  1B7Y A;  1WXB A;  3KBG A;  3QPH A;  2K9G A;  4J9D A;  1M8V A;  1PD1 A;  3A5Z A;  3I7F A;  3V7S A;  1MND A;  1KC8 U;  1BI1 A;  2DFU A;  2C0I A;  1Q82 U;  1K8A R;  4P74 C;  3DSQ A;  4XEM A;  1K8A C;  3DKM A;  1YFR A;  5KYW B;  3GPL A;  2ZT8 A;  3HTZ A;  5I2M A;  1YI2 A;  1QW1 A;  1UHC A;  5EC7 A;  2DX1 A;  4LD6 A;  3VS7 A;  4RMF A;  5GAN 7;  4CRI A;  2X3W D;  1VQ7 Q;  1YFT A;  4E7S A;  3CD6 Q;  1SKU B;  4JJD A;  3EAE A;  2HL3 A;  4IIM A;  3E2U A;  1KQS S;  3N5B B;  3M0S A;  4B6M A;  2LMJ A;  1IGU A;  3H6Z A;  3INZ A;  4H2S A;  4C8Q G;  3GNG A;  3UWN A;  2LQN A;  2ED1 A;  2QDY B;  4A54 A;  5HY6 A;  4LUE A;  2K5I A;  2QA4 Q;  1BIB A;  2K5L A;  3PIP A;  3HSB A;  4J7F A;  1NJI R;  4P73 A;  3CCV A;  2X9H A;  3FIF A;  3VS2 A;  1NJI C;  1R8O B;  2GTJ A;  1M30 A;  3PE0 A;  4J6Y A;  3OW2 P;  1VQ9 Q;  4CS3 A;  5I2S A;  1NEB A;  1RLP C;  4H2U A;  2H8H A;  2XTI A;  1E7O A;  5LJ5 h;  1SET A;  2ZXF A;  2YUP A;  2YWW A;  1SSF A;  2KVQ G;  2JJ9 A;  1N9R A;  5C53 B;  4FYX B;  1VQ6 A;  2P0Q A;  4LDV A;  1YNZ A;  2MYS A;  3TU4 K;  4YP0 A;  1VQL A;  1QQJ A;  2JUF A;  4PLI A;  3NTH A;  3UAT A;  2V8J A;  2M0Y A;  3CCU Q;  4K86 A;  1YBY A;  2HCK A;  4P72 C;  3CCE Q;  4JZ3 A;  3RF1 A;  1ADY A;  4YRG A;  3I35 A;  2CP0 A;  2GFU A;  3LWI A;  3L1A A;  1BB9 A;  4PJO D;  4XU3 A;  2O9V A;  3IKM B;  1RI0 A;  1VQL T;  1M3A A;  2F2X A;  5CO7 A;  1ACM B;  2E4H A;  3W3S A;  2DTO A;  5IHI A;  1UGR B;  1WHL A;  1JJ2 S;  2QEX A;  4F16 A;  1O75 A;  2FZK B;  2ZT6 A;  2QXF A;  3EHQ A;  3OS0 A;  1LJO A;  2BZ8 A;  1WHK A;  3SWN B;  4HA8 A;  2DL7 A;  3TCJ A;  4II1 A;  1GCP A;  5KYU A;  1C1A A;  1TS9 A;  4RDX A;  2CT3 A;  2LP5 A;  2QEX T;  3RDV A;  4OLF A;  3HP9 A;  1G5I A;  2P5I A;  1Y71 A;  3BFM A;  4QVZ A;  1WNL A;  4M77 B;  2E5Q A;  5CK9 A;  2KRN A;  3G4S Q;  2E10 A;  3LH0 A;  4YRQ A;  1XNI A;  1H3H A;  1HYO A;  4BDY A;  2KY9 A;  1WJQ A;  1TSF A;  3L2Q A;  1JEG A;  3JB9 G;  4YRF A;  3VRY A;  1WI7 A;  4MZT A;  3R6N A;  4C92 A;  2LQW A;  1JXO A;  3NHN A;  2AZV A;  3HHT B;  3M4Q A;  1SSH A;  3ZFJ A;  5L8R E;  4YCV A;  1JJC B;  3SB2 A;  4ME7 A;  5GAN f;  4A4K A;  3URG A;  1KFZ A;  2OTJ A;  4GBQ A;  4J9I A;  3DB3 A;  2D0N A;  3VYH B;  3L2R A;  1FMV A;  5GAO q;  1UEB A;  3ICA A;  1G8X A;  2GQV A;  1G83 A;  2V1Q A;  4NOY A;  1JJ2 P;  3JRZ A;  1UEC A; 
#chains in the Genus database with same CATH homology
 3MP6 A;  2FYK A;  2RK1 A;  3L4G A;  5CKE A;  1G51 A;  2OTJ T;  2V8I A;  1WGS A;  1KD1 C;  3A7A A;  2RJC A;  3LYI A;  2DXB A;  2PME A;  1G5H A;  4QQD A;  1UGS B;  3OMC A;  3L42 A;  2ZPF B;  4C8Q D;  4L6V 5;  4QW2 A;  3X26 B;  1VIF A;  2ZT7 A;  1B70 B;  4N0A A;  2R57 A;  2ZPB B;  4XTV A;  3TEH A;  3CC2 A;  3LWH A;  3QDR B;  4YDQ A;  5C52 B;  1EIY A;  3P8B B;  1WQ7 A;  4TVW A;  5LJ3 h;  4MZM A;  4YCU A;  4DOW A;  5HGQ A;  5FU6 C;  3JCM c;  1USY A;  1DJ7 B;  4P3N A;  4M78 A;  2HQE A;  4EMG A;  1UGQ B;  4M75 B;  3CC2 T;  2DU7 A;  1D3B B;  3OYI A;  3ZEH A;  2MWP A;  1E1T A;  4ZTF A;  2XD0 A;  2KQW A;  2LVM A;  2I4N A;  4ZIB A;  5A0L A;  3CPW S;  5GAN h;  5C6S A;  3M4G A;  1H4T A;  2RM4 A;  3VQV A;  5GAO m;  4MDX A;  4UP8 A;  2Q5H A;  3CCM A;  4HVC A;  1RL2 A;  4Q6G A;  4FL6 A;  3JCM Q;  4M7D F;  2G3R A;  3VUB A;  1K73 C;  4GY5 A;  4M78 G;  1NJ8 A;  5LJ5 e;  2MI6 A;  3HL8 A;  4MML A;  1QVG S;  3ERR A;  2CYZ B;  3CCM T;  3NEM A;  3E9F A;  5D6X A;  3JCM V;  5A2Q E;  5M9O A;  2YRV A;  3JB9 D;  1B7Y B;  2R58 A;  4F7U F;  1YIJ A;  3CC7 A;  5I21 A;  1ZHI A;  1VQO A;  1H4S A;  2QQB A;  3RER A;  5CKF A;  1M5Q 1;  2FVU A;  1E1O A;  5E3I A;  1QVP A;  4D6W A;  1VQO T;  3GF5 A;  3KXT A;  4XEO A;  3E19 A;  1XOV A;  3S3O A;  5CR2 A;  1EIF A;  5GMK m;  1K9M C;  2VXE A;  3CXC S;  5LJ5 g;  2E41 A;  2RHQ B;  2CJA A;  1W2B S;  3G71 A;  2DPP B;  4JRI A;  3V8K A;  1KD1 U;  3HRT A;  4J7I A;  2EYQ A;  3HRU A;  1ATI A;  3SWN C;  3OW2 A;  4C5G A;  2ZPI B;  3P8Y A;  4XQ3 A;  3JCM f;  2PQW A;  3G71 T;  2E64 A;  4P3P A;  2FHD A;  4O2D A;  1X56 A;  1WQW A;  1BI2 A;  2YLC A;  2AKW A;  1NE8 A;  2C7I A;  2L5Q A;  1KMM A;  4UPA A;  4CH4 A;  4M7A B;  3A8G B;  3H8Z A;  4N4H A;  3CBP A;  4MMK A;  3L2U A;  2FB7 A;  2RI5 A;  1TH7 A;  5K1P A;  4XTU A;  4BE2 A;  3VQX A;  1IZ6 A;  3A5Y A;  4H2Y A;  4QVC A;  2EJ9 A;  3REU A;  3OA6 A;  4M7D C;  4PJO A;  1W66 A;  1KQS A;  4J15 A;  3RKW A;  5GAM f;  4HKE A;  2DTH A;  1BKB A;  2EAY A;  2D0Q B;  4C5E A;  1KQ1 A;  3C95 A;  2GF7 A;  2HBP A;  2LNV A;  1B8A A;  1WPY A;  1ZQ1 A;  4KBM B;  5LJ3 e;  5KE2 A;  4HT9 A;  3FLG A;  4XU0 A;  4C92 B;  2LRQ A;  3RMS A;  1K73 U;  3E9I A;  5LJ5 j;  3A32 A;  3BY7 A;  2B8A A;  3WVE B;  5J26 A;  4EX5 A;  4A4G A;  4G85 A;  3JCM h;  5AYF A;  4K87 A;  5GAN e;  4LDX A;  4J5Y A;  4XTW A;  2CJ9 A;  2RHY A;  2DDZ A;  1X6O A;  5GAO p;  2M16 A;  1JJ2 A;  3R6O A;  3OQ5 A;  4N4G A;  2EKO A;  2L3R A;  2ZZD A;  1X2H A;  4TVA A;  3M56 A;  2WAC A;  3P8T A;  3IG2 A;  4J6X A;  3QO3 A;  4M7A F;  2E6Z A;  1Q81 C;  2CGH A;  2RB6 A;  2QQ9 A;  5LJ3 g;  4M7D E;  2DQ0 A;  2ODR C;  4IUR A;  1VIE A;  4RMO A;  3GOX A;  3MO8 A;  4C0G A;  5FRO A;  4NL3 A;  1K9M U;  3TEH B;  2I4O A;  3G6E A;  3UDC A;  4EMK A;  2CZ6 B;  1KHC A;  1YCY A;  1ASZ A;  4C8Q A;  4P75 C;  4BY6 B;  1NZ9 A;  4PL6 A;  3E9G A;  1WU7 A;  4RKU E;  1B34 A;  1BIA A;  2DD4 A;  4O6J A;  3JB9 H;  4YRE A;  5GAN g;  3G6E T;  4P74 A;  3HFV A;  4XU2 A;  4F7U E;  2ALY B;  2I4M A;  2JTF A;  2Q7H A;  4IUV A;  4XK8 E;  3BJU A;  4RCC A;  3PTA A;  4HCC A;  1L0W A;  2DO3 A;  1O9S A;  3R07 A;  1IL2 A;  2VGN A;  2P4T A;  3CMA A;  1YI2 T;  3GP8 A;  2E65 A;  2JOY A;  4H2X A;  2P0L A;  1YHQ A;  2EQM A;  3CCJ A;  2VC8 A;  3NET A;  4FIB A;  3C4S A;  1FX7 A;  2A3L A;  2MF2 A;  3CMA T;  2DU5 A;  2MAM A;  2LT4 A;  1YHQ T;  3CCJ T;  3CCV T;  2ZTG A;  3I56 A;  3UPU A;  3MCA B;  3GNF B;  2ARU A;  5LJ5 d;  1X75 C;  4HWR A;  1YB3 A;  3ZBD A;  5LJ3 j;  1OYX A;  2ZGW A;  3FRN A;  2RHX A;  3HRS A;  4YRO A;  2VGM A;  4YRT A;  4M7D D;  3OYE A;  3CEY A;  4HT4 A;  3RL6 A;  4TTV A;  1VQ6 T;  5KCH A;  2RJE A;  1NJ5 A;  3I56 T;  2X4J A;  5HK3 A;  1QP2 A;  3NTK A;  4LDY A;  3WXM B;  5GAO l;  4YPF A;  4OP0 A;  3IAL A;  2X4Y A;  3CPW A;  5CKD A;  5GAN j;  4L5G A;  5FU7 C;  4M7A C;  2BUD A;  2DQ3 A;  1LNX A;  4O5V A;  1Y96 A;  2XI9 A;  4Y28 E;  2J3M A;  2PUK B;  4Z02 A;  2K3Y A;  1HC7 A;  2D6F A;  3RMQ A;  2ZIO A;  4A4H A;  1LOJ A;  3M57 A;  2E5A A;  4WJ4 A;  3OMG A;  3PFS A;  4Q15 A;  4KQE A;  1QVG A;  3HXX A;  2HD0 A;  1Q81 U;  3LX7 A;  4IKF A;  2JNG A;  4ATO A;  3QO8 A;  3QZ9 B;  1X55 A;  1XTD A;  3I55 A;  4LDU A;  2VYT A;  4P71 C;  4XU1 A;  1H3Z A;  2ZPH B;  2RHZ A;  2RJF A;  4ZTZ B;  1NPR A;  5HKC A;  4H2W A;  5FRN A;  4C92 C;  4DOV A;  1X54 A;  2KSS A;  4QVD A;  4H2V A;  3OSS C;  3G1Z A;  2JZ2 A;  1VQ4 A;  3V8J A;  3I55 T;  5FRM A;  4GLK A;  3OY9 A;  2J3L A;  3RGL A;  2LQK A;  2ODR D;  4NS5 A;  3J81 E;  5GMK l;  4E7H A;  1K8A U;  4PJO B;  3RKY A;  3FEO A;  3FJP A;  3VQW A;  3MP8 A;  3RES A;  3JCM J;  4XTY A;  3OBY A;  1VQ4 T;  3SDZ A;  4BDZ A;  3OYF A;  3CXC A;  2RK2 A;  3T9N A;  5GMK e;  3TEG A;  4YCW A;  1W2B A;  2DXC A;  4M7A E;  2QHS A;  2EJG A;  2AMC A;  3JCM X;  2JTM A;  1S72 A;  1WYD A;  4TQF A;  3VQY A;  5DM7 R;  4JS5 A;  4Q5W A;  3A8H B;  1BI3 A;  3E1S A;  3OBW A;  4ZGJ B;  2H3J A;  1NJI U;  2CJB A;  2ZNI A;  1NJ2 A;  3PMI A;  3MEU A;  4BI3 A;  1S72 T;  1Q86 C;  3CC4 A;  1H4V B;  2I4L A;  1JBM A;  3VYG A;  3V7C A;  5LJ3 d;  2HQX A;  3QJY A;  1WLE A;  3UGQ A;  2F5K A;  4ELZ C;  4M77 F;  5IN1 A;  4L87 A;  3M58 A;  2PMF A;  4C5I A;  3A7R A;  2EQU A;  3LGF A;  3X20 B;  1M1K C;  3RIR A;  5CQX A;  3CC4 T;  4YRJ A;  1W4S A;  4EPC A;  3MEW A;  4XTX A;  4C92 E;  4TVA B;  2EQK A;  3JCM W;  1LYL A;  2QHT A;  5GAN d;  2XKO C;  4X5O A;  5GAO r;  4NL2 A;  3QII A;  2P0K A;  5HK0 A;  3A8L B;  5D6W A;  3VUZ A;  4UC4 A;  3QYG B;  2M0O A;  12AS A;  1BYM A;  1EQR A;  4TVY A;  4A4E A;  2ZR2 A;  4A53 A;  3Q1J A;  1ADJ A;  4YRM A;  4C8Q B;  3QJ6 A;  2D9T A;  3A7U A;  1B34 B;  3VKI A;  5GAO n;  3DLM A;  3A5Z B;  1H64 1;  3TEE A;  4E7I A;  3OS2 A;  5K1X A;  3PGG A;  2F5T X;  4M7A D;  2LDM A;  2Q7G A;  4BE1 A;  2BKD N;  2A8E A;  3CD6 A;  2NLU A;  1G5V A;  3QXE B;  1YIJ T;  3CC7 T;  4H2T A;  3PCO A;  3UFG A;  4BI8 B;  4JLG A;  2EWN A;  2QA4 A;  2V8K A;  1JRI A;  4M75 F;  3HXV A;  4E7J A;  2RHU A;  4YRN A;  3HFN A;  2EIF A;  3BDU A;  2LC4 A;  3E9H A;  3MEA A;  2DAQ A;  3MQZ A;  1FXX A;  3BW1 A;  3CCR A;  3SWN A;  2QA4 T;  5GAN 2;  5CAI A;  4OB2 B;  5GMK j;  2DXU A;  2Y4X A;  4JRQ A;  2ZZF A;  2ZPE B;  4KUI A;  1QVF S;  1AHJ B;  4M77 C;  2EFI A;  4LVM A;  3CCR T;  2AHJ B;  5EG2 A;  1KC8 C;  1KOG A;  3OD1 A;  3HFZ A;  1Q82 C;  5KCO A;  2DJZ A;  4YRR A;  3QYH B;  2K2V A;  3L2Z A;  4E7L A;  3LSQ A;  3OS1 A;  1UGP B;  4VUB A;  1Q86 U;  1JJC A;  3OYK A;  4BB7 A;  2XDD A;  1NYR A;  3HRI A;  5IT9 E;  4E47 A;  4M7D A;  4BE0 A;  2VV5 A;  3M59 A;  3ME9 A;  3OYB A;  4BAC A;  4C5H A;  3QUI A;  2X4W A;  4B9W A;  4TWA A;  1M1K U;  4CI0 C;  4YTL A;  2LT1 A;  4M77 G;  2F69 A;  1YJW A;  2L8D A;  3G4S A;  4PHC A;  2MMP A;  2RH2 A;  3F70 A;  2ZNJ A;  3QHS A;  4CS4 A;  4PJO C;  1ASY A;  3CMQ A;  1N27 A;  4DA4 A;  4OMF B;  4F7U A;  1YJW T;  3NTI A;  3G7Z A;  3GIB A;  4KT0 E;  2QTX A;  4KUL A;  3V7R A;  4PKC C;  4ZN1 A;  4M7D G;  2K3X A;  2IY5 A;  3VJP A;  2ZCF B;  4FU6 A;  1SER A;  2QQA A;  3X28 B;  1G3S A;  3CCS A;  2EQJ A;  2IG0 A;  1PYS A;  4LDW A;  3SD4 A;  4M77 E;  3JSC A;  4JLI A;  3MP1 A;  2GFA A;  2XID A;  3L4G B;  1E24 A;  1IRE B;  3AHU A;  4KUD K;  3EFR A;  3NEN A;  1JB0 E;  4M75 C;  5IAY A;  4PNO A;  3S6W A;  3CCS T;  4OGC A;  4UP7 A;  4QQG A;  1NJ1 A;  4F7U G;  5KH6 A;  1HTT A;  3S3N A;  1KHI A;  4DQ2 A;  1QE0 A;  2ZR3 A;  1J5W A;  1EFW A;  3EFS A;  2DXT A;  1M1G A;  4B9X A;  2CZ0 B;  1N8R C;  1NJ6 A;  4C0Z A;  5LJ5 f;  3JCM b;  2PUO B;  3JAM E;  2LCL A;  5GAM h;  1EIY B;  5GAN 6;  4QQ6 A;  1EOV A;  2JN0 A;  4P75 A;  5FU6 B;  4PJO E;  4ZTU B;  1X2G A;  2OAU A;  1WJR A;  4M75 G;  4M78 B;  4HWP A;  4RQF A;  1XQH A;  4YYE A;  1VQN A;  4C8Q C;  4IUP A;  4HWO A;  2XIC A;  1SES A;  4C92 F;  3QZ5 B;  2RHS A;  3PNW C;  5J39 A;  2YHT A;  2VXF A;  3OS5 A;  5C0M A;  2E6N A;  3X24 B;  1VQN T;  1PSF A;  2PVG B;  5GMK i;  4ELY C;  5DLO A;  4YRI A;  1E22 A;  1X01 A;  3HRK A;  3QNE A;  3BDL A;  3X25 B;  1C0A A;  4M75 E;  5LL6 S;  3P8D A;  3VV0 A;  2E12 A;  4M77 D;  2DZC A;  5GAN 3;  3NFC A;  2KAF A;  2RHQ A;  4P73 C;  4YRL A;  3CBO A;  4ZN3 A;  5D6Y A;  4LVK A;  2CS7 A;  1MHN A;  4HWS A;  2RA2 A;  1YFS A;  3A8M B;  4P72 A;  3LLR A;  2XG8 D;  1VQZ A;  1NPP A;  3RAC A;  4X9C A;  2CZ7 B;  4C0F A;  2XDB A;  1GXI E;  4MDW A;  4E7K A;  2ARS A;  3O8V A;  2QHV A;  2DTI A;  3OYH A;  3LW5 E;  5KNN A;  3M4P A;  1Z7M A;  3PCO B;  3P8H A;  1U1S A;  2XHC A;  1B76 A;  4C8Q E;  2RI3 A;  1UB4 A;  1FYF A;  2Q7E A;  1KQ2 A;  4ZTJ A;  4M78 F;  4M7A A;  3M9Q A;  3GLX A;  2MWO A;  5CCA A;  2P0P A;  3TRE A;  1Q7Y C;  3UT1 A;  3DLL A;  3M54 A;  4KR3 A;  1VQ8 A;  2DIG A;  1Y07 A;  4YRK A;  2KDS A;  5FLX E;  1Y7X A;  4LD9 K;  1M1F A;  3QTC A;  2ART A;  4CH5 A;  3OYG A;  2LQ8 A;  1Z7N A;  2NS6 A;  1VQ8 T;  3NEL A;  1G3W A;  2K57 A;  1I8F A;  2EJF A;  3J7A F;  1FWZ A;  5LJ3 f;  1I5L A;  2GCX A;  3MEV A;  3JCM e;  2AKW B;  4P71 A;  3FC3 A;  4M7A G;  3HFZ B;  1N8R U;  4M75 D;  4RG8 A;  4Y91 A;  4HWT A;  1I81 A;  4IUU A;  1VQK A;  2ZPG B;  2IVW A;  1N9W A;  2O4X A;  1VQP A;  1OZ3 A;  3QBY A;  1G3T A;  5F5W A;  3JB9 I;  2ZZE A;  2VUB A;  4C0D B;  3CCQ A;  2C06 A;  2ZZG A;  4M7D B;  1G3Y A;  4FT2 A;  4PG3 A;  2CZ1 B;  1HXD A;  1EVL A;  4LVL A;  3HKS A;  11AS A;  2M9U A;  1VQK T;  4OGE A;  1KG1 A;  4ZGD B;  1VQP T;  2XDP A;  1BBW A;  2WSC E;  1M90 C;  3QSU A;  1U8R A;  3CCQ T;  2QI2 A;  3S3M A;  2LX9 A;  3MEY A;  2DVE A;  2JVV A;  2OTL A;  3HXZ A;  5GAM e;  3PT9 A;  4C92 G;  4K88 A;  3JCM g;  4F7U B;  2CKK A;  2CIM A;  3HPW A;  2PVO B;  3OSV A;  2OTL T;  4BW9 A;  1QVF A;  2IY5 B;  4N0A C;  2QHU A;  1VQM A;  3LGL A;  3QG1 A;  1PYS B;  2ZCE A;  4HCZ A;  4JJN K;  2E3C A;  4BY6 C;  3L2V A;  3OYY A;  1USY C;  3REX A;  2RO0 A;  2EL9 A;  4M78 C;  2RI2 A;  4CS2 A;  4EO4 A;  1VQM T;  3V8L A;  3JCM P;  3J80 E;  4AH6 A;  3SFM A;  4G84 A;  3PMT A;  2ALY A;  3UH0 A;  1QP3 A;  4X34 A;  4LNS A;  1M4Z A;  4CH6 A;  3CCL A;  5GAN 4;  1YJ9 A;  3MHX A;  1RIQ A;  5GAM g;  3OYA A;  1V29 B;  3JB9 J;  1OI1 A;  4OB3 B;  4ZGE B;  2RD1 A;  4N4I A;  2QQR A;  1I4K 1;  4NCX A;  1N6A A;  2BIV A;  1Q7Y U;  3HY1 A;  3CCL T;  4WJ3 M;  4EMK B;  1YJ9 T;  1VQ5 A;  4P5N A;  5CKH A;  4BI4 A;  4PJO F;  3IKL A;  4OVA A;  5CVI A;  1BI0 A;  4HT8 A;  2LCC A;  3OB9 A;  2DK3 A;  2I2L A;  3A74 A;  2XK0 A;  2Q5I A;  3M53 A;  3RUX A;  5ELO A;  1YIT A;  1VQ5 T;  3WVD B;  4H02 A;  4YRS A;  4DPG A;  3HFO A;  4YRP A;  1N9S A;  1VQ7 A;  1YGB A;  4CH3 A;  3MF2 A;  2RHS B;  4J83 A;  3KUF A;  3OYD A;  4BUG A;  1YIT T;  4A4F A;  4PLL A;  4L59 A;  3C94 A;  2YLB A;  1VQ7 T;  3CD6 T;  4KR2 A;  4H2X B;  4M78 E;  3FDR A;  1VQ9 A;  5GAN 5;  2Y4Y A;  4EDU A;  5GAN 8;  3QO5 A;  3CBM A;  4E51 A;  1GGM A;  5KE3 A;  1VUB A;  3A31 A;  1WJS A;  4C92 D;  1VQ9 T;  1M90 U;  3P8V A;  4OB0 B;  4P3O A;  3CCU A;  1EVK A;  5GAM j;  3CCE A;  2QQS A;  5CIU A;  3OYN A;  3OYL A;  3MET A;  3ER0 A;  4M77 A;  3M4Y A;  1ZBX A;  1NNH A;  1OZ2 A;  3A8O B;  5DLQ E;  3M55 A;  4OB1 B;  3KFU A;  3M5A A;  5CKB A;  3CPF A;  3CCU T;  3ASK A;  1MGQ A;  3CCE T;  3L2W A;  3CME A;  2RJD A;  5ELN A;  2E70 A;  2LTO A;  4RCB A;  4C8Q F;  4HCB A;  4FM4 B;  4BD3 A;  4R55 A;  2ZIN A;  5FU7 B;  2XGT A;  2HNI A;  3HXY A;  4JDS A;  2FL7 A;  3OYC A;  4WI1 A;  3CME T;  1Y96 B;  2Y90 A;  2K4Y A;  3OYJ A;  2RHI A;  4MZP A;  2DZ9 A;  2R5A A;  4C0D C;  4LVJ A;  2KMT A;  2G4C A;  3VU3 C;  2A7Y A;  2M1H A;  4X9D A;  2DD5 A;  4FT4 A;  3VBB A;  2DKG A;  3LC0 A;  3G4S T;  5C51 B;  2C8M A;  4UP9 A;  2O01 E;  1B70 A;  4M78 D;  2ZIM A;  4EMH A;  2K5F A;  4J6W A;  4XAX B;  5A0D A;  3QO7 A;  3HXU A;  2DIQ A;  4JRP A;  3WQZ A;  1PSE A;  2KK4 A;  3UGT A;  5DY9 A;  1BBU A;  1M9S A;  3PZC A;  2O4X B;  4OF1 A;  2HAX A;  4IUT A;  3OYM A;  3RKX A;  3JCM d;  3MF1 A;  4BWA A;  4PJO G;  2L89 A;  3FB9 A;  2X35 A;  2XU8 A;  2DEQ A;  4J8O A;  2X4X A;  3QKJ A;  1P92 A;  4M75 A;  4RG2 A;  2WSE E;  1D3B A;  2PU9 B;  3HXW A;  4IUQ A;  4JUV A;  1NYQ A;  3JB9 F;  2AMC B;  2ZT5 A;  5CQY A;  3C12 A;  2E1H A;  1SRY A;  4R56 A;  2R5M A;  4YRC A;  2WSF E;  3DB4 A;  1YJN A;  1U1T A;  5J3B A;  4WF2 A;  5A0G A;  2PVD B;  3OW2 S;  4XTZ A;  5GMK h;  5GAM d;  4RQE A;  1H4Q A;  3HY0 A;  4EMK C;  1YJN T;  3LSS A;  3PIO A;  4TVR A;  4V2S A;  4JS4 A;  4FSX A;  4LVI A;  1QF6 A;  1KMN A;  1HK9 A;  4TQD A;  3TUP A;  4JRK A;  1B7Y A;  3KBG A;  3QPH A;  1M8V A;  3A5Z A;  3I7F A;  3V7S A;  1KC8 U;  1BI1 A;  1Q82 U;  4P74 C;  3DSQ A;  4XEM A;  1K8A C;  3DKM A;  1YFR A;  3GPL A;  2ZT8 A;  3HTZ A;  5I2M A;  1YI2 A;  1QW1 A;  4LD6 A;  4RMF A;  5GAN 7;  4CRI A;  1YFT A;  3EAE A;  1KQS S;  3N5B B;  3H6Z A;  3INZ A;  4H2S A;  4C8Q G;  3GNG A;  3UWN A;  2QDY B;  4A54 A;  5HY6 A;  2K5I A;  1BIB A;  2K5L A;  3PIP A;  3HSB A;  4J7F A;  4P73 A;  3CCV A;  3FIF A;  1NJI C;  1R8O B;  4J6Y A;  4CS3 A;  5I2S A;  4H2U A;  2XTI A;  5LJ5 h;  1SET A;  2ZXF A;  1SSF A;  2KVQ G;  1N9R A;  5C53 B;  1VQ6 A;  2P0Q A;  4LDV A;  3TU4 K;  4YP0 A;  1VQL A;  2JUF A;  4PLI A;  3NTH A;  2V8J A;  4K86 A;  1YBY A;  4P72 C;  3RF1 A;  1ADY A;  4YRG A;  2GFU A;  3LWI A;  3L1A A;  4PJO D;  4XU3 A;  3IKM B;  1RI0 A;  1VQL T;  5CO7 A;  3W3S A;  2DTO A;  1UGR B;  1JJ2 S;  2QEX A;  1O75 A;  2ZT6 A;  2QXF A;  3OS0 A;  1LJO A;  3SWN B;  4HA8 A;  3TCJ A;  4II1 A;  4RDX A;  2QEX T;  4OLF A;  3HP9 A;  1G5I A;  2P5I A;  1Y71 A;  3BFM A;  1WNL A;  4QVZ A;  4M77 B;  2E5Q A;  5CK9 A;  2E10 A;  3LH0 A;  4YRQ A;  1XNI A;  4BDY A;  1WJQ A;  2KY9 A;  3L2Q A;  3JB9 G;  4YRF A;  4MZT A;  4C92 A;  3HHT B;  3M4Q A;  3ZFJ A;  5L8R E;  4YCV A;  1JJC B;  3SB2 A;  4ME7 A;  5GAN f;  4A4K A;  3URG A;  2OTJ A;  3DB3 A;  3VYH B;  3L2R A;  5GAO q;  1UEB A;  3ICA A;  2GQV A;  4NOY A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...