4XTXA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 57 with azide in place of ribose 2'oh
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtxA01
1KMMA 4EMHA 2EJGA 3QNEA 1SERA 2CJBA 4M7AG 2VC8A 1N9WA 3JB9D 2DU7A 3JCMf 3BJUA 4M78E 3RKXA 1EIYA 4CH4A 1W66A 3RKYA 5GMKi 1X55A 4KQEA 3VU3C 1WU7A 1WQWA 2E5AA 3JCMh 3GIBA 2DXUA 2ZZEA 4OP0A 1NNHA 4XEMA 4M7AD 1PYSA 2ZT6A 4RDXA 5GAOq 4TQFA 4H2SA 3HSBA 1H641 3TEGA 5K1PA 1G51A 4PJOG 3A7RA 5GAN3 3A7UA 4YCVA 4UP9A 4RMFA 1QF6A 2ZGWA 1TH7A 3CMQA 1EFWA 2YHTA 1WYDA 2YLBA 5LJ5g 1LNXA 4JRKA 2I4LA 2ZXFA 1WNLA 5I21A 1H4SA 3VQWA 4EX5A 4M77A 3HFVA 5GANh 2ZINA 4RCBA 5KNNA 4K86A 2XGTA 3V7CA 3ERRA 2FB7A 1B70B 4C92C 5C52B 3MEYA 2E3CA 3HY1A 1ASZA 4HT8A 3JCMc 1YB3A 1KMNA 2I4NA 1LJOA 4YROA 1M5Q1 3BDUA 3SWNA 2C7IA 1YCYA 2DQ3A 5GANg 4YPFA 1LOJA 4YRMA 2ZR2A 4H2XA 4HT9A 5GAOn 3HTZA 4H2WA 5LJ5h 1H4TA 2QHUA 3HXYA 2ALYB 3NELA 4HA8A 4BW9A 1ADYA 3JCMJ 2YLCA 3W3SA 4O2DA 1USYA 2ZIOA 2DTIA 4PJOC 2ZZFA 4M75B 3FB9A 3RERA 2DVEA 3A74A 4CH6A 1HC7A 4YRSA 4M78B 2EJ9A 3RACA 2RHQA 2DZCA 3JCMd 3P8VA 4M75G 1I81A 4A54A 3HXWA 4M75E 5C53B 4P73C 4C8QD 1E1OA 1H4VB 3IKLA 1B34B 4XU0A 1B76A 4RQFA 5C51B 3JB9G 1BIAA 3HFZB 1N9RA 4C92E 4YRRA 1HK9A 4YREA 4M7DF 5GAOr 3BW1A 1SETA 4KR3A 5GMKl 4BWAA 4H2UA 2DXTA 3PGGA 4EMKB 4P72C 1EIYB 4J5YA 4YRLA 1C0AA 1JRIA 4M78C 3M4GA 2ZNIA 5GAN8 3JCMe 4C92D 4J6WA 4JUVA 1YFRA 1H4QA 1HXDA 3JCMW 5GMKh 5GAOl 3RESA 3TEHB 2VXFA 1KOGA 4V2SA 3PCOB 4CH5A 3NENA 4YRPA 3LC0A 3SWNB 3AHUA 2DEQA 4WI1A 1I5LA 4WF2A 4X5OA 2Q5HA 2I4MA 2AMCB 2RB6A 2E1HA 2EL9A 3V8JA 4YCUA 3A31A 4ZIBA 1E24A 4MMKA 4CS3A 4P72A 3JB9J 1WPYA 3JCMV 4M7AE 2G4CA 2ZT8A 2CJAA 3VQYA 3L4GA 4YDQA 4TVWA 4YRFA 3VQXA 5LJ5f 2AKWA 4M77B 4M75C 1BBWA 4HWTA 1NJ6A 3RF1A 3OD1A 4G85A 3QO5A 3VQVA 3HFOA 3RKWA 4C8QE 5F5WA 3HRKA 3A5YA 1Z7MA 2ZCEA 4M77G 5GAN4 5GMKm 4ZTZB 4XQ3A 5LJ3f 4M7DG 3RGLA 4P3PA 4XTUA 1M8VA 3QO3A 3V8LA 3RL6A 2RHQB 5GAMh 3L4GB 4KR2A 3JB9I 1X2HA 5GMKj 2E41A 2AKWB 2J3MA 3LSQA 3NETA 4TQDA 2EWNA 4TWAA 4XU3A 1WLEA 3TUPA 1JBMA 2ARTA 3PZCA 3SB2A 4HWOA 5GANd 3BY7A 4JLIA 4M7AB 4XTZA 3UFGA 4XTXA 5GANf 4PJOA 4F7UA 2ARUA 4K88A 4ZTUB 1B8AA 2DJZA 1X2GA 3QO8A 4TTVA 2ZT5A 4CS4A 2DZ9A 1SESA 1ADJA 2E10A 4H2TA 4YRCA 12ASA 4M7DB 1U1SA 2CGHA 2ARSA 4EMKC 1D3BA 1NJ5A 4C8QB 4DQ2A 3JCMb 4X9CA 1EQRA 1G5HA 4M75A 4XU2A 1Y96B 4PJOE 4M7AA 2RA2A 11ASA 2DU5A 5GAMe 4EO4A 1U1TA 4XTWA 5GAN6 2C8MA 2ODRD 3SWNC 4Q6GA 3HY0A 1E1TA 3IG2A 2ZNJA 2HNIA 4QVCA 1G5IA 5LJ5e 4CH3A 5CAIA 3QHSA 5GAMf 1ATIA 3IALA 4HWSA 4H2VA 4M78F 2PMFA 4J6YA 4YP0A 4F7UF 1NYQA 4PJOF 4M7AF 3INZA 1Y96A 4M75F 3P8TA 4NCXA 2IY5B 2I4OA 2ZIMA 1B70A 4X9DA 1EVLA 4XU1A 4UPAA 3REXA 4M7DC 4J15A 4M7DE 3MF2A 1EVKA 5LJ5j 4DPGA 2PMEA 2FYKA 4TVAB 4YRIA 3JB9F 3FJPA 4M75D 3R07A 4UP8A 3L2ZA 1YGBA 5E3IA 4XTVA 5GAOm 2QTXA 4HVCA 4M78D 4PNOA 5LJ3j 5ELNA 2IY5A 4YRGA 1USYC 5GANe 2Y90A 2P0LA 3JCMg 2JN0A 3L1AA 2Q7GA 2J3LA 4AH6A 5LJ5d 5GAOp 4N0AC 4M77F 1MGQA 3REUA 1X56A 1B7YA 4C92B 1LYLA 1IL2A 3G1ZA 5HGQA 4M77D 4F7UG 5LJ3e 4HWPA 2EAYA 2RHSB 2Q7HA 2QHSA 3HRIA 2AMCA 2ZTGA 3P8YA 1ASYA 5GANj 3V7RA 4YRNA 1KQ1A 1NYRA 3EFSA 2E64A 4PJOB 4F7UB 2DQ0A 2VXEA 4M78A 4H02A 4NL3A 3M4PA 5GAMd 4P71C 1I8FA 2E65A 5LJ3h 3I7FA 3JCMP 3QTCA 4QVDA 2ZR3A 5K1XA 1SRYA 3E9HA 1QE0A 2RHSA 3A32A 4N0AA 3HXUA 4C8QF 3HXXA 4K87A 1L0WA 2CIMA 4JRIA 4H2YA 4CS2A 2ALYA 4F7UE 4P73A 1I4K1 3UGTA 3UGQA 1FYFA 2DKGA 2I2LA 3EFRA 4LNSA 4A53A 4TVYA 4NL2A 4YRTA 3JCMQ 1BIBA 4P74C 1Z7NA 2ZT7A 3QSUA 4RQEA 3VBBA 3QUIA 3LSSA 1NJ2A 4XEOA 3V8KA 5GMKe 2P5IA 3A5ZA 4C8QG 4TVAA 1D3BB 3BFMA 4UP7A 4P75A 3DSQA 2QHVA 2DDZA 4PG3A 4J6XA 1JJCA 5LJ3d 2RM4A 3JB9H 3IKMB 2ODRC 1KQ2A 5GAMg 4NOYA 2CJ9A 4P71A 4M7AC 4G84A 1PYSB 4C92F 2QHTA 3A7AA 3V7SA 3HFNA 2DTOA 5GAN7 4P3OA 4C92A 4M78G 4L87A 4Q15A 1X54A 4YRQA 1X01A 4EMKA 1RIQA 4P75C 2XTIA 4EMGA 3WQZA 1JJCB 1VQZA 4YYEA 3HXVA 5GAMj 4YRJA 4XTYA 2ZZGA 3RIRA 4M7DD 3HXZA 4H2XB 3KFUA 3TEHA 3QO7A 3MF1A 1GGMA 3PCOA 3E9IA 3FIFA 1HTTA 4OLFA 4YRKA 4E51A 4C92G 4P74A 4WJ3M 4PJOD 1NJ1A 1WQ7A 2Q5IA 5GAN5 3JCMX 4RCCA 4P3NA 1YFTA 4WJ4A 1YFSA 2DTHA 4Y91A 4HWRA 1EOVA 4PHCA 1BBUA 2EJFA 1B7YB 3NEMA 4M7DA 3M4QA 4M77C 4C8QC 4M77E 2Q7EA 1B34A 5DY9A 4C8QA 3RUXA 1J5WA 5LJ3g 3ICAA 2RD1A 4YCWA 1E22A 5GAN2 3HFZA 3UH0A 1NJ8A 2K57A 4MMLA 5ELOA 1N9SA
chains in the Genus database with same CATH superfamily
1VQ5Q 2AHJB 2CJBA 2LMJA 3GOXA 3OW2A 2VC8A 4QVZA 3CC2A 3JB9D 2GFAA 2PQWA 3JCMf 3BJUA 3TVTA 3CCMT 1N6AA 2GF7A 1QCFA 3M57A 5GMKi 2KXCA 1WQWA 3OYJA 2E5AA 1X6BA 5CKDA 1AEYA 2K9GA 5I2SA 1M90R 3RMQA 1NNHA 2V8JA 5KH6A 1IB8A 2E3IA 1VQNT 4RDXA 4WTOB 3TEGA 5K1PA 3P8DA 2JS0A 3PMIA 2D8JA 1E6HA 4LDUA 4YCVA 3SDZA 1PD1A 1RUWA 1EFWA 1VQOA 4PJLA 1D1CA 4FYYB 3MQZA 1YHQQ 2C0OA 4IUTA 3MEUA 2ROLA 3H6ZA 3NTHA 3HFVA 1VYTA 1JJ2A 1VYVA 4JZ3A 1YJ9A 2PVDB 3JSCA 2H8HA 2D0NA 2DL3A 1RLPC 2FB7A 4C92C 2E3CA 1SRMA 2M9UA 8AT1B 2BE9B 3VUZA 3M5AA 3JCMc 2BTTA 2KE9A 3CD6Q 1FMWA 4OMFB 1LJOA 3SWNA 4OB0B 2YRDA 4LE9A 2DQ3A 2DXCA 2X4JA 4E7JA 1WIEA 3JRZA 2ZR2A 2MWPA 2K5LA 5KCHA 1SEMA 3F70A 1UB4A 2MYSA 2LC4A 2XMFA 3I55Q 3MJXA 4J7IA 1H4TA 5DLOA 2ALYB 2F2VA 1ADYA 1QVFA 2FZGB 4X34A 1YI2A 4LVIA 3W3SA 2LCLA 2ZIOA 2DTIA 2EQMA 6AT1B 1N8RR 4M4ZA 4ZN3A 1QP2A 1Y0MA 4CH6A 3EAEA 2V1RA 1HC7A 2EJ9A 4AG2C 2DZCA 3P8VA 4M75G 3HXWA 2V26A 5C53B 4C8QD 2FPFA 1W6XA 3I9QA 1WHKA 1B34B 1B76A 3OYKA 3JB9G 5D6XA 3HFZB 1ZX6A 1N9RA 1NPRA 4YREA 5FU7B 4KBMB 2JVVA 3BW1A 1K73C 5EG2A 4DBFA 4H2UA 2DXTA 3PGGA 3UA6A 1ZA1B 1JRIA 1AT1B 2P0KA 4M78C 1J3TA 3A8MB 4C92D 1FX7A 4J6WA 4JUVA 3LGFA 5GMKh 2ATCB 2A0FB 2PU9B 1VQMQ 4E7HA 3PCOB 3UT1A 4CH5A 1JB0E 1M1KC 3SWNB 2DEQA 2EKOA 2A37A 2JMAA 3EGUA 3V8JA 1E24A 2YUPA 2HQEA 3JCMV 2F2XA 2E5QA 2EYYA 3EGXB 1LPLA 3CCVQ 1OQKA 3L4GA 4YRFA 2QK0A 4M75C 1VA7A 3QYHB 1NJ6A 4PJJA 4G85A 1AZGB 3HRKA 1D1AA 3JAME 1Z7MA 2GTOA 1KK7A 4KGZB 1OV3A 1WZOA 5GMKm 4ZTZB 4M7DG 3VS7A 1N8RU 1BBZA 1UGQB 1K8AU 2DIGA 3QO3A 3OYAA 2YRVA 5IHKA 1NPPA 4KR2A 5GMKj 2E41A 4TWAA 1R0CB 3I35A 2HSPA 3G7ZA 4OB2B 1KD1R 1WLEA 2K6DA 4JRPA 2ARTA 1YJ9T 4HWOA 3CXCA 3BY7A 2YUQA 1K9AA 4JLIA 5CKFA 2R57A 4Y28E 2K5IA 5J26A 2EYWA 4LN2A 2PZ1A 1SSFA 4K88A 3KUFA 4TTVA 1N5ZA 4CS4A 4HKEA 1W2BA 1VQ9Q 3ULRB 2C0TA 2CP2A 3S3MA 1R0BG 4E7LA 1W1FA 5KYXA 3QYGB 2AZVA 1D3BA 4C8QB 3HPWA 1UFFA 1XOVA 3I55A 5HK3A 1KHCA 5GAMe 4RG8A 2E70A 2C8MA 2ODRD 4FT2A 3HY0A 3L2UA 2ZNJA 2RJFA 3AT1B 1ZSZC 2RI5A 1G5IA 2YUOA 2JT4A 4E6RA 4M78F 3HHTB 2VYTA 1NYQA 4M7AF 1TUCA 4M75F 3UWNA 2A7YA 1G3WA 2FO0A 1WHHA 1B70A 3M58A 4XU1A 4UPAA 1AZEA 4M7DC 3OW2S 2RH2A 3EG3A 1K73U 1SG5A 3OYMA 1OU9A 4YRIA 1JXOA 2K5FA 3D7SB 2B8AA 4M75D 2E12A 2RMOA 4XTVA 5LJ3j 5CCAA 4GLKA 4B9XA 4PFZA 2Y90A 4IUPA 2I0NA 1BKBA 1SF9A 1TG0A 5LJ5d 4M77F 1WI7A 1MGQA 1VQOQ 4ELZC 2AKKA 3A8OB 1LYLA 1YJNQ 3L42A 4HWPA 2Q7HA 3FLGA 5D7UA 1ASYA 2V8IA 3EFSA 2E64A 1Q95G 2P0PA 2E6ZA 4J9HA 5A0DA 5L23A 2DQ0A 3S3OA 4PKCC 3NGPA 3PNWC 1PD0A 4P71C 1SHFA 1W2BP 4F16A 3J80E 2ZR3A 1NYFA 1SRYA 1JO8A 2ZPHB 1OI1A 3G71A 3I55T 3CCUA 3MP8A 3HRTA 3M55A 3A32A 3R6NA 4BI8B 2C06A 1YP5A 3HXUA 2J7IA 1VQ8A 1BI1A 1G5VA 1PSEA 4CS2A 2RHYA 1E6GA 4F7UE 4LNPA 2M51A 2M0OA 2NUTB 1I4K1 1M2VA 5KYNA 3UGTA 5IHNA 2DKGA 2XD0A 1DJ7B 3EFRA 1VQLT 3EGDA 4NL2A 4YRTA 2ZPIB 1IHVA 4P74C 4RQEA 2KRSA 1NM7A 3QUIA 1C6VX 3LSSA 5KYYB 2BZ8A 2HEQA 4XEOA 3V8KA 2P5IA 2WACA 4C8QG 4TVAA 2DFUA 4BI3A 4UP7A 4JLGA 4TVRA 4PG3A 2L3PA 4J6XA 5I11A 2K2VA 2YT6A 1QVGS 1NJIU 5LJ3d 1X6OA 4C5IA 4ZNXA 2PUOB 1Q86R 1VQ9A 4BDYA 1C0MA 4C92F 4DA4A 4JS5A 3SD4A 1IXDA 3VS0A 4CRIA 2LJ1A 2BIVA 1GCQC 4YRQA 4EMKA 4JJBA 1Q7YR 1K0XA 5IN1A 2XTIA 4HXJA 1VQZA 3LH0A 1VQ9T 4FM4B 2DEUA 3CC7T 5GAMj 4XTYA 1K9MR 3X26B 4H2XB 1PC0A 4J9DA 5C6SA 2D6FA 4ZGEB 5HKCA 2DM1A 5FWCA 1FMVA 3CMAA 2KROA 4AFSC 3E9IA 3QPHA 4L6V5 3A8LB 4JS4A 1JJ2P 1G2BA 2FZCB 4A63B 1HTTA 2OX7A 4YRKA 3GLXA 4C92G 2QA4Q 2LNVA 4P74A 3CBPA 3L2WA 2CP7A 1ZSZB 2AK5A 2C0IA 3CC4Q 2DYBA 3UA7A 3JCMX 3G6ET 1A0NB 4WCIA 1YFTA 4WJ4A 3EGXA 3LX7A 4PHCA 4HWRA 3WXMB 2CS7A 1OOTA 3C94A 1Q86C 2XK0A 4M77C 4FYWB 2RF0A 2M16A 4OMQA 3X28B 4IURA 4C8QA 1J5WA 2VVKA 2CP5A 4YCWA 2LQ8A 3PT9A 3GP8A 3UH0A 5ELOA 1R8OB 1AD5A 5KE2A 1N9SA 3I5SA 2DBKA 2JMCA 4EMHA 2E6NA 3UF4A 4Q5WA 3EHQA 3VKIA 3CCET 1TOVA 1M90C 4M78E 3RKXA 3EHRA 4PJMA 3DB3A 3RKYA 1K0SA 4LVJA 5AYFA 3VU3C 2WSFE 3MPUB 3VRZA 4AFZC 2QYZA 2RJEA 3JCMh 2DXBA 2QG9B 2EGEA 3H0HA 4M7AD 1BI2A 3PFSA 5GAOq 4TQFA 2BUDA 4H2SA 3HSBA 1H641 1G51A 1Z9ZA 4PJOG 2HKNA 3OQ5A 1PRMC 4KGVB 3A7UA 1QF6A 2ZGWA 2H3JA 4X1VA 1TH7A 2RQUA 3CMQA 1M1GA 1WXTA 1M2OA 2DJQA 4JRKA 4AFUC 2I4LA 2ZXFA 1MMAA 1OX8A 1YITA 3OMGA 2ZINA 1UDLA 5KNNA 3KBGA 2XGTA 3I56Q 3ERRA 1BI3A 3CCLQ 3EH2A 1ASZA 3QG1A 4HT8A 3EFOA 3FRNA 3UPUA 1UGVA 4LD9K 4HVWA 4MZPA 2JTMA 4YROA 3BDUA 3E19A 3CCMQ 2LRQA 2XDPA 4BE0A 2KDSA 2DIQA 1LOJA 2JTEA 3RMSA 1B7TA 1NYGA 1S72Q 4YRMA 4H2XA 5GAOn 3SEMA 2V1QA 4H2WA 2QHUA 2J6KA 3M0TA 5CKBA 4HA8A 2A3LA 4UC4A 2YUNA 1N27A 2CP0A 3MP1A 3MEVA 1LCKA 2VGMA 1ABQA 2R5MA 4C5EA 2AT1B 2DVEA 1M1KR 3WVDB 5CQXA 2RHQA 4J83A 3RACA 1T3LA 2ZCFB 4FT4A 4KRTA 1I81A 2IG0A 2KVQG 2QDLA 5CR2A 4M75E 5CO7A 5FU6C 2ED1A 5L8RE 4RQFA 1V29B 4CC3A 3OS5A 4JPBW 1ZUUA 1YIJQ 1BIAA 2EW3A 1QKWA 3H0IA 2OTLT 2YWWA 1BB9A 3RDVA 4NS5A 1C1AA 3G4ST 1NZ9A 4E7IA 1H3HA 4M7DF 1K8AC 4R55A 3L2VA 3P8HA 1M2VB 3REAB 1NEGA 4P72C 1UHFA 2DL8A 3TQ7P 5GAN8 3OA6A 2RQWA 1KD1C 1QVGA 3M0UA 1YFRA 1HXDA 3JCMW 1PWTA 1KJWA 3TEHB 2JS2A 2VXFA 3BE3A 4DBHA 4Z88A 1FYNA 5FWBA 2FPDA 1HSQA 3NENA 1KFZA 2YDLA 4YRPA 4WI1A 3TU4K 4X5OA 1OEBA 2FG0A 3CCUT 2XIDA 2E1HA 4HCKA 3CCJQ 4PJNA 1EZZB 4CS3A 4P72A 3JB9J 1FMKA 1PSFA 1WPYA 2DYIA 2FRWA 2ZT8A 3VQYA 2A08A 3CC7Q 1TTHB 1BBWA 4RG2A 3OD1A 3VQVA 3REBB 4D8KA 5F5WA 2OTJQ 5GAN4 3CCRQ 5LJ3f 4XTUA 1M8VA 2NYSA 2QQBA 2RI3A 4QT7A 3V8LA 3RL6A 2RHQB 3A8HB 4OMLA 2FHDA 2K7AA 5HCKA 4LVMA 2J3MA 2EWNA 1SKUB 4XU3A 3EG1A 2XDBA 2KI7A 5J3BA 3CD6T 3A1PA 3PZCA 3SB2A 5GANd 3MEWA 3UFGA 2O9SA 4DEXA 2GNCA 2KXDA 2DJZA 4FL6A 2ZT5A 2MMPA 1BI0A 2E10A 4M7DB 3NMZC 2EQKA 1U1SA 2CGHA 2L8DA 4EMKC 1MMGA 4J7FA 1NJ5A 3VRYA 5HY6A 4X9CA 5CQYA 2F5KA 4HCCA 3HRSA 3URGA 4EPCA 4EO4A 2QEXT 4YTLA 3CCVT 2MI6A 2DA9A 3OYGA 1Z9QA 4FSXA 2O4XB 1E1TA 3VS6A 5M9OA 1K73R 2HNIA 3J7AF 4QW2A 3QHSA 2XI9A 1Q81U 4H2VA 3TSZA 2ZPEB 3R6OA 2X51A 5DLQE 4F7UF 4PJOF 2ZAEA 3M4YA 1VQ6A 4KH1B 2I4OA 1UECA 2ZIMA 1VQ7A 2PUKB 2P0QA 3CC4A 3A98A 1X43A 1EVKA 3G71T 5LJ5j 1O9SA 2FYKA 2B86A 2DAQA 2HL5C 2A28A 3LLRA 3L2RA 3JB9F 4UP8A 1YGBA 5E3IA 2L3RA 4PL6A 5GAOm 5FRNA 4PNOA 2OTLA 1RACB 5AT1B 5CIUA 4KH0B 2P0LA 3NTIA 5IHIA 2QQ9A 1NEBA 1VQ4T 1M30A 1M9SA 1QCNA 3I56T 1B7YA 4EIKA 5A2QE 2X4XA 3LW5E 5HGQA 1I0CA 2EBPA 4M77D 3OSSC 3CPWA 2RHSB 3OYEA 4BE2A 2QHSA 3HRIA 5GANj 4YRNA 4PJOB 4F7UB 2VXEA 1QCOA 1SPKA 1VQMA 1IHWA 2ROTA 3M4PA 1S1NA 1I8FA 2BE7D 2X35A 2DD5A 2E65A 5LJ3h 1AWXA 4QVDA 1G83A 5K1XA 2F2WA 2EQIA 1QE0A 5HK0A 5CVIA 2RHSA 5ECAA 4LXCA 4BB7A 1UG1A 3GBQA 1QVGP 3OYBA 1WXUA 2GGRA 1OX9A 2OAWA 1PKTA 1YJWA 4E7ZA 5IXBA 1BCMA 2ALYA 5C0MA 2EYZA 4P73A 5FLXE 1D0XA 3ZFJA 3UGQA 1FYFA 3VV0A 2G6FX 3EG9A 2CYZB 4TVYA 1QW1A 3JCMQ 2EQJA 1YJ9Q 3M0PA 1BIBA 3CPFA 1WHMA 4RMOA 2CP6A 4FW2A 3FC3A 2VWFA 1WGSA 3CD6A 4A4EA 4B9WA 3DSQA 2QHVA 2DDZA 1PHTA 3BDLA 3CCMA 4ZGJB 3I5RA 3MP6A 4MZMA 1R77A 2P4RA 2RM4A 1GL5A 1AWWA 3IKMB 1O75A 2LT4A 2RNAA 3X25B 3M0SA 2ODRC 2MOXA 5GAMg 2NLUA 1S72A 2CJ9A 1PYSB 3WVEB 1IGQA 4P3OA 4Q15A 3META 2VUBA 2K4YA 2RJCA 1RIQA 2DRKA 1VUBA 1YHQT 4YYEA 2HD0A 4YRJA 3OSVA 2ZZGA 5EC7A 1KHIA 4J9CA 3TEHA 1EX4A 1F1BB 3FJ5A 2Y4XA 1VQKQ 3QO7A 3CEYA 1GGMA 3OMCA 2DK3A 1Q82R 2LVMA 1K9MC 4E51A 4FIBA 2ABLA 3ME9A 3O5ZA 3VS3A 3CPWS 2ECZA 1G8XA 5GAN5 5I22A 4RCCA 1YJWT 1RAEB 4Y91A 1EOVA 3GNGA 1QWEA 3QZ9B 2EJFA 4C0DC 2NUTA 2LNHB 2KR3A 2ESWA 2Q7EA 4E7KA 3RUXA 2RD1A 2E5KA 5GAN2 1VQNQ 1OPLA 1WJRA 1WLPB 5J39A 4EDUA 2SEMA 4D6WA 3QNEA 4BY6C 2L0AA 3QJ6A 3VYGA 2LQNA 2DU7A 1U3OA 2COYA 1VQPA 2RHXA 2ED0A 5CK9A 1RLQC 1X55A 2LCSA 4KQEA 1YI2T 1WU7A 1X2KA 2F5TX 3CCSQ 3MKDA 4AG1C 1P92A 1SHGA 1UGSB 2DXUA 2K3BA 1K4US 2ZZEA 1YNZA 2L5QA 4RTUA 1GBRA 4MDXA 1AHJB 5FRMA 3A7RA 5GAN3 3CMET 4UP9A 4RMFA 2NUPB 3OYNA 4HCBA 3E2UA 1G3SA 2CT4A 1WYDA 2KRMA 4RUGA 5LJ5g 3CC4T 2FVUA 2GQVA 1VIFA 2DL5A 5I21A 1H4SA 3VQWA 2HCKA 4M77A 1KQSA 2JM9A 1MUZA 3PMTA 4RCBA 4K86A 2GTJA 2HBPA 3V7CA 3NHNA 4QQDA 2L89A 2HDAA 1B70B 4A4GA 1D09B 2RPNA 1IRXA 4E47A 1YB3A 4FCYA 2KY9A 4E2FB 1KMNA 4LVKA 1M5Q1 4N4IA 2C7IA 1VQ8T 5GANg 2L3SA 4ELYC 2OI3A 3EG0A 3HTZA 2QTVA 3RR6A 1ARKA 4RTYA 1Q86U 2EYXA 3NELA 4BW9A 2GFUA 2ENMA 3OS2A 1G3TA 4L5GA 4O2DA 3LH5A 4M75B 2CKKA 1M90U 3RERA 3A74A 3ASKA 1PCXA 4YRSA 4M78B 1KIKA 2J05A 3JCMd 2BKDN 1VQ7Q 4A54A 3CMAT 3G6EQ 1ACMB 1M4ZA 1XJWB 1G3YA 4P73C 1I5OB 1M27C 4C0FA 4XU0A 1Y71A 5C51B 3QDRB 1YN8A 2LCCA 2KMTA 4C92E 4YRRA 1HK9A 1WDXA 4GBQA 2A36A 2DLPA 3CMEQ 1SETA 5GMKl 4BWAA 4C5HA 1AVZC 4EMKB 1EIYB 1VQNA 1C0AA 1YJNA 1TUGB 4LDWA 3M4GA 2ZNIA 2LJ3A 1H4QA 4L59A 2M1HA 4HT4A 2W10A 5IAYA 2FEIA 4IIMA 2FZKB 1I5LA 4WF2A 3CCQA 2AMCB 2RB6A 1ZSZA 1ZBJA 3CCSA 2EL9A 4OB3B 3QWXX 4FYXB 4YCUA 3A31A 4ZIBA 2K3XA 2FPEA 1OU8A 1H8KA 2DILA 4M7AE 3E9FA 2CJAA 1XTDA 3DKMA 3OYDA 9ATCB 4TVWA 1WJQA 5LJ5f 3SHWA 2J6FA 2JXBA 1T0HA 3QO5A 1RAGB 2DF6A 2LJ0A 3RKWA 3A5YA 3RGLA 4P3PA 3TCJA 3VYHB 3M0RA 1M8MA 1YIJT 2J6OA 4DBRA 4DEYA 2DL4A 4CI0C 1ZA2B 2O2OA 4PLLA 1X2QA 1BYMA 4PFOA 3DB4A 4TQDA 3LSQA 2LDMA 3H8ZA 1AWOA 3OW2P 1JBMA 2AZSA 4OMMA 2CP3A 7AT1B 4XTZA 2KSSA 4XTXA 5GANf 4F7UA 2ARUA 2QA4A 1TUDA 1B8AA 1X2GA 1MMNA 1S72T 3TREA 4YRCA 3MCAB 5GJWB 4OGCA 1ZHIA 5A0GA 2DMOA 2ARSA 2O9VA 1T3SA 2M02A 1EQRA 1G5HA 4PJOE 1Y96B 1I07A 3MO8A 4M7AA 4CC7A 1JEGA 1X69A 2LP5A 4FW1A 2DERA 2EKHA 2PTKA 5KYWA 4XTWA 1JXMA 2KBTA 3SWNC 4KT0E 2CZ6B 2MK5A 1OPKA 1CKBA 3IG2A 4QVCA 2JUFA 1YI2Q 4ORZA 3CCST 3IALA 4HWSA 1VQ5A 4J6YA 4YP0A 3CCRT 4ESRA 1M3AA 4A4HA 4XK8E 1KD1U 1Y96A 4NCXA 3EGDB 3H41A 2ZZDA 3PIOA 1ZSGA 2QDYB 4LDXA 1WA7A 3PTAA 3REXA 2P4TA 1VQPQ 3G6EA 4M7DE 3MF2A 2COZA 2CUBA 4GY5A 1WYXA 2IVWA 1Q7YU 1MHNA 2LZ6B 2QXFA 3G1JA 2QTXA 3QZ5B 4HVCA 1MV0B 5ELNA 2RHIA 2ZPBB 1VQ7T 4R0KA 2NUZA 4YRGA 1USYC 4E7SA 3HL8A 1W4SA 1KC8C 2KEAA 2JN0A 3L1AA 2Q7GA 2J3LA 1NJIR 4AH6A 5GAOp 4N0AC 3VS1A 1MMDA 4GLMA 4RTXA 1RAHB 2EIFA 1QWFA 3O8VA 5LJ3e 2EAYA 1QVFP 3PVLA 3CC2Q 2AMCA 1B3QA 2J06A 3V7RA 4C0ZA 2KRNA 2LQWA 1KQ1A 2RK2A 1VQ5T 2DE0X 1WX6A 4NL3A 4KULA 5GAMd 3OYHA 3QTCA 3JCMP 1PKSA 3H0FA 1VYUA 3CCQQ 1IREB 1RADB 3E9HA 5GJVB 1GCPA 3C4SA 3Q1JA 4OGEA 4C0GA 1M1KU 2LX7A 3QJYA 3DLLA 2KAFA 4C8QF 3L2QA 1QMCA 4LUDA 2CIMA 1RI9A 1PNJA 4K11A 2X9HA 3X24B 2OTJA 1VQ6T 3SFMA 1FXXA 1PG5B 5IT9E 1NBEB 2YXYA 3CCRA 4LNSA 4A4FA 2KQWA 2PNIA 1KG1A 1KSWA 1Z7NA 3CQTA 2ZT7A 2MWOA 3QSUA 2R5AA 1NJ2A 5GMKe 3N5BB 4C5GA 1M1FA 2SRCA 2W0ZA 1D3BB 1AOJA 4O5VA 1Q81C 4MZTA 1WHJA 3M56A 2CZ1B 4AT1B 2K79A 2OJ2A 1KQ2A 5I2MA 3QDFA 4NOYA 3JV3A 3OBWA 4M7AC 2QI2A 3ZL7C 5KYUB 2QHTA 3V7SA 4B6MA 4C92A 4M78G 1X54A 1UJ0A 4ME7A 2HBWA 1X01A 1Q82U 2QGGA 2HSEB 3KFVA 3PE0A 1D0YA 4N4HA 4ZTJA 3WQZA 3TSWA 3FEOA 4CC4B 3HXVA 2YSQA 3RIRA 1YWPA 3KFUA 4ZTFA 1OULA 5D6YA 3MF1A 3VS4A 1CSKA 5A0LA 4BY6B 3FIFA 4JJDA 4N4GA 1TU0B 4J9FA 4OMOA 1YITT 1KC8U 4QQGA 4OMNA 2X4YA 1NG2A 3QIIA 1QVFS 3VS2A 2QAZA 1Y7XA 2DL7A 3ZBDA 3OY9A 2DTHA 2EYQA 4AMCA 3CCJA 2DBMA 1BBUA 3NEMA 2HZYA 3GPLA 1VQ4Q 2BZYA 4DBQA 3FDRA 4C8QC 4LDVA 5KCOA 5DY9A 1RABB 1RL2A 5LJ3g 1Q81R 3ICAA 1E22A 2RHZA 4Y92A 1SSHA 1FWZA 3J81E 1YFNA 2K57A 2XHCA 3HKSA 4XAXB 4MMLA 1V76A 1RAAB 3NFCA 1U5SA 2OAUA 1WJSA 1KMMA 1VQLQ 2EJGA 5KYYA 2XICA 1SERA 2MF2A 1YCSB 2Z0WA 3MEAA 4M7AG 1N9WA 2CH4A 4RTZA 1EIYA 4J9IA 4CH4A 1UEBA 1K8AR 2K2MA 3LYIA 1W66A 2XG8D 3H9NA 2KYMA 3RBBB 2EGCA 1HD3A 3GIBA 3P8BB 2D1XA 3C0CA 4OP0A 4KGXB 4XEMA 3CC2T 1PYSA 2ZT6A 4OB1B 3OYFA 3VJPA 3CPWP 3CCLT 3E9GA 5FU6B 2JTFA 4F14A 3TEEA 3G4SQ 5IXFA 4VUBA 2EQUA 1YJWQ 1E7OA 2BZXA 3EG2A 3EH1A 1OYXA 2PVGB 1X6GA 1HYOA 2YHTA 2EFIA 3C95A 1MNEA 2HMAA 2YLBA 1LNXA 2RQRA 5FROA 2D0QB 1WNLA 4EX5A 1KC8R 3DLMA 2LQKA 3THKA 2HQHA 3S3NA 4IUUA 2E4HA 5GANh 2MPXC 2A8EA 1ZUYA 2DETA 4HCZA 2QGFB 1BK2A 5C52B 3MEYA 3HY1A 4J9EA 1VQ6Q 2JW4A 3CCUQ 1Q82C 1K9MU 2PVOB 2I4NA 3IQLA 2VASA 2RO0A 1YCYA 3KXTA 2CT3A 2AKLA 4BUGA 2COWA 1WFWA 2YRCA 2DX1A 4YPFA 4J8OA 3OBYA 1VQMT 3CXCS 4HT9A 4JRQA 4Z89A 1X75C 1M3BA 5LJ5h 4ZN1A 1WXBA 2R58A 1UE9A 3LWIA 3HXYA 4KUIA 3CCEA 1JQQA 2HAXA 2MAMA 3JCMJ 2YLCA 1USYA 1N8RC 2KYBA 3OYIA 1ZLMA 2HKQB 4PJOC 2RHUA 5FU7C 1RAIB 1D1BA 2ZZFA 2VGNA 3FB9A 4DOWA 1OZ3A 1SRLA 3PVQA 2JOYA 1E1OA 1H4VB 3IKLA 1D0ZA 5FW9A 2QEXA 1OZ2A 1X27A 1TXQA 1UUEA 1UTIA 1IGUA 2VB6A 2KNBB 1CKAA 4IUQA 1VQ4A 4RKUE 2DRMA 5KYUA 5GAOr 3ZEHA 1LVKA 2RK1A 1VQ8Q 2AIRB 4KR3A 2RQTA 2MIOA 2DVJA 3VUBA 1U8RA 2QQRA 4J5YA 4YRLA 1NLPC 4J9BA 2O88A 2JM8A 2P84A 2X3WD 3UDCA 3JCMe 1NLOC 2KT1A 3GF5A 2GBQA 2KGTA 3RESA 5GAOl 3ER0A 2DPPB 4II1A 1KOGA 2O01E 4CC2A 3A5ZB 2CDTA 4V2SA 3NTKA 1QKXA 3LC0A 1U06A 1TWBA 2XU8A 4RTWA 2LX9A 3AHUA 3QWYA 8ATCB 2Q5HA 4QKUA 2I4MA 3G71Q 2O31A 4MDWA 4MMKA 1TSFA 1WHLA 4IKFA 1ZUKA 2CH4W 2G4CA 1ABOA 4YDQA 1AWJA 3VQXA 2AKWA 4M77B 4Z8AA 4HWTA 4P5NA 3HP9A 4FSSA 3RF1A 3HFOA 2GQIA 4C8QE 2JZ2A 4O6JA 3M53A 2ZCEA 4M77G 1YWOA 2CSQA 4XQ3A 2RN8A 4JDSA 1MV3A 5GAMh 5D6WA 3QXEB 4R56A 1YITQ 3L4GB 2QQAA 3JB9I 1X2HA 3NETA 1V1CA 4D8DA 1XNIA 2HQXA 3CCJT 2AKWB 2V8KA 4QQ6A 2D8HA 2KT8A 3M0QA 3TUPA 1VQKA 4BDZA 2GCXA 2CSIA 2DNUA 3EG9B 1UJYA 2IIMA 2CZ7B 4M7AB 3CBOA 1Y07A 4LD6A 3OYLA 4PJOA 2CUDA 4ZTUB 1QP3A 3QO8A 4OVAA 2FRYA 2XDDA 2DZ9A 2KK4A 5DM7R 1SESA 1ADJA 4H2TA 1KQSP 12ASA 1Y57A 2LT1A 3OYCA 2FL7A 1VQOT 1UGPB 1GXIE 4DQ2A 3JCMb 2EGAA 1YJNT 4M75A 4XU2A 2NUPA 1YHQA 3UATA 2RA2A 1JU5C 11ASA 2DU5A 2VKNA 3OS1A 4OF1A 1U1TA 3OB9A 5GAN6 4Q6GA 1K1ZA 2RI2A 4IUVA 5LJ5e 4CH3A 5CAIA 1GFDA 5GAMf 1ATIA 3CMAQ 3CCLA 3MHXA 3C12A 2PMFA 2E3HA 2QASA 3INZA 4DOVA 3P8TA 2IY5B 4AFQC 4X9DA 1EVLA 5KYWB 2CZ0B 4J15A 4ATOA 1KQSS 4DPGA 2PMEA 4TVAB 3PIPA 2QA4T 1EIFA 3FJPA 5LL6S 2QEXQ 3R07A 3HTRA 3L2ZA 1NJIC 4M78D 1ZBXA 2IY5A 4LUEA 5CKHA 5GANe 3QBYA 3U23A 3JCMg 2OTJT 3G4SA 3CMEA 4ANJA 1BU1A 3REUA 1QVPA 1X56A 3OYYA 4C92B 2MCNA 4BACA 1VQLA 1IL2A 3M59A 3G1ZA 2Y4YA 4F7UG 2VV5A 1HJDA 2ZTGA 3CXCP 3P8YA 3M9QA 1RAFB 4HVUA 1NYRA 4PLIA 4M78A 3I56A 4H02A 2X4WA 3NPFA 3S6WA 1B07A 3I7FA 2EPDA 1YIJA 4ZGDB 4PFPA 2IPOB 5IH2A 2QQSA 3M54A 4N0AA 4PK4A 3HXXA 2ZPGB 3CCVA 4K87A 1L0WA 4JRIA 4Z02A 4H2YA 2RJDA 2HL3A 4BI4A 1T0JA 1VQPT 1GRIA 1EFNA 2NS6A 1GCQA 3A8GB 1IO6A 1YBYA 1UHCA 2I2LA 1QLYA 4LDYA 4A53A 2DD4A 3QKJA 3LGLA 3VS5A 3VBBA 4RTVA 1K76A 4F17A 3A5ZA 5KYXB 1RI0A 3GNFB 3BFMA 4P75A 2F1LA 2L3QA 2WSEE 1W70A 2EVRA 1NE8A 1JJCA 1UGRB 1BCOA 3JB9H 3RNJA 3CC7A 1Q7YC 2NWMA 5KE3A 2O4XA 3EFOB 3HRUA 1JJ2S 4G84A 4P71A 1ZQ1A 1PM3A 1WHGA 2WSCE 4BE1A 3CBMA 3A7AA 1W2BS 1VIEA 3HFNA 2DTOA 5GAN7 4L87A 2X3XD 3OS0A 4JJCA 2H3EB 4A4KA 1PRLC 1MNDA 3CCEQ 4P75C 4C0DB 2M0YA 4EMGA 1JJCB 2ZPFB 3CCQT 1H92A 4OMPA 3X20B 4JZ4A 3HXZA 4M7DD 2F69A 3LWHA 3T9NA 2G3RA 3PCOA 4FU6A 4RTTA 4BD3A 2CREA 2K3YA 4OLFA 2RQVA 1GBQA 4KUDK 1M3CA 3E1SA 4WJ3M 4LVLA 1XQHA 4PJOD 1NJ1A 2LTOA 1WQ7A 4JJNK 2Q5IA 2D9TA 1QQJA 4P3NA 2L2PA 1YFSA 1TS9A 1GFCA 2JJ9A 4F04B 4J9GA 1B7YB 4FYVB 4M7DA 3M4QA 1I1JA 4M77E 2OTLQ 1B34A 2XKOC 2JNGA 4HVVA 2DO3A 1H3ZA 1VQKT 1VOMA 4IIOA 3HFZA 1NJ8A 5CKEA 1IZ6A
chains in the Genus database with same CATH topology
2AHJB 2CJBA 3GOXA 3OW2A 2VC8A 4QVZA 3CC2A 3JB9D 2GFAA 2PQWA 3JCMf 3BJUA 3CCMT 1N6AA 2GF7A 3M57A 5GMKi 1WQWA 3OYJA 2E5AA 5CKDA 5I2SA 3RMQA 1NNHA 2V8JA 5KH6A 4RDXA 1VQNT 3TEGA 5K1PA 3P8DA 3PMIA 4LDUA 4YCVA 3SDZA 1EFWA 1VQOA 3MQZA 4IUTA 3MEUA 3H6ZA 3NTHA 3HFVA 1JJ2A 1YJ9A 2PVDB 3JSCA 2FB7A 4C92C 2E3CA 2M9UA 3VUZA 3M5AA 3JCMc 4OMFB 1LJOA 3SWNA 4OB0B 2DQ3A 2DXCA 2X4JA 4E7JA 3JRZA 2ZR2A 2MWPA 2K5LA 5KCHA 3F70A 1UB4A 2LC4A 4J7IA 1H4TA 5DLOA 2ALYB 1ADYA 1QVFA 4X34A 1YI2A 4LVIA 3W3SA 2LCLA 2ZIOA 2DTIA 2EQMA 4ZN3A 1QP2A 4CH6A 3EAEA 1HC7A 2EJ9A 2DZCA 3P8VA 4M75G 3HXWA 5C53B 4C8QD 1B34B 1B76A 3OYKA 3JB9G 5D6XA 3HFZB 1N9RA 1NPRA 4YREA 5FU7B 4KBMB 2JVVA 3BW1A 1K73C 5EG2A 4H2UA 2DXTA 3PGGA 1JRIA 2P0KA 4M78C 3A8MB 4C92D 1FX7A 4J6WA 4JUVA 3LGFA 5GMKh 2PU9B 4E7HA 3PCOB 3UT1A 4CH5A 1JB0E 1M1KC 3SWNB 2DEQA 2EKOA 3V8JA 1E24A 2HQEA 3JCMV 2E5QA 3L4GA 4YRFA 4M75C 3QYHB 1NJ6A 4G85A 3HRKA 3JAME 1Z7MA 5GMKm 4ZTZB 4M7DG 1N8RU 1UGQB 1K8AU 2DIGA 3QO3A 3OYAA 2YRVA 1NPPA 4KR2A 5GMKj 2E41A 4TWAA 3G7ZA 4OB2B 1WLEA 4JRPA 2ARTA 1YJ9T 4HWOA 3CXCA 3BY7A 4JLIA 5CKFA 2R57A 4Y28E 2K5IA 5J26A 1SSFA 4K88A 3KUFA 4TTVA 4CS4A 4HKEA 1W2BA 3S3MA 4E7LA 3QYGB 1D3BA 4C8QB 3HPWA 1XOVA 3I55A 5HK3A 1KHCA 5GAMe 4RG8A 2E70A 2C8MA 2ODRD 4FT2A 3HY0A 3L2UA 2ZNJA 2RJFA 2RI5A 1G5IA 4M78F 3HHTB 2VYTA 1NYQA 4M7AF 4M75F 3UWNA 2A7YA 1G3WA 1B70A 3M58A 4XU1A 4UPAA 4M7DC 3OW2S 2RH2A 1K73U 3OYMA 4YRIA 2K5FA 2B8AA 4M75D 2E12A 4XTVA 5LJ3j 5CCAA 4GLKA 4B9XA 2Y90A 4IUPA 1BKBA 5LJ5d 4M77F 1MGQA 4ELZC 3A8OB 1LYLA 3L42A 4HWPA 2Q7HA 3FLGA 1ASYA 2V8IA 3EFSA 2E64A 2P0PA 2E6ZA 5A0DA 2DQ0A 3S3OA 4PKCC 3PNWC 4P71C 3J80E 2ZR3A 1SRYA 2ZPHB 1OI1A 3G71A 3I55T 3CCUA 3MP8A 3HRTA 3M55A 3A32A 4BI8B 2C06A 3HXUA 1VQ8A 1BI1A 1G5VA 1PSEA 4CS2A 2RHYA 4F7UE 2M0OA 1I4K1 3UGTA 2DKGA 2XD0A 1DJ7B 3EFRA 1VQLT 4NL2A 4YRTA 2ZPIB 4P74C 4RQEA 3QUIA 3LSSA 4XEOA 3V8KA 2P5IA 2WACA 4C8QG 4TVAA 4BI3A 4UP7A 4JLGA 4TVRA 4PG3A 4J6XA 2K2VA 1QVGS 1NJIU 5LJ3d 1X6OA 4C5IA 2PUOB 1VQ9A 4BDYA 4C92F 4DA4A 4JS5A 3SD4A 4CRIA 2BIVA 4YRQA 4EMKA 5IN1A 2XTIA 1VQZA 3LH0A 1VQ9T 4FM4B 3CC7T 5GAMj 4XTYA 3X26B 4H2XB 5C6SA 2D6FA 4ZGEB 5HKCA 3CMAA 3E9IA 3QPHA 4L6V5 3A8LB 4JS4A 1HTTA 4YRKA 3GLXA 4C92G 2LNVA 4P74A 3CBPA 3L2WA 3JCMX 3G6ET 1YFTA 4WJ4A 4PHCA 3LX7A 4HWRA 3WXMB 2CS7A 3C94A 1Q86C 2XK0A 4M77C 2M16A 3X28B 4IURA 4C8QA 1J5WA 4YCWA 2LQ8A 3PT9A 3GP8A 3UH0A 5ELOA 1R8OB 5KE2A 1N9SA 4EMHA 2E6NA 4Q5WA 3VKIA 3CCET 1M90C 4M78E 3RKXA 3DB3A 3RKYA 4LVJA 5AYFA 3VU3C 2WSFE 2RJEA 3JCMh 2DXBA 4M7AD 1BI2A 3PFSA 5GAOq 4TQFA 2BUDA 4H2SA 3HSBA 1H641 1G51A 4PJOG 3OQ5A 3A7UA 1QF6A 2ZGWA 2H3JA 1TH7A 3CMQA 1M1GA 4JRKA 2I4LA 2ZXFA 1YITA 3OMGA 2ZINA 5KNNA 3KBGA 2XGTA 3ERRA 1BI3A 1ASZA 3QG1A 4HT8A 3FRNA 3UPUA 4LD9K 4MZPA 2JTMA 4YROA 3BDUA 3E19A 2LRQA 2XDPA 4BE0A 2KDSA 2DIQA 1LOJA 3RMSA 4YRMA 4H2XA 5GAOn 4H2WA 2QHUA 5CKBA 4HA8A 2A3LA 4UC4A 1N27A 3MP1A 3MEVA 2VGMA 2R5MA 4C5EA 2DVEA 3WVDB 5CQXA 2RHQA 4J83A 3RACA 2ZCFB 4FT4A 1I81A 2IG0A 2KVQG 5CR2A 4M75E 5CO7A 5FU6C 5L8RE 4RQFA 1V29B 3OS5A 1BIAA 2OTLT 4NS5A 3G4ST 1NZ9A 4E7IA 4M7DF 1K8AC 4R55A 3L2VA 3P8HA 4P72C 5GAN8 3OA6A 1KD1C 1QVGA 1YFRA 1HXDA 3JCMW 3TEHB 2VXFA 3NENA 4YRPA 4WI1A 3TU4K 4X5OA 3CCUT 2XIDA 2E1HA 4CS3A 4P72A 3JB9J 1PSFA 1WPYA 2ZT8A 3VQYA 1BBWA 4RG2A 3OD1A 3VQVA 5F5WA 5GAN4 5LJ3f 4XTUA 1M8VA 2RI3A 2QQBA 3V8LA 3RL6A 2RHQB 3A8HB 2FHDA 4LVMA 2J3MA 2EWNA 4XU3A 2XDBA 5J3BA 3CD6T 3PZCA 3SB2A 5GANd 3MEWA 3UFGA 2DJZA 4FL6A 2ZT5A 2MMPA 1BI0A 2E10A 4M7DB 2EQKA 1U1SA 2CGHA 2L8DA 4EMKC 4J7FA 1NJ5A 5HY6A 4X9CA 5CQYA 2F5KA 4HCCA 3HRSA 3URGA 4EPCA 4EO4A 2QEXT 4YTLA 3CCVT 2MI6A 3OYGA 4FSXA 2O4XB 1E1TA 5M9OA 3J7AF 2HNIA 4QW2A 3QHSA 2XI9A 1Q81U 4H2VA 2ZPEB 3R6OA 5DLQE 4F7UF 4PJOF 3M4YA 1VQ6A 2I4OA 2ZIMA 1VQ7A 2PUKB 2P0QA 3CC4A 1EVKA 3G71T 5LJ5j 1O9SA 2FYKA 2DAQA 3LLRA 3L2RA 3JB9F 4UP8A 1YGBA 5E3IA 2L3RA 4PL6A 5GAOm 5FRNA 4PNOA 2OTLA 5CIUA 2P0LA 3NTIA 2QQ9A 1VQ4T 1M9SA 3I56T 1B7YA 5A2QE 2X4XA 3LW5E 5HGQA 4M77D 3OSSC 3CPWA 2RHSB 3OYEA 4BE2A 2QHSA 3HRIA 5GANj 4YRNA 4PJOB 4F7UB 2VXEA 1VQMA 3M4PA 1I8FA 2X35A 2DD5A 2E65A 5LJ3h 4QVDA 5K1XA 1QE0A 5HK0A 5CVIA 2RHSA 4BB7A 3OYBA 1YJWA 2ALYA 5C0MA 4P73A 5FLXE 3ZFJA 3UGQA 1FYFA 3VV0A 2CYZB 4TVYA 1QW1A 3JCMQ 2EQJA 1BIBA 3CPFA 4RMOA 3FC3A 1WGSA 3CD6A 4A4EA 4B9WA 3DSQA 2QHVA 2DDZA 3BDLA 3CCMA 4ZGJB 3MP6A 4MZMA 2RM4A 3IKMB 1O75A 2LT4A 3X25B 2ODRC 5GAMg 2NLUA 1S72A 2CJ9A 1PYSB 3WVEB 4P3OA 4Q15A 3META 2VUBA 2K4YA 2RJCA 1RIQA 1VUBA 1YHQT 4YYEA 2HD0A 4YRJA 3OSVA 2ZZGA 1KHIA 3TEHA 2Y4XA 3QO7A 3CEYA 1GGMA 3OMCA 2DK3A 2LVMA 1K9MC 4E51A 4FIBA 3ME9A 3CPWS 5GAN5 4RCCA 1YJWT 4Y91A 1EOVA 3GNGA 3QZ9B 2EJFA 4C0DC 2Q7EA 4E7KA 3RUXA 2RD1A 5GAN2 1WJRA 5J39A 4EDUA 4D6WA 3QNEA 4BY6C 3QJ6A 3VYGA 2DU7A 1VQPA 2RHXA 5CK9A 1X55A 4KQEA 1YI2T 1WU7A 2F5TX 1P92A 1UGSB 2DXUA 2ZZEA 2L5QA 4MDXA 1AHJB 5FRMA 3A7RA 5GAN3 3CMET 4UP9A 4RMFA 3OYNA 4HCBA 1G3SA 1WYDA 5LJ5g 3CC4T 2FVUA 2GQVA 1VIFA 5I21A 1H4SA 3VQWA 4M77A 1KQSA 3PMTA 4RCBA 4K86A 2HBPA 3V7CA 4QQDA 2L89A 1B70B 4A4GA 4E47A 1YB3A 2KY9A 1KMNA 4LVKA 1M5Q1 4N4IA 2C7IA 1VQ8T 5GANg 4ELYC 3HTZA 1Q86U 3NELA 4BW9A 2GFUA 3OS2A 1G3TA 4L5GA 4O2DA 4M75B 2CKKA 1M90U 3RERA 3A74A 3ASKA 4YRSA 4M78B 3JCMd 2BKDN 4A54A 3CMAT 1M4ZA 1G3YA 4P73C 4C0FA 4XU0A 1Y71A 5C51B 3QDRB 2LCCA 2KMTA 4C92E 4YRRA 1HK9A 1SETA 5GMKl 4BWAA 4C5HA 4EMKB 1EIYB 1VQNA 1C0AA 1YJNA 4LDWA 3M4GA 2ZNIA 1H4QA 4L59A 2M1HA 4HT4A 5IAYA 1I5LA 4WF2A 3CCQA 2AMCB 2RB6A 3CCSA 2EL9A 4OB3B 4YCUA 3A31A 4ZIBA 2K3XA 4M7AE 3E9FA 2CJAA 1XTDA 3DKMA 3OYDA 4TVWA 1WJQA 5LJ5f 3QO5A 3RKWA 3A5YA 3RGLA 4P3PA 3TCJA 3VYHB 1YIJT 4CI0C 4PLLA 1BYMA 3DB4A 4TQDA 3LSQA 2LDMA 3H8ZA 1JBMA 4XTZA 2KSSA 4XTXA 5GANf 2ARUA 4F7UA 2QA4A 1B8AA 1X2GA 1S72T 3TREA 4YRCA 3MCAB 4OGCA 1ZHIA 5A0GA 2ARSA 1EQRA 1G5HA 4PJOE 1Y96B 3MO8A 4M7AA 4XTWA 3SWNC 4KT0E 2CZ6B 3IG2A 4QVCA 2JUFA 3IALA 3CCST 4HWSA 1VQ5A 4J6YA 4YP0A 3CCRT 4A4HA 4XK8E 1KD1U 1Y96A 4NCXA 3PIOA 2ZZDA 4LDXA 2QDYB 3PTAA 3REXA 2P4TA 3G6EA 4M7DE 3MF2A 4GY5A 2IVWA 1Q7YU 1MHNA 2QXFA 2QTXA 3QZ5B 4HVCA 5ELNA 2RHIA 2ZPBB 1VQ7T 4YRGA 1USYC 3HL8A 1W4SA 1KC8C 2JN0A 3L1AA 2Q7GA 2J3LA 4AH6A 5GAOp 4N0AC 2EIFA 3O8VA 5LJ3e 2EAYA 2AMCA 3V7RA 4C0ZA 1KQ1A 2RK2A 1VQ5T 4NL3A 4KULA 5GAMd 3OYHA 3QTCA 3JCMP 1IREB 3E9HA 3C4SA 3Q1JA 4OGEA 4C0GA 1M1KU 3QJYA 3DLLA 2KAFA 4C8QF 3L2QA 2CIMA 3X24B 2OTJA 1VQ6T 3SFMA 1FXXA 5IT9E 3CCRA 4LNSA 4A4FA 2KQWA 1KG1A 1Z7NA 2ZT7A 2MWOA 3QSUA 2R5AA 1NJ2A 5GMKe 3N5BB 4C5GA 1M1FA 1D3BB 4O5VA 1Q81C 4MZTA 3M56A 2CZ1B 1KQ2A 5I2MA 4NOYA 3OBWA 4M7AC 2QI2A 2QHTA 3V7SA 4C92A 4M78G 1X54A 4ME7A 1X01A 1Q82U 4N4HA 4ZTJA 3WQZA 3FEOA 3HXVA 3RIRA 3KFUA 4ZTFA 5D6YA 3MF1A 5A0LA 4BY6B 3FIFA 4N4GA 1YITT 1KC8U 4QQGA 2X4YA 3QIIA 1QVFS 1Y7XA 3ZBDA 3OY9A 2DTHA 2EYQA 3CCJA 1BBUA 3NEMA 3GPLA 3FDRA 4C8QC 4LDVA 5KCOA 5DY9A 1RL2A 5LJ3g 3ICAA 1E22A 2RHZA 1FWZA 3J81E 3HKSA 2K57A 2XHCA 4XAXB 4MMLA 3NFCA 2OAUA 1WJSA 1KMMA 2EJGA 2XICA 1SERA 2MF2A 3MEAA 4M7AG 1N9WA 1EIYA 4CH4A 1UEBA 3LYIA 1W66A 2XG8D 3GIBA 3P8BB 4OP0A 4XEMA 3CC2T 1PYSA 2ZT6A 4OB1B 3OYFA 3VJPA 3CCLT 3E9GA 5FU6B 2JTFA 3TEEA 4VUBA 2EQUA 1OYXA 2PVGB 2YHTA 3C95A 2EFIA 2YLBA 1LNXA 5FROA 2D0QB 1WNLA 4EX5A 3DLMA 2LQKA 3S3NA 4IUUA 5GANh 2A8EA 4HCZA 5C52B 3MEYA 3HY1A 1Q82C 1K9MU 2PVOB 2I4NA 2RO0A 1YCYA 3KXTA 4BUGA 4YPFA 4J8OA 3OBYA 1VQMT 3CXCS 4HT9A 4JRQA 1X75C 5LJ5h 4ZN1A 2R58A 3LWIA 3HXYA 4KUIA 3CCEA 2HAXA 2MAMA 3JCMJ 2YLCA 1USYA 1N8RC 3OYIA 4PJOC 2RHUA 5FU7C 2ZZFA 2VGNA 3FB9A 4DOWA 1OZ3A 2JOYA 1E1OA 1H4VB 3IKLA 2QEXA 1OZ2A 4IUQA 1VQ4A 4RKUE 5GAOr 3ZEHA 2RK1A 4KR3A 3VUBA 1U8RA 2QQRA 4J5YA 4YRLA 3UDCA 3JCMe 3GF5A 5GAOl 3RESA 3ER0A 2DPPB 4II1A 1KOGA 2O01E 3A5ZB 4V2SA 3NTKA 3LC0A 3AHUA 2XU8A 2LX9A 2Q5HA 2I4MA 4MDWA 4MMKA 4IKFA 2G4CA 4YDQA 3VQXA 2AKWA 4M77B 4HWTA 4P5NA 3HP9A 3RF1A 3HFOA 4C8QE 2JZ2A 4O6JA 3M53A 2ZCEA 4M77G 4XQ3A 4JDSA 5GAMh 4R56A 5D6WA 3QXEB 3L4GB 2QQAA 3JB9I 1X2HA 3NETA 2AKWB 1XNIA 2HQXA 3CCJT 2V8KA 4QQ6A 3TUPA 1VQKA 4BDZA 2GCXA 2CZ7B 4M7AB 3CBOA 1Y07A 4LD6A 3OYLA 4PJOA 4ZTUB 1QP3A 3QO8A 4OVAA 2XDDA 2DZ9A 2KK4A 5DM7R 1SESA 1ADJA 4H2TA 12ASA 2LT1A 3OYCA 2FL7A 1VQOT 1UGPB 1GXIE 4DQ2A 3JCMb 1YJNT 4M75A 4XU2A 1YHQA 2RA2A 11ASA 2DU5A 3OS1A 4OF1A 1U1TA 3OB9A 5GAN6 4Q6GA 2RI2A 4IUVA 5LJ5e 4CH3A 5CAIA 5GAMf 1ATIA 3CCLA 3MHXA 3C12A 2PMFA 3INZA 4DOVA 3P8TA 2IY5B 4X9DA 1EVLA 2CZ0B 4J15A 4ATOA 1KQSS 4DPGA 2PMEA 4TVAB 3PIPA 2QA4T 1EIFA 3FJPA 5LL6S 3R07A 3L2ZA 1NJIC 4M78D 1ZBXA 2IY5A 5CKHA 5GANe 3QBYA 3JCMg 2OTJT 3G4SA 3CMEA 3REUA 1QVPA 1X56A 3OYYA 4C92B 4BACA 1VQLA 1IL2A 3M59A 3G1ZA 2Y4YA 4F7UG 2VV5A 2ZTGA 3P8YA 3M9QA 1NYRA 4PLIA 4M78A 3I56A 4H02A 2X4WA 3S6WA 3I7FA 1YIJA 4ZGDB 2QQSA 3M54A 4N0AA 3HXXA 2ZPGB 3CCVA 4K87A 1L0WA 4JRIA 4Z02A 4H2YA 2RJDA 4BI4A 1VQPT 2NS6A 3A8GB 1YBYA 2I2LA 4LDYA 4A53A 2DD4A 3QKJA 3LGLA 3VBBA 3A5ZA 1RI0A 3GNFB 3BFMA 4P75A 2WSEE 1NE8A 1JJCA 1UGRB 3JB9H 3CC7A 1Q7YC 4P71A 5KE3A 4G84A 2O4XA 3HRUA 1JJ2S 1ZQ1A 2WSCE 4BE1A 3A7AA 3CBMA 1W2BS 1VIEA 3HFNA 2DTOA 5GAN7 4L87A 3OS0A 4A4KA 4P75C 4C0DB 4EMGA 1JJCB 2ZPFB 3CCQT 3X20B 3HXZA 4M7DD 2F69A 3LWHA 3T9NA 2G3RA 3PCOA 4FU6A 4BD3A 2K3YA 4OLFA 4KUDK 3E1SA 4WJ3M 4LVLA 1XQHA 4PJOD 1NJ1A 2LTOA 1WQ7A 4JJNK 2Q5IA 2D9TA 4P3NA 1YFSA 1B7YB 4M7DA 3M4QA 4M77E 1B34A 2XKOC 2JNGA 1H3ZA 2DO3A 1VQKT 3HFZA 1NJ8A 5CKEA 1IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMM A;  4EMH A;  2EJG A;  3QNE A;  1SER A;  2CJB A;  4M7A G;  2VC8 A;  1N9W A;  3JB9 D;  2DU7 A;  3JCM f;  3BJU A;  4M78 E;  3RKX A;  1EIY A;  4CH4 A;  1W66 A;  3RKY A;  5GMK i;  1X55 A;  4KQE A;  3VU3 C;  1WU7 A;  1WQW A;  2E5A A;  3JCM h;  3GIB A;  2DXU A;  2ZZE A;  4OP0 A;  1NNH A;  4XEM A;  4M7A D;  1PYS A;  2ZT6 A;  4RDX A;  5GAO q;  4TQF A;  4H2S A;  3HSB A;  1H64 1;  3TEG A;  5K1P A;  1G51 A;  4PJO G;  3A7R A;  5GAN 3;  3A7U A;  4YCV A;  4UP9 A;  4RMF A;  1QF6 A;  2ZGW A;  1TH7 A;  3CMQ A;  1EFW A;  2YHT A;  1WYD A;  2YLB A;  5LJ5 g;  1LNX A;  4JRK A;  2I4L A;  2ZXF A;  1WNL A;  5I21 A;  1H4S A;  3VQW A;  4EX5 A;  4M77 A;  3HFV A;  5GAN h;  2ZIN A;  4RCB A;  5KNN A;  4K86 A;  2XGT A;  3V7C A;  3ERR A;  2FB7 A;  1B70 B;  4C92 C;  5C52 B;  3MEY A;  2E3C A;  3HY1 A;  1ASZ A;  4HT8 A;  3JCM c;  1YB3 A;  1KMN A;  2I4N A;  1LJO A;  4YRO A;  1M5Q 1;  3BDU A;  3SWN A;  2C7I A;  1YCY A;  2DQ3 A;  5GAN g;  4YPF A;  1LOJ A;  4YRM A;  2ZR2 A;  4H2X A;  4HT9 A;  5GAO n;  3HTZ A;  4H2W A;  5LJ5 h;  1H4T A;  2QHU A;  3HXY A;  2ALY B;  3NEL A;  4HA8 A;  4BW9 A;  1ADY A;  3JCM J;  2YLC A;  3W3S A;  4O2D A;  1USY A;  2ZIO A;  2DTI A;  4PJO C;  2ZZF A;  4M75 B;  3FB9 A;  3RER A;  2DVE A;  3A74 A;  4CH6 A;  1HC7 A;  4YRS A;  4M78 B;  2EJ9 A;  3RAC A;  2RHQ A;  2DZC A;  3JCM d;  3P8V A;  4M75 G;  1I81 A;  4A54 A;  3HXW A;  4M75 E;  5C53 B;  4P73 C;  4C8Q D;  1E1O A;  1H4V B;  3IKL A;  1B34 B;  4XU0 A;  1B76 A;  4RQF A;  5C51 B;  3JB9 G;  1BIA A;  3HFZ B;  1N9R A;  4C92 E;  4YRR A;  1HK9 A;  4YRE A;  4M7D F;  5GAO r;  3BW1 A;  1SET A;  4KR3 A;  5GMK l;  4BWA A;  4H2U A;  2DXT A;  3PGG A;  4EMK B;  4P72 C;  1EIY B;  4J5Y A;  4YRL A;  1C0A A;  1JRI A;  4M78 C;  3M4G A;  2ZNI A;  5GAN 8;  3JCM e;  4C92 D;  4J6W A;  4JUV A;  1YFR A;  1H4Q A;  1HXD A;  3JCM W;  5GMK h;  5GAO l;  3RES A;  3TEH B;  2VXF A;  1KOG A;  4V2S A;  3PCO B;  4CH5 A;  3NEN A;  4YRP A;  3LC0 A;  3SWN B;  3AHU A;  2DEQ A;  4WI1 A;  1I5L A;  4WF2 A;  4X5O A;  2Q5H A;  2I4M A;  2AMC B;  2RB6 A;  2E1H A;  2EL9 A;  3V8J A;  4YCU A;  3A31 A;  4ZIB A;  1E24 A;  4MMK A;  4CS3 A;  4P72 A;  3JB9 J;  1WPY A;  3JCM V;  4M7A E;  2G4C A;  2ZT8 A;  2CJA A;  3VQY A;  3L4G A;  4YDQ A;  4TVW A;  4YRF A;  3VQX A;  5LJ5 f;  2AKW A;  4M77 B;  4M75 C;  1BBW A;  4HWT A;  1NJ6 A;  3RF1 A;  3OD1 A;  4G85 A;  3QO5 A;  3VQV A;  3HFO A;  3RKW A;  4C8Q E;  5F5W A;  3HRK A;  3A5Y A;  1Z7M A;  2ZCE A;  4M77 G;  5GAN 4;  5GMK m;  4ZTZ B;  4XQ3 A;  5LJ3 f;  4M7D G;  3RGL A;  4P3P A;  4XTU A;  1M8V A;  3QO3 A;  3V8L A;  3RL6 A;  2RHQ B;  5GAM h;  3L4G B;  4KR2 A;  3JB9 I;  1X2H A;  5GMK j;  2E41 A;  2AKW B;  2J3M A;  3LSQ A;  3NET A;  4TQD A;  2EWN A;  4TWA A;  4XU3 A;  1WLE A;  3TUP A;  1JBM A;  2ART A;  3PZC A;  3SB2 A;  4HWO A;  5GAN d;  3BY7 A;  4JLI A;  4M7A B;  4XTZ A;  3UFG A;  4XTX A;  5GAN f;  4PJO A;  4F7U A;  2ARU A;  4K88 A;  4ZTU B;  1B8A A;  2DJZ A;  1X2G A;  3QO8 A;  4TTV A;  2ZT5 A;  4CS4 A;  2DZ9 A;  1SES A;  1ADJ A;  2E10 A;  4H2T A;  4YRC A;  12AS A;  4M7D B;  1U1S A;  2CGH A;  2ARS A;  4EMK C;  1D3B A;  1NJ5 A;  4C8Q B;  4DQ2 A;  3JCM b;  4X9C A;  1EQR A;  1G5H A;  4M75 A;  4XU2 A;  1Y96 B;  4PJO E;  4M7A A;  2RA2 A;  11AS A;  2DU5 A;  5GAM e;  4EO4 A;  1U1T A;  4XTW A;  5GAN 6;  2C8M A;  2ODR D;  3SWN C;  4Q6G A;  3HY0 A;  1E1T A;  3IG2 A;  2ZNJ A;  2HNI A;  4QVC A;  1G5I A;  5LJ5 e;  4CH3 A;  5CAI A;  3QHS A;  5GAM f;  1ATI A;  3IAL A;  4HWS A;  4H2V A;  4M78 F;  2PMF A;  4J6Y A;  4YP0 A;  4F7U F;  1NYQ A;  4PJO F;  4M7A F;  3INZ A;  1Y96 A;  4M75 F;  3P8T A;  4NCX A;  2IY5 B;  2I4O A;  2ZIM A;  1B70 A;  4X9D A;  1EVL A;  4XU1 A;  4UPA A;  3REX A;  4M7D C;  4J15 A;  4M7D E;  3MF2 A;  1EVK A;  5LJ5 j;  4DPG A;  2PME A;  2FYK A;  4TVA B;  4YRI A;  3JB9 F;  3FJP A;  4M75 D;  3R07 A;  4UP8 A;  3L2Z A;  1YGB A;  5E3I A;  4XTV A;  5GAO m;  2QTX A;  4HVC A;  4M78 D;  4PNO A;  5LJ3 j;  5ELN A;  2IY5 A;  4YRG A;  1USY C;  5GAN e;  2Y90 A;  2P0L A;  3JCM g;  2JN0 A;  3L1A A;  2Q7G A;  2J3L A;  4AH6 A;  5LJ5 d;  5GAO p;  4N0A C;  4M77 F;  1MGQ A;  3REU A;  1X56 A;  1B7Y A;  4C92 B;  1LYL A;  1IL2 A;  3G1Z A;  5HGQ A;  4M77 D;  4F7U G;  5LJ3 e;  4HWP A;  2EAY A;  2RHS B;  2Q7H A;  2QHS A;  3HRI A;  2AMC A;  2ZTG A;  3P8Y A;  1ASY A;  5GAN j;  3V7R A;  4YRN A;  1KQ1 A;  1NYR A;  3EFS A;  2E64 A;  4PJO B;  4F7U B;  2DQ0 A;  2VXE A;  4M78 A;  4H02 A;  4NL3 A;  3M4P A;  5GAM d;  4P71 C;  1I8F A;  2E65 A;  5LJ3 h;  3I7F A;  3JCM P;  3QTC A;  4QVD A;  2ZR3 A;  5K1X A;  1SRY A;  3E9H A;  1QE0 A;  2RHS A;  3A32 A;  4N0A A;  3HXU A;  4C8Q F;  3HXX A;  4K87 A;  1L0W A;  2CIM A;  4JRI A;  4H2Y A;  4CS2 A;  2ALY A;  4F7U E;  4P73 A;  1I4K 1;  3UGT A;  3UGQ A;  1FYF A;  2DKG A;  2I2L A;  3EFR A;  4LNS A;  4A53 A;  4TVY A;  4NL2 A;  4YRT A;  3JCM Q;  1BIB A;  4P74 C;  1Z7N A;  2ZT7 A;  3QSU A;  4RQE A;  3VBB A;  3QUI A;  3LSS A;  1NJ2 A;  4XEO A;  3V8K A;  5GMK e;  2P5I A;  3A5Z A;  4C8Q G;  4TVA A;  1D3B B;  3BFM A;  4UP7 A;  4P75 A;  3DSQ A;  2QHV A;  2DDZ A;  4PG3 A;  4J6X A;  1JJC A;  5LJ3 d;  2RM4 A;  3JB9 H;  3IKM B;  2ODR C;  1KQ2 A;  5GAM g;  4NOY A;  2CJ9 A;  4P71 A;  4M7A C;  4G84 A;  1PYS B;  4C92 F;  2QHT A;  3A7A A;  3V7S A;  3HFN A;  2DTO A;  5GAN 7;  4P3O A;  4C92 A;  4M78 G;  4L87 A;  4Q15 A;  1X54 A;  4YRQ A;  1X01 A;  4EMK A;  1RIQ A;  4P75 C;  2XTI A;  4EMG A;  3WQZ A;  1JJC B;  1VQZ A;  4YYE A;  3HXV A;  5GAM j;  4YRJ A;  4XTY A;  2ZZG A;  3RIR A;  4M7D D;  3HXZ A;  4H2X B;  3KFU A;  3TEH A;  3QO7 A;  3MF1 A;  1GGM A;  3PCO A;  3E9I A;  3FIF A;  1HTT A;  4OLF A;  4YRK A;  4E51 A;  4C92 G;  4P74 A;  4WJ3 M;  4PJO D;  1NJ1 A;  1WQ7 A;  2Q5I A;  5GAN 5;  3JCM X;  4RCC A;  4P3N A;  1YFT A;  4WJ4 A;  1YFS A;  2DTH A;  4Y91 A;  4HWR A;  1EOV A;  4PHC A;  1BBU A;  2EJF A;  1B7Y B;  3NEM A;  4M7D A;  3M4Q A;  4M77 C;  4C8Q C;  4M77 E;  2Q7E A;  1B34 A;  5DY9 A;  4C8Q A;  3RUX A;  1J5W A;  5LJ3 g;  3ICA A;  2RD1 A;  4YCW A;  1E22 A;  5GAN 2;  3HFZ A;  3UH0 A;  1NJ8 A;  2K57 A;  4MML A;  5ELO A;  1N9S A; 
#chains in the Genus database with same CATH topology
 1VQ5 Q;  2AHJ B;  2CJB A;  2LMJ A;  3GOX A;  3OW2 A;  2VC8 A;  4QVZ A;  3CC2 A;  3JB9 D;  2GFA A;  2PQW A;  3JCM f;  3BJU A;  3TVT A;  3CCM T;  1N6A A;  2GF7 A;  1QCF A;  3M57 A;  5GMK i;  2KXC A;  1WQW A;  3OYJ A;  2E5A A;  1X6B A;  5CKD A;  1AEY A;  2K9G A;  5I2S A;  1M90 R;  3RMQ A;  1NNH A;  2V8J A;  5KH6 A;  1IB8 A;  2E3I A;  1VQN T;  4RDX A;  4WTO B;  3TEG A;  5K1P A;  3P8D A;  2JS0 A;  3PMI A;  2D8J A;  1E6H A;  4LDU A;  4YCV A;  3SDZ A;  1PD1 A;  1RUW A;  1EFW A;  1VQO A;  4PJL A;  1D1C A;  4FYY B;  3MQZ A;  1YHQ Q;  2C0O A;  4IUT A;  3MEU A;  2ROL A;  3H6Z A;  3NTH A;  3HFV A;  1VYT A;  1JJ2 A;  1VYV A;  4JZ3 A;  1YJ9 A;  2PVD B;  3JSC A;  2H8H A;  2D0N A;  2DL3 A;  1RLP C;  2FB7 A;  4C92 C;  2E3C A;  1SRM A;  2M9U A;  8AT1 B;  2BE9 B;  3VUZ A;  3M5A A;  3JCM c;  2BTT A;  2KE9 A;  3CD6 Q;  1FMW A;  4OMF B;  1LJO A;  3SWN A;  4OB0 B;  2YRD A;  4LE9 A;  2DQ3 A;  2DXC A;  2X4J A;  4E7J A;  1WIE A;  3JRZ A;  2ZR2 A;  2MWP A;  2K5L A;  5KCH A;  1SEM A;  3F70 A;  1UB4 A;  2MYS A;  2LC4 A;  2XMF A;  3I55 Q;  3MJX A;  4J7I A;  1H4T A;  5DLO A;  2ALY B;  2F2V A;  1ADY A;  1QVF A;  2FZG B;  4X34 A;  1YI2 A;  4LVI A;  3W3S A;  2LCL A;  2ZIO A;  2DTI A;  2EQM A;  6AT1 B;  1N8R R;  4M4Z A;  4ZN3 A;  1QP2 A;  1Y0M A;  4CH6 A;  3EAE A;  2V1R A;  1HC7 A;  2EJ9 A;  4AG2 C;  2DZC A;  3P8V A;  4M75 G;  3HXW A;  2V26 A;  5C53 B;  4C8Q D;  2FPF A;  1W6X A;  3I9Q A;  1WHK A;  1B34 B;  1B76 A;  3OYK A;  3JB9 G;  5D6X A;  3HFZ B;  1ZX6 A;  1N9R A;  1NPR A;  4YRE A;  5FU7 B;  4KBM B;  2JVV A;  3BW1 A;  1K73 C;  5EG2 A;  4DBF A;  4H2U A;  2DXT A;  3PGG A;  3UA6 A;  1ZA1 B;  1JRI A;  1AT1 B;  2P0K A;  4M78 C;  1J3T A;  3A8M B;  4C92 D;  1FX7 A;  4J6W A;  4JUV A;  3LGF A;  5GMK h;  2ATC B;  2A0F B;  2PU9 B;  1VQM Q;  4E7H A;  3PCO B;  3UT1 A;  4CH5 A;  1JB0 E;  1M1K C;  3SWN B;  2DEQ A;  2EKO A;  2A37 A;  2JMA A;  3EGU A;  3V8J A;  1E24 A;  2YUP A;  2HQE A;  3JCM V;  2F2X A;  2E5Q A;  2EYY A;  3EGX B;  1LPL A;  3CCV Q;  1OQK A;  3L4G A;  4YRF A;  2QK0 A;  4M75 C;  1VA7 A;  3QYH B;  1NJ6 A;  4PJJ A;  4G85 A;  1AZG B;  3HRK A;  1D1A A;  3JAM E;  1Z7M A;  2GTO A;  1KK7 A;  4KGZ B;  1OV3 A;  1WZO A;  5GMK m;  4ZTZ B;  4M7D G;  3VS7 A;  1N8R U;  1BBZ A;  1UGQ B;  1K8A U;  2DIG A;  3QO3 A;  3OYA A;  2YRV A;  5IHK A;  1NPP A;  4KR2 A;  5GMK j;  2E41 A;  4TWA A;  1R0C B;  3I35 A;  2HSP A;  3G7Z A;  4OB2 B;  1KD1 R;  1WLE A;  2K6D A;  4JRP A;  2ART A;  1YJ9 T;  4HWO A;  3CXC A;  3BY7 A;  2YUQ A;  1K9A A;  4JLI A;  5CKF A;  2R57 A;  4Y28 E;  2K5I A;  5J26 A;  2EYW A;  4LN2 A;  2PZ1 A;  1SSF A;  4K88 A;  3KUF A;  4TTV A;  1N5Z A;  4CS4 A;  4HKE A;  1W2B A;  1VQ9 Q;  3ULR B;  2C0T A;  2CP2 A;  3S3M A;  1R0B G;  4E7L A;  1W1F A;  5KYX A;  3QYG B;  2AZV A;  1D3B A;  4C8Q B;  3HPW A;  1UFF A;  1XOV A;  3I55 A;  5HK3 A;  1KHC A;  5GAM e;  4RG8 A;  2E70 A;  2C8M A;  2ODR D;  4FT2 A;  3HY0 A;  3L2U A;  2ZNJ A;  2RJF A;  3AT1 B;  1ZSZ C;  2RI5 A;  1G5I A;  2YUO A;  2JT4 A;  4E6R A;  4M78 F;  3HHT B;  2VYT A;  1NYQ A;  4M7A F;  1TUC A;  4M75 F;  3UWN A;  2A7Y A;  1G3W A;  2FO0 A;  1WHH A;  1B70 A;  3M58 A;  4XU1 A;  4UPA A;  1AZE A;  4M7D C;  3OW2 S;  2RH2 A;  3EG3 A;  1K73 U;  1SG5 A;  3OYM A;  1OU9 A;  4YRI A;  1JXO A;  2K5F A;  3D7S B;  2B8A A;  4M75 D;  2E12 A;  2RMO A;  4XTV A;  5LJ3 j;  5CCA A;  4GLK A;  4B9X A;  4PFZ A;  2Y90 A;  4IUP A;  2I0N A;  1BKB A;  1SF9 A;  1TG0 A;  5LJ5 d;  4M77 F;  1WI7 A;  1MGQ A;  1VQO Q;  4ELZ C;  2AKK A;  3A8O B;  1LYL A;  1YJN Q;  3L42 A;  4HWP A;  2Q7H A;  3FLG A;  5D7U A;  1ASY A;  2V8I A;  3EFS A;  2E64 A;  1Q95 G;  2P0P A;  2E6Z A;  4J9H A;  5A0D A;  5L23 A;  2DQ0 A;  3S3O A;  4PKC C;  3NGP A;  3PNW C;  1PD0 A;  4P71 C;  1SHF A;  1W2B P;  4F16 A;  3J80 E;  2ZR3 A;  1NYF A;  1SRY A;  1JO8 A;  2ZPH B;  1OI1 A;  3G71 A;  3I55 T;  3CCU A;  3MP8 A;  3HRT A;  3M55 A;  3A32 A;  3R6N A;  4BI8 B;  2C06 A;  1YP5 A;  3HXU A;  2J7I A;  1VQ8 A;  1BI1 A;  1G5V A;  1PSE A;  4CS2 A;  2RHY A;  1E6G A;  4F7U E;  4LNP A;  2M51 A;  2M0O A;  2NUT B;  1I4K 1;  1M2V A;  5KYN A;  3UGT A;  5IHN A;  2DKG A;  2XD0 A;  1DJ7 B;  3EFR A;  1VQL T;  3EGD A;  4NL2 A;  4YRT A;  2ZPI B;  1IHV A;  4P74 C;  4RQE A;  2KRS A;  1NM7 A;  3QUI A;  1C6V X;  3LSS A;  5KYY B;  2BZ8 A;  2HEQ A;  4XEO A;  3V8K A;  2P5I A;  2WAC A;  4C8Q G;  4TVA A;  2DFU A;  4BI3 A;  4UP7 A;  4JLG A;  4TVR A;  4PG3 A;  2L3P A;  4J6X A;  5I11 A;  2K2V A;  2YT6 A;  1QVG S;  1NJI U;  5LJ3 d;  1X6O A;  4C5I A;  4ZNX A;  2PUO B;  1Q86 R;  1VQ9 A;  4BDY A;  1C0M A;  4C92 F;  4DA4 A;  4JS5 A;  3SD4 A;  1IXD A;  3VS0 A;  4CRI A;  2LJ1 A;  2BIV A;  1GCQ C;  4YRQ A;  4EMK A;  4JJB A;  1Q7Y R;  1K0X A;  5IN1 A;  2XTI A;  4HXJ A;  1VQZ A;  3LH0 A;  1VQ9 T;  4FM4 B;  2DEU A;  3CC7 T;  5GAM j;  4XTY A;  1K9M R;  3X26 B;  4H2X B;  1PC0 A;  4J9D A;  5C6S A;  2D6F A;  4ZGE B;  5HKC A;  2DM1 A;  5FWC A;  1FMV A;  3CMA A;  2KRO A;  4AFS C;  3E9I A;  3QPH A;  4L6V 5;  3A8L B;  4JS4 A;  1JJ2 P;  1G2B A;  2FZC B;  4A63 B;  1HTT A;  2OX7 A;  4YRK A;  3GLX A;  4C92 G;  2QA4 Q;  2LNV A;  4P74 A;  3CBP A;  3L2W A;  2CP7 A;  1ZSZ B;  2AK5 A;  2C0I A;  3CC4 Q;  2DYB A;  3UA7 A;  3JCM X;  3G6E T;  1A0N B;  4WCI A;  1YFT A;  4WJ4 A;  3EGX A;  3LX7 A;  4PHC A;  4HWR A;  3WXM B;  2CS7 A;  1OOT A;  3C94 A;  1Q86 C;  2XK0 A;  4M77 C;  4FYW B;  2RF0 A;  2M16 A;  4OMQ A;  3X28 B;  4IUR A;  4C8Q A;  1J5W A;  2VVK A;  2CP5 A;  4YCW A;  2LQ8 A;  3PT9 A;  3GP8 A;  3UH0 A;  5ELO A;  1R8O B;  1AD5 A;  5KE2 A;  1N9S A;  3I5S A;  2DBK A;  2JMC A;  4EMH A;  2E6N A;  3UF4 A;  4Q5W A;  3EHQ A;  3VKI A;  3CCE T;  1TOV A;  1M90 C;  4M78 E;  3RKX A;  3EHR A;  4PJM A;  3DB3 A;  3RKY A;  1K0S A;  4LVJ A;  5AYF A;  3VU3 C;  2WSF E;  3MPU B;  3VRZ A;  4AFZ C;  2QYZ A;  2RJE A;  3JCM h;  2DXB A;  2QG9 B;  2EGE A;  3H0H A;  4M7A D;  1BI2 A;  3PFS A;  5GAO q;  4TQF A;  2BUD A;  4H2S A;  3HSB A;  1H64 1;  1G51 A;  1Z9Z A;  4PJO G;  2HKN A;  3OQ5 A;  1PRM C;  4KGV B;  3A7U A;  1QF6 A;  2ZGW A;  2H3J A;  4X1V A;  1TH7 A;  2RQU A;  3CMQ A;  1M1G A;  1WXT A;  1M2O A;  2DJQ A;  4JRK A;  4AFU C;  2I4L A;  2ZXF A;  1MMA A;  1OX8 A;  1YIT A;  3OMG A;  2ZIN A;  1UDL A;  5KNN A;  3KBG A;  2XGT A;  3I56 Q;  3ERR A;  1BI3 A;  3CCL Q;  3EH2 A;  1ASZ A;  3QG1 A;  4HT8 A;  3EFO A;  3FRN A;  3UPU A;  1UGV A;  4LD9 K;  4HVW A;  4MZP A;  2JTM A;  4YRO A;  3BDU A;  3E19 A;  3CCM Q;  2LRQ A;  2XDP A;  4BE0 A;  2KDS A;  2DIQ A;  1LOJ A;  2JTE A;  3RMS A;  1B7T A;  1NYG A;  1S72 Q;  4YRM A;  4H2X A;  5GAO n;  3SEM A;  2V1Q A;  4H2W A;  2QHU A;  2J6K A;  3M0T A;  5CKB A;  4HA8 A;  2A3L A;  4UC4 A;  2YUN A;  1N27 A;  2CP0 A;  3MP1 A;  3MEV A;  1LCK A;  2VGM A;  1ABQ A;  2R5M A;  4C5E A;  2AT1 B;  2DVE A;  1M1K R;  3WVD B;  5CQX A;  2RHQ A;  4J83 A;  3RAC A;  1T3L A;  2ZCF B;  4FT4 A;  4KRT A;  1I81 A;  2IG0 A;  2KVQ G;  2QDL A;  5CR2 A;  4M75 E;  5CO7 A;  5FU6 C;  2ED1 A;  5L8R E;  4RQF A;  1V29 B;  4CC3 A;  3OS5 A;  4JPB W;  1ZUU A;  1YIJ Q;  1BIA A;  2EW3 A;  1QKW A;  3H0I A;  2OTL T;  2YWW A;  1BB9 A;  3RDV A;  4NS5 A;  1C1A A;  3G4S T;  1NZ9 A;  4E7I A;  1H3H A;  4M7D F;  1K8A C;  4R55 A;  3L2V A;  3P8H A;  1M2V B;  3REA B;  1NEG A;  4P72 C;  1UHF A;  2DL8 A;  3TQ7 P;  5GAN 8;  3OA6 A;  2RQW A;  1KD1 C;  1QVG A;  3M0U A;  1YFR A;  1HXD A;  3JCM W;  1PWT A;  1KJW A;  3TEH B;  2JS2 A;  2VXF A;  3BE3 A;  4DBH A;  4Z88 A;  1FYN A;  5FWB A;  2FPD A;  1HSQ A;  3NEN A;  1KFZ A;  2YDL A;  4YRP A;  4WI1 A;  3TU4 K;  4X5O A;  1OEB A;  2FG0 A;  3CCU T;  2XID A;  2E1H A;  4HCK A;  3CCJ Q;  4PJN A;  1EZZ B;  4CS3 A;  4P72 A;  3JB9 J;  1FMK A;  1PSF A;  1WPY A;  2DYI A;  2FRW A;  2ZT8 A;  3VQY A;  2A08 A;  3CC7 Q;  1TTH B;  1BBW A;  4RG2 A;  3OD1 A;  3VQV A;  3REB B;  4D8K A;  5F5W A;  2OTJ Q;  5GAN 4;  3CCR Q;  5LJ3 f;  4XTU A;  1M8V A;  2NYS A;  2QQB A;  2RI3 A;  4QT7 A;  3V8L A;  3RL6 A;  2RHQ B;  3A8H B;  4OML A;  2FHD A;  2K7A A;  5HCK A;  4LVM A;  2J3M A;  2EWN A;  1SKU B;  4XU3 A;  3EG1 A;  2XDB A;  2KI7 A;  5J3B A;  3CD6 T;  3A1P A;  3PZC A;  3SB2 A;  5GAN d;  3MEW A;  3UFG A;  2O9S A;  4DEX A;  2GNC A;  2KXD A;  2DJZ A;  4FL6 A;  2ZT5 A;  2MMP A;  1BI0 A;  2E10 A;  4M7D B;  3NMZ C;  2EQK A;  1U1S A;  2CGH A;  2L8D A;  4EMK C;  1MMG A;  4J7F A;  1NJ5 A;  3VRY A;  5HY6 A;  4X9C A;  5CQY A;  2F5K A;  4HCC A;  3HRS A;  3URG A;  4EPC A;  4EO4 A;  2QEX T;  4YTL A;  3CCV T;  2MI6 A;  2DA9 A;  3OYG A;  1Z9Q A;  4FSX A;  2O4X B;  1E1T A;  3VS6 A;  5M9O A;  1K73 R;  2HNI A;  3J7A F;  4QW2 A;  3QHS A;  2XI9 A;  1Q81 U;  4H2V A;  3TSZ A;  2ZPE B;  3R6O A;  2X51 A;  5DLQ E;  4F7U F;  4PJO F;  2ZAE A;  3M4Y A;  1VQ6 A;  4KH1 B;  2I4O A;  1UEC A;  2ZIM A;  1VQ7 A;  2PUK B;  2P0Q A;  3CC4 A;  3A98 A;  1X43 A;  1EVK A;  3G71 T;  5LJ5 j;  1O9S A;  2FYK A;  2B86 A;  2DAQ A;  2HL5 C;  2A28 A;  3LLR A;  3L2R A;  3JB9 F;  4UP8 A;  1YGB A;  5E3I A;  2L3R A;  4PL6 A;  5GAO m;  5FRN A;  4PNO A;  2OTL A;  1RAC B;  5AT1 B;  5CIU A;  4KH0 B;  2P0L A;  3NTI A;  5IHI A;  2QQ9 A;  1NEB A;  1VQ4 T;  1M30 A;  1M9S A;  1QCN A;  3I56 T;  1B7Y A;  4EIK A;  5A2Q E;  2X4X A;  3LW5 E;  5HGQ A;  1I0C A;  2EBP A;  4M77 D;  3OSS C;  3CPW A;  2RHS B;  3OYE A;  4BE2 A;  2QHS A;  3HRI A;  5GAN j;  4YRN A;  4PJO B;  4F7U B;  2VXE A;  1QCO A;  1SPK A;  1VQM A;  1IHW A;  2ROT A;  3M4P A;  1S1N A;  1I8F A;  2BE7 D;  2X35 A;  2DD5 A;  2E65 A;  5LJ3 h;  1AWX A;  4QVD A;  1G83 A;  5K1X A;  2F2W A;  2EQI A;  1QE0 A;  5HK0 A;  5CVI A;  2RHS A;  5ECA A;  4LXC A;  4BB7 A;  1UG1 A;  3GBQ A;  1QVG P;  3OYB A;  1WXU A;  2GGR A;  1OX9 A;  2OAW A;  1PKT A;  1YJW A;  4E7Z A;  5IXB A;  1BCM A;  2ALY A;  5C0M A;  2EYZ A;  4P73 A;  5FLX E;  1D0X A;  3ZFJ A;  3UGQ A;  1FYF A;  3VV0 A;  2G6F X;  3EG9 A;  2CYZ B;  4TVY A;  1QW1 A;  3JCM Q;  2EQJ A;  1YJ9 Q;  3M0P A;  1BIB A;  3CPF A;  1WHM A;  4RMO A;  2CP6 A;  4FW2 A;  3FC3 A;  2VWF A;  1WGS A;  3CD6 A;  4A4E A;  4B9W A;  3DSQ A;  2QHV A;  2DDZ A;  1PHT A;  3BDL A;  3CCM A;  4ZGJ B;  3I5R A;  3MP6 A;  4MZM A;  1R77 A;  2P4R A;  2RM4 A;  1GL5 A;  1AWW A;  3IKM B;  1O75 A;  2LT4 A;  2RNA A;  3X25 B;  3M0S A;  2ODR C;  2MOX A;  5GAM g;  2NLU A;  1S72 A;  2CJ9 A;  1PYS B;  3WVE B;  1IGQ A;  4P3O A;  4Q15 A;  3MET A;  2VUB A;  2K4Y A;  2RJC A;  1RIQ A;  2DRK A;  1VUB A;  1YHQ T;  4YYE A;  2HD0 A;  4YRJ A;  3OSV A;  2ZZG A;  5EC7 A;  1KHI A;  4J9C A;  3TEH A;  1EX4 A;  1F1B B;  3FJ5 A;  2Y4X A;  1VQK Q;  3QO7 A;  3CEY A;  1GGM A;  3OMC A;  2DK3 A;  1Q82 R;  2LVM A;  1K9M C;  4E51 A;  4FIB A;  2ABL A;  3ME9 A;  3O5Z A;  3VS3 A;  3CPW S;  2ECZ A;  1G8X A;  5GAN 5;  5I22 A;  4RCC A;  1YJW T;  1RAE B;  4Y91 A;  1EOV A;  3GNG A;  1QWE A;  3QZ9 B;  2EJF A;  4C0D C;  2NUT A;  2LNH B;  2KR3 A;  2ESW A;  2Q7E A;  4E7K A;  3RUX A;  2RD1 A;  2E5K A;  5GAN 2;  1VQN Q;  1OPL A;  1WJR A;  1WLP B;  5J39 A;  4EDU A;  2SEM A;  4D6W A;  3QNE A;  4BY6 C;  2L0A A;  3QJ6 A;  3VYG A;  2LQN A;  2DU7 A;  1U3O A;  2COY A;  1VQP A;  2RHX A;  2ED0 A;  5CK9 A;  1RLQ C;  1X55 A;  2LCS A;  4KQE A;  1YI2 T;  1WU7 A;  1X2K A;  2F5T X;  3CCS Q;  3MKD A;  4AG1 C;  1P92 A;  1SHG A;  1UGS B;  2DXU A;  2K3B A;  1K4U S;  2ZZE A;  1YNZ A;  2L5Q A;  4RTU A;  1GBR A;  4MDX A;  1AHJ B;  5FRM A;  3A7R A;  5GAN 3;  3CME T;  4UP9 A;  4RMF A;  2NUP B;  3OYN A;  4HCB A;  3E2U A;  1G3S A;  2CT4 A;  1WYD A;  2KRM A;  4RUG A;  5LJ5 g;  3CC4 T;  2FVU A;  2GQV A;  1VIF A;  2DL5 A;  5I21 A;  1H4S A;  3VQW A;  2HCK A;  4M77 A;  1KQS A;  2JM9 A;  1MUZ A;  3PMT A;  4RCB A;  4K86 A;  2GTJ A;  2HBP A;  3V7C A;  3NHN A;  4QQD A;  2L89 A;  2HDA A;  1B70 B;  4A4G A;  1D09 B;  2RPN A;  1IRX A;  4E47 A;  1YB3 A;  4FCY A;  2KY9 A;  4E2F B;  1KMN A;  4LVK A;  1M5Q 1;  4N4I A;  2C7I A;  1VQ8 T;  5GAN g;  2L3S A;  4ELY C;  2OI3 A;  3EG0 A;  3HTZ A;  2QTV A;  3RR6 A;  1ARK A;  4RTY A;  1Q86 U;  2EYX A;  3NEL A;  4BW9 A;  2GFU A;  2ENM A;  3OS2 A;  1G3T A;  4L5G A;  4O2D A;  3LH5 A;  4M75 B;  2CKK A;  1M90 U;  3RER A;  3A74 A;  3ASK A;  1PCX A;  4YRS A;  4M78 B;  1KIK A;  2J05 A;  3JCM d;  2BKD N;  1VQ7 Q;  4A54 A;  3CMA T;  3G6E Q;  1ACM B;  1M4Z A;  1XJW B;  1G3Y A;  4P73 C;  1I5O B;  1M27 C;  4C0F A;  4XU0 A;  1Y71 A;  5C51 B;  3QDR B;  1YN8 A;  2LCC A;  2KMT A;  4C92 E;  4YRR A;  1HK9 A;  1WDX A;  4GBQ A;  2A36 A;  2DLP A;  3CME Q;  1SET A;  5GMK l;  4BWA A;  4C5H A;  1AVZ C;  4EMK B;  1EIY B;  1VQN A;  1C0A A;  1YJN A;  1TUG B;  4LDW A;  3M4G A;  2ZNI A;  2LJ3 A;  1H4Q A;  4L59 A;  2M1H A;  4HT4 A;  2W10 A;  5IAY A;  2FEI A;  4IIM A;  2FZK B;  1I5L A;  4WF2 A;  3CCQ A;  2AMC B;  2RB6 A;  1ZSZ A;  1ZBJ A;  3CCS A;  2EL9 A;  4OB3 B;  3QWX X;  4FYX B;  4YCU A;  3A31 A;  4ZIB A;  2K3X A;  2FPE A;  1OU8 A;  1H8K A;  2DIL A;  4M7A E;  3E9F A;  2CJA A;  1XTD A;  3DKM A;  3OYD A;  9ATC B;  4TVW A;  1WJQ A;  5LJ5 f;  3SHW A;  2J6F A;  2JXB A;  1T0H A;  3QO5 A;  1RAG B;  2DF6 A;  2LJ0 A;  3RKW A;  3A5Y A;  3RGL A;  4P3P A;  3TCJ A;  3VYH B;  3M0R A;  1M8M A;  1YIJ T;  2J6O A;  4DBR A;  4DEY A;  2DL4 A;  4CI0 C;  1ZA2 B;  2O2O A;  4PLL A;  1X2Q A;  1BYM A;  4PFO A;  3DB4 A;  4TQD A;  3LSQ A;  2LDM A;  3H8Z A;  1AWO A;  3OW2 P;  1JBM A;  2AZS A;  4OMM A;  2CP3 A;  7AT1 B;  4XTZ A;  2KSS A;  4XTX A;  5GAN f;  4F7U A;  2ARU A;  2QA4 A;  1TUD A;  1B8A A;  1X2G A;  1MMN A;  1S72 T;  3TRE A;  4YRC A;  3MCA B;  5GJW B;  4OGC A;  1ZHI A;  5A0G A;  2DMO A;  2ARS A;  2O9V A;  1T3S A;  2M02 A;  1EQR A;  1G5H A;  4PJO E;  1Y96 B;  1I07 A;  3MO8 A;  4M7A A;  4CC7 A;  1JEG A;  1X69 A;  2LP5 A;  4FW1 A;  2DER A;  2EKH A;  2PTK A;  5KYW A;  4XTW A;  1JXM A;  2KBT A;  3SWN C;  4KT0 E;  2CZ6 B;  2MK5 A;  1OPK A;  1CKB A;  3IG2 A;  4QVC A;  2JUF A;  1YI2 Q;  4ORZ A;  3CCS T;  3IAL A;  4HWS A;  1VQ5 A;  4J6Y A;  4YP0 A;  3CCR T;  4ESR A;  1M3A A;  4A4H A;  4XK8 E;  1KD1 U;  1Y96 A;  4NCX A;  3EGD B;  3H41 A;  2ZZD A;  3PIO A;  1ZSG A;  2QDY B;  4LDX A;  1WA7 A;  3PTA A;  3REX A;  2P4T A;  1VQP Q;  3G6E A;  4M7D E;  3MF2 A;  2COZ A;  2CUB A;  4GY5 A;  1WYX A;  2IVW A;  1Q7Y U;  1MHN A;  2LZ6 B;  2QXF A;  3G1J A;  2QTX A;  3QZ5 B;  4HVC A;  1MV0 B;  5ELN A;  2RHI A;  2ZPB B;  1VQ7 T;  4R0K A;  2NUZ A;  4YRG A;  1USY C;  4E7S A;  3HL8 A;  1W4S A;  1KC8 C;  2KEA A;  2JN0 A;  3L1A A;  2Q7G A;  2J3L A;  1NJI R;  4AH6 A;  5GAO p;  4N0A C;  3VS1 A;  1MMD A;  4GLM A;  4RTX A;  1RAH B;  2EIF A;  1QWF A;  3O8V A;  5LJ3 e;  2EAY A;  1QVF P;  3PVL A;  3CC2 Q;  2AMC A;  1B3Q A;  2J06 A;  3V7R A;  4C0Z A;  2KRN A;  2LQW A;  1KQ1 A;  2RK2 A;  1VQ5 T;  2DE0 X;  1WX6 A;  4NL3 A;  4KUL A;  5GAM d;  3OYH A;  3QTC A;  3JCM P;  1PKS A;  3H0F A;  1VYU A;  3CCQ Q;  1IRE B;  1RAD B;  3E9H A;  5GJV B;  1GCP A;  3C4S A;  3Q1J A;  4OGE A;  4C0G A;  1M1K U;  2LX7 A;  3QJY A;  3DLL A;  2KAF A;  4C8Q F;  3L2Q A;  1QMC A;  4LUD A;  2CIM A;  1RI9 A;  1PNJ A;  4K11 A;  2X9H A;  3X24 B;  2OTJ A;  1VQ6 T;  3SFM A;  1FXX A;  1PG5 B;  5IT9 E;  1NBE B;  2YXY A;  3CCR A;  4LNS A;  4A4F A;  2KQW A;  2PNI A;  1KG1 A;  1KSW A;  1Z7N A;  3CQT A;  2ZT7 A;  2MWO A;  3QSU A;  2R5A A;  1NJ2 A;  5GMK e;  3N5B B;  4C5G A;  1M1F A;  2SRC A;  2W0Z A;  1D3B B;  1AOJ A;  4O5V A;  1Q81 C;  4MZT A;  1WHJ A;  3M56 A;  2CZ1 B;  4AT1 B;  2K79 A;  2OJ2 A;  1KQ2 A;  5I2M A;  3QDF A;  4NOY A;  3JV3 A;  3OBW A;  4M7A C;  2QI2 A;  3ZL7 C;  5KYU B;  2QHT A;  3V7S A;  4B6M A;  4C92 A;  4M78 G;  1X54 A;  1UJ0 A;  4ME7 A;  2HBW A;  1X01 A;  1Q82 U;  2QGG A;  2HSE B;  3KFV A;  3PE0 A;  1D0Y A;  4N4H A;  4ZTJ A;  3WQZ A;  3TSW A;  3FEO A;  4CC4 B;  3HXV A;  2YSQ A;  3RIR A;  1YWP A;  3KFU A;  4ZTF A;  1OUL A;  5D6Y A;  3MF1 A;  3VS4 A;  1CSK A;  5A0L A;  4BY6 B;  3FIF A;  4JJD A;  4N4G A;  1TU0 B;  4J9F A;  4OMO A;  1YIT T;  1KC8 U;  4QQG A;  4OMN A;  2X4Y A;  1NG2 A;  3QII A;  1QVF S;  3VS2 A;  2QAZ A;  1Y7X A;  2DL7 A;  3ZBD A;  3OY9 A;  2DTH A;  2EYQ A;  4AMC A;  3CCJ A;  2DBM A;  1BBU A;  3NEM A;  2HZY A;  3GPL A;  1VQ4 Q;  2BZY A;  4DBQ A;  3FDR A;  4C8Q C;  4LDV A;  5KCO A;  5DY9 A;  1RAB B;  1RL2 A;  5LJ3 g;  1Q81 R;  3ICA A;  1E22 A;  2RHZ A;  4Y92 A;  1SSH A;  1FWZ A;  3J81 E;  1YFN A;  2K57 A;  2XHC A;  3HKS A;  4XAX B;  4MML A;  1V76 A;  1RAA B;  3NFC A;  1U5S A;  2OAU A;  1WJS A;  1KMM A;  1VQL Q;  2EJG A;  5KYY A;  2XIC A;  1SER A;  2MF2 A;  1YCS B;  2Z0W A;  3MEA A;  4M7A G;  1N9W A;  2CH4 A;  4RTZ A;  1EIY A;  4J9I A;  4CH4 A;  1UEB A;  1K8A R;  2K2M A;  3LYI A;  1W66 A;  2XG8 D;  3H9N A;  2KYM A;  3RBB B;  2EGC A;  1HD3 A;  3GIB A;  3P8B B;  2D1X A;  3C0C A;  4OP0 A;  4KGX B;  4XEM A;  3CC2 T;  1PYS A;  2ZT6 A;  4OB1 B;  3OYF A;  3VJP A;  3CPW P;  3CCL T;  3E9G A;  5FU6 B;  2JTF A;  4F14 A;  3TEE A;  3G4S Q;  5IXF A;  4VUB A;  2EQU A;  1YJW Q;  1E7O A;  2BZX A;  3EG2 A;  3EH1 A;  1OYX A;  2PVG B;  1X6G A;  1HYO A;  2YHT A;  2EFI A;  3C95 A;  1MNE A;  2HMA A;  2YLB A;  1LNX A;  2RQR A;  5FRO A;  2D0Q B;  1WNL A;  4EX5 A;  1KC8 R;  3DLM A;  2LQK A;  3THK A;  2HQH A;  3S3N A;  4IUU A;  2E4H A;  5GAN h;  2MPX C;  2A8E A;  1ZUY A;  2DET A;  4HCZ A;  2QGF B;  1BK2 A;  5C52 B;  3MEY A;  3HY1 A;  4J9E A;  1VQ6 Q;  2JW4 A;  3CCU Q;  1Q82 C;  1K9M U;  2PVO B;  2I4N A;  3IQL A;  2VAS A;  2RO0 A;  1YCY A;  3KXT A;  2CT3 A;  2AKL A;  4BUG A;  2COW A;  1WFW A;  2YRC A;  2DX1 A;  4YPF A;  4J8O A;  3OBY A;  1VQM T;  3CXC S;  4HT9 A;  4JRQ A;  4Z89 A;  1X75 C;  1M3B A;  5LJ5 h;  4ZN1 A;  1WXB A;  2R58 A;  1UE9 A;  3LWI A;  3HXY A;  4KUI A;  3CCE A;  1JQQ A;  2HAX A;  2MAM A;  3JCM J;  2YLC A;  1USY A;  1N8R C;  2KYB A;  3OYI A;  1ZLM A;  2HKQ B;  4PJO C;  2RHU A;  5FU7 C;  1RAI B;  1D1B A;  2ZZF A;  2VGN A;  3FB9 A;  4DOW A;  1OZ3 A;  1SRL A;  3PVQ A;  2JOY A;  1E1O A;  1H4V B;  3IKL A;  1D0Z A;  5FW9 A;  2QEX A;  1OZ2 A;  1X27 A;  1TXQ A;  1UUE A;  1UTI A;  1IGU A;  2VB6 A;  2KNB B;  1CKA A;  4IUQ A;  1VQ4 A;  4RKU E;  2DRM A;  5KYU A;  5GAO r;  3ZEH A;  1LVK A;  2RK1 A;  1VQ8 Q;  2AIR B;  4KR3 A;  2RQT A;  2MIO A;  2DVJ A;  3VUB A;  1U8R A;  2QQR A;  4J5Y A;  4YRL A;  1NLP C;  4J9B A;  2O88 A;  2JM8 A;  2P84 A;  2X3W D;  3UDC A;  3JCM e;  1NLO C;  2KT1 A;  3GF5 A;  2GBQ A;  2KGT A;  3RES A;  5GAO l;  3ER0 A;  2DPP B;  4II1 A;  1KOG A;  2O01 E;  4CC2 A;  3A5Z B;  2CDT A;  4V2S A;  3NTK A;  1QKX A;  3LC0 A;  1U06 A;  1TWB A;  2XU8 A;  4RTW A;  2LX9 A;  3AHU A;  3QWY A;  8ATC B;  2Q5H A;  4QKU A;  2I4M A;  3G71 Q;  2O31 A;  4MDW A;  4MMK A;  1TSF A;  1WHL A;  4IKF A;  1ZUK A;  2CH4 W;  2G4C A;  1ABO A;  4YDQ A;  1AWJ A;  3VQX A;  2AKW A;  4M77 B;  4Z8A A;  4HWT A;  4P5N A;  3HP9 A;  4FSS A;  3RF1 A;  3HFO A;  2GQI A;  4C8Q E;  2JZ2 A;  4O6J A;  3M53 A;  2ZCE A;  4M77 G;  1YWO A;  2CSQ A;  4XQ3 A;  2RN8 A;  4JDS A;  1MV3 A;  5GAM h;  5D6W A;  3QXE B;  4R56 A;  1YIT Q;  3L4G B;  2QQA A;  3JB9 I;  1X2H A;  3NET A;  1V1C A;  4D8D A;  1XNI A;  2HQX A;  3CCJ T;  2AKW B;  2V8K A;  4QQ6 A;  2D8H A;  2KT8 A;  3M0Q A;  3TUP A;  1VQK A;  4BDZ A;  2GCX A;  2CSI A;  2DNU A;  3EG9 B;  1UJY A;  2IIM A;  2CZ7 B;  4M7A B;  3CBO A;  1Y07 A;  4LD6 A;  3OYL A;  4PJO A;  2CUD A;  4ZTU B;  1QP3 A;  3QO8 A;  4OVA A;  2FRY A;  2XDD A;  2DZ9 A;  2KK4 A;  5DM7 R;  1SES A;  1ADJ A;  4H2T A;  1KQS P;  12AS A;  1Y57 A;  2LT1 A;  3OYC A;  2FL7 A;  1VQO T;  1UGP B;  1GXI E;  4DQ2 A;  3JCM b;  2EGA A;  1YJN T;  4M75 A;  4XU2 A;  2NUP A;  1YHQ A;  3UAT A;  2RA2 A;  1JU5 C;  11AS A;  2DU5 A;  2VKN A;  3OS1 A;  4OF1 A;  1U1T A;  3OB9 A;  5GAN 6;  4Q6G A;  1K1Z A;  2RI2 A;  4IUV A;  5LJ5 e;  4CH3 A;  5CAI A;  1GFD A;  5GAM f;  1ATI A;  3CMA Q;  3CCL A;  3MHX A;  3C12 A;  2PMF A;  2E3H A;  2QAS A;  3INZ A;  4DOV A;  3P8T A;  2IY5 B;  4AFQ C;  4X9D A;  1EVL A;  5KYW B;  2CZ0 B;  4J15 A;  4ATO A;  1KQS S;  4DPG A;  2PME A;  4TVA B;  3PIP A;  2QA4 T;  1EIF A;  3FJP A;  5LL6 S;  2QEX Q;  3R07 A;  3HTR A;  3L2Z A;  1NJI C;  4M78 D;  1ZBX A;  2IY5 A;  4LUE A;  5CKH A;  5GAN e;  3QBY A;  3U23 A;  3JCM g;  2OTJ T;  3G4S A;  3CME A;  4ANJ A;  1BU1 A;  3REU A;  1QVP A;  1X56 A;  3OYY A;  4C92 B;  2MCN A;  4BAC A;  1VQL A;  1IL2 A;  3M59 A;  3G1Z A;  2Y4Y A;  4F7U G;  2VV5 A;  1HJD A;  2ZTG A;  3CXC P;  3P8Y A;  3M9Q A;  1RAF B;  4HVU A;  1NYR A;  4PLI A;  4M78 A;  3I56 A;  4H02 A;  2X4W A;  3NPF A;  3S6W A;  1B07 A;  3I7F A;  2EPD A;  1YIJ A;  4ZGD B;  4PFP A;  2IPO B;  5IH2 A;  2QQS A;  3M54 A;  4N0A A;  4PK4 A;  3HXX A;  2ZPG B;  3CCV A;  4K87 A;  1L0W A;  4JRI A;  4Z02 A;  4H2Y A;  2RJD A;  2HL3 A;  4BI4 A;  1T0J A;  1VQP T;  1GRI A;  1EFN A;  2NS6 A;  1GCQ A;  3A8G B;  1IO6 A;  1YBY A;  1UHC A;  2I2L A;  1QLY A;  4LDY A;  4A53 A;  2DD4 A;  3QKJ A;  3LGL A;  3VS5 A;  3VBB A;  4RTV A;  1K76 A;  4F17 A;  3A5Z A;  5KYX B;  1RI0 A;  3GNF B;  3BFM A;  4P75 A;  2F1L A;  2L3Q A;  2WSE E;  1W70 A;  2EVR A;  1NE8 A;  1JJC A;  1UGR B;  1BCO A;  3JB9 H;  3RNJ A;  3CC7 A;  1Q7Y C;  2NWM A;  5KE3 A;  2O4X A;  3EFO B;  3HRU A;  1JJ2 S;  4G84 A;  4P71 A;  1ZQ1 A;  1PM3 A;  1WHG A;  2WSC E;  4BE1 A;  3CBM A;  3A7A A;  1W2B S;  1VIE A;  3HFN A;  2DTO A;  5GAN 7;  4L87 A;  2X3X D;  3OS0 A;  4JJC A;  2H3E B;  4A4K A;  1PRL C;  1MND A;  3CCE Q;  4P75 C;  4C0D B;  2M0Y A;  4EMG A;  1JJC B;  2ZPF B;  3CCQ T;  1H92 A;  4OMP A;  3X20 B;  4JZ4 A;  3HXZ A;  4M7D D;  2F69 A;  3LWH A;  3T9N A;  2G3R A;  3PCO A;  4FU6 A;  4RTT A;  4BD3 A;  2CRE A;  2K3Y A;  4OLF A;  2RQV A;  1GBQ A;  4KUD K;  1M3C A;  3E1S A;  4WJ3 M;  4LVL A;  1XQH A;  4PJO D;  1NJ1 A;  2LTO A;  1WQ7 A;  4JJN K;  2Q5I A;  2D9T A;  1QQJ A;  4P3N A;  2L2P A;  1YFS A;  1TS9 A;  1GFC A;  2JJ9 A;  4F04 B;  4J9G A;  1B7Y B;  4FYV B;  4M7D A;  3M4Q A;  1I1J A;  4M77 E;  2OTL Q;  1B34 A;  2XKO C;  2JNG A;  4HVV A;  2DO3 A;  1H3Z A;  1VQK T;  1VOM A;  4IIO A;  3HFZ A;  1NJ8 A;  5CKE A;  1IZ6 A; 
#chains in the Genus database with same CATH homology
 2AHJ B;  2CJB A;  3GOX A;  3OW2 A;  2VC8 A;  4QVZ A;  3CC2 A;  3JB9 D;  2GFA A;  2PQW A;  3JCM f;  3BJU A;  3CCM T;  1N6A A;  2GF7 A;  3M57 A;  5GMK i;  1WQW A;  3OYJ A;  2E5A A;  5CKD A;  5I2S A;  3RMQ A;  1NNH A;  2V8J A;  5KH6 A;  4RDX A;  1VQN T;  3TEG A;  5K1P A;  3P8D A;  3PMI A;  4LDU A;  4YCV A;  3SDZ A;  1EFW A;  1VQO A;  3MQZ A;  4IUT A;  3MEU A;  3H6Z A;  3NTH A;  3HFV A;  1JJ2 A;  1YJ9 A;  2PVD B;  3JSC A;  2FB7 A;  4C92 C;  2E3C A;  2M9U A;  3VUZ A;  3M5A A;  3JCM c;  4OMF B;  1LJO A;  3SWN A;  4OB0 B;  2DQ3 A;  2DXC A;  2X4J A;  4E7J A;  3JRZ A;  2ZR2 A;  2MWP A;  2K5L A;  5KCH A;  3F70 A;  1UB4 A;  2LC4 A;  4J7I A;  1H4T A;  5DLO A;  2ALY B;  1ADY A;  1QVF A;  4X34 A;  1YI2 A;  4LVI A;  3W3S A;  2LCL A;  2ZIO A;  2DTI A;  2EQM A;  4ZN3 A;  1QP2 A;  4CH6 A;  3EAE A;  1HC7 A;  2EJ9 A;  2DZC A;  3P8V A;  4M75 G;  3HXW A;  5C53 B;  4C8Q D;  1B34 B;  1B76 A;  3OYK A;  3JB9 G;  5D6X A;  3HFZ B;  1N9R A;  1NPR A;  4YRE A;  5FU7 B;  4KBM B;  2JVV A;  3BW1 A;  1K73 C;  5EG2 A;  4H2U A;  2DXT A;  3PGG A;  1JRI A;  2P0K A;  4M78 C;  3A8M B;  4C92 D;  1FX7 A;  4J6W A;  4JUV A;  3LGF A;  5GMK h;  2PU9 B;  4E7H A;  3PCO B;  3UT1 A;  4CH5 A;  1JB0 E;  1M1K C;  3SWN B;  2DEQ A;  2EKO A;  3V8J A;  1E24 A;  2HQE A;  3JCM V;  2E5Q A;  3L4G A;  4YRF A;  4M75 C;  3QYH B;  1NJ6 A;  4G85 A;  3HRK A;  3JAM E;  1Z7M A;  5GMK m;  4ZTZ B;  4M7D G;  1N8R U;  1UGQ B;  1K8A U;  2DIG A;  3QO3 A;  3OYA A;  2YRV A;  1NPP A;  4KR2 A;  5GMK j;  2E41 A;  4TWA A;  3G7Z A;  4OB2 B;  1WLE A;  4JRP A;  2ART A;  1YJ9 T;  4HWO A;  3CXC A;  3BY7 A;  4JLI A;  5CKF A;  2R57 A;  4Y28 E;  2K5I A;  5J26 A;  1SSF A;  4K88 A;  3KUF A;  4TTV A;  4CS4 A;  4HKE A;  1W2B A;  3S3M A;  4E7L A;  3QYG B;  1D3B A;  4C8Q B;  3HPW A;  1XOV A;  3I55 A;  5HK3 A;  1KHC A;  5GAM e;  4RG8 A;  2E70 A;  2C8M A;  2ODR D;  4FT2 A;  3HY0 A;  3L2U A;  2ZNJ A;  2RJF A;  2RI5 A;  1G5I A;  4M78 F;  3HHT B;  2VYT A;  1NYQ A;  4M7A F;  4M75 F;  3UWN A;  2A7Y A;  1G3W A;  1B70 A;  3M58 A;  4XU1 A;  4UPA A;  4M7D C;  3OW2 S;  2RH2 A;  1K73 U;  3OYM A;  4YRI A;  2K5F A;  2B8A A;  4M75 D;  2E12 A;  4XTV A;  5LJ3 j;  5CCA A;  4GLK A;  4B9X A;  2Y90 A;  4IUP A;  1BKB A;  5LJ5 d;  4M77 F;  1MGQ A;  4ELZ C;  3A8O B;  1LYL A;  3L42 A;  4HWP A;  2Q7H A;  3FLG A;  1ASY A;  2V8I A;  3EFS A;  2E64 A;  2P0P A;  2E6Z A;  5A0D A;  2DQ0 A;  3S3O A;  4PKC C;  3PNW C;  4P71 C;  3J80 E;  2ZR3 A;  1SRY A;  2ZPH B;  1OI1 A;  3G71 A;  3I55 T;  3CCU A;  3MP8 A;  3HRT A;  3M55 A;  3A32 A;  4BI8 B;  2C06 A;  3HXU A;  1VQ8 A;  1BI1 A;  1G5V A;  1PSE A;  4CS2 A;  2RHY A;  4F7U E;  2M0O A;  1I4K 1;  3UGT A;  2DKG A;  2XD0 A;  1DJ7 B;  3EFR A;  1VQL T;  4NL2 A;  4YRT A;  2ZPI B;  4P74 C;  4RQE A;  3QUI A;  3LSS A;  4XEO A;  3V8K A;  2P5I A;  2WAC A;  4C8Q G;  4TVA A;  4BI3 A;  4UP7 A;  4JLG A;  4TVR A;  4PG3 A;  4J6X A;  2K2V A;  1QVG S;  1NJI U;  5LJ3 d;  1X6O A;  4C5I A;  2PUO B;  1VQ9 A;  4BDY A;  4C92 F;  4DA4 A;  4JS5 A;  3SD4 A;  4CRI A;  2BIV A;  4YRQ A;  4EMK A;  5IN1 A;  2XTI A;  1VQZ A;  3LH0 A;  1VQ9 T;  4FM4 B;  3CC7 T;  5GAM j;  4XTY A;  3X26 B;  4H2X B;  5C6S A;  2D6F A;  4ZGE B;  5HKC A;  3CMA A;  3E9I A;  3QPH A;  4L6V 5;  3A8L B;  4JS4 A;  1HTT A;  4YRK A;  3GLX A;  4C92 G;  2LNV A;  4P74 A;  3CBP A;  3L2W A;  3JCM X;  3G6E T;  1YFT A;  4WJ4 A;  4PHC A;  3LX7 A;  4HWR A;  3WXM B;  2CS7 A;  3C94 A;  1Q86 C;  2XK0 A;  4M77 C;  2M16 A;  3X28 B;  4IUR A;  4C8Q A;  1J5W A;  4YCW A;  2LQ8 A;  3PT9 A;  3GP8 A;  3UH0 A;  5ELO A;  1R8O B;  5KE2 A;  1N9S A;  4EMH A;  2E6N A;  4Q5W A;  3VKI A;  3CCE T;  1M90 C;  4M78 E;  3RKX A;  3DB3 A;  3RKY A;  4LVJ A;  5AYF A;  3VU3 C;  2WSF E;  2RJE A;  3JCM h;  2DXB A;  4M7A D;  1BI2 A;  3PFS A;  5GAO q;  4TQF A;  2BUD A;  4H2S A;  3HSB A;  1H64 1;  1G51 A;  4PJO G;  3OQ5 A;  3A7U A;  1QF6 A;  2ZGW A;  2H3J A;  1TH7 A;  3CMQ A;  1M1G A;  4JRK A;  2I4L A;  2ZXF A;  1YIT A;  3OMG A;  2ZIN A;  5KNN A;  3KBG A;  2XGT A;  3ERR A;  1BI3 A;  1ASZ A;  3QG1 A;  4HT8 A;  3FRN A;  3UPU A;  4LD9 K;  4MZP A;  2JTM A;  4YRO A;  3BDU A;  3E19 A;  2LRQ A;  2XDP A;  4BE0 A;  2KDS A;  2DIQ A;  1LOJ A;  3RMS A;  4YRM A;  4H2X A;  5GAO n;  4H2W A;  2QHU A;  5CKB A;  4HA8 A;  2A3L A;  4UC4 A;  1N27 A;  3MP1 A;  3MEV A;  2VGM A;  2R5M A;  4C5E A;  2DVE A;  3WVD B;  5CQX A;  2RHQ A;  4J83 A;  3RAC A;  2ZCF B;  4FT4 A;  1I81 A;  2IG0 A;  2KVQ G;  5CR2 A;  4M75 E;  5CO7 A;  5FU6 C;  5L8R E;  4RQF A;  1V29 B;  3OS5 A;  1BIA A;  2OTL T;  4NS5 A;  3G4S T;  1NZ9 A;  4E7I A;  4M7D F;  1K8A C;  4R55 A;  3L2V A;  3P8H A;  4P72 C;  5GAN 8;  3OA6 A;  1KD1 C;  1QVG A;  1YFR A;  1HXD A;  3JCM W;  3TEH B;  2VXF A;  3NEN A;  4YRP A;  4WI1 A;  3TU4 K;  4X5O A;  3CCU T;  2XID A;  2E1H A;  4CS3 A;  4P72 A;  3JB9 J;  1PSF A;  1WPY A;  2ZT8 A;  3VQY A;  1BBW A;  4RG2 A;  3OD1 A;  3VQV A;  5F5W A;  5GAN 4;  5LJ3 f;  4XTU A;  1M8V A;  2RI3 A;  2QQB A;  3V8L A;  3RL6 A;  2RHQ B;  3A8H B;  2FHD A;  4LVM A;  2J3M A;  2EWN A;  4XU3 A;  2XDB A;  5J3B A;  3CD6 T;  3PZC A;  3SB2 A;  5GAN d;  3MEW A;  3UFG A;  2DJZ A;  4FL6 A;  2ZT5 A;  2MMP A;  1BI0 A;  2E10 A;  4M7D B;  2EQK A;  1U1S A;  2CGH A;  2L8D A;  4EMK C;  4J7F A;  1NJ5 A;  5HY6 A;  4X9C A;  5CQY A;  2F5K A;  4HCC A;  3HRS A;  3URG A;  4EPC A;  4EO4 A;  2QEX T;  4YTL A;  3CCV T;  2MI6 A;  3OYG A;  4FSX A;  2O4X B;  1E1T A;  5M9O A;  3J7A F;  2HNI A;  4QW2 A;  3QHS A;  2XI9 A;  1Q81 U;  4H2V A;  2ZPE B;  3R6O A;  5DLQ E;  4F7U F;  4PJO F;  3M4Y A;  1VQ6 A;  2I4O A;  2ZIM A;  1VQ7 A;  2PUK B;  2P0Q A;  3CC4 A;  1EVK A;  3G71 T;  5LJ5 j;  1O9S A;  2FYK A;  2DAQ A;  3LLR A;  3L2R A;  3JB9 F;  4UP8 A;  1YGB A;  5E3I A;  2L3R A;  4PL6 A;  5GAO m;  5FRN A;  4PNO A;  2OTL A;  5CIU A;  2P0L A;  3NTI A;  2QQ9 A;  1VQ4 T;  1M9S A;  3I56 T;  1B7Y A;  5A2Q E;  2X4X A;  3LW5 E;  5HGQ A;  4M77 D;  3OSS C;  3CPW A;  2RHS B;  3OYE A;  4BE2 A;  2QHS A;  3HRI A;  5GAN j;  4YRN A;  4PJO B;  4F7U B;  2VXE A;  1VQM A;  3M4P A;  1I8F A;  2X35 A;  2DD5 A;  2E65 A;  5LJ3 h;  4QVD A;  5K1X A;  1QE0 A;  5HK0 A;  5CVI A;  2RHS A;  4BB7 A;  3OYB A;  1YJW A;  2ALY A;  5C0M A;  4P73 A;  5FLX E;  3ZFJ A;  3UGQ A;  1FYF A;  3VV0 A;  2CYZ B;  4TVY A;  1QW1 A;  3JCM Q;  2EQJ A;  1BIB A;  3CPF A;  4RMO A;  3FC3 A;  1WGS A;  3CD6 A;  4A4E A;  4B9W A;  3DSQ A;  2QHV A;  2DDZ A;  3BDL A;  3CCM A;  4ZGJ B;  3MP6 A;  4MZM A;  2RM4 A;  3IKM B;  1O75 A;  2LT4 A;  3X25 B;  2ODR C;  5GAM g;  2NLU A;  1S72 A;  2CJ9 A;  1PYS B;  3WVE B;  4P3O A;  4Q15 A;  3MET A;  2VUB A;  2K4Y A;  2RJC A;  1RIQ A;  1VUB A;  1YHQ T;  4YYE A;  2HD0 A;  4YRJ A;  3OSV A;  2ZZG A;  1KHI A;  3TEH A;  2Y4X A;  3QO7 A;  3CEY A;  1GGM A;  3OMC A;  2DK3 A;  2LVM A;  1K9M C;  4E51 A;  4FIB A;  3ME9 A;  3CPW S;  5GAN 5;  4RCC A;  1YJW T;  4Y91 A;  1EOV A;  3GNG A;  3QZ9 B;  2EJF A;  4C0D C;  2Q7E A;  4E7K A;  3RUX A;  2RD1 A;  5GAN 2;  1WJR A;  5J39 A;  4EDU A;  4D6W A;  3QNE A;  4BY6 C;  3QJ6 A;  3VYG A;  2DU7 A;  1VQP A;  2RHX A;  5CK9 A;  1X55 A;  4KQE A;  1YI2 T;  1WU7 A;  2F5T X;  1P92 A;  1UGS B;  2DXU A;  2ZZE A;  2L5Q A;  4MDX A;  1AHJ B;  5FRM A;  3A7R A;  5GAN 3;  3CME T;  4UP9 A;  4RMF A;  3OYN A;  4HCB A;  1G3S A;  1WYD A;  5LJ5 g;  3CC4 T;  2FVU A;  2GQV A;  1VIF A;  5I21 A;  1H4S A;  3VQW A;  4M77 A;  1KQS A;  3PMT A;  4RCB A;  4K86 A;  2HBP A;  3V7C A;  4QQD A;  2L89 A;  1B70 B;  4A4G A;  4E47 A;  1YB3 A;  2KY9 A;  1KMN A;  4LVK A;  1M5Q 1;  4N4I A;  2C7I A;  1VQ8 T;  5GAN g;  4ELY C;  3HTZ A;  1Q86 U;  3NEL A;  4BW9 A;  2GFU A;  3OS2 A;  1G3T A;  4L5G A;  4O2D A;  4M75 B;  2CKK A;  1M90 U;  3RER A;  3A74 A;  3ASK A;  4YRS A;  4M78 B;  3JCM d;  2BKD N;  4A54 A;  3CMA T;  1M4Z A;  1G3Y A;  4P73 C;  4C0F A;  4XU0 A;  1Y71 A;  5C51 B;  3QDR B;  2LCC A;  2KMT A;  4C92 E;  4YRR A;  1HK9 A;  1SET A;  5GMK l;  4BWA A;  4C5H A;  4EMK B;  1EIY B;  1VQN A;  1C0A A;  1YJN A;  4LDW A;  3M4G A;  2ZNI A;  1H4Q A;  4L59 A;  2M1H A;  4HT4 A;  5IAY A;  1I5L A;  4WF2 A;  3CCQ A;  2AMC B;  2RB6 A;  3CCS A;  2EL9 A;  4OB3 B;  4YCU A;  3A31 A;  4ZIB A;  2K3X A;  4M7A E;  3E9F A;  2CJA A;  1XTD A;  3DKM A;  3OYD A;  4TVW A;  1WJQ A;  5LJ5 f;  3QO5 A;  3RKW A;  3A5Y A;  3RGL A;  4P3P A;  3TCJ A;  3VYH B;  1YIJ T;  4CI0 C;  4PLL A;  1BYM A;  3DB4 A;  4TQD A;  3LSQ A;  2LDM A;  3H8Z A;  1JBM A;  4XTZ A;  2KSS A;  4XTX A;  5GAN f;  2ARU A;  4F7U A;  2QA4 A;  1B8A A;  1X2G A;  1S72 T;  3TRE A;  4YRC A;  3MCA B;  4OGC A;  1ZHI A;  5A0G A;  2ARS A;  1EQR A;  1G5H A;  4PJO E;  1Y96 B;  3MO8 A;  4M7A A;  4XTW A;  3SWN C;  4KT0 E;  2CZ6 B;  3IG2 A;  4QVC A;  2JUF A;  3IAL A;  3CCS T;  4HWS A;  1VQ5 A;  4J6Y A;  4YP0 A;  3CCR T;  4A4H A;  4XK8 E;  1KD1 U;  1Y96 A;  4NCX A;  3PIO A;  2ZZD A;  4LDX A;  2QDY B;  3PTA A;  3REX A;  2P4T A;  3G6E A;  4M7D E;  3MF2 A;  4GY5 A;  2IVW A;  1Q7Y U;  1MHN A;  2QXF A;  2QTX A;  3QZ5 B;  4HVC A;  5ELN A;  2RHI A;  2ZPB B;  1VQ7 T;  4YRG A;  1USY C;  3HL8 A;  1W4S A;  1KC8 C;  2JN0 A;  3L1A A;  2Q7G A;  2J3L A;  4AH6 A;  5GAO p;  4N0A C;  2EIF A;  3O8V A;  5LJ3 e;  2EAY A;  2AMC A;  3V7R A;  4C0Z A;  1KQ1 A;  2RK2 A;  1VQ5 T;  4NL3 A;  4KUL A;  5GAM d;  3OYH A;  3QTC A;  3JCM P;  1IRE B;  3E9H A;  3C4S A;  3Q1J A;  4OGE A;  4C0G A;  1M1K U;  3QJY A;  3DLL A;  2KAF A;  4C8Q F;  3L2Q A;  2CIM A;  3X24 B;  2OTJ A;  1VQ6 T;  3SFM A;  1FXX A;  5IT9 E;  3CCR A;  4LNS A;  4A4F A;  2KQW A;  1KG1 A;  1Z7N A;  2ZT7 A;  2MWO A;  3QSU A;  2R5A A;  1NJ2 A;  5GMK e;  3N5B B;  4C5G A;  1M1F A;  1D3B B;  4O5V A;  1Q81 C;  4MZT A;  3M56 A;  2CZ1 B;  1KQ2 A;  5I2M A;  4NOY A;  3OBW A;  4M7A C;  2QI2 A;  2QHT A;  3V7S A;  4C92 A;  4M78 G;  1X54 A;  4ME7 A;  1X01 A;  1Q82 U;  4N4H A;  4ZTJ A;  3WQZ A;  3FEO A;  3HXV A;  3RIR A;  3KFU A;  4ZTF A;  5D6Y A;  3MF1 A;  5A0L A;  4BY6 B;  3FIF A;  4N4G A;  1YIT T;  1KC8 U;  4QQG A;  2X4Y A;  3QII A;  1QVF S;  1Y7X A;  3ZBD A;  3OY9 A;  2DTH A;  2EYQ A;  3CCJ A;  1BBU A;  3NEM A;  3GPL A;  3FDR A;  4C8Q C;  4LDV A;  5KCO A;  5DY9 A;  1RL2 A;  5LJ3 g;  3ICA A;  1E22 A;  2RHZ A;  1FWZ A;  3J81 E;  3HKS A;  2K57 A;  2XHC A;  4XAX B;  4MML A;  3NFC A;  2OAU A;  1WJS A;  1KMM A;  2EJG A;  2XIC A;  1SER A;  2MF2 A;  3MEA A;  4M7A G;  1N9W A;  1EIY A;  4CH4 A;  1UEB A;  3LYI A;  1W66 A;  2XG8 D;  3GIB A;  3P8B B;  4OP0 A;  4XEM A;  3CC2 T;  1PYS A;  2ZT6 A;  4OB1 B;  3OYF A;  3VJP A;  3CCL T;  3E9G A;  5FU6 B;  2JTF A;  3TEE A;  4VUB A;  2EQU A;  1OYX A;  2PVG B;  2YHT A;  3C95 A;  2EFI A;  2YLB A;  1LNX A;  5FRO A;  2D0Q B;  1WNL A;  4EX5 A;  3DLM A;  2LQK A;  3S3N A;  4IUU A;  5GAN h;  2A8E A;  4HCZ A;  5C52 B;  3MEY A;  3HY1 A;  1Q82 C;  1K9M U;  2PVO B;  2I4N A;  2RO0 A;  1YCY A;  3KXT A;  4BUG A;  4YPF A;  4J8O A;  3OBY A;  1VQM T;  3CXC S;  4HT9 A;  4JRQ A;  1X75 C;  5LJ5 h;  4ZN1 A;  2R58 A;  3LWI A;  3HXY A;  4KUI A;  3CCE A;  2HAX A;  2MAM A;  3JCM J;  2YLC A;  1USY A;  1N8R C;  3OYI A;  4PJO C;  2RHU A;  5FU7 C;  2ZZF A;  2VGN A;  3FB9 A;  4DOW A;  1OZ3 A;  2JOY A;  1E1O A;  1H4V B;  3IKL A;  2QEX A;  1OZ2 A;  4IUQ A;  1VQ4 A;  4RKU E;  5GAO r;  3ZEH A;  2RK1 A;  4KR3 A;  3VUB A;  1U8R A;  2QQR A;  4J5Y A;  4YRL A;  3UDC A;  3JCM e;  3GF5 A;  5GAO l;  3RES A;  3ER0 A;  2DPP B;  4II1 A;  1KOG A;  2O01 E;  3A5Z B;  4V2S A;  3NTK A;  3LC0 A;  3AHU A;  2XU8 A;  2LX9 A;  2Q5H A;  2I4M A;  4MDW A;  4MMK A;  4IKF A;  2G4C A;  4YDQ A;  3VQX A;  2AKW A;  4M77 B;  4HWT A;  4P5N A;  3HP9 A;  3RF1 A;  3HFO A;  4C8Q E;  2JZ2 A;  4O6J A;  3M53 A;  2ZCE A;  4M77 G;  4XQ3 A;  4JDS A;  5GAM h;  4R56 A;  5D6W A;  3QXE B;  3L4G B;  2QQA A;  3JB9 I;  1X2H A;  3NET A;  2AKW B;  1XNI A;  2HQX A;  3CCJ T;  2V8K A;  4QQ6 A;  3TUP A;  1VQK A;  4BDZ A;  2GCX A;  2CZ7 B;  4M7A B;  3CBO A;  1Y07 A;  4LD6 A;  3OYL A;  4PJO A;  4ZTU B;  1QP3 A;  3QO8 A;  4OVA A;  2XDD A;  2DZ9 A;  2KK4 A;  5DM7 R;  1SES A;  1ADJ A;  4H2T A;  12AS A;  2LT1 A;  3OYC A;  2FL7 A;  1VQO T;  1UGP B;  1GXI E;  4DQ2 A;  3JCM b;  1YJN T;  4M75 A;  4XU2 A;  1YHQ A;  2RA2 A;  11AS A;  2DU5 A;  3OS1 A;  4OF1 A;  1U1T A;  3OB9 A;  5GAN 6;  4Q6G A;  2RI2 A;  4IUV A;  5LJ5 e;  4CH3 A;  5CAI A;  5GAM f;  1ATI A;  3CCL A;  3MHX A;  3C12 A;  2PMF A;  3INZ A;  4DOV A;  3P8T A;  2IY5 B;  4X9D A;  1EVL A;  2CZ0 B;  4J15 A;  4ATO A;  1KQS S;  4DPG A;  2PME A;  4TVA B;  3PIP A;  2QA4 T;  1EIF A;  3FJP A;  5LL6 S;  3R07 A;  3L2Z A;  1NJI C;  4M78 D;  1ZBX A;  2IY5 A;  5CKH A;  5GAN e;  3QBY A;  3JCM g;  2OTJ T;  3G4S A;  3CME A;  3REU A;  1QVP A;  1X56 A;  3OYY A;  4C92 B;  4BAC A;  1VQL A;  1IL2 A;  3M59 A;  3G1Z A;  2Y4Y A;  4F7U G;  2VV5 A;  2ZTG A;  3P8Y A;  3M9Q A;  1NYR A;  4PLI A;  4M78 A;  3I56 A;  4H02 A;  2X4W A;  3S6W A;  3I7F A;  1YIJ A;  4ZGD B;  2QQS A;  3M54 A;  4N0A A;  3HXX A;  2ZPG B;  3CCV A;  4K87 A;  1L0W A;  4JRI A;  4Z02 A;  4H2Y A;  2RJD A;  4BI4 A;  1VQP T;  2NS6 A;  3A8G B;  1YBY A;  2I2L A;  4LDY A;  4A53 A;  2DD4 A;  3QKJ A;  3LGL A;  3VBB A;  3A5Z A;  1RI0 A;  3GNF B;  3BFM A;  4P75 A;  2WSE E;  1NE8 A;  1JJC A;  1UGR B;  3JB9 H;  3CC7 A;  1Q7Y C;  4P71 A;  5KE3 A;  4G84 A;  2O4X A;  3HRU A;  1JJ2 S;  1ZQ1 A;  2WSC E;  4BE1 A;  3A7A A;  3CBM A;  1W2B S;  1VIE A;  3HFN A;  2DTO A;  5GAN 7;  4L87 A;  3OS0 A;  4A4K A;  4P75 C;  4C0D B;  4EMG A;  1JJC B;  2ZPF B;  3CCQ T;  3X20 B;  3HXZ A;  4M7D D;  2F69 A;  3LWH A;  3T9N A;  2G3R A;  3PCO A;  4FU6 A;  4BD3 A;  2K3Y A;  4OLF A;  4KUD K;  3E1S A;  4WJ3 M;  4LVL A;  1XQH A;  4PJO D;  1NJ1 A;  2LTO A;  1WQ7 A;  4JJN K;  2Q5I A;  2D9T A;  4P3N A;  1YFS A;  1B7Y B;  4M7D A;  3M4Q A;  4M77 E;  1B34 A;  2XKO C;  2JNG A;  1H3Z A;  2DO3 A;  1VQK T;  3HFZ A;  1NJ8 A;  5CKE A;  1IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...