4XU3A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 92
structure length 263
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu3A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu3A01
2I4OA 2DTOA 4MMLA 4X9DA 4XU3A 4PNOA 4EMKB 4KR2A 2I2LA 4C8QF 3FIFA 5LJ5d 3VU3C 4M75B 3P8YA 3MEYA 4TTVA 4YRRA 4G84A 1L0WA 4JLIA 3A7UA 3HY0A 3SWNA 3JCMW 3L2ZA 3A5YA 3CMQA 1YFRA 2RD1A 1BIAA 4RDXA 3I7FA 4C92B 1NJ6A 5GAOl 4YRIA 2E5AA 3BW1A 1SERA 3QNEA 2P0LA 3V7CA 4QVDA 3V7RA 5LJ3e 4K88A 4H2WA 2I4MA 3TUPA 3JCMe 3JB9F 4PG3A 4M7DA 1WYDA 1H4SA 5LJ5f 2ODRC 4PHCA 1G5IA 1M5Q1 3QUIA 2E10A 3RF1A 4CH6A 4M7DD 2AMCA 5E3IA 2I4LA 3KFUA 1PYSB 3HFNA 1KMMA 5LJ3j 4PJOC 1WPYA 3JCMJ 3MF2A 3HTZA 3VQYA 4M7AF 3E9HA 2DVEA 4O2DA 4CH5A 4XTWA 2DTHA 3SWNC 4M75E 3JCMg 3JB9D 4XU1A 2VC8A 4RQFA 4C92F 2ZXFA 4PJOD 2ARSA 1PYSA 5GAN5 4XTZA 3P8TA 5GAOm 4H2XA 1YB3A 2IY5A 3M4QA 3MF1A 4XEOA 1KMNA 3PCOB 3QO7A 1D3BA 5LJ3d 3UGTA 1N9SA 2DZ9A 3HXWA 4J6WA 1HTTA 2CJBA 3TEHA 1WU7A 4HWRA 1WQ7A 5LJ5h 3VQXA 1Y96B 1KQ1A 5GANg 4N0AC 2QHUA 4YREA 3JCMc 4C92A 4M78C 2VXFA 3BY7A 4C8QD 1M8VA 4P3OA 4PJOE 2EJFA 5C52B 4P71C 3BFMA 1B7YA 1NJ8A 2YLBA 3QO3A 3LC0A 2FYKA 4NL3A 4XTXA 4F7UF 5GAMf 2DXUA 4XTYA 2FB7A 2ZT6A 2RHSA 2JN0A 1I4K1 4TVYA 4UP8A 1SETA 4K87A 3EFSA 3RIRA 1QF6A 3A31A 4H2VA 4YRMA 2Q7EA 1HC7A 2DJZA 4EMKA 2XTIA 4Q15A 1EVLA 2ZIOA 3NEMA 2DZCA 3ERRA 3VQWA 4ZIBA 1BBWA 3TEGA 1LNXA 4M77E 2ZR3A 4XU0A 3A5ZA 4P75C 4CS2A 1X55A 1YFTA 2ZTGA 1EQRA 2ZT5A 3E9IA 4HT9A 1ATIA 4TVAB 5DY9A 2EAYA 4DPGA 4NCXA 3VQVA 4M7AE 4EX5A 1YCYA 4M78A 4M7AC 4KR3A 5GMKe 1YGBA 4YRJA 5I21A 4P73C 4YRNA 1B70B 4J6XA 1ASYA 5LJ3h 3M4PA 2QHVA 2DU7A 3AHUA 4YROA 4UP7A 4M7DG 5GAN8 2ZCEA 4TQFA 2EJ9A 1FYFA 2E41A 3VBBA 2J3MA 1WQWA 1EOVA 4CH4A 2ZT8A 2EJGA 4YRSA 5GMKj 5GAN2 3RACA 1Y96A 2DEQA 2VXEA 1BIBA 3RESA 3G1ZA 1X54A 3V7SA 3JB9I 5GAOn 2ZZFA 3L1AA 3RGLA 5GANh 2Y90A 4J5YA 3JCMh 3JB9G 3HXXA 3IKMB 2IY5B 2RHSB 4XTVA 4PJOG 4M77B 5GMKl 5GANj 3GIBA 3OD1A 5GAMj 2RB6A 2EL9A 2ZINA 4YYEA 3JCMQ 3JCMd 4P74C 4OP0A 2CIMA 5GAN3 1NJ1A 4H2YA 4H2UA 4LNSA 3HSBA 4NL2A 4RCCA 4XTUA 4C92G 2PMEA 3HFVA 2DU5A 4HWOA 4M75F 1LJOA 3TEHB 1H641 2C7IA 3RKXA 5GANe 4KQEA 4YRGA 4G85A 4F7UG 1D3BB 3A7RA 3PCOA 3QTCA 2HNIA 4M7DC 3ICAA 2C8MA 3LSSA 3JCMb 4M7DB 1GGMA 2ODRD 4M75C 4ZTUB 2P5IA 2E64A 4E51A 4M78G 2DQ0A 3A74A 4NOYA 5C53B 12ASA 3PGGA 5GAMh 5GAMd 4M78E 1YFSA 5GANd 1NNHA 1NYQA 5ELOA 1KQ2A 1ADJA 4BW9A 4RCBA 3RKWA 4YRCA 1N9WA 2ZR2A 3DSQA 4YRTA 1SRYA 1JBMA 4PJOF 2QTXA 4P3PA 4CH3A 4PJOB 4M77G 4H2TA 1H4VB 1X56A 3QSUA 3JCMP 4M77A 2YHTA 3IG2A 4X5OA 3LSQA 1EVKA 5LJ5g 5GAN6 2CJ9A 2ZIMA 1B8AA 4C92C 3HFOA 2ZZGA 1HK9A 4V2SA 2ZZEA 1ADYA 4HWPA 4YCWA 4AH6A 4A53A 3REXA 5GMKm 4Y91A 5GANf 1QE0A 3SB2A 4YRKA 2ARUA 3HXYA 3M4GA 5GAN7 5GAOr 1WNLA 4XQ3A 2RA2A 3BJUA 4N0AA 4JRKA 1BBUA 4F7UB 1LOJA 3EFRA 1B34B 3SWNB 1E1OA 2ALYA 1X2GA 4M75D 2Q7HA 4P72C 5CAIA 2PMFA 4YP0A 4P71A 4M78F 3QO5A 4HT8A 4Q6GA 4M78B 4M75A 1KOGA 5LJ3f 3IALA 3JB9J 2RHQA 4F7UA 4H02A 4TWAA 3HY1A 4YPFA 5LJ3g 2E1HA 4M7DF 1I8FA 3RERA 4XU2A 3BDUA 4M7AB 4P73A 4C92D 1I5LA 1LYLA 1H4QA 3JB9H 4X9CA 2CGHA 4M7AG 4M77C 4TVWA 3QO8A 3UGQA 11ASA 1SESA 3A32A 2ARTA 3PZCA 3R07A 3WQZA 2Q7GA 5K1PA 2ZNJA 1EIYA 3V8KA 3HXZA 2E3CA 4PJOA 1E1TA 3V8JA 3NENA 1B7YB 4L87A 5GAOp 1NJ5A 1Z7NA 4YDQA 4C8QB 1NYRA 5GAMe 5ELNA 4H2SA 4F7UE 5GAOq 4BWAA 4M78D 4YRQA 5F5WA 3HFZA 3L4GA 4EO4A 4YCVA 4YRPA 2DTIA 4P72A 2QHSA 3V8LA 4C92E 2CJAA 4J15A 4ZTZB 2AKWA 3RL6A 4QVCA 5C51B 4HVCA 1NJ2A 4K86A 3REUA 4H2XB 3QHSA 1J5WA 4WJ4A 4WF2A 4M77D 2AKWB 2Q5IA 2DKGA 1JJCA 4XEMA 5GMKh 2RM4A 2E65A 4CS4A 4RQEA 1W66A 3L4GB 4C8QE 4C8QC 1USYC 5K1XA 1WLEA 4J6YA 4P74A 1EFWA 2XGTA 2DQ3A 1JRIA 2EWNA 3JCMX 3UFGA 2I4NA 4YRLA 1B76A 3HXVA 1C0AA 4CS3A 3W3SA 3NETA 3P8VA 1I81A 2QHTA 3HRIA 1JJCB 3HRKA 2AMCB 2DDZA 1TH7A 1EIYB 4M7DE 1U1SA 3A7AA 3NELA 1ASZA 2K57A 4YCUA 4M75G 4UP9A 5KNNA 3UH0A 4HWSA 4HA8A 2ZT7A 3RKYA 3HXUA 4TQDA 3JCMf 4P75A 1MGQA 2YLCA 2DXTA 1VQZA 1X01A 3HFZB 1RIQA 4P3NA 1IL2A 5GMKi 4YRFA 4JRIA 3JCMV 4OLFA 1H4TA 1X2HA 4EMKC 5LJ5j 2ZNIA 1G5HA 4C8QA 1USYA 4WI1A 1Z7MA 2RHQB 1G51A 2Q5HA 4EMGA 3FB9A 1B70A 4MMKA 3RUXA 4EMHA 2J3LA 5HGQA 3FJPA 4JUVA 4RMFA 4DQ2A 1E24A 4M7AD 2ALYB 1HXDA 1E22A 1B34A 1N9RA 2ZGWA 5GAMg 4HWTA 1U1TA 4TVAA 4M77F 3IKLA 2G4CA 4UPAA 4WJ3M 5GAN4 4M7AA 5LJ5e 4C8QG 3INZA 4A54A
chains in the Genus database with same CATH superfamily
3CC4T 1KD1C 3CXCP 1VQOA 1NJIU 1ZSGA 4X9DA 5CVIA 2DRMA 4BUGA 1ZUKA 4E7JA 4VUBA 4EMKB 4ZTFA 2LQNA 2X4YA 2V1QA 2I2LA 4ZNXA 3SEMA 1QQJA 3REBB 1H8KA 3EG1A 2OTJQ 1G8XA 1M1GA 2P0PA 2QASA 4FM4B 4WCIA 2D1XA 4RMOA 3OY9A 2JVVA 2QQAA 5CO7A 1QCNA 1ZUYA 2Y4YA 1VQ6Q 4G84A 1M3CA 1M4ZA 3SWNA 1ZA1B 3L2ZA 4ELZC 2DEUA 3CC7T 2MMPA 2ZPGB 3CMQA 2E70A 2OJ2A 3META 4MZPA 1BIAA 5AYFA 4LVIA 1S72T 2J06A 1VQMA 2RHIA 4DOWA 2JOYA 4J9HA 2OTLA 2FZCB 2E5AA 3CC2Q 1V29B 3V7CA 4B9XA 3V7RA 4K88A 3JCMe 3A8GB 3NTHA 3QPHA 5FWBA 1WXBA 1G2BA 1H4SA 4O5VA 1UGQB 2K9GA 1VQPT 2A08A 2QYZA 1G5IA 3QUIA 3RF1A 3KFUA 2ROLA 1OI1A 1Q7YU 1VA7A 2GQIA 2EW3A 1WIEA 4E47A 1J3TA 2MAMA 4XTWA 3IQLA 1YITQ 4AMCA 4JJBA 3L2QA 1U5SA 5LL6S 4C92F 3OYEA 4J9IA 2KY9A 1KG1A 2FEIA 4KH0B 4DOVA 1K73R 1PYSA 4OB1B 1IRXA 2F2WA 3H9NA 3CCEA 2NYSA 1YB3A 1VQOQ 3E9FA 2YRDA 2IG0A 2DYIA 2ZZDA 3M56A 3MEAA 1WHKA 3HXWA 1Z9QA 4ORZA 2M1HA 4KGZB 1WQ7A 3VQXA 3GPLA 1QVGS 2KEAA 1QKXA 2O4XA 3E1SA 5A0DA 2HKNA 2M02A 4F17A 1A0NB 4C92A 3J80E 2VXFA 2G3RA 4C8QD 1M8VA 2DIGA 4KBMB 3UA6A 1KJWA 3UDCA 2WSFE 3BFMA 1QWFA 1SG5A 1NJ8A 3LC0A 2PUKB 2JS2A 2FYKA 2SEMA 4NL3A 3S3MA 4XTYA 2FB7A 1RADB 1YJ9Q 4UP8A 1JO8A 4K87A 1GFCA 2HAXA 2Q7EA 5IAYA 4Q15A 2EKHA 2HCKA 2DL5A 4B6MA 5A2QE 3VQWA 2NLUA 1BBWA 3TEGA 1LNXA 4ZIBA 3A5ZA 2HQEA 2ESWA 4IIMA 3A5ZB 2HL5C 1X55A 1YFTA 1M1KR 2ZT5A 3BDLA 3DKMA 1ATIA 3M4YA 4OF1A 2X3XD 2KYMA 3TSWA 4NCXA 1K9MR 4M7AE 4CRIA 3QZ9B 1OX9A 1XOVA 1NYGA 1B70B 1YJWT 4J6XA 3H6ZA 5LJ3h 1NZ9A 5CKEA 2QHVA 1N8RU 1TS9A 3AHUA 1TXQA 4OGCA 4YROA 1DJ7B 1T0HA 1Q82R 2K6DA 2E41A 3VBBA 5HY6A 1EOVA 4BB7A 5GMKj 2DX1A 1VQ5T 5GAN2 4J9BA 1Y96A 2LX9A 3CC4A 5FRMA 3G1ZA 3EHRA 4JDSA 3V7SA 1YP5A 3JB9I 5GAOn 2KVQG 2ZZFA 2VUBA 2RI2A 1F1BB 2BTTA 5GANh 1QVFA 3JCMh 3JB9G 1FMWA 2M51A 1NEGA 3PTAA 4M77B 2LQKA 3VUZA 1M1KU 3GIBA 3OD1A 2P0QA 5GAMj 2RB6A 1LPLA 2EL9A 4YYEA 3NFCA 3JCMd 3EH2A 5GAN3 3ASKA 1OZ3A 3GP8A 3EGDB 2OAWA 3C94A 3HSBA 2JZ2A 4FSSA 1W2BP 1SF9A 1ZSZA 5FU7C 2YRCA 2MF2A 1YJ9A 3MP6A 2QDLA 1VQ9Q 1G83A 2KR3A 3TEHB 4JRQA 2C7IA 3CCUA 3HRTA 1QWEA 4LVJA 4KQEA 4A54A 4J9EA 2HKQB 2QDYB 1D3BB 2AK5A 3PCOA 3EGXA 3ICAA 4LDVA 3PIPA 1GGMA 4ZTUB 4KGVB 1MMNA 2YUPA 4E51A 3P8DA 3A74A 3PGGA 4M78E 2KMTA 3PFSA 1NNHA 2H3JA 2KQWA 3GNGA 3I56Q 1KQ2A 2B8AA 3DLMA 1KC8C 2RNAA 1M90R 1ADJA 1LVKA 1KK7A 1O9SA 3DSQA 1SRYA 2QTXA 2EGEA 5AT1B 4PJOB 1K0XA 3HTRA 4M77G 1VQ4T 2ZPFB 3M57A 3JCMP 2YHTA 5EC7A 4C5IA 5GAN6 2QQSA 2ZIMA 1R0BG 1G3WA 3HFOA 4JRPA 3C95A 3OW2A 4BD3A 4AH6A 2EYZA 2A37A 2OX7A 4A53A 4JJDA 5GMKm 2ZPBB 2F69A 1Q81U 1MUZA 4YRKA 2ARUA 4RTTA 3VKIA 3M4GA 3CCSA 1WNLA 3BJUA 4N0AA 1BBUA 2LX7A 3EFRA 1SSFA 4JJCA 2YUOA 3CPFA 1E1OA 4NS5A 4P72C 2XDPA 4YP0A 2V8JA 1R8OB 1VQ9T 1AWOA 2RK1A 3OYBA 1Z9ZA 2EYYA 3EG9B 2RN8A 4M75A 4J9DA 3IALA 4HVUA 2CUDA 1IREB 1WXTA 2RQWA 1ZBXA 1UHFA 1X43A 3M0TA 3MQZA 4TWAA 1PSEA 3CCVT 3HY1A 4YPFA 1OZ2A 5LJ3g 1ZA2B 4M7DF 1I8FA 3A8OB 3VS2A 3RERA 2FG0A 3M0PA 2RHXA 1PD1A 4LDUA 4XU2A 1MHNA 3UT1A 3LGFA 2CS7A 3NHNA 1PD0A 3VS0A 3JB9H 5KYWA 4M77C 1UTIA 1WHJA 2CP3A 1Q81R 4C0FA 4LUEA 1PM3A 2K2MA 2QQ9A 2VVKA 2ZNJA 3HRSA 3V8KA 3X20B 3CXCS 3OW2S 3VRYA 4J9FA 2RK2A 4PLLA 5GAOq 1U3OA 3GNFB 4E7LA 1TU0B 1PC0A 3CPWS 2ED1A 1RAAB 1ZBJA 3UF4A 1VQ5A 1WZOA 2QHSA 4P72A 3V8LA 2CJAA 2Z0WA 1M90U 4QVCA 5C51B 2QGGA 3VUBA 1NJ2A 1VYVA 4EPCA 3REUA 2NUTA 3HPWA 4WJ4A 4WF2A 4M77D 2O31A 3I5RA 4XEMA 3H41A 1JJ2A 1K0SA 3L4GB 4OVAA 4C8QC 4J6YA 4LD6A 2XGTA 2DMOA 2EWNA 2EVRA 2GTJA 2KDSA 2KROA 2I4NA 2F5TX 1XJWB 2NWMA 4A4GA 2RJDA 1PKSA 1JQQA 2K79A 3GOXA 2L8DA 2E6ZA 2J7IA 1JJCB 2GQVA 2DDZA 2GNCA 3A7AA 1JXMA 5KYYA 1TOVA 1YN8A 5KNNA 3UH0A 2JJ9A 4HWSA 2JXBA 4HVVA 3OYJA 5FWCA 4RTYA 4BDZA 3HFZB 5A0GA 1RIQA 3UATA 2GTOA 2JT4A 2XIDA 4P3NA 2DD4A 4F14A 4A4HA 4Z8AA 4EMKC 2ZNIA 2LDMA 4PJLA 5CQXA 2YRVA 1G3TA 3FB9A 1QVFS 3CD6Q 1VQ6T 1PHTA 1GXIE 4M4ZA 2V26A 2ALYB 4FCYA 1HXDA 3CMAT 2KT8A 4JLGA 2ZGWA 4HWTA 4QQ6A 4TVAA 4M77F 5KYUB 3X26B 4M7AA 4AT1B 4C8QG 1K8AC 2I4OA 3VS4A 2DTOA 5CK9A 2HQXA 5HK0A 4XU3A 3NTIA 2A8EA 2CZ0B 3S6WA 5KE3A 1T3SA 1X69A 2CREA 4KR2A 3KXTA 4C8QF 2EKOA 4FW1A 4M75B 4ELYC 1W2BA 3CCSQ 3P8YA 3LW5E 2NUZA 1M2VA 4LDYA 4RTXA 4KUDK 3OBWA 1ZSZC 2CT3A 3CCJQ 3MJXA 2RD1A 4RDXA 3VRZA 1X75C 2XI9A 1VQ4A 4DBFA 1C1AA 4BDYA 3QWYA 4YRIA 3QNEA 4QVDA 1YWPA 3X25B 3EFOB 1I0CA 1XQHA 1SSHA 3M0UA 2E5QA 3I55A 1TTHB 2DXCA 2ODRC 1ZX6A 2DBMA 1M5Q1 5CIUA 3PE0A 1QVGA 4M7DD 4CH6A 2C06A 2I4LA 1PYSB 4HCZA 3CD6T 2JUFA 3KBGA 4LE9A 4PJOC 1RI9A 3MPUB 3E9HA 3DB4A 4O2DA 3PMIA 2E6NA 4OMPA 4M75E 4C0DB 4LN2A 3JCMg 3JB9D 4RQFA 3OYAA 1GCQC 2ZXFA 3NPFA 4PJOD 2R58A 3SHWA 5GAN5 1H3HA 2MYSA 2ZPHB 4FYWB 1BCOA 1NYFA 2FRYA 3RR6A 3CCMA 3VS7A 4XEOA 1KMNA 3PCOB 4PLIA 4X1VA 1D3BA 4O6JA 1N9SA 3CC4Q 4J83A 2DL7A 1BBZA 1VQ5Q 2CJBA 3TEHA 2DXBA 4N0AC 1K76A 3NGPA 3JCMc 2MI6A 1EX4A 1OYXA 4TVRA 2X4XA 3AT1B 2KT1A 1B7YA 4XTXA 5GAMf 1YIJA 2DXUA 4HT4A 1I4K1 1D0ZA 4TVYA 3M0RA 2SRCA 4YRMA 1HC7A 4EMKA 5I2MA 4IUUA 2XTIA 3NEMA 4FIBA 3I55Q 3M0QA 4K11A 5CCAA 4M77E 1AVZC 2ZR3A 1LCKA 4ME7A 5IN1A 3PNWC 1KFZA 2ZPIB 1RAEB 3E9IA 3JAME 5DY9A 3S3NA 2BE9B 3G7ZA 2JTEA 1X6GA 3PVQA 1D09B 2EIFA 1AT1B 1GBQA 4KR3A 2YWWA 1YHQQ 4DBQA 1OPLA 1QKWA 1ASYA 5J3BA 1UB4A 1G5VA 1Q86R 1KD1U 4UP7A 4M7DG 2A36A 4RG2A 2EJ9A 4ZN1A 5HCKA 2RHUA 4FL6A 2HMAA 1BI0A 1OEBA 4YRSA 4PKCC 1BIBA 2PVDB 1W4SA 4HCKA 2LNHB 2EGAA 2Y4XA 2R57A 4FSXA 2Y90A 1JJ2P 5ECAA 2IY5B 1MV3A 2NS6A 2XU8A 1PNJA 5CQYA 5GANj 3A8HB 4EDUA 4PJMA 3CCQQ 1D0YA 2MIOA 2CIMA 5CKHA 1X2KA 4H2UA 5C0MA 2OTJT 1Q82C 4RCCA 1JU5C 3CCRA 2PMEA 3HFVA 1VQ6A 2BKDN 1MMDA 4E7ZA 1CKBA 1OV3A 4M75F 2DD5A 3URGA 2L89A 5GANe 8ATCB 3REAB 4F7UG 2EGCA 4HCCA 3G71Q 2KI7A 2HNIA 2DE0X 2C8MA 3JCMb 2C0OA 2VV5A 4M7DB 1M1KC 3ZL7C 1VQKT 2CSIA 2VGMA 2DQ0A 1RAHB 5CKDA 2RPNA 4E7SA 12ASA 4IUTA 1IHVA 1YFSA 4AFUC 3CD6A 4QW2A 4Y92A 1NYQA 3SDZA 4LNPA 4E7KA 3WVEB 1UG1A 1VQNQ 3G1JA 4YRTA 1JBMA 1P92A 5GJWB 3QJ6A 4P3PA 2DO3A 3TQ7P 4CH3A 2CH4W 2AZVA 2FO0A 2X9HA 1H4VB 1Y07A 1PRMC 5LJ5g 4IUVA 1IGQA 5IHKA 2ZZGA 3L2UA 1ADYA 2ZZEA 4YCWA 2LTOA 2CH4A 1SKUB 4QT7A 3A98A 4ATOA 4PK4A 1QE0A 2COWA 2L2PA 1I5OB 2CT4A 2RA2A 3FC3A 2FPEA 2XD0A 4J7IA 1B34B 2PTKA 2DNUA 4OB0B 5FLXE 2ECZA 2XG8D 4M75D 1K73C 2PMFA 4P71A 4M78F 4HT8A 2V8IA 4Q6GA 2LJ1A 3JB9J 2RHQA 1K1ZA 1KQSA 4DEYA 4XAXB 2CDTA 3OS0A 2K7AA 2LP5A 2L3QA 4CC4B 3QDRB 3THKA 1YJNQ 4RTZA 3CMAA 5IH2A 3BDUA 2QI2A 1RLQC 1VQMT 3OS5A 2K3XA 4C92D 1LYLA 4ZTJA 2K5IA 5HKCA 3CCST 1ZQ1A 2AT1B 2CGHA 4TVWA 1NM7A 1SHFA 2KXCA 5FU6B 2PVGB 4JJNK 1SESA 4LDXA 3A32A 5FU6C 2R5MA 1FWZA 4BE1A 3L2RA 3T9NA 2E3CA 3CMET 3V8JA 4PJOA 1B7YB 5GAOp 2EQIA 1Z7NA 1C6VX 2HDAA 2VASA 5ELNA 4H2SA 1VUBA 1VQLT 2IVWA 5KCHA 2LC4A 4M78D 4FT2A 1M8MA 3FDRA 4J15A 2LQ8A 3QJYA 3RL6A 2D8HA 5DM7R 2HQHA 5CR2A 4HVCA 1U06A 3OS1A 1TUCA 1Y7XA 1IHWA 2D9TA 1J5WA 5GJVB 2DKGA 1JJCA 3ER0A 3QIIA 2QQRA 4CC3A 1W66A 4A4EA 3OSSC 4C8QE 2V8KA 1EFWA 2QA4A 4P74A 1JRIA 3JCMX 4OGEA 2D6FA 1WI7A 2RHYA 1YITT 1B7TA 2FPDA 3OYNA 3HXVA 1C0AA 2V1RA 2I0NA 3CCRT 4CS3A 3W3SA 2ATCB 1I81A 5A0LA 5D6WA 1TH7A 1TUDA 2QGFB 3NELA 4YCUA 1AZEA 1OOTA 1ZHIA 4JPBW 5CKBA 2ZT7A 1QVFP 3FJ5A 3HXUA 2BIVA 3TEEA 1RUWA 1K9MU 2YLCA 5IXFA 1VQZA 1FMVA 1UGPB 2RJCA 3G71A 2CZ1B 2GCXA 1IL2A 1YHQA 5GMKi 2HBPA 2DBKA 3M0SA 3JCMV 4OLFA 1HYOA 3MEWA 5LJ5j 1USYA 4GY5A 5KH6A 3OYLA 1G51A 1B70A 3OYMA 2RMOA 4KT0E 2J3LA 5HGQA 4CC2A 1EIFA 1E24A 4M7AD 4KGXB 1PCXA 1GCPA 4FYVB 1IB8A 1ARKA 1KIKA 2J6KA 1Q81C 4UPAA 3IKLA 1AD5A 1VIEA 5GAN4 2CZ6B 5LJ5e 1R77A 3INZA 4MMLA 1WJQA 3FRNA 2CSQA 3RMSA 2ABLA 3MP1A 1PKTA 4PNOA 4E7IA 1GFDA 2XDDA 5IHIA 3U23A 2FZKB 1VIFA 5LJ5d 3VU3C 2GF7A 4RTWA 1BI1A 3MEYA 4TTVA 2RQUA 4E7HA 2FVUA 1X2QA 1L0WA 4JLIA 1GL5A 3A7UA 1M1FA 4N4IA 3JCMW 2YDLA 2L3PA 1YFRA 1TUGB 1I07A 1WHMA 2EQKA 2QTVA 1K8AU 1X6BA 3QDFA 1MV0B 1RABB 4XK8E 3MCAB 2P0LA 2IIMA 2O9SA 5LJ3e 2QEXA 3EAEA 4Z88A 2YXYA 1UEBA 1KD1R 4M7DA 3E2UA 1WYDA 2XHCA 2CP5A 2HD0A 1VQPA 2H8HA 1K73U 2DJQA 5L23A 5DLQE 2AMCA 5E3IA 1QCFA 3UWNA 1FX7A 3HFNA 1VQNA 1OU9A 1KMMA 1YBYA 2WSCE 5LJ3j 2O88A 2GFAA 3JCMJ 3CMEA 3CCLQ 1KQSS 3HTZA 1Q7YC 3VQYA 2DVEA 4IIOA 5KE2A 4CH5A 2DTHA 2MPXC 1JJ2S 3HL8A 2BUDA 2KSSA 3EG2A 3G4SQ 4XU1A 1M90C 2K3BA 2VC8A 1BCMA 1BK2A 2ARSA 1B07A 2GFUA 2ZPEB 1D1AA 4XTZA 4BI3A 3P8TA 5GAOm 3OA6A 5FU7B 1VQKQ 2P4TA 2A28A 3EGXB 5KYNA 3QO7A 3J7AF 3VS5A 2LNVA 1N27A 1HTTA 4LVKA 1ABQA 5LJ5h 3EFOA 1K8AR 1Y96B 1OULA 3I9QA 1D1CA 5D7UA 1KQ1A 3VJPA 2OTJA 2COYA 5GANg 2DFUA 3L42A 4M78C 3FEOA 2KAFA 4PJOE 2QG9B 3CCQA 3OYIA 2DL3A 1N8RR 1QP3A 3C4SA 2XK0A 2YLBA 2QA4Q 3MHXA 2W0ZA 4F7UF 1V76A 2YUNA 3E9GA 2ZT6A 2JN0A 1YJNA 3CC2A 3NTKA 2MWOA 3EFSA 1VQ9A 1QF6A 2DA9A 3A31A 4H2VA 3SD4A 4HVWA 2DJZA 1EVLA 2ZIOA 2FHDA 1TWBA 2E5KA 2EYQA 3HRUA 2B86A 3LGLA 2YUQA 4BI8B 1OU8A 4CS2A 2M9UA 3H8ZA 2DYBA 2ZTGA 1AWWA 3VYGA 2KE9A 3CCLT 4HT9A 2D0QB 4TVAB 3JV3A 2BZ8A 4CC7A 3VQVA 4M78A 4MZMA 3DLLA 1X6OA 1VQLQ 1YGBA 1N8RC 2PQWA 4YRJA 5I21A 4P73C 1IXDA 2H3EB 2JMAA 2LVMA 2X35A 1YIJT 1VQOT 3PIOA 5GAN8 3GBQA 4LDWA 2DVJA 4TQFA 1K9MC 3X24B 1FYFA 2J3MA 3MEUA 2ZT8A 2EJGA 1AEYA 1C0MA 2VYTA 3RACA 5L8RE 2VXEA 3RDVA 4C0GA 3D7SB 3VS6A 1SRMA 3CC2T 1BKBA 3L1AA 2KRMA 3RGLA 3HXXA 3IKMB 4XTVA 4PJOG 2XICA 3CC7A 4C0DC 1YHQT 5GMKl 2CP7A 3M58A 2ZINA 4OB2B 3JCMQ 3JRZA 3TSZA 2F2XA 4JZ4A 4P74C 1CKAA 4QQGA 4H2YA 4LNSA 1WFWA 5IHNA 1SHGA 4XTUA 4C92G 4EIKA 1WHGA 1W70A 1ABOA 1UGRB 1YWOA 1YJ9T 1VQ8A 2ROTA 4HWOA 4MDXA 1LJOA 2CP6A 1H641 2DLPA 2DF6A 1Y0MA 4YRGA 1S72Q 2QEXT 3LWHA 3A7RA 3NMZC 4OMFB 4LVMA 4M7DC 5M9OA 1NLPC 4BE0A 3LSSA 2J05A 2ENMA 2ODRD 4M75C 2J6FA 3GF5A 5EG2A 1PSFA 4FT4A 1AHJB 1N5ZA 1VQPQ 5C53B 4PFOA 5GAMh 1I1JA 2EQUA 5GAMd 3L2VA 5GANd 1QMCA 5ELOA 1ZSZB 4RCBA 3RKWA 2KGTA 4ZGDB 4YRCA 1N9WA 2ZR2A 3TU4K 3PVLA 4PJOF 1Q7YR 4H2TA 1GCQA 3A8MB 4BACA 1YI2T 3G6ET 1YITA 1EVKA 2EQJA 2CJ9A 1D0XA 3OB9A 3G4SA 3HKSA 1UGSB 3MO8A 5KYWB 4V2SA 2X4WA 3MEVA 4AG2C 1SEMA 2IPOB 2CUBA 1QCOA 2DAQA 2EYXA 1VQKA 5CKFA 1G3SA 3HXYA 4F04B 5GAN7 4XQ3A 3MP8A 2NUPA 4JRKA 1NJIC 2VKNA 1LOJA 1VQNT 1ACMB 2BZXA 2ALYA 2WACA 1BI2A 1NE8A 1B3QA 2W10A 3EG9A 1M3AA 2LQWA 5FROA 1VQ4Q 2K3YA 5LJ3f 3H0FA 4IKFA 2AZSA 1K9AA 2O2OA 1ZUUA 4F7UA 3CCVA 2NUPB 1AZGB 3CBOA 1V1CA 3ZFJA 1YIJQ 3EGUA 2E1HA 1YCSB 3FLGA 4E2FB 4D6WA 1WJRA 2RQTA 3UA7A 4M7AB 1I5LA 2XMFA 2LZ6B 4PJJA 4D8KA 3UGQA 11ASA 1YJWA 1Q86C 1Q95G 3WQZA 2GGRA 2Q7GA 4Z89A 1UECA 2HL3A 3NENA 2EYWA 4L87A 2X3WD 1NJ5A 3ME9A 3BE3A 3OYGA 1FMKA 4C8QB 4YDQA 1NYRA 2VWFA 5GAMe 1XNIA 4OMLA 2RJEA 4JS4A 4BWAA 2BZYA 3MKDA 2CP2A 2MCNA 3HFZA 3F70A 1NPPA 4YCVA 3CEYA 1W1FA 4QKUA 1PWTA 4GLKA 4HKEA 2DRKA 1OX8A 4C92E 2AKWA 2FPFA 1QVPA 5KYYB 4PFPA 3OYHA 1X27A 4K86A 1U8RA 1SPKA 2Q5IA 2XDBA 2EQMA 1Q82U 4RQEA 4X34A 4C0ZA 1USYC 2QAZA 4F16A 2AKLA 1VOMA 3UFGA 1VQ7T 2HEQA 3CCUT 4YRLA 1NEBA 1B76A 2JTFA 3CBPA 5HK3A 4RG8A 4R0KA 3NETA 3P8VA 2K5FA 4LVLA 2AMCB 1EIYB 2NUTB 3OYYA 2L0AA 4AFSC 5D6XA 2J6OA 3I5SA 1VQ8Q 4M75G 1KQSP 4UP9A 2RF0A 2DETA 2LJ3A 4HA8A 1KSWA 4IUPA 4TQDA 5I22A 1X01A 1VYUA 2EFIA 3A1PA 3I35A 4BE2A 4OB3B 5I11A 1HD3A 4FYYB 4KH1B 1H4TA 1X2HA 2LCCA 1RAIB 2QA4T 1G5HA 4WI1A 2D0NA 2YT6A 3C12A 4OMNA 2RHQB 2C0TA 4EMGA 1G3YA 1M2VB 4MMKA 1RI0A 1WA7A 3RUXA 3LLRA 3FJPA 4RMFA 1BI3A 1E6GA 1E6HA 5DLOA 1JB0E 2QK0A 3OQ5A 4FYXB 4IUQA 5KYXB 3OMGA 5GAMg 1U1TA 4KUIA 1HJDA 2ED0A 1UUEA 1E7OA 9ATCB 3SFMA 4HXJA 2A3LA 1SRLA 4CI0C 4R55A 1WLPB 2LT1A 1UE9A 2JM8A 2CZ7B 2PUOB 2P84A 2QQBA 2DILA 4GBQA 3PT9A 1FXXA 4DEXA 3CCQT 3H0IA 4FW2A 3FIFA 2E3IA 3QZ5B 3LH0A 1WJSA 1WDXA 3OMCA 4YRRA 2G6FX 3QWXX 2P4RA 1M2OA 3HY0A 2EPDA 3A5YA 4Q5WA 2L5QA 4LUDA 3CCUQ 1BB9A 4RTVA 2PVOB 3I7FA 1WGSA 4C92B 1NJ6A 2HSEB 5GAOl 4DBRA 3BW1A 1SERA 2A0FB 2EBPA 1FYNA 3TCJA 4DBHA 4FU6A 2I4MA 4H2WA 3TUPA 1RLPC 3RBBB 3CCVQ 3JB9F 2LT4A 4PG3A 5LJ5f 2DM1A 1O75A 2KYBA 4PHCA 1UHCA 3EG3A 2R5AA 2E10A 3I56A 1IGUA 3E19A 1M3BA 3P8BB 3M53A 4PFZA 3LX7A 3S3OA 1WPYA 3MF2A 2BE7D 2M16A 4J9GA 2HBWA 2FRWA 3OW2P 1YJWQ 4M7AF 2DL8A 3X28B 3EH1A 4LD9K 2RH2A 4JZ3A 2K4YA 3SWNC 1VQ7Q 3OYFA 4C5HA 3QKJA 3RNJA 1KC8U 6AT1B 3TREA 1UGVA 2F1LA 3CCMT 4H2XA 1HSQA 1GBRA 2FL7A 2M0OA 2IY5A 3M4QA 3MF1A 1VQ8T 1NJIR 4BI4A 1Q86U 3UGTA 5LJ3d 2DZ9A 1NLOC 1UFFA 1S1NA 1BYMA 4J6WA 2RO0A 1WU7A 4HWRA 2DPPB 3QYHB 4C5EA 3WVDB 2HZYA 2QHUA 4YREA 4QQDA 3CC7Q 3BY7A 2OI3A 2E3HA 4P3OA 2DERA 2EJFA 5FW9A 3I56T 5C52B 4P71C 3CCJA 1KHIA 2KXDA 3QO3A 1OPKA 4QVZA 1R0CB 2K5LA 2LCSA 2RHSA 2OTLQ 4A4KA 2RI5A 2PZ1A 1SETA 3CMAQ 3RIRA 2COZA 3M55A 2LMJA 5IT9E 3WXMB 2DZCA 1S72A 3ERRA 1YI2A 4XU0A 4P75C 2YSQA 4N4HA 2LRQA 1EQRA 4AFZC 1NG2A 1JEGA 5KYUA 4L5GA 2EAYA 4DPGA 1OQKA 1WHHA 3OYDA 4EX5A 1UJYA 1YCYA 5IXBA 3VS3A 5I2SA 4Z02A 4M7AC 1M27C 3M5AA 5GMKe 4KRTA 1H92A 4YRNA 8AT1B 3R6NA 3G6EA 2FZGB 3M4PA 3M54A 2DU7A 3G4ST 1K4US 2K2VA 4II1A 2RQVA 4R56A 2ZCEA 3EHQA 4HCBA 3OYCA 4L6V5 4CH4A 1WQWA 3CCJT 1RACB 2O4XB 4OMMA 2PNIA 2RI3A 2DEQA 2QXFA 3RESA 3M9QA 2F2VA 1X54A 4PL6A 2KNBB 1W6XA 4D8DA 3QXEB 3P8HA 4J5YA 3RMQA 3QYGB 3HP9A 2JNGA 2RHSB 1XTDA 1TG0A 1KC8R 4OP0A 1NJ1A 4WTOB 2HSPA 4NL2A 3CCET 3J81E 2MK5A 2JW4A 2DU5A 3I55T 1UDLA 1JXOA 3RKXA 1UJ0A 1WX6A 2DK3A 4AFQC 4ZN3A 4G85A 2JS0A 1YI2Q 1VQMQ 1W2BS 3QTCA 2KRNA 2O9VA 1EFNA 2AIRB 3VYHB 3CPWA 3O5ZA 4RUGA 4B9WA 2P5IA 2E64A 2L3SA 4M78G 4NOYA 3OS2A 2AHJB 2L3RA 4DA4A 4ZGEB 4N4GA 5J26A 4BW9A 1MNDA 3EGDA 5D6YA 2F5KA 2AKKA 2DL4A 2CP0A 1X56A 3QSUA 2E12A 4M77A 3H0HA 3IG2A 4X5OA 3LSQA 1VQ7A 1TSFA 1IO6A 2RHZA 1B8AA 2X51A 4C92C 2JTMA 3CXCA 1HK9A 1T0JA 4HWPA 3N5BB 5FRNA 3REXA 1QW1A 1YNZA 4ESRA 4Y91A 1MNEA 4BY6C 5GANf 3SB2A 3CBMA 2JM9A 4J8OA 2XKOC 5GAOr 3OBYA 1QVGP 1PG5B 2KBTA 4Y28E 2VB6A 1KHCA 4P5NA 4YTLA 4RKUE 4F7UB 3EG0A 5KYXA 3SWNB 1WYXA 2DIQA 1PRLC 2GBQA 2X4JA 1X2GA 2Q7HA 5CAIA 1MMAA 4BY6B 3QO5A 3VV0A 3CCRQ 3ZEHA 3UPUA 4M78B 1KOGA 1ZLMA 2QEXQ 4L59A 1N6AA 2PU9B 4ANJA 4H02A 4LXCA 2KRSA 3OSVA 1WHLA 1BU1A 4ZGJB 3JSCA 4GLMA 1CSKA 2CKKA 2OAUA 4P73A 3Q1JA 1H3ZA 1H4QA 3QG1A 1NBEB 2RJFA 4X9CA 4M7AG 3QO8A 3OYKA 4IURA 3QBYA 2ARTA 3PZCA 3R07A 3L2WA 3CQTA 5K1PA 1EIYA 3HXZA 2O01E 2M0YA 1VYTA 3LH5A 1RL2A 1E1TA 1RAGB 5J39A 3VS1A 1WXUA 2P0KA 4MZTA 4F7UE 3CCEQ 1Y71A 1VQLA 5KCOA 3CCMQ 2MOXA 1QLYA 4YRQA 4C5GA 3G6EQ 5F5WA 1MMGA 3L4GA 4A4FA 4EO4A 4YRPA 2DTIA 4E6RA 3ULRB 2D8JA 4ZTZB 2KK4A 1M30A 4A63B 4H2XB 3QHSA 2AKWB 1QP2A 1AOJA 4OMOA 5GMKh 1T3LA 2RM4A 2E65A 4J9CA 4CS4A 3LWIA 3CPWP 4JS5A 5K1XA 1WLEA 2CYZB 2RQRA 3C0CA 2DQ3A 2VGNA 3ZBDA 1D1BA 3O8VA 1EZZB 4RTUA 3HHTB 2LJ0A 3DB3A 3GLXA 2QHTA 3HRIA 3HRKA 5C6SA 1M9SA 1RAFB 2C0IA 4M7DE 1U1SA 4OMQA 1ASZA 2K57A 4PJNA 1GRIA 2WSEE 3RKYA 4KULA 7AT1B 3JCMf 1YJNT 4P75A 2A7YA 1MGQA 3KFVA 3G71T 2DXTA 3PMTA 4AG1C 4YRFA 2ZAEA 4JRIA 1YFNA 4C8QA 1Z7MA 2Q5HA 2E4HA 2OTLT 3CMEQ 3CCLA 1Y57A 2ZCFB 4J7FA 1AWXA 4EMHA 3TVTA 1IZ6A 4MDWA 3KUFA 4JUVA 4DQ2A 2MWPA 3LYIA 3R6OA 1E22A 1B34A 1N9RA 4UC4A 2LCLA 3M59A 3A8LB 2G4CA 4WJ3M 1NPRA 2JMCA 1AWJA
chains in the Genus database with same CATH topology
3CC4T 1KD1C 1VQOA 1NJIU 4X9DA 5CVIA 4BUGA 4E7JA 4VUBA 4EMKB 4ZTFA 2X4YA 2I2LA 1M1GA 2P0PA 4FM4B 4RMOA 3OY9A 2JVVA 2QQAA 5CO7A 2Y4YA 4G84A 1M4ZA 3SWNA 3L2ZA 4ELZC 3CC7T 2MMPA 2ZPGB 3CMQA 2E70A 3META 4MZPA 1BIAA 5AYFA 4LVIA 1S72T 1VQMA 2RHIA 4DOWA 2JOYA 2OTLA 2E5AA 1V29B 3V7CA 4B9XA 3V7RA 4K88A 3JCMe 3A8GB 3NTHA 3QPHA 1H4SA 4O5VA 1UGQB 1VQPT 1G5IA 3QUIA 3RF1A 3KFUA 1OI1A 1Q7YU 4E47A 2MAMA 4XTWA 3L2QA 5LL6S 4C92F 3OYEA 1KG1A 2KY9A 4DOVA 1PYSA 4OB1B 3CCEA 1YB3A 3E9FA 2IG0A 2ZZDA 3M56A 3MEAA 3HXWA 2M1HA 1WQ7A 3VQXA 3GPLA 1QVGS 2O4XA 3E1SA 5A0DA 4C92A 3J80E 2VXFA 2G3RA 4C8QD 1M8VA 2DIGA 4KBMB 3UDCA 2WSFE 3BFMA 1NJ8A 3LC0A 2PUKB 2FYKA 4NL3A 3S3MA 4XTYA 2FB7A 4UP8A 4K87A 2HAXA 2Q7EA 5IAYA 4Q15A 5A2QE 3VQWA 2NLUA 1BBWA 3TEGA 1LNXA 4ZIBA 3A5ZA 2HQEA 3A5ZB 1X55A 1YFTA 2ZT5A 3BDLA 3DKMA 1ATIA 3M4YA 4OF1A 4NCXA 4M7AE 4CRIA 3QZ9B 1XOVA 1B70B 1YJWT 4J6XA 3H6ZA 5LJ3h 1NZ9A 5CKEA 2QHVA 1N8RU 3AHUA 4OGCA 4YROA 1DJ7B 2E41A 3VBBA 5HY6A 1EOVA 4BB7A 5GMKj 1VQ5T 5GAN2 1Y96A 2LX9A 3CC4A 5FRMA 3G1ZA 4JDSA 3V7SA 3JB9I 5GAOn 2KVQG 2ZZFA 2VUBA 2RI2A 5GANh 1QVFA 3JCMh 3JB9G 3PTAA 4M77B 2LQKA 3VUZA 1M1KU 3GIBA 3OD1A 2P0QA 5GAMj 2RB6A 2EL9A 4YYEA 3NFCA 3JCMd 5GAN3 3ASKA 1OZ3A 3GP8A 3C94A 3HSBA 2JZ2A 5FU7C 2MF2A 1YJ9A 3MP6A 3TEHB 4JRQA 2C7IA 3CCUA 3HRTA 4LVJA 4KQEA 2QDYB 1D3BB 3PCOA 3ICAA 4LDVA 3PIPA 1GGMA 4ZTUB 4E51A 3P8DA 3A74A 3PGGA 4M78E 2KMTA 3PFSA 1NNHA 2H3JA 2KQWA 3GNGA 1KQ2A 2B8AA 3DLMA 1KC8C 1ADJA 1O9SA 3DSQA 1SRYA 2QTXA 4PJOB 4M77G 1VQ4T 2ZPFB 3M57A 3JCMP 2YHTA 4C5IA 5GAN6 2QQSA 2ZIMA 1G3WA 3HFOA 4JRPA 3C95A 3OW2A 4BD3A 4AH6A 4A53A 5GMKm 2ZPBB 2F69A 1Q81U 4YRKA 2ARUA 3VKIA 3M4GA 3CCSA 1WNLA 3BJUA 4N0AA 1BBUA 3EFRA 1SSFA 3CPFA 1E1OA 4NS5A 4P72C 2XDPA 4YP0A 2V8JA 1R8OB 1VQ9T 2RK1A 3OYBA 4M75A 3IALA 1IREB 1ZBXA 3MQZA 4TWAA 1PSEA 3CCVT 3HY1A 4YPFA 1OZ2A 5LJ3g 4M7DF 1I8FA 3A8OB 3RERA 2RHXA 4XU2A 4LDUA 1MHNA 3UT1A 3LGFA 2CS7A 3JB9H 4M77C 4C0FA 2QQ9A 2ZNJA 3HRSA 3V8KA 3X20B 3CXCS 3OW2S 2RK2A 4PLLA 5GAOq 3GNFB 4E7LA 3CPWS 1VQ5A 4P72A 2QHSA 3V8LA 2CJAA 1M90U 4QVCA 5C51B 3VUBA 1NJ2A 4EPCA 3REUA 3HPWA 4WJ4A 4WF2A 4M77D 4XEMA 1JJ2A 3L4GB 4OVAA 4C8QC 4J6YA 4LD6A 2XGTA 2EWNA 2KDSA 2I4NA 2F5TX 4A4GA 2RJDA 3GOXA 2L8DA 2E6ZA 1JJCB 2GQVA 2DDZA 3A7AA 5KNNA 3UH0A 4HWSA 3OYJA 4BDZA 3HFZB 5A0GA 1RIQA 2XIDA 4P3NA 2DD4A 4A4HA 4EMKC 2ZNIA 2LDMA 5CQXA 2YRVA 1G3TA 3FB9A 1QVFS 1VQ6T 1GXIE 2ALYB 1HXDA 3CMAT 4JLGA 2ZGWA 4HWTA 4QQ6A 4TVAA 4M77F 4M7AA 3X26B 4C8QG 1K8AC 2I4OA 2DTOA 5CK9A 2HQXA 5HK0A 4XU3A 3NTIA 2A8EA 2CZ0B 3S6WA 5KE3A 4KR2A 3KXTA 4C8QF 2EKOA 4M75B 4ELYC 1W2BA 3P8YA 3LW5E 4LDYA 4KUDK 3OBWA 2RD1A 4RDXA 1X75C 2XI9A 1VQ4A 4BDYA 4YRIA 3QNEA 4QVDA 3X25B 1XQHA 2E5QA 3I55A 2DXCA 2ODRC 1M5Q1 5CIUA 1QVGA 4CH6A 4M7DD 2C06A 2I4LA 1PYSB 4HCZA 3CD6T 2JUFA 3KBGA 4PJOC 3E9HA 3DB4A 4O2DA 3PMIA 2E6NA 4C0DB 4M75E 3JCMg 3JB9D 4RQFA 3OYAA 2ZXFA 4PJOD 2R58A 5GAN5 2ZPHB 3CCMA 4XEOA 1KMNA 3PCOB 4PLIA 1D3BA 4O6JA 1N9SA 4J83A 2CJBA 3TEHA 2DXBA 4N0AC 3JCMc 2MI6A 1OYXA 4TVRA 2X4XA 1B7YA 4XTXA 5GAMf 1YIJA 2DXUA 4HT4A 1I4K1 4TVYA 4YRMA 1HC7A 4EMKA 5I2MA 4IUUA 2XTIA 3NEMA 4FIBA 5CCAA 4M77E 2ZR3A 4ME7A 5IN1A 3PNWC 2ZPIB 3E9IA 3JAME 5DY9A 3S3NA 3G7ZA 2EIFA 4KR3A 1ASYA 5J3BA 1UB4A 1G5VA 1KD1U 4UP7A 4M7DG 4RG2A 2EJ9A 4ZN1A 2RHUA 4FL6A 1BI0A 4YRSA 4PKCC 1BIBA 2PVDB 1W4SA 2Y4XA 2R57A 4FSXA 2Y90A 2IY5B 2NS6A 2XU8A 5CQYA 5GANj 3A8HB 4EDUA 2CIMA 5CKHA 4H2UA 5C0MA 2OTJT 1Q82C 4RCCA 3CCRA 2PMEA 3HFVA 1VQ6A 2BKDN 4M75F 2DD5A 3URGA 2L89A 5GANe 4F7UG 4HCCA 2HNIA 2C8MA 3JCMb 2VV5A 4M7DB 1M1KC 1VQKT 2VGMA 2DQ0A 5CKDA 12ASA 4IUTA 1YFSA 3CD6A 4QW2A 1NYQA 3SDZA 4E7KA 3WVEB 4YRTA 1JBMA 1P92A 3QJ6A 4P3PA 2DO3A 4CH3A 1H4VB 1Y07A 5LJ5g 4IUVA 2ZZGA 3L2UA 1ADYA 2ZZEA 4YCWA 2LTOA 4ATOA 1QE0A 3FC3A 2RA2A 2XD0A 4J7IA 1B34B 4OB0B 5FLXE 2XG8D 4M75D 1K73C 2PMFA 4P71A 4M78F 4HT8A 2V8IA 4Q6GA 3JB9J 2RHQA 1KQSA 4XAXB 3OS0A 3QDRB 3CMAA 3BDUA 2QI2A 1VQMT 3OS5A 2K3XA 4C92D 1LYLA 4ZTJA 2K5IA 5HKCA 3CCST 1ZQ1A 2CGHA 4TVWA 5FU6B 2PVGB 4JJNK 1SESA 4LDXA 3A32A 5FU6C 2R5MA 1FWZA 4BE1A 3L2RA 3T9NA 2E3CA 3CMET 3V8JA 4PJOA 1B7YB 5GAOp 1Z7NA 5ELNA 4H2SA 1VUBA 1VQLT 2IVWA 5KCHA 2LC4A 4M78D 4FT2A 3FDRA 4J15A 2LQ8A 3QJYA 3RL6A 5DM7R 5CR2A 4HVCA 3OS1A 1Y7XA 2D9TA 1J5WA 2DKGA 1JJCA 3ER0A 3QIIA 2QQRA 1W66A 4A4EA 3OSSC 4C8QE 2V8KA 1EFWA 2QA4A 4P74A 1JRIA 3JCMX 4OGEA 2D6FA 2RHYA 1YITT 3OYNA 3HXVA 1C0AA 3CCRT 4CS3A 3W3SA 1I81A 5A0LA 5D6WA 1TH7A 3NELA 4YCUA 1ZHIA 5CKBA 2ZT7A 3HXUA 2BIVA 3TEEA 1K9MU 2YLCA 1VQZA 1UGPB 2RJCA 3G71A 2CZ1B 2GCXA 1IL2A 1YHQA 5GMKi 2HBPA 3JCMV 4OLFA 3MEWA 5LJ5j 1USYA 4GY5A 5KH6A 3OYLA 1G51A 1B70A 3OYMA 4KT0E 2J3LA 5HGQA 1EIFA 1E24A 4M7AD 1Q81C 4UPAA 3IKLA 1VIEA 5GAN4 2CZ6B 5LJ5e 3INZA 4MMLA 1WJQA 3FRNA 3RMSA 3MP1A 4PNOA 4E7IA 2XDDA 1VIFA 5LJ5d 3VU3C 2GF7A 1BI1A 3MEYA 4TTVA 4E7HA 2FVUA 1L0WA 4JLIA 3A7UA 1M1FA 4N4IA 3JCMW 1YFRA 2EQKA 1K8AU 4XK8E 3MCAB 2P0LA 5LJ3e 2QEXA 3EAEA 1UEBA 4M7DA 1WYDA 2XHCA 2HD0A 1VQPA 1K73U 5DLQE 2AMCA 5E3IA 3UWNA 1FX7A 3HFNA 1VQNA 1KMMA 1YBYA 2WSCE 5LJ3j 2GFAA 3JCMJ 3CMEA 1KQSS 3HTZA 1Q7YC 3VQYA 2DVEA 5KE2A 4CH5A 2DTHA 1JJ2S 3HL8A 2BUDA 2KSSA 4XU1A 1M90C 2VC8A 2ARSA 2GFUA 2ZPEB 4XTZA 4BI3A 3P8TA 5GAOm 3OA6A 5FU7B 2P4TA 3QO7A 3J7AF 2LNVA 1N27A 1HTTA 4LVKA 5LJ5h 1Y96B 1KQ1A 3VJPA 2OTJA 5GANg 3L42A 4M78C 3FEOA 2KAFA 4PJOE 3CCQA 3OYIA 1QP3A 3C4SA 2XK0A 2YLBA 3MHXA 4F7UF 3E9GA 2ZT6A 2JN0A 1YJNA 3CC2A 3NTKA 2MWOA 3EFSA 1VQ9A 1QF6A 3A31A 4H2VA 3SD4A 2DJZA 1EVLA 2ZIOA 2FHDA 2EYQA 3HRUA 3LGLA 4BI8B 4CS2A 2M9UA 3H8ZA 2ZTGA 3VYGA 3CCLT 4HT9A 2D0QB 4TVAB 3VQVA 4M78A 4MZMA 3DLLA 1X6OA 1YGBA 1N8RC 2PQWA 4YRJA 5I21A 4P73C 2LVMA 2X35A 1YIJT 1VQOT 3PIOA 5GAN8 4LDWA 4TQFA 1K9MC 3X24B 1FYFA 2J3MA 3MEUA 2ZT8A 2EJGA 2VYTA 3RACA 5L8RE 2VXEA 4C0GA 3CC2T 1BKBA 3L1AA 3RGLA 3HXXA 3IKMB 4XTVA 4PJOG 2XICA 3CC7A 4C0DC 1YHQT 5GMKl 3M58A 2ZINA 4OB2B 3JCMQ 3JRZA 4P74C 4QQGA 4H2YA 4LNSA 4XTUA 4C92G 1UGRB 1YJ9T 1VQ8A 4HWOA 4MDXA 1LJOA 1H641 4YRGA 2QEXT 3LWHA 3A7RA 4OMFB 4LVMA 4M7DC 5M9OA 4BE0A 3LSSA 2ODRD 4M75C 3GF5A 5EG2A 1PSFA 4FT4A 1AHJB 5C53B 5GAMh 2EQUA 5GAMd 3L2VA 5GANd 5ELOA 4RCBA 3RKWA 4ZGDB 4YRCA 1N9WA 2ZR2A 3TU4K 4PJOF 4H2TA 3A8MB 4BACA 1YI2T 3G6ET 1YITA 1EVKA 2EQJA 2CJ9A 3OB9A 3G4SA 3HKSA 1UGSB 3MO8A 4V2SA 2X4WA 3MEVA 2DAQA 1VQKA 5CKFA 1G3SA 3HXYA 5GAN7 4XQ3A 3MP8A 4JRKA 1NJIC 1LOJA 1VQNT 2ALYA 2WACA 1BI2A 1NE8A 5FROA 2K3YA 5LJ3f 4IKFA 4F7UA 3CCVA 3CBOA 3ZFJA 2E1HA 3FLGA 4D6WA 1WJRA 4M7AB 1I5LA 3UGQA 11ASA 1YJWA 1Q86C 3WQZA 2Q7GA 3NENA 4L87A 1NJ5A 3ME9A 3OYGA 4YDQA 4C8QB 1NYRA 5GAMe 1XNIA 2RJEA 4JS4A 4BWAA 3HFZA 3F70A 1NPPA 4YCVA 3CEYA 4GLKA 4HKEA 4C92E 2AKWA 1QVPA 3OYHA 4K86A 1U8RA 2Q5IA 2XDBA 2EQMA 1Q82U 4RQEA 4X34A 4C0ZA 1USYC 3UFGA 1VQ7T 3CCUT 4YRLA 1B76A 2JTFA 3CBPA 5HK3A 4RG8A 3NETA 3P8VA 2K5FA 4LVLA 2AMCB 1EIYB 3OYYA 5D6XA 4M75G 4UP9A 4HA8A 4IUPA 4TQDA 1X01A 2EFIA 4BE2A 4OB3B 1H4TA 1X2HA 2LCCA 2QA4T 1G5HA 4WI1A 3C12A 2RHQB 4EMGA 1G3YA 4MMKA 1RI0A 3RUXA 3LLRA 3FJPA 4RMFA 1BI3A 5DLOA 1JB0E 3OQ5A 4IUQA 3OMGA 5GAMg 1U1TA 4KUIA 3SFMA 2A3LA 4CI0C 4R55A 2LT1A 2PUOB 2CZ7B 2QQBA 3PT9A 1FXXA 3CCQT 3FIFA 3QZ5B 3LH0A 1WJSA 3OMCA 4YRRA 3HY0A 3A5YA 4Q5WA 2L5QA 2PVOB 3I7FA 1WGSA 4C92B 1NJ6A 5GAOl 3BW1A 1SERA 3TCJA 4H2WA 2I4MA 4FU6A 3TUPA 3JB9F 2LT4A 4PG3A 5LJ5f 1O75A 4PHCA 2R5AA 2E10A 3I56A 3E19A 3P8BB 3M53A 3LX7A 3S3OA 1WPYA 3MF2A 2M16A 4M7AF 3X28B 4LD9K 2RH2A 2K4YA 3SWNC 3OYFA 4C5HA 3QKJA 1KC8U 3TREA 3CCMT 4H2XA 2FL7A 2M0OA 2IY5A 3M4QA 3MF1A 1VQ8T 4BI4A 1Q86U 3UGTA 5LJ3d 2DZ9A 1BYMA 4J6WA 2RO0A 1WU7A 4HWRA 2DPPB 3QYHB 4C5EA 3WVDB 2QHUA 4YREA 4QQDA 3BY7A 4P3OA 2EJFA 3I56T 5C52B 4P71C 3CCJA 1KHIA 3QO3A 4QVZA 2K5LA 2RHSA 4A4KA 2RI5A 1SETA 3RIRA 3M55A 5IT9E 3WXMB 2DZCA 1S72A 3ERRA 1YI2A 4XU0A 4P75C 4N4HA 2LRQA 1EQRA 4L5GA 2EAYA 4DPGA 3OYDA 4EX5A 1YCYA 5I2SA 4Z02A 4M7AC 3M5AA 5GMKe 4YRNA 3G6EA 3M4PA 3M54A 2DU7A 3G4ST 2K2VA 4II1A 4R56A 2ZCEA 4HCBA 3OYCA 4L6V5 4CH4A 1WQWA 3CCJT 2O4XB 2RI3A 2DEQA 2QXFA 3RESA 3M9QA 1X54A 4PL6A 3QXEB 3P8HA 4J5YA 3RMQA 3QYGB 3HP9A 2JNGA 2RHSB 1XTDA 4OP0A 1NJ1A 4NL2A 3CCET 3J81E 2DU5A 3I55T 3RKXA 4ZN3A 2DK3A 4G85A 1W2BS 3QTCA 3VYHB 3CPWA 4B9WA 2P5IA 2E64A 4M78G 4NOYA 3OS2A 2AHJB 2L3RA 4DA4A 4ZGEB 4N4GA 5J26A 4BW9A 5D6YA 2F5KA 1X56A 3QSUA 2E12A 4M77A 3IG2A 4X5OA 3LSQA 1VQ7A 2RHZA 1B8AA 4C92C 2JTMA 3CXCA 1HK9A 4HWPA 3N5BB 5FRNA 3REXA 1QW1A 4Y91A 4BY6C 5GANf 3SB2A 3CBMA 4J8OA 5GAOr 2XKOC 3OBYA 4Y28E 1KHCA 4P5NA 4YTLA 4RKUE 4F7UB 3SWNB 2DIQA 2X4JA 1X2GA 2Q7HA 5CAIA 4BY6B 3QO5A 3VV0A 3ZEHA 3UPUA 4M78B 1KOGA 4L59A 1N6AA 2PU9B 4H02A 3OSVA 4ZGJB 3JSCA 2CKKA 2OAUA 4P73A 3Q1JA 1H3ZA 1H4QA 3QG1A 2RJFA 4X9CA 4M7AG 3QO8A 3OYKA 4IURA 3QBYA 2ARTA 3PZCA 3R07A 3L2WA 1EIYA 5K1PA 3HXZA 2O01E 1RL2A 1E1TA 5J39A 2P0KA 4MZTA 4F7UE 1Y71A 1VQLA 5KCOA 4YRQA 5F5WA 4C5GA 3L4GA 4A4FA 4EO4A 4YRPA 2DTIA 4ZTZB 2KK4A 4H2XB 3QHSA 2AKWB 1QP2A 5GMKh 2RM4A 2E65A 4CS4A 3LWIA 4JS5A 5K1XA 1WLEA 2CYZB 2DQ3A 2VGNA 3ZBDA 3O8VA 3HHTB 3DB3A 3GLXA 2QHTA 3HRIA 3HRKA 5C6SA 1M9SA 4M7DE 1U1SA 1ASZA 2K57A 2WSEE 3RKYA 4KULA 3JCMf 1YJNT 4P75A 2A7YA 1MGQA 3G71T 2DXTA 3PMTA 4YRFA 4JRIA 4C8QA 1Z7MA 2Q5HA 2OTLT 3CCLA 2ZCFB 4J7FA 4EMHA 1IZ6A 4MDWA 3KUFA 4JUVA 4DQ2A 2MWPA 3LYIA 3R6OA 1E22A 1B34A 1N9RA 4UC4A 2LCLA 3M59A 3A8LB 2G4CA 4WJ3M 1NPRA 4A54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I4O A;  2DTO A;  4MML A;  4X9D A;  4XU3 A;  4PNO A;  4EMK B;  4KR2 A;  2I2L A;  4C8Q F;  3FIF A;  5LJ5 d;  3VU3 C;  4M75 B;  3P8Y A;  3MEY A;  4TTV A;  4YRR A;  4G84 A;  1L0W A;  4JLI A;  3A7U A;  3HY0 A;  3SWN A;  3JCM W;  3L2Z A;  3A5Y A;  3CMQ A;  1YFR A;  2RD1 A;  1BIA A;  4RDX A;  3I7F A;  4C92 B;  1NJ6 A;  5GAO l;  4YRI A;  2E5A A;  3BW1 A;  1SER A;  3QNE A;  2P0L A;  3V7C A;  4QVD A;  3V7R A;  5LJ3 e;  4K88 A;  4H2W A;  2I4M A;  3TUP A;  3JCM e;  3JB9 F;  4PG3 A;  4M7D A;  1WYD A;  1H4S A;  5LJ5 f;  2ODR C;  4PHC A;  1G5I A;  1M5Q 1;  3QUI A;  2E10 A;  3RF1 A;  4CH6 A;  4M7D D;  2AMC A;  5E3I A;  2I4L A;  3KFU A;  1PYS B;  3HFN A;  1KMM A;  5LJ3 j;  4PJO C;  1WPY A;  3JCM J;  3MF2 A;  3HTZ A;  3VQY A;  4M7A F;  3E9H A;  2DVE A;  4O2D A;  4CH5 A;  4XTW A;  2DTH A;  3SWN C;  4M75 E;  3JCM g;  3JB9 D;  4XU1 A;  2VC8 A;  4RQF A;  4C92 F;  2ZXF A;  4PJO D;  2ARS A;  1PYS A;  5GAN 5;  4XTZ A;  3P8T A;  5GAO m;  4H2X A;  1YB3 A;  2IY5 A;  3M4Q A;  3MF1 A;  4XEO A;  1KMN A;  3PCO B;  3QO7 A;  1D3B A;  5LJ3 d;  3UGT A;  1N9S A;  2DZ9 A;  3HXW A;  4J6W A;  1HTT A;  2CJB A;  3TEH A;  1WU7 A;  4HWR A;  1WQ7 A;  5LJ5 h;  3VQX A;  1Y96 B;  1KQ1 A;  5GAN g;  4N0A C;  2QHU A;  4YRE A;  3JCM c;  4C92 A;  4M78 C;  2VXF A;  3BY7 A;  4C8Q D;  1M8V A;  4P3O A;  4PJO E;  2EJF A;  5C52 B;  4P71 C;  3BFM A;  1B7Y A;  1NJ8 A;  2YLB A;  3QO3 A;  3LC0 A;  2FYK A;  4NL3 A;  4XTX A;  4F7U F;  5GAM f;  2DXU A;  4XTY A;  2FB7 A;  2ZT6 A;  2RHS A;  2JN0 A;  1I4K 1;  4TVY A;  4UP8 A;  1SET A;  4K87 A;  3EFS A;  3RIR A;  1QF6 A;  3A31 A;  4H2V A;  4YRM A;  2Q7E A;  1HC7 A;  2DJZ A;  4EMK A;  2XTI A;  4Q15 A;  1EVL A;  2ZIO A;  3NEM A;  2DZC A;  3ERR A;  3VQW A;  4ZIB A;  1BBW A;  3TEG A;  1LNX A;  4M77 E;  2ZR3 A;  4XU0 A;  3A5Z A;  4P75 C;  4CS2 A;  1X55 A;  1YFT A;  2ZTG A;  1EQR A;  2ZT5 A;  3E9I A;  4HT9 A;  1ATI A;  4TVA B;  5DY9 A;  2EAY A;  4DPG A;  4NCX A;  3VQV A;  4M7A E;  4EX5 A;  1YCY A;  4M78 A;  4M7A C;  4KR3 A;  5GMK e;  1YGB A;  4YRJ A;  5I21 A;  4P73 C;  4YRN A;  1B70 B;  4J6X A;  1ASY A;  5LJ3 h;  3M4P A;  2QHV A;  2DU7 A;  3AHU A;  4YRO A;  4UP7 A;  4M7D G;  5GAN 8;  2ZCE A;  4TQF A;  2EJ9 A;  1FYF A;  2E41 A;  3VBB A;  2J3M A;  1WQW A;  1EOV A;  4CH4 A;  2ZT8 A;  2EJG A;  4YRS A;  5GMK j;  5GAN 2;  3RAC A;  1Y96 A;  2DEQ A;  2VXE A;  1BIB A;  3RES A;  3G1Z A;  1X54 A;  3V7S A;  3JB9 I;  5GAO n;  2ZZF A;  3L1A A;  3RGL A;  5GAN h;  2Y90 A;  4J5Y A;  3JCM h;  3JB9 G;  3HXX A;  3IKM B;  2IY5 B;  2RHS B;  4XTV A;  4PJO G;  4M77 B;  5GMK l;  5GAN j;  3GIB A;  3OD1 A;  5GAM j;  2RB6 A;  2EL9 A;  2ZIN A;  4YYE A;  3JCM Q;  3JCM d;  4P74 C;  4OP0 A;  2CIM A;  5GAN 3;  1NJ1 A;  4H2Y A;  4H2U A;  4LNS A;  3HSB A;  4NL2 A;  4RCC A;  4XTU A;  4C92 G;  2PME A;  3HFV A;  2DU5 A;  4HWO A;  4M75 F;  1LJO A;  3TEH B;  1H64 1;  2C7I A;  3RKX A;  5GAN e;  4KQE A;  4YRG A;  4G85 A;  4F7U G;  1D3B B;  3A7R A;  3PCO A;  3QTC A;  2HNI A;  4M7D C;  3ICA A;  2C8M A;  3LSS A;  3JCM b;  4M7D B;  1GGM A;  2ODR D;  4M75 C;  4ZTU B;  2P5I A;  2E64 A;  4E51 A;  4M78 G;  2DQ0 A;  3A74 A;  4NOY A;  5C53 B;  12AS A;  3PGG A;  5GAM h;  5GAM d;  4M78 E;  1YFS A;  5GAN d;  1NNH A;  1NYQ A;  5ELO A;  1KQ2 A;  1ADJ A;  4BW9 A;  4RCB A;  3RKW A;  4YRC A;  1N9W A;  2ZR2 A;  3DSQ A;  4YRT A;  1SRY A;  1JBM A;  4PJO F;  2QTX A;  4P3P A;  4CH3 A;  4PJO B;  4M77 G;  4H2T A;  1H4V B;  1X56 A;  3QSU A;  3JCM P;  4M77 A;  2YHT A;  3IG2 A;  4X5O A;  3LSQ A;  1EVK A;  5LJ5 g;  5GAN 6;  2CJ9 A;  2ZIM A;  1B8A A;  4C92 C;  3HFO A;  2ZZG A;  1HK9 A;  4V2S A;  2ZZE A;  1ADY A;  4HWP A;  4YCW A;  4AH6 A;  4A53 A;  3REX A;  5GMK m;  4Y91 A;  5GAN f;  1QE0 A;  3SB2 A;  4YRK A;  2ARU A;  3HXY A;  3M4G A;  5GAN 7;  5GAO r;  1WNL A;  4XQ3 A;  2RA2 A;  3BJU A;  4N0A A;  4JRK A;  1BBU A;  4F7U B;  1LOJ A;  3EFR A;  1B34 B;  3SWN B;  1E1O A;  2ALY A;  1X2G A;  4M75 D;  2Q7H A;  4P72 C;  5CAI A;  2PMF A;  4YP0 A;  4P71 A;  4M78 F;  3QO5 A;  4HT8 A;  4Q6G A;  4M78 B;  4M75 A;  1KOG A;  5LJ3 f;  3IAL A;  3JB9 J;  2RHQ A;  4F7U A;  4H02 A;  4TWA A;  3HY1 A;  4YPF A;  5LJ3 g;  2E1H A;  4M7D F;  1I8F A;  3RER A;  4XU2 A;  3BDU A;  4M7A B;  4P73 A;  4C92 D;  1I5L A;  1LYL A;  1H4Q A;  3JB9 H;  4X9C A;  2CGH A;  4M7A G;  4M77 C;  4TVW A;  3QO8 A;  3UGQ A;  11AS A;  1SES A;  3A32 A;  2ART A;  3PZC A;  3R07 A;  3WQZ A;  2Q7G A;  5K1P A;  2ZNJ A;  1EIY A;  3V8K A;  3HXZ A;  2E3C A;  4PJO A;  1E1T A;  3V8J A;  3NEN A;  1B7Y B;  4L87 A;  5GAO p;  1NJ5 A;  1Z7N A;  4YDQ A;  4C8Q B;  1NYR A;  5GAM e;  5ELN A;  4H2S A;  4F7U E;  5GAO q;  4BWA A;  4M78 D;  4YRQ A;  5F5W A;  3HFZ A;  3L4G A;  4EO4 A;  4YCV A;  4YRP A;  2DTI A;  4P72 A;  2QHS A;  3V8L A;  4C92 E;  2CJA A;  4J15 A;  4ZTZ B;  2AKW A;  3RL6 A;  4QVC A;  5C51 B;  4HVC A;  1NJ2 A;  4K86 A;  3REU A;  4H2X B;  3QHS A;  1J5W A;  4WJ4 A;  4WF2 A;  4M77 D;  2AKW B;  2Q5I A;  2DKG A;  1JJC A;  4XEM A;  5GMK h;  2RM4 A;  2E65 A;  4CS4 A;  4RQE A;  1W66 A;  3L4G B;  4C8Q E;  4C8Q C;  1USY C;  5K1X A;  1WLE A;  4J6Y A;  4P74 A;  1EFW A;  2XGT A;  2DQ3 A;  1JRI A;  2EWN A;  3JCM X;  3UFG A;  2I4N A;  4YRL A;  1B76 A;  3HXV A;  1C0A A;  4CS3 A;  3W3S A;  3NET A;  3P8V A;  1I81 A;  2QHT A;  3HRI A;  1JJC B;  3HRK A;  2AMC B;  2DDZ A;  1TH7 A;  1EIY B;  4M7D E;  1U1S A;  3A7A A;  3NEL A;  1ASZ A;  2K57 A;  4YCU A;  4M75 G;  4UP9 A;  5KNN A;  3UH0 A;  4HWS A;  4HA8 A;  2ZT7 A;  3RKY A;  3HXU A;  4TQD A;  3JCM f;  4P75 A;  1MGQ A;  2YLC A;  2DXT A;  1VQZ A;  1X01 A;  3HFZ B;  1RIQ A;  4P3N A;  1IL2 A;  5GMK i;  4YRF A;  4JRI A;  3JCM V;  4OLF A;  1H4T A;  1X2H A;  4EMK C;  5LJ5 j;  2ZNI A;  1G5H A;  4C8Q A;  1USY A;  4WI1 A;  1Z7M A;  2RHQ B;  1G51 A;  2Q5H A;  4EMG A;  3FB9 A;  1B70 A;  4MMK A;  3RUX A;  4EMH A;  2J3L A;  5HGQ A;  3FJP A;  4JUV A;  4RMF A;  4DQ2 A;  1E24 A;  4M7A D;  2ALY B;  1HXD A;  1E22 A;  1B34 A;  1N9R A;  2ZGW A;  5GAM g;  4HWT A;  1U1T A;  4TVA A;  4M77 F;  3IKL A;  2G4C A;  4UPA A;  4WJ3 M;  5GAN 4;  4M7A A;  5LJ5 e;  4C8Q G;  3INZ A;  4A54 A; 
#chains in the Genus database with same CATH topology
 3CC4 T;  1KD1 C;  3CXC P;  1VQO A;  1NJI U;  1ZSG A;  4X9D A;  5CVI A;  2DRM A;  4BUG A;  1ZUK A;  4E7J A;  4VUB A;  4EMK B;  4ZTF A;  2LQN A;  2X4Y A;  2V1Q A;  2I2L A;  4ZNX A;  3SEM A;  1QQJ A;  3REB B;  1H8K A;  3EG1 A;  2OTJ Q;  1G8X A;  1M1G A;  2P0P A;  2QAS A;  4FM4 B;  4WCI A;  2D1X A;  4RMO A;  3OY9 A;  2JVV A;  2QQA A;  5CO7 A;  1QCN A;  1ZUY A;  2Y4Y A;  1VQ6 Q;  4G84 A;  1M3C A;  1M4Z A;  3SWN A;  1ZA1 B;  3L2Z A;  4ELZ C;  2DEU A;  3CC7 T;  2MMP A;  2ZPG B;  3CMQ A;  2E70 A;  2OJ2 A;  3MET A;  4MZP A;  1BIA A;  5AYF A;  4LVI A;  1S72 T;  2J06 A;  1VQM A;  2RHI A;  4DOW A;  2JOY A;  4J9H A;  2OTL A;  2FZC B;  2E5A A;  3CC2 Q;  1V29 B;  3V7C A;  4B9X A;  3V7R A;  4K88 A;  3JCM e;  3A8G B;  3NTH A;  3QPH A;  5FWB A;  1WXB A;  1G2B A;  1H4S A;  4O5V A;  1UGQ B;  2K9G A;  1VQP T;  2A08 A;  2QYZ A;  1G5I A;  3QUI A;  3RF1 A;  3KFU A;  2ROL A;  1OI1 A;  1Q7Y U;  1VA7 A;  2GQI A;  2EW3 A;  1WIE A;  4E47 A;  1J3T A;  2MAM A;  4XTW A;  3IQL A;  1YIT Q;  4AMC A;  4JJB A;  3L2Q A;  1U5S A;  5LL6 S;  4C92 F;  3OYE A;  4J9I A;  2KY9 A;  1KG1 A;  2FEI A;  4KH0 B;  4DOV A;  1K73 R;  1PYS A;  4OB1 B;  1IRX A;  2F2W A;  3H9N A;  3CCE A;  2NYS A;  1YB3 A;  1VQO Q;  3E9F A;  2YRD A;  2IG0 A;  2DYI A;  2ZZD A;  3M56 A;  3MEA A;  1WHK A;  3HXW A;  1Z9Q A;  4ORZ A;  2M1H A;  4KGZ B;  1WQ7 A;  3VQX A;  3GPL A;  1QVG S;  2KEA A;  1QKX A;  2O4X A;  3E1S A;  5A0D A;  2HKN A;  2M02 A;  4F17 A;  1A0N B;  4C92 A;  3J80 E;  2VXF A;  2G3R A;  4C8Q D;  1M8V A;  2DIG A;  4KBM B;  3UA6 A;  1KJW A;  3UDC A;  2WSF E;  3BFM A;  1QWF A;  1SG5 A;  1NJ8 A;  3LC0 A;  2PUK B;  2JS2 A;  2FYK A;  2SEM A;  4NL3 A;  3S3M A;  4XTY A;  2FB7 A;  1RAD B;  1YJ9 Q;  4UP8 A;  1JO8 A;  4K87 A;  1GFC A;  2HAX A;  2Q7E A;  5IAY A;  4Q15 A;  2EKH A;  2HCK A;  2DL5 A;  4B6M A;  5A2Q E;  3VQW A;  2NLU A;  1BBW A;  3TEG A;  1LNX A;  4ZIB A;  3A5Z A;  2HQE A;  2ESW A;  4IIM A;  3A5Z B;  2HL5 C;  1X55 A;  1YFT A;  1M1K R;  2ZT5 A;  3BDL A;  3DKM A;  1ATI A;  3M4Y A;  4OF1 A;  2X3X D;  2KYM A;  3TSW A;  4NCX A;  1K9M R;  4M7A E;  4CRI A;  3QZ9 B;  1OX9 A;  1XOV A;  1NYG A;  1B70 B;  1YJW T;  4J6X A;  3H6Z A;  5LJ3 h;  1NZ9 A;  5CKE A;  2QHV A;  1N8R U;  1TS9 A;  3AHU A;  1TXQ A;  4OGC A;  4YRO A;  1DJ7 B;  1T0H A;  1Q82 R;  2K6D A;  2E41 A;  3VBB A;  5HY6 A;  1EOV A;  4BB7 A;  5GMK j;  2DX1 A;  1VQ5 T;  5GAN 2;  4J9B A;  1Y96 A;  2LX9 A;  3CC4 A;  5FRM A;  3G1Z A;  3EHR A;  4JDS A;  3V7S A;  1YP5 A;  3JB9 I;  5GAO n;  2KVQ G;  2ZZF A;  2VUB A;  2RI2 A;  1F1B B;  2BTT A;  5GAN h;  1QVF A;  3JCM h;  3JB9 G;  1FMW A;  2M51 A;  1NEG A;  3PTA A;  4M77 B;  2LQK A;  3VUZ A;  1M1K U;  3GIB A;  3OD1 A;  2P0Q A;  5GAM j;  2RB6 A;  1LPL A;  2EL9 A;  4YYE A;  3NFC A;  3JCM d;  3EH2 A;  5GAN 3;  3ASK A;  1OZ3 A;  3GP8 A;  3EGD B;  2OAW A;  3C94 A;  3HSB A;  2JZ2 A;  4FSS A;  1W2B P;  1SF9 A;  1ZSZ A;  5FU7 C;  2YRC A;  2MF2 A;  1YJ9 A;  3MP6 A;  2QDL A;  1VQ9 Q;  1G83 A;  2KR3 A;  3TEH B;  4JRQ A;  2C7I A;  3CCU A;  3HRT A;  1QWE A;  4LVJ A;  4KQE A;  4A54 A;  4J9E A;  2HKQ B;  2QDY B;  1D3B B;  2AK5 A;  3PCO A;  3EGX A;  3ICA A;  4LDV A;  3PIP A;  1GGM A;  4ZTU B;  4KGV B;  1MMN A;  2YUP A;  4E51 A;  3P8D A;  3A74 A;  3PGG A;  4M78 E;  2KMT A;  3PFS A;  1NNH A;  2H3J A;  2KQW A;  3GNG A;  3I56 Q;  1KQ2 A;  2B8A A;  3DLM A;  1KC8 C;  2RNA A;  1M90 R;  1ADJ A;  1LVK A;  1KK7 A;  1O9S A;  3DSQ A;  1SRY A;  2QTX A;  2EGE A;  5AT1 B;  4PJO B;  1K0X A;  3HTR A;  4M77 G;  1VQ4 T;  2ZPF B;  3M57 A;  3JCM P;  2YHT A;  5EC7 A;  4C5I A;  5GAN 6;  2QQS A;  2ZIM A;  1R0B G;  1G3W A;  3HFO A;  4JRP A;  3C95 A;  3OW2 A;  4BD3 A;  4AH6 A;  2EYZ A;  2A37 A;  2OX7 A;  4A53 A;  4JJD A;  5GMK m;  2ZPB B;  2F69 A;  1Q81 U;  1MUZ A;  4YRK A;  2ARU A;  4RTT A;  3VKI A;  3M4G A;  3CCS A;  1WNL A;  3BJU A;  4N0A A;  1BBU A;  2LX7 A;  3EFR A;  1SSF A;  4JJC A;  2YUO A;  3CPF A;  1E1O A;  4NS5 A;  4P72 C;  2XDP A;  4YP0 A;  2V8J A;  1R8O B;  1VQ9 T;  1AWO A;  2RK1 A;  3OYB A;  1Z9Z A;  2EYY A;  3EG9 B;  2RN8 A;  4M75 A;  4J9D A;  3IAL A;  4HVU A;  2CUD A;  1IRE B;  1WXT A;  2RQW A;  1ZBX A;  1UHF A;  1X43 A;  3M0T A;  3MQZ A;  4TWA A;  1PSE A;  3CCV T;  3HY1 A;  4YPF A;  1OZ2 A;  5LJ3 g;  1ZA2 B;  4M7D F;  1I8F A;  3A8O B;  3VS2 A;  3RER A;  2FG0 A;  3M0P A;  2RHX A;  1PD1 A;  4LDU A;  4XU2 A;  1MHN A;  3UT1 A;  3LGF A;  2CS7 A;  3NHN A;  1PD0 A;  3VS0 A;  3JB9 H;  5KYW A;  4M77 C;  1UTI A;  1WHJ A;  2CP3 A;  1Q81 R;  4C0F A;  4LUE A;  1PM3 A;  2K2M A;  2QQ9 A;  2VVK A;  2ZNJ A;  3HRS A;  3V8K A;  3X20 B;  3CXC S;  3OW2 S;  3VRY A;  4J9F A;  2RK2 A;  4PLL A;  5GAO q;  1U3O A;  3GNF B;  4E7L A;  1TU0 B;  1PC0 A;  3CPW S;  2ED1 A;  1RAA B;  1ZBJ A;  3UF4 A;  1VQ5 A;  1WZO A;  2QHS A;  4P72 A;  3V8L A;  2CJA A;  2Z0W A;  1M90 U;  4QVC A;  5C51 B;  2QGG A;  3VUB A;  1NJ2 A;  1VYV A;  4EPC A;  3REU A;  2NUT A;  3HPW A;  4WJ4 A;  4WF2 A;  4M77 D;  2O31 A;  3I5R A;  4XEM A;  3H41 A;  1JJ2 A;  1K0S A;  3L4G B;  4OVA A;  4C8Q C;  4J6Y A;  4LD6 A;  2XGT A;  2DMO A;  2EWN A;  2EVR A;  2GTJ A;  2KDS A;  2KRO A;  2I4N A;  2F5T X;  1XJW B;  2NWM A;  4A4G A;  2RJD A;  1PKS A;  1JQQ A;  2K79 A;  3GOX A;  2L8D A;  2E6Z A;  2J7I A;  1JJC B;  2GQV A;  2DDZ A;  2GNC A;  3A7A A;  1JXM A;  5KYY A;  1TOV A;  1YN8 A;  5KNN A;  3UH0 A;  2JJ9 A;  4HWS A;  2JXB A;  4HVV A;  3OYJ A;  5FWC A;  4RTY A;  4BDZ A;  3HFZ B;  5A0G A;  1RIQ A;  3UAT A;  2GTO A;  2JT4 A;  2XID A;  4P3N A;  2DD4 A;  4F14 A;  4A4H A;  4Z8A A;  4EMK C;  2ZNI A;  2LDM A;  4PJL A;  5CQX A;  2YRV A;  1G3T A;  3FB9 A;  1QVF S;  3CD6 Q;  1VQ6 T;  1PHT A;  1GXI E;  4M4Z A;  2V26 A;  2ALY B;  4FCY A;  1HXD A;  3CMA T;  2KT8 A;  4JLG A;  2ZGW A;  4HWT A;  4QQ6 A;  4TVA A;  4M77 F;  5KYU B;  3X26 B;  4M7A A;  4AT1 B;  4C8Q G;  1K8A C;  2I4O A;  3VS4 A;  2DTO A;  5CK9 A;  2HQX A;  5HK0 A;  4XU3 A;  3NTI A;  2A8E A;  2CZ0 B;  3S6W A;  5KE3 A;  1T3S A;  1X69 A;  2CRE A;  4KR2 A;  3KXT A;  4C8Q F;  2EKO A;  4FW1 A;  4M75 B;  4ELY C;  1W2B A;  3CCS Q;  3P8Y A;  3LW5 E;  2NUZ A;  1M2V A;  4LDY A;  4RTX A;  4KUD K;  3OBW A;  1ZSZ C;  2CT3 A;  3CCJ Q;  3MJX A;  2RD1 A;  4RDX A;  3VRZ A;  1X75 C;  2XI9 A;  1VQ4 A;  4DBF A;  1C1A A;  4BDY A;  3QWY A;  4YRI A;  3QNE A;  4QVD A;  1YWP A;  3X25 B;  3EFO B;  1I0C A;  1XQH A;  1SSH A;  3M0U A;  2E5Q A;  3I55 A;  1TTH B;  2DXC A;  2ODR C;  1ZX6 A;  2DBM A;  1M5Q 1;  5CIU A;  3PE0 A;  1QVG A;  4M7D D;  4CH6 A;  2C06 A;  2I4L A;  1PYS B;  4HCZ A;  3CD6 T;  2JUF A;  3KBG A;  4LE9 A;  4PJO C;  1RI9 A;  3MPU B;  3E9H A;  3DB4 A;  4O2D A;  3PMI A;  2E6N A;  4OMP A;  4M75 E;  4C0D B;  4LN2 A;  3JCM g;  3JB9 D;  4RQF A;  3OYA A;  1GCQ C;  2ZXF A;  3NPF A;  4PJO D;  2R58 A;  3SHW A;  5GAN 5;  1H3H A;  2MYS A;  2ZPH B;  4FYW B;  1BCO A;  1NYF A;  2FRY A;  3RR6 A;  3CCM A;  3VS7 A;  4XEO A;  1KMN A;  3PCO B;  4PLI A;  4X1V A;  1D3B A;  4O6J A;  1N9S A;  3CC4 Q;  4J83 A;  2DL7 A;  1BBZ A;  1VQ5 Q;  2CJB A;  3TEH A;  2DXB A;  4N0A C;  1K76 A;  3NGP A;  3JCM c;  2MI6 A;  1EX4 A;  1OYX A;  4TVR A;  2X4X A;  3AT1 B;  2KT1 A;  1B7Y A;  4XTX A;  5GAM f;  1YIJ A;  2DXU A;  4HT4 A;  1I4K 1;  1D0Z A;  4TVY A;  3M0R A;  2SRC A;  4YRM A;  1HC7 A;  4EMK A;  5I2M A;  4IUU A;  2XTI A;  3NEM A;  4FIB A;  3I55 Q;  3M0Q A;  4K11 A;  5CCA A;  4M77 E;  1AVZ C;  2ZR3 A;  1LCK A;  4ME7 A;  5IN1 A;  3PNW C;  1KFZ A;  2ZPI B;  1RAE B;  3E9I A;  3JAM E;  5DY9 A;  3S3N A;  2BE9 B;  3G7Z A;  2JTE A;  1X6G A;  3PVQ A;  1D09 B;  2EIF A;  1AT1 B;  1GBQ A;  4KR3 A;  2YWW A;  1YHQ Q;  4DBQ A;  1OPL A;  1QKW A;  1ASY A;  5J3B A;  1UB4 A;  1G5V A;  1Q86 R;  1KD1 U;  4UP7 A;  4M7D G;  2A36 A;  4RG2 A;  2EJ9 A;  4ZN1 A;  5HCK A;  2RHU A;  4FL6 A;  2HMA A;  1BI0 A;  1OEB A;  4YRS A;  4PKC C;  1BIB A;  2PVD B;  1W4S A;  4HCK A;  2LNH B;  2EGA A;  2Y4X A;  2R57 A;  4FSX A;  2Y90 A;  1JJ2 P;  5ECA A;  2IY5 B;  1MV3 A;  2NS6 A;  2XU8 A;  1PNJ A;  5CQY A;  5GAN j;  3A8H B;  4EDU A;  4PJM A;  3CCQ Q;  1D0Y A;  2MIO A;  2CIM A;  5CKH A;  1X2K A;  4H2U A;  5C0M A;  2OTJ T;  1Q82 C;  4RCC A;  1JU5 C;  3CCR A;  2PME A;  3HFV A;  1VQ6 A;  2BKD N;  1MMD A;  4E7Z A;  1CKB A;  1OV3 A;  4M75 F;  2DD5 A;  3URG A;  2L89 A;  5GAN e;  8ATC B;  3REA B;  4F7U G;  2EGC A;  4HCC A;  3G71 Q;  2KI7 A;  2HNI A;  2DE0 X;  2C8M A;  3JCM b;  2C0O A;  2VV5 A;  4M7D B;  1M1K C;  3ZL7 C;  1VQK T;  2CSI A;  2VGM A;  2DQ0 A;  1RAH B;  5CKD A;  2RPN A;  4E7S A;  12AS A;  4IUT A;  1IHV A;  1YFS A;  4AFU C;  3CD6 A;  4QW2 A;  4Y92 A;  1NYQ A;  3SDZ A;  4LNP A;  4E7K A;  3WVE B;  1UG1 A;  1VQN Q;  3G1J A;  4YRT A;  1JBM A;  1P92 A;  5GJW B;  3QJ6 A;  4P3P A;  2DO3 A;  3TQ7 P;  4CH3 A;  2CH4 W;  2AZV A;  2FO0 A;  2X9H A;  1H4V B;  1Y07 A;  1PRM C;  5LJ5 g;  4IUV A;  1IGQ A;  5IHK A;  2ZZG A;  3L2U A;  1ADY A;  2ZZE A;  4YCW A;  2LTO A;  2CH4 A;  1SKU B;  4QT7 A;  3A98 A;  4ATO A;  4PK4 A;  1QE0 A;  2COW A;  2L2P A;  1I5O B;  2CT4 A;  2RA2 A;  3FC3 A;  2FPE A;  2XD0 A;  4J7I A;  1B34 B;  2PTK A;  2DNU A;  4OB0 B;  5FLX E;  2ECZ A;  2XG8 D;  4M75 D;  1K73 C;  2PMF A;  4P71 A;  4M78 F;  4HT8 A;  2V8I A;  4Q6G A;  2LJ1 A;  3JB9 J;  2RHQ A;  1K1Z A;  1KQS A;  4DEY A;  4XAX B;  2CDT A;  3OS0 A;  2K7A A;  2LP5 A;  2L3Q A;  4CC4 B;  3QDR B;  3THK A;  1YJN Q;  4RTZ A;  3CMA A;  5IH2 A;  3BDU A;  2QI2 A;  1RLQ C;  1VQM T;  3OS5 A;  2K3X A;  4C92 D;  1LYL A;  4ZTJ A;  2K5I A;  5HKC A;  3CCS T;  1ZQ1 A;  2AT1 B;  2CGH A;  4TVW A;  1NM7 A;  1SHF A;  2KXC A;  5FU6 B;  2PVG B;  4JJN K;  1SES A;  4LDX A;  3A32 A;  5FU6 C;  2R5M A;  1FWZ A;  4BE1 A;  3L2R A;  3T9N A;  2E3C A;  3CME T;  3V8J A;  4PJO A;  1B7Y B;  5GAO p;  2EQI A;  1Z7N A;  1C6V X;  2HDA A;  2VAS A;  5ELN A;  4H2S A;  1VUB A;  1VQL T;  2IVW A;  5KCH A;  2LC4 A;  4M78 D;  4FT2 A;  1M8M A;  3FDR A;  4J15 A;  2LQ8 A;  3QJY A;  3RL6 A;  2D8H A;  5DM7 R;  2HQH A;  5CR2 A;  4HVC A;  1U06 A;  3OS1 A;  1TUC A;  1Y7X A;  1IHW A;  2D9T A;  1J5W A;  5GJV B;  2DKG A;  1JJC A;  3ER0 A;  3QII A;  2QQR A;  4CC3 A;  1W66 A;  4A4E A;  3OSS C;  4C8Q E;  2V8K A;  1EFW A;  2QA4 A;  4P74 A;  1JRI A;  3JCM X;  4OGE A;  2D6F A;  1WI7 A;  2RHY A;  1YIT T;  1B7T A;  2FPD A;  3OYN A;  3HXV A;  1C0A A;  2V1R A;  2I0N A;  3CCR T;  4CS3 A;  3W3S A;  2ATC B;  1I81 A;  5A0L A;  5D6W A;  1TH7 A;  1TUD A;  2QGF B;  3NEL A;  4YCU A;  1AZE A;  1OOT A;  1ZHI A;  4JPB W;  5CKB A;  2ZT7 A;  1QVF P;  3FJ5 A;  3HXU A;  2BIV A;  3TEE A;  1RUW A;  1K9M U;  2YLC A;  5IXF A;  1VQZ A;  1FMV A;  1UGP B;  2RJC A;  3G71 A;  2CZ1 B;  2GCX A;  1IL2 A;  1YHQ A;  5GMK i;  2HBP A;  2DBK A;  3M0S A;  3JCM V;  4OLF A;  1HYO A;  3MEW A;  5LJ5 j;  1USY A;  4GY5 A;  5KH6 A;  3OYL A;  1G51 A;  1B70 A;  3OYM A;  2RMO A;  4KT0 E;  2J3L A;  5HGQ A;  4CC2 A;  1EIF A;  1E24 A;  4M7A D;  4KGX B;  1PCX A;  1GCP A;  4FYV B;  1IB8 A;  1ARK A;  1KIK A;  2J6K A;  1Q81 C;  4UPA A;  3IKL A;  1AD5 A;  1VIE A;  5GAN 4;  2CZ6 B;  5LJ5 e;  1R77 A;  3INZ A;  4MML A;  1WJQ A;  3FRN A;  2CSQ A;  3RMS A;  2ABL A;  3MP1 A;  1PKT A;  4PNO A;  4E7I A;  1GFD A;  2XDD A;  5IHI A;  3U23 A;  2FZK B;  1VIF A;  5LJ5 d;  3VU3 C;  2GF7 A;  4RTW A;  1BI1 A;  3MEY A;  4TTV A;  2RQU A;  4E7H A;  2FVU A;  1X2Q A;  1L0W A;  4JLI A;  1GL5 A;  3A7U A;  1M1F A;  4N4I A;  3JCM W;  2YDL A;  2L3P A;  1YFR A;  1TUG B;  1I07 A;  1WHM A;  2EQK A;  2QTV A;  1K8A U;  1X6B A;  3QDF A;  1MV0 B;  1RAB B;  4XK8 E;  3MCA B;  2P0L A;  2IIM A;  2O9S A;  5LJ3 e;  2QEX A;  3EAE A;  4Z88 A;  2YXY A;  1UEB A;  1KD1 R;  4M7D A;  3E2U A;  1WYD A;  2XHC A;  2CP5 A;  2HD0 A;  1VQP A;  2H8H A;  1K73 U;  2DJQ A;  5L23 A;  5DLQ E;  2AMC A;  5E3I A;  1QCF A;  3UWN A;  1FX7 A;  3HFN A;  1VQN A;  1OU9 A;  1KMM A;  1YBY A;  2WSC E;  5LJ3 j;  2O88 A;  2GFA A;  3JCM J;  3CME A;  3CCL Q;  1KQS S;  3HTZ A;  1Q7Y C;  3VQY A;  2DVE A;  4IIO A;  5KE2 A;  4CH5 A;  2DTH A;  2MPX C;  1JJ2 S;  3HL8 A;  2BUD A;  2KSS A;  3EG2 A;  3G4S Q;  4XU1 A;  1M90 C;  2K3B A;  2VC8 A;  1BCM A;  1BK2 A;  2ARS A;  1B07 A;  2GFU A;  2ZPE B;  1D1A A;  4XTZ A;  4BI3 A;  3P8T A;  5GAO m;  3OA6 A;  5FU7 B;  1VQK Q;  2P4T A;  2A28 A;  3EGX B;  5KYN A;  3QO7 A;  3J7A F;  3VS5 A;  2LNV A;  1N27 A;  1HTT A;  4LVK A;  1ABQ A;  5LJ5 h;  3EFO A;  1K8A R;  1Y96 B;  1OUL A;  3I9Q A;  1D1C A;  5D7U A;  1KQ1 A;  3VJP A;  2OTJ A;  2COY A;  5GAN g;  2DFU A;  3L42 A;  4M78 C;  3FEO A;  2KAF A;  4PJO E;  2QG9 B;  3CCQ A;  3OYI A;  2DL3 A;  1N8R R;  1QP3 A;  3C4S A;  2XK0 A;  2YLB A;  2QA4 Q;  3MHX A;  2W0Z A;  4F7U F;  1V76 A;  2YUN A;  3E9G A;  2ZT6 A;  2JN0 A;  1YJN A;  3CC2 A;  3NTK A;  2MWO A;  3EFS A;  1VQ9 A;  1QF6 A;  2DA9 A;  3A31 A;  4H2V A;  3SD4 A;  4HVW A;  2DJZ A;  1EVL A;  2ZIO A;  2FHD A;  1TWB A;  2E5K A;  2EYQ A;  3HRU A;  2B86 A;  3LGL A;  2YUQ A;  4BI8 B;  1OU8 A;  4CS2 A;  2M9U A;  3H8Z A;  2DYB A;  2ZTG A;  1AWW A;  3VYG A;  2KE9 A;  3CCL T;  4HT9 A;  2D0Q B;  4TVA B;  3JV3 A;  2BZ8 A;  4CC7 A;  3VQV A;  4M78 A;  4MZM A;  3DLL A;  1X6O A;  1VQL Q;  1YGB A;  1N8R C;  2PQW A;  4YRJ A;  5I21 A;  4P73 C;  1IXD A;  2H3E B;  2JMA A;  2LVM A;  2X35 A;  1YIJ T;  1VQO T;  3PIO A;  5GAN 8;  3GBQ A;  4LDW A;  2DVJ A;  4TQF A;  1K9M C;  3X24 B;  1FYF A;  2J3M A;  3MEU A;  2ZT8 A;  2EJG A;  1AEY A;  1C0M A;  2VYT A;  3RAC A;  5L8R E;  2VXE A;  3RDV A;  4C0G A;  3D7S B;  3VS6 A;  1SRM A;  3CC2 T;  1BKB A;  3L1A A;  2KRM A;  3RGL A;  3HXX A;  3IKM B;  4XTV A;  4PJO G;  2XIC A;  3CC7 A;  4C0D C;  1YHQ T;  5GMK l;  2CP7 A;  3M58 A;  2ZIN A;  4OB2 B;  3JCM Q;  3JRZ A;  3TSZ A;  2F2X A;  4JZ4 A;  4P74 C;  1CKA A;  4QQG A;  4H2Y A;  4LNS A;  1WFW A;  5IHN A;  1SHG A;  4XTU A;  4C92 G;  4EIK A;  1WHG A;  1W70 A;  1ABO A;  1UGR B;  1YWO A;  1YJ9 T;  1VQ8 A;  2ROT A;  4HWO A;  4MDX A;  1LJO A;  2CP6 A;  1H64 1;  2DLP A;  2DF6 A;  1Y0M A;  4YRG A;  1S72 Q;  2QEX T;  3LWH A;  3A7R A;  3NMZ C;  4OMF B;  4LVM A;  4M7D C;  5M9O A;  1NLP C;  4BE0 A;  3LSS A;  2J05 A;  2ENM A;  2ODR D;  4M75 C;  2J6F A;  3GF5 A;  5EG2 A;  1PSF A;  4FT4 A;  1AHJ B;  1N5Z A;  1VQP Q;  5C53 B;  4PFO A;  5GAM h;  1I1J A;  2EQU A;  5GAM d;  3L2V A;  5GAN d;  1QMC A;  5ELO A;  1ZSZ B;  4RCB A;  3RKW A;  2KGT A;  4ZGD B;  4YRC A;  1N9W A;  2ZR2 A;  3TU4 K;  3PVL A;  4PJO F;  1Q7Y R;  4H2T A;  1GCQ A;  3A8M B;  4BAC A;  1YI2 T;  3G6E T;  1YIT A;  1EVK A;  2EQJ A;  2CJ9 A;  1D0X A;  3OB9 A;  3G4S A;  3HKS A;  1UGS B;  3MO8 A;  5KYW B;  4V2S A;  2X4W A;  3MEV A;  4AG2 C;  1SEM A;  2IPO B;  2CUB A;  1QCO A;  2DAQ A;  2EYX A;  1VQK A;  5CKF A;  1G3S A;  3HXY A;  4F04 B;  5GAN 7;  4XQ3 A;  3MP8 A;  2NUP A;  4JRK A;  1NJI C;  2VKN A;  1LOJ A;  1VQN T;  1ACM B;  2BZX A;  2ALY A;  2WAC A;  1BI2 A;  1NE8 A;  1B3Q A;  2W10 A;  3EG9 A;  1M3A A;  2LQW A;  5FRO A;  1VQ4 Q;  2K3Y A;  5LJ3 f;  3H0F A;  4IKF A;  2AZS A;  1K9A A;  2O2O A;  1ZUU A;  4F7U A;  3CCV A;  2NUP B;  1AZG B;  3CBO A;  1V1C A;  3ZFJ A;  1YIJ Q;  3EGU A;  2E1H A;  1YCS B;  3FLG A;  4E2F B;  4D6W A;  1WJR A;  2RQT A;  3UA7 A;  4M7A B;  1I5L A;  2XMF A;  2LZ6 B;  4PJJ A;  4D8K A;  3UGQ A;  11AS A;  1YJW A;  1Q86 C;  1Q95 G;  3WQZ A;  2GGR A;  2Q7G A;  4Z89 A;  1UEC A;  2HL3 A;  3NEN A;  2EYW A;  4L87 A;  2X3W D;  1NJ5 A;  3ME9 A;  3BE3 A;  3OYG A;  1FMK A;  4C8Q B;  4YDQ A;  1NYR A;  2VWF A;  5GAM e;  1XNI A;  4OML A;  2RJE A;  4JS4 A;  4BWA A;  2BZY A;  3MKD A;  2CP2 A;  2MCN A;  3HFZ A;  3F70 A;  1NPP A;  4YCV A;  3CEY A;  1W1F A;  4QKU A;  1PWT A;  4GLK A;  4HKE A;  2DRK A;  1OX8 A;  4C92 E;  2AKW A;  2FPF A;  1QVP A;  5KYY B;  4PFP A;  3OYH A;  1X27 A;  4K86 A;  1U8R A;  1SPK A;  2Q5I A;  2XDB A;  2EQM A;  1Q82 U;  4RQE A;  4X34 A;  4C0Z A;  1USY C;  2QAZ A;  4F16 A;  2AKL A;  1VOM A;  3UFG A;  1VQ7 T;  2HEQ A;  3CCU T;  4YRL A;  1NEB A;  1B76 A;  2JTF A;  3CBP A;  5HK3 A;  4RG8 A;  4R0K A;  3NET A;  3P8V A;  2K5F A;  4LVL A;  2AMC B;  1EIY B;  2NUT B;  3OYY A;  2L0A A;  4AFS C;  5D6X A;  2J6O A;  3I5S A;  1VQ8 Q;  4M75 G;  1KQS P;  4UP9 A;  2RF0 A;  2DET A;  2LJ3 A;  4HA8 A;  1KSW A;  4IUP A;  4TQD A;  5I22 A;  1X01 A;  1VYU A;  2EFI A;  3A1P A;  3I35 A;  4BE2 A;  4OB3 B;  5I11 A;  1HD3 A;  4FYY B;  4KH1 B;  1H4T A;  1X2H A;  2LCC A;  1RAI B;  2QA4 T;  1G5H A;  4WI1 A;  2D0N A;  2YT6 A;  3C12 A;  4OMN A;  2RHQ B;  2C0T A;  4EMG A;  1G3Y A;  1M2V B;  4MMK A;  1RI0 A;  1WA7 A;  3RUX A;  3LLR A;  3FJP A;  4RMF A;  1BI3 A;  1E6G A;  1E6H A;  5DLO A;  1JB0 E;  2QK0 A;  3OQ5 A;  4FYX B;  4IUQ A;  5KYX B;  3OMG A;  5GAM g;  1U1T A;  4KUI A;  1HJD A;  2ED0 A;  1UUE A;  1E7O A;  9ATC B;  3SFM A;  4HXJ A;  2A3L A;  1SRL A;  4CI0 C;  4R55 A;  1WLP B;  2LT1 A;  1UE9 A;  2JM8 A;  2CZ7 B;  2PUO B;  2P84 A;  2QQB A;  2DIL A;  4GBQ A;  3PT9 A;  1FXX A;  4DEX A;  3CCQ T;  3H0I A;  4FW2 A;  3FIF A;  2E3I A;  3QZ5 B;  3LH0 A;  1WJS A;  1WDX A;  3OMC A;  4YRR A;  2G6F X;  3QWX X;  2P4R A;  1M2O A;  3HY0 A;  2EPD A;  3A5Y A;  4Q5W A;  2L5Q A;  4LUD A;  3CCU Q;  1BB9 A;  4RTV A;  2PVO B;  3I7F A;  1WGS A;  4C92 B;  1NJ6 A;  2HSE B;  5GAO l;  4DBR A;  3BW1 A;  1SER A;  2A0F B;  2EBP A;  1FYN A;  3TCJ A;  4DBH A;  4FU6 A;  2I4M A;  4H2W A;  3TUP A;  1RLP C;  3RBB B;  3CCV Q;  3JB9 F;  2LT4 A;  4PG3 A;  5LJ5 f;  2DM1 A;  1O75 A;  2KYB A;  4PHC A;  1UHC A;  3EG3 A;  2R5A A;  2E10 A;  3I56 A;  1IGU A;  3E19 A;  1M3B A;  3P8B B;  3M53 A;  4PFZ A;  3LX7 A;  3S3O A;  1WPY A;  3MF2 A;  2BE7 D;  2M16 A;  4J9G A;  2HBW A;  2FRW A;  3OW2 P;  1YJW Q;  4M7A F;  2DL8 A;  3X28 B;  3EH1 A;  4LD9 K;  2RH2 A;  4JZ3 A;  2K4Y A;  3SWN C;  1VQ7 Q;  3OYF A;  4C5H A;  3QKJ A;  3RNJ A;  1KC8 U;  6AT1 B;  3TRE A;  1UGV A;  2F1L A;  3CCM T;  4H2X A;  1HSQ A;  1GBR A;  2FL7 A;  2M0O A;  2IY5 A;  3M4Q A;  3MF1 A;  1VQ8 T;  1NJI R;  4BI4 A;  1Q86 U;  3UGT A;  5LJ3 d;  2DZ9 A;  1NLO C;  1UFF A;  1S1N A;  1BYM A;  4J6W A;  2RO0 A;  1WU7 A;  4HWR A;  2DPP B;  3QYH B;  4C5E A;  3WVD B;  2HZY A;  2QHU A;  4YRE A;  4QQD A;  3CC7 Q;  3BY7 A;  2OI3 A;  2E3H A;  4P3O A;  2DER A;  2EJF A;  5FW9 A;  3I56 T;  5C52 B;  4P71 C;  3CCJ A;  1KHI A;  2KXD A;  3QO3 A;  1OPK A;  4QVZ A;  1R0C B;  2K5L A;  2LCS A;  2RHS A;  2OTL Q;  4A4K A;  2RI5 A;  2PZ1 A;  1SET A;  3CMA Q;  3RIR A;  2COZ A;  3M55 A;  2LMJ A;  5IT9 E;  3WXM B;  2DZC A;  1S72 A;  3ERR A;  1YI2 A;  4XU0 A;  4P75 C;  2YSQ A;  4N4H A;  2LRQ A;  1EQR A;  4AFZ C;  1NG2 A;  1JEG A;  5KYU A;  4L5G A;  2EAY A;  4DPG A;  1OQK A;  1WHH A;  3OYD A;  4EX5 A;  1UJY A;  1YCY A;  5IXB A;  3VS3 A;  5I2S A;  4Z02 A;  4M7A C;  1M27 C;  3M5A A;  5GMK e;  4KRT A;  1H92 A;  4YRN A;  8AT1 B;  3R6N A;  3G6E A;  2FZG B;  3M4P A;  3M54 A;  2DU7 A;  3G4S T;  1K4U S;  2K2V A;  4II1 A;  2RQV A;  4R56 A;  2ZCE A;  3EHQ A;  4HCB A;  3OYC A;  4L6V 5;  4CH4 A;  1WQW A;  3CCJ T;  1RAC B;  2O4X B;  4OMM A;  2PNI A;  2RI3 A;  2DEQ A;  2QXF A;  3RES A;  3M9Q A;  2F2V A;  1X54 A;  4PL6 A;  2KNB B;  1W6X A;  4D8D A;  3QXE B;  3P8H A;  4J5Y A;  3RMQ A;  3QYG B;  3HP9 A;  2JNG A;  2RHS B;  1XTD A;  1TG0 A;  1KC8 R;  4OP0 A;  1NJ1 A;  4WTO B;  2HSP A;  4NL2 A;  3CCE T;  3J81 E;  2MK5 A;  2JW4 A;  2DU5 A;  3I55 T;  1UDL A;  1JXO A;  3RKX A;  1UJ0 A;  1WX6 A;  2DK3 A;  4AFQ C;  4ZN3 A;  4G85 A;  2JS0 A;  1YI2 Q;  1VQM Q;  1W2B S;  3QTC A;  2KRN A;  2O9V A;  1EFN A;  2AIR B;  3VYH B;  3CPW A;  3O5Z A;  4RUG A;  4B9W A;  2P5I A;  2E64 A;  2L3S A;  4M78 G;  4NOY A;  3OS2 A;  2AHJ B;  2L3R A;  4DA4 A;  4ZGE B;  4N4G A;  5J26 A;  4BW9 A;  1MND A;  3EGD A;  5D6Y A;  2F5K A;  2AKK A;  2DL4 A;  2CP0 A;  1X56 A;  3QSU A;  2E12 A;  4M77 A;  3H0H A;  3IG2 A;  4X5O A;  3LSQ A;  1VQ7 A;  1TSF A;  1IO6 A;  2RHZ A;  1B8A A;  2X51 A;  4C92 C;  2JTM A;  3CXC A;  1HK9 A;  1T0J A;  4HWP A;  3N5B B;  5FRN A;  3REX A;  1QW1 A;  1YNZ A;  4ESR A;  4Y91 A;  1MNE A;  4BY6 C;  5GAN f;  3SB2 A;  3CBM A;  2JM9 A;  4J8O A;  2XKO C;  5GAO r;  3OBY A;  1QVG P;  1PG5 B;  2KBT A;  4Y28 E;  2VB6 A;  1KHC A;  4P5N A;  4YTL A;  4RKU E;  4F7U B;  3EG0 A;  5KYX A;  3SWN B;  1WYX A;  2DIQ A;  1PRL C;  2GBQ A;  2X4J A;  1X2G A;  2Q7H A;  5CAI A;  1MMA A;  4BY6 B;  3QO5 A;  3VV0 A;  3CCR Q;  3ZEH A;  3UPU A;  4M78 B;  1KOG A;  1ZLM A;  2QEX Q;  4L59 A;  1N6A A;  2PU9 B;  4ANJ A;  4H02 A;  4LXC A;  2KRS A;  3OSV A;  1WHL A;  1BU1 A;  4ZGJ B;  3JSC A;  4GLM A;  1CSK A;  2CKK A;  2OAU A;  4P73 A;  3Q1J A;  1H3Z A;  1H4Q A;  3QG1 A;  1NBE B;  2RJF A;  4X9C A;  4M7A G;  3QO8 A;  3OYK A;  4IUR A;  3QBY A;  2ART A;  3PZC A;  3R07 A;  3L2W A;  3CQT A;  5K1P A;  1EIY A;  3HXZ A;  2O01 E;  2M0Y A;  1VYT A;  3LH5 A;  1RL2 A;  1E1T A;  1RAG B;  5J39 A;  3VS1 A;  1WXU A;  2P0K A;  4MZT A;  4F7U E;  3CCE Q;  1Y71 A;  1VQL A;  5KCO A;  3CCM Q;  2MOX A;  1QLY A;  4YRQ A;  4C5G A;  3G6E Q;  5F5W A;  1MMG A;  3L4G A;  4A4F A;  4EO4 A;  4YRP A;  2DTI A;  4E6R A;  3ULR B;  2D8J A;  4ZTZ B;  2KK4 A;  1M30 A;  4A63 B;  4H2X B;  3QHS A;  2AKW B;  1QP2 A;  1AOJ A;  4OMO A;  5GMK h;  1T3L A;  2RM4 A;  2E65 A;  4J9C A;  4CS4 A;  3LWI A;  3CPW P;  4JS5 A;  5K1X A;  1WLE A;  2CYZ B;  2RQR A;  3C0C A;  2DQ3 A;  2VGN A;  3ZBD A;  1D1B A;  3O8V A;  1EZZ B;  4RTU A;  3HHT B;  2LJ0 A;  3DB3 A;  3GLX A;  2QHT A;  3HRI A;  3HRK A;  5C6S A;  1M9S A;  1RAF B;  2C0I A;  4M7D E;  1U1S A;  4OMQ A;  1ASZ A;  2K57 A;  4PJN A;  1GRI A;  2WSE E;  3RKY A;  4KUL A;  7AT1 B;  3JCM f;  1YJN T;  4P75 A;  2A7Y A;  1MGQ A;  3KFV A;  3G71 T;  2DXT A;  3PMT A;  4AG1 C;  4YRF A;  2ZAE A;  4JRI A;  1YFN A;  4C8Q A;  1Z7M A;  2Q5H A;  2E4H A;  2OTL T;  3CME Q;  3CCL A;  1Y57 A;  2ZCF B;  4J7F A;  1AWX A;  4EMH A;  3TVT A;  1IZ6 A;  4MDW A;  3KUF A;  4JUV A;  4DQ2 A;  2MWP A;  3LYI A;  3R6O A;  1E22 A;  1B34 A;  1N9R A;  4UC4 A;  2LCL A;  3M59 A;  3A8L B;  2G4C A;  4WJ3 M;  1NPR A;  2JMC A;  1AWJ A; 
#chains in the Genus database with same CATH homology
 3CC4 T;  1KD1 C;  1VQO A;  1NJI U;  4X9D A;  5CVI A;  4BUG A;  4E7J A;  4VUB A;  4EMK B;  4ZTF A;  2X4Y A;  2I2L A;  1M1G A;  2P0P A;  4FM4 B;  4RMO A;  3OY9 A;  2JVV A;  2QQA A;  5CO7 A;  2Y4Y A;  4G84 A;  1M4Z A;  3SWN A;  3L2Z A;  4ELZ C;  3CC7 T;  2MMP A;  2ZPG B;  3CMQ A;  2E70 A;  3MET A;  4MZP A;  1BIA A;  5AYF A;  4LVI A;  1S72 T;  1VQM A;  2RHI A;  4DOW A;  2JOY A;  2OTL A;  2E5A A;  1V29 B;  3V7C A;  4B9X A;  3V7R A;  4K88 A;  3JCM e;  3A8G B;  3NTH A;  3QPH A;  1H4S A;  4O5V A;  1UGQ B;  1VQP T;  1G5I A;  3QUI A;  3RF1 A;  3KFU A;  1OI1 A;  1Q7Y U;  4E47 A;  2MAM A;  4XTW A;  3L2Q A;  5LL6 S;  4C92 F;  3OYE A;  1KG1 A;  2KY9 A;  4DOV A;  1PYS A;  4OB1 B;  3CCE A;  1YB3 A;  3E9F A;  2IG0 A;  2ZZD A;  3M56 A;  3MEA A;  3HXW A;  2M1H A;  1WQ7 A;  3VQX A;  3GPL A;  1QVG S;  2O4X A;  3E1S A;  5A0D A;  4C92 A;  3J80 E;  2VXF A;  2G3R A;  4C8Q D;  1M8V A;  2DIG A;  4KBM B;  3UDC A;  2WSF E;  3BFM A;  1NJ8 A;  3LC0 A;  2PUK B;  2FYK A;  4NL3 A;  3S3M A;  4XTY A;  2FB7 A;  4UP8 A;  4K87 A;  2HAX A;  2Q7E A;  5IAY A;  4Q15 A;  5A2Q E;  3VQW A;  2NLU A;  1BBW A;  3TEG A;  1LNX A;  4ZIB A;  3A5Z A;  2HQE A;  3A5Z B;  1X55 A;  1YFT A;  2ZT5 A;  3BDL A;  3DKM A;  1ATI A;  3M4Y A;  4OF1 A;  4NCX A;  4M7A E;  4CRI A;  3QZ9 B;  1XOV A;  1B70 B;  1YJW T;  4J6X A;  3H6Z A;  5LJ3 h;  1NZ9 A;  5CKE A;  2QHV A;  1N8R U;  3AHU A;  4OGC A;  4YRO A;  1DJ7 B;  2E41 A;  3VBB A;  5HY6 A;  1EOV A;  4BB7 A;  5GMK j;  1VQ5 T;  5GAN 2;  1Y96 A;  2LX9 A;  3CC4 A;  5FRM A;  3G1Z A;  4JDS A;  3V7S A;  3JB9 I;  5GAO n;  2KVQ G;  2ZZF A;  2VUB A;  2RI2 A;  5GAN h;  1QVF A;  3JCM h;  3JB9 G;  3PTA A;  4M77 B;  2LQK A;  3VUZ A;  1M1K U;  3GIB A;  3OD1 A;  2P0Q A;  5GAM j;  2RB6 A;  2EL9 A;  4YYE A;  3NFC A;  3JCM d;  5GAN 3;  3ASK A;  1OZ3 A;  3GP8 A;  3C94 A;  3HSB A;  2JZ2 A;  5FU7 C;  2MF2 A;  1YJ9 A;  3MP6 A;  3TEH B;  4JRQ A;  2C7I A;  3CCU A;  3HRT A;  4LVJ A;  4KQE A;  2QDY B;  1D3B B;  3PCO A;  3ICA A;  4LDV A;  3PIP A;  1GGM A;  4ZTU B;  4E51 A;  3P8D A;  3A74 A;  3PGG A;  4M78 E;  2KMT A;  3PFS A;  1NNH A;  2H3J A;  2KQW A;  3GNG A;  1KQ2 A;  2B8A A;  3DLM A;  1KC8 C;  1ADJ A;  1O9S A;  3DSQ A;  1SRY A;  2QTX A;  4PJO B;  4M77 G;  1VQ4 T;  2ZPF B;  3M57 A;  3JCM P;  2YHT A;  4C5I A;  5GAN 6;  2QQS A;  2ZIM A;  1G3W A;  3HFO A;  4JRP A;  3C95 A;  3OW2 A;  4BD3 A;  4AH6 A;  4A53 A;  5GMK m;  2ZPB B;  2F69 A;  1Q81 U;  4YRK A;  2ARU A;  3VKI A;  3M4G A;  3CCS A;  1WNL A;  3BJU A;  4N0A A;  1BBU A;  3EFR A;  1SSF A;  3CPF A;  1E1O A;  4NS5 A;  4P72 C;  2XDP A;  4YP0 A;  2V8J A;  1R8O B;  1VQ9 T;  2RK1 A;  3OYB A;  4M75 A;  3IAL A;  1IRE B;  1ZBX A;  3MQZ A;  4TWA A;  1PSE A;  3CCV T;  3HY1 A;  4YPF A;  1OZ2 A;  5LJ3 g;  4M7D F;  1I8F A;  3A8O B;  3RER A;  2RHX A;  4XU2 A;  4LDU A;  1MHN A;  3UT1 A;  3LGF A;  2CS7 A;  3JB9 H;  4M77 C;  4C0F A;  2QQ9 A;  2ZNJ A;  3HRS A;  3V8K A;  3X20 B;  3CXC S;  3OW2 S;  2RK2 A;  4PLL A;  5GAO q;  3GNF B;  4E7L A;  3CPW S;  1VQ5 A;  4P72 A;  2QHS A;  3V8L A;  2CJA A;  1M90 U;  4QVC A;  5C51 B;  3VUB A;  1NJ2 A;  4EPC A;  3REU A;  3HPW A;  4WJ4 A;  4WF2 A;  4M77 D;  4XEM A;  1JJ2 A;  3L4G B;  4OVA A;  4C8Q C;  4J6Y A;  4LD6 A;  2XGT A;  2EWN A;  2KDS A;  2I4N A;  2F5T X;  4A4G A;  2RJD A;  3GOX A;  2L8D A;  2E6Z A;  1JJC B;  2GQV A;  2DDZ A;  3A7A A;  5KNN A;  3UH0 A;  4HWS A;  3OYJ A;  4BDZ A;  3HFZ B;  5A0G A;  1RIQ A;  2XID A;  4P3N A;  2DD4 A;  4A4H A;  4EMK C;  2ZNI A;  2LDM A;  5CQX A;  2YRV A;  1G3T A;  3FB9 A;  1QVF S;  1VQ6 T;  1GXI E;  2ALY B;  1HXD A;  3CMA T;  4JLG A;  2ZGW A;  4HWT A;  4QQ6 A;  4TVA A;  4M77 F;  4M7A A;  3X26 B;  4C8Q G;  1K8A C;  2I4O A;  2DTO A;  5CK9 A;  2HQX A;  5HK0 A;  4XU3 A;  3NTI A;  2A8E A;  2CZ0 B;  3S6W A;  5KE3 A;  4KR2 A;  3KXT A;  4C8Q F;  2EKO A;  4M75 B;  4ELY C;  1W2B A;  3P8Y A;  3LW5 E;  4LDY A;  4KUD K;  3OBW A;  2RD1 A;  4RDX A;  1X75 C;  2XI9 A;  1VQ4 A;  4BDY A;  4YRI A;  3QNE A;  4QVD A;  3X25 B;  1XQH A;  2E5Q A;  3I55 A;  2DXC A;  2ODR C;  1M5Q 1;  5CIU A;  1QVG A;  4CH6 A;  4M7D D;  2C06 A;  2I4L A;  1PYS B;  4HCZ A;  3CD6 T;  2JUF A;  3KBG A;  4PJO C;  3E9H A;  3DB4 A;  4O2D A;  3PMI A;  2E6N A;  4C0D B;  4M75 E;  3JCM g;  3JB9 D;  4RQF A;  3OYA A;  2ZXF A;  4PJO D;  2R58 A;  5GAN 5;  2ZPH B;  3CCM A;  4XEO A;  1KMN A;  3PCO B;  4PLI A;  1D3B A;  4O6J A;  1N9S A;  4J83 A;  2CJB A;  3TEH A;  2DXB A;  4N0A C;  3JCM c;  2MI6 A;  1OYX A;  4TVR A;  2X4X A;  1B7Y A;  4XTX A;  5GAM f;  1YIJ A;  2DXU A;  4HT4 A;  1I4K 1;  4TVY A;  4YRM A;  1HC7 A;  4EMK A;  5I2M A;  4IUU A;  2XTI A;  3NEM A;  4FIB A;  5CCA A;  4M77 E;  2ZR3 A;  4ME7 A;  5IN1 A;  3PNW C;  2ZPI B;  3E9I A;  3JAM E;  5DY9 A;  3S3N A;  3G7Z A;  2EIF A;  4KR3 A;  1ASY A;  5J3B A;  1UB4 A;  1G5V A;  1KD1 U;  4UP7 A;  4M7D G;  4RG2 A;  2EJ9 A;  4ZN1 A;  2RHU A;  4FL6 A;  1BI0 A;  4YRS A;  4PKC C;  1BIB A;  2PVD B;  1W4S A;  2Y4X A;  2R57 A;  4FSX A;  2Y90 A;  2IY5 B;  2NS6 A;  2XU8 A;  5CQY A;  5GAN j;  3A8H B;  4EDU A;  2CIM A;  5CKH A;  4H2U A;  5C0M A;  2OTJ T;  1Q82 C;  4RCC A;  3CCR A;  2PME A;  3HFV A;  1VQ6 A;  2BKD N;  4M75 F;  2DD5 A;  3URG A;  2L89 A;  5GAN e;  4F7U G;  4HCC A;  2HNI A;  2C8M A;  3JCM b;  2VV5 A;  4M7D B;  1M1K C;  1VQK T;  2VGM A;  2DQ0 A;  5CKD A;  12AS A;  4IUT A;  1YFS A;  3CD6 A;  4QW2 A;  1NYQ A;  3SDZ A;  4E7K A;  3WVE B;  4YRT A;  1JBM A;  1P92 A;  3QJ6 A;  4P3P A;  2DO3 A;  4CH3 A;  1H4V B;  1Y07 A;  5LJ5 g;  4IUV A;  2ZZG A;  3L2U A;  1ADY A;  2ZZE A;  4YCW A;  2LTO A;  4ATO A;  1QE0 A;  3FC3 A;  2RA2 A;  2XD0 A;  4J7I A;  1B34 B;  4OB0 B;  5FLX E;  2XG8 D;  4M75 D;  1K73 C;  2PMF A;  4P71 A;  4M78 F;  4HT8 A;  2V8I A;  4Q6G A;  3JB9 J;  2RHQ A;  1KQS A;  4XAX B;  3OS0 A;  3QDR B;  3CMA A;  3BDU A;  2QI2 A;  1VQM T;  3OS5 A;  2K3X A;  4C92 D;  1LYL A;  4ZTJ A;  2K5I A;  5HKC A;  3CCS T;  1ZQ1 A;  2CGH A;  4TVW A;  5FU6 B;  2PVG B;  4JJN K;  1SES A;  4LDX A;  3A32 A;  5FU6 C;  2R5M A;  1FWZ A;  4BE1 A;  3L2R A;  3T9N A;  2E3C A;  3CME T;  3V8J A;  4PJO A;  1B7Y B;  5GAO p;  1Z7N A;  5ELN A;  4H2S A;  1VUB A;  1VQL T;  2IVW A;  5KCH A;  2LC4 A;  4M78 D;  4FT2 A;  3FDR A;  4J15 A;  2LQ8 A;  3QJY A;  3RL6 A;  5DM7 R;  5CR2 A;  4HVC A;  3OS1 A;  1Y7X A;  2D9T A;  1J5W A;  2DKG A;  1JJC A;  3ER0 A;  3QII A;  2QQR A;  1W66 A;  4A4E A;  3OSS C;  4C8Q E;  2V8K A;  1EFW A;  2QA4 A;  4P74 A;  1JRI A;  3JCM X;  4OGE A;  2D6F A;  2RHY A;  1YIT T;  3OYN A;  3HXV A;  1C0A A;  3CCR T;  4CS3 A;  3W3S A;  1I81 A;  5A0L A;  5D6W A;  1TH7 A;  3NEL A;  4YCU A;  1ZHI A;  5CKB A;  2ZT7 A;  3HXU A;  2BIV A;  3TEE A;  1K9M U;  2YLC A;  1VQZ A;  1UGP B;  2RJC A;  3G71 A;  2CZ1 B;  2GCX A;  1IL2 A;  1YHQ A;  5GMK i;  2HBP A;  3JCM V;  4OLF A;  3MEW A;  5LJ5 j;  1USY A;  4GY5 A;  5KH6 A;  3OYL A;  1G51 A;  1B70 A;  3OYM A;  4KT0 E;  2J3L A;  5HGQ A;  1EIF A;  1E24 A;  4M7A D;  1Q81 C;  4UPA A;  3IKL A;  1VIE A;  5GAN 4;  2CZ6 B;  5LJ5 e;  3INZ A;  4MML A;  1WJQ A;  3FRN A;  3RMS A;  3MP1 A;  4PNO A;  4E7I A;  2XDD A;  1VIF A;  5LJ5 d;  3VU3 C;  2GF7 A;  1BI1 A;  3MEY A;  4TTV A;  4E7H A;  2FVU A;  1L0W A;  4JLI A;  3A7U A;  1M1F A;  4N4I A;  3JCM W;  1YFR A;  2EQK A;  1K8A U;  4XK8 E;  3MCA B;  2P0L A;  5LJ3 e;  2QEX A;  3EAE A;  1UEB A;  4M7D A;  1WYD A;  2XHC A;  2HD0 A;  1VQP A;  1K73 U;  5DLQ E;  2AMC A;  5E3I A;  3UWN A;  1FX7 A;  3HFN A;  1VQN A;  1KMM A;  1YBY A;  2WSC E;  5LJ3 j;  2GFA A;  3JCM J;  3CME A;  1KQS S;  3HTZ A;  1Q7Y C;  3VQY A;  2DVE A;  5KE2 A;  4CH5 A;  2DTH A;  1JJ2 S;  3HL8 A;  2BUD A;  2KSS A;  4XU1 A;  1M90 C;  2VC8 A;  2ARS A;  2GFU A;  2ZPE B;  4XTZ A;  4BI3 A;  3P8T A;  5GAO m;  3OA6 A;  5FU7 B;  2P4T A;  3QO7 A;  3J7A F;  2LNV A;  1N27 A;  1HTT A;  4LVK A;  5LJ5 h;  1Y96 B;  1KQ1 A;  3VJP A;  2OTJ A;  5GAN g;  3L42 A;  4M78 C;  3FEO A;  2KAF A;  4PJO E;  3CCQ A;  3OYI A;  1QP3 A;  3C4S A;  2XK0 A;  2YLB A;  3MHX A;  4F7U F;  3E9G A;  2ZT6 A;  2JN0 A;  1YJN A;  3CC2 A;  3NTK A;  2MWO A;  3EFS A;  1VQ9 A;  1QF6 A;  3A31 A;  4H2V A;  3SD4 A;  2DJZ A;  1EVL A;  2ZIO A;  2FHD A;  2EYQ A;  3HRU A;  3LGL A;  4BI8 B;  4CS2 A;  2M9U A;  3H8Z A;  2ZTG A;  3VYG A;  3CCL T;  4HT9 A;  2D0Q B;  4TVA B;  3VQV A;  4M78 A;  4MZM A;  3DLL A;  1X6O A;  1YGB A;  1N8R C;  2PQW A;  4YRJ A;  5I21 A;  4P73 C;  2LVM A;  2X35 A;  1YIJ T;  1VQO T;  3PIO A;  5GAN 8;  4LDW A;  4TQF A;  1K9M C;  3X24 B;  1FYF A;  2J3M A;  3MEU A;  2ZT8 A;  2EJG A;  2VYT A;  3RAC A;  5L8R E;  2VXE A;  4C0G A;  3CC2 T;  1BKB A;  3L1A A;  3RGL A;  3HXX A;  3IKM B;  4XTV A;  4PJO G;  2XIC A;  3CC7 A;  4C0D C;  1YHQ T;  5GMK l;  3M58 A;  2ZIN A;  4OB2 B;  3JCM Q;  3JRZ A;  4P74 C;  4QQG A;  4H2Y A;  4LNS A;  4XTU A;  4C92 G;  1UGR B;  1YJ9 T;  1VQ8 A;  4HWO A;  4MDX A;  1LJO A;  1H64 1;  4YRG A;  2QEX T;  3LWH A;  3A7R A;  4OMF B;  4LVM A;  4M7D C;  5M9O A;  4BE0 A;  3LSS A;  2ODR D;  4M75 C;  3GF5 A;  5EG2 A;  1PSF A;  4FT4 A;  1AHJ B;  5C53 B;  5GAM h;  2EQU A;  5GAM d;  3L2V A;  5GAN d;  5ELO A;  4RCB A;  3RKW A;  4ZGD B;  4YRC A;  1N9W A;  2ZR2 A;  3TU4 K;  4PJO F;  4H2T A;  3A8M B;  4BAC A;  1YI2 T;  3G6E T;  1YIT A;  1EVK A;  2EQJ A;  2CJ9 A;  3OB9 A;  3G4S A;  3HKS A;  1UGS B;  3MO8 A;  4V2S A;  2X4W A;  3MEV A;  2DAQ A;  1VQK A;  5CKF A;  1G3S A;  3HXY A;  5GAN 7;  4XQ3 A;  3MP8 A;  4JRK A;  1NJI C;  1LOJ A;  1VQN T;  2ALY A;  2WAC A;  1BI2 A;  1NE8 A;  5FRO A;  2K3Y A;  5LJ3 f;  4IKF A;  4F7U A;  3CCV A;  3CBO A;  3ZFJ A;  2E1H A;  3FLG A;  4D6W A;  1WJR A;  4M7A B;  1I5L A;  3UGQ A;  11AS A;  1YJW A;  1Q86 C;  3WQZ A;  2Q7G A;  3NEN A;  4L87 A;  1NJ5 A;  3ME9 A;  3OYG A;  4YDQ A;  4C8Q B;  1NYR A;  5GAM e;  1XNI A;  2RJE A;  4JS4 A;  4BWA A;  3HFZ A;  3F70 A;  1NPP A;  4YCV A;  3CEY A;  4GLK A;  4HKE A;  4C92 E;  2AKW A;  1QVP A;  3OYH A;  4K86 A;  1U8R A;  2Q5I A;  2XDB A;  2EQM A;  1Q82 U;  4RQE A;  4X34 A;  4C0Z A;  1USY C;  3UFG A;  1VQ7 T;  3CCU T;  4YRL A;  1B76 A;  2JTF A;  3CBP A;  5HK3 A;  4RG8 A;  3NET A;  3P8V A;  2K5F A;  4LVL A;  2AMC B;  1EIY B;  3OYY A;  5D6X A;  4M75 G;  4UP9 A;  4HA8 A;  4IUP A;  4TQD A;  1X01 A;  2EFI A;  4BE2 A;  4OB3 B;  1H4T A;  1X2H A;  2LCC A;  2QA4 T;  1G5H A;  4WI1 A;  3C12 A;  2RHQ B;  4EMG A;  1G3Y A;  4MMK A;  1RI0 A;  3RUX A;  3LLR A;  3FJP A;  4RMF A;  1BI3 A;  5DLO A;  1JB0 E;  3OQ5 A;  4IUQ A;  3OMG A;  5GAM g;  1U1T A;  4KUI A;  3SFM A;  2A3L A;  4CI0 C;  4R55 A;  2LT1 A;  2PUO B;  2CZ7 B;  2QQB A;  3PT9 A;  1FXX A;  3CCQ T;  3FIF A;  3QZ5 B;  3LH0 A;  1WJS A;  3OMC A;  4YRR A;  3HY0 A;  3A5Y A;  4Q5W A;  2L5Q A;  2PVO B;  3I7F A;  1WGS A;  4C92 B;  1NJ6 A;  5GAO l;  3BW1 A;  1SER A;  3TCJ A;  4H2W A;  2I4M A;  4FU6 A;  3TUP A;  3JB9 F;  2LT4 A;  4PG3 A;  5LJ5 f;  1O75 A;  4PHC A;  2R5A A;  2E10 A;  3I56 A;  3E19 A;  3P8B B;  3M53 A;  3LX7 A;  3S3O A;  1WPY A;  3MF2 A;  2M16 A;  4M7A F;  3X28 B;  4LD9 K;  2RH2 A;  2K4Y A;  3SWN C;  3OYF A;  4C5H A;  3QKJ A;  1KC8 U;  3TRE A;  3CCM T;  4H2X A;  2FL7 A;  2M0O A;  2IY5 A;  3M4Q A;  3MF1 A;  1VQ8 T;  4BI4 A;  1Q86 U;  3UGT A;  5LJ3 d;  2DZ9 A;  1BYM A;  4J6W A;  2RO0 A;  1WU7 A;  4HWR A;  2DPP B;  3QYH B;  4C5E A;  3WVD B;  2QHU A;  4YRE A;  4QQD A;  3BY7 A;  4P3O A;  2EJF A;  3I56 T;  5C52 B;  4P71 C;  3CCJ A;  1KHI A;  3QO3 A;  4QVZ A;  2K5L A;  2RHS A;  4A4K A;  2RI5 A;  1SET A;  3RIR A;  3M55 A;  5IT9 E;  3WXM B;  2DZC A;  1S72 A;  3ERR A;  1YI2 A;  4XU0 A;  4P75 C;  4N4H A;  2LRQ A;  1EQR A;  4L5G A;  2EAY A;  4DPG A;  3OYD A;  4EX5 A;  1YCY A;  5I2S A;  4Z02 A;  4M7A C;  3M5A A;  5GMK e;  4YRN A;  3G6E A;  3M4P A;  3M54 A;  2DU7 A;  3G4S T;  2K2V A;  4II1 A;  4R56 A;  2ZCE A;  4HCB A;  3OYC A;  4L6V 5;  4CH4 A;  1WQW A;  3CCJ T;  2O4X B;  2RI3 A;  2DEQ A;  2QXF A;  3RES A;  3M9Q A;  1X54 A;  4PL6 A;  3QXE B;  3P8H A;  4J5Y A;  3RMQ A;  3QYG B;  3HP9 A;  2JNG A;  2RHS B;  1XTD A;  4OP0 A;  1NJ1 A;  4NL2 A;  3CCE T;  3J81 E;  2DU5 A;  3I55 T;  3RKX A;  4ZN3 A;  2DK3 A;  4G85 A;  1W2B S;  3QTC A;  3VYH B;  3CPW A;  4B9W A;  2P5I A;  2E64 A;  4M78 G;  4NOY A;  3OS2 A;  2AHJ B;  2L3R A;  4DA4 A;  4ZGE B;  4N4G A;  5J26 A;  4BW9 A;  5D6Y A;  2F5K A;  1X56 A;  3QSU A;  2E12 A;  4M77 A;  3IG2 A;  4X5O A;  3LSQ A;  1VQ7 A;  2RHZ A;  1B8A A;  4C92 C;  2JTM A;  3CXC A;  1HK9 A;  4HWP A;  3N5B B;  5FRN A;  3REX A;  1QW1 A;  4Y91 A;  4BY6 C;  5GAN f;  3SB2 A;  3CBM A;  4J8O A;  5GAO r;  2XKO C;  3OBY A;  4Y28 E;  1KHC A;  4P5N A;  4YTL A;  4RKU E;  4F7U B;  3SWN B;  2DIQ A;  2X4J A;  1X2G A;  2Q7H A;  5CAI A;  4BY6 B;  3QO5 A;  3VV0 A;  3ZEH A;  3UPU A;  4M78 B;  1KOG A;  4L59 A;  1N6A A;  2PU9 B;  4H02 A;  3OSV A;  4ZGJ B;  3JSC A;  2CKK A;  2OAU A;  4P73 A;  3Q1J A;  1H3Z A;  1H4Q A;  3QG1 A;  2RJF A;  4X9C A;  4M7A G;  3QO8 A;  3OYK A;  4IUR A;  3QBY A;  2ART A;  3PZC A;  3R07 A;  3L2W A;  1EIY A;  5K1P A;  3HXZ A;  2O01 E;  1RL2 A;  1E1T A;  5J39 A;  2P0K A;  4MZT A;  4F7U E;  1Y71 A;  1VQL A;  5KCO A;  4YRQ A;  5F5W A;  4C5G A;  3L4G A;  4A4F A;  4EO4 A;  4YRP A;  2DTI A;  4ZTZ B;  2KK4 A;  4H2X B;  3QHS A;  2AKW B;  1QP2 A;  5GMK h;  2RM4 A;  2E65 A;  4CS4 A;  3LWI A;  4JS5 A;  5K1X A;  1WLE A;  2CYZ B;  2DQ3 A;  2VGN A;  3ZBD A;  3O8V A;  3HHT B;  3DB3 A;  3GLX A;  2QHT A;  3HRI A;  3HRK A;  5C6S A;  1M9S A;  4M7D E;  1U1S A;  1ASZ A;  2K57 A;  2WSE E;  3RKY A;  4KUL A;  3JCM f;  1YJN T;  4P75 A;  2A7Y A;  1MGQ A;  3G71 T;  2DXT A;  3PMT A;  4YRF A;  4JRI A;  4C8Q A;  1Z7M A;  2Q5H A;  2OTL T;  3CCL A;  2ZCF B;  4J7F A;  4EMH A;  1IZ6 A;  4MDW A;  3KUF A;  4JUV A;  4DQ2 A;  2MWP A;  3LYI A;  3R6O A;  1E22 A;  1B34 A;  1N9R A;  4UC4 A;  2LCL A;  3M59 A;  3A8L B;  2G4C A;  4WJ3 M;  1NPR A;  4A54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...