4XU3A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 263
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu3A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu3A01
3LC0A 2ZT7A 4M77B 2QHVA 4UP8A 2CIMA 3SWNA 2P5IA 4P73C 4YYEA 1EVLA 1YFRA 1BIAA 2XTIA 3A32A 1I4K1 1H4VB 4YRNA 4TQFA 2ZCEA 4C8QF 3HRKA 3NETA 4M78D 1SESA 4C92C 4PJOG 1YB3A 5K1XA 4N0AC 3MEYA 4K86A 4YROA 2DZ9A 1I8FA 3PZCA 4XTUA 4UP9A 4M78E 3MF2A 4TQDA 3PCOA 4M75D 5LJ5j 2ARSA 1VQZA 3HFVA 4DPGA 4ZIBA 4ZTUB 3JCMd 2RHSA 5C52B 4YDQA 4M7DD 2DQ0A 5LJ5e 1HXDA 4NOYA 3JCMg 4K87A 2EL9A 2I2LA 3OD1A 3RF1A 4M7DE 5C51B 2Q5HA 2DXUA 1N9WA 1H641 4M7AF 3EFSA 4CH3A 1Z7NA 3L4GA 4UPAA 4M75B 5GMKm 5GAOm 3WQZA 4YCVA 4K88A 4PJOD 4XTWA 4F7UB 3R07A 1WPYA 3G1ZA 4OP0A 1FYFA 2XGTA 4N0AA 3LSQA 4H2WA 4C92G 2RHQB 3E9HA 3LSSA 4PJOE 5GMKj 5LJ3j 3REXA 4TTVA 3RUXA 2Q7EA 1KQ1A 2DEQA 4RQEA 3SWNB 3NEMA 5GMKe 1ADJA 4NL3A 5LJ3e 1USYC 4QVDA 1KOGA 4J6XA 2DXTA 3P8VA 4YRJA 4H2XA 5ELNA 3TEGA 5GANd 4HA8A 3A31A 4V2SA 4M77F 2VXFA 4P75C 1WQWA 1QE0A 5GAMj 1C0AA 5GAOn 5GMKi 5GANg 4H02A 4ZTZB 3PCOB 5GAMe 1B8AA 1HTTA 2RHSB 2ZT6A 4JUVA 4EMGA 4P72A 4KR2A 3V7CA 3KFUA 4C92D 2ARTA 3RESA 1LNXA 3QHSA 5GAN4 4J5YA 2EWNA 1TH7A 2Q5IA 4L87A 3HXWA 1QF6A 4C92E 1LYLA 4PNOA 4YRFA 3L2ZA 3P8TA 4H2SA 1NYRA 4J6YA 3L4GB 4X5OA 4MMKA 3A5YA 3JCMf 2QHTA 4TVAA 5GAN8 1NJ2A 3A7UA 4M78A 4G84A 4WJ3M 2CGHA 3HY1A 2HNIA 3UH0A 1H4TA 4BW9A 3NENA 2YLBA 2YHTA 3JCMJ 4TVYA 1N9RA 1BBWA 3JB9G 4YPFA 1WU7A 4M75F 1HK9A 2RM4A 4JLIA 4XQ3A 4HT9A 3JCMQ 4XU1A 3JCMW 4F7UF 1YCYA 3VQXA 4M7DA 4P71A 2DKGA 3QTCA 1ASZA 1E22A 1ADYA 3M4PA 4TWAA 2ALYA 1E1OA 3REUA 4XU0A 2ZGWA 4YRSA 1W66A 3JB9J 2J3LA 2Q7GA 3V8JA 4G85A 3QSUA 1WNLA 4PJOA 2DTOA 4EMHA 3UGQA 4H2UA 2AMCA 4YCUA 4YREA 5GMKh 2Y90A 5LJ3h 5GANh 2ZT8A 1M8VA 5GANf 3JB9D 3A5ZA 2AKWB 4YRQA 4EMKA 4H2TA 5E3IA 4M7AC 3RKXA 3HXUA 4YCWA 5C53B 2DU7A 2E5AA 2FB7A 4HWRA 2DU5A 2ZTGA 1Z7MA 1NYQA 3HFOA 4M78B 5GAMh 4P3OA 5CAIA 5LJ5d 2RD1A 2QHUA 3FIFA 3UFGA 3BW1A 4E51A 4P73A 2ZNIA 4WF2A 5LJ5g 2C7IA 4HWPA 4P74C 3JB9H 2DJZA 2RA2A 2DDZA 2E3CA 3QNEA 5GAOr 4HWTA 1LOJA 4QVCA 4M7DB 4C92A 4Q6GA 3HRIA 3V7SA 3I7FA 4CS4A 3BJUA 4WJ4A 4M77C 1JJCA 2ALYB 3AHUA 1G51A 3TEHA 5I21A 3V8LA 4M7AG 4RDXA 4YP0A 5DY9A 5GAOq 3HXVA 4JRKA 4CS2A 5LJ3d 1EVKA 4PJOB 2AMCB 3MF1A 1M5Q1 3IKLA 3RACA 4CS3A 5LJ3g 2I4MA 2QHSA 2E1HA 4EMKB 3HFZA 1WYDA 1X56A 3E9IA 4EO4A 4P74A 2ZIMA 3UGTA 1B70A 11ASA 1B34A 4Y91A 5GAMd 2VXEA 2DTHA 5GAMg 1WQ7A 4M77G 4YRRA 4M7AD 4RCBA 4XTYA 1USYA 4HT8A 1SRYA 2DZCA 4YRTA 3QO3A 1B76A 2E64A 4M7AE 2CJAA 2ZR2A 4XU3A 1EQRA 4M78F 5GAN2 4C92B 4Q15A 4P75A 3L1AA 4XEOA 3V7RA 2I4LA 2DTIA 5LJ5h 4YRLA 1JJCB 3TUPA 1YFTA 3SWNC 3P8YA 4J15A 3BDUA 4H2VA 3TEHB 1E24A 1X2GA 3HTZA 2E65A 4JRIA 12ASA 3JCMX 2IY5A 1G5HA 4M7DF 1NJ5A 4H2XB 4C8QC 2K57A 1X55A 2QTXA 2ZZEA 1EIYA 4M77D 1Y96A 3HY0A 1ATIA 4YRKA 1D3BA 4CH4A 1X01A 2DQ3A 4CH5A 4X9CA 3EFRA 2CJ9A 3M4GA 3HFZB 4M77E 2I4OA 4LNSA 3FB9A 3IALA 4WI1A 1I81A 4X9DA 4HVCA 4PJOF 3VQVA 1B70B 4RMFA 5GAOp 1B34B 3JCMV 4F7UG 4TVWA 1BBUA 5LJ3f 4BWAA 1WLEA 1N9SA 3FJPA 4PHCA 4CH6A 5HGQA 4P3NA 4XU2A 1U1TA 2E41A 4NL2A 2ZT5A 5GAN3 2ODRC 4C8QA 4DQ2A 3JCMP 1NJ6A 4TVAB 3HSBA 4UP7A 1H4QA 4AH6A 2ZZGA 4C8QG 4XTVA 5GAMf 1EOVA 1SETA 3A7RA 3JCMe 3RKWA 2Q7HA 3ERRA 4YRIA 5F5WA 3A74A 2PMFA 4XEMA 3ICAA 1U1SA 4HWOA 4M75E 2IY5B 4C92F 4P3PA 5GAN6 3VBBA 2I4NA 2CJBA 4F7UE 3BFMA 3IG2A 2ZR3A 1EIYB 2JN0A 1Y96B 1D3BB 1NJ1A 4M7AA 2VC8A 3HFNA 3JCMb 1B7YA 1KQ2A 4NCXA 3NELA 1RIQA 3VQWA 3JB9I 4YRMA 1ASYA 4C8QD 3INZA 4P72C 4XTXA 3VQYA 2ZNJA 4C8QE 1BIBA 4A54A 2EAYA 5GANj 1L0WA 1JRIA 3IKMB 1YGBA 5GAN5 2DVEA 1PYSA 2ARUA 3M4QA 5ELOA 1X2HA 5GANe 3QO7A 3DSQA 4PG3A 3QUIA 1MGQA 2RB6A 3RERA 3GIBA 5K1PA 4YRPA 4C8QB 3QO5A 3QO8A 4M78C 2EJFA 1NJ8A 4KQEA 4M77A 4HWSA 3A7AA 4EX5A 2G4CA 4OLFA 2ZINA 4KR3A 4A53A 4M75C 4MMLA 3BY7A 2E10A 3RGLA 1KMNA 4RCCA 3RIRA 4H2YA 2ODRD 2ZZFA 3VU3C 4M7DC 2J3MA 1KMMA 4P71C 5GAN7 1YFSA 2FYKA 3HXYA 3JB9F 1G5IA 2AKWA 5LJ5f 1E1TA 3SB2A 3RL6A 4M7AB 1J5WA 1SERA 1B7YB 4XTZA 4O2DA 3JCMh 5GMKl 5GAOl 5KNNA 2EJGA 4RQFA 4PJOC 1JBMA 1IL2A 1GGMA 2PMEA 1HC7A 3HXZA 2EJ9A 2C8MA 4J6WA 4M78G 4YRCA 1X54A 3W3SA 4EMKC 4YRGA 4M75A 1EFWA 1NNHA 1H4SA 1LJOA 4M75G 1PYSB 2ZXFA 2P0LA 4F7UA 3V8KA 2YLCA 3PGGA 1I5LA 3JCMc 4M7DG 3RKYA 2RHQA 3HXXA 2ZIOA 3CMQA
chains in the Genus database with same CATH superfamily
2HDAA 2D9TA 4LE9A 4M77B 1OZ2A 4IURA 2AT1B 4B6MA 2P5IA 4P73C 1EVLA 1YFRA 2XTIA 3A32A 5CVIA 3J7AF 1AVZC 2W10A 1QWFA 3P8BB 4M78D 3M57A 4D8KA 4LD6A 2AKLA 1QVGP 1X2KA 4K86A 2EYZA 1Z9ZA 1N5ZA 4A4FA 3HFVA 1VQZA 2QGGA 4ZTUB 3CCRQ 2G3RA 1VQOQ 5C52B 5AYFA 1QP2A 3MCAB 4YDQA 2DQ0A 2BZXA 3G4ST 3G7ZA 3UPUA 2I2LA 5HKCA 2BTTA 1VQLA 2LP5A 4GLMA 2KVQG 1N9WA 3EFSA 4CH3A 3HRSA 1RAGB 1HD3A 2FVUA 3PMIA 1YJ9T 3URGA 4RTXA 2V26A 3E19A 3R07A 1WPYA 2H3EB 2O9VA 3QYGB 2CUBA 5J26A 1PSEA 3TVTA 3OYGA 4PJOE 5GMKj 5LJ3j 3GLXA 3REXA 3EH1A 1D1AA 3AT1B 5GMKe 5LJ3e 4TVRA 4CC4B 3O5ZA 1VQKT 2K79A 4YRJA 2V8KA 5ELNA 3I55T 3TEGA 2HSEB 1KSWA 3H6ZA 1WHGA 1C0AA 3OYDA 4H02A 2VGMA 3OMGA 1M3AA 3VS5A 5KYXB 1E7OA 1HTTA 4IIMA 2VUBA 5L23A 3CC2Q 3X26B 2F5TX 1VQ9A 3KFUA 1D1BA 5GAN4 4IUVA 2EWNA 1W2BP 2Q5IA 4PFZA 1YJNT 4C92E 4PNOA 5CKBA 4YRFA 3L4GB 1QVFP 4X5OA 2KK4A 4MMKA 3OS5A 3CMAQ 3T9NA 5FWBA 4WJ3M 5J39A 4LDXA 1H4TA 4JZ3A 3G6ET 3GP8A 3CCJT 1TTHB 1BU1A 2HBPA 4DBHA 1JB0E 3CCSQ 3EHRA 2XDPA 1ZSZC 3RMQA 1XJWB 2CREA 3CCRA 1G3WA 1SSHA 1VQOA 3OYMA 4LVIA 5IXFA 3M4PA 2ALYA 1B7TA 1TG0A 1D1CA 3REUA 3GNGA 2MI6A 3QWXX 2PVDB 5I22A 1RAHB 3ASKA 1VQNQ 3RMSA 2LX9A 3UGQA 2AMCA 2K5IA 5GMKh 2X3XD 5LJ3h 5HK0A 5GANf 5FU7B 3M0QA 2DPPB 4ZGDB 4H2TA 5E3IA 4EDUA 1M2VB 2Y4YA 2HKNA 2DU7A 1RADB 2DU5A 1VQLT 2KE9A 1Z7MA 3HPWA 3L2UA 1GFCA 4M78B 2ROLA 4PJMA 5LJ5d 3FIFA 4NS5A 2DX1A 3UFGA 3BW1A 1H8KA 1M1KC 6AT1B 1UGRB 3CC7T 3FLGA 4HWPA 3X24B 4E7JA 1YN8A 4HWTA 1B07A 9ATCB 3HRIA 2RI2A 4X1VA 3CC2A 1JQQA 1H3ZA 4OB0B 2PQWA 3WVEB 3BJUA 4WJ4A 1IZ6A 1TXQA 3TEHA 2A28A 1MNEA 4M7AG 1ARKA 2DXCA 2HBWA 3HXVA 3ZFJA 4JRKA 1MMAA 3ZBDA 1EVKA 5D6YA 1WXTA 1KC8R 3CXCP 5C6SA 3OYLA 1WX6A 3WXMB 4WCIA 4FSXA 2I4MA 5IT9E 1KFZA 4EMKB 3OS1A 5D6WA 1VQ9T 3CCSA 4P74A 4BB7A 3TU4K 1QCOA 1VIEA 2JXBA 1M1KU 1BI0A 2KBTA 2RMOA 2VXEA 3MJXA 1VQPA 4XK8E 4ESRA 1QVGA 1XNIA 1WQ7A 3EG3A 4M77G 4RCBA 3ER0A 4HT8A 5IHKA 2AIRB 3QDRB 2MOXA 2E64A 2B8AA 2OTLT 1EQRA 2QDLA 4LVMA 5GAN2 2Y4XA 2QEXT 2LRQA 4PJLA 4P75A 4XEOA 1FX7A 2R5AA 1UGSB 2EGAA 2HSPA 2DTIA 4IUTA 5LJ5h 4D6WA 1YFTA 3SWNC 1OOTA 3BDUA 3QXEB 5DM7R 1X2GA 3CCRT 1YHQQ 4OMFB 1VQOT 2HQXA 5FRMA 8AT1B 4M7DF 3JV3A 4H2XB 4MZMA 3OYYA 2C0OA 3OBYA 2ZZEA 1EIYA 1Y96A 5KCHA 4N4GA 4CH4A 2NUPB 4LUDA 3MO8A 3EFRA 3M4GA 1ZUYA 3HFZB 2I4OA 2JMAA 3FB9A 2NUTA 3HKSA 4WI1A 1I81A 5L8RE 2A08A 3VQVA 2RPNA 4RMFA 5GAOp 2COZA 1WHLA 1B34B 2J6KA 3JCMV 2CP2A 2YRDA 1BBUA 4FL6A 5LJ3f 1XOVA 1ABQA 2QXFA 3FJPA 4CH6A 2PUKB 1T0JA 4P3NA 4OMQA 4LN2A 3LH5A 4DA4A 2KEAA 2DL5A 2E41A 1O9SA 2DL7A 4AG2C 3QZ5B 3VS0A 2K3BA 1G3SA 4XTVA 1AT1B 3JCMe 4OMMA 5KH6A 3O8VA 5F5WA 1D0XA 3META 3VJPA 3ICAA 1U1SA 1AZGB 3MPUB 3CC2T 1AD5A 2CH4A 2NUZA 4M75E 4KUIA 1UHFA 2JT4A 2PVOB 4BE2A 3VBBA 1TU0B 2I4NA 4F7UE 1GCQC 3BE3A 4KRTA 5CKHA 1ZHIA 2E5QA 5FU6C 4NCXA 3NELA 4IIOA 2CP0A 1IB8A 2OAUA 1ASYA 3UF4A 2HEQA 1E6GA 2L5QA 3L2QA 2ZNJA 1KJWA 2GF7A 3OSSC 2EAYA 1L0WA 3CCST 1M2OA 3EHQA 3EGDA 4C0DC 1ZSZB 3OYHA 3QO7A 2J6FA 2QGFB 3QUIA 1VQPT 2X4JA 5K1PA 2DBMA 1YHQA 2F1LA 3GOXA 2FHDA 1PRLC 1RLPC 1BB9A 1VQ4Q 4KQEA 2FZCB 4HWSA 3A7AA 2LC4A 2G4CA 1Y07A 1EZZB 4FSSA 2LTOA 1U3OA 1G8XA 3C12A 3BY7A 1UHCA 1KMNA 1M30A 2XICA 3RIRA 4H2YA 2OAWA 2HL5C 2J3MA 1AWOA 3QG1A 3HXYA 3R6NA 4J7FA 5LJ5f 3SB2A 2AZVA 2QAZA 4J9CA 1LCKA 4HCBA 3JCMh 2QTVA 4PJOC 1G83A 1TOVA 1IL2A 2PMEA 3HXZA 3MKDA 4M78G 1M1FA 1K76A 4A4KA 4YRCA 2J06A 4P5NA 2PNIA 2H3JA 2RQWA 4A63B 3W3SA 2GBQA 4C5EA 3C4SA 5D6XA 3M55A 1S72A 4YRGA 4FW2A 1EFWA 1NNHA 2P0QA 3M58A 5KYWA 4PL6A 1LPLA 2OTJQ 2KRSA 3V8KA 2DL3A 2NYSA 4DEXA 3CXCA 3OYCA 3LC0A 4O5VA 2L3SA 3G71Q 2QHVA 4LDVA 4LDYA 1JXMA 3CCEQ 1NG2A 3CCMQ 4IKFA 4RKUE 1I4K1 5IHIA 1H4VB 4TQFA 1M27C 2EGEA 2XKOC 4AFQC 3M59A 1GBQA 3J80E 4C92C 5K1XA 4N0AC 3PE0A 3MEYA 3HHTB 4YROA 1I8FA 3PZCA 4XTUA 4UP9A 3MF2A 4TQDA 4FYWB 3TSWA 2ARSA 1UFFA 2RO0A 1SPKA 2VGNA 2O4XB 1K1ZA 1X6OA 2CP6A 3OD1A 1IRXA 3RF1A 1K0SA 2AHJB 4DEYA 1VQ4A 4M7AF 5CR2A 1Z7NA 2D8JA 4UPAA 5GMKm 4A4EA 1QW1A 1ZA1B 1Q81C 4K88A 4DBRA 4PJOD 3H0IA 1AWXA 4ME7A 2M9UA 3A8OB 4OP0A 4Z89A 2RHQB 5FU7C 3RUXA 2BIVA 2DEQA 3NPFA 4RQEA 3SWNB 2RK1A 3RR6A 2D0QB 3QWYA 2M1HA 1TUGB 2DXTA 4H2XA 4RTTA 5GANd 3JSCA 4HVUA 4M77F 2VXFA 1WQWA 1QE0A 1E6HA 5GAMj 3OA6A 5GAOn 2NUPA 3QKJA 2QG9B 1ZUKA 4CC2A 5A2QE 2GFAA 2C0TA 4ZTZB 4PLLA 1NBEB 3PCOB 4AG1C 5GAMe 1B8AA 2RHSB 4JUVA 4EMGA 1M1GA 4BD3A 1X69A 4C92D 3NTIA 3RESA 1NLOC 4DBFA 1LNXA 2QI2A 2OTJA 4LVLA 2XK0A 1TH7A 4CI0C 4L87A 1W6XA 4LVKA 2HCKA 1C0MA 1Q81U 1LYLA 3EFOA 4N4HA 1QVGS 5IXBA 1M4ZA 1IGUA 4QT7A 1WHMA 2AKKA 3G71A 1PHTA 1VYUA 2CZ6B 4AMCA 3CCEA 3CCMA 3A5YA 3JCMf 4BI8B 2F2VA 4G84A 2QQRA 1NJIC 1PSFA 2HNIA 4AFZC 3UH0A 1S72T 3NENA 2KQWA 2YHTA 1M3BA 1N9RA 1RLQC 1WU7A 4Z02A 2QASA 2K6DA 4Y92A 1R0BG 2DO3A 4HT9A 3NGPA 4XU1A 3JCMQ 3MEWA 4E7SA 5FW9A 1SEMA 4M7DA 1RAIB 4P71A 1RAEB 1GXIE 1E22A 2M02A 3PVQA 4TWAA 2EQKA 1ZX6A 4QVZA 2ZGWA 3VV0A 4YRSA 5FU6B 2Q7GA 4G85A 4CC7A 2ENMA 3QSUA 2DTOA 3THKA 2X4XA 3ZL7C 2IVWA 1TUDA 2VYTA 4E47A 2JTEA 2Y90A 5GANh 1OZ3A 3LLRA 1SSFA 5M9OA 2AKWB 3DKMA 2JOYA 3CD6Q 1N8RC 1NJIU 1MV3A 4C0DB 2QQAA 4YCWA 2QA4T 2RHXA 4EPCA 5C53B 3EGXA 1VQ7Q 2KT1A 2FB7A 1YITQ 4HWRA 1VYTA 1VQ4T 3HFOA 4MDWA 5GAMh 4LNPA 2QHUA 1PRMC 2MWPA 2DNUA 4E51A 2ZNIA 4Z8AA 4GLKA 5LJ5g 2RNAA 2KT8A 2EQUA 2C06A 2DJZA 1Q95G 2DDZA 2XI9A 3QJYA 3CMEQ 1EX4A 3V7SA 3M54A 2K3XA 3I7FA 2L2PA 1JJCA 2E70A 4ZGJB 5I21A 1YI2Q 4JPBW 3P8DA 4E7HA 4RDXA 4YP0A 5DY9A 1YBYA 1ZLMA 5GAOq 3M0SA 5D7UA 1JJ2A 5FRNA 4B9XA 4BI4A 1N8RU 5LJ3d 4E6RA 3QBYA 4PJOB 4R55A 3MHXA 3A8MB 1M5Q1 3RACA 3A5ZB 2L3PA 4ELYC 2QHSA 2E1HA 2E3HA 3H9NA 4O6JA 1YJWQ 2LQ8A 2CH4W 4LXCA 2PTKA 2CUDA 4EO4A 2OTJT 1ZSGA 4HT4A 1I5OB 2XG8D 3GPLA 5I2SA 2WSEE 4L5GA 2CP7A 5CKFA 3CCLQ 2DIQA 2X51A 1VUBA 3CCET 3HP9A 3CCMT 8ATCB 1USYA 4II1A 1NEGA 2DZCA 3LGLA 3OYNA 2E5KA 3U23A 3VUBA 2CJAA 1K73C 2OX7A 2LX7A 4M78F 3QPHA 1SF9A 1QQJA 4C92B 2JVVA 1UGPB 1QKWA 1YIJQ 2I4LA 2ZPFB 2FEIA 2RHYA 4YRLA 3TUPA 2I0NA 4EIKA 3S3OA 4H2VA 1N6AA 1BKBA 2FL7A 3CCVQ 2RQUA 2VB6A 3CD6A 12ASA 2DBKA 1JU5C 3VKIA 5A0LA 1VQ7A 1B3QA 2AZSA 2DM1A 3M4YA 1D3BA 3CPWP 1M9SA 2CJ9A 4A4HA 1WZOA 3LGFA 2LVMA 2EQMA 3IALA 1X43A 4OGEA 4L6V5 1U06A 3DLLA 2JS2A 1B70B 3CBPA 3IQLA 3OMCA 1V1CA 2YUPA 2KDSA 3CMEA 2XIDA 1K73U 3EG9A 3CXCS 2QQBA 2V1QA 2ZPHB 2KNBB 2Z0WA 1YI2A 1OPKA 2ZT5A 1WHKA 4TVAB 1H4QA 1OU8A 2O2OA 2EKHA 4LUEA 1BI1A 4FIBA 2YRCA 5GAMf 3SD4A 2M0YA 1G2BA 2FPEA 3F70A 1PM3A 2RI5A 1Y0MA 4IUQA 3EGUA 4GY5A 3EAEA 2M51A 4HWOA 2BZ8A 2MK5A 1K9MC 2LJ1A 2IY5B 5I2MA 2NLUA 2LQNA 4P3PA 2D8HA 4ZGEB 1KQSA 2CJBA 4OF1A 2R57A 1ZBXA 3IG2A 4FW1A 4JJDA 1SG5A 3J81E 2XDBA 1T3LA 4M7AA 3HFNA 3CCLA 3JCMb 1B7YA 1KQ2A 1RIQA 3VQWA 1WIEA 1MMDA 4JDSA 1ZUUA 1RAFB 3CMAA 5A0DA 5KYUB 5IN1A 4C8QE 4A54A 1RUWA 3LWIA 2XHCA 3VYHB 1NPPA 1YIJA 2DVEA 1PYSA 2FRYA 4E7KA 1M8MA 1P92A 4E7IA 1Q81R 3ME9A 1RACB 3CCVA 4PG3A 1SHFA 3RERA 1KIKA 1HJDA 4C8QB 3QO8A 5CKDA 4M77A 1K9MU 4EX5A 4UC4A 1K9AA 4PFOA 4FCYA 2DL8A 4KR3A 1Q86C 4JS5A 3NTHA 2EW3A 2E10A 1UECA 3M0UA 4J9IA 2X3WD 1VQNA 2LQWA 2VKNA 1TSFA 2LJ0A 2FYKA 1UG1A 4HVVA 2AKWA 4WTOB 4OMNA 3CD6T 3E9FA 3RL6A 4J9DA 1IO6A 5IH2A 2E6NA 4JS4A 5ECAA 4RTVA 3OS2A 4F16A 1VQ7T 2KMTA 5GMKl 2EJGA 1SRLA 1JBMA 2D1XA 1AEYA 2GTJA 4AFSC 1HC7A 4C5HA 1X54A 2YUOA 1WYXA 2LDMA 2IPOB 3A8HB 1X2QA 2YLCA 1Q86U 3ZEHA 1I5LA 1NJIR 2M0OA 2XU8A 3RKYA 1PC0A 3HXXA 4YRMA 3CMQA 3GF5A 2ZT7A 4OB1B 1NM7A 1VQ5Q 1YI2T 5EG2A 2PU9B 3OYAA 1WJSA 4KT0E 2COWA 1PKTA 4YRNA 2DMOA 2ZCEA 3HRKA 3M56A 4PJOG 1X6BA 1W2BA 2ESWA 2DZ9A 3MP1A 4KGVB 1IGQA 5KYXA 4DPGA 3OYIA 1QVFA 1PD0A 3JCMd 3VS1A 2KR3A 3R6OA 3OY9A 4IUPA 3ULRB 5GJWB 1ZBJA 4K87A 1BBZA 3CCLT 1R8OB 4M7DE 1T0HA 5C51B 1QWEA 2DXUA 1N8RR 2XDDA 3L4GA 2H8HA 1PWTA 4M75B 3CMAT 5GAOm 1UUEA 4HCCA 3CQTA 4F7UB 3GBQA 3G1ZA 1PCXA 4N0AA 3LSQA 1KHCA 4C92G 3LSSA 2LT1A 1YIJT 3TCJA 2DILA 4N4IA 3CPWA 2Q7EA 2KROA 1FMKA 2LCCA 3CCVT 3NEMA 1ADJA 3S3NA 4F17A 4QVDA 1OEBA 1EFNA 4J6XA 3P8VA 1AWWA 4BY6C 3LYIA 4LDUA 3I9QA 1JJ2S 1UB4A 4HA8A 1TUCA 3L2RA 5FROA 4P75C 5J3BA 4J8OA 2EQJA 5GMKi 5GANg 2MF2A 1VQ6Q 3L2VA 1WA7A 2K5LA 2CT4A 1VQMQ 2ED1A 1VQNT 2ZT6A 2X9HA 1UGVA 4KH0B 5LL6S 4BI3A 4P72A 4KR2A 2DD5A 4KBMB 1WJQA 3QHSA 5CK9A 4J5YA 1U8RA 4A4GA 3HXWA 1QF6A 1M2VA 1NYGA 3L2ZA 4QQDA 1NYRA 2JTFA 2NS6A 1VQ5A 3QYHB 2ZZDA 2KRNA 3QDFA 2QHTA 4TVAA 5GAN8 3OSVA 1NJ2A 4M78A 3HY1A 2YLBA 1K8AR 4PK4A 3C0CA 4YPFA 2PUOB 2RN8A 4JLIA 4OB2B 4XQ3A 1YFNA 1K73R 3MP6A 2LNHB 3JCMW 2XD0A 1YCYA 3VQXA 2IIMA 1QCNA 2YDLA 2F2XA 2DKGA 3QTCA 1ADYA 3OW2P 2JMCA 2L0AA 2YUQA 3A1PA 2ZPEB 2BE7D 2J3LA 3JB9J 1VA7A 1WNLA 1H92A 1WFWA 4H2UA 1U5SA 5KYUA 3VUZA 4YCUA 5DLOA 3FJ5A 1C6VX 1UGQB 3JB9D 2DYIA 4YRQA 4EMKA 2JM8A 2RJDA 2G6FX 3I35A 4KULA 2E5AA 4OVAA 3D7SB 2ZTGA 2KSSA 2ECZA 5FWCA 2GQVA 5CIUA 1D0ZA 2FZGB 4KGXB 4P3OA 2E6ZA 3CCJQ 4FYVB 3E2UA 2VV5A 4P73A 3TSZA 4WF2A 1FWZA 3HL8A 1VQ6A 2C7IA 1NZ9A 1KG1A 2RA2A 2E3CA 3QNEA 1VQMA 1N27A 4QVCA 1NE8A 3VRYA 2GNCA 2ED0A 4L59A 4D8DA 4CS4A 1GL5A 2QQSA 1KQSS 2WACA 2ALYB 1G51A 3V8LA 3DLMA 2O01E 1YHQT 4J9EA 1K9MR 1VQ8Q 3SHWA 1TS9A 4BUGA 3KFVA 1V76A 1KHIA 4LDWA 2XMFA 3PVLA 2GTOA 1X75C 1CKAA 5C0MA 2AMCB 1X6GA 3FEOA 1Q7YC 3IKLA 5LJ3g 4HCKA 1QCFA 4C0FA 2CSQA 3HFZA 1HSQA 2EPDA 5GJVB 5A0GA 1G5VA 3EG1A 3REBB 1GFDA 1WYDA 2RJEA 1SKUB 5CO7A 3E9IA 2ZIMA 2JS0A 1IREB 1B34A 3SDZA 4Y91A 1D0YA 2J7IA 1YP5A 5GAMd 2YWWA 2CZ7B 3QJ6A 2AK5A 2JUFA 2BE9B 1AHJB 2NWMA 1VQ5T 2VWFA 2CS7A 1PNJA 1SRYA 3CC7Q 4YRTA 3QO3A 1OQKA 2GFUA 4LD9K 4M7AE 1B76A 2P0KA 4XU3A 1FMVA 4ZN3A 3OS0A 2PZ1A 3L1AA 2DA9A 2YUNA 1Q86R 2LNVA 4Y28E 1ZQ1A 4J15A 3TEHB 2V8JA 3HTZA 1Q7YU 1MHNA 2E65A 4JRIA 3JCMX 2JJ9A 3M0TA 1NJ5A 3CPFA 4C8QC 2DYBA 5CQXA 3EH2A 2K57A 1X55A 4FYXB 2QTXA 2KY9A 4YRKA 5KE2A 1WHJA 2VVKA 1WXUA 4CH5A 3S6WA 4ZTJA 4M77E 1J3TA 3CCJA 4BE0A 3UA6A 1PD1A 3NMZC 1VQ9Q 2M16A 2P84A 1Y71A 3SFMA 2E3IA 4PJOF 4F7UG 5IHNA 4KUDK 1A0NB 2DD4A 4BWAA 1WLEA 1N9SA 4ORZA 3TQ7P 1NEBA 4PHCA 2KYBA 3OYFA 5HGQA 4XU2A 1ZSZA 1I07A 5CCAA 1VQ8A 2OTLQ 4ZNXA 4MZPA 4BY6B 3PIPA 4DQ2A 1NJ6A 3I56Q 3HSBA 4XAXB 4UP7A 2HL3A 4AH6A 2JNGA 2QEXQ 1NYFA 2EYWA 4R56A 1SETA 3RKWA 1VQ6T 2Q7HA 1W2BS 3ERRA 1UEBA 1VQMT 4XEMA 3CCQQ 3HRUA 2F69A 1QVFS 2EKOA 2K5FA 3CBMA 1O75A 4C92F 4AT1B 2JM9A 2FPFA 3BFMA 4DOVA 2D6FA 1EIYB 3M0RA 1Y96B 3RBBB 1MMNA 2J6OA 2ZPIB 3VS2A 3PMTA 2NUTB 4C8QD 3INZA 4OGCA 3CC7A 3BDLA 4C0ZA 2K2VA 4XTXA 3VQYA 2K3YA 2KRMA 2RHUA 3OW2A 1VYVA 2QDYB 1DJ7B 2OI3A 2ZPBB 2MAMA 3DB4A 1UE9A 3IKMB 3UA7A 1D09B 3C94A 3OB9A 3CPWS 3M4QA 5ELOA 1X2HA 4KH1B 4ATOA 3DSQA 1WXBA 3LX7A 4ZN1A 4VUBA 5KYYB 3GIBA 3N5BB 2RJFA 3QO5A 3MEUA 5CQYA 3M9QA 3G71T 4E2FB 3CEYA 1K8AC 4FYYB 4OLFA 1OPLA 2HQEA 4BDZA 4M75C 2LZ6B 2RI3A 4RCCA 1H3HA 1RL2A 2ZZFA 2GQIA 4M7DC 1GCPA 2ZAEA 1KMMA 1UJYA 1VOMA 5GAN7 4P71C 1YFSA 2A36A 2RQTA 3E1SA 3PTAA 3C95A 1J5WA 4PFPA 3MP8A 2GCXA 2L3RA 2O4XA 4MZTA 7AT1B 5GAOl 4RQFA 3RNJA 3PNWC 4Q5WA 3EG0A 1I1JA 4HCZA 1YITA 1SRMA 2OTLA 2JW4A 5CKEA 2EJ9A 1GGMA 3I56A 4OMOA 2OJ2A 1WI7A 2QEXA 2QYZA 3H0HA 2DERA 4ZTFA 3I5RA 2ZXFA 2DLPA 1ABOA 2PVGB 3EGDB 2P0LA 4R0KA 3CCQA 1K8AU 3PGGA 2ATCB 1VQPQ 3JCMc 4PLIA 2RHQA 2ZIOA 5KE3A 5HY6A 2DEUA 4RUGA 4UP8A 2CIMA 3SWNA 2MIOA 3A98A 4YYEA 4ANJA 1BIAA 1VQ8T 1V29B 2K2MA 3OQ5A 1W4SA 2WSFE 4GBQA 4C8QF 3NETA 2DK3A 1SESA 2MCNA 1YB3A 1RI9A 1RI0A 4M78E 3FC3A 2RJCA 4M75D 3PCOA 5LJ5j 1X27A 4ZIBA 4F14A 2X4WA 2RHSA 1YJWA 4RMOA 2CT3A 2RK2A 4M7DD 2HKQB 2LJ3A 5LJ5e 1HXDA 4NOYA 3JCMg 2EL9A 4FU6A 2Q5HA 1TWBA 1BI2A 3REAB 2MWOA 5KYNA 3H8ZA 1H641 4C5IA 1OULA 2DE0X 3OYKA 1IHVA 3P8HA 3WQZA 2CP3A 4YCVA 3UWNA 5KYWB 1AZEA 3PT9A 4XTWA 1I0CA 3VS3A 4C0GA 1FYFA 2XGTA 4ELZC 4HVWA 4H2WA 3E9HA 2EFIA 1Q82C 4TTVA 2KAFA 1KQ1A 4RG2A 4MDXA 2RHZA 4PJJA 4NL3A 1USYC 2RQRA 1KOGA 4Z88A 1VIFA 2ZPGB 4J9FA 1M90C 2FO0A 3Q1JA 4V2SA 1GCQA 3A31A 4RG8A 4RTYA 3CCUQ 2DF6A 1WHHA 2L8DA 1OX8A 1R0CB 2CYZB 3MEVA 3KUFA 3V7CA 4JJNK 2ARTA 3A8LB 1Q7YR 4BACA 2CZ0B 4HKEA 5EC7A 2CZ1B 4RTUA 3PFSA 2FRWA 1WGSA 1W70A 1CSKA 1GRIA 2SRCA 3P8TA 4H2SA 4J6YA 1WDXA 3X20B 2QK0A 3DB3A 2HMAA 2YRVA 1Q82U 1YITT 4DBQA 3VS4A 3I56T 5AT1B 2O9SA 3A7UA 2CKKA 4CC3A 2CGHA 4BW9A 3LW5E 3JCMJ 3UDCA 4TVYA 2A8EA 2C0IA 1BBWA 1M90U 1OV3A 3JB9G 4M75F 1KD1R 1QMCA 1HK9A 3CCQT 2J05A 2RM4A 1UJ0A 1BCMA 2DL4A 3EG2A 4F7UF 2LQKA 3CMET 3UT1A 5KCOA 4OMLA 1QVPA 3X28B 1G3YA 1UTIA 1ASZA 2LMJA 2R5MA 1KK7A 1AWJA 1E1OA 4XU0A 1W1FA 2HQHA 2HZYA 3H41A 3QZ9B 1W66A 4J83A 3V8JA 4OB3B 3TEEA 2F2WA 4PJOA 1BI3A 4EMHA 2V8IA 4YREA 3E9GA 1Z9QA 1K0XA 2ZT8A 5FLXE 1M8VA 3A5ZA 1YWPA 1YJWT 3LH0A 3EFOB 2DFUA 4M7AC 1RAAB 4JJBA 3RKXA 3HXUA 1OI1A 4KGZB 5KYYA 4J9HA 1WLPB 4AFUC 1ZA2B 3CC4Q 1NYQA 3OYBA 2K7AA 3GNFB 4F04B 1QKXA 5CAIA 2RD1A 4JRQA 1S72Q 3G1JA 2CSIA 2DAQA 3QIIA 3M53A 3CCUA 1G3TA 4M4ZA 1Y7XA 3NHNA 4P74C 1RABB 3JB9H 1ACMB 1UDLA 1WJRA 2A37A 1YNZA 5GAOr 1LOJA 4Q6GA 4M7DB 4C92A 1NPRA 2K4YA 2A3LA 2D0NA 4M77C 2EIFA 3WVDB 3AHUA 5DLQE 3S3MA 4BE1A 2COYA 4JJCA 2EYQA 1MMGA 4CS2A 2A0FB 1FXXA 2A7YA 2E4HA 1GBRA 2ABLA 2KI7A 3M5AA 1YWOA 4CS3A 3LWHA 2MYSA 1AOJA 3L2WA 1CKBA 3OW2S 2RQVA 3JAME 1X56A 1BCOA 1IHWA 3MEAA 4QQ6A 3UGTA 4RTWA 3KXTA 3HTRA 2QA4Q 1F1BB 1B70A 11ASA 3EGXB 3G4SQ 2DTHA 3HRTA 1PG5B 5GAMg 4YRRA 4M7AD 4X34A 4OMPA 1HYOA 1T3SA 4XTYA 3VS6A 1NLPC 2KXCA 1YJ9Q 2EGCA 1IXDA 2ZR2A 5HCKA 1M3CA 4CRIA 2FPDA 4Q15A 1OU9A 3KBGA 2HAXA 2R58A 3V7RA 3PIOA 1JJCB 3P8YA 1K4US 3OBWA 1E24A 2WSCE 2IY5A 1VQKQ 1G5HA 2YXYA 1QP3A 2L3QA 2RH2A 2DETA 3I55Q 1BK2A 2CP5A 2W0ZA 3H0FA 4DOWA 4M77D 3HY0A 1ATIA 4C5GA 3CC4A 1X01A 2DQ3A 4X9CA 1XQHA 1R77A 3I5SA 2F5KA 3CBOA 4LNSA 4X9DA 3FDRA 4E7LA 5I11A 1JJ2P 4HVCA 3L42A 3OYJA 4TVWA 4QKUA 4E7ZA 1YJNQ 2RF0A 4J9BA 1U1TA 1OYXA 4NL2A 1JEGA 5GAN3 1MV0B 2ZCFB 5IAYA 2MMPA 2ODRC 4C8QA 3JCMP 1MUZA 1C1AA 2CDTA 2ZZGA 4C8QG 2EQIA 1EOVA 3G6EQ 3CCUT 3A7RA 5HK3A 4YRIA 1S1NA 2P4TA 4IUUA 3A74A 2RHIA 4RTZA 2DIGA 2PMFA 2KXDA 3NFCA 4FT2A 2EBPA 2O88A 3M0PA 5GAN6 2YSQA 2QA4A 1JO8A 1KC8C 4BDYA 3G4SA 2ZR3A 2JN0A 1OX9A 2GGRA 2JTMA 4JLGA 1Y57A 2DJQA 1D3BB 1NJ1A 3FRNA 2VC8A 3RDVA 2SEMA 3X25B 3TREA 2FG0A 2L89A 3JB9I 4QW2A 1YJ9A 4P72C 1FMWA 2KYMA 2JZ2A 2E12A 1MNDA 2K9GA 2FZKB 1BIBA 4J7IA 5GANj 3EG9B 4FM4B 2EYYA 1M1KR 1JRIA 3NTKA 3VS7A 2BZYA 1YGBA 4PKCC 5GAN5 2BUDA 4K11A 2ARUA 2ROTA 5GANe 4QQGA 1YCSB 1BYMA 1MGQA 2RB6A 3A8GB 2EVRA 4YRPA 2X4YA 1VQKA 3VRZA 1VQLQ 4M78C 2EJFA 1NJ8A 2QQ9A 1Q82R 3I55A 2DXBA 2VASA 1XTDA 2B86A 1EIFA 2ZINA 4A53A 2DVJA 1KC8U 4HXJA 1KD1C 4MMLA 3VYGA 3MQZA 3RGLA 1FYNA 1M90R 2ODRD 3VU3C 2EYXA 4B9WA 1QLYA 2YT6A 3JB9F 1G5IA 1PKSA 2LCSA 2V1RA 4PJNA 1E1TA 3JRZA 4YTLA 4M7AB 1YJNA 1SERA 1B7YB 2DRMA 4XTZA 4O2DA 1JXOA 4JRPA 4FT4A 5KNNA 4LVJA 2LCLA 2P4RA 3CC4T 1LVKA 1KQSP 2C8MA 4J6WA 3UATA 2O31A 2KGTA 4EMKC 3G6EA 4J9GA 4M75A 1H4SA 4JZ4A 2X35A 3SEMA 1LJOA 4M75G 1PYSB 1SHGA 4F7UA 2IG0A 3OYEA 2HD0A 2LT4A 2MPXC 2P0PA 1KD1U 2BKDN 4M7DG 2DRKA 3MF1A
chains in the Genus database with same CATH topology
2D9TA 4M77B 1OZ2A 4IURA 2P5IA 4P73C 1EVLA 1YFRA 2XTIA 3A32A 5CVIA 3J7AF 3P8BB 4M78D 3M57A 4LD6A 4K86A 4A4FA 3HFVA 1VQZA 4ZTUB 2G3RA 5C52B 5AYFA 1QP2A 3MCAB 4YDQA 2DQ0A 3G4ST 3G7ZA 3UPUA 2I2LA 5HKCA 1VQLA 2KVQG 1N9WA 3EFSA 4CH3A 3HRSA 3PMIA 2FVUA 1YJ9T 3URGA 3E19A 3R07A 1WPYA 3QYGB 5J26A 1PSEA 3OYGA 4PJOE 5GMKj 5LJ3j 3GLXA 3REXA 5GMKe 5LJ3e 4TVRA 1VQKT 4YRJA 2V8KA 5ELNA 3I55T 3TEGA 3H6ZA 1C0AA 3OYDA 4H02A 2VGMA 3OMGA 1HTTA 2VUBA 3X26B 2F5TX 1VQ9A 3KFUA 5GAN4 4IUVA 2EWNA 2Q5IA 1YJNT 4C92E 4PNOA 5CKBA 4YRFA 3L4GB 4X5OA 2KK4A 4MMKA 3OS5A 3T9NA 4WJ3M 5J39A 4LDXA 1H4TA 3G6ET 3GP8A 3CCJT 2HBPA 1JB0E 2XDPA 3RMQA 3CCRA 1G3WA 1VQOA 3OYMA 4LVIA 3M4PA 2ALYA 3REUA 3GNGA 2MI6A 2PVDB 3ASKA 3RMSA 2LX9A 3UGQA 2AMCA 2K5IA 5GMKh 5LJ3h 5HK0A 5GANf 5FU7B 2DPPB 4ZGDB 4H2TA 5E3IA 4EDUA 2Y4YA 2DU7A 2DU5A 1VQLT 1Z7MA 3HPWA 3L2UA 4M78B 5LJ5d 3FIFA 4NS5A 3UFGA 3BW1A 1M1KC 1UGRB 3CC7T 3FLGA 4HWPA 3X24B 4E7JA 4HWTA 3HRIA 2RI2A 3CC2A 1H3ZA 4OB0B 2PQWA 3WVEB 3BJUA 4WJ4A 1IZ6A 3TEHA 4M7AG 2DXCA 3HXVA 3ZFJA 4JRKA 3ZBDA 1EVKA 5D6YA 5C6SA 3OYLA 3WXMB 4FSXA 2I4MA 5IT9E 4EMKB 3OS1A 5D6WA 1VQ9T 3CCSA 4P74A 4BB7A 3TU4K 1VIEA 1M1KU 1BI0A 2VXEA 1VQPA 4XK8E 1QVGA 1XNIA 1WQ7A 4M77G 4RCBA 3ER0A 4HT8A 3QDRB 2E64A 2B8AA 2OTLT 1EQRA 4LVMA 5GAN2 2Y4XA 2QEXT 2LRQA 4P75A 4XEOA 1FX7A 2R5AA 1UGSB 2DTIA 4IUTA 5LJ5h 4D6WA 1YFTA 3SWNC 3BDUA 3QXEB 5DM7R 1X2GA 3CCRT 4OMFB 1VQOT 2HQXA 5FRMA 4M7DF 4H2XB 4MZMA 3OYYA 3OBYA 2ZZEA 1EIYA 1Y96A 5KCHA 4N4GA 4CH4A 3MO8A 3EFRA 3M4GA 3HFZB 2I4OA 3FB9A 4WI1A 3HKSA 1I81A 5L8RE 3VQVA 4RMFA 5GAOp 1B34B 3JCMV 1BBUA 4FL6A 5LJ3f 1XOVA 2QXFA 3FJPA 4CH6A 2PUKB 4P3NA 4DA4A 2E41A 1O9SA 3QZ5B 1G3SA 4XTVA 3JCMe 5KH6A 3O8VA 5F5WA 3META 3VJPA 3ICAA 1U1SA 3CC2T 4M75E 4KUIA 2PVOB 4BE2A 3VBBA 2I4NA 4F7UE 5CKHA 1ZHIA 2E5QA 5FU6C 4NCXA 3NELA 2OAUA 1ASYA 2L5QA 3L2QA 2ZNJA 2GF7A 2EAYA 3OSSC 1L0WA 3CCST 4C0DC 3OYHA 3QO7A 3QUIA 1VQPT 2X4JA 5K1PA 1YHQA 3GOXA 2FHDA 4KQEA 4HWSA 3A7AA 2LC4A 2G4CA 1Y07A 2LTOA 3C12A 3BY7A 1KMNA 2XICA 3RIRA 4H2YA 2J3MA 3QG1A 3HXYA 4J7FA 5LJ5f 3SB2A 4HCBA 3JCMh 4PJOC 1IL2A 2PMEA 3HXZA 4M78G 1M1FA 4A4KA 4YRCA 4P5NA 3W3SA 2H3JA 4C5EA 3C4SA 5D6XA 3M55A 1S72A 4YRGA 1EFWA 1NNHA 2P0QA 3M58A 4PL6A 3V8KA 3CXCA 3OYCA 3LC0A 4O5VA 2QHVA 4LDVA 4LDYA 4IKFA 4RKUE 1I4K1 1H4VB 4TQFA 2XKOC 3M59A 3J80E 4C92C 5K1XA 4N0AC 3MEYA 3HHTB 4YROA 1I8FA 3PZCA 4XTUA 4UP9A 3MF2A 4TQDA 2ARSA 2RO0A 2VGNA 2O4XB 1X6OA 3OD1A 3RF1A 2AHJB 1VQ4A 4M7AF 5CR2A 1Z7NA 4UPAA 5GMKm 4A4EA 1QW1A 1Q81C 4K88A 4PJOD 4ME7A 2M9UA 3A8OB 4OP0A 2RHQB 5FU7C 3RUXA 2BIVA 2DEQA 4RQEA 3SWNB 2RK1A 2D0QB 2M1HA 2DXTA 4H2XA 5GANd 3JSCA 4M77F 2VXFA 1WQWA 1QE0A 5GAMj 3OA6A 5GAOn 3QKJA 5A2QE 2GFAA 4ZTZB 4PLLA 3PCOB 5GAMe 1B8AA 2RHSB 4JUVA 4EMGA 1M1GA 4BD3A 4C92D 3NTIA 3RESA 2OTJA 1LNXA 2QI2A 4LVLA 2XK0A 1TH7A 4CI0C 4L87A 4LVKA 1Q81U 1LYLA 4N4HA 1QVGS 1M4ZA 3G71A 3CCEA 2CZ6B 3CCMA 3A5YA 3JCMf 4BI8B 4G84A 2QQRA 1NJIC 1PSFA 2HNIA 3UH0A 1S72T 3NENA 2KQWA 2YHTA 1N9RA 1WU7A 4Z02A 2DO3A 4HT9A 3JCMQ 4XU1A 3MEWA 4M7DA 4P71A 1GXIE 1E22A 4TWAA 2EQKA 4QVZA 2ZGWA 3VV0A 4YRSA 5FU6B 2Q7GA 4G85A 3QSUA 2DTOA 2X4XA 2IVWA 2VYTA 4E47A 2Y90A 5GANh 1OZ3A 3LLRA 1SSFA 5M9OA 2AKWB 3DKMA 2JOYA 1N8RC 1NJIU 4C0DB 2QQAA 4YCWA 2QA4T 2RHXA 4EPCA 5C53B 2FB7A 4HWRA 1VQ4T 3HFOA 4MDWA 5GAMh 2QHUA 2MWPA 4E51A 2ZNIA 4GLKA 5LJ5g 2EQUA 2C06A 2DJZA 2DDZA 2XI9A 3QJYA 3V7SA 3M54A 2K3XA 3I7FA 1JJCA 2E70A 4ZGJB 5I21A 3P8DA 4E7HA 4RDXA 4YP0A 5DY9A 1YBYA 5GAOq 5FRNA 1JJ2A 4B9XA 4BI4A 1N8RU 5LJ3d 3QBYA 4PJOB 4R55A 3MHXA 3A8MB 1M5Q1 3RACA 3A5ZB 4ELYC 2QHSA 2E1HA 4O6JA 2LQ8A 4EO4A 2OTJT 4HT4A 2XG8D 3GPLA 5I2SA 2WSEE 4L5GA 5CKFA 2DIQA 1VUBA 3CCET 3HP9A 3CCMT 1USYA 4II1A 2DZCA 3LGLA 3OYNA 3VUBA 2CJAA 1K73C 4M78F 3QPHA 4C92B 2JVVA 1UGPB 2I4LA 2ZPFB 2RHYA 4YRLA 3TUPA 3S3OA 4H2VA 1N6AA 1BKBA 2FL7A 3CD6A 12ASA 3VKIA 5A0LA 1VQ7A 3M4YA 1D3BA 1M9SA 2CJ9A 4A4HA 3LGFA 2LVMA 2EQMA 3IALA 4L6V5 4OGEA 3DLLA 1B70B 3CBPA 3OMCA 2KDSA 3CMEA 2XIDA 1K73U 3CXCS 2QQBA 2ZPHB 1YI2A 2ZT5A 4TVAB 1H4QA 1BI1A 4FIBA 5GAMf 3SD4A 3F70A 2RI5A 4IUQA 4GY5A 3EAEA 4HWOA 1K9MC 2IY5B 5I2MA 2NLUA 4P3PA 4ZGEB 1KQSA 2CJBA 4OF1A 2R57A 1ZBXA 3IG2A 3J81E 2XDBA 4M7AA 3HFNA 3CCLA 3JCMb 1B7YA 1KQ2A 1RIQA 3VQWA 4JDSA 3CMAA 5A0DA 5IN1A 4C8QE 4A54A 3LWIA 2XHCA 3VYHB 1NPPA 1YIJA 2DVEA 1PYSA 4E7KA 1P92A 4E7IA 3ME9A 3CCVA 4PG3A 3RERA 4C8QB 3QO8A 5CKDA 4M77A 1K9MU 4EX5A 4UC4A 4KR3A 1Q86C 4JS5A 3NTHA 2E10A 1VQNA 2FYKA 2AKWA 3CD6T 3E9FA 3RL6A 2E6NA 4JS4A 3OS2A 1VQ7T 2KMTA 5GMKl 2EJGA 1JBMA 1HC7A 4C5HA 1X54A 2LDMA 3A8HB 2YLCA 1Q86U 3ZEHA 1I5LA 2M0OA 2XU8A 3RKYA 3HXXA 4YRMA 3CMQA 3GF5A 2ZT7A 4OB1B 1YI2T 5EG2A 2PU9B 3OYAA 1WJSA 4KT0E 4YRNA 2ZCEA 3HRKA 3M56A 4PJOG 1W2BA 2DZ9A 3MP1A 4DPGA 3OYIA 1QVFA 3JCMd 3R6OA 3OY9A 4IUPA 4K87A 3CCLT 1R8OB 4M7DE 5C51B 2DXUA 2XDDA 3L4GA 4M75B 3CMAT 5GAOm 4HCCA 4F7UB 3G1ZA 4N0AA 3LSQA 1KHCA 4C92G 3LSSA 2LT1A 1YIJT 3TCJA 4N4IA 3CPWA 2Q7EA 2LCCA 3CCVT 3NEMA 1ADJA 3S3NA 4QVDA 4J6XA 3P8VA 4BY6C 3LYIA 4LDUA 1JJ2S 1UB4A 4HA8A 3L2RA 5FROA 4P75C 5J3BA 4J8OA 2EQJA 5GMKi 5GANg 2MF2A 3L2VA 2K5LA 1VQNT 2ZT6A 5LL6S 4BI3A 4P72A 4KR2A 2DD5A 4KBMB 1WJQA 3QHSA 5CK9A 4J5YA 1U8RA 4A4GA 3HXWA 1QF6A 3L2ZA 4QQDA 1NYRA 2JTFA 2NS6A 1VQ5A 3QYHB 2ZZDA 2QHTA 4TVAA 5GAN8 3OSVA 1NJ2A 4M78A 3HY1A 2YLBA 4YPFA 2PUOB 4JLIA 4OB2B 4XQ3A 3MP6A 3JCMW 2XD0A 1YCYA 3VQXA 2DKGA 3QTCA 1ADYA 2ZPEB 2J3LA 3JB9J 1WNLA 4H2UA 3VUZA 4YCUA 5DLOA 1UGQB 3JB9D 4YRQA 4EMKA 2RJDA 4KULA 2E5AA 4OVAA 2ZTGA 2KSSA 2GQVA 5CIUA 4P3OA 2E6ZA 2VV5A 4P73A 4WF2A 1FWZA 3HL8A 1VQ6A 2C7IA 1NZ9A 1KG1A 2RA2A 2E3CA 3QNEA 1VQMA 1N27A 4QVCA 1NE8A 4L59A 4CS4A 2QQSA 1KQSS 2WACA 2ALYB 1G51A 3V8LA 3DLMA 2O01E 1YHQT 4BUGA 1KHIA 4LDWA 1X75C 5C0MA 2AMCB 3FEOA 1Q7YC 3IKLA 5LJ3g 4C0FA 3HFZA 1G5VA 5A0GA 1WYDA 2RJEA 5CO7A 3E9IA 2ZIMA 1IREB 1B34A 3SDZA 4Y91A 5GAMd 2CZ7B 3QJ6A 2JUFA 1AHJB 1VQ5T 2CS7A 1SRYA 4YRTA 3QO3A 2GFUA 4LD9K 4M7AE 1B76A 2P0KA 4XU3A 4ZN3A 3OS0A 3L1AA 2LNVA 4Y28E 1ZQ1A 4J15A 3TEHB 2V8JA 3HTZA 1Q7YU 1MHNA 2E65A 4JRIA 3JCMX 1NJ5A 3CPFA 4C8QC 5CQXA 2K57A 1X55A 2QTXA 2KY9A 4YRKA 5KE2A 4CH5A 3S6WA 4ZTJA 4M77E 3CCJA 4BE0A 2M16A 1Y71A 3SFMA 4PJOF 4F7UG 4KUDK 2DD4A 4BWAA 1WLEA 1N9SA 4PHCA 3OYFA 5HGQA 4XU2A 5CCAA 1VQ8A 4MZPA 4BY6B 3PIPA 4DQ2A 1NJ6A 4UP7A 3HSBA 4XAXB 4AH6A 2JNGA 1SETA 4R56A 3RKWA 1VQ6T 2Q7HA 1W2BS 3ERRA 1UEBA 1VQMT 4XEMA 3HRUA 2F69A 1QVFS 2EKOA 2K5FA 3CBMA 1O75A 4C92F 3BFMA 4DOVA 2D6FA 1EIYB 1Y96B 2ZPIB 3PMTA 4C8QD 3INZA 4OGCA 3CC7A 3BDLA 4C0ZA 2K2VA 4XTXA 3VQYA 2K3YA 2RHUA 3OW2A 2QDYB 1DJ7B 2ZPBB 3DB4A 2MAMA 3IKMB 3C94A 3OB9A 3CPWS 3M4QA 5ELOA 1X2HA 4ATOA 3DSQA 4ZN1A 3LX7A 4VUBA 3GIBA 3N5BB 2RJFA 3QO5A 3MEUA 5CQYA 3M9QA 3G71T 3CEYA 1K8AC 4OLFA 2HQEA 4BDZA 4M75C 2RI3A 4RCCA 1RL2A 2ZZFA 4M7DC 1KMMA 4P71C 5GAN7 1YFSA 3E1SA 3PTAA 3C95A 1J5WA 3MP8A 2GCXA 2L3RA 2O4XA 4MZTA 5GAOl 4RQFA 3PNWC 4Q5WA 4HCZA 1YITA 2OTLA 1GGMA 5CKEA 2EJ9A 3I56A 2QEXA 4ZTFA 2ZXFA 2P0LA 2PVGB 3CCQA 1K8AU 3PGGA 3JCMc 4PLIA 2RHQA 2ZIOA 5KE3A 5HY6A 4UP8A 2CIMA 3SWNA 4YYEA 1BIAA 1VQ8T 1V29B 3OQ5A 1W4SA 2WSFE 4C8QF 3NETA 2DK3A 1SESA 1YB3A 1RI0A 4M78E 3FC3A 2RJCA 4M75D 3PCOA 5LJ5j 4ZIBA 2X4WA 2RHSA 1YJWA 4RMOA 2RK2A 4M7DD 5LJ5e 1HXDA 4NOYA 3JCMg 2EL9A 4FU6A 2Q5HA 1BI2A 2MWOA 3H8ZA 1H641 4C5IA 3OYKA 3P8HA 3WQZA 4YCVA 3UWNA 3PT9A 4XTWA 4C0GA 1FYFA 2XGTA 4ELZC 4H2WA 3E9HA 2EFIA 1Q82C 4TTVA 2KAFA 1KQ1A 4RG2A 4MDXA 2RHZA 4NL3A 1USYC 1KOGA 1VIFA 2ZPGB 1M90C 3Q1JA 4V2SA 3A31A 4RG8A 2L8DA 2CYZB 3MEVA 3KUFA 3V7CA 4JJNK 2ARTA 3A8LB 4BACA 2CZ0B 4HKEA 2CZ1B 3PFSA 1WGSA 3P8TA 4H2SA 4J6YA 3X20B 3DB3A 2YRVA 1Q82U 1YITT 3I56T 3A7UA 2CKKA 2CGHA 4BW9A 3LW5E 3JCMJ 3UDCA 4TVYA 2A8EA 1BBWA 1M90U 3JB9G 4M75F 1HK9A 3CCQT 2RM4A 4F7UF 2LQKA 3CMET 3UT1A 5KCOA 3X28B 1QVPA 1G3YA 1ASZA 2R5MA 1E1OA 4XU0A 3QZ9B 1W66A 4J83A 3V8JA 4OB3B 3TEEA 4PJOA 1BI3A 4EMHA 2V8IA 4YREA 3E9GA 2ZT8A 5FLXE 1M8VA 3A5ZA 1YJWT 3LH0A 4M7AC 3RKXA 3HXUA 1OI1A 1NYQA 3OYBA 3GNFB 5CAIA 2RD1A 4JRQA 2DAQA 3QIIA 3M53A 3CCUA 1G3TA 1Y7XA 4P74C 3JB9H 1WJRA 5GAOr 1LOJA 4Q6GA 4M7DB 4C92A 1NPRA 2K4YA 2A3LA 4M77C 2EIFA 3WVDB 3AHUA 5DLQE 3S3MA 4BE1A 2EYQA 4CS2A 1FXXA 2A7YA 3M5AA 4CS3A 3LWHA 3L2WA 3OW2S 3JAME 1X56A 3MEAA 4QQ6A 3UGTA 3KXTA 1B70A 11ASA 2DTHA 3HRTA 5GAMg 4YRRA 4M7AD 4X34A 4XTYA 2ZR2A 4CRIA 4Q15A 3KBGA 2HAXA 2R58A 3V7RA 3PIOA 1JJCB 3P8YA 3OBWA 1E24A 2WSCE 2IY5A 1G5HA 1QP3A 2RH2A 4DOWA 4M77D 3HY0A 1ATIA 4C5GA 3CC4A 1X01A 2DQ3A 4X9CA 1XQHA 2F5KA 3CBOA 4LNSA 4X9DA 3FDRA 4E7LA 4HVCA 3L42A 3OYJA 4TVWA 1U1TA 1OYXA 4NL2A 5GAN3 2ZCFB 2ODRC 5IAYA 2MMPA 4C8QA 3JCMP 2ZZGA 4C8QG 1EOVA 3CCUT 3A7RA 5HK3A 4YRIA 2P4TA 4IUUA 3A74A 2RHIA 2PMFA 2DIGA 3NFCA 4FT2A 5GAN6 2QA4A 1KC8C 4BDYA 3G4SA 2ZR3A 2JN0A 2JTMA 4JLGA 1D3BB 1NJ1A 3FRNA 2VC8A 3X25B 3TREA 2L89A 3JB9I 4QW2A 1YJ9A 4P72C 2JZ2A 2E12A 1BIBA 4J7IA 5GANj 4FM4B 1JRIA 3NTKA 1YGBA 4PKCC 5GAN5 2BUDA 2ARUA 5GANe 4QQGA 1BYMA 1MGQA 2RB6A 3A8GB 4YRPA 2X4YA 1VQKA 4M78C 2EJFA 1NJ8A 2QQ9A 3I55A 2DXBA 1XTDA 2ZINA 1EIFA 4A53A 1KC8U 1KD1C 4MMLA 3VYGA 3MQZA 3RGLA 2ODRD 3VU3C 4B9WA 3JB9F 1G5IA 1E1TA 3JRZA 4YTLA 4M7AB 1YJNA 1SERA 1B7YB 4XTZA 4O2DA 4JRPA 4FT4A 5KNNA 4LVJA 2LCLA 3CC4T 2C8MA 4J6WA 4EMKC 3G6EA 4M75A 1H4SA 2X35A 1LJOA 4M75G 1PYSB 4F7UA 2IG0A 3OYEA 2HD0A 2LT4A 2P0PA 1KD1U 2BKDN 4M7DG 3MF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LC0 A;  2ZT7 A;  4M77 B;  2QHV A;  4UP8 A;  2CIM A;  3SWN A;  2P5I A;  4P73 C;  4YYE A;  1EVL A;  1YFR A;  1BIA A;  2XTI A;  3A32 A;  1I4K 1;  1H4V B;  4YRN A;  4TQF A;  2ZCE A;  4C8Q F;  3HRK A;  3NET A;  4M78 D;  1SES A;  4C92 C;  4PJO G;  1YB3 A;  5K1X A;  4N0A C;  3MEY A;  4K86 A;  4YRO A;  2DZ9 A;  1I8F A;  3PZC A;  4XTU A;  4UP9 A;  4M78 E;  3MF2 A;  4TQD A;  3PCO A;  4M75 D;  5LJ5 j;  2ARS A;  1VQZ A;  3HFV A;  4DPG A;  4ZIB A;  4ZTU B;  3JCM d;  2RHS A;  5C52 B;  4YDQ A;  4M7D D;  2DQ0 A;  5LJ5 e;  1HXD A;  4NOY A;  3JCM g;  4K87 A;  2EL9 A;  2I2L A;  3OD1 A;  3RF1 A;  4M7D E;  5C51 B;  2Q5H A;  2DXU A;  1N9W A;  1H64 1;  4M7A F;  3EFS A;  4CH3 A;  1Z7N A;  3L4G A;  4UPA A;  4M75 B;  5GMK m;  5GAO m;  3WQZ A;  4YCV A;  4K88 A;  4PJO D;  4XTW A;  4F7U B;  3R07 A;  1WPY A;  3G1Z A;  4OP0 A;  1FYF A;  2XGT A;  4N0A A;  3LSQ A;  4H2W A;  4C92 G;  2RHQ B;  3E9H A;  3LSS A;  4PJO E;  5GMK j;  5LJ3 j;  3REX A;  4TTV A;  3RUX A;  2Q7E A;  1KQ1 A;  2DEQ A;  4RQE A;  3SWN B;  3NEM A;  5GMK e;  1ADJ A;  4NL3 A;  5LJ3 e;  1USY C;  4QVD A;  1KOG A;  4J6X A;  2DXT A;  3P8V A;  4YRJ A;  4H2X A;  5ELN A;  3TEG A;  5GAN d;  4HA8 A;  3A31 A;  4V2S A;  4M77 F;  2VXF A;  4P75 C;  1WQW A;  1QE0 A;  5GAM j;  1C0A A;  5GAO n;  5GMK i;  5GAN g;  4H02 A;  4ZTZ B;  3PCO B;  5GAM e;  1B8A A;  1HTT A;  2RHS B;  2ZT6 A;  4JUV A;  4EMG A;  4P72 A;  4KR2 A;  3V7C A;  3KFU A;  4C92 D;  2ART A;  3RES A;  1LNX A;  3QHS A;  5GAN 4;  4J5Y A;  2EWN A;  1TH7 A;  2Q5I A;  4L87 A;  3HXW A;  1QF6 A;  4C92 E;  1LYL A;  4PNO A;  4YRF A;  3L2Z A;  3P8T A;  4H2S A;  1NYR A;  4J6Y A;  3L4G B;  4X5O A;  4MMK A;  3A5Y A;  3JCM f;  2QHT A;  4TVA A;  5GAN 8;  1NJ2 A;  3A7U A;  4M78 A;  4G84 A;  4WJ3 M;  2CGH A;  3HY1 A;  2HNI A;  3UH0 A;  1H4T A;  4BW9 A;  3NEN A;  2YLB A;  2YHT A;  3JCM J;  4TVY A;  1N9R A;  1BBW A;  3JB9 G;  4YPF A;  1WU7 A;  4M75 F;  1HK9 A;  2RM4 A;  4JLI A;  4XQ3 A;  4HT9 A;  3JCM Q;  4XU1 A;  3JCM W;  4F7U F;  1YCY A;  3VQX A;  4M7D A;  4P71 A;  2DKG A;  3QTC A;  1ASZ A;  1E22 A;  1ADY A;  3M4P A;  4TWA A;  2ALY A;  1E1O A;  3REU A;  4XU0 A;  2ZGW A;  4YRS A;  1W66 A;  3JB9 J;  2J3L A;  2Q7G A;  3V8J A;  4G85 A;  3QSU A;  1WNL A;  4PJO A;  2DTO A;  4EMH A;  3UGQ A;  4H2U A;  2AMC A;  4YCU A;  4YRE A;  5GMK h;  2Y90 A;  5LJ3 h;  5GAN h;  2ZT8 A;  1M8V A;  5GAN f;  3JB9 D;  3A5Z A;  2AKW B;  4YRQ A;  4EMK A;  4H2T A;  5E3I A;  4M7A C;  3RKX A;  3HXU A;  4YCW A;  5C53 B;  2DU7 A;  2E5A A;  2FB7 A;  4HWR A;  2DU5 A;  2ZTG A;  1Z7M A;  1NYQ A;  3HFO A;  4M78 B;  5GAM h;  4P3O A;  5CAI A;  5LJ5 d;  2RD1 A;  2QHU A;  3FIF A;  3UFG A;  3BW1 A;  4E51 A;  4P73 A;  2ZNI A;  4WF2 A;  5LJ5 g;  2C7I A;  4HWP A;  4P74 C;  3JB9 H;  2DJZ A;  2RA2 A;  2DDZ A;  2E3C A;  3QNE A;  5GAO r;  4HWT A;  1LOJ A;  4QVC A;  4M7D B;  4C92 A;  4Q6G A;  3HRI A;  3V7S A;  3I7F A;  4CS4 A;  3BJU A;  4WJ4 A;  4M77 C;  1JJC A;  2ALY B;  3AHU A;  1G51 A;  3TEH A;  5I21 A;  3V8L A;  4M7A G;  4RDX A;  4YP0 A;  5DY9 A;  5GAO q;  3HXV A;  4JRK A;  4CS2 A;  5LJ3 d;  1EVK A;  4PJO B;  2AMC B;  3MF1 A;  1M5Q 1;  3IKL A;  3RAC A;  4CS3 A;  5LJ3 g;  2I4M A;  2QHS A;  2E1H A;  4EMK B;  3HFZ A;  1WYD A;  1X56 A;  3E9I A;  4EO4 A;  4P74 A;  2ZIM A;  3UGT A;  1B70 A;  11AS A;  1B34 A;  4Y91 A;  5GAM d;  2VXE A;  2DTH A;  5GAM g;  1WQ7 A;  4M77 G;  4YRR A;  4M7A D;  4RCB A;  4XTY A;  1USY A;  4HT8 A;  1SRY A;  2DZC A;  4YRT A;  3QO3 A;  1B76 A;  2E64 A;  4M7A E;  2CJA A;  2ZR2 A;  4XU3 A;  1EQR A;  4M78 F;  5GAN 2;  4C92 B;  4Q15 A;  4P75 A;  3L1A A;  4XEO A;  3V7R A;  2I4L A;  2DTI A;  5LJ5 h;  4YRL A;  1JJC B;  3TUP A;  1YFT A;  3SWN C;  3P8Y A;  4J15 A;  3BDU A;  4H2V A;  3TEH B;  1E24 A;  1X2G A;  3HTZ A;  2E65 A;  4JRI A;  12AS A;  3JCM X;  2IY5 A;  1G5H A;  4M7D F;  1NJ5 A;  4H2X B;  4C8Q C;  2K57 A;  1X55 A;  2QTX A;  2ZZE A;  1EIY A;  4M77 D;  1Y96 A;  3HY0 A;  1ATI A;  4YRK A;  1D3B A;  4CH4 A;  1X01 A;  2DQ3 A;  4CH5 A;  4X9C A;  3EFR A;  2CJ9 A;  3M4G A;  3HFZ B;  4M77 E;  2I4O A;  4LNS A;  3FB9 A;  3IAL A;  4WI1 A;  1I81 A;  4X9D A;  4HVC A;  4PJO F;  3VQV A;  1B70 B;  4RMF A;  5GAO p;  1B34 B;  3JCM V;  4F7U G;  4TVW A;  1BBU A;  5LJ3 f;  4BWA A;  1WLE A;  1N9S A;  3FJP A;  4PHC A;  4CH6 A;  5HGQ A;  4P3N A;  4XU2 A;  1U1T A;  2E41 A;  4NL2 A;  2ZT5 A;  5GAN 3;  2ODR C;  4C8Q A;  4DQ2 A;  3JCM P;  1NJ6 A;  4TVA B;  3HSB A;  4UP7 A;  1H4Q A;  4AH6 A;  2ZZG A;  4C8Q G;  4XTV A;  5GAM f;  1EOV A;  1SET A;  3A7R A;  3JCM e;  3RKW A;  2Q7H A;  3ERR A;  4YRI A;  5F5W A;  3A74 A;  2PMF A;  4XEM A;  3ICA A;  1U1S A;  4HWO A;  4M75 E;  2IY5 B;  4C92 F;  4P3P A;  5GAN 6;  3VBB A;  2I4N A;  2CJB A;  4F7U E;  3BFM A;  3IG2 A;  2ZR3 A;  1EIY B;  2JN0 A;  1Y96 B;  1D3B B;  1NJ1 A;  4M7A A;  2VC8 A;  3HFN A;  3JCM b;  1B7Y A;  1KQ2 A;  4NCX A;  3NEL A;  1RIQ A;  3VQW A;  3JB9 I;  4YRM A;  1ASY A;  4C8Q D;  3INZ A;  4P72 C;  4XTX A;  3VQY A;  2ZNJ A;  4C8Q E;  1BIB A;  4A54 A;  2EAY A;  5GAN j;  1L0W A;  1JRI A;  3IKM B;  1YGB A;  5GAN 5;  2DVE A;  1PYS A;  2ARU A;  3M4Q A;  5ELO A;  1X2H A;  5GAN e;  3QO7 A;  3DSQ A;  4PG3 A;  3QUI A;  1MGQ A;  2RB6 A;  3RER A;  3GIB A;  5K1P A;  4YRP A;  4C8Q B;  3QO5 A;  3QO8 A;  4M78 C;  2EJF A;  1NJ8 A;  4KQE A;  4M77 A;  4HWS A;  3A7A A;  4EX5 A;  2G4C A;  4OLF A;  2ZIN A;  4KR3 A;  4A53 A;  4M75 C;  4MML A;  3BY7 A;  2E10 A;  3RGL A;  1KMN A;  4RCC A;  3RIR A;  4H2Y A;  2ODR D;  2ZZF A;  3VU3 C;  4M7D C;  2J3M A;  1KMM A;  4P71 C;  5GAN 7;  1YFS A;  2FYK A;  3HXY A;  3JB9 F;  1G5I A;  2AKW A;  5LJ5 f;  1E1T A;  3SB2 A;  3RL6 A;  4M7A B;  1J5W A;  1SER A;  1B7Y B;  4XTZ A;  4O2D A;  3JCM h;  5GMK l;  5GAO l;  5KNN A;  2EJG A;  4RQF A;  4PJO C;  1JBM A;  1IL2 A;  1GGM A;  2PME A;  1HC7 A;  3HXZ A;  2EJ9 A;  2C8M A;  4J6W A;  4M78 G;  4YRC A;  1X54 A;  3W3S A;  4EMK C;  4YRG A;  4M75 A;  1EFW A;  1NNH A;  1H4S A;  1LJO A;  4M75 G;  1PYS B;  2ZXF A;  2P0L A;  4F7U A;  3V8K A;  2YLC A;  3PGG A;  1I5L A;  3JCM c;  4M7D G;  3RKY A;  2RHQ A;  3HXX A;  2ZIO A;  3CMQ A; 
#chains in the Genus database with same CATH topology
 2HDA A;  2D9T A;  4LE9 A;  4M77 B;  1OZ2 A;  4IUR A;  2AT1 B;  4B6M A;  2P5I A;  4P73 C;  1EVL A;  1YFR A;  2XTI A;  3A32 A;  5CVI A;  3J7A F;  1AVZ C;  2W10 A;  1QWF A;  3P8B B;  4M78 D;  3M57 A;  4D8K A;  4LD6 A;  2AKL A;  1QVG P;  1X2K A;  4K86 A;  2EYZ A;  1Z9Z A;  1N5Z A;  4A4F A;  3HFV A;  1VQZ A;  2QGG A;  4ZTU B;  3CCR Q;  2G3R A;  1VQO Q;  5C52 B;  5AYF A;  1QP2 A;  3MCA B;  4YDQ A;  2DQ0 A;  2BZX A;  3G4S T;  3G7Z A;  3UPU A;  2I2L A;  5HKC A;  2BTT A;  1VQL A;  2LP5 A;  4GLM A;  2KVQ G;  1N9W A;  3EFS A;  4CH3 A;  3HRS A;  1RAG B;  1HD3 A;  2FVU A;  3PMI A;  1YJ9 T;  3URG A;  4RTX A;  2V26 A;  3E19 A;  3R07 A;  1WPY A;  2H3E B;  2O9V A;  3QYG B;  2CUB A;  5J26 A;  1PSE A;  3TVT A;  3OYG A;  4PJO E;  5GMK j;  5LJ3 j;  3GLX A;  3REX A;  3EH1 A;  1D1A A;  3AT1 B;  5GMK e;  5LJ3 e;  4TVR A;  4CC4 B;  3O5Z A;  1VQK T;  2K79 A;  4YRJ A;  2V8K A;  5ELN A;  3I55 T;  3TEG A;  2HSE B;  1KSW A;  3H6Z A;  1WHG A;  1C0A A;  3OYD A;  4H02 A;  2VGM A;  3OMG A;  1M3A A;  3VS5 A;  5KYX B;  1E7O A;  1HTT A;  4IIM A;  2VUB A;  5L23 A;  3CC2 Q;  3X26 B;  2F5T X;  1VQ9 A;  3KFU A;  1D1B A;  5GAN 4;  4IUV A;  2EWN A;  1W2B P;  2Q5I A;  4PFZ A;  1YJN T;  4C92 E;  4PNO A;  5CKB A;  4YRF A;  3L4G B;  1QVF P;  4X5O A;  2KK4 A;  4MMK A;  3OS5 A;  3CMA Q;  3T9N A;  5FWB A;  4WJ3 M;  5J39 A;  4LDX A;  1H4T A;  4JZ3 A;  3G6E T;  3GP8 A;  3CCJ T;  1TTH B;  1BU1 A;  2HBP A;  4DBH A;  1JB0 E;  3CCS Q;  3EHR A;  2XDP A;  1ZSZ C;  3RMQ A;  1XJW B;  2CRE A;  3CCR A;  1G3W A;  1SSH A;  1VQO A;  3OYM A;  4LVI A;  5IXF A;  3M4P A;  2ALY A;  1B7T A;  1TG0 A;  1D1C A;  3REU A;  3GNG A;  2MI6 A;  3QWX X;  2PVD B;  5I22 A;  1RAH B;  3ASK A;  1VQN Q;  3RMS A;  2LX9 A;  3UGQ A;  2AMC A;  2K5I A;  5GMK h;  2X3X D;  5LJ3 h;  5HK0 A;  5GAN f;  5FU7 B;  3M0Q A;  2DPP B;  4ZGD B;  4H2T A;  5E3I A;  4EDU A;  1M2V B;  2Y4Y A;  2HKN A;  2DU7 A;  1RAD B;  2DU5 A;  1VQL T;  2KE9 A;  1Z7M A;  3HPW A;  3L2U A;  1GFC A;  4M78 B;  2ROL A;  4PJM A;  5LJ5 d;  3FIF A;  4NS5 A;  2DX1 A;  3UFG A;  3BW1 A;  1H8K A;  1M1K C;  6AT1 B;  1UGR B;  3CC7 T;  3FLG A;  4HWP A;  3X24 B;  4E7J A;  1YN8 A;  4HWT A;  1B07 A;  9ATC B;  3HRI A;  2RI2 A;  4X1V A;  3CC2 A;  1JQQ A;  1H3Z A;  4OB0 B;  2PQW A;  3WVE B;  3BJU A;  4WJ4 A;  1IZ6 A;  1TXQ A;  3TEH A;  2A28 A;  1MNE A;  4M7A G;  1ARK A;  2DXC A;  2HBW A;  3HXV A;  3ZFJ A;  4JRK A;  1MMA A;  3ZBD A;  1EVK A;  5D6Y A;  1WXT A;  1KC8 R;  3CXC P;  5C6S A;  3OYL A;  1WX6 A;  3WXM B;  4WCI A;  4FSX A;  2I4M A;  5IT9 E;  1KFZ A;  4EMK B;  3OS1 A;  5D6W A;  1VQ9 T;  3CCS A;  4P74 A;  4BB7 A;  3TU4 K;  1QCO A;  1VIE A;  2JXB A;  1M1K U;  1BI0 A;  2KBT A;  2RMO A;  2VXE A;  3MJX A;  1VQP A;  4XK8 E;  4ESR A;  1QVG A;  1XNI A;  1WQ7 A;  3EG3 A;  4M77 G;  4RCB A;  3ER0 A;  4HT8 A;  5IHK A;  2AIR B;  3QDR B;  2MOX A;  2E64 A;  2B8A A;  2OTL T;  1EQR A;  2QDL A;  4LVM A;  5GAN 2;  2Y4X A;  2QEX T;  2LRQ A;  4PJL A;  4P75 A;  4XEO A;  1FX7 A;  2R5A A;  1UGS B;  2EGA A;  2HSP A;  2DTI A;  4IUT A;  5LJ5 h;  4D6W A;  1YFT A;  3SWN C;  1OOT A;  3BDU A;  3QXE B;  5DM7 R;  1X2G A;  3CCR T;  1YHQ Q;  4OMF B;  1VQO T;  2HQX A;  5FRM A;  8AT1 B;  4M7D F;  3JV3 A;  4H2X B;  4MZM A;  3OYY A;  2C0O A;  3OBY A;  2ZZE A;  1EIY A;  1Y96 A;  5KCH A;  4N4G A;  4CH4 A;  2NUP B;  4LUD A;  3MO8 A;  3EFR A;  3M4G A;  1ZUY A;  3HFZ B;  2I4O A;  2JMA A;  3FB9 A;  2NUT A;  3HKS A;  4WI1 A;  1I81 A;  5L8R E;  2A08 A;  3VQV A;  2RPN A;  4RMF A;  5GAO p;  2COZ A;  1WHL A;  1B34 B;  2J6K A;  3JCM V;  2CP2 A;  2YRD A;  1BBU A;  4FL6 A;  5LJ3 f;  1XOV A;  1ABQ A;  2QXF A;  3FJP A;  4CH6 A;  2PUK B;  1T0J A;  4P3N A;  4OMQ A;  4LN2 A;  3LH5 A;  4DA4 A;  2KEA A;  2DL5 A;  2E41 A;  1O9S A;  2DL7 A;  4AG2 C;  3QZ5 B;  3VS0 A;  2K3B A;  1G3S A;  4XTV A;  1AT1 B;  3JCM e;  4OMM A;  5KH6 A;  3O8V A;  5F5W A;  1D0X A;  3MET A;  3VJP A;  3ICA A;  1U1S A;  1AZG B;  3MPU B;  3CC2 T;  1AD5 A;  2CH4 A;  2NUZ A;  4M75 E;  4KUI A;  1UHF A;  2JT4 A;  2PVO B;  4BE2 A;  3VBB A;  1TU0 B;  2I4N A;  4F7U E;  1GCQ C;  3BE3 A;  4KRT A;  5CKH A;  1ZHI A;  2E5Q A;  5FU6 C;  4NCX A;  3NEL A;  4IIO A;  2CP0 A;  1IB8 A;  2OAU A;  1ASY A;  3UF4 A;  2HEQ A;  1E6G A;  2L5Q A;  3L2Q A;  2ZNJ A;  1KJW A;  2GF7 A;  3OSS C;  2EAY A;  1L0W A;  3CCS T;  1M2O A;  3EHQ A;  3EGD A;  4C0D C;  1ZSZ B;  3OYH A;  3QO7 A;  2J6F A;  2QGF B;  3QUI A;  1VQP T;  2X4J A;  5K1P A;  2DBM A;  1YHQ A;  2F1L A;  3GOX A;  2FHD A;  1PRL C;  1RLP C;  1BB9 A;  1VQ4 Q;  4KQE A;  2FZC B;  4HWS A;  3A7A A;  2LC4 A;  2G4C A;  1Y07 A;  1EZZ B;  4FSS A;  2LTO A;  1U3O A;  1G8X A;  3C12 A;  3BY7 A;  1UHC A;  1KMN A;  1M30 A;  2XIC A;  3RIR A;  4H2Y A;  2OAW A;  2HL5 C;  2J3M A;  1AWO A;  3QG1 A;  3HXY A;  3R6N A;  4J7F A;  5LJ5 f;  3SB2 A;  2AZV A;  2QAZ A;  4J9C A;  1LCK A;  4HCB A;  3JCM h;  2QTV A;  4PJO C;  1G83 A;  1TOV A;  1IL2 A;  2PME A;  3HXZ A;  3MKD A;  4M78 G;  1M1F A;  1K76 A;  4A4K A;  4YRC A;  2J06 A;  4P5N A;  2PNI A;  2H3J A;  2RQW A;  4A63 B;  3W3S A;  2GBQ A;  4C5E A;  3C4S A;  5D6X A;  3M55 A;  1S72 A;  4YRG A;  4FW2 A;  1EFW A;  1NNH A;  2P0Q A;  3M58 A;  5KYW A;  4PL6 A;  1LPL A;  2OTJ Q;  2KRS A;  3V8K A;  2DL3 A;  2NYS A;  4DEX A;  3CXC A;  3OYC A;  3LC0 A;  4O5V A;  2L3S A;  3G71 Q;  2QHV A;  4LDV A;  4LDY A;  1JXM A;  3CCE Q;  1NG2 A;  3CCM Q;  4IKF A;  4RKU E;  1I4K 1;  5IHI A;  1H4V B;  4TQF A;  1M27 C;  2EGE A;  2XKO C;  4AFQ C;  3M59 A;  1GBQ A;  3J80 E;  4C92 C;  5K1X A;  4N0A C;  3PE0 A;  3MEY A;  3HHT B;  4YRO A;  1I8F A;  3PZC A;  4XTU A;  4UP9 A;  3MF2 A;  4TQD A;  4FYW B;  3TSW A;  2ARS A;  1UFF A;  2RO0 A;  1SPK A;  2VGN A;  2O4X B;  1K1Z A;  1X6O A;  2CP6 A;  3OD1 A;  1IRX A;  3RF1 A;  1K0S A;  2AHJ B;  4DEY A;  1VQ4 A;  4M7A F;  5CR2 A;  1Z7N A;  2D8J A;  4UPA A;  5GMK m;  4A4E A;  1QW1 A;  1ZA1 B;  1Q81 C;  4K88 A;  4DBR A;  4PJO D;  3H0I A;  1AWX A;  4ME7 A;  2M9U A;  3A8O B;  4OP0 A;  4Z89 A;  2RHQ B;  5FU7 C;  3RUX A;  2BIV A;  2DEQ A;  3NPF A;  4RQE A;  3SWN B;  2RK1 A;  3RR6 A;  2D0Q B;  3QWY A;  2M1H A;  1TUG B;  2DXT A;  4H2X A;  4RTT A;  5GAN d;  3JSC A;  4HVU A;  4M77 F;  2VXF A;  1WQW A;  1QE0 A;  1E6H A;  5GAM j;  3OA6 A;  5GAO n;  2NUP A;  3QKJ A;  2QG9 B;  1ZUK A;  4CC2 A;  5A2Q E;  2GFA A;  2C0T A;  4ZTZ B;  4PLL A;  1NBE B;  3PCO B;  4AG1 C;  5GAM e;  1B8A A;  2RHS B;  4JUV A;  4EMG A;  1M1G A;  4BD3 A;  1X69 A;  4C92 D;  3NTI A;  3RES A;  1NLO C;  4DBF A;  1LNX A;  2QI2 A;  2OTJ A;  4LVL A;  2XK0 A;  1TH7 A;  4CI0 C;  4L87 A;  1W6X A;  4LVK A;  2HCK A;  1C0M A;  1Q81 U;  1LYL A;  3EFO A;  4N4H A;  1QVG S;  5IXB A;  1M4Z A;  1IGU A;  4QT7 A;  1WHM A;  2AKK A;  3G71 A;  1PHT A;  1VYU A;  2CZ6 B;  4AMC A;  3CCE A;  3CCM A;  3A5Y A;  3JCM f;  4BI8 B;  2F2V A;  4G84 A;  2QQR A;  1NJI C;  1PSF A;  2HNI A;  4AFZ C;  3UH0 A;  1S72 T;  3NEN A;  2KQW A;  2YHT A;  1M3B A;  1N9R A;  1RLQ C;  1WU7 A;  4Z02 A;  2QAS A;  2K6D A;  4Y92 A;  1R0B G;  2DO3 A;  4HT9 A;  3NGP A;  4XU1 A;  3JCM Q;  3MEW A;  4E7S A;  5FW9 A;  1SEM A;  4M7D A;  1RAI B;  4P71 A;  1RAE B;  1GXI E;  1E22 A;  2M02 A;  3PVQ A;  4TWA A;  2EQK A;  1ZX6 A;  4QVZ A;  2ZGW A;  3VV0 A;  4YRS A;  5FU6 B;  2Q7G A;  4G85 A;  4CC7 A;  2ENM A;  3QSU A;  2DTO A;  3THK A;  2X4X A;  3ZL7 C;  2IVW A;  1TUD A;  2VYT A;  4E47 A;  2JTE A;  2Y90 A;  5GAN h;  1OZ3 A;  3LLR A;  1SSF A;  5M9O A;  2AKW B;  3DKM A;  2JOY A;  3CD6 Q;  1N8R C;  1NJI U;  1MV3 A;  4C0D B;  2QQA A;  4YCW A;  2QA4 T;  2RHX A;  4EPC A;  5C53 B;  3EGX A;  1VQ7 Q;  2KT1 A;  2FB7 A;  1YIT Q;  4HWR A;  1VYT A;  1VQ4 T;  3HFO A;  4MDW A;  5GAM h;  4LNP A;  2QHU A;  1PRM C;  2MWP A;  2DNU A;  4E51 A;  2ZNI A;  4Z8A A;  4GLK A;  5LJ5 g;  2RNA A;  2KT8 A;  2EQU A;  2C06 A;  2DJZ A;  1Q95 G;  2DDZ A;  2XI9 A;  3QJY A;  3CME Q;  1EX4 A;  3V7S A;  3M54 A;  2K3X A;  3I7F A;  2L2P A;  1JJC A;  2E70 A;  4ZGJ B;  5I21 A;  1YI2 Q;  4JPB W;  3P8D A;  4E7H A;  4RDX A;  4YP0 A;  5DY9 A;  1YBY A;  1ZLM A;  5GAO q;  3M0S A;  5D7U A;  1JJ2 A;  5FRN A;  4B9X A;  4BI4 A;  1N8R U;  5LJ3 d;  4E6R A;  3QBY A;  4PJO B;  4R55 A;  3MHX A;  3A8M B;  1M5Q 1;  3RAC A;  3A5Z B;  2L3P A;  4ELY C;  2QHS A;  2E1H A;  2E3H A;  3H9N A;  4O6J A;  1YJW Q;  2LQ8 A;  2CH4 W;  4LXC A;  2PTK A;  2CUD A;  4EO4 A;  2OTJ T;  1ZSG A;  4HT4 A;  1I5O B;  2XG8 D;  3GPL A;  5I2S A;  2WSE E;  4L5G A;  2CP7 A;  5CKF A;  3CCL Q;  2DIQ A;  2X51 A;  1VUB A;  3CCE T;  3HP9 A;  3CCM T;  8ATC B;  1USY A;  4II1 A;  1NEG A;  2DZC A;  3LGL A;  3OYN A;  2E5K A;  3U23 A;  3VUB A;  2CJA A;  1K73 C;  2OX7 A;  2LX7 A;  4M78 F;  3QPH A;  1SF9 A;  1QQJ A;  4C92 B;  2JVV A;  1UGP B;  1QKW A;  1YIJ Q;  2I4L A;  2ZPF B;  2FEI A;  2RHY A;  4YRL A;  3TUP A;  2I0N A;  4EIK A;  3S3O A;  4H2V A;  1N6A A;  1BKB A;  2FL7 A;  3CCV Q;  2RQU A;  2VB6 A;  3CD6 A;  12AS A;  2DBK A;  1JU5 C;  3VKI A;  5A0L A;  1VQ7 A;  1B3Q A;  2AZS A;  2DM1 A;  3M4Y A;  1D3B A;  3CPW P;  1M9S A;  2CJ9 A;  4A4H A;  1WZO A;  3LGF A;  2LVM A;  2EQM A;  3IAL A;  1X43 A;  4OGE A;  4L6V 5;  1U06 A;  3DLL A;  2JS2 A;  1B70 B;  3CBP A;  3IQL A;  3OMC A;  1V1C A;  2YUP A;  2KDS A;  3CME A;  2XID A;  1K73 U;  3EG9 A;  3CXC S;  2QQB A;  2V1Q A;  2ZPH B;  2KNB B;  2Z0W A;  1YI2 A;  1OPK A;  2ZT5 A;  1WHK A;  4TVA B;  1H4Q A;  1OU8 A;  2O2O A;  2EKH A;  4LUE A;  1BI1 A;  4FIB A;  2YRC A;  5GAM f;  3SD4 A;  2M0Y A;  1G2B A;  2FPE A;  3F70 A;  1PM3 A;  2RI5 A;  1Y0M A;  4IUQ A;  3EGU A;  4GY5 A;  3EAE A;  2M51 A;  4HWO A;  2BZ8 A;  2MK5 A;  1K9M C;  2LJ1 A;  2IY5 B;  5I2M A;  2NLU A;  2LQN A;  4P3P A;  2D8H A;  4ZGE B;  1KQS A;  2CJB A;  4OF1 A;  2R57 A;  1ZBX A;  3IG2 A;  4FW1 A;  4JJD A;  1SG5 A;  3J81 E;  2XDB A;  1T3L A;  4M7A A;  3HFN A;  3CCL A;  3JCM b;  1B7Y A;  1KQ2 A;  1RIQ A;  3VQW A;  1WIE A;  1MMD A;  4JDS A;  1ZUU A;  1RAF B;  3CMA A;  5A0D A;  5KYU B;  5IN1 A;  4C8Q E;  4A54 A;  1RUW A;  3LWI A;  2XHC A;  3VYH B;  1NPP A;  1YIJ A;  2DVE A;  1PYS A;  2FRY A;  4E7K A;  1M8M A;  1P92 A;  4E7I A;  1Q81 R;  3ME9 A;  1RAC B;  3CCV A;  4PG3 A;  1SHF A;  3RER A;  1KIK A;  1HJD A;  4C8Q B;  3QO8 A;  5CKD A;  4M77 A;  1K9M U;  4EX5 A;  4UC4 A;  1K9A A;  4PFO A;  4FCY A;  2DL8 A;  4KR3 A;  1Q86 C;  4JS5 A;  3NTH A;  2EW3 A;  2E10 A;  1UEC A;  3M0U A;  4J9I A;  2X3W D;  1VQN A;  2LQW A;  2VKN A;  1TSF A;  2LJ0 A;  2FYK A;  1UG1 A;  4HVV A;  2AKW A;  4WTO B;  4OMN A;  3CD6 T;  3E9F A;  3RL6 A;  4J9D A;  1IO6 A;  5IH2 A;  2E6N A;  4JS4 A;  5ECA A;  4RTV A;  3OS2 A;  4F16 A;  1VQ7 T;  2KMT A;  5GMK l;  2EJG A;  1SRL A;  1JBM A;  2D1X A;  1AEY A;  2GTJ A;  4AFS C;  1HC7 A;  4C5H A;  1X54 A;  2YUO A;  1WYX A;  2LDM A;  2IPO B;  3A8H B;  1X2Q A;  2YLC A;  1Q86 U;  3ZEH A;  1I5L A;  1NJI R;  2M0O A;  2XU8 A;  3RKY A;  1PC0 A;  3HXX A;  4YRM A;  3CMQ A;  3GF5 A;  2ZT7 A;  4OB1 B;  1NM7 A;  1VQ5 Q;  1YI2 T;  5EG2 A;  2PU9 B;  3OYA A;  1WJS A;  4KT0 E;  2COW A;  1PKT A;  4YRN A;  2DMO A;  2ZCE A;  3HRK A;  3M56 A;  4PJO G;  1X6B A;  1W2B A;  2ESW A;  2DZ9 A;  3MP1 A;  4KGV B;  1IGQ A;  5KYX A;  4DPG A;  3OYI A;  1QVF A;  1PD0 A;  3JCM d;  3VS1 A;  2KR3 A;  3R6O A;  3OY9 A;  4IUP A;  3ULR B;  5GJW B;  1ZBJ A;  4K87 A;  1BBZ A;  3CCL T;  1R8O B;  4M7D E;  1T0H A;  5C51 B;  1QWE A;  2DXU A;  1N8R R;  2XDD A;  3L4G A;  2H8H A;  1PWT A;  4M75 B;  3CMA T;  5GAO m;  1UUE A;  4HCC A;  3CQT A;  4F7U B;  3GBQ A;  3G1Z A;  1PCX A;  4N0A A;  3LSQ A;  1KHC A;  4C92 G;  3LSS A;  2LT1 A;  1YIJ T;  3TCJ A;  2DIL A;  4N4I A;  3CPW A;  2Q7E A;  2KRO A;  1FMK A;  2LCC A;  3CCV T;  3NEM A;  1ADJ A;  3S3N A;  4F17 A;  4QVD A;  1OEB A;  1EFN A;  4J6X A;  3P8V A;  1AWW A;  4BY6 C;  3LYI A;  4LDU A;  3I9Q A;  1JJ2 S;  1UB4 A;  4HA8 A;  1TUC A;  3L2R A;  5FRO A;  4P75 C;  5J3B A;  4J8O A;  2EQJ A;  5GMK i;  5GAN g;  2MF2 A;  1VQ6 Q;  3L2V A;  1WA7 A;  2K5L A;  2CT4 A;  1VQM Q;  2ED1 A;  1VQN T;  2ZT6 A;  2X9H A;  1UGV A;  4KH0 B;  5LL6 S;  4BI3 A;  4P72 A;  4KR2 A;  2DD5 A;  4KBM B;  1WJQ A;  3QHS A;  5CK9 A;  4J5Y A;  1U8R A;  4A4G A;  3HXW A;  1QF6 A;  1M2V A;  1NYG A;  3L2Z A;  4QQD A;  1NYR A;  2JTF A;  2NS6 A;  1VQ5 A;  3QYH B;  2ZZD A;  2KRN A;  3QDF A;  2QHT A;  4TVA A;  5GAN 8;  3OSV A;  1NJ2 A;  4M78 A;  3HY1 A;  2YLB A;  1K8A R;  4PK4 A;  3C0C A;  4YPF A;  2PUO B;  2RN8 A;  4JLI A;  4OB2 B;  4XQ3 A;  1YFN A;  1K73 R;  3MP6 A;  2LNH B;  3JCM W;  2XD0 A;  1YCY A;  3VQX A;  2IIM A;  1QCN A;  2YDL A;  2F2X A;  2DKG A;  3QTC A;  1ADY A;  3OW2 P;  2JMC A;  2L0A A;  2YUQ A;  3A1P A;  2ZPE B;  2BE7 D;  2J3L A;  3JB9 J;  1VA7 A;  1WNL A;  1H92 A;  1WFW A;  4H2U A;  1U5S A;  5KYU A;  3VUZ A;  4YCU A;  5DLO A;  3FJ5 A;  1C6V X;  1UGQ B;  3JB9 D;  2DYI A;  4YRQ A;  4EMK A;  2JM8 A;  2RJD A;  2G6F X;  3I35 A;  4KUL A;  2E5A A;  4OVA A;  3D7S B;  2ZTG A;  2KSS A;  2ECZ A;  5FWC A;  2GQV A;  5CIU A;  1D0Z A;  2FZG B;  4KGX B;  4P3O A;  2E6Z A;  3CCJ Q;  4FYV B;  3E2U A;  2VV5 A;  4P73 A;  3TSZ A;  4WF2 A;  1FWZ A;  3HL8 A;  1VQ6 A;  2C7I A;  1NZ9 A;  1KG1 A;  2RA2 A;  2E3C A;  3QNE A;  1VQM A;  1N27 A;  4QVC A;  1NE8 A;  3VRY A;  2GNC A;  2ED0 A;  4L59 A;  4D8D A;  4CS4 A;  1GL5 A;  2QQS A;  1KQS S;  2WAC A;  2ALY B;  1G51 A;  3V8L A;  3DLM A;  2O01 E;  1YHQ T;  4J9E A;  1K9M R;  1VQ8 Q;  3SHW A;  1TS9 A;  4BUG A;  3KFV A;  1V76 A;  1KHI A;  4LDW A;  2XMF A;  3PVL A;  2GTO A;  1X75 C;  1CKA A;  5C0M A;  2AMC B;  1X6G A;  3FEO A;  1Q7Y C;  3IKL A;  5LJ3 g;  4HCK A;  1QCF A;  4C0F A;  2CSQ A;  3HFZ A;  1HSQ A;  2EPD A;  5GJV B;  5A0G A;  1G5V A;  3EG1 A;  3REB B;  1GFD A;  1WYD A;  2RJE A;  1SKU B;  5CO7 A;  3E9I A;  2ZIM A;  2JS0 A;  1IRE B;  1B34 A;  3SDZ A;  4Y91 A;  1D0Y A;  2J7I A;  1YP5 A;  5GAM d;  2YWW A;  2CZ7 B;  3QJ6 A;  2AK5 A;  2JUF A;  2BE9 B;  1AHJ B;  2NWM A;  1VQ5 T;  2VWF A;  2CS7 A;  1PNJ A;  1SRY A;  3CC7 Q;  4YRT A;  3QO3 A;  1OQK A;  2GFU A;  4LD9 K;  4M7A E;  1B76 A;  2P0K A;  4XU3 A;  1FMV A;  4ZN3 A;  3OS0 A;  2PZ1 A;  3L1A A;  2DA9 A;  2YUN A;  1Q86 R;  2LNV A;  4Y28 E;  1ZQ1 A;  4J15 A;  3TEH B;  2V8J A;  3HTZ A;  1Q7Y U;  1MHN A;  2E65 A;  4JRI A;  3JCM X;  2JJ9 A;  3M0T A;  1NJ5 A;  3CPF A;  4C8Q C;  2DYB A;  5CQX A;  3EH2 A;  2K57 A;  1X55 A;  4FYX B;  2QTX A;  2KY9 A;  4YRK A;  5KE2 A;  1WHJ A;  2VVK A;  1WXU A;  4CH5 A;  3S6W A;  4ZTJ A;  4M77 E;  1J3T A;  3CCJ A;  4BE0 A;  3UA6 A;  1PD1 A;  3NMZ C;  1VQ9 Q;  2M16 A;  2P84 A;  1Y71 A;  3SFM A;  2E3I A;  4PJO F;  4F7U G;  5IHN A;  4KUD K;  1A0N B;  2DD4 A;  4BWA A;  1WLE A;  1N9S A;  4ORZ A;  3TQ7 P;  1NEB A;  4PHC A;  2KYB A;  3OYF A;  5HGQ A;  4XU2 A;  1ZSZ A;  1I07 A;  5CCA A;  1VQ8 A;  2OTL Q;  4ZNX A;  4MZP A;  4BY6 B;  3PIP A;  4DQ2 A;  1NJ6 A;  3I56 Q;  3HSB A;  4XAX B;  4UP7 A;  2HL3 A;  4AH6 A;  2JNG A;  2QEX Q;  1NYF A;  2EYW A;  4R56 A;  1SET A;  3RKW A;  1VQ6 T;  2Q7H A;  1W2B S;  3ERR A;  1UEB A;  1VQM T;  4XEM A;  3CCQ Q;  3HRU A;  2F69 A;  1QVF S;  2EKO A;  2K5F A;  3CBM A;  1O75 A;  4C92 F;  4AT1 B;  2JM9 A;  2FPF A;  3BFM A;  4DOV A;  2D6F A;  1EIY B;  3M0R A;  1Y96 B;  3RBB B;  1MMN A;  2J6O A;  2ZPI B;  3VS2 A;  3PMT A;  2NUT B;  4C8Q D;  3INZ A;  4OGC A;  3CC7 A;  3BDL A;  4C0Z A;  2K2V A;  4XTX A;  3VQY A;  2K3Y A;  2KRM A;  2RHU A;  3OW2 A;  1VYV A;  2QDY B;  1DJ7 B;  2OI3 A;  2ZPB B;  2MAM A;  3DB4 A;  1UE9 A;  3IKM B;  3UA7 A;  1D09 B;  3C94 A;  3OB9 A;  3CPW S;  3M4Q A;  5ELO A;  1X2H A;  4KH1 B;  4ATO A;  3DSQ A;  1WXB A;  3LX7 A;  4ZN1 A;  4VUB A;  5KYY B;  3GIB A;  3N5B B;  2RJF A;  3QO5 A;  3MEU A;  5CQY A;  3M9Q A;  3G71 T;  4E2F B;  3CEY A;  1K8A C;  4FYY B;  4OLF A;  1OPL A;  2HQE A;  4BDZ A;  4M75 C;  2LZ6 B;  2RI3 A;  4RCC A;  1H3H A;  1RL2 A;  2ZZF A;  2GQI A;  4M7D C;  1GCP A;  2ZAE A;  1KMM A;  1UJY A;  1VOM A;  5GAN 7;  4P71 C;  1YFS A;  2A36 A;  2RQT A;  3E1S A;  3PTA A;  3C95 A;  1J5W A;  4PFP A;  3MP8 A;  2GCX A;  2L3R A;  2O4X A;  4MZT A;  7AT1 B;  5GAO l;  4RQF A;  3RNJ A;  3PNW C;  4Q5W A;  3EG0 A;  1I1J A;  4HCZ A;  1YIT A;  1SRM A;  2OTL A;  2JW4 A;  5CKE A;  2EJ9 A;  1GGM A;  3I56 A;  4OMO A;  2OJ2 A;  1WI7 A;  2QEX A;  2QYZ A;  3H0H A;  2DER A;  4ZTF A;  3I5R A;  2ZXF A;  2DLP A;  1ABO A;  2PVG B;  3EGD B;  2P0L A;  4R0K A;  3CCQ A;  1K8A U;  3PGG A;  2ATC B;  1VQP Q;  3JCM c;  4PLI A;  2RHQ A;  2ZIO A;  5KE3 A;  5HY6 A;  2DEU A;  4RUG A;  4UP8 A;  2CIM A;  3SWN A;  2MIO A;  3A98 A;  4YYE A;  4ANJ A;  1BIA A;  1VQ8 T;  1V29 B;  2K2M A;  3OQ5 A;  1W4S A;  2WSF E;  4GBQ A;  4C8Q F;  3NET A;  2DK3 A;  1SES A;  2MCN A;  1YB3 A;  1RI9 A;  1RI0 A;  4M78 E;  3FC3 A;  2RJC A;  4M75 D;  3PCO A;  5LJ5 j;  1X27 A;  4ZIB A;  4F14 A;  2X4W A;  2RHS A;  1YJW A;  4RMO A;  2CT3 A;  2RK2 A;  4M7D D;  2HKQ B;  2LJ3 A;  5LJ5 e;  1HXD A;  4NOY A;  3JCM g;  2EL9 A;  4FU6 A;  2Q5H A;  1TWB A;  1BI2 A;  3REA B;  2MWO A;  5KYN A;  3H8Z A;  1H64 1;  4C5I A;  1OUL A;  2DE0 X;  3OYK A;  1IHV A;  3P8H A;  3WQZ A;  2CP3 A;  4YCV A;  3UWN A;  5KYW B;  1AZE A;  3PT9 A;  4XTW A;  1I0C A;  3VS3 A;  4C0G A;  1FYF A;  2XGT A;  4ELZ C;  4HVW A;  4H2W A;  3E9H A;  2EFI A;  1Q82 C;  4TTV A;  2KAF A;  1KQ1 A;  4RG2 A;  4MDX A;  2RHZ A;  4PJJ A;  4NL3 A;  1USY C;  2RQR A;  1KOG A;  4Z88 A;  1VIF A;  2ZPG B;  4J9F A;  1M90 C;  2FO0 A;  3Q1J A;  4V2S A;  1GCQ A;  3A31 A;  4RG8 A;  4RTY A;  3CCU Q;  2DF6 A;  1WHH A;  2L8D A;  1OX8 A;  1R0C B;  2CYZ B;  3MEV A;  3KUF A;  3V7C A;  4JJN K;  2ART A;  3A8L B;  1Q7Y R;  4BAC A;  2CZ0 B;  4HKE A;  5EC7 A;  2CZ1 B;  4RTU A;  3PFS A;  2FRW A;  1WGS A;  1W70 A;  1CSK A;  1GRI A;  2SRC A;  3P8T A;  4H2S A;  4J6Y A;  1WDX A;  3X20 B;  2QK0 A;  3DB3 A;  2HMA A;  2YRV A;  1Q82 U;  1YIT T;  4DBQ A;  3VS4 A;  3I56 T;  5AT1 B;  2O9S A;  3A7U A;  2CKK A;  4CC3 A;  2CGH A;  4BW9 A;  3LW5 E;  3JCM J;  3UDC A;  4TVY A;  2A8E A;  2C0I A;  1BBW A;  1M90 U;  1OV3 A;  3JB9 G;  4M75 F;  1KD1 R;  1QMC A;  1HK9 A;  3CCQ T;  2J05 A;  2RM4 A;  1UJ0 A;  1BCM A;  2DL4 A;  3EG2 A;  4F7U F;  2LQK A;  3CME T;  3UT1 A;  5KCO A;  4OML A;  1QVP A;  3X28 B;  1G3Y A;  1UTI A;  1ASZ A;  2LMJ A;  2R5M A;  1KK7 A;  1AWJ A;  1E1O A;  4XU0 A;  1W1F A;  2HQH A;  2HZY A;  3H41 A;  3QZ9 B;  1W66 A;  4J83 A;  3V8J A;  4OB3 B;  3TEE A;  2F2W A;  4PJO A;  1BI3 A;  4EMH A;  2V8I A;  4YRE A;  3E9G A;  1Z9Q A;  1K0X A;  2ZT8 A;  5FLX E;  1M8V A;  3A5Z A;  1YWP A;  1YJW T;  3LH0 A;  3EFO B;  2DFU A;  4M7A C;  1RAA B;  4JJB A;  3RKX A;  3HXU A;  1OI1 A;  4KGZ B;  5KYY A;  4J9H A;  1WLP B;  4AFU C;  1ZA2 B;  3CC4 Q;  1NYQ A;  3OYB A;  2K7A A;  3GNF B;  4F04 B;  1QKX A;  5CAI A;  2RD1 A;  4JRQ A;  1S72 Q;  3G1J A;  2CSI A;  2DAQ A;  3QII A;  3M53 A;  3CCU A;  1G3T A;  4M4Z A;  1Y7X A;  3NHN A;  4P74 C;  1RAB B;  3JB9 H;  1ACM B;  1UDL A;  1WJR A;  2A37 A;  1YNZ A;  5GAO r;  1LOJ A;  4Q6G A;  4M7D B;  4C92 A;  1NPR A;  2K4Y A;  2A3L A;  2D0N A;  4M77 C;  2EIF A;  3WVD B;  3AHU A;  5DLQ E;  3S3M A;  4BE1 A;  2COY A;  4JJC A;  2EYQ A;  1MMG A;  4CS2 A;  2A0F B;  1FXX A;  2A7Y A;  2E4H A;  1GBR A;  2ABL A;  2KI7 A;  3M5A A;  1YWO A;  4CS3 A;  3LWH A;  2MYS A;  1AOJ A;  3L2W A;  1CKB A;  3OW2 S;  2RQV A;  3JAM E;  1X56 A;  1BCO A;  1IHW A;  3MEA A;  4QQ6 A;  3UGT A;  4RTW A;  3KXT A;  3HTR A;  2QA4 Q;  1F1B B;  1B70 A;  11AS A;  3EGX B;  3G4S Q;  2DTH A;  3HRT A;  1PG5 B;  5GAM g;  4YRR A;  4M7A D;  4X34 A;  4OMP A;  1HYO A;  1T3S A;  4XTY A;  3VS6 A;  1NLP C;  2KXC A;  1YJ9 Q;  2EGC A;  1IXD A;  2ZR2 A;  5HCK A;  1M3C A;  4CRI A;  2FPD A;  4Q15 A;  1OU9 A;  3KBG A;  2HAX A;  2R58 A;  3V7R A;  3PIO A;  1JJC B;  3P8Y A;  1K4U S;  3OBW A;  1E24 A;  2WSC E;  2IY5 A;  1VQK Q;  1G5H A;  2YXY A;  1QP3 A;  2L3Q A;  2RH2 A;  2DET A;  3I55 Q;  1BK2 A;  2CP5 A;  2W0Z A;  3H0F A;  4DOW A;  4M77 D;  3HY0 A;  1ATI A;  4C5G A;  3CC4 A;  1X01 A;  2DQ3 A;  4X9C A;  1XQH A;  1R77 A;  3I5S A;  2F5K A;  3CBO A;  4LNS A;  4X9D A;  3FDR A;  4E7L A;  5I11 A;  1JJ2 P;  4HVC A;  3L42 A;  3OYJ A;  4TVW A;  4QKU A;  4E7Z A;  1YJN Q;  2RF0 A;  4J9B A;  1U1T A;  1OYX A;  4NL2 A;  1JEG A;  5GAN 3;  1MV0 B;  2ZCF B;  5IAY A;  2MMP A;  2ODR C;  4C8Q A;  3JCM P;  1MUZ A;  1C1A A;  2CDT A;  2ZZG A;  4C8Q G;  2EQI A;  1EOV A;  3G6E Q;  3CCU T;  3A7R A;  5HK3 A;  4YRI A;  1S1N A;  2P4T A;  4IUU A;  3A74 A;  2RHI A;  4RTZ A;  2DIG A;  2PMF A;  2KXD A;  3NFC A;  4FT2 A;  2EBP A;  2O88 A;  3M0P A;  5GAN 6;  2YSQ A;  2QA4 A;  1JO8 A;  1KC8 C;  4BDY A;  3G4S A;  2ZR3 A;  2JN0 A;  1OX9 A;  2GGR A;  2JTM A;  4JLG A;  1Y57 A;  2DJQ A;  1D3B B;  1NJ1 A;  3FRN A;  2VC8 A;  3RDV A;  2SEM A;  3X25 B;  3TRE A;  2FG0 A;  2L89 A;  3JB9 I;  4QW2 A;  1YJ9 A;  4P72 C;  1FMW A;  2KYM A;  2JZ2 A;  2E12 A;  1MND A;  2K9G A;  2FZK B;  1BIB A;  4J7I A;  5GAN j;  3EG9 B;  4FM4 B;  2EYY A;  1M1K R;  1JRI A;  3NTK A;  3VS7 A;  2BZY A;  1YGB A;  4PKC C;  5GAN 5;  2BUD A;  4K11 A;  2ARU A;  2ROT A;  5GAN e;  4QQG A;  1YCS B;  1BYM A;  1MGQ A;  2RB6 A;  3A8G B;  2EVR A;  4YRP A;  2X4Y A;  1VQK A;  3VRZ A;  1VQL Q;  4M78 C;  2EJF A;  1NJ8 A;  2QQ9 A;  1Q82 R;  3I55 A;  2DXB A;  2VAS A;  1XTD A;  2B86 A;  1EIF A;  2ZIN A;  4A53 A;  2DVJ A;  1KC8 U;  4HXJ A;  1KD1 C;  4MML A;  3VYG A;  3MQZ A;  3RGL A;  1FYN A;  1M90 R;  2ODR D;  3VU3 C;  2EYX A;  4B9W A;  1QLY A;  2YT6 A;  3JB9 F;  1G5I A;  1PKS A;  2LCS A;  2V1R A;  4PJN A;  1E1T A;  3JRZ A;  4YTL A;  4M7A B;  1YJN A;  1SER A;  1B7Y B;  2DRM A;  4XTZ A;  4O2D A;  1JXO A;  4JRP A;  4FT4 A;  5KNN A;  4LVJ A;  2LCL A;  2P4R A;  3CC4 T;  1LVK A;  1KQS P;  2C8M A;  4J6W A;  3UAT A;  2O31 A;  2KGT A;  4EMK C;  3G6E A;  4J9G A;  4M75 A;  1H4S A;  4JZ4 A;  2X35 A;  3SEM A;  1LJO A;  4M75 G;  1PYS B;  1SHG A;  4F7U A;  2IG0 A;  3OYE A;  2HD0 A;  2LT4 A;  2MPX C;  2P0P A;  1KD1 U;  2BKD N;  4M7D G;  2DRK A;  3MF1 A; 
#chains in the Genus database with same CATH homology
 2D9T A;  4M77 B;  1OZ2 A;  4IUR A;  2P5I A;  4P73 C;  1EVL A;  1YFR A;  2XTI A;  3A32 A;  5CVI A;  3J7A F;  3P8B B;  4M78 D;  3M57 A;  4LD6 A;  4K86 A;  4A4F A;  3HFV A;  1VQZ A;  4ZTU B;  2G3R A;  5C52 B;  5AYF A;  1QP2 A;  3MCA B;  4YDQ A;  2DQ0 A;  3G4S T;  3G7Z A;  3UPU A;  2I2L A;  5HKC A;  1VQL A;  2KVQ G;  1N9W A;  3EFS A;  4CH3 A;  3HRS A;  3PMI A;  2FVU A;  1YJ9 T;  3URG A;  3E19 A;  3R07 A;  1WPY A;  3QYG B;  5J26 A;  1PSE A;  3OYG A;  4PJO E;  5GMK j;  5LJ3 j;  3GLX A;  3REX A;  5GMK e;  5LJ3 e;  4TVR A;  1VQK T;  4YRJ A;  2V8K A;  5ELN A;  3I55 T;  3TEG A;  3H6Z A;  1C0A A;  3OYD A;  4H02 A;  2VGM A;  3OMG A;  1HTT A;  2VUB A;  3X26 B;  2F5T X;  1VQ9 A;  3KFU A;  5GAN 4;  4IUV A;  2EWN A;  2Q5I A;  1YJN T;  4C92 E;  4PNO A;  5CKB A;  4YRF A;  3L4G B;  4X5O A;  2KK4 A;  4MMK A;  3OS5 A;  3T9N A;  4WJ3 M;  5J39 A;  4LDX A;  1H4T A;  3G6E T;  3GP8 A;  3CCJ T;  2HBP A;  1JB0 E;  2XDP A;  3RMQ A;  3CCR A;  1G3W A;  1VQO A;  3OYM A;  4LVI A;  3M4P A;  2ALY A;  3REU A;  3GNG A;  2MI6 A;  2PVD B;  3ASK A;  3RMS A;  2LX9 A;  3UGQ A;  2AMC A;  2K5I A;  5GMK h;  5LJ3 h;  5HK0 A;  5GAN f;  5FU7 B;  2DPP B;  4ZGD B;  4H2T A;  5E3I A;  4EDU A;  2Y4Y A;  2DU7 A;  2DU5 A;  1VQL T;  1Z7M A;  3HPW A;  3L2U A;  4M78 B;  5LJ5 d;  3FIF A;  4NS5 A;  3UFG A;  3BW1 A;  1M1K C;  1UGR B;  3CC7 T;  3FLG A;  4HWP A;  3X24 B;  4E7J A;  4HWT A;  3HRI A;  2RI2 A;  3CC2 A;  1H3Z A;  4OB0 B;  2PQW A;  3WVE B;  3BJU A;  4WJ4 A;  1IZ6 A;  3TEH A;  4M7A G;  2DXC A;  3HXV A;  3ZFJ A;  4JRK A;  3ZBD A;  1EVK A;  5D6Y A;  5C6S A;  3OYL A;  3WXM B;  4FSX A;  2I4M A;  5IT9 E;  4EMK B;  3OS1 A;  5D6W A;  1VQ9 T;  3CCS A;  4P74 A;  4BB7 A;  3TU4 K;  1VIE A;  1M1K U;  1BI0 A;  2VXE A;  1VQP A;  4XK8 E;  1QVG A;  1XNI A;  1WQ7 A;  4M77 G;  4RCB A;  3ER0 A;  4HT8 A;  3QDR B;  2E64 A;  2B8A A;  2OTL T;  1EQR A;  4LVM A;  5GAN 2;  2Y4X A;  2QEX T;  2LRQ A;  4P75 A;  4XEO A;  1FX7 A;  2R5A A;  1UGS B;  2DTI A;  4IUT A;  5LJ5 h;  4D6W A;  1YFT A;  3SWN C;  3BDU A;  3QXE B;  5DM7 R;  1X2G A;  3CCR T;  4OMF B;  1VQO T;  2HQX A;  5FRM A;  4M7D F;  4H2X B;  4MZM A;  3OYY A;  3OBY A;  2ZZE A;  1EIY A;  1Y96 A;  5KCH A;  4N4G A;  4CH4 A;  3MO8 A;  3EFR A;  3M4G A;  3HFZ B;  2I4O A;  3FB9 A;  4WI1 A;  3HKS A;  1I81 A;  5L8R E;  3VQV A;  4RMF A;  5GAO p;  1B34 B;  3JCM V;  1BBU A;  4FL6 A;  5LJ3 f;  1XOV A;  2QXF A;  3FJP A;  4CH6 A;  2PUK B;  4P3N A;  4DA4 A;  2E41 A;  1O9S A;  3QZ5 B;  1G3S A;  4XTV A;  3JCM e;  5KH6 A;  3O8V A;  5F5W A;  3MET A;  3VJP A;  3ICA A;  1U1S A;  3CC2 T;  4M75 E;  4KUI A;  2PVO B;  4BE2 A;  3VBB A;  2I4N A;  4F7U E;  5CKH A;  1ZHI A;  2E5Q A;  5FU6 C;  4NCX A;  3NEL A;  2OAU A;  1ASY A;  2L5Q A;  3L2Q A;  2ZNJ A;  2GF7 A;  2EAY A;  3OSS C;  1L0W A;  3CCS T;  4C0D C;  3OYH A;  3QO7 A;  3QUI A;  1VQP T;  2X4J A;  5K1P A;  1YHQ A;  3GOX A;  2FHD A;  4KQE A;  4HWS A;  3A7A A;  2LC4 A;  2G4C A;  1Y07 A;  2LTO A;  3C12 A;  3BY7 A;  1KMN A;  2XIC A;  3RIR A;  4H2Y A;  2J3M A;  3QG1 A;  3HXY A;  4J7F A;  5LJ5 f;  3SB2 A;  4HCB A;  3JCM h;  4PJO C;  1IL2 A;  2PME A;  3HXZ A;  4M78 G;  1M1F A;  4A4K A;  4YRC A;  4P5N A;  3W3S A;  2H3J A;  4C5E A;  3C4S A;  5D6X A;  3M55 A;  1S72 A;  4YRG A;  1EFW A;  1NNH A;  2P0Q A;  3M58 A;  4PL6 A;  3V8K A;  3CXC A;  3OYC A;  3LC0 A;  4O5V A;  2QHV A;  4LDV A;  4LDY A;  4IKF A;  4RKU E;  1I4K 1;  1H4V B;  4TQF A;  2XKO C;  3M59 A;  3J80 E;  4C92 C;  5K1X A;  4N0A C;  3MEY A;  3HHT B;  4YRO A;  1I8F A;  3PZC A;  4XTU A;  4UP9 A;  3MF2 A;  4TQD A;  2ARS A;  2RO0 A;  2VGN A;  2O4X B;  1X6O A;  3OD1 A;  3RF1 A;  2AHJ B;  1VQ4 A;  4M7A F;  5CR2 A;  1Z7N A;  4UPA A;  5GMK m;  4A4E A;  1QW1 A;  1Q81 C;  4K88 A;  4PJO D;  4ME7 A;  2M9U A;  3A8O B;  4OP0 A;  2RHQ B;  5FU7 C;  3RUX A;  2BIV A;  2DEQ A;  4RQE A;  3SWN B;  2RK1 A;  2D0Q B;  2M1H A;  2DXT A;  4H2X A;  5GAN d;  3JSC A;  4M77 F;  2VXF A;  1WQW A;  1QE0 A;  5GAM j;  3OA6 A;  5GAO n;  3QKJ A;  5A2Q E;  2GFA A;  4ZTZ B;  4PLL A;  3PCO B;  5GAM e;  1B8A A;  2RHS B;  4JUV A;  4EMG A;  1M1G A;  4BD3 A;  4C92 D;  3NTI A;  3RES A;  2OTJ A;  1LNX A;  2QI2 A;  4LVL A;  2XK0 A;  1TH7 A;  4CI0 C;  4L87 A;  4LVK A;  1Q81 U;  1LYL A;  4N4H A;  1QVG S;  1M4Z A;  3G71 A;  3CCE A;  2CZ6 B;  3CCM A;  3A5Y A;  3JCM f;  4BI8 B;  4G84 A;  2QQR A;  1NJI C;  1PSF A;  2HNI A;  3UH0 A;  1S72 T;  3NEN A;  2KQW A;  2YHT A;  1N9R A;  1WU7 A;  4Z02 A;  2DO3 A;  4HT9 A;  3JCM Q;  4XU1 A;  3MEW A;  4M7D A;  4P71 A;  1GXI E;  1E22 A;  4TWA A;  2EQK A;  4QVZ A;  2ZGW A;  3VV0 A;  4YRS A;  5FU6 B;  2Q7G A;  4G85 A;  3QSU A;  2DTO A;  2X4X A;  2IVW A;  2VYT A;  4E47 A;  2Y90 A;  5GAN h;  1OZ3 A;  3LLR A;  1SSF A;  5M9O A;  2AKW B;  3DKM A;  2JOY A;  1N8R C;  1NJI U;  4C0D B;  2QQA A;  4YCW A;  2QA4 T;  2RHX A;  4EPC A;  5C53 B;  2FB7 A;  4HWR A;  1VQ4 T;  3HFO A;  4MDW A;  5GAM h;  2QHU A;  2MWP A;  4E51 A;  2ZNI A;  4GLK A;  5LJ5 g;  2EQU A;  2C06 A;  2DJZ A;  2DDZ A;  2XI9 A;  3QJY A;  3V7S A;  3M54 A;  2K3X A;  3I7F A;  1JJC A;  2E70 A;  4ZGJ B;  5I21 A;  3P8D A;  4E7H A;  4RDX A;  4YP0 A;  5DY9 A;  1YBY A;  5GAO q;  5FRN A;  1JJ2 A;  4B9X A;  4BI4 A;  1N8R U;  5LJ3 d;  3QBY A;  4PJO B;  4R55 A;  3MHX A;  3A8M B;  1M5Q 1;  3RAC A;  3A5Z B;  4ELY C;  2QHS A;  2E1H A;  4O6J A;  2LQ8 A;  4EO4 A;  2OTJ T;  4HT4 A;  2XG8 D;  3GPL A;  5I2S A;  2WSE E;  4L5G A;  5CKF A;  2DIQ A;  1VUB A;  3CCE T;  3HP9 A;  3CCM T;  1USY A;  4II1 A;  2DZC A;  3LGL A;  3OYN A;  3VUB A;  2CJA A;  1K73 C;  4M78 F;  3QPH A;  4C92 B;  2JVV A;  1UGP B;  2I4L A;  2ZPF B;  2RHY A;  4YRL A;  3TUP A;  3S3O A;  4H2V A;  1N6A A;  1BKB A;  2FL7 A;  3CD6 A;  12AS A;  3VKI A;  5A0L A;  1VQ7 A;  3M4Y A;  1D3B A;  1M9S A;  2CJ9 A;  4A4H A;  3LGF A;  2LVM A;  2EQM A;  3IAL A;  4L6V 5;  4OGE A;  3DLL A;  1B70 B;  3CBP A;  3OMC A;  2KDS A;  3CME A;  2XID A;  1K73 U;  3CXC S;  2QQB A;  2ZPH B;  1YI2 A;  2ZT5 A;  4TVA B;  1H4Q A;  1BI1 A;  4FIB A;  5GAM f;  3SD4 A;  3F70 A;  2RI5 A;  4IUQ A;  4GY5 A;  3EAE A;  4HWO A;  1K9M C;  2IY5 B;  5I2M A;  2NLU A;  4P3P A;  4ZGE B;  1KQS A;  2CJB A;  4OF1 A;  2R57 A;  1ZBX A;  3IG2 A;  3J81 E;  2XDB A;  4M7A A;  3HFN A;  3CCL A;  3JCM b;  1B7Y A;  1KQ2 A;  1RIQ A;  3VQW A;  4JDS A;  3CMA A;  5A0D A;  5IN1 A;  4C8Q E;  4A54 A;  3LWI A;  2XHC A;  3VYH B;  1NPP A;  1YIJ A;  2DVE A;  1PYS A;  4E7K A;  1P92 A;  4E7I A;  3ME9 A;  3CCV A;  4PG3 A;  3RER A;  4C8Q B;  3QO8 A;  5CKD A;  4M77 A;  1K9M U;  4EX5 A;  4UC4 A;  4KR3 A;  1Q86 C;  4JS5 A;  3NTH A;  2E10 A;  1VQN A;  2FYK A;  2AKW A;  3CD6 T;  3E9F A;  3RL6 A;  2E6N A;  4JS4 A;  3OS2 A;  1VQ7 T;  2KMT A;  5GMK l;  2EJG A;  1JBM A;  1HC7 A;  4C5H A;  1X54 A;  2LDM A;  3A8H B;  2YLC A;  1Q86 U;  3ZEH A;  1I5L A;  2M0O A;  2XU8 A;  3RKY A;  3HXX A;  4YRM A;  3CMQ A;  3GF5 A;  2ZT7 A;  4OB1 B;  1YI2 T;  5EG2 A;  2PU9 B;  3OYA A;  1WJS A;  4KT0 E;  4YRN A;  2ZCE A;  3HRK A;  3M56 A;  4PJO G;  1W2B A;  2DZ9 A;  3MP1 A;  4DPG A;  3OYI A;  1QVF A;  3JCM d;  3R6O A;  3OY9 A;  4IUP A;  4K87 A;  3CCL T;  1R8O B;  4M7D E;  5C51 B;  2DXU A;  2XDD A;  3L4G A;  4M75 B;  3CMA T;  5GAO m;  4HCC A;  4F7U B;  3G1Z A;  4N0A A;  3LSQ A;  1KHC A;  4C92 G;  3LSS A;  2LT1 A;  1YIJ T;  3TCJ A;  4N4I A;  3CPW A;  2Q7E A;  2LCC A;  3CCV T;  3NEM A;  1ADJ A;  3S3N A;  4QVD A;  4J6X A;  3P8V A;  4BY6 C;  3LYI A;  4LDU A;  1JJ2 S;  1UB4 A;  4HA8 A;  3L2R A;  5FRO A;  4P75 C;  5J3B A;  4J8O A;  2EQJ A;  5GMK i;  5GAN g;  2MF2 A;  3L2V A;  2K5L A;  1VQN T;  2ZT6 A;  5LL6 S;  4BI3 A;  4P72 A;  4KR2 A;  2DD5 A;  4KBM B;  1WJQ A;  3QHS A;  5CK9 A;  4J5Y A;  1U8R A;  4A4G A;  3HXW A;  1QF6 A;  3L2Z A;  4QQD A;  1NYR A;  2JTF A;  2NS6 A;  1VQ5 A;  3QYH B;  2ZZD A;  2QHT A;  4TVA A;  5GAN 8;  3OSV A;  1NJ2 A;  4M78 A;  3HY1 A;  2YLB A;  4YPF A;  2PUO B;  4JLI A;  4OB2 B;  4XQ3 A;  3MP6 A;  3JCM W;  2XD0 A;  1YCY A;  3VQX A;  2DKG A;  3QTC A;  1ADY A;  2ZPE B;  2J3L A;  3JB9 J;  1WNL A;  4H2U A;  3VUZ A;  4YCU A;  5DLO A;  1UGQ B;  3JB9 D;  4YRQ A;  4EMK A;  2RJD A;  4KUL A;  2E5A A;  4OVA A;  2ZTG A;  2KSS A;  2GQV A;  5CIU A;  4P3O A;  2E6Z A;  2VV5 A;  4P73 A;  4WF2 A;  1FWZ A;  3HL8 A;  1VQ6 A;  2C7I A;  1NZ9 A;  1KG1 A;  2RA2 A;  2E3C A;  3QNE A;  1VQM A;  1N27 A;  4QVC A;  1NE8 A;  4L59 A;  4CS4 A;  2QQS A;  1KQS S;  2WAC A;  2ALY B;  1G51 A;  3V8L A;  3DLM A;  2O01 E;  1YHQ T;  4BUG A;  1KHI A;  4LDW A;  1X75 C;  5C0M A;  2AMC B;  3FEO A;  1Q7Y C;  3IKL A;  5LJ3 g;  4C0F A;  3HFZ A;  1G5V A;  5A0G A;  1WYD A;  2RJE A;  5CO7 A;  3E9I A;  2ZIM A;  1IRE B;  1B34 A;  3SDZ A;  4Y91 A;  5GAM d;  2CZ7 B;  3QJ6 A;  2JUF A;  1AHJ B;  1VQ5 T;  2CS7 A;  1SRY A;  4YRT A;  3QO3 A;  2GFU A;  4LD9 K;  4M7A E;  1B76 A;  2P0K A;  4XU3 A;  4ZN3 A;  3OS0 A;  3L1A A;  2LNV A;  4Y28 E;  1ZQ1 A;  4J15 A;  3TEH B;  2V8J A;  3HTZ A;  1Q7Y U;  1MHN A;  2E65 A;  4JRI A;  3JCM X;  1NJ5 A;  3CPF A;  4C8Q C;  5CQX A;  2K57 A;  1X55 A;  2QTX A;  2KY9 A;  4YRK A;  5KE2 A;  4CH5 A;  3S6W A;  4ZTJ A;  4M77 E;  3CCJ A;  4BE0 A;  2M16 A;  1Y71 A;  3SFM A;  4PJO F;  4F7U G;  4KUD K;  2DD4 A;  4BWA A;  1WLE A;  1N9S A;  4PHC A;  3OYF A;  5HGQ A;  4XU2 A;  5CCA A;  1VQ8 A;  4MZP A;  4BY6 B;  3PIP A;  4DQ2 A;  1NJ6 A;  4UP7 A;  3HSB A;  4XAX B;  4AH6 A;  2JNG A;  1SET A;  4R56 A;  3RKW A;  1VQ6 T;  2Q7H A;  1W2B S;  3ERR A;  1UEB A;  1VQM T;  4XEM A;  3HRU A;  2F69 A;  1QVF S;  2EKO A;  2K5F A;  3CBM A;  1O75 A;  4C92 F;  3BFM A;  4DOV A;  2D6F A;  1EIY B;  1Y96 B;  2ZPI B;  3PMT A;  4C8Q D;  3INZ A;  4OGC A;  3CC7 A;  3BDL A;  4C0Z A;  2K2V A;  4XTX A;  3VQY A;  2K3Y A;  2RHU A;  3OW2 A;  2QDY B;  1DJ7 B;  2ZPB B;  3DB4 A;  2MAM A;  3IKM B;  3C94 A;  3OB9 A;  3CPW S;  3M4Q A;  5ELO A;  1X2H A;  4ATO A;  3DSQ A;  4ZN1 A;  3LX7 A;  4VUB A;  3GIB A;  3N5B B;  2RJF A;  3QO5 A;  3MEU A;  5CQY A;  3M9Q A;  3G71 T;  3CEY A;  1K8A C;  4OLF A;  2HQE A;  4BDZ A;  4M75 C;  2RI3 A;  4RCC A;  1RL2 A;  2ZZF A;  4M7D C;  1KMM A;  4P71 C;  5GAN 7;  1YFS A;  3E1S A;  3PTA A;  3C95 A;  1J5W A;  3MP8 A;  2GCX A;  2L3R A;  2O4X A;  4MZT A;  5GAO l;  4RQF A;  3PNW C;  4Q5W A;  4HCZ A;  1YIT A;  2OTL A;  1GGM A;  5CKE A;  2EJ9 A;  3I56 A;  2QEX A;  4ZTF A;  2ZXF A;  2P0L A;  2PVG B;  3CCQ A;  1K8A U;  3PGG A;  3JCM c;  4PLI A;  2RHQ A;  2ZIO A;  5KE3 A;  5HY6 A;  4UP8 A;  2CIM A;  3SWN A;  4YYE A;  1BIA A;  1VQ8 T;  1V29 B;  3OQ5 A;  1W4S A;  2WSF E;  4C8Q F;  3NET A;  2DK3 A;  1SES A;  1YB3 A;  1RI0 A;  4M78 E;  3FC3 A;  2RJC A;  4M75 D;  3PCO A;  5LJ5 j;  4ZIB A;  2X4W A;  2RHS A;  1YJW A;  4RMO A;  2RK2 A;  4M7D D;  5LJ5 e;  1HXD A;  4NOY A;  3JCM g;  2EL9 A;  4FU6 A;  2Q5H A;  1BI2 A;  2MWO A;  3H8Z A;  1H64 1;  4C5I A;  3OYK A;  3P8H A;  3WQZ A;  4YCV A;  3UWN A;  3PT9 A;  4XTW A;  4C0G A;  1FYF A;  2XGT A;  4ELZ C;  4H2W A;  3E9H A;  2EFI A;  1Q82 C;  4TTV A;  2KAF A;  1KQ1 A;  4RG2 A;  4MDX A;  2RHZ A;  4NL3 A;  1USY C;  1KOG A;  1VIF A;  2ZPG B;  1M90 C;  3Q1J A;  4V2S A;  3A31 A;  4RG8 A;  2L8D A;  2CYZ B;  3MEV A;  3KUF A;  3V7C A;  4JJN K;  2ART A;  3A8L B;  4BAC A;  2CZ0 B;  4HKE A;  2CZ1 B;  3PFS A;  1WGS A;  3P8T A;  4H2S A;  4J6Y A;  3X20 B;  3DB3 A;  2YRV A;  1Q82 U;  1YIT T;  3I56 T;  3A7U A;  2CKK A;  2CGH A;  4BW9 A;  3LW5 E;  3JCM J;  3UDC A;  4TVY A;  2A8E A;  1BBW A;  1M90 U;  3JB9 G;  4M75 F;  1HK9 A;  3CCQ T;  2RM4 A;  4F7U F;  2LQK A;  3CME T;  3UT1 A;  5KCO A;  3X28 B;  1QVP A;  1G3Y A;  1ASZ A;  2R5M A;  1E1O A;  4XU0 A;  3QZ9 B;  1W66 A;  4J83 A;  3V8J A;  4OB3 B;  3TEE A;  4PJO A;  1BI3 A;  4EMH A;  2V8I A;  4YRE A;  3E9G A;  2ZT8 A;  5FLX E;  1M8V A;  3A5Z A;  1YJW T;  3LH0 A;  4M7A C;  3RKX A;  3HXU A;  1OI1 A;  1NYQ A;  3OYB A;  3GNF B;  5CAI A;  2RD1 A;  4JRQ A;  2DAQ A;  3QII A;  3M53 A;  3CCU A;  1G3T A;  1Y7X A;  4P74 C;  3JB9 H;  1WJR A;  5GAO r;  1LOJ A;  4Q6G A;  4M7D B;  4C92 A;  1NPR A;  2K4Y A;  2A3L A;  4M77 C;  2EIF A;  3WVD B;  3AHU A;  5DLQ E;  3S3M A;  4BE1 A;  2EYQ A;  4CS2 A;  1FXX A;  2A7Y A;  3M5A A;  4CS3 A;  3LWH A;  3L2W A;  3OW2 S;  3JAM E;  1X56 A;  3MEA A;  4QQ6 A;  3UGT A;  3KXT A;  1B70 A;  11AS A;  2DTH A;  3HRT A;  5GAM g;  4YRR A;  4M7A D;  4X34 A;  4XTY A;  2ZR2 A;  4CRI A;  4Q15 A;  3KBG A;  2HAX A;  2R58 A;  3V7R A;  3PIO A;  1JJC B;  3P8Y A;  3OBW A;  1E24 A;  2WSC E;  2IY5 A;  1G5H A;  1QP3 A;  2RH2 A;  4DOW A;  4M77 D;  3HY0 A;  1ATI A;  4C5G A;  3CC4 A;  1X01 A;  2DQ3 A;  4X9C A;  1XQH A;  2F5K A;  3CBO A;  4LNS A;  4X9D A;  3FDR A;  4E7L A;  4HVC A;  3L42 A;  3OYJ A;  4TVW A;  1U1T A;  1OYX A;  4NL2 A;  5GAN 3;  2ZCF B;  2ODR C;  5IAY A;  2MMP A;  4C8Q A;  3JCM P;  2ZZG A;  4C8Q G;  1EOV A;  3CCU T;  3A7R A;  5HK3 A;  4YRI A;  2P4T A;  4IUU A;  3A74 A;  2RHI A;  2PMF A;  2DIG A;  3NFC A;  4FT2 A;  5GAN 6;  2QA4 A;  1KC8 C;  4BDY A;  3G4S A;  2ZR3 A;  2JN0 A;  2JTM A;  4JLG A;  1D3B B;  1NJ1 A;  3FRN A;  2VC8 A;  3X25 B;  3TRE A;  2L89 A;  3JB9 I;  4QW2 A;  1YJ9 A;  4P72 C;  2JZ2 A;  2E12 A;  1BIB A;  4J7I A;  5GAN j;  4FM4 B;  1JRI A;  3NTK A;  1YGB A;  4PKC C;  5GAN 5;  2BUD A;  2ARU A;  5GAN e;  4QQG A;  1BYM A;  1MGQ A;  2RB6 A;  3A8G B;  4YRP A;  2X4Y A;  1VQK A;  4M78 C;  2EJF A;  1NJ8 A;  2QQ9 A;  3I55 A;  2DXB A;  1XTD A;  2ZIN A;  1EIF A;  4A53 A;  1KC8 U;  1KD1 C;  4MML A;  3VYG A;  3MQZ A;  3RGL A;  2ODR D;  3VU3 C;  4B9W A;  3JB9 F;  1G5I A;  1E1T A;  3JRZ A;  4YTL A;  4M7A B;  1YJN A;  1SER A;  1B7Y B;  4XTZ A;  4O2D A;  4JRP A;  4FT4 A;  5KNN A;  4LVJ A;  2LCL A;  3CC4 T;  2C8M A;  4J6W A;  4EMK C;  3G6E A;  4M75 A;  1H4S A;  2X35 A;  1LJO A;  4M75 G;  1PYS B;  4F7U A;  2IG0 A;  3OYE A;  2HD0 A;  2LT4 A;  2P0P A;  1KD1 U;  2BKD N;  4M7D G;  3MF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...