4XU3A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
263
Chain Sequence
b'DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 263
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu3A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu3A01
1VQZA 3FJPA 4J5YA 3JCMg 4XEOA 4M7DG 3HXUA 3UGQA 2ZZEA 3M4QA 4CH4A 1USYC 2Q7EA 3HSBA 5GMKe 1EOVA 2XTIA 2DZ9A 4M77B 1NJ8A 1KQ1A 3INZA 3VU3C 5GAN7 5GMKl 5GAOn 4YRGA 5F5WA 3NETA 2G4CA 1X2GA 4C8QB 4TQDA 5K1PA 11ASA 3JCMb 4M7AA 4M75A 1KMMA 1H4VB 1QF6A 4MMKA 5LJ3j 4M7DD 1KOGA 3P8YA 1X54A 4TVWA 2RHQB 3QO7A 1ADJA 3TEHA 4TTVA 3CMQA 4G84A 1NJ6A 3HFOA 1EIYB 4J6XA 4YRIA 2ZT6A 4M77E 1BBWA 2RA2A 2ALYA 3UGTA 2J3LA 2CJBA 2ZXFA 1JJCA 4C8QE 2YLCA 3A7AA 3A5ZA 4RMFA 1Z7MA 1B7YA 2IY5A 1B8AA 4EMGA 2VC8A 1WNLA 3A5YA 5GANf 1LJOA 2ODRC 2DU5A 4PNOA 4XEMA 4XQ3A 3HXXA 1LOJA 3JCMV 3RKXA 3JCMh 2HNIA 2E65A 4P74C 3V7SA 2C8MA 1BIAA 4Y91A 2E41A 3L2ZA 2ARUA 5GAOp 3HY1A 1N9SA 1B34A 2YHTA 4HWOA 3RUXA 4EMKA 5C52B 4NOYA 5GAN8 3VQVA 4F7UF 2CIMA 4NCXA 4TVYA 1G51A 1WLEA 4UP8A 4X5OA 4YRFA 3UFGA 1SERA 4BW9A 2ZNIA 4M7AF 4M75F 5LJ3f 4H2UA 3JCMW 5GMKj 3EFSA 4P72C 1H641 2DU7A 4YREA 4PJOD 1NYQA 4CH3A 4RQEA 4M7AB 3JB9F 4M75B 1H4SA 4A54A 1YFRA 4YPFA 2FB7A 5GAOq 1E22A 2DDZA 2Q7GA 2QHSA 3QO3A 4E51A 3I7FA 4JUVA 4HT8A 3JCMP 2DZCA 1X01A 5GAMj 4EMHA 3AHUA 3TEHB 1ASZA 1D3BA 4DPGA 4ZTUB 1M5Q1 4M7DA 4YRPA 3V7RA 2Y90A 4K86A 3BFMA 2QHTA 1PYSA 3V8LA 1WQWA 4J15A 2ALYB 4YP0A 2ZINA 1JJCB 3KFUA 3JCMc 4HWPA 4M7AE 2XGTA 4M75E 3NENA 4KR3A 2IY5B 2P0LA 4C92F 4JRIA 2DQ0A 2EJ9A 4HT9A 4YRCA 4M7DC 5GANj 1ADYA 1NNHA 2E1HA 4NL3A 4C92B 5GAN2 1B34B 2Q7HA 1YGBA 4M77F 4EMKB 5GAOr 4XU1A 2VXFA 5LJ5d 3RKWA 4C8QF 1IL2A 1E24A 1EVLA 5ELOA 1TH7A 1RIQA 1M8VA 1SETA 4YRRA 4C92E 2ZGWA 5GAMf 3JB9H 4V2SA 1HC7A 5LJ5g 2VXEA 3RKYA 4J6WA 4X9DA 3BDUA 4M78C 5I21A 4XU3A 1WYDA 2PMEA 3VQWA 4XTUA 2ARSA 5GAN3 1WU7A 1I81A 3DSQA 3JCMe 4Q6GA 1FYFA 4PJOA 3ICAA 4P74A 4YRSA 3QSUA 4M7DB 2RHSA 4M78G 4CS4A 2C7IA 3RGLA 3PCOA 3RL6A 3VQXA 1PYSB 3JCMX 2AMCA 4PG3A 4HA8A 1G5IA 3HFNA 3HY0A 5GAOl 4YRNA 4WJ4A 5ELNA 5LJ5e 3BY7A 5GAN4 2EAYA 4YCVA 4TVAA 1ATIA 4PJOC 4YRKA 4XTWA 3HFZA 4M78D 3V7CA 3L4GB 4X9CA 3HTZA 5LJ3d 4P72A 1JBMA 4M7DE 3QUIA 1YFSA 3REUA 3LC0A 3RESA 3JB9I 4F7UG 4XTXA 2Q5HA 4PJOG 1H4QA 4H02A 4UP7A 4WI1A 1BIBA 5LJ5h 3BJUA 2CJAA 2ARTA 2ZCEA 3HFVA 3SB2A 1NJ5A 5LJ3g 1WPYA 5GAN5 2ZNJA 4EX5A 4A53A 2QTXA 3UH0A 3JB9G 3A7UA 2EWNA 1H4TA 4YRLA 2QHVA 4PHCA 1X2HA 2RB6A 3HXWA 3M4PA 1U1TA 3M4GA 1X56A 2CJ9A 4EO4A 2DTIA 3SWNA 5GAOm 5C53B 2ZTGA 4MMLA 4H2WA 3LSQA 4H2YA 3BW1A 5LJ3e 3JB9D 3FIFA 1B70A 2I4LA 5CAIA 3JCMJ 3MEYA 4P3OA 3PCOB 2RD1A 2AMCB 1B7YB 3QO5A 1Y96A 3IALA 1YCYA 4M77C 1L0WA 4QVDA 3SWNC 1HXDA 1NYRA 3V8JA 4TVAB 1N9RA 3MF1A 1B76A 4QVCA 2ZZFA 5LJ3h 4YRJA 1Z7NA 1SRYA 4M77G 3RACA 1KQ2A 5GAMd 4C92D 4M78A 1I8FA 3JCMQ 4C8QG 2PMFA 3A31A 3FB9A 2QHUA 4P75C 1HTTA 5K1XA 4N0AA 4NL2A 3A7RA 4CH6A 2FYKA 4YCUA 3IG2A 5GAMg 4M77D 1U1SA 1G5HA 2EJGA 2DQ3A 2RM4A 4XTYA 3NEMA 3WQZA 3RIRA 4C8QD 2ZT7A 4RDXA 3RF1A 3IKMB 3MF2A 1GGMA 4M7DF 3JCMf 5GANd 1LNXA 4ZIBA 2AKWA 3A74A 4F7UA 4N0AC 4YYEA 4OLFA 1EFWA 4WJ3M 3QNEA 3SWNB 2EL9A 1D3BB 4XU2A 2K57A 2DVEA 4P71A 1EQRA 4XU0A 1B70B 4AH6A 5GAMe 5GANg 3P8TA 3QTCA 1HK9A 1W66A 3HRIA 5LJ5f 1X55A 1YB3A 4DQ2A 2ZT5A 4H2VA 4O2DA 1E1OA 1Y96B 5GMKh 4CS3A 3VBBA 2DEQA 4BWAA 4KQEA 3W3SA 4P71C 4J6YA 5E3IA 4M7AC 4M75C 1JRIA 4M78F 4H2XA 4UP9A 3E9HA 1NJ1A 4RCCA 4K88A 5HGQA 2DXTA 3HXYA 2ZR2A 3E9IA 5GAMh 3JB9J 4P3PA 2P5IA 2I4OA 3PGGA 4OP0A 5GANe 1C0AA 2EJFA 4M78B 3QHSA 3LSSA 4M7AG 3L1AA 4M75G 4YRTA 3QO8A 1SESA 3HRKA 4C92A 1J5WA 3GIBA 1EVKA 2Q5IA 4H2TA 3REXA 5GMKm 4RQFA 1E1TA 1N9WA 3PZCA 3HXZA 1I4K1 4PJOF 1YFTA 2CGHA 2ZT8A 4M7AD 4M75D 2DKGA 5GANh 4M78E 4M77A 4G85A 2DJZA 4P73A 2AKWB 2I4MA 4F7UB 4YCWA 4C92C 4PJOB 4JLIA 4C8QA 3RERA 2ODRD 3V8KA 3ERRA 3A32A 5C51B 4RCBA 2RHSB 4XTZA 3EFRA 3HXVA 4EMKC 2E3CA 4CS2A 1I5LA 4HWSA 2ZZGA 2RHQA 2E64A 4YDQA 1WQ7A 4C92G 5GAN6 4HVCA 1EIYA 3VQYA 5KNNA 4P73C 2DXUA 4CH5A 4P75A 3TUPA 2J3MA 5LJ5j 4YRQA 3R07A 4WF2A 4C8QC 2ZIMA 4TQFA 3HFZB 4HWRA 4F7UE 2ZR3A 4PJOE 4K87A 2ZIOA 4H2SA 3OD1A 4UPAA 2DTOA 4H2XB 12ASA 1QE0A 5GMKi 4L87A 2E10A 4LNSA 3G1ZA 2YLBA 3TEGA 4HWTA 4YRMA 3P8VA 2I4NA 1LYLA 1USYA 3JCMd 1MGQA 4P3NA 2DTHA 4Q15A 4ZTZB 1BBUA 1ASYA 3L4GA 4JRKA 2E5AA 2JN0A 1KMNA 3NELA 4TWAA 4YROA 3IKLA 4XTVA 1NJ2A 4KR2A 2I2LA 5DY9A
chains in the Genus database with same CATH superfamily
4J5YA 4C0ZA 4CH4A 1PM3A 1YFNA 2K3XA 1WJSA 1YJ9Q 4M4ZA 4BDYA 5FWBA 1N8RR 2DZ9A 2RF0A 3G7ZA 1NJ8A 2FL7A 4YRGA 1UG1A 3META 3CCUQ 2PUKB 4D8KA 11ASA 3PMIA 3OYCA 4M75A 4OMOA 4MMKA 5LJ3j 2RHIA 1YJNA 1QQJA 2XI9A 3TEHA 4TTVA 3CMQA 4G84A 4RTWA 2P0QA 3EG2A 4YRIA 2ZT6A 2JTEA 2RA2A 4KH0B 2ALYA 1AOJA 1WHLA 1JJCA 4C8QE 2O4XB 4RMFA 3PVQA 2ATCB 5C6SA 2DXCA 2OAUA 1RAHB 1SF9A 1RLPC 3FRNA 2DF6A 1RAAB 1XJWB 3HXXA 2A36A 3JCMV 1KC8U 3RKXA 2EQJA 2E65A 2QG9B 2C8MA 3OYJA 3CCVT 8ATCB 3MHXA 4ZTFA 2RQRA 5CQXA 1WGSA 4R55A 2QGGA 3PE0A 3RUXA 4EMKA 2DFUA 1M2OA 1JXMA 1QVPA 2LP5A 4FL6A 4K11A 3EG9A 1KD1R 2RI3A 1WLEA 1LPLA 4UP8A 4YRFA 3UFGA 5CKDA 4BW9A 1H92A 4M75F 1YITA 3EFSA 1O9SA 3CPWA 3OSSC 1W2BS 4PJOD 1NYQA 2O31A 1VYTA 4M75B 2MCNA 2FB7A 2ZCFB 5EG2A 3OYLA 2QHSA 1X2QA 2VYTA 4JUVA 4HT8A 3JCMP 5CIUA 3Q1JA 4E6RA 3LGFA 3CPFA 3NMZC 5CKEA 2E6NA 3TEHB 3M5AA 1D3BA 1M2VB 2VASA 2CP0A 2Y90A 1VQPT 4QKUA 3G6ET 1PYSA 3PNWC 2ALYB 1QCNA 4YP0A 1JJCB 4LVIA 2V8KA 3NENA 1R8OB 2QEXQ 2RPNA 1KC8C 4J9GA 1NPPA 1VQ6Q 5FU6C 3NTIA 4PL6A 2BZYA 4M7DC 5GANj 2F69A 2XDPA 4AG2C 1NNHA 3C12A 3F70A 1M9SA 1UTIA 1OX9A 2DXBA 1OULA 1WHKA 1OPLA 1PD0A 1VQOA 1Q7YR 2DD4A 4EMKB 5A0DA 1YI2T 3OBWA 2DBMA 1KHCA 2XK0A 4C8QF 2CYZB 1MV0B 1X75C 1E24A 2L3PA 1ZUUA 1EVLA 3HTRA 4O6JA 4KUIA 4LVJA 1TH7A 1WZOA 2DRMA 1WYXA 2K3BA 2ED1A 3X24B 1M8VA 1SETA 4YRRA 1NZ9A 3H8ZA 2HBWA 3JB9H 4V2SA 2C0IA 4OF1A 2XG8D 1KFZA 4XU3A 3CXCS 4XTUA 5GAN3 1MNEA 3TVTA 3DSQA 3CCMA 5FWCA 3I35A 1M1KR 3DB3A 4IUPA 1FYFA 3VS7A 4PJOA 1SHFA 3CCQQ 1FWZA 4D8DA 4M78G 2K5LA 2C7IA 2ESWA 3TCJA 2COYA 1BB9A 3UWNA 1ABOA 1PYSB 3RL6A 1YWPA 3G4SA 3HFNA 5FW9A 4WJ4A 1Y57A 3LLRA 4TVAA 2P0PA 1OQKA 4M78D 3SHWA 1ZSZC 2K5IA 1IGQA 3I9QA 3UA6A 3S3OA 4P72A 2W0ZA 2BE9B 4ZGDB 3LC0A 1KQSA 2QYZA 2Q5HA 2KVQG 2X4XA 2BIVA 3MQZA 1VIFA 4B9XA 4MZPA 2E70A 2CJAA 1CSKA 1NG2A 2M16A 3CCJT 1ZSGA 3JRZA 5GAN5 1S72A 2QTXA 1QVFS 2X4YA 3UH0A 3JB9G 3WXMB 3OYYA 5I11A 1ZLMA 1H8KA 2X35A 5KYNA 2RK1A 1PHTA 2VVKA 1X2HA 3HXWA 3LH0A 5KCHA 2EQIA 1T0HA 1X56A 1C6VX 2DTIA 2IPOB 1FMWA 1OZ3A 2A3LA 3BW1A 3JB9D 1G2BA 1B70A 2LQKA 2SRCA 1CKBA 1WA7A 2KMTA 2O9SA 3MEYA 1UJ0A 2YUPA 5D7UA 1Y96A 2EGEA 2EYQA 1FMKA 3O5ZA 2D8HA 4QVDA 4AFUC 1AEYA 5FU7C 4TVAB 1N9RA 5CK9A 3MF1A 3EHQA 1G8XA 3NHNA 2ZZFA 1ARKA 4YRJA 1Z7NA 7AT1B 1PSFA 1NYGA 3OYKA 4X34A 3A1PA 1YHQA 3REBB 1KQ2A 1RADB 4C92D 5GAMd 1QVGP 2YDLA 2GTJA 4M78A 3JCMQ 1WJQA 1MMDA 3A31A 2LJ1A 1HYOA 2QA4T 3A7RA 4CH6A 3UA7A 1IO6A 1G5HA 2EJGA 4XTYA 4Z8AA 3RIRA 3X20B 4OGCA 3MF2A 2DK3A 1HD3A 4E47A 1K9MU 2M9UA 4IUTA 2COZA 1LCKA 1WI7A 2HQHA 2JNGA 4A4EA 1BI2A 1UGVA 1OU9A 4FSSA 2K79A 4XU0A 1B70B 1U3OA 3ER0A 4DBQA 1GFCA 4WCIA 3HPWA 2V26A 4FU6A 1CKAA 3PT9A 2SEMA 4ANJA 1Y96B 4HCZA 1Q95G 3M53A 1M27C 1TUGB 1NJIU 4CS3A 4BWAA 2BZXA 2GTOA 4QVZA 1HJDA 4M75C 1JRIA 4M78F 2EYYA 1GRIA 5HGQA 1VQPA 3G6EA 3E9IA 2JJ9A 2P5IA 3EGDA 4X1VA 4OP0A 1C0AA 2EJFA 4M78B 2QQ9A 3LSSA 2ZPEB 4OMPA 1T0JA 4FYWB 2Z0WA 4BUGA 2KYBA 4C92A 5LL6S 1EVKA 4OMQA 2MI6A 1JO8A 1WJRA 1WHMA 2LDMA 4RQFA 1N9WA 1K9MC 1E6HA 4BI4A 2HKQB 5IAYA 3SEMA 3MKDA 3OYNA 1AHJB 4G85A 4IKFA 2RI2A 1C0MA 1YIJQ 5GJVB 4KRTA 2V1QA 2HMAA 1JU5C 3KBGA 4RCBA 3CC2Q 2L8DA 4EMKC 2E3CA 2F5TX 1K1ZA 2ZZGA 2RHQA 1R0BG 3CC4A 2E64A 3G71Q 3OYGA 4HVCA 1NJIC 2J3MA 4YRQA 3R07A 4C8QC 2MIOA 3UPUA 2MWPA 4F7UE 1VQ5T 4R56A 4K87A 2ZIOA 3MEWA 1WIEA 5AYFA 4AFSC 3OW2S 4UPAA 1B07A 1M1FA 12ASA 4NS5A 1IGUA 3M55A 3CCRA 1MUZA 2E10A 2YLBA 4HWTA 3EGDB 2OTLA 4JS5A 1YITT 4OMFB 2EKOA 4ZTZB 2LMJA 4KUDK 2CUBA 1QP3A 2DE0X 4C0FA 4PJMA 1YWOA 1RI9A 2KRSA 1M90U 2KXDA 4XTVA 2I2LA 2YSQA 1QW1A 2ZPHB 3FJPA 3UGQA 1UE9A 3HXUA 2LNVA 1USYC 3HSBA 2IIMA 5GMKe 4A4HA 5A2QE 3INZA 3VU3C 4C5IA 2J6FA 4PFZA 5F5WA 2KBTA 3CCJA 4TQDA 3RMQA 1QF6A 2LRQA 4HVVA 2XIDA 3P8YA 4TVWA 4DBFA 2RHQB 1QVFA 1ADJA 2KK4A 1NJ6A 3HFOA 4OB0B 1VQMT 1VQLA 1WLPB 2QDLA 2O2OA 1VQOT 2IG0A 1KSWA 2CJBA 1SG5A 2YLCA 4UC4A 3A5ZA 2DPPB 3I55Q 1B7YA 2IY5A 4AFQC 4A4FA 4EMGA 1AT1B 1WNLA 3BE3A 3FJ5A 4XEMA 4XQ3A 1RAEB 5IHIA 3O8VA 1M3BA 1BI3A 3V7SA 4FW1A 1BIAA 4Y91A 3L2ZA 3I56T 2JMCA 1M90C 3CCEA 2IVWA 1N9SA 1PNJA 3R6NA 4NOYA 5GAN8 1SKUB 3IQLA 3CBPA 4F7UF 3CCVQ 1VQ6A 4GY5A 5D6WA 1BBZA 1D1AA 4X5OA 3L2WA 2ZNIA 1VQKQ 3X25B 2FZKB 4P72C 1DJ7B 2DYBA 9ATCB 4ORZA 2BZ8A 1F1BB 3CC7A 2QA4A 4BACA 3NFCA 3TEEA 2MYSA 1VQ4A 3C0CA 2A8EA 4J9CA 3QO3A 3I7FA 2M51A 2DZCA 4E7SA 5ECAA 2ECZA 3AHUA 4C0DB 2VV5A 1ZQ1A 1VQ7A 2NUPB 4OB1B 4DPGA 5KCOA 2X4JA 3V7RA 4K86A 1AZEA 2QHTA 3V8LA 1WQWA 2OTJA 2O01E 2HDAA 4F14A 2ABLA 3KFUA 3A5ZB 4HWPA 2KRNA 4M75E 1M30A 1I1JA 4KR3A 2QI2A 2IY5B 4RTTA 2GQVA 2LT1A 3OYEA 1KK7A 2EJ9A 2NUZA 1VQ9T 2F5KA 1G3SA 1KD1U 3TU4K 4QQGA 2Y4XA 3VV0A 3L42A 2Q7HA 4F16A 1J3TA 3R6OA 3PVLA 4PLLA 4E7ZA 5GAOr 2EGCA 2VXFA 3BDLA 2JXBA 2KT8A 5ELOA 3EFOB 1RIQA 3NTKA 2YRVA 2PTKA 1JQQA 2KYMA 3QYGB 4YTLA 3X26B 5GAMf 3GPLA 5LJ5g 2VXEA 2C0TA 5KYYB 4X9DA 1OV3A 2VGMA 3BDUA 4M78C 3VS5A 5I21A 4FM4B 5FROA 1WU7A 1FMVA 1PG5B 1I81A 2K6DA 3H0FA 4Q6GA 2G6FX 2CT3A 2EW3A 1QWEA 2LJ3A 4HCCA 3L2UA 1EIFA 1RABB 4IUVA 2VWFA 2WACA 1MMGA 1YHQT 4LDYA 1NYFA 3OMCA 2FRYA 1PRLC 1K4US 2AIRB 4MDXA 1FXXA 4YRNA 5ELNA 5LJ5e 5HKCA 4J9HA 5GAN4 3CCST 4YCVA 3VYHB 2P4RA 1MV3A 4FW2A 1Q7YU 1KD1C 2B8AA 3VUZA 3L4GB 4E7LA 3OQ5A 3OYFA 2V8JA 1UUEA 2VKNA 1VQ5A 1XOVA 3REUA 3RESA 1K0SA 4XTXA 4PJOG 3MO8A 4L6V5 1H4QA 3OW2A 4LXCA 3MCAB 4WI1A 5LJ5h 3HFVA 2GNCA 2QQSA 3M9QA 1N6AA 3CMAQ 5LJ3g 3OB9A 1AWJA 1QP2A 1A0NB 5IXFA 2VGNA 1BU1A 1M1KU 2K7AA 2RN8A 3OYHA 3HRSA 2I0NA 4YRLA 2FVUA 3REAB 2O88A 2R5MA 3A8LB 3OA6A 3M4PA 2D8JA 2M0OA 2CJ9A 2LX7A 4MZMA 4WTOB 1WHJA 1PKSA 2AHJB 5IHKA 5LJ3e 1QKWA 1UGQB 4E2FB 1SPKA 3CPWP 4P3OA 3VUBA 2KAFA 1RAIB 2O9VA 3MPUB 2XICA 3LH5A 5D6YA 3CQTA 1Z9QA 2QK0A 2OAWA 2RQTA 1Q7YC 3QKJA 3SWNC 3VRYA 1HXDA 2BE7D 2PUOB 3G1JA 4QVCA 1VQNA 2HCKA 2RQUA 2DO3A 5KYXA 1ZA1B 3KFVA 5LJ3h 1VQMA 2DBKA 1SRYA 3EHRA 4M77G 3RACA 2QQAA 1I8FA 1X6OA 2KNBB 4ME7A 3EG9B 2QHUA 2KXCA 4KGXB 4NL2A 1MMNA 2GQIA 2NYSA 2DL4A 4HVUA 2JOYA 3LWIA 1M1KC 3IG2A 3CC4T 4M77D 1U1SA 3EH1A 1YJ9T 2RM4A 2AKLA 2X4WA 2P0KA 3I56A 1NM7A 1Q82R 3RNJA 3RF1A 3IKMB 1RAGB 4JDSA 2AT1B 2DX1A 1LNXA 2J6OA 3A74A 2ROLA 4N0AC 2LQ8A 1JJ2S 1D3BB 1PSEA 4XU2A 1ZUKA 5IT9E 2CS7A 4P71A 4FT2A 3OMGA 3CCRT 4AFZC 5I22A 4AH6A 3H0IA 3OS2A 5GANg 2OTLT 2NS6A 1HK9A 1W66A 5LJ5f 2ROTA 2EQMA 4H2VA 1E7OA 2GF7A 3A8GB 1E1OA 3CMEQ 1IZ6A 3CBOA 4B9WA 5IH2A 2DL3A 2QQBA 2AZVA 5E3IA 5HK0A 4H2XA 4CC3A 1UGRB 5KYXB 2V8IA 1ZHIA 2JUFA 1UECA 4RCCA 1NJ1A 2JMAA 3HXYA 2FZGB 2ZR2A 2R58A 3QPHA 2DL8A 3PGGA 5GANe 2KDSA 4CI0C 3UT1A 2DA9A 3I5SA 4ZN3A 3EG3A 2FEIA 1BYMA 4TVRA 4M7AG 4JJDA 2WSCE 3QO8A 4YRTA 1I07A 4D6WA 5KE3A 3HRKA 2E4HA 1J5WA 1AWOA 1VQ9A 2HZYA 4KH1B 3GIBA 4PK4A 3N5BB 3M56A 4PKCC 1WHGA 2VUBA 3P8DA 5GMKm 1C1AA 5DLQE 5HY6A 4PFOA 3PZCA 1KQSP 4PJOF 2FHDA 2RJEA 4M7AD 1YJNQ 1VQLT 5GANh 4M78E 4M77A 3SFMA 1VQ8Q 2CSIA 2DETA 2I4MA 2PVGB 4YCWA 4PJOB 2F1LA 4JLIA 5M9OA 3RERA 2CZ0B 2KT1A 5C51B 5FRNA 1PKTA 1SSHA 1Y71A 4CS2A 4HWSA 3EH2A 2KRMA 5I2SA 2KSSA 1MNDA 1X43A 1WQ7A 4C92G 5GAN6 1JEGA 2BKDN 1EIYA 5KNNA 4P73C 1VYVA 2A7YA 2FPFA 3CCET 1VUBA 3GF5A 2ZIMA 1P92A 2KI7A 4HWRA 2ZR3A 3GOXA 3CD6A 2A08A 4ZN1A 1VQ6T 4RG2A 5IHNA 4QQDA 1K73R 1OU8A 2RHZA 2E12A 2DTOA 4PJLA 1QVGA 4H2XB 1QE0A 5GMKi 4LNSA 3TEGA 2MF2A 2PU9B 4GLKA 1HSQA 4LNPA 3ASKA 2I4NA 2PVDB 2ZZDA 1ASYA 1UGPB 1I5OB 3CCSA 3CC7T 2EIFA 2EGAA 1VIEA 4JRKA 2E5AA 1VQ4T 2JN0A 3NELA 2BUDA 1YITQ 4HVWA 1NJ2A 3GLXA 5DY9A 1VQ7T 3JCMg 1ZA2B 4M7DG 1IHVA 3S3MA 1VYUA 2ZZEA 3M4QA 2FRWA 1EOVA 1YJWQ 3GP8A 2XTIA 4M77B 2OTJT 1KQ1A 5GAN7 2RHXA 2HAXA 1OEBA 1QCFA 1K9AA 1X2KA 2LZ6B 2PQWA 1TXQA 1BCOA 1X2GA 4M7AA 2EQUA 4Z02A 4M7DD 1KOGA 3CCQT 5D6XA 4OMLA 1OPKA 3S6WA 2J05A 4ELZC 1VQKA 4Y28E 3PTAA 4J9EA 3DB4A 1EIYB 2DJQA 4J6XA 3VRZA 1D0YA 1BBWA 1H3ZA 2CZ1B 2ZXFA 3A7AA 2PNIA 2MWOA 1U06A 2DU5A 3A5YA 5GANf 4LDVA 2ODRC 3RMSA 4PNOA 1Q86R 3MEUA 5L8RE 1LOJA 1W2BP 3TSWA 3JCMh 5KYWA 4LN2A 2HNIA 4E7IA 1MHNA 2E41A 2DNUA 2MOXA 3PIOA 3HY1A 2H3EB 1B34A 2D6FA 2ZPIB 3CCLA 5C52B 1VOMA 4DOWA 3A8MB 2CIMA 4J9IA 1UDLA 4J7IA 3MJXA 2LQNA 3QZ5B 3SDZA 5FLXE 1SERA 3E9GA 3MEVA 4RKUE 4M7AF 3CCMQ 4BE1A 2L5QA 4H2UA 5GMKj 3U23A 5HK3A 4QT7A 3PFSA 2DU7A 4ZGEB 1WX6A 4CH3A 4M7AB 3WVEB 4F04B 3JB9F 4E51A 1M1GA 5GAOq 1E22A 2Q7GA 1YJ9A 3G4SQ 5L23A 5GAMj 3OYAA 2K2VA 2CP6A 5CO7A 1ASZA 1QWFA 4ZTUB 3CCUA 4M7DA 2L3QA 4L59A 4KT0E 3BFMA 4RTYA 2K4YA 3C94A 5I2MA 3E9FA 3OYIA 1JJ2A 3HKSA 3X28B 2E3IA 2XGTA 1GBRA 2DILA 3I5RA 1UHFA 4QQ6A 4C0GA 4ESRA 4C92F 4JRIA 2DQ0A 3QXEB 4HT9A 2AK5A 4HCKA 2FZCB 5KYWB 1ADYA 3M0SA 3CXCP 5A0GA 4C92B 1S72Q 5GAN2 1B34B 1YGBA 2DL5A 2CKKA 2E6ZA 5AT1B 2J6KA 4XU1A 5LJ5d 4IUQA 2B86A 2C0OA 1IL2A 3QYHB 1Q81U 3UDCA 3J7AF 4JPBW 3LX7A 2YRCA 2XMFA 2MAMA 5J3BA 3M0TA 2CUDA 4CC2A 1OZ2A 1NLPC 1Y07A 4J6WA 3RKYA 2PMEA 4DBHA 3JV3A 2X51A 3MP1A 1UJYA 2HEQA 1VQNT 2DL7A 4II1A 1D09B 1RUWA 1W4SA 4ATOA 2JTFA 5FU6B 4P74A 3QSUA 4M7DB 2RHSA 4RMOA 4ZNXA 1KHIA 2V1RA 2L89A 4RTUA 1UEBA 2AMCA 2JZ2A 2YUQA 3L2VA 2EYXA 3M0RA 4MDWA 1QVFP 4PJOC 4YRKA 4XTWA 3HFZA 2E5KA 3EGUA 1N5ZA 2QGFB 4BDZA 1G3YA 2QTVA 1G3WA 4X9CA 5LJ3d 1JBMA 5IXBA 1YFSA 2P84A 2JT4A 4Y92A 3OS0A 2QEXA 3JB9I 1WXUA 1NBEB 4CC7A 2ZAEA 1Q81C 2XD0A 1H3HA 4H02A 3BJUA 3H0HA 1G3TA 2EKHA 2JS0A 4R0KA 3SB2A 1WPYA 1TWBA 1KG1A 2ZNJA 4EX5A 2MPXC 1Q81R 2QAZA 2EWNA 1H4TA 2W10A 5CKFA 1YIJT 2QHVA 2YUNA 3CC2T 4F17A 3M4GA 3LGLA 4EO4A 4MMLA 4H2WA 3LSQA 4AG1C 4H2YA 1TTHB 3GNGA 1IB8A 2OX7A 1M4ZA 4L5GA 3HL8A 3VS2A 2CSQA 2E3HA 4J9BA 1IXDA 3L2QA 2AMCB 1K8AU 1B7YB 1M3CA 3VJPA 1VQPQ 2ZPGB 3G6EQ 4LDXA 3IALA 3NGPA 4M77C 3CCQA 1L0WA 2H3JA 1FYNA 3V8JA 4FCYA 1B76A 4LDWA 2YT6A 2KQWA 2J7IA 1TOVA 2YXYA 2FPDA 1LVKA 1B7TA 3VS1A 3H41A 3CMEA 4C8QG 2X9HA 2D0QB 1TUDA 3QJYA 1SHGA 5FRMA 2LX9A 1HTTA 5C0MA 2DVJA 1I0CA 1YI2Q 4YCUA 3QJ6A 3VS0A 3KXTA 4KGVB 1KJWA 4C8QD 2CP5A 2ZT7A 1T3SA 1X27A 2R57A 1GGMA 3WVDB 2QDYB 1JXOA 5GANd 3CC4Q 4ZIBA 2LCLA 4CRIA 4CC4B 1IREB 1Y7XA 3CD6T 4OLFA 3A8HB 3EG1A 2EFIA 1QVGS 3QNEA 5FU7B 4DEYA 4IIOA 2DVEA 2K2MA 3VS3A 3OYBA 4E7JA 2NLUA 1K8AC 4LDUA 3P8TA 1ZBJA 3QTCA 3HRIA 1VQ8A 2VB6A 3EG0A 1X55A 1YB3A 4DQ2A 2WSFE 4HXJA 3LW5E 3CCRQ 4O2DA 1M2VA 3I55T 2OTLQ 3VBBA 2DEQA 4KQEA 3W3SA 4RUGA 1K8AR 1BKBA 2L3SA 3FEOA 1W1FA 4M7AC 1OYXA 2Y4YA 2AZSA 2RJDA 4K88A 4EIKA 4JLGA 3JB9J 3VYGA 1WFWA 3QHSA 3L1AA 1BI0A 1Q82U 1SESA 1K76A 4H2TA 3REXA 4RTVA 1ABQA 2QASA 2EPDA 1GCPA 4JJCA 5CKHA 3CCJQ 1E1TA 4LUEA 1VQKT 3HXZA 1I4K1 1GBQA 2ZT8A 5J39A 2LQWA 2DKGA 4C5GA 3J81E 3OW2P 1V29B 1EFNA 4C92C 4C8QA 1PRMC 3V8KA 3ERRA 3EAEA 1VQLQ 4XTZA 3EFRA 3HXVA 4OB3B 2CP2A 1JB0E 4EPCA 1T3LA 1MMAA 3OBYA 1YJWA 4YDQA 5GJWB 3RBBB 4J9DA 1N27A 3EGXA 3VQYA 2DXUA 4JRQA 4CH5A 1D1CA 2K3YA 4P75A 3TUPA 4FIBA 4WF2A 4TQFA 2DEUA 3KUFA 3CCLT 4PJOE 2HL5C 1SRMA 1GFDA 4H2SA 3OD1A 2K5FA 5KE2A 3CCEQ 2JTMA 1UHCA 2D0NA 4LVLA 1X69A 4L87A 1Y0MA 4YRMA 3MP6A 1USYA 1WXTA 2RQVA 3JCMd 1Q82C 1MGQA 1OOTA 3M0UA 2DTHA 1YP5A 2R5AA 1BBUA 4P3NA 1G83A 2GFAA 4N4HA 2JS2A 2L2PA 4OMMA 3UF4A 1KMNA 4TWAA 4YROA 3IKLA 1KC8R 4HCBA 3CC7Q 2QA4Q 1VQZA 4A4KA 4XEOA 3L2RA 1VQ4Q 3CCUT 2L0AA 2Q7EA 3FLGA 2DAQA 2D1XA 1SSFA 2KROA 3ZBDA 1VQ7Q 3URGA 5GMKl 3M0QA 5CVIA 5GAOn 4IUUA 4LD9K 1WHHA 3NETA 2G4CA 4C8QB 4J8OA 4BE0A 5K1PA 3JCMb 2A28A 1KMMA 1H4VB 2LVMA 3P8BB 4B6MA 4Q5WA 2OTJQ 1BK2A 3HRUA 1X54A 2A0FB 2EYZA 1EX4A 4PFPA 3QO7A 2ZPFB 1PC0A 1K73U 1YIJA 3EGXB 1PCXA 2E5QA 3OS5A 1NEGA 4M77E 2LNHB 3CC2A 3QWYA 3UGTA 2J3LA 1E6GA 2HQEA 4VUBA 1GCQA 1Z7MA 2KE9A 2LT4A 1K0XA 2BTTA 3G71A 1B8AA 2RO0A 2VC8A 4C0DC 1LJOA 3M58A 4JZ3A 1TU0B 2MMPA 2QQRA 2FO0A 4OMNA 4IURA 4JJNK 2G3RA 4P74C 1KIKA 2RMOA 1U8RA 2ARUA 5GAOp 2MK5A 1D0ZA 3AT1B 1Z9ZA 2YHTA 3OSVA 4HWOA 1VA7A 4LE9A 3C95A 1IHWA 3CMAT 3ZFJA 3VQVA 3C4SA 4NCXA 2XU8A 4TVYA 1G51A 4XK8E 3RR6A 1UFFA 4ELYC 4PJNA 2AKKA 1RLQC 5LJ3f 3JCMW 3ZEHA 2L3RA 4LUDA 1H641 5A0LA 4OGEA 1D0XA 4YREA 4RQEA 1H4SA 4A54A 4C5HA 1YFRA 2DDZA 4YPFA 4N4GA 1X01A 1K73C 4A4GA 4EMHA 4DOVA 4BE2A 3M54A 1SEMA 1M5Q1 2M1HA 4YRPA 3QDFA 5CKBA 4RG8A 2XHCA 2QEXT 1Q86U 1ACMB 2CH4A 4J15A 2ZINA 3SD4A 2PVOB 3OY9A 3JCMc 4M7AE 3HHTB 5KYUA 1VQ5Q 2RNAA 4FYVB 2FG0A 5CR2A 3NPFA 3PIPA 2P0LA 3QDRB 4ZTJA 4YRCA 4BY6B 3QBYA 1W6XA 2E1HA 4NL3A 2RI5A 4PLIA 5KH6A 3I55A 1BCMA 1NEBA 1TG0A 1RAFB 3UATA 1GXIE 1S1NA 4M77F 1ZBXA 2GFUA 1V76A 3TREA 1AZGB 3P8HA 3RKWA 2XDDA 2GCXA 1V1CA 1R0CB 2NUTA 2P4TA 2X3WD 1YBYA 2ZGWA 2EBPA 3DKMA 1NE8A 1QMCA 2DIGA 4C92E 2OJ2A 3CCVA 3OS1A 1HC7A 4QW2A 1WYDA 1R77A 4JS4A 1B3QA 3VQWA 2DM1A 2K9GA 2ARSA 2HBPA 2KGTA 3JCMe 3A8OB 1UGSB 4J7FA 2CZ6B 3ICAA 1AD5A 1Q86C 4YRSA 3RDVA 3T9NA 2RH2A 4CS4A 3A98A 4N4IA 4PJJA 1VQNQ 2HSEB 4XAXB 3NTHA 4KULA 3CMET 3PCOA 3RGLA 3VQXA 3JCMX 3GNFB 2NWMA 4HT4A 1VQMQ 4PG3A 4HA8A 1G5IA 3HY0A 1AWXA 5GAOl 1VQOQ 4BI3A 2LCSA 5KYUB 1W2BA 3BY7A 1WXBA 2EAYA 1ATIA 4O5VA 2COWA 1ZX6A 4E7HA 3H9NA 3V7CA 3M0PA 1RACB 4IIMA 3HTZA 4M7DE 3OYMA 3QUIA 4BD3A 2EVRA 1XQHA 1TUCA 2ZPBB 1X6GA 4F7UG 2WSEE 3QG1A 1YCSB 4FT4A 3I56Q 4UP7A 2RK2A 1BIBA 2CT4A 3DLLA 2ARTA 2ZCEA 2YWWA 4FSXA 1M3AA 2DIQA 3M59A 1NJ5A 2DLPA 1D1BA 1OI1A 3D7SB 4ZGJB 1PD1A 2NUTB 4A53A 4OB2B 1YJNT 2DD5A 4LD6A 4KBMB 1VQ8T 3A7UA 3QIIA 1EZZB 2JW4A 3JSCA 2HL3A 2FPEA 4JRPA 4PHCA 1NLOC 1XNIA 4MZTA 2RB6A 2CP3A 1U1TA 1YI2A 3J80E 3SWNA 5GAOm 5C53B 2ZTGA 2DMOA 3M57A 4RTZA 3M4YA 3FIFA 1K9MR 4Z89A 2I4LA 5CAIA 3JCMJ 1O75A 1TSFA 4JZ4A 5HCKA 4J83A 1W70A 1QLYA 3PCOB 2RD1A 4AT1B 8AT1B 4DBRA 2YUOA 2KR3A 3QO5A 2RHUA 1IRXA 1YCYA 2XKOC 3E19A 3ULRB 6AT1B 1RL2A 2CH4W 1NYRA 2J06A 4DEXA 3MP8A 2LTOA 3CXCA 4GBQA 2C06A 2XDBA 4E7KA 4P5NA 4GLMA 4KGZB 1VQ9Q 3VKIA 2GBQA 1NJIR 1JJ2P 2LJ0A 2DERA 3TSZA 2PMFA 2HQXA 2LCCA 3FB9A 2ED0A 4P75C 3CPWS 5K1XA 4N0AA 3E1SA 4C5EA 2FYKA 4FYYB 4JJBA 5GAMg 1YJWT 2DQ3A 3NEMA 3WQZA 1TS9A 4RDXA 4M7DF 3JCMf 3CMAA 2D9TA 2QXFA 2AKWA 1XTDA 1ZUYA 2CZ7B 3HP9A 4F7UA 2A37A 4YYEA 3PMTA 1EFWA 4WJ3M 3SWNB 2EL9A 1FX7A 3H6ZA 1ZSZA 2K57A 2KY9A 2CP7A 2HSPA 3QZ9B 2ENMA 1WDXA 1OX8A 1EQRA 2M02A 2X3XD 3CD6Q 3DLMA 1RI0A 5GAMe 4LVKA 4J9FA 4HKEA 1AWWA 1YHQQ 1GL5A 2ZT5A 2NUPA 3THKA 5DM7R 2CDTA 5GMKh 1YN8A 2EQKA 1YNZA 4P71C 4J6YA 3S3NA 3CCSQ 2HKNA 3CBMA 4UP9A 3LYIA 3E9HA 1AVZC 2DXTA 4BB7A 4P3PA 5GAMh 4LVMA 2I4OA 1X6BA 3CEYA 4M75G 4AMCA 5CCAA 2LC4A 2DRKA 2RJFA 2Q5IA 2EYWA 1GCQC 3FC3A 3ZL7C 1N8RU 1G5VA 3QWXX 3CCMT 4BI8B 1M8MA 3VS4A 5DLOA 1YFTA 2JVVA 1BI1A 2CGHA 2RHYA 4M75D 4BY6C 2M0YA 3EFOA 1M90R 4OVAA 2DJZA 3E2UA 4P73A 1QCOA 3TQ7P 2AKWB 2F2VA 2KEAA 4F7UB 1QKXA 2ODRD 3A32A 3GBQA 3G4ST 3G71T 1ZSZB 5J26A 2CREA 2RHSB 1NPRA 5KYYA 3LWHA 1I5LA 5CQYA 3FDRA 4EDUA 2OI3A 4FYXB 2PZ1A 4A63B 5IN1A 3VS6A 2JM9A 5LJ5j 2GGRA 2H8HA 3ME9A 2YRDA 1KQSS 3HFZB 2F2WA 2JM8A 2O4XA 2HD0A 4DA4A 4Z88A 2RQWA 3HRTA 3G1ZA 3CCLQ 3P8VA 1SRLA 1LYLA 3OYDA 4RTXA 5EC7A 1S72T 2F2XA 2DYIA 1PWTA 4Q15A 3L4GA 1U5SA 1UB4A 1N8RC 3MEAA 2RJCA 4KR2A 3JAME
chains in the Genus database with same CATH topology
4J5YA 4C0ZA 4CH4A 2K3XA 1WJSA 4BDYA 2DZ9A 3G7ZA 1NJ8A 2FL7A 4YRGA 3META 2PUKB 11ASA 3PMIA 3OYCA 4M75A 4MMKA 5LJ3j 2RHIA 1YJNA 2XI9A 3TEHA 4TTVA 3CMQA 4G84A 2P0QA 4YRIA 2ZT6A 2RA2A 2ALYA 1JJCA 4C8QE 2O4XB 4RMFA 5C6SA 2DXCA 2OAUA 3FRNA 3HXXA 3JCMV 1KC8U 3RKXA 2EQJA 2E65A 2C8MA 3OYJA 3CCVT 3MHXA 4ZTFA 5CQXA 1WGSA 4R55A 3RUXA 4EMKA 1QVPA 4FL6A 2RI3A 1WLEA 4UP8A 4YRFA 3UFGA 5CKDA 4BW9A 4M75F 1YITA 3EFSA 1O9SA 3CPWA 3OSSC 1W2BS 4PJOD 1NYQA 4M75B 2FB7A 2ZCFB 5EG2A 3OYLA 2QHSA 2VYTA 4JUVA 4HT8A 3JCMP 5CIUA 3Q1JA 3LGFA 3CPFA 5CKEA 2E6NA 3TEHB 3M5AA 1D3BA 2Y90A 1VQPT 3G6ET 1PYSA 3PNWC 2ALYB 4YP0A 1JJCB 4LVIA 2V8KA 3NENA 1R8OB 1KC8C 1NPPA 5FU6C 3NTIA 4PL6A 4M7DC 5GANj 2F69A 2XDPA 1NNHA 3C12A 3F70A 1M9SA 2DXBA 1VQOA 2DD4A 4EMKB 5A0DA 1YI2T 3OBWA 1KHCA 2XK0A 4C8QF 2CYZB 1X75C 1E24A 1EVLA 4O6JA 4KUIA 4LVJA 1TH7A 3X24B 1M8VA 1SETA 4YRRA 1NZ9A 3H8ZA 3JB9H 4V2SA 4OF1A 2XG8D 4XU3A 3CXCS 4XTUA 5GAN3 3DSQA 3CCMA 1FYFA 3DB3A 4IUPA 4PJOA 1FWZA 4M78G 2K5LA 2C7IA 3TCJA 3UWNA 3RL6A 1PYSB 3G4SA 3HFNA 4WJ4A 3LLRA 4TVAA 2P0PA 4M78D 2K5IA 3S3OA 4P72A 4ZGDB 3LC0A 1KQSA 2Q5HA 2KVQG 2X4XA 2BIVA 3MQZA 1VIFA 4B9XA 4MZPA 2E70A 2CJAA 2M16A 3CCJT 3JRZA 5GAN5 1S72A 2QTXA 1QVFS 2X4YA 3UH0A 3JB9G 3WXMB 3OYYA 2X35A 2RK1A 1X2HA 3HXWA 3LH0A 5KCHA 1X56A 2DTIA 1OZ3A 2A3LA 3BW1A 3JB9D 1B70A 2LQKA 2KMTA 3MEYA 1Y96A 2EYQA 4QVDA 5FU7C 4TVAB 1N9RA 5CK9A 3MF1A 2ZZFA 4YRJA 1Z7NA 1PSFA 3OYKA 4X34A 1YHQA 1KQ2A 5GAMd 4C92D 4M78A 3JCMQ 1WJQA 3A31A 2QA4T 3A7RA 4CH6A 1G5HA 2EJGA 4XTYA 3RIRA 3X20B 4OGCA 3MF2A 2DK3A 4E47A 1K9MU 2M9UA 4IUTA 2JNGA 4A4EA 1BI2A 4XU0A 1B70B 3ER0A 3HPWA 4FU6A 3PT9A 1Y96B 4HCZA 3M53A 1NJIU 4CS3A 4BWAA 4QVZA 4M75C 1JRIA 4M78F 5HGQA 1VQPA 3G6EA 3E9IA 2P5IA 4OP0A 1C0AA 2EJFA 4M78B 2QQ9A 3LSSA 2ZPEB 4BUGA 4C92A 5LL6S 1EVKA 2MI6A 1WJRA 2LDMA 4RQFA 1N9WA 1K9MC 4BI4A 5IAYA 3OYNA 1AHJB 4G85A 4IKFA 2RI2A 3KBGA 4RCBA 2L8DA 4EMKC 2E3CA 2F5TX 2ZZGA 2RHQA 3CC4A 2E64A 3OYGA 4HVCA 1NJIC 2J3MA 4YRQA 3R07A 4C8QC 3UPUA 2MWPA 4F7UE 1VQ5T 4R56A 4K87A 2ZIOA 3MEWA 5AYFA 3OW2S 4UPAA 1M1FA 12ASA 4NS5A 3M55A 3CCRA 2E10A 2YLBA 4HWTA 2OTLA 4JS5A 1YITT 4OMFB 2EKOA 4ZTZB 4KUDK 1QP3A 4C0FA 1M90U 4XTVA 2I2LA 1QW1A 2ZPHB 3FJPA 3UGQA 3HXUA 2LNVA 1USYC 3HSBA 5GMKe 4A4HA 5A2QE 3INZA 3VU3C 4C5IA 5F5WA 3CCJA 4TQDA 3RMQA 1QF6A 2LRQA 2XIDA 3P8YA 4TVWA 2RHQB 1QVFA 1ADJA 2KK4A 1NJ6A 3HFOA 4OB0B 1VQMT 1VQLA 1VQOT 2IG0A 2CJBA 2YLCA 4UC4A 3A5ZA 2DPPB 1B7YA 2IY5A 4A4FA 4EMGA 1WNLA 4XEMA 4XQ3A 3O8VA 1BI3A 3V7SA 1BIAA 4Y91A 3L2ZA 3I56T 1M90C 3CCEA 2IVWA 1N9SA 4NOYA 5GAN8 3CBPA 4F7UF 1VQ6A 4GY5A 5D6WA 4X5OA 3L2WA 2ZNIA 3X25B 4P72C 1DJ7B 4BACA 3CC7A 2QA4A 3NFCA 3TEEA 1VQ4A 2A8EA 3QO3A 3I7FA 2DZCA 3AHUA 4C0DB 2VV5A 1ZQ1A 1VQ7A 4OB1B 4DPGA 5KCOA 2X4JA 3V7RA 4K86A 2QHTA 3V8LA 1WQWA 2OTJA 2O01E 3KFUA 3A5ZB 4HWPA 4M75E 4KR3A 2QI2A 2IY5B 2GQVA 2LT1A 3OYEA 2EJ9A 1VQ9T 2F5KA 1G3SA 1KD1U 3TU4K 4QQGA 2Y4XA 3VV0A 3L42A 2Q7HA 3R6OA 4PLLA 5GAOr 2VXFA 3BDLA 5ELOA 1RIQA 3NTKA 2YRVA 3QYGB 4YTLA 3X26B 5GAMf 3GPLA 5LJ5g 2VXEA 4X9DA 3BDUA 2VGMA 4M78C 5I21A 4FM4B 5FROA 1WU7A 1I81A 4Q6GA 4HCCA 3L2UA 1EIFA 4IUVA 2WACA 1YHQT 4LDYA 3OMCA 4MDXA 1FXXA 4YRNA 5ELNA 5LJ5e 5HKCA 5GAN4 3CCST 4YCVA 3VYHB 1Q7YU 1KD1C 2B8AA 3VUZA 3L4GB 4E7LA 3OQ5A 3OYFA 2V8JA 1VQ5A 1XOVA 3REUA 3RESA 4XTXA 4PJOG 3MO8A 4L6V5 1H4QA 3OW2A 3MCAB 4WI1A 5LJ5h 3HFVA 2QQSA 3M9QA 1N6AA 5LJ3g 3OB9A 1QP2A 2VGNA 1M1KU 3OYHA 3HRSA 4YRLA 2FVUA 2R5MA 3A8LB 3OA6A 3M4PA 2M0OA 2CJ9A 4MZMA 2AHJB 5LJ3e 1UGQB 4P3OA 3VUBA 2KAFA 2XICA 5D6YA 1Q7YC 3QKJA 3SWNC 1HXDA 2PUOB 4QVCA 1VQNA 2DO3A 5LJ3h 1VQMA 1SRYA 4M77G 3RACA 2QQAA 1I8FA 1X6OA 4ME7A 2QHUA 4NL2A 2JOYA 3LWIA 1M1KC 3IG2A 3CC4T 4M77D 1U1SA 1YJ9T 2RM4A 2X4WA 2P0KA 3I56A 3RF1A 3IKMB 4JDSA 1LNXA 3A74A 4N0AC 2LQ8A 1JJ2S 1D3BB 1PSEA 4XU2A 5IT9E 2CS7A 4P71A 4FT2A 3OMGA 3CCRT 4AH6A 3OS2A 5GANg 2OTLT 2NS6A 1HK9A 1W66A 5LJ5f 2EQMA 4H2VA 2GF7A 3A8GB 1E1OA 1IZ6A 3CBOA 4B9WA 2QQBA 5E3IA 5HK0A 4H2XA 1UGRB 2V8IA 1ZHIA 2JUFA 1NJ1A 4RCCA 3HXYA 2ZR2A 2R58A 3QPHA 3PGGA 5GANe 2KDSA 4CI0C 3UT1A 4ZN3A 1BYMA 4TVRA 4M7AG 2WSCE 3QO8A 4YRTA 4D6WA 5KE3A 3HRKA 1J5WA 1VQ9A 3GIBA 3N5BB 3M56A 4PKCC 2VUBA 3P8DA 5GMKm 5HY6A 5DLQE 3PZCA 4PJOF 2FHDA 2RJEA 4M7AD 1VQLT 5GANh 4M78E 4M77A 3SFMA 2I4MA 2PVGB 4YCWA 4PJOB 4JLIA 5M9OA 3RERA 2CZ0B 5C51B 5FRNA 1Y71A 4CS2A 4HWSA 5I2SA 2KSSA 1WQ7A 4C92G 5GAN6 2BKDN 1EIYA 5KNNA 4P73C 2A7YA 3CCET 1VUBA 3GF5A 2ZIMA 1P92A 4HWRA 2ZR3A 3GOXA 3CD6A 4ZN1A 1VQ6T 4RG2A 4QQDA 2RHZA 2E12A 2DTOA 1QVGA 4H2XB 1QE0A 5GMKi 4LNSA 3TEGA 2MF2A 2PU9B 4GLKA 3ASKA 2I4NA 2PVDB 2ZZDA 1ASYA 1UGPB 3CC7T 3CCSA 2EIFA 1VIEA 4JRKA 2E5AA 1VQ4T 2JN0A 3NELA 2BUDA 1NJ2A 3GLXA 5DY9A 1VQ7T 3JCMg 4M7DG 3S3MA 2ZZEA 3M4QA 1EOVA 3GP8A 2XTIA 4M77B 2OTJT 1KQ1A 5GAN7 2RHXA 2HAXA 2PQWA 1X2GA 4M7AA 2EQUA 4Z02A 4M7DD 1KOGA 3CCQT 5D6XA 3S6WA 4ELZC 1VQKA 4Y28E 3PTAA 3DB4A 1EIYB 4J6XA 1BBWA 1H3ZA 2CZ1B 2ZXFA 3A7AA 2MWOA 2DU5A 3A5YA 5GANf 4LDVA 2ODRC 3RMSA 4PNOA 3MEUA 5L8RE 1LOJA 3JCMh 2HNIA 4E7IA 1MHNA 2E41A 3PIOA 3HY1A 1B34A 2D6FA 2ZPIB 3CCLA 5C52B 4DOWA 3A8MB 2CIMA 4J7IA 3QZ5B 3SDZA 5FLXE 1SERA 3E9GA 3MEVA 4RKUE 4M7AF 4BE1A 2L5QA 4H2UA 5GMKj 5HK3A 2DU7A 3PFSA 4ZGEB 4CH3A 4M7AB 3WVEB 3JB9F 4E51A 1M1GA 5GAOq 1E22A 2Q7GA 1YJ9A 5GAMj 3OYAA 2K2VA 5CO7A 1ASZA 4ZTUB 3CCUA 4M7DA 4L59A 4KT0E 3BFMA 2K4YA 3C94A 5I2MA 3E9FA 3OYIA 1JJ2A 3HKSA 3X28B 2XGTA 4QQ6A 4C0GA 2DQ0A 4C92F 4JRIA 3QXEB 4HT9A 1ADYA 5A0GA 4C92B 5GAN2 1B34B 1YGBA 2CKKA 2E6ZA 4XU1A 5LJ5d 4IUQA 1IL2A 3QYHB 1Q81U 3UDCA 3J7AF 3LX7A 2MAMA 5J3BA 1OZ2A 1Y07A 3RKYA 4J6WA 2PMEA 3MP1A 1VQNT 4II1A 1W4SA 4ATOA 2JTFA 5FU6B 4P74A 3QSUA 4M7DB 2RHSA 4RMOA 1KHIA 2L89A 1UEBA 2AMCA 2JZ2A 3L2VA 4MDWA 4PJOC 4YRKA 4XTWA 3HFZA 4BDZA 1G3YA 1G3WA 4X9CA 5LJ3d 1JBMA 1YFSA 3OS0A 2QEXA 3JB9I 1Q81C 2XD0A 4H02A 3BJUA 1G3TA 3SB2A 1WPYA 1KG1A 2ZNJA 4EX5A 2EWNA 1H4TA 5CKFA 1YIJT 2QHVA 3CC2T 3M4GA 3LGLA 4EO4A 4MMLA 4H2WA 3LSQA 4H2YA 3GNGA 1M4ZA 4L5GA 3HL8A 3L2QA 2AMCB 1K8AU 1B7YB 3VJPA 4LDXA 2ZPGB 3IALA 3CCQA 4M77C 1L0WA 2H3JA 3V8JA 1B76A 4LDWA 2KQWA 3CMEA 4C8QG 2D0QB 3QJYA 5FRMA 2LX9A 1HTTA 5C0MA 4YCUA 3QJ6A 3KXTA 4C8QD 2ZT7A 2R57A 1GGMA 3WVDB 2QDYB 5GANd 4ZIBA 2LCLA 4CRIA 1IREB 1Y7XA 3CD6T 4OLFA 3A8HB 2EFIA 1QVGS 3QNEA 5FU7B 2DVEA 3OYBA 4E7JA 2NLUA 1K8AC 4LDUA 3P8TA 3QTCA 3HRIA 1VQ8A 1X55A 1YB3A 4DQ2A 2WSFE 4O2DA 3LW5E 3I55T 3VBBA 2DEQA 4KQEA 3W3SA 1BKBA 3FEOA 4M7AC 1OYXA 2Y4YA 2RJDA 4K88A 4JLGA 3JB9J 3VYGA 3QHSA 3L1AA 1BI0A 1Q82U 1SESA 4H2TA 3REXA 5CKHA 1E1TA 1VQKT 3HXZA 1I4K1 2ZT8A 5J39A 2DKGA 4C5GA 3J81E 1V29B 4C92C 4C8QA 3V8KA 3ERRA 3EAEA 4XTZA 3EFRA 3HXVA 4OB3B 1JB0E 4EPCA 3OBYA 1YJWA 4YDQA 1N27A 3VQYA 2DXUA 4JRQA 4CH5A 2K3YA 4P75A 3TUPA 4FIBA 4WF2A 4TQFA 3KUFA 3CCLT 4PJOE 4H2SA 3OD1A 2K5FA 5KE2A 2JTMA 4LVLA 4L87A 4YRMA 3MP6A 1USYA 3JCMd 1Q82C 1MGQA 4P3NA 2DTHA 2R5AA 1BBUA 2GFAA 4N4HA 1KMNA 4TWAA 4YROA 3IKLA 4HCBA 1VQZA 4A4KA 4XEOA 3L2RA 3CCUT 2Q7EA 3FLGA 2DAQA 1SSFA 3ZBDA 3URGA 5GMKl 5CVIA 5GAOn 4IUUA 4LD9K 3NETA 2G4CA 4C8QB 4J8OA 4BE0A 5K1PA 3JCMb 1KMMA 1H4VB 2LVMA 3P8BB 4Q5WA 3HRUA 1X54A 3QO7A 2ZPFB 1K73U 1YIJA 2E5QA 3OS5A 4M77E 3CC2A 3UGTA 2J3LA 2HQEA 4VUBA 1Z7MA 2LT4A 3G71A 1B8AA 2VC8A 2RO0A 4C0DC 1LJOA 3M58A 2MMPA 2QQRA 4IURA 4JJNK 2G3RA 4P74C 1U8RA 2ARUA 5GAOp 2YHTA 3OSVA 4HWOA 3C95A 3CMAT 3ZFJA 3VQVA 3C4SA 4NCXA 2XU8A 4TVYA 1G51A 4XK8E 4ELYC 5LJ3f 3JCMW 3ZEHA 2L3RA 1H641 5A0LA 4OGEA 4YREA 4RQEA 1H4SA 4A54A 4C5HA 1YFRA 2DDZA 4YPFA 4N4GA 1X01A 1K73C 4A4GA 4EMHA 4DOVA 4BE2A 3M54A 2M1HA 1M5Q1 4YRPA 5CKBA 4RG8A 2XHCA 2QEXT 1Q86U 4J15A 2ZINA 3SD4A 2PVOB 3OY9A 3JCMc 4M7AE 3HHTB 5CR2A 3PIPA 2P0LA 3QDRB 4ZTJA 4YRCA 4BY6B 3QBYA 2E1HA 4NL3A 2RI5A 4PLIA 5KH6A 3I55A 1GXIE 4M77F 1ZBXA 2GFUA 3TREA 3P8HA 3RKWA 2XDDA 2GCXA 2P4TA 1YBYA 2ZGWA 3DKMA 4C92E 1NE8A 3CCVA 2DIGA 3OS1A 1HC7A 4QW2A 1WYDA 4JS4A 3VQWA 2ARSA 2HBPA 3JCMe 3A8OB 1UGSB 4J7FA 2CZ6B 3ICAA 1Q86C 4YRSA 3T9NA 2RH2A 4CS4A 4N4IA 4XAXB 3RGLA 3NTHA 4KULA 3CMET 3PCOA 3VQXA 3JCMX 3GNFB 4HT4A 4PG3A 4HA8A 1G5IA 3HY0A 5GAOl 4BI3A 1W2BA 3BY7A 2EAYA 1ATIA 4O5VA 4E7HA 3V7CA 3HTZA 4M7DE 3OYMA 3QUIA 4BD3A 1XQHA 2ZPBB 4F7UG 2WSEE 3QG1A 4FT4A 4UP7A 2RK2A 1BIBA 3DLLA 2ARTA 2ZCEA 4FSXA 2DIQA 3M59A 1NJ5A 1OI1A 4ZGJB 4A53A 4OB2B 1YJNT 2DD5A 4LD6A 4KBMB 1VQ8T 3A7UA 3QIIA 3JSCA 4JRPA 4PHCA 1XNIA 4MZTA 2RB6A 1U1TA 1YI2A 3J80E 3SWNA 5GAOm 5C53B 2ZTGA 3M57A 3M4YA 3FIFA 2I4LA 5CAIA 3JCMJ 1O75A 4J83A 3PCOB 2RD1A 3QO5A 2RHUA 1YCYA 2XKOC 3E19A 1RL2A 1NYRA 3MP8A 2LTOA 3CXCA 2XDBA 2C06A 4E7KA 4P5NA 3VKIA 2PMFA 2HQXA 2LCCA 3FB9A 4P75C 3CPWS 5K1XA 4N0AA 3E1SA 4C5EA 2FYKA 5GAMg 1YJWT 2DQ3A 3NEMA 3WQZA 4RDXA 4M7DF 3JCMf 3CMAA 2D9TA 2QXFA 2AKWA 1XTDA 3HP9A 2CZ7B 4F7UA 4YYEA 3PMTA 1EFWA 4WJ3M 3SWNB 2EL9A 1FX7A 3H6ZA 2K57A 2KY9A 3QZ9B 1EQRA 3DLMA 1RI0A 5GAMe 4LVKA 4HKEA 2ZT5A 5DM7R 5GMKh 2EQKA 4P71C 4J6YA 3S3NA 3CBMA 4UP9A 3LYIA 3E9HA 2DXTA 4BB7A 4P3PA 5GAMh 4LVMA 2I4OA 3CEYA 4M75G 5CCAA 2LC4A 2RJFA 2Q5IA 3FC3A 1N8RU 1G5VA 3CCMT 4BI8B 5DLOA 1YFTA 2JVVA 1BI1A 2CGHA 2RHYA 4M75D 4BY6C 4OVAA 2DJZA 4P73A 2AKWB 4F7UB 2ODRD 3A32A 3G4ST 3G71T 2RHSB 5J26A 1NPRA 3LWHA 1I5LA 5CQYA 3FDRA 4EDUA 5IN1A 5LJ5j 3ME9A 1KQSS 3HFZB 2O4XA 2HD0A 4DA4A 3HRTA 3G1ZA 3P8VA 1LYLA 3OYDA 1S72T 4Q15A 3L4GA 1UB4A 1N8RC 3MEAA 2RJCA 4KR2A 3JAME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQZ A;  3FJP A;  4J5Y A;  3JCM g;  4XEO A;  4M7D G;  3HXU A;  3UGQ A;  2ZZE A;  3M4Q A;  4CH4 A;  1USY C;  2Q7E A;  3HSB A;  5GMK e;  1EOV A;  2XTI A;  2DZ9 A;  4M77 B;  1NJ8 A;  1KQ1 A;  3INZ A;  3VU3 C;  5GAN 7;  5GMK l;  5GAO n;  4YRG A;  5F5W A;  3NET A;  2G4C A;  1X2G A;  4C8Q B;  4TQD A;  5K1P A;  11AS A;  3JCM b;  4M7A A;  4M75 A;  1KMM A;  1H4V B;  1QF6 A;  4MMK A;  5LJ3 j;  4M7D D;  1KOG A;  3P8Y A;  1X54 A;  4TVW A;  2RHQ B;  3QO7 A;  1ADJ A;  3TEH A;  4TTV A;  3CMQ A;  4G84 A;  1NJ6 A;  3HFO A;  1EIY B;  4J6X A;  4YRI A;  2ZT6 A;  4M77 E;  1BBW A;  2RA2 A;  2ALY A;  3UGT A;  2J3L A;  2CJB A;  2ZXF A;  1JJC A;  4C8Q E;  2YLC A;  3A7A A;  3A5Z A;  4RMF A;  1Z7M A;  1B7Y A;  2IY5 A;  1B8A A;  4EMG A;  2VC8 A;  1WNL A;  3A5Y A;  5GAN f;  1LJO A;  2ODR C;  2DU5 A;  4PNO A;  4XEM A;  4XQ3 A;  3HXX A;  1LOJ A;  3JCM V;  3RKX A;  3JCM h;  2HNI A;  2E65 A;  4P74 C;  3V7S A;  2C8M A;  1BIA A;  4Y91 A;  2E41 A;  3L2Z A;  2ARU A;  5GAO p;  3HY1 A;  1N9S A;  1B34 A;  2YHT A;  4HWO A;  3RUX A;  4EMK A;  5C52 B;  4NOY A;  5GAN 8;  3VQV A;  4F7U F;  2CIM A;  4NCX A;  4TVY A;  1G51 A;  1WLE A;  4UP8 A;  4X5O A;  4YRF A;  3UFG A;  1SER A;  4BW9 A;  2ZNI A;  4M7A F;  4M75 F;  5LJ3 f;  4H2U A;  3JCM W;  5GMK j;  3EFS A;  4P72 C;  1H64 1;  2DU7 A;  4YRE A;  4PJO D;  1NYQ A;  4CH3 A;  4RQE A;  4M7A B;  3JB9 F;  4M75 B;  1H4S A;  4A54 A;  1YFR A;  4YPF A;  2FB7 A;  5GAO q;  1E22 A;  2DDZ A;  2Q7G A;  2QHS A;  3QO3 A;  4E51 A;  3I7F A;  4JUV A;  4HT8 A;  3JCM P;  2DZC A;  1X01 A;  5GAM j;  4EMH A;  3AHU A;  3TEH B;  1ASZ A;  1D3B A;  4DPG A;  4ZTU B;  1M5Q 1;  4M7D A;  4YRP A;  3V7R A;  2Y90 A;  4K86 A;  3BFM A;  2QHT A;  1PYS A;  3V8L A;  1WQW A;  4J15 A;  2ALY B;  4YP0 A;  2ZIN A;  1JJC B;  3KFU A;  3JCM c;  4HWP A;  4M7A E;  2XGT A;  4M75 E;  3NEN A;  4KR3 A;  2IY5 B;  2P0L A;  4C92 F;  4JRI A;  2DQ0 A;  2EJ9 A;  4HT9 A;  4YRC A;  4M7D C;  5GAN j;  1ADY A;  1NNH A;  2E1H A;  4NL3 A;  4C92 B;  5GAN 2;  1B34 B;  2Q7H A;  1YGB A;  4M77 F;  4EMK B;  5GAO r;  4XU1 A;  2VXF A;  5LJ5 d;  3RKW A;  4C8Q F;  1IL2 A;  1E24 A;  1EVL A;  5ELO A;  1TH7 A;  1RIQ A;  1M8V A;  1SET A;  4YRR A;  4C92 E;  2ZGW A;  5GAM f;  3JB9 H;  4V2S A;  1HC7 A;  5LJ5 g;  2VXE A;  3RKY A;  4J6W A;  4X9D A;  3BDU A;  4M78 C;  5I21 A;  4XU3 A;  1WYD A;  2PME A;  3VQW A;  4XTU A;  2ARS A;  5GAN 3;  1WU7 A;  1I81 A;  3DSQ A;  3JCM e;  4Q6G A;  1FYF A;  4PJO A;  3ICA A;  4P74 A;  4YRS A;  3QSU A;  4M7D B;  2RHS A;  4M78 G;  4CS4 A;  2C7I A;  3RGL A;  3PCO A;  3RL6 A;  3VQX A;  1PYS B;  3JCM X;  2AMC A;  4PG3 A;  4HA8 A;  1G5I A;  3HFN A;  3HY0 A;  5GAO l;  4YRN A;  4WJ4 A;  5ELN A;  5LJ5 e;  3BY7 A;  5GAN 4;  2EAY A;  4YCV A;  4TVA A;  1ATI A;  4PJO C;  4YRK A;  4XTW A;  3HFZ A;  4M78 D;  3V7C A;  3L4G B;  4X9C A;  3HTZ A;  5LJ3 d;  4P72 A;  1JBM A;  4M7D E;  3QUI A;  1YFS A;  3REU A;  3LC0 A;  3RES A;  3JB9 I;  4F7U G;  4XTX A;  2Q5H A;  4PJO G;  1H4Q A;  4H02 A;  4UP7 A;  4WI1 A;  1BIB A;  5LJ5 h;  3BJU A;  2CJA A;  2ART A;  2ZCE A;  3HFV A;  3SB2 A;  1NJ5 A;  5LJ3 g;  1WPY A;  5GAN 5;  2ZNJ A;  4EX5 A;  4A53 A;  2QTX A;  3UH0 A;  3JB9 G;  3A7U A;  2EWN A;  1H4T A;  4YRL A;  2QHV A;  4PHC A;  1X2H A;  2RB6 A;  3HXW A;  3M4P A;  1U1T A;  3M4G A;  1X56 A;  2CJ9 A;  4EO4 A;  2DTI A;  3SWN A;  5GAO m;  5C53 B;  2ZTG A;  4MML A;  4H2W A;  3LSQ A;  4H2Y A;  3BW1 A;  5LJ3 e;  3JB9 D;  3FIF A;  1B70 A;  2I4L A;  5CAI A;  3JCM J;  3MEY A;  4P3O A;  3PCO B;  2RD1 A;  2AMC B;  1B7Y B;  3QO5 A;  1Y96 A;  3IAL A;  1YCY A;  4M77 C;  1L0W A;  4QVD A;  3SWN C;  1HXD A;  1NYR A;  3V8J A;  4TVA B;  1N9R A;  3MF1 A;  1B76 A;  4QVC A;  2ZZF A;  5LJ3 h;  4YRJ A;  1Z7N A;  1SRY A;  4M77 G;  3RAC A;  1KQ2 A;  5GAM d;  4C92 D;  4M78 A;  1I8F A;  3JCM Q;  4C8Q G;  2PMF A;  3A31 A;  3FB9 A;  2QHU A;  4P75 C;  1HTT A;  5K1X A;  4N0A A;  4NL2 A;  3A7R A;  4CH6 A;  2FYK A;  4YCU A;  3IG2 A;  5GAM g;  4M77 D;  1U1S A;  1G5H A;  2EJG A;  2DQ3 A;  2RM4 A;  4XTY A;  3NEM A;  3WQZ A;  3RIR A;  4C8Q D;  2ZT7 A;  4RDX A;  3RF1 A;  3IKM B;  3MF2 A;  1GGM A;  4M7D F;  3JCM f;  5GAN d;  1LNX A;  4ZIB A;  2AKW A;  3A74 A;  4F7U A;  4N0A C;  4YYE A;  4OLF A;  1EFW A;  4WJ3 M;  3QNE A;  3SWN B;  2EL9 A;  1D3B B;  4XU2 A;  2K57 A;  2DVE A;  4P71 A;  1EQR A;  4XU0 A;  1B70 B;  4AH6 A;  5GAM e;  5GAN g;  3P8T A;  3QTC A;  1HK9 A;  1W66 A;  3HRI A;  5LJ5 f;  1X55 A;  1YB3 A;  4DQ2 A;  2ZT5 A;  4H2V A;  4O2D A;  1E1O A;  1Y96 B;  5GMK h;  4CS3 A;  3VBB A;  2DEQ A;  4BWA A;  4KQE A;  3W3S A;  4P71 C;  4J6Y A;  5E3I A;  4M7A C;  4M75 C;  1JRI A;  4M78 F;  4H2X A;  4UP9 A;  3E9H A;  1NJ1 A;  4RCC A;  4K88 A;  5HGQ A;  2DXT A;  3HXY A;  2ZR2 A;  3E9I A;  5GAM h;  3JB9 J;  4P3P A;  2P5I A;  2I4O A;  3PGG A;  4OP0 A;  5GAN e;  1C0A A;  2EJF A;  4M78 B;  3QHS A;  3LSS A;  4M7A G;  3L1A A;  4M75 G;  4YRT A;  3QO8 A;  1SES A;  3HRK A;  4C92 A;  1J5W A;  3GIB A;  1EVK A;  2Q5I A;  4H2T A;  3REX A;  5GMK m;  4RQF A;  1E1T A;  1N9W A;  3PZC A;  3HXZ A;  1I4K 1;  4PJO F;  1YFT A;  2CGH A;  2ZT8 A;  4M7A D;  4M75 D;  2DKG A;  5GAN h;  4M78 E;  4M77 A;  4G85 A;  2DJZ A;  4P73 A;  2AKW B;  2I4M A;  4F7U B;  4YCW A;  4C92 C;  4PJO B;  4JLI A;  4C8Q A;  3RER A;  2ODR D;  3V8K A;  3ERR A;  3A32 A;  5C51 B;  4RCB A;  2RHS B;  4XTZ A;  3EFR A;  3HXV A;  4EMK C;  2E3C A;  4CS2 A;  1I5L A;  4HWS A;  2ZZG A;  2RHQ A;  2E64 A;  4YDQ A;  1WQ7 A;  4C92 G;  5GAN 6;  4HVC A;  1EIY A;  3VQY A;  5KNN A;  4P73 C;  2DXU A;  4CH5 A;  4P75 A;  3TUP A;  2J3M A;  5LJ5 j;  4YRQ A;  3R07 A;  4WF2 A;  4C8Q C;  2ZIM A;  4TQF A;  3HFZ B;  4HWR A;  4F7U E;  2ZR3 A;  4PJO E;  4K87 A;  2ZIO A;  4H2S A;  3OD1 A;  4UPA A;  2DTO A;  4H2X B;  12AS A;  1QE0 A;  5GMK i;  4L87 A;  2E10 A;  4LNS A;  3G1Z A;  2YLB A;  3TEG A;  4HWT A;  4YRM A;  3P8V A;  2I4N A;  1LYL A;  1USY A;  3JCM d;  1MGQ A;  4P3N A;  2DTH A;  4Q15 A;  4ZTZ B;  1BBU A;  1ASY A;  3L4G A;  4JRK A;  2E5A A;  2JN0 A;  1KMN A;  3NEL A;  4TWA A;  4YRO A;  3IKL A;  4XTV A;  1NJ2 A;  4KR2 A;  2I2L A;  5DY9 A; 
#chains in the Genus database with same CATH topology
 4J5Y A;  4C0Z A;  4CH4 A;  1PM3 A;  1YFN A;  2K3X A;  1WJS A;  1YJ9 Q;  4M4Z A;  4BDY A;  5FWB A;  1N8R R;  2DZ9 A;  2RF0 A;  3G7Z A;  1NJ8 A;  2FL7 A;  4YRG A;  1UG1 A;  3MET A;  3CCU Q;  2PUK B;  4D8K A;  11AS A;  3PMI A;  3OYC A;  4M75 A;  4OMO A;  4MMK A;  5LJ3 j;  2RHI A;  1YJN A;  1QQJ A;  2XI9 A;  3TEH A;  4TTV A;  3CMQ A;  4G84 A;  4RTW A;  2P0Q A;  3EG2 A;  4YRI A;  2ZT6 A;  2JTE A;  2RA2 A;  4KH0 B;  2ALY A;  1AOJ A;  1WHL A;  1JJC A;  4C8Q E;  2O4X B;  4RMF A;  3PVQ A;  2ATC B;  5C6S A;  2DXC A;  2OAU A;  1RAH B;  1SF9 A;  1RLP C;  3FRN A;  2DF6 A;  1RAA B;  1XJW B;  3HXX A;  2A36 A;  3JCM V;  1KC8 U;  3RKX A;  2EQJ A;  2E65 A;  2QG9 B;  2C8M A;  3OYJ A;  3CCV T;  8ATC B;  3MHX A;  4ZTF A;  2RQR A;  5CQX A;  1WGS A;  4R55 A;  2QGG A;  3PE0 A;  3RUX A;  4EMK A;  2DFU A;  1M2O A;  1JXM A;  1QVP A;  2LP5 A;  4FL6 A;  4K11 A;  3EG9 A;  1KD1 R;  2RI3 A;  1WLE A;  1LPL A;  4UP8 A;  4YRF A;  3UFG A;  5CKD A;  4BW9 A;  1H92 A;  4M75 F;  1YIT A;  3EFS A;  1O9S A;  3CPW A;  3OSS C;  1W2B S;  4PJO D;  1NYQ A;  2O31 A;  1VYT A;  4M75 B;  2MCN A;  2FB7 A;  2ZCF B;  5EG2 A;  3OYL A;  2QHS A;  1X2Q A;  2VYT A;  4JUV A;  4HT8 A;  3JCM P;  5CIU A;  3Q1J A;  4E6R A;  3LGF A;  3CPF A;  3NMZ C;  5CKE A;  2E6N A;  3TEH B;  3M5A A;  1D3B A;  1M2V B;  2VAS A;  2CP0 A;  2Y90 A;  1VQP T;  4QKU A;  3G6E T;  1PYS A;  3PNW C;  2ALY B;  1QCN A;  4YP0 A;  1JJC B;  4LVI A;  2V8K A;  3NEN A;  1R8O B;  2QEX Q;  2RPN A;  1KC8 C;  4J9G A;  1NPP A;  1VQ6 Q;  5FU6 C;  3NTI A;  4PL6 A;  2BZY A;  4M7D C;  5GAN j;  2F69 A;  2XDP A;  4AG2 C;  1NNH A;  3C12 A;  3F70 A;  1M9S A;  1UTI A;  1OX9 A;  2DXB A;  1OUL A;  1WHK A;  1OPL A;  1PD0 A;  1VQO A;  1Q7Y R;  2DD4 A;  4EMK B;  5A0D A;  1YI2 T;  3OBW A;  2DBM A;  1KHC A;  2XK0 A;  4C8Q F;  2CYZ B;  1MV0 B;  1X75 C;  1E24 A;  2L3P A;  1ZUU A;  1EVL A;  3HTR A;  4O6J A;  4KUI A;  4LVJ A;  1TH7 A;  1WZO A;  2DRM A;  1WYX A;  2K3B A;  2ED1 A;  3X24 B;  1M8V A;  1SET A;  4YRR A;  1NZ9 A;  3H8Z A;  2HBW A;  3JB9 H;  4V2S A;  2C0I A;  4OF1 A;  2XG8 D;  1KFZ A;  4XU3 A;  3CXC S;  4XTU A;  5GAN 3;  1MNE A;  3TVT A;  3DSQ A;  3CCM A;  5FWC A;  3I35 A;  1M1K R;  3DB3 A;  4IUP A;  1FYF A;  3VS7 A;  4PJO A;  1SHF A;  3CCQ Q;  1FWZ A;  4D8D A;  4M78 G;  2K5L A;  2C7I A;  2ESW A;  3TCJ A;  2COY A;  1BB9 A;  3UWN A;  1ABO A;  1PYS B;  3RL6 A;  1YWP A;  3G4S A;  3HFN A;  5FW9 A;  4WJ4 A;  1Y57 A;  3LLR A;  4TVA A;  2P0P A;  1OQK A;  4M78 D;  3SHW A;  1ZSZ C;  2K5I A;  1IGQ A;  3I9Q A;  3UA6 A;  3S3O A;  4P72 A;  2W0Z A;  2BE9 B;  4ZGD B;  3LC0 A;  1KQS A;  2QYZ A;  2Q5H A;  2KVQ G;  2X4X A;  2BIV A;  3MQZ A;  1VIF A;  4B9X A;  4MZP A;  2E70 A;  2CJA A;  1CSK A;  1NG2 A;  2M16 A;  3CCJ T;  1ZSG A;  3JRZ A;  5GAN 5;  1S72 A;  2QTX A;  1QVF S;  2X4Y A;  3UH0 A;  3JB9 G;  3WXM B;  3OYY A;  5I11 A;  1ZLM A;  1H8K A;  2X35 A;  5KYN A;  2RK1 A;  1PHT A;  2VVK A;  1X2H A;  3HXW A;  3LH0 A;  5KCH A;  2EQI A;  1T0H A;  1X56 A;  1C6V X;  2DTI A;  2IPO B;  1FMW A;  1OZ3 A;  2A3L A;  3BW1 A;  3JB9 D;  1G2B A;  1B70 A;  2LQK A;  2SRC A;  1CKB A;  1WA7 A;  2KMT A;  2O9S A;  3MEY A;  1UJ0 A;  2YUP A;  5D7U A;  1Y96 A;  2EGE A;  2EYQ A;  1FMK A;  3O5Z A;  2D8H A;  4QVD A;  4AFU C;  1AEY A;  5FU7 C;  4TVA B;  1N9R A;  5CK9 A;  3MF1 A;  3EHQ A;  1G8X A;  3NHN A;  2ZZF A;  1ARK A;  4YRJ A;  1Z7N A;  7AT1 B;  1PSF A;  1NYG A;  3OYK A;  4X34 A;  3A1P A;  1YHQ A;  3REB B;  1KQ2 A;  1RAD B;  4C92 D;  5GAM d;  1QVG P;  2YDL A;  2GTJ A;  4M78 A;  3JCM Q;  1WJQ A;  1MMD A;  3A31 A;  2LJ1 A;  1HYO A;  2QA4 T;  3A7R A;  4CH6 A;  3UA7 A;  1IO6 A;  1G5H A;  2EJG A;  4XTY A;  4Z8A A;  3RIR A;  3X20 B;  4OGC A;  3MF2 A;  2DK3 A;  1HD3 A;  4E47 A;  1K9M U;  2M9U A;  4IUT A;  2COZ A;  1LCK A;  1WI7 A;  2HQH A;  2JNG A;  4A4E A;  1BI2 A;  1UGV A;  1OU9 A;  4FSS A;  2K79 A;  4XU0 A;  1B70 B;  1U3O A;  3ER0 A;  4DBQ A;  1GFC A;  4WCI A;  3HPW A;  2V26 A;  4FU6 A;  1CKA A;  3PT9 A;  2SEM A;  4ANJ A;  1Y96 B;  4HCZ A;  1Q95 G;  3M53 A;  1M27 C;  1TUG B;  1NJI U;  4CS3 A;  4BWA A;  2BZX A;  2GTO A;  4QVZ A;  1HJD A;  4M75 C;  1JRI A;  4M78 F;  2EYY A;  1GRI A;  5HGQ A;  1VQP A;  3G6E A;  3E9I A;  2JJ9 A;  2P5I A;  3EGD A;  4X1V A;  4OP0 A;  1C0A A;  2EJF A;  4M78 B;  2QQ9 A;  3LSS A;  2ZPE B;  4OMP A;  1T0J A;  4FYW B;  2Z0W A;  4BUG A;  2KYB A;  4C92 A;  5LL6 S;  1EVK A;  4OMQ A;  2MI6 A;  1JO8 A;  1WJR A;  1WHM A;  2LDM A;  4RQF A;  1N9W A;  1K9M C;  1E6H A;  4BI4 A;  2HKQ B;  5IAY A;  3SEM A;  3MKD A;  3OYN A;  1AHJ B;  4G85 A;  4IKF A;  2RI2 A;  1C0M A;  1YIJ Q;  5GJV B;  4KRT A;  2V1Q A;  2HMA A;  1JU5 C;  3KBG A;  4RCB A;  3CC2 Q;  2L8D A;  4EMK C;  2E3C A;  2F5T X;  1K1Z A;  2ZZG A;  2RHQ A;  1R0B G;  3CC4 A;  2E64 A;  3G71 Q;  3OYG A;  4HVC A;  1NJI C;  2J3M A;  4YRQ A;  3R07 A;  4C8Q C;  2MIO A;  3UPU A;  2MWP A;  4F7U E;  1VQ5 T;  4R56 A;  4K87 A;  2ZIO A;  3MEW A;  1WIE A;  5AYF A;  4AFS C;  3OW2 S;  4UPA A;  1B07 A;  1M1F A;  12AS A;  4NS5 A;  1IGU A;  3M55 A;  3CCR A;  1MUZ A;  2E10 A;  2YLB A;  4HWT A;  3EGD B;  2OTL A;  4JS5 A;  1YIT T;  4OMF B;  2EKO A;  4ZTZ B;  2LMJ A;  4KUD K;  2CUB A;  1QP3 A;  2DE0 X;  4C0F A;  4PJM A;  1YWO A;  1RI9 A;  2KRS A;  1M90 U;  2KXD A;  4XTV A;  2I2L A;  2YSQ A;  1QW1 A;  2ZPH B;  3FJP A;  3UGQ A;  1UE9 A;  3HXU A;  2LNV A;  1USY C;  3HSB A;  2IIM A;  5GMK e;  4A4H A;  5A2Q E;  3INZ A;  3VU3 C;  4C5I A;  2J6F A;  4PFZ A;  5F5W A;  2KBT A;  3CCJ A;  4TQD A;  3RMQ A;  1QF6 A;  2LRQ A;  4HVV A;  2XID A;  3P8Y A;  4TVW A;  4DBF A;  2RHQ B;  1QVF A;  1ADJ A;  2KK4 A;  1NJ6 A;  3HFO A;  4OB0 B;  1VQM T;  1VQL A;  1WLP B;  2QDL A;  2O2O A;  1VQO T;  2IG0 A;  1KSW A;  2CJB A;  1SG5 A;  2YLC A;  4UC4 A;  3A5Z A;  2DPP B;  3I55 Q;  1B7Y A;  2IY5 A;  4AFQ C;  4A4F A;  4EMG A;  1AT1 B;  1WNL A;  3BE3 A;  3FJ5 A;  4XEM A;  4XQ3 A;  1RAE B;  5IHI A;  3O8V A;  1M3B A;  1BI3 A;  3V7S A;  4FW1 A;  1BIA A;  4Y91 A;  3L2Z A;  3I56 T;  2JMC A;  1M90 C;  3CCE A;  2IVW A;  1N9S A;  1PNJ A;  3R6N A;  4NOY A;  5GAN 8;  1SKU B;  3IQL A;  3CBP A;  4F7U F;  3CCV Q;  1VQ6 A;  4GY5 A;  5D6W A;  1BBZ A;  1D1A A;  4X5O A;  3L2W A;  2ZNI A;  1VQK Q;  3X25 B;  2FZK B;  4P72 C;  1DJ7 B;  2DYB A;  9ATC B;  4ORZ A;  2BZ8 A;  1F1B B;  3CC7 A;  2QA4 A;  4BAC A;  3NFC A;  3TEE A;  2MYS A;  1VQ4 A;  3C0C A;  2A8E A;  4J9C A;  3QO3 A;  3I7F A;  2M51 A;  2DZC A;  4E7S A;  5ECA A;  2ECZ A;  3AHU A;  4C0D B;  2VV5 A;  1ZQ1 A;  1VQ7 A;  2NUP B;  4OB1 B;  4DPG A;  5KCO A;  2X4J A;  3V7R A;  4K86 A;  1AZE A;  2QHT A;  3V8L A;  1WQW A;  2OTJ A;  2O01 E;  2HDA A;  4F14 A;  2ABL A;  3KFU A;  3A5Z B;  4HWP A;  2KRN A;  4M75 E;  1M30 A;  1I1J A;  4KR3 A;  2QI2 A;  2IY5 B;  4RTT A;  2GQV A;  2LT1 A;  3OYE A;  1KK7 A;  2EJ9 A;  2NUZ A;  1VQ9 T;  2F5K A;  1G3S A;  1KD1 U;  3TU4 K;  4QQG A;  2Y4X A;  3VV0 A;  3L42 A;  2Q7H A;  4F16 A;  1J3T A;  3R6O A;  3PVL A;  4PLL A;  4E7Z A;  5GAO r;  2EGC A;  2VXF A;  3BDL A;  2JXB A;  2KT8 A;  5ELO A;  3EFO B;  1RIQ A;  3NTK A;  2YRV A;  2PTK A;  1JQQ A;  2KYM A;  3QYG B;  4YTL A;  3X26 B;  5GAM f;  3GPL A;  5LJ5 g;  2VXE A;  2C0T A;  5KYY B;  4X9D A;  1OV3 A;  2VGM A;  3BDU A;  4M78 C;  3VS5 A;  5I21 A;  4FM4 B;  5FRO A;  1WU7 A;  1FMV A;  1PG5 B;  1I81 A;  2K6D A;  3H0F A;  4Q6G A;  2G6F X;  2CT3 A;  2EW3 A;  1QWE A;  2LJ3 A;  4HCC A;  3L2U A;  1EIF A;  1RAB B;  4IUV A;  2VWF A;  2WAC A;  1MMG A;  1YHQ T;  4LDY A;  1NYF A;  3OMC A;  2FRY A;  1PRL C;  1K4U S;  2AIR B;  4MDX A;  1FXX A;  4YRN A;  5ELN A;  5LJ5 e;  5HKC A;  4J9H A;  5GAN 4;  3CCS T;  4YCV A;  3VYH B;  2P4R A;  1MV3 A;  4FW2 A;  1Q7Y U;  1KD1 C;  2B8A A;  3VUZ A;  3L4G B;  4E7L A;  3OQ5 A;  3OYF A;  2V8J A;  1UUE A;  2VKN A;  1VQ5 A;  1XOV A;  3REU A;  3RES A;  1K0S A;  4XTX A;  4PJO G;  3MO8 A;  4L6V 5;  1H4Q A;  3OW2 A;  4LXC A;  3MCA B;  4WI1 A;  5LJ5 h;  3HFV A;  2GNC A;  2QQS A;  3M9Q A;  1N6A A;  3CMA Q;  5LJ3 g;  3OB9 A;  1AWJ A;  1QP2 A;  1A0N B;  5IXF A;  2VGN A;  1BU1 A;  1M1K U;  2K7A A;  2RN8 A;  3OYH A;  3HRS A;  2I0N A;  4YRL A;  2FVU A;  3REA B;  2O88 A;  2R5M A;  3A8L B;  3OA6 A;  3M4P A;  2D8J A;  2M0O A;  2CJ9 A;  2LX7 A;  4MZM A;  4WTO B;  1WHJ A;  1PKS A;  2AHJ B;  5IHK A;  5LJ3 e;  1QKW A;  1UGQ B;  4E2F B;  1SPK A;  3CPW P;  4P3O A;  3VUB A;  2KAF A;  1RAI B;  2O9V A;  3MPU B;  2XIC A;  3LH5 A;  5D6Y A;  3CQT A;  1Z9Q A;  2QK0 A;  2OAW A;  2RQT A;  1Q7Y C;  3QKJ A;  3SWN C;  3VRY A;  1HXD A;  2BE7 D;  2PUO B;  3G1J A;  4QVC A;  1VQN A;  2HCK A;  2RQU A;  2DO3 A;  5KYX A;  1ZA1 B;  3KFV A;  5LJ3 h;  1VQM A;  2DBK A;  1SRY A;  3EHR A;  4M77 G;  3RAC A;  2QQA A;  1I8F A;  1X6O A;  2KNB B;  4ME7 A;  3EG9 B;  2QHU A;  2KXC A;  4KGX B;  4NL2 A;  1MMN A;  2GQI A;  2NYS A;  2DL4 A;  4HVU A;  2JOY A;  3LWI A;  1M1K C;  3IG2 A;  3CC4 T;  4M77 D;  1U1S A;  3EH1 A;  1YJ9 T;  2RM4 A;  2AKL A;  2X4W A;  2P0K A;  3I56 A;  1NM7 A;  1Q82 R;  3RNJ A;  3RF1 A;  3IKM B;  1RAG B;  4JDS A;  2AT1 B;  2DX1 A;  1LNX A;  2J6O A;  3A74 A;  2ROL A;  4N0A C;  2LQ8 A;  1JJ2 S;  1D3B B;  1PSE A;  4XU2 A;  1ZUK A;  5IT9 E;  2CS7 A;  4P71 A;  4FT2 A;  3OMG A;  3CCR T;  4AFZ C;  5I22 A;  4AH6 A;  3H0I A;  3OS2 A;  5GAN g;  2OTL T;  2NS6 A;  1HK9 A;  1W66 A;  5LJ5 f;  2ROT A;  2EQM A;  4H2V A;  1E7O A;  2GF7 A;  3A8G B;  1E1O A;  3CME Q;  1IZ6 A;  3CBO A;  4B9W A;  5IH2 A;  2DL3 A;  2QQB A;  2AZV A;  5E3I A;  5HK0 A;  4H2X A;  4CC3 A;  1UGR B;  5KYX B;  2V8I A;  1ZHI A;  2JUF A;  1UEC A;  4RCC A;  1NJ1 A;  2JMA A;  3HXY A;  2FZG B;  2ZR2 A;  2R58 A;  3QPH A;  2DL8 A;  3PGG A;  5GAN e;  2KDS A;  4CI0 C;  3UT1 A;  2DA9 A;  3I5S A;  4ZN3 A;  3EG3 A;  2FEI A;  1BYM A;  4TVR A;  4M7A G;  4JJD A;  2WSC E;  3QO8 A;  4YRT A;  1I07 A;  4D6W A;  5KE3 A;  3HRK A;  2E4H A;  1J5W A;  1AWO A;  1VQ9 A;  2HZY A;  4KH1 B;  3GIB A;  4PK4 A;  3N5B B;  3M56 A;  4PKC C;  1WHG A;  2VUB A;  3P8D A;  5GMK m;  1C1A A;  5DLQ E;  5HY6 A;  4PFO A;  3PZC A;  1KQS P;  4PJO F;  2FHD A;  2RJE A;  4M7A D;  1YJN Q;  1VQL T;  5GAN h;  4M78 E;  4M77 A;  3SFM A;  1VQ8 Q;  2CSI A;  2DET A;  2I4M A;  2PVG B;  4YCW A;  4PJO B;  2F1L A;  4JLI A;  5M9O A;  3RER A;  2CZ0 B;  2KT1 A;  5C51 B;  5FRN A;  1PKT A;  1SSH A;  1Y71 A;  4CS2 A;  4HWS A;  3EH2 A;  2KRM A;  5I2S A;  2KSS A;  1MND A;  1X43 A;  1WQ7 A;  4C92 G;  5GAN 6;  1JEG A;  2BKD N;  1EIY A;  5KNN A;  4P73 C;  1VYV A;  2A7Y A;  2FPF A;  3CCE T;  1VUB A;  3GF5 A;  2ZIM A;  1P92 A;  2KI7 A;  4HWR A;  2ZR3 A;  3GOX A;  3CD6 A;  2A08 A;  4ZN1 A;  1VQ6 T;  4RG2 A;  5IHN A;  4QQD A;  1K73 R;  1OU8 A;  2RHZ A;  2E12 A;  2DTO A;  4PJL A;  1QVG A;  4H2X B;  1QE0 A;  5GMK i;  4LNS A;  3TEG A;  2MF2 A;  2PU9 B;  4GLK A;  1HSQ A;  4LNP A;  3ASK A;  2I4N A;  2PVD B;  2ZZD A;  1ASY A;  1UGP B;  1I5O B;  3CCS A;  3CC7 T;  2EIF A;  2EGA A;  1VIE A;  4JRK A;  2E5A A;  1VQ4 T;  2JN0 A;  3NEL A;  2BUD A;  1YIT Q;  4HVW A;  1NJ2 A;  3GLX A;  5DY9 A;  1VQ7 T;  3JCM g;  1ZA2 B;  4M7D G;  1IHV A;  3S3M A;  1VYU A;  2ZZE A;  3M4Q A;  2FRW A;  1EOV A;  1YJW Q;  3GP8 A;  2XTI A;  4M77 B;  2OTJ T;  1KQ1 A;  5GAN 7;  2RHX A;  2HAX A;  1OEB A;  1QCF A;  1K9A A;  1X2K A;  2LZ6 B;  2PQW A;  1TXQ A;  1BCO A;  1X2G A;  4M7A A;  2EQU A;  4Z02 A;  4M7D D;  1KOG A;  3CCQ T;  5D6X A;  4OML A;  1OPK A;  3S6W A;  2J05 A;  4ELZ C;  1VQK A;  4Y28 E;  3PTA A;  4J9E A;  3DB4 A;  1EIY B;  2DJQ A;  4J6X A;  3VRZ A;  1D0Y A;  1BBW A;  1H3Z A;  2CZ1 B;  2ZXF A;  3A7A A;  2PNI A;  2MWO A;  1U06 A;  2DU5 A;  3A5Y A;  5GAN f;  4LDV A;  2ODR C;  3RMS A;  4PNO A;  1Q86 R;  3MEU A;  5L8R E;  1LOJ A;  1W2B P;  3TSW A;  3JCM h;  5KYW A;  4LN2 A;  2HNI A;  4E7I A;  1MHN A;  2E41 A;  2DNU A;  2MOX A;  3PIO A;  3HY1 A;  2H3E B;  1B34 A;  2D6F A;  2ZPI B;  3CCL A;  5C52 B;  1VOM A;  4DOW A;  3A8M B;  2CIM A;  4J9I A;  1UDL A;  4J7I A;  3MJX A;  2LQN A;  3QZ5 B;  3SDZ A;  5FLX E;  1SER A;  3E9G A;  3MEV A;  4RKU E;  4M7A F;  3CCM Q;  4BE1 A;  2L5Q A;  4H2U A;  5GMK j;  3U23 A;  5HK3 A;  4QT7 A;  3PFS A;  2DU7 A;  4ZGE B;  1WX6 A;  4CH3 A;  4M7A B;  3WVE B;  4F04 B;  3JB9 F;  4E51 A;  1M1G A;  5GAO q;  1E22 A;  2Q7G A;  1YJ9 A;  3G4S Q;  5L23 A;  5GAM j;  3OYA A;  2K2V A;  2CP6 A;  5CO7 A;  1ASZ A;  1QWF A;  4ZTU B;  3CCU A;  4M7D A;  2L3Q A;  4L59 A;  4KT0 E;  3BFM A;  4RTY A;  2K4Y A;  3C94 A;  5I2M A;  3E9F A;  3OYI A;  1JJ2 A;  3HKS A;  3X28 B;  2E3I A;  2XGT A;  1GBR A;  2DIL A;  3I5R A;  1UHF A;  4QQ6 A;  4C0G A;  4ESR A;  4C92 F;  4JRI A;  2DQ0 A;  3QXE B;  4HT9 A;  2AK5 A;  4HCK A;  2FZC B;  5KYW B;  1ADY A;  3M0S A;  3CXC P;  5A0G A;  4C92 B;  1S72 Q;  5GAN 2;  1B34 B;  1YGB A;  2DL5 A;  2CKK A;  2E6Z A;  5AT1 B;  2J6K A;  4XU1 A;  5LJ5 d;  4IUQ A;  2B86 A;  2C0O A;  1IL2 A;  3QYH B;  1Q81 U;  3UDC A;  3J7A F;  4JPB W;  3LX7 A;  2YRC A;  2XMF A;  2MAM A;  5J3B A;  3M0T A;  2CUD A;  4CC2 A;  1OZ2 A;  1NLP C;  1Y07 A;  4J6W A;  3RKY A;  2PME A;  4DBH A;  3JV3 A;  2X51 A;  3MP1 A;  1UJY A;  2HEQ A;  1VQN T;  2DL7 A;  4II1 A;  1D09 B;  1RUW A;  1W4S A;  4ATO A;  2JTF A;  5FU6 B;  4P74 A;  3QSU A;  4M7D B;  2RHS A;  4RMO A;  4ZNX A;  1KHI A;  2V1R A;  2L89 A;  4RTU A;  1UEB A;  2AMC A;  2JZ2 A;  2YUQ A;  3L2V A;  2EYX A;  3M0R A;  4MDW A;  1QVF P;  4PJO C;  4YRK A;  4XTW A;  3HFZ A;  2E5K A;  3EGU A;  1N5Z A;  2QGF B;  4BDZ A;  1G3Y A;  2QTV A;  1G3W A;  4X9C A;  5LJ3 d;  1JBM A;  5IXB A;  1YFS A;  2P84 A;  2JT4 A;  4Y92 A;  3OS0 A;  2QEX A;  3JB9 I;  1WXU A;  1NBE B;  4CC7 A;  2ZAE A;  1Q81 C;  2XD0 A;  1H3H A;  4H02 A;  3BJU A;  3H0H A;  1G3T A;  2EKH A;  2JS0 A;  4R0K A;  3SB2 A;  1WPY A;  1TWB A;  1KG1 A;  2ZNJ A;  4EX5 A;  2MPX C;  1Q81 R;  2QAZ A;  2EWN A;  1H4T A;  2W10 A;  5CKF A;  1YIJ T;  2QHV A;  2YUN A;  3CC2 T;  4F17 A;  3M4G A;  3LGL A;  4EO4 A;  4MML A;  4H2W A;  3LSQ A;  4AG1 C;  4H2Y A;  1TTH B;  3GNG A;  1IB8 A;  2OX7 A;  1M4Z A;  4L5G A;  3HL8 A;  3VS2 A;  2CSQ A;  2E3H A;  4J9B A;  1IXD A;  3L2Q A;  2AMC B;  1K8A U;  1B7Y B;  1M3C A;  3VJP A;  1VQP Q;  2ZPG B;  3G6E Q;  4LDX A;  3IAL A;  3NGP A;  4M77 C;  3CCQ A;  1L0W A;  2H3J A;  1FYN A;  3V8J A;  4FCY A;  1B76 A;  4LDW A;  2YT6 A;  2KQW A;  2J7I A;  1TOV A;  2YXY A;  2FPD A;  1LVK A;  1B7T A;  3VS1 A;  3H41 A;  3CME A;  4C8Q G;  2X9H A;  2D0Q B;  1TUD A;  3QJY A;  1SHG A;  5FRM A;  2LX9 A;  1HTT A;  5C0M A;  2DVJ A;  1I0C A;  1YI2 Q;  4YCU A;  3QJ6 A;  3VS0 A;  3KXT A;  4KGV B;  1KJW A;  4C8Q D;  2CP5 A;  2ZT7 A;  1T3S A;  1X27 A;  2R57 A;  1GGM A;  3WVD B;  2QDY B;  1JXO A;  5GAN d;  3CC4 Q;  4ZIB A;  2LCL A;  4CRI A;  4CC4 B;  1IRE B;  1Y7X A;  3CD6 T;  4OLF A;  3A8H B;  3EG1 A;  2EFI A;  1QVG S;  3QNE A;  5FU7 B;  4DEY A;  4IIO A;  2DVE A;  2K2M A;  3VS3 A;  3OYB A;  4E7J A;  2NLU A;  1K8A C;  4LDU A;  3P8T A;  1ZBJ A;  3QTC A;  3HRI A;  1VQ8 A;  2VB6 A;  3EG0 A;  1X55 A;  1YB3 A;  4DQ2 A;  2WSF E;  4HXJ A;  3LW5 E;  3CCR Q;  4O2D A;  1M2V A;  3I55 T;  2OTL Q;  3VBB A;  2DEQ A;  4KQE A;  3W3S A;  4RUG A;  1K8A R;  1BKB A;  2L3S A;  3FEO A;  1W1F A;  4M7A C;  1OYX A;  2Y4Y A;  2AZS A;  2RJD A;  4K88 A;  4EIK A;  4JLG A;  3JB9 J;  3VYG A;  1WFW A;  3QHS A;  3L1A A;  1BI0 A;  1Q82 U;  1SES A;  1K76 A;  4H2T A;  3REX A;  4RTV A;  1ABQ A;  2QAS A;  2EPD A;  1GCP A;  4JJC A;  5CKH A;  3CCJ Q;  1E1T A;  4LUE A;  1VQK T;  3HXZ A;  1I4K 1;  1GBQ A;  2ZT8 A;  5J39 A;  2LQW A;  2DKG A;  4C5G A;  3J81 E;  3OW2 P;  1V29 B;  1EFN A;  4C92 C;  4C8Q A;  1PRM C;  3V8K A;  3ERR A;  3EAE A;  1VQL Q;  4XTZ A;  3EFR A;  3HXV A;  4OB3 B;  2CP2 A;  1JB0 E;  4EPC A;  1T3L A;  1MMA A;  3OBY A;  1YJW A;  4YDQ A;  5GJW B;  3RBB B;  4J9D A;  1N27 A;  3EGX A;  3VQY A;  2DXU A;  4JRQ A;  4CH5 A;  1D1C A;  2K3Y A;  4P75 A;  3TUP A;  4FIB A;  4WF2 A;  4TQF A;  2DEU A;  3KUF A;  3CCL T;  4PJO E;  2HL5 C;  1SRM A;  1GFD A;  4H2S A;  3OD1 A;  2K5F A;  5KE2 A;  3CCE Q;  2JTM A;  1UHC A;  2D0N A;  4LVL A;  1X69 A;  4L87 A;  1Y0M A;  4YRM A;  3MP6 A;  1USY A;  1WXT A;  2RQV A;  3JCM d;  1Q82 C;  1MGQ A;  1OOT A;  3M0U A;  2DTH A;  1YP5 A;  2R5A A;  1BBU A;  4P3N A;  1G83 A;  2GFA A;  4N4H A;  2JS2 A;  2L2P A;  4OMM A;  3UF4 A;  1KMN A;  4TWA A;  4YRO A;  3IKL A;  1KC8 R;  4HCB A;  3CC7 Q;  2QA4 Q;  1VQZ A;  4A4K A;  4XEO A;  3L2R A;  1VQ4 Q;  3CCU T;  2L0A A;  2Q7E A;  3FLG A;  2DAQ A;  2D1X A;  1SSF A;  2KRO A;  3ZBD A;  1VQ7 Q;  3URG A;  5GMK l;  3M0Q A;  5CVI A;  5GAO n;  4IUU A;  4LD9 K;  1WHH A;  3NET A;  2G4C A;  4C8Q B;  4J8O A;  4BE0 A;  5K1P A;  3JCM b;  2A28 A;  1KMM A;  1H4V B;  2LVM A;  3P8B B;  4B6M A;  4Q5W A;  2OTJ Q;  1BK2 A;  3HRU A;  1X54 A;  2A0F B;  2EYZ A;  1EX4 A;  4PFP A;  3QO7 A;  2ZPF B;  1PC0 A;  1K73 U;  1YIJ A;  3EGX B;  1PCX A;  2E5Q A;  3OS5 A;  1NEG A;  4M77 E;  2LNH B;  3CC2 A;  3QWY A;  3UGT A;  2J3L A;  1E6G A;  2HQE A;  4VUB A;  1GCQ A;  1Z7M A;  2KE9 A;  2LT4 A;  1K0X A;  2BTT A;  3G71 A;  1B8A A;  2RO0 A;  2VC8 A;  4C0D C;  1LJO A;  3M58 A;  4JZ3 A;  1TU0 B;  2MMP A;  2QQR A;  2FO0 A;  4OMN A;  4IUR A;  4JJN K;  2G3R A;  4P74 C;  1KIK A;  2RMO A;  1U8R A;  2ARU A;  5GAO p;  2MK5 A;  1D0Z A;  3AT1 B;  1Z9Z A;  2YHT A;  3OSV A;  4HWO A;  1VA7 A;  4LE9 A;  3C95 A;  1IHW A;  3CMA T;  3ZFJ A;  3VQV A;  3C4S A;  4NCX A;  2XU8 A;  4TVY A;  1G51 A;  4XK8 E;  3RR6 A;  1UFF A;  4ELY C;  4PJN A;  2AKK A;  1RLQ C;  5LJ3 f;  3JCM W;  3ZEH A;  2L3R A;  4LUD A;  1H64 1;  5A0L A;  4OGE A;  1D0X A;  4YRE A;  4RQE A;  1H4S A;  4A54 A;  4C5H A;  1YFR A;  2DDZ A;  4YPF A;  4N4G A;  1X01 A;  1K73 C;  4A4G A;  4EMH A;  4DOV A;  4BE2 A;  3M54 A;  1SEM A;  1M5Q 1;  2M1H A;  4YRP A;  3QDF A;  5CKB A;  4RG8 A;  2XHC A;  2QEX T;  1Q86 U;  1ACM B;  2CH4 A;  4J15 A;  2ZIN A;  3SD4 A;  2PVO B;  3OY9 A;  3JCM c;  4M7A E;  3HHT B;  5KYU A;  1VQ5 Q;  2RNA A;  4FYV B;  2FG0 A;  5CR2 A;  3NPF A;  3PIP A;  2P0L A;  3QDR B;  4ZTJ A;  4YRC A;  4BY6 B;  3QBY A;  1W6X A;  2E1H A;  4NL3 A;  2RI5 A;  4PLI A;  5KH6 A;  3I55 A;  1BCM A;  1NEB A;  1TG0 A;  1RAF B;  3UAT A;  1GXI E;  1S1N A;  4M77 F;  1ZBX A;  2GFU A;  1V76 A;  3TRE A;  1AZG B;  3P8H A;  3RKW A;  2XDD A;  2GCX A;  1V1C A;  1R0C B;  2NUT A;  2P4T A;  2X3W D;  1YBY A;  2ZGW A;  2EBP A;  3DKM A;  1NE8 A;  1QMC A;  2DIG A;  4C92 E;  2OJ2 A;  3CCV A;  3OS1 A;  1HC7 A;  4QW2 A;  1WYD A;  1R77 A;  4JS4 A;  1B3Q A;  3VQW A;  2DM1 A;  2K9G A;  2ARS A;  2HBP A;  2KGT A;  3JCM e;  3A8O B;  1UGS B;  4J7F A;  2CZ6 B;  3ICA A;  1AD5 A;  1Q86 C;  4YRS A;  3RDV A;  3T9N A;  2RH2 A;  4CS4 A;  3A98 A;  4N4I A;  4PJJ A;  1VQN Q;  2HSE B;  4XAX B;  3NTH A;  4KUL A;  3CME T;  3PCO A;  3RGL A;  3VQX A;  3JCM X;  3GNF B;  2NWM A;  4HT4 A;  1VQM Q;  4PG3 A;  4HA8 A;  1G5I A;  3HY0 A;  1AWX A;  5GAO l;  1VQO Q;  4BI3 A;  2LCS A;  5KYU B;  1W2B A;  3BY7 A;  1WXB A;  2EAY A;  1ATI A;  4O5V A;  2COW A;  1ZX6 A;  4E7H A;  3H9N A;  3V7C A;  3M0P A;  1RAC B;  4IIM A;  3HTZ A;  4M7D E;  3OYM A;  3QUI A;  4BD3 A;  2EVR A;  1XQH A;  1TUC A;  2ZPB B;  1X6G A;  4F7U G;  2WSE E;  3QG1 A;  1YCS B;  4FT4 A;  3I56 Q;  4UP7 A;  2RK2 A;  1BIB A;  2CT4 A;  3DLL A;  2ART A;  2ZCE A;  2YWW A;  4FSX A;  1M3A A;  2DIQ A;  3M59 A;  1NJ5 A;  2DLP A;  1D1B A;  1OI1 A;  3D7S B;  4ZGJ B;  1PD1 A;  2NUT B;  4A53 A;  4OB2 B;  1YJN T;  2DD5 A;  4LD6 A;  4KBM B;  1VQ8 T;  3A7U A;  3QII A;  1EZZ B;  2JW4 A;  3JSC A;  2HL3 A;  2FPE A;  4JRP A;  4PHC A;  1NLO C;  1XNI A;  4MZT A;  2RB6 A;  2CP3 A;  1U1T A;  1YI2 A;  3J80 E;  3SWN A;  5GAO m;  5C53 B;  2ZTG A;  2DMO A;  3M57 A;  4RTZ A;  3M4Y A;  3FIF A;  1K9M R;  4Z89 A;  2I4L A;  5CAI A;  3JCM J;  1O75 A;  1TSF A;  4JZ4 A;  5HCK A;  4J83 A;  1W70 A;  1QLY A;  3PCO B;  2RD1 A;  4AT1 B;  8AT1 B;  4DBR A;  2YUO A;  2KR3 A;  3QO5 A;  2RHU A;  1IRX A;  1YCY A;  2XKO C;  3E19 A;  3ULR B;  6AT1 B;  1RL2 A;  2CH4 W;  1NYR A;  2J06 A;  4DEX A;  3MP8 A;  2LTO A;  3CXC A;  4GBQ A;  2C06 A;  2XDB A;  4E7K A;  4P5N A;  4GLM A;  4KGZ B;  1VQ9 Q;  3VKI A;  2GBQ A;  1NJI R;  1JJ2 P;  2LJ0 A;  2DER A;  3TSZ A;  2PMF A;  2HQX A;  2LCC A;  3FB9 A;  2ED0 A;  4P75 C;  3CPW S;  5K1X A;  4N0A A;  3E1S A;  4C5E A;  2FYK A;  4FYY B;  4JJB A;  5GAM g;  1YJW T;  2DQ3 A;  3NEM A;  3WQZ A;  1TS9 A;  4RDX A;  4M7D F;  3JCM f;  3CMA A;  2D9T A;  2QXF A;  2AKW A;  1XTD A;  1ZUY A;  2CZ7 B;  3HP9 A;  4F7U A;  2A37 A;  4YYE A;  3PMT A;  1EFW A;  4WJ3 M;  3SWN B;  2EL9 A;  1FX7 A;  3H6Z A;  1ZSZ A;  2K57 A;  2KY9 A;  2CP7 A;  2HSP A;  3QZ9 B;  2ENM A;  1WDX A;  1OX8 A;  1EQR A;  2M02 A;  2X3X D;  3CD6 Q;  3DLM A;  1RI0 A;  5GAM e;  4LVK A;  4J9F A;  4HKE A;  1AWW A;  1YHQ Q;  1GL5 A;  2ZT5 A;  2NUP A;  3THK A;  5DM7 R;  2CDT A;  5GMK h;  1YN8 A;  2EQK A;  1YNZ A;  4P71 C;  4J6Y A;  3S3N A;  3CCS Q;  2HKN A;  3CBM A;  4UP9 A;  3LYI A;  3E9H A;  1AVZ C;  2DXT A;  4BB7 A;  4P3P A;  5GAM h;  4LVM A;  2I4O A;  1X6B A;  3CEY A;  4M75 G;  4AMC A;  5CCA A;  2LC4 A;  2DRK A;  2RJF A;  2Q5I A;  2EYW A;  1GCQ C;  3FC3 A;  3ZL7 C;  1N8R U;  1G5V A;  3QWX X;  3CCM T;  4BI8 B;  1M8M A;  3VS4 A;  5DLO A;  1YFT A;  2JVV A;  1BI1 A;  2CGH A;  2RHY A;  4M75 D;  4BY6 C;  2M0Y A;  3EFO A;  1M90 R;  4OVA A;  2DJZ A;  3E2U A;  4P73 A;  1QCO A;  3TQ7 P;  2AKW B;  2F2V A;  2KEA A;  4F7U B;  1QKX A;  2ODR D;  3A32 A;  3GBQ A;  3G4S T;  3G71 T;  1ZSZ B;  5J26 A;  2CRE A;  2RHS B;  1NPR A;  5KYY A;  3LWH A;  1I5L A;  5CQY A;  3FDR A;  4EDU A;  2OI3 A;  4FYX B;  2PZ1 A;  4A63 B;  5IN1 A;  3VS6 A;  2JM9 A;  5LJ5 j;  2GGR A;  2H8H A;  3ME9 A;  2YRD A;  1KQS S;  3HFZ B;  2F2W A;  2JM8 A;  2O4X A;  2HD0 A;  4DA4 A;  4Z88 A;  2RQW A;  3HRT A;  3G1Z A;  3CCL Q;  3P8V A;  1SRL A;  1LYL A;  3OYD A;  4RTX A;  5EC7 A;  1S72 T;  2F2X A;  2DYI A;  1PWT A;  4Q15 A;  3L4G A;  1U5S A;  1UB4 A;  1N8R C;  3MEA A;  2RJC A;  4KR2 A;  3JAM E; 
#chains in the Genus database with same CATH homology
 4J5Y A;  4C0Z A;  4CH4 A;  2K3X A;  1WJS A;  4BDY A;  2DZ9 A;  3G7Z A;  1NJ8 A;  2FL7 A;  4YRG A;  3MET A;  2PUK B;  11AS A;  3PMI A;  3OYC A;  4M75 A;  4MMK A;  5LJ3 j;  2RHI A;  1YJN A;  2XI9 A;  3TEH A;  4TTV A;  3CMQ A;  4G84 A;  2P0Q A;  4YRI A;  2ZT6 A;  2RA2 A;  2ALY A;  1JJC A;  4C8Q E;  2O4X B;  4RMF A;  5C6S A;  2DXC A;  2OAU A;  3FRN A;  3HXX A;  3JCM V;  1KC8 U;  3RKX A;  2EQJ A;  2E65 A;  2C8M A;  3OYJ A;  3CCV T;  3MHX A;  4ZTF A;  5CQX A;  1WGS A;  4R55 A;  3RUX A;  4EMK A;  1QVP A;  4FL6 A;  2RI3 A;  1WLE A;  4UP8 A;  4YRF A;  3UFG A;  5CKD A;  4BW9 A;  4M75 F;  1YIT A;  3EFS A;  1O9S A;  3CPW A;  3OSS C;  1W2B S;  4PJO D;  1NYQ A;  4M75 B;  2FB7 A;  2ZCF B;  5EG2 A;  3OYL A;  2QHS A;  2VYT A;  4JUV A;  4HT8 A;  3JCM P;  5CIU A;  3Q1J A;  3LGF A;  3CPF A;  5CKE A;  2E6N A;  3TEH B;  3M5A A;  1D3B A;  2Y90 A;  1VQP T;  3G6E T;  1PYS A;  3PNW C;  2ALY B;  4YP0 A;  1JJC B;  4LVI A;  2V8K A;  3NEN A;  1R8O B;  1KC8 C;  1NPP A;  5FU6 C;  3NTI A;  4PL6 A;  4M7D C;  5GAN j;  2F69 A;  2XDP A;  1NNH A;  3C12 A;  3F70 A;  1M9S A;  2DXB A;  1VQO A;  2DD4 A;  4EMK B;  5A0D A;  1YI2 T;  3OBW A;  1KHC A;  2XK0 A;  4C8Q F;  2CYZ B;  1X75 C;  1E24 A;  1EVL A;  4O6J A;  4KUI A;  4LVJ A;  1TH7 A;  3X24 B;  1M8V A;  1SET A;  4YRR A;  1NZ9 A;  3H8Z A;  3JB9 H;  4V2S A;  4OF1 A;  2XG8 D;  4XU3 A;  3CXC S;  4XTU A;  5GAN 3;  3DSQ A;  3CCM A;  1FYF A;  3DB3 A;  4IUP A;  4PJO A;  1FWZ A;  4M78 G;  2K5L A;  2C7I A;  3TCJ A;  3UWN A;  3RL6 A;  1PYS B;  3G4S A;  3HFN A;  4WJ4 A;  3LLR A;  4TVA A;  2P0P A;  4M78 D;  2K5I A;  3S3O A;  4P72 A;  4ZGD B;  3LC0 A;  1KQS A;  2Q5H A;  2KVQ G;  2X4X A;  2BIV A;  3MQZ A;  1VIF A;  4B9X A;  4MZP A;  2E70 A;  2CJA A;  2M16 A;  3CCJ T;  3JRZ A;  5GAN 5;  1S72 A;  2QTX A;  1QVF S;  2X4Y A;  3UH0 A;  3JB9 G;  3WXM B;  3OYY A;  2X35 A;  2RK1 A;  1X2H A;  3HXW A;  3LH0 A;  5KCH A;  1X56 A;  2DTI A;  1OZ3 A;  2A3L A;  3BW1 A;  3JB9 D;  1B70 A;  2LQK A;  2KMT A;  3MEY A;  1Y96 A;  2EYQ A;  4QVD A;  5FU7 C;  4TVA B;  1N9R A;  5CK9 A;  3MF1 A;  2ZZF A;  4YRJ A;  1Z7N A;  1PSF A;  3OYK A;  4X34 A;  1YHQ A;  1KQ2 A;  5GAM d;  4C92 D;  4M78 A;  3JCM Q;  1WJQ A;  3A31 A;  2QA4 T;  3A7R A;  4CH6 A;  1G5H A;  2EJG A;  4XTY A;  3RIR A;  3X20 B;  4OGC A;  3MF2 A;  2DK3 A;  4E47 A;  1K9M U;  2M9U A;  4IUT A;  2JNG A;  4A4E A;  1BI2 A;  4XU0 A;  1B70 B;  3ER0 A;  3HPW A;  4FU6 A;  3PT9 A;  1Y96 B;  4HCZ A;  3M53 A;  1NJI U;  4CS3 A;  4BWA A;  4QVZ A;  4M75 C;  1JRI A;  4M78 F;  5HGQ A;  1VQP A;  3G6E A;  3E9I A;  2P5I A;  4OP0 A;  1C0A A;  2EJF A;  4M78 B;  2QQ9 A;  3LSS A;  2ZPE B;  4BUG A;  4C92 A;  5LL6 S;  1EVK A;  2MI6 A;  1WJR A;  2LDM A;  4RQF A;  1N9W A;  1K9M C;  4BI4 A;  5IAY A;  3OYN A;  1AHJ B;  4G85 A;  4IKF A;  2RI2 A;  3KBG A;  4RCB A;  2L8D A;  4EMK C;  2E3C A;  2F5T X;  2ZZG A;  2RHQ A;  3CC4 A;  2E64 A;  3OYG A;  4HVC A;  1NJI C;  2J3M A;  4YRQ A;  3R07 A;  4C8Q C;  3UPU A;  2MWP A;  4F7U E;  1VQ5 T;  4R56 A;  4K87 A;  2ZIO A;  3MEW A;  5AYF A;  3OW2 S;  4UPA A;  1M1F A;  12AS A;  4NS5 A;  3M55 A;  3CCR A;  2E10 A;  2YLB A;  4HWT A;  2OTL A;  4JS5 A;  1YIT T;  4OMF B;  2EKO A;  4ZTZ B;  4KUD K;  1QP3 A;  4C0F A;  1M90 U;  4XTV A;  2I2L A;  1QW1 A;  2ZPH B;  3FJP A;  3UGQ A;  3HXU A;  2LNV A;  1USY C;  3HSB A;  5GMK e;  4A4H A;  5A2Q E;  3INZ A;  3VU3 C;  4C5I A;  5F5W A;  3CCJ A;  4TQD A;  3RMQ A;  1QF6 A;  2LRQ A;  2XID A;  3P8Y A;  4TVW A;  2RHQ B;  1QVF A;  1ADJ A;  2KK4 A;  1NJ6 A;  3HFO A;  4OB0 B;  1VQM T;  1VQL A;  1VQO T;  2IG0 A;  2CJB A;  2YLC A;  4UC4 A;  3A5Z A;  2DPP B;  1B7Y A;  2IY5 A;  4A4F A;  4EMG A;  1WNL A;  4XEM A;  4XQ3 A;  3O8V A;  1BI3 A;  3V7S A;  1BIA A;  4Y91 A;  3L2Z A;  3I56 T;  1M90 C;  3CCE A;  2IVW A;  1N9S A;  4NOY A;  5GAN 8;  3CBP A;  4F7U F;  1VQ6 A;  4GY5 A;  5D6W A;  4X5O A;  3L2W A;  2ZNI A;  3X25 B;  4P72 C;  1DJ7 B;  4BAC A;  3CC7 A;  2QA4 A;  3NFC A;  3TEE A;  1VQ4 A;  2A8E A;  3QO3 A;  3I7F A;  2DZC A;  3AHU A;  4C0D B;  2VV5 A;  1ZQ1 A;  1VQ7 A;  4OB1 B;  4DPG A;  5KCO A;  2X4J A;  3V7R A;  4K86 A;  2QHT A;  3V8L A;  1WQW A;  2OTJ A;  2O01 E;  3KFU A;  3A5Z B;  4HWP A;  4M75 E;  4KR3 A;  2QI2 A;  2IY5 B;  2GQV A;  2LT1 A;  3OYE A;  2EJ9 A;  1VQ9 T;  2F5K A;  1G3S A;  1KD1 U;  3TU4 K;  4QQG A;  2Y4X A;  3VV0 A;  3L42 A;  2Q7H A;  3R6O A;  4PLL A;  5GAO r;  2VXF A;  3BDL A;  5ELO A;  1RIQ A;  3NTK A;  2YRV A;  3QYG B;  4YTL A;  3X26 B;  5GAM f;  3GPL A;  5LJ5 g;  2VXE A;  4X9D A;  3BDU A;  2VGM A;  4M78 C;  5I21 A;  4FM4 B;  5FRO A;  1WU7 A;  1I81 A;  4Q6G A;  4HCC A;  3L2U A;  1EIF A;  4IUV A;  2WAC A;  1YHQ T;  4LDY A;  3OMC A;  4MDX A;  1FXX A;  4YRN A;  5ELN A;  5LJ5 e;  5HKC A;  5GAN 4;  3CCS T;  4YCV A;  3VYH B;  1Q7Y U;  1KD1 C;  2B8A A;  3VUZ A;  3L4G B;  4E7L A;  3OQ5 A;  3OYF A;  2V8J A;  1VQ5 A;  1XOV A;  3REU A;  3RES A;  4XTX A;  4PJO G;  3MO8 A;  4L6V 5;  1H4Q A;  3OW2 A;  3MCA B;  4WI1 A;  5LJ5 h;  3HFV A;  2QQS A;  3M9Q A;  1N6A A;  5LJ3 g;  3OB9 A;  1QP2 A;  2VGN A;  1M1K U;  3OYH A;  3HRS A;  4YRL A;  2FVU A;  2R5M A;  3A8L B;  3OA6 A;  3M4P A;  2M0O A;  2CJ9 A;  4MZM A;  2AHJ B;  5LJ3 e;  1UGQ B;  4P3O A;  3VUB A;  2KAF A;  2XIC A;  5D6Y A;  1Q7Y C;  3QKJ A;  3SWN C;  1HXD A;  2PUO B;  4QVC A;  1VQN A;  2DO3 A;  5LJ3 h;  1VQM A;  1SRY A;  4M77 G;  3RAC A;  2QQA A;  1I8F A;  1X6O A;  4ME7 A;  2QHU A;  4NL2 A;  2JOY A;  3LWI A;  1M1K C;  3IG2 A;  3CC4 T;  4M77 D;  1U1S A;  1YJ9 T;  2RM4 A;  2X4W A;  2P0K A;  3I56 A;  3RF1 A;  3IKM B;  4JDS A;  1LNX A;  3A74 A;  4N0A C;  2LQ8 A;  1JJ2 S;  1D3B B;  1PSE A;  4XU2 A;  5IT9 E;  2CS7 A;  4P71 A;  4FT2 A;  3OMG A;  3CCR T;  4AH6 A;  3OS2 A;  5GAN g;  2OTL T;  2NS6 A;  1HK9 A;  1W66 A;  5LJ5 f;  2EQM A;  4H2V A;  2GF7 A;  3A8G B;  1E1O A;  1IZ6 A;  3CBO A;  4B9W A;  2QQB A;  5E3I A;  5HK0 A;  4H2X A;  1UGR B;  2V8I A;  1ZHI A;  2JUF A;  1NJ1 A;  4RCC A;  3HXY A;  2ZR2 A;  2R58 A;  3QPH A;  3PGG A;  5GAN e;  2KDS A;  4CI0 C;  3UT1 A;  4ZN3 A;  1BYM A;  4TVR A;  4M7A G;  2WSC E;  3QO8 A;  4YRT A;  4D6W A;  5KE3 A;  3HRK A;  1J5W A;  1VQ9 A;  3GIB A;  3N5B B;  3M56 A;  4PKC C;  2VUB A;  3P8D A;  5GMK m;  5HY6 A;  5DLQ E;  3PZC A;  4PJO F;  2FHD A;  2RJE A;  4M7A D;  1VQL T;  5GAN h;  4M78 E;  4M77 A;  3SFM A;  2I4M A;  2PVG B;  4YCW A;  4PJO B;  4JLI A;  5M9O A;  3RER A;  2CZ0 B;  5C51 B;  5FRN A;  1Y71 A;  4CS2 A;  4HWS A;  5I2S A;  2KSS A;  1WQ7 A;  4C92 G;  5GAN 6;  2BKD N;  1EIY A;  5KNN A;  4P73 C;  2A7Y A;  3CCE T;  1VUB A;  3GF5 A;  2ZIM A;  1P92 A;  4HWR A;  2ZR3 A;  3GOX A;  3CD6 A;  4ZN1 A;  1VQ6 T;  4RG2 A;  4QQD A;  2RHZ A;  2E12 A;  2DTO A;  1QVG A;  4H2X B;  1QE0 A;  5GMK i;  4LNS A;  3TEG A;  2MF2 A;  2PU9 B;  4GLK A;  3ASK A;  2I4N A;  2PVD B;  2ZZD A;  1ASY A;  1UGP B;  3CC7 T;  3CCS A;  2EIF A;  1VIE A;  4JRK A;  2E5A A;  1VQ4 T;  2JN0 A;  3NEL A;  2BUD A;  1NJ2 A;  3GLX A;  5DY9 A;  1VQ7 T;  3JCM g;  4M7D G;  3S3M A;  2ZZE A;  3M4Q A;  1EOV A;  3GP8 A;  2XTI A;  4M77 B;  2OTJ T;  1KQ1 A;  5GAN 7;  2RHX A;  2HAX A;  2PQW A;  1X2G A;  4M7A A;  2EQU A;  4Z02 A;  4M7D D;  1KOG A;  3CCQ T;  5D6X A;  3S6W A;  4ELZ C;  1VQK A;  4Y28 E;  3PTA A;  3DB4 A;  1EIY B;  4J6X A;  1BBW A;  1H3Z A;  2CZ1 B;  2ZXF A;  3A7A A;  2MWO A;  2DU5 A;  3A5Y A;  5GAN f;  4LDV A;  2ODR C;  3RMS A;  4PNO A;  3MEU A;  5L8R E;  1LOJ A;  3JCM h;  2HNI A;  4E7I A;  1MHN A;  2E41 A;  3PIO A;  3HY1 A;  1B34 A;  2D6F A;  2ZPI B;  3CCL A;  5C52 B;  4DOW A;  3A8M B;  2CIM A;  4J7I A;  3QZ5 B;  3SDZ A;  5FLX E;  1SER A;  3E9G A;  3MEV A;  4RKU E;  4M7A F;  4BE1 A;  2L5Q A;  4H2U A;  5GMK j;  5HK3 A;  2DU7 A;  3PFS A;  4ZGE B;  4CH3 A;  4M7A B;  3WVE B;  3JB9 F;  4E51 A;  1M1G A;  5GAO q;  1E22 A;  2Q7G A;  1YJ9 A;  5GAM j;  3OYA A;  2K2V A;  5CO7 A;  1ASZ A;  4ZTU B;  3CCU A;  4M7D A;  4L59 A;  4KT0 E;  3BFM A;  2K4Y A;  3C94 A;  5I2M A;  3E9F A;  3OYI A;  1JJ2 A;  3HKS A;  3X28 B;  2XGT A;  4QQ6 A;  4C0G A;  2DQ0 A;  4C92 F;  4JRI A;  3QXE B;  4HT9 A;  1ADY A;  5A0G A;  4C92 B;  5GAN 2;  1B34 B;  1YGB A;  2CKK A;  2E6Z A;  4XU1 A;  5LJ5 d;  4IUQ A;  1IL2 A;  3QYH B;  1Q81 U;  3UDC A;  3J7A F;  3LX7 A;  2MAM A;  5J3B A;  1OZ2 A;  1Y07 A;  3RKY A;  4J6W A;  2PME A;  3MP1 A;  1VQN T;  4II1 A;  1W4S A;  4ATO A;  2JTF A;  5FU6 B;  4P74 A;  3QSU A;  4M7D B;  2RHS A;  4RMO A;  1KHI A;  2L89 A;  1UEB A;  2AMC A;  2JZ2 A;  3L2V A;  4MDW A;  4PJO C;  4YRK A;  4XTW A;  3HFZ A;  4BDZ A;  1G3Y A;  1G3W A;  4X9C A;  5LJ3 d;  1JBM A;  1YFS A;  3OS0 A;  2QEX A;  3JB9 I;  1Q81 C;  2XD0 A;  4H02 A;  3BJU A;  1G3T A;  3SB2 A;  1WPY A;  1KG1 A;  2ZNJ A;  4EX5 A;  2EWN A;  1H4T A;  5CKF A;  1YIJ T;  2QHV A;  3CC2 T;  3M4G A;  3LGL A;  4EO4 A;  4MML A;  4H2W A;  3LSQ A;  4H2Y A;  3GNG A;  1M4Z A;  4L5G A;  3HL8 A;  3L2Q A;  2AMC B;  1K8A U;  1B7Y B;  3VJP A;  4LDX A;  2ZPG B;  3IAL A;  3CCQ A;  4M77 C;  1L0W A;  2H3J A;  3V8J A;  1B76 A;  4LDW A;  2KQW A;  3CME A;  4C8Q G;  2D0Q B;  3QJY A;  5FRM A;  2LX9 A;  1HTT A;  5C0M A;  4YCU A;  3QJ6 A;  3KXT A;  4C8Q D;  2ZT7 A;  2R57 A;  1GGM A;  3WVD B;  2QDY B;  5GAN d;  4ZIB A;  2LCL A;  4CRI A;  1IRE B;  1Y7X A;  3CD6 T;  4OLF A;  3A8H B;  2EFI A;  1QVG S;  3QNE A;  5FU7 B;  2DVE A;  3OYB A;  4E7J A;  2NLU A;  1K8A C;  4LDU A;  3P8T A;  3QTC A;  3HRI A;  1VQ8 A;  1X55 A;  1YB3 A;  4DQ2 A;  2WSF E;  4O2D A;  3LW5 E;  3I55 T;  3VBB A;  2DEQ A;  4KQE A;  3W3S A;  1BKB A;  3FEO A;  4M7A C;  1OYX A;  2Y4Y A;  2RJD A;  4K88 A;  4JLG A;  3JB9 J;  3VYG A;  3QHS A;  3L1A A;  1BI0 A;  1Q82 U;  1SES A;  4H2T A;  3REX A;  5CKH A;  1E1T A;  1VQK T;  3HXZ A;  1I4K 1;  2ZT8 A;  5J39 A;  2DKG A;  4C5G A;  3J81 E;  1V29 B;  4C92 C;  4C8Q A;  3V8K A;  3ERR A;  3EAE A;  4XTZ A;  3EFR A;  3HXV A;  4OB3 B;  1JB0 E;  4EPC A;  3OBY A;  1YJW A;  4YDQ A;  1N27 A;  3VQY A;  2DXU A;  4JRQ A;  4CH5 A;  2K3Y A;  4P75 A;  3TUP A;  4FIB A;  4WF2 A;  4TQF A;  3KUF A;  3CCL T;  4PJO E;  4H2S A;  3OD1 A;  2K5F A;  5KE2 A;  2JTM A;  4LVL A;  4L87 A;  4YRM A;  3MP6 A;  1USY A;  3JCM d;  1Q82 C;  1MGQ A;  4P3N A;  2DTH A;  2R5A A;  1BBU A;  2GFA A;  4N4H A;  1KMN A;  4TWA A;  4YRO A;  3IKL A;  4HCB A;  1VQZ A;  4A4K A;  4XEO A;  3L2R A;  3CCU T;  2Q7E A;  3FLG A;  2DAQ A;  1SSF A;  3ZBD A;  3URG A;  5GMK l;  5CVI A;  5GAO n;  4IUU A;  4LD9 K;  3NET A;  2G4C A;  4C8Q B;  4J8O A;  4BE0 A;  5K1P A;  3JCM b;  1KMM A;  1H4V B;  2LVM A;  3P8B B;  4Q5W A;  3HRU A;  1X54 A;  3QO7 A;  2ZPF B;  1K73 U;  1YIJ A;  2E5Q A;  3OS5 A;  4M77 E;  3CC2 A;  3UGT A;  2J3L A;  2HQE A;  4VUB A;  1Z7M A;  2LT4 A;  3G71 A;  1B8A A;  2VC8 A;  2RO0 A;  4C0D C;  1LJO A;  3M58 A;  2MMP A;  2QQR A;  4IUR A;  4JJN K;  2G3R A;  4P74 C;  1U8R A;  2ARU A;  5GAO p;  2YHT A;  3OSV A;  4HWO A;  3C95 A;  3CMA T;  3ZFJ A;  3VQV A;  3C4S A;  4NCX A;  2XU8 A;  4TVY A;  1G51 A;  4XK8 E;  4ELY C;  5LJ3 f;  3JCM W;  3ZEH A;  2L3R A;  1H64 1;  5A0L A;  4OGE A;  4YRE A;  4RQE A;  1H4S A;  4A54 A;  4C5H A;  1YFR A;  2DDZ A;  4YPF A;  4N4G A;  1X01 A;  1K73 C;  4A4G A;  4EMH A;  4DOV A;  4BE2 A;  3M54 A;  2M1H A;  1M5Q 1;  4YRP A;  5CKB A;  4RG8 A;  2XHC A;  2QEX T;  1Q86 U;  4J15 A;  2ZIN A;  3SD4 A;  2PVO B;  3OY9 A;  3JCM c;  4M7A E;  3HHT B;  5CR2 A;  3PIP A;  2P0L A;  3QDR B;  4ZTJ A;  4YRC A;  4BY6 B;  3QBY A;  2E1H A;  4NL3 A;  2RI5 A;  4PLI A;  5KH6 A;  3I55 A;  1GXI E;  4M77 F;  1ZBX A;  2GFU A;  3TRE A;  3P8H A;  3RKW A;  2XDD A;  2GCX A;  2P4T A;  1YBY A;  2ZGW A;  3DKM A;  4C92 E;  1NE8 A;  3CCV A;  2DIG A;  3OS1 A;  1HC7 A;  4QW2 A;  1WYD A;  4JS4 A;  3VQW A;  2ARS A;  2HBP A;  3JCM e;  3A8O B;  1UGS B;  4J7F A;  2CZ6 B;  3ICA A;  1Q86 C;  4YRS A;  3T9N A;  2RH2 A;  4CS4 A;  4N4I A;  4XAX B;  3RGL A;  3NTH A;  4KUL A;  3CME T;  3PCO A;  3VQX A;  3JCM X;  3GNF B;  4HT4 A;  4PG3 A;  4HA8 A;  1G5I A;  3HY0 A;  5GAO l;  4BI3 A;  1W2B A;  3BY7 A;  2EAY A;  1ATI A;  4O5V A;  4E7H A;  3V7C A;  3HTZ A;  4M7D E;  3OYM A;  3QUI A;  4BD3 A;  1XQH A;  2ZPB B;  4F7U G;  2WSE E;  3QG1 A;  4FT4 A;  4UP7 A;  2RK2 A;  1BIB A;  3DLL A;  2ART A;  2ZCE A;  4FSX A;  2DIQ A;  3M59 A;  1NJ5 A;  1OI1 A;  4ZGJ B;  4A53 A;  4OB2 B;  1YJN T;  2DD5 A;  4LD6 A;  4KBM B;  1VQ8 T;  3A7U A;  3QII A;  3JSC A;  4JRP A;  4PHC A;  1XNI A;  4MZT A;  2RB6 A;  1U1T A;  1YI2 A;  3J80 E;  3SWN A;  5GAO m;  5C53 B;  2ZTG A;  3M57 A;  3M4Y A;  3FIF A;  2I4L A;  5CAI A;  3JCM J;  1O75 A;  4J83 A;  3PCO B;  2RD1 A;  3QO5 A;  2RHU A;  1YCY A;  2XKO C;  3E19 A;  1RL2 A;  1NYR A;  3MP8 A;  2LTO A;  3CXC A;  2XDB A;  2C06 A;  4E7K A;  4P5N A;  3VKI A;  2PMF A;  2HQX A;  2LCC A;  3FB9 A;  4P75 C;  3CPW S;  5K1X A;  4N0A A;  3E1S A;  4C5E A;  2FYK A;  5GAM g;  1YJW T;  2DQ3 A;  3NEM A;  3WQZ A;  4RDX A;  4M7D F;  3JCM f;  3CMA A;  2D9T A;  2QXF A;  2AKW A;  1XTD A;  3HP9 A;  2CZ7 B;  4F7U A;  4YYE A;  3PMT A;  1EFW A;  4WJ3 M;  3SWN B;  2EL9 A;  1FX7 A;  3H6Z A;  2K57 A;  2KY9 A;  3QZ9 B;  1EQR A;  3DLM A;  1RI0 A;  5GAM e;  4LVK A;  4HKE A;  2ZT5 A;  5DM7 R;  5GMK h;  2EQK A;  4P71 C;  4J6Y A;  3S3N A;  3CBM A;  4UP9 A;  3LYI A;  3E9H A;  2DXT A;  4BB7 A;  4P3P A;  5GAM h;  4LVM A;  2I4O A;  3CEY A;  4M75 G;  5CCA A;  2LC4 A;  2RJF A;  2Q5I A;  3FC3 A;  1N8R U;  1G5V A;  3CCM T;  4BI8 B;  5DLO A;  1YFT A;  2JVV A;  1BI1 A;  2CGH A;  2RHY A;  4M75 D;  4BY6 C;  4OVA A;  2DJZ A;  4P73 A;  2AKW B;  4F7U B;  2ODR D;  3A32 A;  3G4S T;  3G71 T;  2RHS B;  5J26 A;  1NPR A;  3LWH A;  1I5L A;  5CQY A;  3FDR A;  4EDU A;  5IN1 A;  5LJ5 j;  3ME9 A;  1KQS S;  3HFZ B;  2O4X A;  2HD0 A;  4DA4 A;  3HRT A;  3G1Z A;  3P8V A;  1LYL A;  3OYD A;  1S72 T;  4Q15 A;  3L4G A;  1UB4 A;  1N8R C;  3MEA A;  2RJC A;  4KR2 A;  3JAM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...