4XU3A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 92
structure length 263
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu3A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu3A01
3QO3A 5GAOm 4CS2A 3L1AA 1USYA 4F7UB 4PJOD 2RHQB 3DSQA 2ARUA 5E3IA 5GMKe 2E3CA 4F7UE 3A7AA 3QSUA 4M77E 1KMNA 4KQEA 5GAN3 1B70B 1Y96A 1C0AA 3QO7A 2ZR2A 2FYKA 2AKWA 3RUXA 4BW9A 2RHQA 4YP0A 3PZCA 4M7DE 4PHCA 1HXDA 3HRKA 4XU0A 4M78C 2CJAA 2HNIA 4C8QA 4H2UA 3VU3C 3HXZA 3JB9J 1B70A 3W3SA 4M77G 3TEHA 3G1ZA 4X5OA 1NNHA 1BBUA 4ZTUB 4A54A 4YCUA 4C92B 4M78B 4C8QB 4YRSA 3JCMQ 4PJOC 1J5WA 2ZINA 2DDZA 4F7UA 4XTYA 4WF2A 1X2GA 2AKWB 2RM4A 4M78E 4M7DD 5GMKl 3UGQA 2DQ0A 2EJGA 12ASA 4TVAA 3AHUA 3IKMB 3LSQA 1Z7MA 3HXYA 1KOGA 2VXEA 2Q5HA 4C92D 1JBMA 4XU2A 3JCMb 1KQ2A 3TEGA 1N9RA 5GMKi 2ZNIA 2DQ3A 5K1XA 1SRYA 5LJ3j 5LJ5e 4OP0A 5C52B 1HTTA 1KQ1A 3RKYA 5GAN4 4C8QF 4M78F 3BJUA 1W66A 3BDUA 1SESA 2J3MA 3P8VA 2DTHA 1NJ1A 4C92A 3NELA 1YFRA 5LJ3h 1MGQA 1PYSA 1G51A 4JRIA 3HXXA 2PMEA 4JUVA 1H641 5KNNA 3RIRA 2ZGWA 4P3NA 1X01A 4X9CA 5GANg 1H4TA 5K1PA 3RESA 5LJ5j 5LJ3e 1X54A 1Y96B 4HWOA 3KFUA 4PJOA 2Q5IA 5ELOA 4P75C 3JB9G 3A5ZA 3HY0A 4QVDA 2ZIMA 5LJ5h 5GAN7 1LOJA 4F7UF 5GAN6 4M77F 3JB9D 1G5IA 4V2SA 4RDXA 2XGTA 1D3BA 4M75G 4EMKB 1NJ8A 4C92E 4NCXA 2IY5B 4M7DF 4H2WA 3FB9A 5F5WA 2JN0A 1WQ7A 4J6YA 1SETA 3EFRA 4M78A 4M75B 1RIQA 5GANe 3INZA 2DU5A 4CH4A 3JCMV 3IG2A 2DU7A 4NOYA 1ASZA 3JCMh 4P75A 1EVLA 2Q7GA 5HGQA 2ODRC 3IALA 2DJZA 3A7UA 5GANh 5C51B 1X56A 4Y91A 3NENA 4M7DA 1EIYA 2QHUA 4TWAA 3IKLA 4DPGA 4Q15A 2Q7HA 4RCCA 5GANf 2QHVA 1E1TA 3NETA 3CMQA 2E41A 4P3OA 4P74A 4TQFA 3SWNC 3FJPA 3JCMW 2I4NA 4YRMA 3QHSA 4J6XA 11ASA 4EMHA 4RQEA 4PJOF 4YRCA 2XTIA 5GAMe 1LNXA 3HSBA 3TEHB 1NJ5A 2I4OA 5GAMj 3HRIA 3V7CA 3A7RA 4NL2A 1HK9A 4YRKA 4YRPA 2ZCEA 2FB7A 4J6WA 5LJ3f 3BW1A 3RERA 2EL9A 1BBWA 3GIBA 5GAMh 3REXA 3HTZA 2ZZFA 2C7IA 1QE0A 4K87A 2DKGA 4H2TA 3A5YA 1X55A 4WI1A 4XEMA 5GAMd 1U1TA 2QHSA 4M7AA 4YROA 4M75E 1M8VA 3QO8A 1D3BB 3L4GB 4HT8A 3E9HA 3P8YA 4C8QE 4TVYA 4NL3A 4ZTZB 1JJCB 3HFVA 4UPAA 4YRTA 4BWAA 1QF6A 4H2YA 4TQDA 3UFGA 4C92F 2CGHA 4XTZA 5GAOr 3UGTA 3RKXA 1B34B 2E10A 4YCVA 2DZ9A 4YRQA 4H02A 2DXTA 3HFOA 5GANd 4XU1A 4M7AG 3HY1A 1WLEA 2CJ9A 2J3LA 1YFTA 4TVWA 4E51A 3V7RA 4C8QD 2QHTA 3LSSA 1ATIA 3L2ZA 4M7AB 2DVEA 1IL2A 4EMKC 4MMKA 2CJBA 2ZXFA 2ODRD 1HC7A 3HXUA 4RQFA 2EWNA 3OD1A 2RD1A 1GGMA 4EO4A 3ICAA 4CS4A 1EQRA 4H2XB 2I4MA 4AH6A 3VQXA 5GAN5 1LJOA 2ZR3A 1B34A 1KMMA 2RHSA 2K57A 1EVKA 4C8QC 4JRKA 2ALYB 4XTVA 1B7YA 3JCMJ 1NYRA 3UH0A 1U1SA 3SWNB 1BIBA 5CAIA 3R07A 5GAMf 4QVCA 4XEOA 1YCYA 4M75C 1M5Q1 4HWRA 2VXFA 2ALYA 4J15A 4YRNA 4K86A 2Q7EA 5ELNA 3E9IA 4H2VA 4M75D 5GANj 4G85A 2E65A 3RACA 3RF1A 1Z7NA 2ZTGA 3QNEA 5I21A 4C8QG 4YRGA 2ZT5A 4XQ3A 3QTCA 3EFSA 4YRJA 3HFZA 3RGLA 4G84A 2E64A 4M77C 4KR2A 1NJ6A 3MF2A 2RHSB 3NEMA 3JCMe 1SERA 2DZCA 4M75A 4N0AC 3JCMf 3WQZA 2EJ9A 1X2HA 4UP9A 4XTWA 3V8JA 3V8KA 4PNOA 3FIFA 3M4GA 4HVCA 4WJ4A 4M7AE 2VC8A 3QO5A 4P74C 3JCMc 3MEYA 1L0WA 3REUA 2AMCA 5GMKm 4MMLA 5GAMg 1B8AA 1FYFA 3JCMX 1E24A 4H2SA 3PCOB 5GAOl 5GMKj 4M7AF 1USYC 1E1OA 4YRIA 2P0LA 3V8LA 2ZT6A 4CH6A 2PMFA 1ADJA 1H4QA 1LYLA 1NJ2A 3JB9I 5C53B 2I2LA 2YHTA 1WQWA 4EMGA 3MF1A 4YYEA 3RKWA 4F7UG 2C8MA 3L4GA 1PYSB 3RL6A 1EFWA 2ZT7A 3I7FA 4HWSA 5GAN8 1EIYB 1YFSA 4CS3A 2RA2A 4XTXA 3BFMA 3PCOA 2RB6A 4TVAB 3VQWA 3VQVA 3A31A 3VQYA 2AMCB 2EAYA 3SB2A 1B7YB 1G5HA 1YB3A 1H4VB 4PG3A 3HXWA 2DXUA 1I81A 1I4K1 1YGBA 1WYDA 2YLBA 5LJ3g 4L87A 4M78D 4P73A 2ZZGA 4K88A 2ZT8A 4YPFA 3P8TA 2ZIOA 2I4LA 5GAOn 4C92G 5GAN2 4M78G 4M7DB 3HFZB 1WPYA 1I5LA 5LJ5f 3QUIA 4YREA 2P5IA 1EOVA 3JCMd 4YRRA 1WNLA 4WJ3M 4M7DG 1NYQA 4M77B 4H2XA 4YDQA 4P71A 4M7AC 5LJ5g 3JB9H 4YCWA 4PJOG 4A53A 4YRLA 4M7DC 2EJFA 2ZZEA 1TH7A 4P72A 4M7AD 2ZNJA 4P73C 3PGGA 2CIMA 4PJOB 5GAOp 5GAOq 1ADYA 2E5AA 4O2DA 1H4SA 4M77D 3JB9F 4C92C 4DQ2A 2QTXA 3JCMP 3SWNA 3A32A 4KR3A 4X9DA 4OLFA 1E22A 4J5YA 1B76A 4EX5A 3LC0A 1BIAA 4PJOE 4ZIBA 4YRFA 2G4CA 4XU3A 5LJ3d 1WU7A 2ARSA 4P3PA 2IY5A 5GMKh 3ERRA 3VBBA 4HT9A 1I8FA 4M77A 4RCBA 4HWTA 3TUPA 1N9WA 2DTIA 4XTUA 4CH3A 3M4PA 4P72C 4EMKA 4Q6GA 4CH5A 4HA8A 4N0AA 3JCMg 2Y90A 2DTOA 3HFNA 3BY7A 3M4QA 2ARTA 4UP8A 4M75F 2YLCA 2DEQA 4JLIA 4TTVA 5LJ5d 3V7SA 3HXVA 1ASYA 1N9SA 4RMFA 1JJCA 1VQZA 2E1HA 4UP7A 4P71C 1JRIA 3A74A 5DY9A 4HWPA 4LNSA
chains in the Genus database with same CATH superfamily
3QO3A 4CS2A 2EBPA 1D1BA 2E4HA 3L1AA 4F7UB 1W4SA 1KC8U 3CPWP 1K76A 1E6GA 3WXMB 1K9MR 2HL3A 4F7UE 3A7AA 5KYYB 5DLQE 4QVZA 1VQOA 2FZKB 2ZR2A 1RLPC 4C0GA 2KT1A 1YI2A 1VQNQ 4M78C 3CCVA 2CJAA 3VU3C 3FEOA 1T3LA 4IUPA 3W3SA 2MMPA 1LPLA 4M77G 4HCKA 4X34A 1GCQA 2L5QA 2A36A 2P0QA 4C8QB 4E47A 4BB7A 4IUUA 4DEYA 2ZINA 4F7UA 5J3BA 1VQ6A 2AKWB 2IPOB 4FIBA 1M2VA 1X2KA 4LUDA 5GMKl 3E1SA 4II1A 3LSQA 3NGPA 3CBOA 3IQLA 2O88A 2DL5A 3I5RA 1JBMA 1GFCA 5FW9A 2FEIA 4OF1A 1N9RA 2X51A 4JRPA 3M53A 2NUPA 2WSCE 3HRSA 4BY6C 1YI2T 1VQPQ 3RKYA 4AFSC 1SHGA 3MCAB 3G7ZA 3BJUA 1W66A 3BDUA 3ASKA 1VQ4Q 1ZUKA 2JUFA 5FRMA 4J9CA 2DA9A 4C92A 5LJ3h 3CCUT 1WHLA 2GQVA 1PYSA 3ZL7C 2QQSA 1PM3A 2CH4A 2O9SA 3JRZA 4P3NA 3THKA 3C12A 1M1FA 2EQKA 5LJ5j 1C0MA 1Y96B 3P8DA 4HWOA 3LGLA 4LDWA 4PJOA 5ELOA 1XTDA 1FX7A 3R6OA 1PD1A 3JB9G 1N27A 4QVDA 3PIPA 5GAN7 4LVJA 1TOVA 2NS6A 1MHNA 1W2BS 1NJ8A 4RTYA 2M0YA 1LCKA 2RO0A 2JN0A 1WIEA 1SETA 2CP7A 3EFRA 1FXXA 3TU4K 1YJWA 1I07A 4CH4A 3JCMV 1NBEB 3IG2A 1UGSB 2Z0WA 4ZN1A 4IIMA 1K8AC 1QCFA 3M58A 1EVLA 2DJZA 1X6OA 2JNGA 1ZA1B 3VS7A 2C06A 4QT7A 2HQEA 5IHIA 2CZ1B 4Y91A 4J9BA 2IG0A 2CSIA 4DPGA 3E19A 1Q86R 2Q7HA 5GANf 2QHVA 3NETA 3CMQA 4P3OA 5LL6S 3SWNC 3H41A 1VQ5Q 2D0NA 1KFZA 2JJ9A 4C5HA 4J6XA 2RHUA 1IHVA 2XDBA 1VQ7Q 4TVRA 2YRDA 3HRUA 2X4WA 2XTIA 2YXYA 3QWYA 2ZPFB 3CD6T 2HBPA 5GAMe 2QASA 4HCZA 3G6ET 1MUZA 5A0LA 2I4OA 2RJCA 3A7RA 1PKSA 4O6JA 4YRKA 4YRPA 9ATCB 2EL9A 1Q7YR 1G3TA 3FJ5A 1OI1A 1KSWA 2IVWA 4J83A 2CUDA 2EYZA 2WACA 5GAMh 1KIKA 3EH2A 4DOWA 1X55A 1H8KA 1KD1R 4WI1A 2DYIA 3CBMA 3VUZA 4RTUA 3QZ9B 5I11A 1N5ZA 1ZUYA 2JS0A 3DB3A 1H92A 3OW2P 3OYYA 4M75E 4E7ZA 3OS2A 2DEUA 1UDLA 3CCUA 2A7YA 4ORZA 1AZEA 1UECA 1KD1U 2F5TX 3HFVA 3HHTB 3AT1B 3SFMA 1CKBA 3M0SA 1ARKA 3CCQQ 1TTHB 1NG2A 3RKXA 2ED0A 2JTEA 3CC2A 1VQMQ 3MKDA 1UGVA 3X25B 2DXTA 2XMFA 4KT0E 3LW5E 1YFTA 1TU0B 5D7UA 4C8QD 3VS3A 6AT1B 2LT4A 4PLLA 4RG2A 4R0KA 2DXBA 4EMKC 1VQOQ 1IL2A 1V1CA 4FT4A 4CC2A 1ZBXA 2F2XA 2X3XD 3NTKA 1PCXA 3A8GB 2RD1A 2JZ2A 5EC7A 2O2OA 1PRMC 4CS4A 3OYBA 2QGFB 4JJCA 4DEXA 4AH6A 4EPCA 3QXEB 2E5KA 2DBMA 4DBQA 1LJOA 4EDUA 2KXCA 4FT2A 1E6HA 3VS6A 3QZ5B 3UH0A 3M54A 1NYRA 1U1SA 3CC2T 3EG9B 1QVPA 3SWNB 1BIBA 4PFOA 5IN1A 3R07A 5GAMf 4M75C 1M5Q1 3CCJA 3OMGA 1KC8R 4YRNA 2CDTA 2DERA 1S1NA 4O5VA 1VQ4A 1Y0MA 3CCMT 3T9NA 4L6V5 2V8IA 3CCJQ 2E65A 1VQPA 3RF1A 1G8XA 1U06A 1C6VX 3E2UA 4GY5A 4ZTJA 1FMKA 1RAAB 4C5IA 2L2PA 3OS5A 4D8KA 3CCUQ 3OBYA 3RGLA 4HKEA 2ESWA 4M77C 2KY9A 4PK4A 4G84A 2CP0A 2RHSB 2OJ2A 3NEMA 3JCMe 1FMWA 4JZ4A 1JEGA 3JCMf 4N0AC 4HVWA 2F2VA 4UP9A 4XTWA 3X28B 4PNOA 3QO5A 2RH2A 1BCMA 1JU5C 1L0WA 2AMCA 2RI5A 3OYKA 1AD5A 3ZEHA 1X43A 1GCPA 2DYBA 3E9GA 4OMPA 1Q7YU 4OMNA 1UHCA 4X1VA 3V8LA 1BU1A 1O75A 1LYLA 1VQNA 2JM9A 3JB9I 4A4KA 1MMAA 2VUBA 4EMGA 1U8RA 1O9SA 3RL6A 1VQ8A 1WDXA 4J9HA 3RMQA 3BFMA 3I56A 3VUBA 5IH2A 3CPWS 1G3YA 1M2VB 2AMCB 2EAYA 1QMCA 1UE9A 1YB3A 3NFCA 2DL3A 4FM4B 4L5GA 2YLBA 2KRMA 2X35A 2M9UA 3DKMA 1YJWQ 2LCCA 1WLPB 1A0NB 3P8TA 2ZIOA 4AFUC 1QW1A 1IB8A 4M78G 1NJIR 5LJ5f 3QUIA 1M3BA 1GL5A 2L3SA 1RI9A 3WVEB 2P5IA 4N4IA 3OQ5A 4DBHA 1WNLA 4YRRA 4WJ3M 4QQGA 1ZSZA 2P4RA 4HXJA 5LJ5g 1K1ZA 4YCWA 1R77A 2HSPA 4A53A 4QQDA 4YRLA 3OYHA 4A4EA 2EJFA 2ZZEA 4RMOA 1UEBA 4P73C 3L42A 3M5AA 3PGGA 4R56A 4YTLA 2AHJB 3PVQA 1H4SA 4M77D 2XU8A 4X9DA 1OX9A 5D6WA 4J5YA 4OLFA 1VQ5A 2DNUA 5IAYA 4XU3A 2YUOA 3RR6A 1I5OB 4IUQA 3CCSQ 2HEQA 4HT9A 1VOMA 1K8AR 2VGNA 3TVTA 4LDVA 2LJ1A 3GNFB 2K2MA 4CH5A 1G3WA 1QWEA 5I2MA 4PL6A 2RQWA 4A4FA 2D0QB 2A3LA 2YLCA 1RI0A 2K3YA 5LJ5d 3V7SA 2RJEA 1ASYA 4RMFA 1XJWB 3HRTA 2Y4XA 3LH0A 4UP7A 1PD0A 4P71C 2XDDA 3RMSA 1M3CA 1OYXA 2DF6A 2EFIA 1XNIA 2PTKA 1M9SA 4PJOD 1YWPA 4PLIA 1QP2A 2ARUA 5GMKe 4M77E 1KMNA 4KQEA 3A8MB 1B70B 1Y96A 1C0AA 1W70A 1IXDA 3QO7A 2AKWA 3RUXA 4BW9A 4IIOA 3CEYA 4M7DE 1HXDA 2DPPB 4H2UA 1YI2Q 1PRLC 2LQNA 1H3HA 4RTZA 1VQKA 3OMCA 3CC2Q 1BBUA 4ZTUB 4A54A 4C92B 1IO6A 3JCMQ 4A4GA 2QQ9A 1G83A 1N6AA 1WX6A 4XTYA 2OAUA 2XI9A 3FRNA 2GFAA 2RM4A 4J7IA 4E2FB 1AT1B 3UGQA 1K9MU 2DQ0A 2EJGA 2CH4W 3CMAA 1Z7MA 1KOGA 2VXEA 2A28A 4BY6B 1OV3A 2Q5HA 1S72T 4LE9A 1QVFA 2CSQA 2EKHA 2NWMA 3ER0A 1XQHA 1KQ2A 1VQ6T 3U23A 1EX4A 3OYMA 3JV3A 3FDRA 1W2BP 2MAMA 3QG1A 5LJ3j 4OP0A 4KULA 1M90C 2CZ7B 1KQSP 1KQ1A 4MZTA 3H8ZA 1SESA 2DTHA 1M3AA 3MO8A 1VQKT 1JJ2P 3G4ST 1MGQA 1EZZB 2EYWA 2FPDA 3OYAA 2CP3A 2PMEA 2HDAA 3G71Q 5KNNA 3RIRA 2KXDA 1OU9A 5GANg 3CCRQ 4LVLA 2JM8A 2K7AA 3CCQT 3ULRB 1BI1A 1QP3A 1WA7A 2YUQA 4P75C 2K3XA 4HT4A 4MZPA 2ZIMA 5FRNA 4F7UF 5GAN6 1ZUUA 2KE9A 3L2RA 2ZCFB 4C92E 3A8HB 1D0ZA 2O9VA 2RQVA 4H2WA 1X75C 3FB9A 1WHHA 1WHGA 4J6YA 3EFOB 4M78A 1G2BA 3LYIA 1OX8A 4J9EA 5GANe 5KYNA 2QGGA 4F14A 2GBQA 3HPWA 4NOYA 2QQRA 3A7UA 1SRMA 2RI3A 4QKUA 1X56A 1VQ9A 3NENA 1UTIA 1EIYA 2QHUA 4BI8B 2XDPA 2Y4YA 2FZGB 3A98A 2CT4A 4IURA 1UGPB 4RTXA 1QLYA 1WHJA 4P74A 1EIFA 2KVQG 4TQFA 2MK5A 2RQTA 2BZYA 3FJPA 3JCMW 2HZYA 2I4NA 2GCXA 4GBQA 4ZGJB 3JAME 3VV0A 1Q95G 4KGZB 1TWBA 5A0GA 4RQEA 4PJOF 4LD6A 4YRCA 2AIRB 3PIOA 1LNXA 2XK0A 4BE0A 3TEHB 1NJ5A 2ZPIB 1AWWA 3V7CA 1V29B 1NE8A 2BIVA 2VWFA 2FB7A 4CC7A 3BW1A 2DETA 1BBWA 2QXFA 2QQAA 2GQIA 3GIBA 5KCHA 1QE0A 1OZ2A 4H2TA 1Q86U 5GAMd 1SRLA 5A0DA 5A2QE 3CXCP 2PVGB 4E7IA 5I22A 2CREA 1ZX6A 3L4GB 3E9HA 4P5NA 4FSXA 3P8YA 3RBBB 1ABOA 1GRIA 4OGCA 3GNGA 2C0OA 1JJCB 4BWAA 4ESRA 4WTOB 4JLGA 1VQLT 4DBFA 3NHNA 4LVKA 3UFGA 2KRSA 2ECZA 2PVDB 2CGHA 3A1PA 4XTZA 1OPKA 5GAOr 1OULA 2ROLA 3MQZA 2E10A 2KQWA 3N5BB 4YRQA 2CT3A 3FC3A 1PG5B 5GANd 2HSEB 3O8VA 4M7AG 1NJIC 1WGSA 2CUBA 1D0XA 1OPLA 4F17A 3JSCA 4TVWA 1IRXA 1B7TA 2QHTA 2MCNA 1ATIA 4RUGA 2DVEA 2CJBA 4MMKA 4ELZC 2JVVA 1UGQB 1DJ7B 2HAXA 3FLGA 3HXUA 4RQFA 2OAWA 1Z9ZA 3EGUA 4C0DC 4EO4A 1JQQA 3EG1A 2I4MA 1TUCA 3C95A 3S3OA 2E12A 2AZVA 2FZCB 3D7SB 4FCYA 3CCLT 1KQSA 4ZGDB 1KHIA 4XTVA 3JCMJ 3OSSC 2J7IA 5FROA 2EQUA 4KUDK 2H3JA 5FWBA 5CAIA 3QDRB 2LRQA 4QVCA 1ZBJA 1YCYA 4OGEA 4HWRA 4PFZA 2QA4A 5CKFA 2Q7EA 5ELNA 2EQJA 4M75D 2PU9B 4LUEA 1Z7NA 3G6EA 1NYFA 2GTOA 5CIUA 3MEVA 3NTHA 5IXBA 2ZT5A 3OS1A 2YRCA 1M1KR 1YP5A 3EFSA 2FPFA 2XIDA 3HFZA 3EG9A 3REAB 3M57A 2KYMA 1VA7A 4ZNXA 4NS5A 2P4TA 3WQZA 1X2HA 3V8JA 1FMVA 5CKDA 1YJNT 2BE7D 4HVCA 4M7AE 2C0IA 5CK9A 3QBYA 2L0AA 4P74C 1U3OA 2XHCA 2NUTA 3REUA 1SF9A 2MIOA 4MMLA 5GAMg 1K9AA 5CR2A 1E24A 3PCOB 3OBWA 2OTLQ 5GMKj 2ABLA 3MP1A 3SHWA 2RF0A 1E1OA 2PUOB 4JZ3A 1H4QA 1ADJA 1KHCA 1SSHA 2NUPB 5C53B 2YHTA 2LQKA 5HK0A 1WQWA 2OX7A 2RJFA 4FYWB 1Q81R 2QDLA 2C8MA 3L4GA 2NUZA 1N8RC 2ZT7A 2DL7A 2QI2A 2EQIA 3KXTA 2CZ0B 3TEEA 2FO0A 3SEMA 1GBQA 1V76A 3A31A 3VQYA 3GF5A 4ZN3A 2A8EA 2LNVA 1SKUB 1H4VB 4PG3A 3HXWA 1IGQA 4CC4B 1I81A 5EG2A 1WZOA 3CC7A 1WYDA 2E6NA 5LJ3g 3M0TA 2AKLA 4M78D 1HD3A 2SEMA 2HD0A 4J8OA 2JOYA 5GAOn 3VYHB 4DA4A 5KYXB 1I5LA 3CCLA 5AYFA 3VS0A 1YITQ 2RHIA 3UT1A 3VS1A 4M7DG 1NYQA 2X4YA 1TSFA 3VRZA 2SRCA 2KT8A 2EYYA 2KBTA 2LCSA 2DIQA 4RTTA 1TUGB 3CCJT 2B8AA 1YCSB 2CIMA 5GAOq 2FRWA 2E5AA 2K5IA 4C92C 4DQ2A 2ZZDA 3JCMP 3CCET 1NPPA 2RMOA 3EH1A 1W2BA 1B76A 3LC0A 4ZIBA 4YRFA 5HCKA 5KE2A 2COZA 1NZ9A 3PFSA 2OI3A 4MDWA 3QYGB 1AOJA 1M1GA 4D6WA 5FWCA 4BE1A 3ERRA 1KG1A 3VBBA 4LVMA 1VQ9Q 1I8FA 4RCBA 3QYHB 3TUPA 2AKKA 2PVOB 1N9WA 2DTIA 4C5GA 4FW1A 4P72C 3S3MA 1Y7XA 1IHWA 4Q6GA 2W0ZA 2LT1A 4HA8A 2R5MA 1YFNA 2DILA 2Y90A 4C5EA 3KFVA 3M4QA 4HVUA 2VKNA 1WFWA 4M75F 2YRVA 2ARTA 3EG3A 2A37A 3BDLA 3HXVA 2CYZB 2MOXA 1YHQT 1JJCA 3A74A 3NTIA 1D1CA 1SSFA 5DY9A 1SEMA 5GAOm 2QG9B 3J80E 4L59A 1USYA 3CCVT 1NLPC 4J7FA 2QDYB 4BI3A 2V1QA 2PQWA 3CPFA 3TCJA 2E3CA 2JW4A 1J3TA 2V1RA 3PTAA 2DRMA 5GAN3 2DXCA 2MI6A 3OY9A 1TXQA 2L3PA 5D6YA 2ED1A 4YP0A 3CCMA 1WXBA 2PNIA 1K8AU 3PZCA 3CCVQ 4PHCA 1BYMA 3HRKA 1SPKA 2HNIA 4C8QA 3HXZA 3JB9J 1ZLMA 1D09B 3TEHA 4RTVA 3G1ZA 4X5OA 2OTLA 3KUFA 2LJ0A 4FYYB 3M4YA 4F16A 1J5WA 2P84A 3CCRT 2DDZA 4WF2A 2RK2A 5CKEA 4M78E 3GBQA 12ASA 1R0BG 3LWHA 1RAFB 3CMEA 4FU6A 4QW2A 5ECAA 1SG5A 4C92D 4J9FA 3CMAQ 4Q5WA 1Y07A 4JS5A 5DLOA 3TEGA 4EIKA 3SDZA 5CQYA 1F1BB 5GMKi 2ZNIA 2DQ3A 5CKBA 3VRYA 4JPBW 1U5SA 5K1XA 1N8RU 1HJDA 1JO8A 2LQWA 1HTTA 5GAN4 4C8QF 1M30A 2LTOA 3UA6A 2J3MA 2DO3A 2LX9A 1NJ1A 1VYTA 1G51A 2RNAA 3HXXA 1YIJA 1H641 1RAEB 3RDVA 1X01A 4X9CA 1H4TA 3RESA 3OYCA 5LJ3e 3I5SA 1VYVA 2X3WD 2CZ6B 2JMAA 1ACMB 3REBB 4ZTFA 3HY0A 2JS2A 3PVLA 5GJVB 1D1AA 3CMET 5KYYA 1R0CB 1LOJA 1KK7A 4M77F 2HQXA 3EHQA 1Q82U 1G5IA 4V2SA 2XGTA 1RAGB 4NCXA 1WHMA 2LQ8A 3CC4Q 4M7DF 4MZMA 5F5WA 2IY5B 3L2UA 1BK2A 3C4SA 3CPWA 2DU5A 5L23A 3OYIA 2LDMA 2ATCB 3JCMh 1QKXA 2Q7GA 4P75A 2K2VA 4F04B 4OB0B 1ZSZC 5C51B 1NPRA 5IHNA 1D0YA 1YIJT 1YJ9A 2QEXQ 5KH6A 4Q15A 4RCCA 1E1TA 5IXFA 3CXCS 2D9TA 2R57A 2OTLT 1ZSZB 5KYUB 2EW3A 2DD5A 4AFQC 3L2VA 1RADB 2O31A 2DJQA 3Q1JA 3GP8A 4YRMA 3QHSA 2QAZA 2EQMA 2RQUA 4DBRA 2F1LA 3G71A 2VASA 1Q81U 3I56T 3L2WA 3HSBA 1WJSA 4BACA 1M1KU 4E7SA 5GAMj 3HRIA 1B07A 2KAFA 4NL2A 4AMCA 1IZ6A 1GBRA 1HK9A 4J6WA 1JXMA 3REXA 3HTZA 1Y71A 2ZZFA 2C7IA 5CVIA 2DKGA 3A5YA 4J9GA 4PJJA 1NJIU 3OYNA 4C0DB 1GXIE 1U1TA 2QHSA 2K79A 1QCNA 1AVZC 2EGCA 4C8QE 4NL3A 4Z02A 4ZTZB 2ENMA 3OS0A 5KYWB 1M8MA 2L8DA 1QF6A 1ABQA 3C0CA 4CC3A 3G6EQ 4TQDA 4ATOA 3UA7A 3I55T 3HTRA 4C92F 2P0KA 3G71T 3H0FA 1VQ8Q 4RTWA 1UJ0A 2QA4Q 1VQKQ 4BDYA 2HMAA 2GFUA 2DZ9A 1YJ9Q 4H02A 1KJWA 1K0SA 4YCVA 1N8RR 3OSVA 4XU1A 4BD3A 1WLEA 3V7RA 4A4HA 4FYVB 2KSSA 3L2ZA 3M9QA 4K11A 3A8OB 4JJBA 1YN8A 2EWNA 1UJYA 2M02A 3QJYA 2NUTB 1S72Q 2RJDA 4RG8A 1EQRA 2V26A 4IKFA 3EAEA 1I0CA 2COYA 2ZR3A 2D8HA 5L8RE 1KMMA 2JMCA 1YJNA 5FU7C 4C8QC 4JRKA 1B7YA 2H8HA 4HCCA 2KROA 4GLMA 3VS4A 3RNJA 1M1KC 2AZSA 4XEOA 2XG8D 2C0TA 3OYGA 2EYQA 3HKSA 4J15A 4AT1B 4K86A 3VKIA 3E9IA 4G85A 5IT9E 1AZGB 1K73R 3RACA 3TREA 2ZTGA 3M0PA 3X24B 1QVGS 3QNEA 2MYSA 5KYWA 5I21A 2AT1B 2NYSA 2ZAEA 2DIGA 3QTCA 2BZ8A 1Q86C 5KYXA 4E7KA 2VV5A 1HSQA 1VQ4T 4ZGEB 3GOXA 2RN8A 1RABB 2DL4A 1SERA 2L89A 2MF2A 2DZCA 1UUEA 1VQPT 3M56A 4KGXB 4IUTA 1UGRB 4Z8AA 3WVDB 2OTJQ 2VC8A 1QVFP 3CC7T 2CP6A 3JCMc 2M51A 2GF7A 3MEYA 2FHDA 2FVUA 2XKOC 2YDLA 3MP6A 5GMKm 1B8AA 4BDZA 1FYFA 3F70A 1VQMT 4H2SA 2EVRA 2BZXA 1IREB 1USYC 3LWIA 3EGDA 4YRIA 1JJ2S 2P0LA 2QK0A 2ZT6A 2KR3A 2NLUA 4IUVA 1GFDA 2I2LA 3PMIA 3MF1A 3RKWA 4F7UG 2GTJA 3UPUA 1PYSB 1EFWA 1X27A 1VQOT 3CBPA 1TG0A 4HWSA 3OYLA 1EIYB 3VJPA 3QIIA 1YFSA 4CS3A 2F2WA 4XTXA 2ZPBB 3PCOA 2RB6A 3TSZA 4TVAB 1UG1A 2KGTA 3DLLA 5CKHA 1B7YB 1UHFA 2FG0A 1OEBA 4BI4A 4FSSA 4WCIA 4PKCC 1VQ8T 2A08A 2JT4A 4L87A 3TQ7P 1RL2A 4YPFA 5GAN2 1MMDA 3HFZB 2ROTA 1Y57A 4YREA 3C94A 3UWNA 1EOVA 4E7LA 3JCMd 1YHQQ 5D6XA 1YJWT 4H2XA 2CP2A 2BE9B 4P71A 2DK3A 2DL8A 1Q82C 4M7DC 3G4SQ 4LD9K 1RACB 1TH7A 4M7AD 1QWFA 2ZNJA 1OOTA 2DAQA 4OMLA 1VQ7A 1QCOA 5GAOp 1I1JA 4VUBA 1WXTA 3A32A 2J6OA 2D8JA 4JJNK 1E22A 1W6XA 4KUIA 4PJOE 3H6ZA 3R6NA 5GJWB 2GNCA 1MNEA 4JRQA 1WU7A 2DLPA 2ZPGB 2DD4A 1WI7A 4OMFB 3M0UA 4P3PA 2XD0A 5GMKh 4KGVB 3CD6A 4XTUA 4Z88A 3M4PA 1Q82R 3JCMg 2DTOA 2KK4A 3BY7A 2YWWA 2A0FB 1T3SA 1K73C 3META 2J6FA 4JLIA 4TTVA 2G6FX 3EGXB 3CC7Q 2QEXT 3CMEQ 1N9SA 1NLOC 1E7OA 1NEGA 3CC4A 4E7HA 3H0IA 2E1HA 1JRIA 1MV0B 1AWXA 4LNSA 1OZ3A 4AG2C 1PHTA 2F5KA 1WJQA 5CO7A 5M9OA 2RHQB 3DSQA 2LNHB 2X4JA 5E3IA 4D8DA 2J05A 4OMMA 3QSUA 5HKCA 5I2SA 2BTTA 2WSEE 2FYKA 1T0JA 2RHQA 4XU0A 1WHKA 3OYJA 5HK3A 1CSKA 3EHRA 3DLMA 1B70A 4B9XA 2YSQA 4B9WA 4KH1B 2RHXA 2WSFE 1NNHA 4C0FA 2KRNA 4YCUA 3E9FA 1M90U 4M78B 4YRSA 4PJOC 1RUWA 4M4ZA 1OU8A 1VUBA 1X2GA 1PC0A 3H0HA 3QJ6A 2LZ6B 4M7DD 2X4XA 3QDFA 4TVAA 3AHUA 3IKMB 1UFFA 4MDXA 1X69A 3HXYA 3UATA 1WJRA 4JJDA 1M4ZA 4KRTA 4PJMA 4XU2A 3MJXA 2YUPA 3JCMb 1XOVA 1BCOA 3J7AF 3I35A 1SRYA 3M0RA 3MEAA 5LJ5e 5C52B 2K6DA 2JTMA 1VQNT 4M78F 3EGXA 1P92A 3P8VA 3CCEA 4PJLA 4PJNA 2L3RA 2RI2A 3NELA 3NMZC 1UB4A 1YFRA 1OQKA 5AT1B 4JRIA 2M0OA 4JUVA 3VS2A 3UF4A 2MPXC 2ZGWA 3QKJA 2QA4T 2HKNA 2ZPEB 4B6MA 2JXBA 3CCST 5K1PA 1X54A 5C0MA 1MMNA 2QQBA 3KFUA 2Q5IA 3I55Q 1MV3A 2YT6A 3G4SA 3A5ZA 5DM7R 5LJ5h 4J9DA 2W10A 4Z89A 5C6SA 3JB9D 2PZ1A 4ANJA 2QEXA 4RDXA 2EIFA 3OB9A 1T0HA 4RKUE 2LMJA 1D3BA 2KDSA 4M75G 4EMKB 2DRKA 2FL7A 1WQ7A 3MPUB 4LNPA 4M75B 1RIQA 3INZA 4BE2A 2DU7A 3OYEA 1ASZA 1AWJA 5HGQA 3EG2A 2ODRC 1BB9A 3S6WA 3IALA 5GANh 2M16A 2MWPA 1KQSS 5J39A 3CD6Q 2E3HA 5FU7B 4R55A 4M7DA 4TWAA 3ME9A 3IKLA 2P0PA 3CCSA 4FYXB 3I56Q 1KC8C 2E6ZA 2LVMA 3BE3A 2E41A 4JDSA 1VQ5T 3J81E 1QVFS 3KBGA 4HVVA 1VQ9T 1Q7YC 4Y92A 2J6KA 3CCRA 11ASA 4EMHA 1M2OA 5FU6B 1K73U 5FLXE 1YIJQ 2DM1A 2QTVA 1MNDA 1VQLQ 2RK1A 1JXOA 8AT1B 5CCAA 4A63B 3OA6A 3CCEQ 1PNJA 2ZCEA 2KNBB 4C0ZA 5LJ3f 3RERA 4QQ6A 4K87A 4N4HA 1SHFA 3UDCA 1VQLA 4XEMA 1AWOA 2K5LA 1BBZA 1R8OB 1JJ2A 3S3NA 4M7AA 5J26A 2GGRA 4YROA 1ZQ1A 1ZHIA 1M8VA 2K9GA 1D3BB 4FL6A 2OTJT 1RAHB 4HT8A 3QO8A 1PSEA 4TVYA 1JB0E 4OVAA 4LXCA 4UPAA 1VIFA 1EFNA 4YRTA 1RAIB 2QYZA 3OYFA 4H2YA 2F69A 5FU6C 1KD1C 4CRIA 2LP5A 2O4XA 3P8HA 3EFOA 3UGTA 1LVKA 1B34B 1C1AA 2HKQB 2LJ3A 3HFOA 4E7JA 2E3IA 3HY1A 2CJ9A 2J3LA 4E51A 2XICA 2FRYA 3CCMQ 3LSSA 4AG1C 2KI7A 2VGMA 1TS9A 3M55A 4M7AB 2ZXFA 1YJNQ 2HL5C 2PUKB 1WXUA 1HC7A 2ODRD 3MHXA 3L2QA 4Y28E 1W1FA 3OD1A 2EPDA 3CMAT 5CQXA 3OW2A 1NM7A 2DMOA 1GGMA 2V8KA 3ICAA 4KH0B 4ELYC 4OMOA 4H2XB 2OTJA 1M27C 3VQXA 5GAN5 3PMTA 2EGEA 4CI0C 1B34A 1G3SA 1YJ9T 2RHSA 2K57A 2LCLA 1K0XA 2YUNA 1EVKA 2I0NA 2EGAA 4XAXB 3X26B 2ALYB 3M59A 2D1XA 1Z9QA 4XK8E 1BI2A 1NEBA 1VQMA 2BKDN 3PNWC 3VS5A 2VXFA 3O5ZA 3QPHA 1AEYA 2ALYA 2K5FA 1CKAA 3OYDA 1RLQC 2IIMA 1YNZA 3MEUA 3CCQA 3H9NA 4H2VA 5GANj 2RPNA 3URGA 3HP9A 2K3BA 1QVGA 4LVIA 2CS7A 3MEWA 1NYGA 2V8JA 1X6GA 1G5VA 4C8QG 4YRGA 4XQ3A 3OW2S 2L3QA 3GPLA 4YRJA 4GLKA 2E5QA 2E64A 4KR2A 1NJ6A 3MF2A 3LX7A 2KMTA 3P8BB 2DE0X 4PFPA 4OB2B 4M75A 2D6FA 2EJ9A 4J9IA 1M90R 4LDYA 1X6BA 3VYGA 3V8KA 4KBMB 3FIFA 2R58A 2RHZA 3M4GA 4WJ4A 1VQ6Q 5KE3A 2AK5A 2BUDA 1PSFA 1ZA2B 2MWOA 1S72A 1PWTA 1VYUA 3CCLQ 1IGUA 3EG0A 2DX1A 3JCMX 4ME7A 1K9MC 5GAOl 2G3RA 3LGFA 4LN2A 7AT1B 2FPEA 4M7AF 3DB4A 3GLXA 2LX7A 2O01E 1H3ZA 4CH6A 2PMFA 3PE0A 1QVGP 2R5AA 3ZFJA 3TSWA 4BUGA 1BI3A 1NJ2A 4AFZC 2E70A 1FYNA 3M0QA 4YYEA 1X2QA 2JTFA 3I7FA 5GAN8 1AHJB 1VQ7T 2RA2A 2DFUA 1YWOA 4LDUA 3VQWA 2VVKA 3VQVA 5HY6A 3SB2A 1G5HA 1FWZA 2DXUA 5KYUA 2J06A 2X9HA 1I4K1 1YGBA 1B3QA 1ZSGA 4P73A 2ZZGA 4K88A 2ZT8A 1YITT 1K4US 2I4LA 1QKWA 4C92G 2VB6A 4OB1B 4M7DB 1WPYA 8ATCB 2KEAA 3SD4A 2LC4A 4OB3B 5KCOA 3A8LB 1HYOA 2RHYA 1TUDA 4M77B 4UC4A 4YDQA 4M7AC 3JB9H 2HQHA 4PJOG 3CC4T 4HCBA 2O4XB 1WYXA 2B86A 3I55A 4P72A 2RQRA 2EKOA 4PJOB 1ADYA 4O2DA 2CKKA 3LH5A 3JB9F 2QTXA 2COWA 1Q81C 3SWNA 2H3EB 4KR3A 2K4YA 4EX5A 1BIAA 4N4GA 3CQTA 2DVJA 3QWXX 2G4CA 3A5ZB 1VIEA 4DOVA 5LJ3d 4FW2A 2VYTA 3EGDB 2ARSA 4OMQA 4E6RA 3G1JA 2CP5A 2IY5A 1YITA 2DBKA 1YHQA 4M77A 4HWTA 3X20B 2KYBA 1GCQC 3CXCA 1MMGA 2HBWA 4CH3A 4EMKA 4LDXA 1BI0A 4N0AA 3ZBDA 3MP8A 1QQJA 3HFNA 1YBYA 1PKTA 2ZPHB 4JS4A 3I9QA 5IHKA 4UP8A 2DEQA 2HCKA 3NPFA 3HL8A 3LLRA 1VQZA 1BKBA 2EYXA 3PT9A 4HWPA 2M1HA
chains in the Genus database with same CATH topology
3QO3A 4CS2A 3L1AA 4F7UB 1W4SA 1KC8U 3WXMB 4F7UE 3A7AA 5DLQE 4QVZA 1VQOA 2ZR2A 4C0GA 1YI2A 4M78C 3CCVA 2CJAA 3VU3C 3FEOA 4IUPA 3W3SA 2MMPA 4M77G 4X34A 2L5QA 2P0QA 4C8QB 4E47A 4BB7A 4IUUA 2ZINA 4F7UA 5J3BA 1VQ6A 2AKWB 4FIBA 5GMKl 3E1SA 4II1A 3LSQA 3CBOA 1JBMA 4OF1A 1N9RA 4JRPA 3M53A 3HRSA 2WSCE 4BY6C 1YI2T 3RKYA 3MCAB 3G7ZA 3BJUA 1W66A 3BDUA 3ASKA 2JUFA 5FRMA 4C92A 5LJ3h 3CCUT 2GQVA 1PYSA 2QQSA 3JRZA 4P3NA 3C12A 1M1FA 2EQKA 5LJ5j 1Y96B 3P8DA 4HWOA 3LGLA 4LDWA 4PJOA 5ELOA 1XTDA 1FX7A 3R6OA 3JB9G 1N27A 4QVDA 3PIPA 5GAN7 4LVJA 2NS6A 1MHNA 1W2BS 1NJ8A 2RO0A 2JN0A 1SETA 3EFRA 1FXXA 3TU4K 1YJWA 4CH4A 3JCMV 3IG2A 1UGSB 4ZN1A 1K8AC 3M58A 1EVLA 2DJZA 1X6OA 2JNGA 2C06A 2HQEA 2CZ1B 4Y91A 2IG0A 4DPGA 3E19A 2Q7HA 5GANf 2QHVA 3NETA 3CMQA 4P3OA 5LL6S 3SWNC 4C5HA 4J6XA 2RHUA 2XDBA 4TVRA 3HRUA 2X4WA 2XTIA 2ZPFB 3CD6T 2HBPA 5GAMe 4HCZA 3G6ET 5A0LA 2I4OA 2RJCA 3A7RA 4O6JA 4YRKA 4YRPA 2EL9A 1G3TA 1OI1A 2IVWA 4J83A 2WACA 5GAMh 4DOWA 1X55A 4WI1A 3CBMA 3VUZA 3QZ9B 3DB3A 3OYYA 4M75E 3OS2A 3CCUA 2A7YA 1KD1U 2F5TX 3HFVA 3HHTB 3SFMA 3RKXA 3CC2A 3X25B 2DXTA 4KT0E 3LW5E 1YFTA 4C8QD 2LT4A 4PLLA 4RG2A 2DXBA 4EMKC 1IL2A 4FT4A 1ZBXA 3NTKA 3A8GB 2RD1A 2JZ2A 4CS4A 3OYBA 4AH6A 4EPCA 3QXEB 1LJOA 4EDUA 4FT2A 3QZ5B 3UH0A 3M54A 1NYRA 1U1SA 3CC2T 1QVPA 3SWNB 1BIBA 5IN1A 3R07A 5GAMf 4M75C 1M5Q1 3CCJA 3OMGA 4YRNA 4O5VA 1VQ4A 3CCMT 3T9NA 4L6V5 2V8IA 2E65A 1VQPA 3RF1A 4GY5A 4ZTJA 4C5IA 3OS5A 3OBYA 3RGLA 4HKEA 4G84A 4M77C 2KY9A 2RHSB 3NEMA 3JCMe 3JCMf 4N0AC 4UP9A 4XTWA 3X28B 4PNOA 3QO5A 2RH2A 1L0WA 2AMCA 2RI5A 3OYKA 3ZEHA 3E9GA 1Q7YU 3V8LA 1O75A 1LYLA 1VQNA 3JB9I 4A4KA 2VUBA 4EMGA 1U8RA 1O9SA 3RL6A 1VQ8A 3RMQA 3BFMA 3I56A 3VUBA 3CPWS 1G3YA 2AMCB 2EAYA 1YB3A 3NFCA 4FM4B 4L5GA 2YLBA 2X35A 2M9UA 3DKMA 2LCCA 3P8TA 2ZIOA 1QW1A 4M78G 5LJ5f 3QUIA 3WVEB 2P5IA 4N4IA 3OQ5A 4YRRA 1WNLA 4WJ3M 4QQGA 5LJ5g 4YCWA 4A53A 4QQDA 4YRLA 3OYHA 4A4EA 2EJFA 2ZZEA 4RMOA 1UEBA 4P73C 3L42A 3M5AA 3PGGA 4R56A 4YTLA 2AHJB 1H4SA 4M77D 2XU8A 4X9DA 4OLFA 5D6WA 4J5YA 1VQ5A 5IAYA 4XU3A 4IUQA 4HT9A 2VGNA 4LDVA 3GNFB 4CH5A 1G3WA 5I2MA 4PL6A 4A4FA 2D0QB 2A3LA 2YLCA 1RI0A 2K3YA 5LJ5d 3V7SA 2RJEA 1ASYA 4RMFA 3HRTA 2Y4XA 3LH0A 4UP7A 4P71C 2XDDA 3RMSA 1OYXA 2EFIA 1XNIA 1M9SA 4PJOD 4PLIA 2ARUA 1QP2A 5GMKe 4M77E 1KMNA 4KQEA 3A8MB 1B70B 1Y96A 1C0AA 3QO7A 2AKWA 3RUXA 4BW9A 3CEYA 4M7DE 1HXDA 2DPPB 4H2UA 1VQKA 3OMCA 1BBUA 4ZTUB 4A54A 4C92B 3JCMQ 4A4GA 2QQ9A 1N6AA 4XTYA 2OAUA 2XI9A 3FRNA 2GFAA 2RM4A 4J7IA 3UGQA 1K9MU 2DQ0A 2EJGA 3CMAA 1Z7MA 1KOGA 2VXEA 4BY6B 2Q5HA 1S72T 1QVFA 3ER0A 1XQHA 1KQ2A 1VQ6T 3OYMA 3FDRA 2MAMA 3QG1A 5LJ3j 4OP0A 4KULA 1M90C 2CZ7B 1KQ1A 4MZTA 3H8ZA 1SESA 2DTHA 3MO8A 1VQKT 3G4ST 1MGQA 3OYAA 2PMEA 5KNNA 3RIRA 5GANg 4LVLA 3CCQT 1BI1A 1QP3A 4P75C 2K3XA 4HT4A 4MZPA 2ZIMA 5FRNA 4F7UF 5GAN6 3L2RA 2ZCFB 4C92E 3A8HB 4H2WA 1X75C 3FB9A 4J6YA 4M78A 3LYIA 5GANe 3HPWA 4NOYA 2QQRA 3A7UA 2RI3A 1X56A 1VQ9A 3NENA 1EIYA 2QHUA 4BI8B 2XDPA 2Y4YA 4IURA 1UGPB 4P74A 1EIFA 2KVQG 4TQFA 3FJPA 3JCMW 2I4NA 2GCXA 4ZGJB 3JAME 3VV0A 5A0GA 4RQEA 4PJOF 4LD6A 4YRCA 3PIOA 1LNXA 2XK0A 4BE0A 3TEHB 1NJ5A 2ZPIB 3V7CA 1V29B 1NE8A 2BIVA 2FB7A 3BW1A 1BBWA 2QXFA 2QQAA 3GIBA 5KCHA 1QE0A 1OZ2A 4H2TA 1Q86U 5GAMd 5A0DA 5A2QE 2PVGB 4E7IA 3L4GB 3E9HA 4P5NA 4FSXA 3P8YA 4OGCA 3GNGA 1JJCB 4BWAA 4JLGA 1VQLT 4LVKA 3UFGA 2PVDB 2CGHA 4XTZA 5GAOr 3MQZA 2E10A 2KQWA 3N5BB 4YRQA 3FC3A 5GANd 3O8VA 4M7AG 1NJIC 1WGSA 4TVWA 3JSCA 2QHTA 1ATIA 2DVEA 2CJBA 4MMKA 4ELZC 2JVVA 1UGQB 1DJ7B 2HAXA 3FLGA 3HXUA 4RQFA 4C0DC 4EO4A 2I4MA 3C95A 3S3OA 2E12A 3CCLT 1KQSA 4ZGDB 1KHIA 4XTVA 3JCMJ 3OSSC 5FROA 2EQUA 4KUDK 2H3JA 5CAIA 3QDRB 2LRQA 4QVCA 1YCYA 4OGEA 4HWRA 2QA4A 5CKFA 2Q7EA 5ELNA 2EQJA 4M75D 2PU9B 1Z7NA 3G6EA 5CIUA 3MEVA 3NTHA 2ZT5A 3OS1A 3EFSA 2XIDA 3HFZA 3M57A 4NS5A 2P4TA 3WQZA 1X2HA 3V8JA 5CKDA 1YJNT 4HVCA 4M7AE 5CK9A 3QBYA 4P74C 2XHCA 3REUA 4MMLA 5GAMg 5CR2A 1E24A 3PCOB 3OBWA 5GMKj 3MP1A 1E1OA 2PUOB 1H4QA 1ADJA 1KHCA 5C53B 2YHTA 2LQKA 5HK0A 1WQWA 2RJFA 2C8MA 3L4GA 1N8RC 2ZT7A 2QI2A 3KXTA 2CZ0B 3TEEA 3A31A 3VQYA 3GF5A 4ZN3A 2A8EA 2LNVA 1H4VB 4PG3A 3HXWA 1I81A 5EG2A 3CC7A 1WYDA 2E6NA 5LJ3g 4M78D 2HD0A 4J8OA 2JOYA 5GAOn 3VYHB 4DA4A 1I5LA 3CCLA 5AYFA 2RHIA 3UT1A 4M7DG 1NYQA 2X4YA 2DIQA 3CCJT 2B8AA 2CIMA 5GAOq 2E5AA 2K5IA 4C92C 4DQ2A 2ZZDA 3JCMP 3CCET 1NPPA 1W2BA 1B76A 3LC0A 4ZIBA 4YRFA 5KE2A 1NZ9A 3PFSA 3QYGB 1M1GA 4MDWA 4D6WA 4BE1A 3ERRA 1KG1A 3VBBA 4LVMA 1I8FA 4RCBA 3QYHB 3TUPA 2PVOB 1N9WA 2DTIA 4C5GA 4P72C 3S3MA 1Y7XA 4Q6GA 2LT1A 4HA8A 2R5MA 2Y90A 4C5EA 3M4QA 2ARTA 2YRVA 4M75F 3BDLA 3HXVA 2CYZB 1YHQT 1JJCA 3A74A 3NTIA 1SSFA 5DY9A 5GAOm 3J80E 4L59A 1USYA 3CCVT 4J7FA 2QDYB 4BI3A 2PQWA 3CPFA 3TCJA 2E3CA 3PTAA 5GAN3 2DXCA 2MI6A 3OY9A 5D6YA 4YP0A 3CCMA 1K8AU 3PZCA 4PHCA 1BYMA 3HRKA 2HNIA 4C8QA 3HXZA 3JB9J 3TEHA 3G1ZA 4X5OA 2OTLA 3KUFA 3M4YA 1J5WA 3CCRT 2DDZA 4WF2A 2RK2A 5CKEA 4M78E 12ASA 3LWHA 3CMEA 4FU6A 4QW2A 4C92D 4Q5WA 1Y07A 4JS5A 5DLOA 3TEGA 3SDZA 5CQYA 5GMKi 2ZNIA 2DQ3A 5CKBA 5K1XA 1N8RU 1HTTA 5GAN4 4C8QF 2LTOA 2J3MA 2DO3A 2LX9A 1NJ1A 1G51A 3HXXA 1YIJA 1H641 1X01A 4X9CA 1H4TA 3RESA 3OYCA 5LJ3e 2CZ6B 4ZTFA 3HY0A 3CMET 1LOJA 4M77F 2HQXA 1Q82U 1G5IA 4V2SA 2XGTA 4NCXA 2LQ8A 2IY5B 4M7DF 4MZMA 5F5WA 3L2UA 3C4SA 3CPWA 2DU5A 3OYIA 2LDMA 3JCMh 4P75A 2Q7GA 2K2VA 4OB0B 5C51B 1NPRA 1YIJT 1YJ9A 5KH6A 4Q15A 4RCCA 1E1TA 3CXCS 2D9TA 2R57A 2OTLT 2DD5A 3L2VA 3Q1JA 4YRMA 3GP8A 3QHSA 2EQMA 3G71A 1Q81U 3I56T 3L2WA 3HSBA 1WJSA 4BACA 1M1KU 5GAMj 3HRIA 2KAFA 4NL2A 1IZ6A 1HK9A 4J6WA 3REXA 3HTZA 1Y71A 2ZZFA 2C7IA 5CVIA 2DKGA 3A5YA 1NJIU 3OYNA 4C0DB 1GXIE 1U1TA 2QHSA 4C8QE 4NL3A 4Z02A 4ZTZB 3OS0A 2L8DA 1QF6A 4TQDA 4ATOA 3I55T 4C92F 2P0KA 3G71T 4BDYA 2GFUA 2DZ9A 4YCVA 4H02A 3OSVA 4XU1A 4BD3A 1WLEA 3V7RA 4A4HA 2KSSA 3L2ZA 3M9QA 3A8OB 2EWNA 3QJYA 2RJDA 4RG8A 1EQRA 4IKFA 3EAEA 2ZR3A 5L8RE 1KMMA 1YJNA 5FU7C 4C8QC 4JRKA 1B7YA 4HCCA 1M1KC 4XEOA 2XG8D 3OYGA 2EYQA 3HKSA 4J15A 4K86A 3VKIA 3E9IA 4G85A 5IT9E 3RACA 3TREA 2ZTGA 3X24B 1QVGS 3QNEA 5I21A 2DIGA 3QTCA 1Q86C 4E7KA 2VV5A 1VQ4T 4ZGEB 3GOXA 1SERA 2L89A 2MF2A 2DZCA 1VQPT 3M56A 4IUTA 1UGRB 3WVDB 2VC8A 3CC7T 3JCMc 2GF7A 3MEYA 2FHDA 2FVUA 2XKOC 3MP6A 5GMKm 1B8AA 4BDZA 1FYFA 3F70A 1VQMT 4H2SA 1IREB 1USYC 3LWIA 4YRIA 1JJ2S 2P0LA 2ZT6A 2NLUA 4IUVA 2I2LA 3PMIA 3MF1A 3RKWA 4F7UG 3UPUA 1PYSB 1EFWA 1VQOT 3CBPA 4HWSA 3OYLA 1EIYB 3VJPA 3QIIA 1YFSA 4CS3A 4XTXA 2ZPBB 3PCOA 2RB6A 4TVAB 3DLLA 5CKHA 1B7YB 4BI4A 4PKCC 1VQ8T 4L87A 1RL2A 4YPFA 5GAN2 3HFZB 4YREA 3C94A 3UWNA 1EOVA 4E7LA 3JCMd 5D6XA 1YJWT 4H2XA 4P71A 2DK3A 1Q82C 4M7DC 4LD9K 1TH7A 4M7AD 2ZNJA 2DAQA 1VQ7A 5GAOp 4VUBA 3A32A 4JJNK 1E22A 4KUIA 4PJOE 3H6ZA 4JRQA 1WU7A 2ZPGB 2DD4A 4OMFB 4P3PA 2XD0A 5GMKh 3CD6A 4XTUA 3M4PA 3JCMg 2DTOA 2KK4A 3BY7A 1K73C 3META 4JLIA 4TTVA 2QEXT 1N9SA 3CC4A 4E7HA 2E1HA 1JRIA 4LNSA 1OZ3A 2F5KA 1WJQA 5CO7A 5M9OA 3DSQA 2RHQB 2X4JA 5E3IA 3QSUA 5HKCA 5I2SA 2WSEE 2FYKA 2RHQA 4XU0A 3OYJA 5HK3A 3DLMA 1B70A 4B9XA 4B9WA 2RHXA 2WSFE 1NNHA 4C0FA 4YCUA 3E9FA 1M90U 4M78B 4YRSA 4PJOC 1VUBA 1X2GA 3QJ6A 4M7DD 2X4XA 4TVAA 3AHUA 3IKMB 4MDXA 3HXYA 1WJRA 1M4ZA 4XU2A 3JCMb 1XOVA 3J7AF 1SRYA 3MEAA 5LJ5e 5C52B 2JTMA 1VQNT 4M78F 1P92A 3P8VA 3CCEA 2L3RA 2RI2A 3NELA 1YFRA 1UB4A 4JRIA 2M0OA 4JUVA 2ZGWA 3QKJA 2QA4T 2ZPEB 3CCST 5K1PA 1X54A 5C0MA 2QQBA 3KFUA 2Q5IA 3G4SA 3A5ZA 5DM7R 5LJ5h 5C6SA 3JB9D 2QEXA 4RDXA 2EIFA 3OB9A 4RKUE 1D3BA 2KDSA 4M75G 4EMKB 2FL7A 1WQ7A 4M75B 1RIQA 3INZA 4BE2A 2DU7A 3OYEA 1ASZA 5HGQA 2ODRC 3IALA 3S6WA 5GANh 2M16A 2MWPA 1KQSS 5J39A 5FU7B 4R55A 4M7DA 4TWAA 3ME9A 3IKLA 2P0PA 3CCSA 1KC8C 2E6ZA 2LVMA 2E41A 4JDSA 1VQ5T 3J81E 1QVFS 3KBGA 1VQ9T 1Q7YC 3CCRA 11ASA 4EMHA 5FU6B 1K73U 5FLXE 2RK1A 5CCAA 3OA6A 2ZCEA 4C0ZA 5LJ3f 3RERA 4QQ6A 4K87A 4N4HA 3UDCA 1VQLA 4XEMA 2K5LA 1R8OB 1JJ2A 3S3NA 4M7AA 5J26A 4YROA 1ZQ1A 1ZHIA 1M8VA 4FL6A 1D3BB 2OTJT 3QO8A 4HT8A 1PSEA 4TVYA 1JB0E 4OVAA 4UPAA 1VIFA 4YRTA 3OYFA 4H2YA 2F69A 5FU6C 1KD1C 4CRIA 2O4XA 3P8HA 3UGTA 1B34B 3HFOA 4E7JA 3HY1A 2CJ9A 2J3LA 4E51A 2XICA 3LSSA 2VGMA 3M55A 4M7AB 2ZXFA 2ODRD 2PUKB 1HC7A 3MHXA 3L2QA 4Y28E 3OD1A 3CMAT 5CQXA 3OW2A 1GGMA 2V8KA 3ICAA 4ELYC 4H2XB 2OTJA 3VQXA 5GAN5 3PMTA 4CI0C 1B34A 1G3SA 1YJ9T 2RHSA 2K57A 2LCLA 1EVKA 4XAXB 3X26B 2ALYB 3M59A 4XK8E 1BI2A 1VQMA 2BKDN 3PNWC 2VXFA 2ALYA 3QPHA 2K5FA 3OYDA 3MEUA 3CCQA 4H2VA 5GANj 3URGA 3HP9A 1QVGA 4LVIA 2CS7A 3MEWA 2V8JA 1G5VA 4C8QG 4YRGA 4XQ3A 3OW2S 3GPLA 4YRJA 4GLKA 2E5QA 2E64A 4KR2A 1NJ6A 3MF2A 3LX7A 2KMTA 3P8BB 4OB2B 4M75A 2D6FA 2EJ9A 4LDYA 3VYGA 3V8KA 4KBMB 3FIFA 2R58A 2RHZA 3M4GA 4WJ4A 5KE3A 2BUDA 1PSFA 2MWOA 1S72A 3JCMX 4ME7A 1K9MC 5GAOl 2G3RA 3LGFA 4M7AF 3DB4A 3GLXA 2O01E 1H3ZA 4CH6A 2PMFA 2R5AA 3ZFJA 4BUGA 1BI3A 1NJ2A 2E70A 4YYEA 2JTFA 3I7FA 5GAN8 1AHJB 1VQ7T 2RA2A 4LDUA 3VQWA 3VQVA 5HY6A 3SB2A 1G5HA 1FWZA 2DXUA 1I4K1 1YGBA 4P73A 2ZZGA 4K88A 2ZT8A 1YITT 2I4LA 4C92G 4OB1B 4M7DB 1WPYA 3SD4A 2LC4A 4OB3B 5KCOA 3A8LB 2RHYA 4M77B 4UC4A 4YDQA 4M7AC 3JB9H 4PJOG 3CC4T 4HCBA 2O4XB 3I55A 4P72A 2EKOA 4O2DA 4PJOB 1ADYA 2CKKA 3JB9F 2QTXA 1Q81C 3SWNA 4KR3A 2K4YA 4EX5A 1BIAA 4N4GA 2G4CA 3A5ZB 1VIEA 4DOVA 5LJ3d 2VYTA 2ARSA 2IY5A 1YITA 1YHQA 4M77A 4HWTA 3X20B 3CXCA 4CH3A 4EMKA 4LDXA 1BI0A 4N0AA 3ZBDA 3MP8A 3HFNA 1YBYA 4UP8A 2ZPHB 4JS4A 2DEQA 3HL8A 3LLRA 1VQZA 1BKBA 3PT9A 4HWPA 2M1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  5GAO m;  4CS2 A;  3L1A A;  1USY A;  4F7U B;  4PJO D;  2RHQ B;  3DSQ A;  2ARU A;  5E3I A;  5GMK e;  2E3C A;  4F7U E;  3A7A A;  3QSU A;  4M77 E;  1KMN A;  4KQE A;  5GAN 3;  1B70 B;  1Y96 A;  1C0A A;  3QO7 A;  2ZR2 A;  2FYK A;  2AKW A;  3RUX A;  4BW9 A;  2RHQ A;  4YP0 A;  3PZC A;  4M7D E;  4PHC A;  1HXD A;  3HRK A;  4XU0 A;  4M78 C;  2CJA A;  2HNI A;  4C8Q A;  4H2U A;  3VU3 C;  3HXZ A;  3JB9 J;  1B70 A;  3W3S A;  4M77 G;  3TEH A;  3G1Z A;  4X5O A;  1NNH A;  1BBU A;  4ZTU B;  4A54 A;  4YCU A;  4C92 B;  4M78 B;  4C8Q B;  4YRS A;  3JCM Q;  4PJO C;  1J5W A;  2ZIN A;  2DDZ A;  4F7U A;  4XTY A;  4WF2 A;  1X2G A;  2AKW B;  2RM4 A;  4M78 E;  4M7D D;  5GMK l;  3UGQ A;  2DQ0 A;  2EJG A;  12AS A;  4TVA A;  3AHU A;  3IKM B;  3LSQ A;  1Z7M A;  3HXY A;  1KOG A;  2VXE A;  2Q5H A;  4C92 D;  1JBM A;  4XU2 A;  3JCM b;  1KQ2 A;  3TEG A;  1N9R A;  5GMK i;  2ZNI A;  2DQ3 A;  5K1X A;  1SRY A;  5LJ3 j;  5LJ5 e;  4OP0 A;  5C52 B;  1HTT A;  1KQ1 A;  3RKY A;  5GAN 4;  4C8Q F;  4M78 F;  3BJU A;  1W66 A;  3BDU A;  1SES A;  2J3M A;  3P8V A;  2DTH A;  1NJ1 A;  4C92 A;  3NEL A;  1YFR A;  5LJ3 h;  1MGQ A;  1PYS A;  1G51 A;  4JRI A;  3HXX A;  2PME A;  4JUV A;  1H64 1;  5KNN A;  3RIR A;  2ZGW A;  4P3N A;  1X01 A;  4X9C A;  5GAN g;  1H4T A;  5K1P A;  3RES A;  5LJ5 j;  5LJ3 e;  1X54 A;  1Y96 B;  4HWO A;  3KFU A;  4PJO A;  2Q5I A;  5ELO A;  4P75 C;  3JB9 G;  3A5Z A;  3HY0 A;  4QVD A;  2ZIM A;  5LJ5 h;  5GAN 7;  1LOJ A;  4F7U F;  5GAN 6;  4M77 F;  3JB9 D;  1G5I A;  4V2S A;  4RDX A;  2XGT A;  1D3B A;  4M75 G;  4EMK B;  1NJ8 A;  4C92 E;  4NCX A;  2IY5 B;  4M7D F;  4H2W A;  3FB9 A;  5F5W A;  2JN0 A;  1WQ7 A;  4J6Y A;  1SET A;  3EFR A;  4M78 A;  4M75 B;  1RIQ A;  5GAN e;  3INZ A;  2DU5 A;  4CH4 A;  3JCM V;  3IG2 A;  2DU7 A;  4NOY A;  1ASZ A;  3JCM h;  4P75 A;  1EVL A;  2Q7G A;  5HGQ A;  2ODR C;  3IAL A;  2DJZ A;  3A7U A;  5GAN h;  5C51 B;  1X56 A;  4Y91 A;  3NEN A;  4M7D A;  1EIY A;  2QHU A;  4TWA A;  3IKL A;  4DPG A;  4Q15 A;  2Q7H A;  4RCC A;  5GAN f;  2QHV A;  1E1T A;  3NET A;  3CMQ A;  2E41 A;  4P3O A;  4P74 A;  4TQF A;  3SWN C;  3FJP A;  3JCM W;  2I4N A;  4YRM A;  3QHS A;  4J6X A;  11AS A;  4EMH A;  4RQE A;  4PJO F;  4YRC A;  2XTI A;  5GAM e;  1LNX A;  3HSB A;  3TEH B;  1NJ5 A;  2I4O A;  5GAM j;  3HRI A;  3V7C A;  3A7R A;  4NL2 A;  1HK9 A;  4YRK A;  4YRP A;  2ZCE A;  2FB7 A;  4J6W A;  5LJ3 f;  3BW1 A;  3RER A;  2EL9 A;  1BBW A;  3GIB A;  5GAM h;  3REX A;  3HTZ A;  2ZZF A;  2C7I A;  1QE0 A;  4K87 A;  2DKG A;  4H2T A;  3A5Y A;  1X55 A;  4WI1 A;  4XEM A;  5GAM d;  1U1T A;  2QHS A;  4M7A A;  4YRO A;  4M75 E;  1M8V A;  3QO8 A;  1D3B B;  3L4G B;  4HT8 A;  3E9H A;  3P8Y A;  4C8Q E;  4TVY A;  4NL3 A;  4ZTZ B;  1JJC B;  3HFV A;  4UPA A;  4YRT A;  4BWA A;  1QF6 A;  4H2Y A;  4TQD A;  3UFG A;  4C92 F;  2CGH A;  4XTZ A;  5GAO r;  3UGT A;  3RKX A;  1B34 B;  2E10 A;  4YCV A;  2DZ9 A;  4YRQ A;  4H02 A;  2DXT A;  3HFO A;  5GAN d;  4XU1 A;  4M7A G;  3HY1 A;  1WLE A;  2CJ9 A;  2J3L A;  1YFT A;  4TVW A;  4E51 A;  3V7R A;  4C8Q D;  2QHT A;  3LSS A;  1ATI A;  3L2Z A;  4M7A B;  2DVE A;  1IL2 A;  4EMK C;  4MMK A;  2CJB A;  2ZXF A;  2ODR D;  1HC7 A;  3HXU A;  4RQF A;  2EWN A;  3OD1 A;  2RD1 A;  1GGM A;  4EO4 A;  3ICA A;  4CS4 A;  1EQR A;  4H2X B;  2I4M A;  4AH6 A;  3VQX A;  5GAN 5;  1LJO A;  2ZR3 A;  1B34 A;  1KMM A;  2RHS A;  2K57 A;  1EVK A;  4C8Q C;  4JRK A;  2ALY B;  4XTV A;  1B7Y A;  3JCM J;  1NYR A;  3UH0 A;  1U1S A;  3SWN B;  1BIB A;  5CAI A;  3R07 A;  5GAM f;  4QVC A;  4XEO A;  1YCY A;  4M75 C;  1M5Q 1;  4HWR A;  2VXF A;  2ALY A;  4J15 A;  4YRN A;  4K86 A;  2Q7E A;  5ELN A;  3E9I A;  4H2V A;  4M75 D;  5GAN j;  4G85 A;  2E65 A;  3RAC A;  3RF1 A;  1Z7N A;  2ZTG A;  3QNE A;  5I21 A;  4C8Q G;  4YRG A;  2ZT5 A;  4XQ3 A;  3QTC A;  3EFS A;  4YRJ A;  3HFZ A;  3RGL A;  4G84 A;  2E64 A;  4M77 C;  4KR2 A;  1NJ6 A;  3MF2 A;  2RHS B;  3NEM A;  3JCM e;  1SER A;  2DZC A;  4M75 A;  4N0A C;  3JCM f;  3WQZ A;  2EJ9 A;  1X2H A;  4UP9 A;  4XTW A;  3V8J A;  3V8K A;  4PNO A;  3FIF A;  3M4G A;  4HVC A;  4WJ4 A;  4M7A E;  2VC8 A;  3QO5 A;  4P74 C;  3JCM c;  3MEY A;  1L0W A;  3REU A;  2AMC A;  5GMK m;  4MML A;  5GAM g;  1B8A A;  1FYF A;  3JCM X;  1E24 A;  4H2S A;  3PCO B;  5GAO l;  5GMK j;  4M7A F;  1USY C;  1E1O A;  4YRI A;  2P0L A;  3V8L A;  2ZT6 A;  4CH6 A;  2PMF A;  1ADJ A;  1H4Q A;  1LYL A;  1NJ2 A;  3JB9 I;  5C53 B;  2I2L A;  2YHT A;  1WQW A;  4EMG A;  3MF1 A;  4YYE A;  3RKW A;  4F7U G;  2C8M A;  3L4G A;  1PYS B;  3RL6 A;  1EFW A;  2ZT7 A;  3I7F A;  4HWS A;  5GAN 8;  1EIY B;  1YFS A;  4CS3 A;  2RA2 A;  4XTX A;  3BFM A;  3PCO A;  2RB6 A;  4TVA B;  3VQW A;  3VQV A;  3A31 A;  3VQY A;  2AMC B;  2EAY A;  3SB2 A;  1B7Y B;  1G5H A;  1YB3 A;  1H4V B;  4PG3 A;  3HXW A;  2DXU A;  1I81 A;  1I4K 1;  1YGB A;  1WYD A;  2YLB A;  5LJ3 g;  4L87 A;  4M78 D;  4P73 A;  2ZZG A;  4K88 A;  2ZT8 A;  4YPF A;  3P8T A;  2ZIO A;  2I4L A;  5GAO n;  4C92 G;  5GAN 2;  4M78 G;  4M7D B;  3HFZ B;  1WPY A;  1I5L A;  5LJ5 f;  3QUI A;  4YRE A;  2P5I A;  1EOV A;  3JCM d;  4YRR A;  1WNL A;  4WJ3 M;  4M7D G;  1NYQ A;  4M77 B;  4H2X A;  4YDQ A;  4P71 A;  4M7A C;  5LJ5 g;  3JB9 H;  4YCW A;  4PJO G;  4A53 A;  4YRL A;  4M7D C;  2EJF A;  2ZZE A;  1TH7 A;  4P72 A;  4M7A D;  2ZNJ A;  4P73 C;  3PGG A;  2CIM A;  4PJO B;  5GAO p;  5GAO q;  1ADY A;  2E5A A;  4O2D A;  1H4S A;  4M77 D;  3JB9 F;  4C92 C;  4DQ2 A;  2QTX A;  3JCM P;  3SWN A;  3A32 A;  4KR3 A;  4X9D A;  4OLF A;  1E22 A;  4J5Y A;  1B76 A;  4EX5 A;  3LC0 A;  1BIA A;  4PJO E;  4ZIB A;  4YRF A;  2G4C A;  4XU3 A;  5LJ3 d;  1WU7 A;  2ARS A;  4P3P A;  2IY5 A;  5GMK h;  3ERR A;  3VBB A;  4HT9 A;  1I8F A;  4M77 A;  4RCB A;  4HWT A;  3TUP A;  1N9W A;  2DTI A;  4XTU A;  4CH3 A;  3M4P A;  4P72 C;  4EMK A;  4Q6G A;  4CH5 A;  4HA8 A;  4N0A A;  3JCM g;  2Y90 A;  2DTO A;  3HFN A;  3BY7 A;  3M4Q A;  2ART A;  4UP8 A;  4M75 F;  2YLC A;  2DEQ A;  4JLI A;  4TTV A;  5LJ5 d;  3V7S A;  3HXV A;  1ASY A;  1N9S A;  4RMF A;  1JJC A;  1VQZ A;  2E1H A;  4UP7 A;  4P71 C;  1JRI A;  3A74 A;  5DY9 A;  4HWP A;  4LNS A; 
#chains in the Genus database with same CATH topology
 3QO3 A;  4CS2 A;  2EBP A;  1D1B A;  2E4H A;  3L1A A;  4F7U B;  1W4S A;  1KC8 U;  3CPW P;  1K76 A;  1E6G A;  3WXM B;  1K9M R;  2HL3 A;  4F7U E;  3A7A A;  5KYY B;  5DLQ E;  4QVZ A;  1VQO A;  2FZK B;  2ZR2 A;  1RLP C;  4C0G A;  2KT1 A;  1YI2 A;  1VQN Q;  4M78 C;  3CCV A;  2CJA A;  3VU3 C;  3FEO A;  1T3L A;  4IUP A;  3W3S A;  2MMP A;  1LPL A;  4M77 G;  4HCK A;  4X34 A;  1GCQ A;  2L5Q A;  2A36 A;  2P0Q A;  4C8Q B;  4E47 A;  4BB7 A;  4IUU A;  4DEY A;  2ZIN A;  4F7U A;  5J3B A;  1VQ6 A;  2AKW B;  2IPO B;  4FIB A;  1M2V A;  1X2K A;  4LUD A;  5GMK l;  3E1S A;  4II1 A;  3LSQ A;  3NGP A;  3CBO A;  3IQL A;  2O88 A;  2DL5 A;  3I5R A;  1JBM A;  1GFC A;  5FW9 A;  2FEI A;  4OF1 A;  1N9R A;  2X51 A;  4JRP A;  3M53 A;  2NUP A;  2WSC E;  3HRS A;  4BY6 C;  1YI2 T;  1VQP Q;  3RKY A;  4AFS C;  1SHG A;  3MCA B;  3G7Z A;  3BJU A;  1W66 A;  3BDU A;  3ASK A;  1VQ4 Q;  1ZUK A;  2JUF A;  5FRM A;  4J9C A;  2DA9 A;  4C92 A;  5LJ3 h;  3CCU T;  1WHL A;  2GQV A;  1PYS A;  3ZL7 C;  2QQS A;  1PM3 A;  2CH4 A;  2O9S A;  3JRZ A;  4P3N A;  3THK A;  3C12 A;  1M1F A;  2EQK A;  5LJ5 j;  1C0M A;  1Y96 B;  3P8D A;  4HWO A;  3LGL A;  4LDW A;  4PJO A;  5ELO A;  1XTD A;  1FX7 A;  3R6O A;  1PD1 A;  3JB9 G;  1N27 A;  4QVD A;  3PIP A;  5GAN 7;  4LVJ A;  1TOV A;  2NS6 A;  1MHN A;  1W2B S;  1NJ8 A;  4RTY A;  2M0Y A;  1LCK A;  2RO0 A;  2JN0 A;  1WIE A;  1SET A;  2CP7 A;  3EFR A;  1FXX A;  3TU4 K;  1YJW A;  1I07 A;  4CH4 A;  3JCM V;  1NBE B;  3IG2 A;  1UGS B;  2Z0W A;  4ZN1 A;  4IIM A;  1K8A C;  1QCF A;  3M58 A;  1EVL A;  2DJZ A;  1X6O A;  2JNG A;  1ZA1 B;  3VS7 A;  2C06 A;  4QT7 A;  2HQE A;  5IHI A;  2CZ1 B;  4Y91 A;  4J9B A;  2IG0 A;  2CSI A;  4DPG A;  3E19 A;  1Q86 R;  2Q7H A;  5GAN f;  2QHV A;  3NET A;  3CMQ A;  4P3O A;  5LL6 S;  3SWN C;  3H41 A;  1VQ5 Q;  2D0N A;  1KFZ A;  2JJ9 A;  4C5H A;  4J6X A;  2RHU A;  1IHV A;  2XDB A;  1VQ7 Q;  4TVR A;  2YRD A;  3HRU A;  2X4W A;  2XTI A;  2YXY A;  3QWY A;  2ZPF B;  3CD6 T;  2HBP A;  5GAM e;  2QAS A;  4HCZ A;  3G6E T;  1MUZ A;  5A0L A;  2I4O A;  2RJC A;  3A7R A;  1PKS A;  4O6J A;  4YRK A;  4YRP A;  9ATC B;  2EL9 A;  1Q7Y R;  1G3T A;  3FJ5 A;  1OI1 A;  1KSW A;  2IVW A;  4J83 A;  2CUD A;  2EYZ A;  2WAC A;  5GAM h;  1KIK A;  3EH2 A;  4DOW A;  1X55 A;  1H8K A;  1KD1 R;  4WI1 A;  2DYI A;  3CBM A;  3VUZ A;  4RTU A;  3QZ9 B;  5I11 A;  1N5Z A;  1ZUY A;  2JS0 A;  3DB3 A;  1H92 A;  3OW2 P;  3OYY A;  4M75 E;  4E7Z A;  3OS2 A;  2DEU A;  1UDL A;  3CCU A;  2A7Y A;  4ORZ A;  1AZE A;  1UEC A;  1KD1 U;  2F5T X;  3HFV A;  3HHT B;  3AT1 B;  3SFM A;  1CKB A;  3M0S A;  1ARK A;  3CCQ Q;  1TTH B;  1NG2 A;  3RKX A;  2ED0 A;  2JTE A;  3CC2 A;  1VQM Q;  3MKD A;  1UGV A;  3X25 B;  2DXT A;  2XMF A;  4KT0 E;  3LW5 E;  1YFT A;  1TU0 B;  5D7U A;  4C8Q D;  3VS3 A;  6AT1 B;  2LT4 A;  4PLL A;  4RG2 A;  4R0K A;  2DXB A;  4EMK C;  1VQO Q;  1IL2 A;  1V1C A;  4FT4 A;  4CC2 A;  1ZBX A;  2F2X A;  2X3X D;  3NTK A;  1PCX A;  3A8G B;  2RD1 A;  2JZ2 A;  5EC7 A;  2O2O A;  1PRM C;  4CS4 A;  3OYB A;  2QGF B;  4JJC A;  4DEX A;  4AH6 A;  4EPC A;  3QXE B;  2E5K A;  2DBM A;  4DBQ A;  1LJO A;  4EDU A;  2KXC A;  4FT2 A;  1E6H A;  3VS6 A;  3QZ5 B;  3UH0 A;  3M54 A;  1NYR A;  1U1S A;  3CC2 T;  3EG9 B;  1QVP A;  3SWN B;  1BIB A;  4PFO A;  5IN1 A;  3R07 A;  5GAM f;  4M75 C;  1M5Q 1;  3CCJ A;  3OMG A;  1KC8 R;  4YRN A;  2CDT A;  2DER A;  1S1N A;  4O5V A;  1VQ4 A;  1Y0M A;  3CCM T;  3T9N A;  4L6V 5;  2V8I A;  3CCJ Q;  2E65 A;  1VQP A;  3RF1 A;  1G8X A;  1U06 A;  1C6V X;  3E2U A;  4GY5 A;  4ZTJ A;  1FMK A;  1RAA B;  4C5I A;  2L2P A;  3OS5 A;  4D8K A;  3CCU Q;  3OBY A;  3RGL A;  4HKE A;  2ESW A;  4M77 C;  2KY9 A;  4PK4 A;  4G84 A;  2CP0 A;  2RHS B;  2OJ2 A;  3NEM A;  3JCM e;  1FMW A;  4JZ4 A;  1JEG A;  3JCM f;  4N0A C;  4HVW A;  2F2V A;  4UP9 A;  4XTW A;  3X28 B;  4PNO A;  3QO5 A;  2RH2 A;  1BCM A;  1JU5 C;  1L0W A;  2AMC A;  2RI5 A;  3OYK A;  1AD5 A;  3ZEH A;  1X43 A;  1GCP A;  2DYB A;  3E9G A;  4OMP A;  1Q7Y U;  4OMN A;  1UHC A;  4X1V A;  3V8L A;  1BU1 A;  1O75 A;  1LYL A;  1VQN A;  2JM9 A;  3JB9 I;  4A4K A;  1MMA A;  2VUB A;  4EMG A;  1U8R A;  1O9S A;  3RL6 A;  1VQ8 A;  1WDX A;  4J9H A;  3RMQ A;  3BFM A;  3I56 A;  3VUB A;  5IH2 A;  3CPW S;  1G3Y A;  1M2V B;  2AMC B;  2EAY A;  1QMC A;  1UE9 A;  1YB3 A;  3NFC A;  2DL3 A;  4FM4 B;  4L5G A;  2YLB A;  2KRM A;  2X35 A;  2M9U A;  3DKM A;  1YJW Q;  2LCC A;  1WLP B;  1A0N B;  3P8T A;  2ZIO A;  4AFU C;  1QW1 A;  1IB8 A;  4M78 G;  1NJI R;  5LJ5 f;  3QUI A;  1M3B A;  1GL5 A;  2L3S A;  1RI9 A;  3WVE B;  2P5I A;  4N4I A;  3OQ5 A;  4DBH A;  1WNL A;  4YRR A;  4WJ3 M;  4QQG A;  1ZSZ A;  2P4R A;  4HXJ A;  5LJ5 g;  1K1Z A;  4YCW A;  1R77 A;  2HSP A;  4A53 A;  4QQD A;  4YRL A;  3OYH A;  4A4E A;  2EJF A;  2ZZE A;  4RMO A;  1UEB A;  4P73 C;  3L42 A;  3M5A A;  3PGG A;  4R56 A;  4YTL A;  2AHJ B;  3PVQ A;  1H4S A;  4M77 D;  2XU8 A;  4X9D A;  1OX9 A;  5D6W A;  4J5Y A;  4OLF A;  1VQ5 A;  2DNU A;  5IAY A;  4XU3 A;  2YUO A;  3RR6 A;  1I5O B;  4IUQ A;  3CCS Q;  2HEQ A;  4HT9 A;  1VOM A;  1K8A R;  2VGN A;  3TVT A;  4LDV A;  2LJ1 A;  3GNF B;  2K2M A;  4CH5 A;  1G3W A;  1QWE A;  5I2M A;  4PL6 A;  2RQW A;  4A4F A;  2D0Q B;  2A3L A;  2YLC A;  1RI0 A;  2K3Y A;  5LJ5 d;  3V7S A;  2RJE A;  1ASY A;  4RMF A;  1XJW B;  3HRT A;  2Y4X A;  3LH0 A;  4UP7 A;  1PD0 A;  4P71 C;  2XDD A;  3RMS A;  1M3C A;  1OYX A;  2DF6 A;  2EFI A;  1XNI A;  2PTK A;  1M9S A;  4PJO D;  1YWP A;  4PLI A;  1QP2 A;  2ARU A;  5GMK e;  4M77 E;  1KMN A;  4KQE A;  3A8M B;  1B70 B;  1Y96 A;  1C0A A;  1W70 A;  1IXD A;  3QO7 A;  2AKW A;  3RUX A;  4BW9 A;  4IIO A;  3CEY A;  4M7D E;  1HXD A;  2DPP B;  4H2U A;  1YI2 Q;  1PRL C;  2LQN A;  1H3H A;  4RTZ A;  1VQK A;  3OMC A;  3CC2 Q;  1BBU A;  4ZTU B;  4A54 A;  4C92 B;  1IO6 A;  3JCM Q;  4A4G A;  2QQ9 A;  1G83 A;  1N6A A;  1WX6 A;  4XTY A;  2OAU A;  2XI9 A;  3FRN A;  2GFA A;  2RM4 A;  4J7I A;  4E2F B;  1AT1 B;  3UGQ A;  1K9M U;  2DQ0 A;  2EJG A;  2CH4 W;  3CMA A;  1Z7M A;  1KOG A;  2VXE A;  2A28 A;  4BY6 B;  1OV3 A;  2Q5H A;  1S72 T;  4LE9 A;  1QVF A;  2CSQ A;  2EKH A;  2NWM A;  3ER0 A;  1XQH A;  1KQ2 A;  1VQ6 T;  3U23 A;  1EX4 A;  3OYM A;  3JV3 A;  3FDR A;  1W2B P;  2MAM A;  3QG1 A;  5LJ3 j;  4OP0 A;  4KUL A;  1M90 C;  2CZ7 B;  1KQS P;  1KQ1 A;  4MZT A;  3H8Z A;  1SES A;  2DTH A;  1M3A A;  3MO8 A;  1VQK T;  1JJ2 P;  3G4S T;  1MGQ A;  1EZZ B;  2EYW A;  2FPD A;  3OYA A;  2CP3 A;  2PME A;  2HDA A;  3G71 Q;  5KNN A;  3RIR A;  2KXD A;  1OU9 A;  5GAN g;  3CCR Q;  4LVL A;  2JM8 A;  2K7A A;  3CCQ T;  3ULR B;  1BI1 A;  1QP3 A;  1WA7 A;  2YUQ A;  4P75 C;  2K3X A;  4HT4 A;  4MZP A;  2ZIM A;  5FRN A;  4F7U F;  5GAN 6;  1ZUU A;  2KE9 A;  3L2R A;  2ZCF B;  4C92 E;  3A8H B;  1D0Z A;  2O9V A;  2RQV A;  4H2W A;  1X75 C;  3FB9 A;  1WHH A;  1WHG A;  4J6Y A;  3EFO B;  4M78 A;  1G2B A;  3LYI A;  1OX8 A;  4J9E A;  5GAN e;  5KYN A;  2QGG A;  4F14 A;  2GBQ A;  3HPW A;  4NOY A;  2QQR A;  3A7U A;  1SRM A;  2RI3 A;  4QKU A;  1X56 A;  1VQ9 A;  3NEN A;  1UTI A;  1EIY A;  2QHU A;  4BI8 B;  2XDP A;  2Y4Y A;  2FZG B;  3A98 A;  2CT4 A;  4IUR A;  1UGP B;  4RTX A;  1QLY A;  1WHJ A;  4P74 A;  1EIF A;  2KVQ G;  4TQF A;  2MK5 A;  2RQT A;  2BZY A;  3FJP A;  3JCM W;  2HZY A;  2I4N A;  2GCX A;  4GBQ A;  4ZGJ B;  3JAM E;  3VV0 A;  1Q95 G;  4KGZ B;  1TWB A;  5A0G A;  4RQE A;  4PJO F;  4LD6 A;  4YRC A;  2AIR B;  3PIO A;  1LNX A;  2XK0 A;  4BE0 A;  3TEH B;  1NJ5 A;  2ZPI B;  1AWW A;  3V7C A;  1V29 B;  1NE8 A;  2BIV A;  2VWF A;  2FB7 A;  4CC7 A;  3BW1 A;  2DET A;  1BBW A;  2QXF A;  2QQA A;  2GQI A;  3GIB A;  5KCH A;  1QE0 A;  1OZ2 A;  4H2T A;  1Q86 U;  5GAM d;  1SRL A;  5A0D A;  5A2Q E;  3CXC P;  2PVG B;  4E7I A;  5I22 A;  2CRE A;  1ZX6 A;  3L4G B;  3E9H A;  4P5N A;  4FSX A;  3P8Y A;  3RBB B;  1ABO A;  1GRI A;  4OGC A;  3GNG A;  2C0O A;  1JJC B;  4BWA A;  4ESR A;  4WTO B;  4JLG A;  1VQL T;  4DBF A;  3NHN A;  4LVK A;  3UFG A;  2KRS A;  2ECZ A;  2PVD B;  2CGH A;  3A1P A;  4XTZ A;  1OPK A;  5GAO r;  1OUL A;  2ROL A;  3MQZ A;  2E10 A;  2KQW A;  3N5B B;  4YRQ A;  2CT3 A;  3FC3 A;  1PG5 B;  5GAN d;  2HSE B;  3O8V A;  4M7A G;  1NJI C;  1WGS A;  2CUB A;  1D0X A;  1OPL A;  4F17 A;  3JSC A;  4TVW A;  1IRX A;  1B7T A;  2QHT A;  2MCN A;  1ATI A;  4RUG A;  2DVE A;  2CJB A;  4MMK A;  4ELZ C;  2JVV A;  1UGQ B;  1DJ7 B;  2HAX A;  3FLG A;  3HXU A;  4RQF A;  2OAW A;  1Z9Z A;  3EGU A;  4C0D C;  4EO4 A;  1JQQ A;  3EG1 A;  2I4M A;  1TUC A;  3C95 A;  3S3O A;  2E12 A;  2AZV A;  2FZC B;  3D7S B;  4FCY A;  3CCL T;  1KQS A;  4ZGD B;  1KHI A;  4XTV A;  3JCM J;  3OSS C;  2J7I A;  5FRO A;  2EQU A;  4KUD K;  2H3J A;  5FWB A;  5CAI A;  3QDR B;  2LRQ A;  4QVC A;  1ZBJ A;  1YCY A;  4OGE A;  4HWR A;  4PFZ A;  2QA4 A;  5CKF A;  2Q7E A;  5ELN A;  2EQJ A;  4M75 D;  2PU9 B;  4LUE A;  1Z7N A;  3G6E A;  1NYF A;  2GTO A;  5CIU A;  3MEV A;  3NTH A;  5IXB A;  2ZT5 A;  3OS1 A;  2YRC A;  1M1K R;  1YP5 A;  3EFS A;  2FPF A;  2XID A;  3HFZ A;  3EG9 A;  3REA B;  3M57 A;  2KYM A;  1VA7 A;  4ZNX A;  4NS5 A;  2P4T A;  3WQZ A;  1X2H A;  3V8J A;  1FMV A;  5CKD A;  1YJN T;  2BE7 D;  4HVC A;  4M7A E;  2C0I A;  5CK9 A;  3QBY A;  2L0A A;  4P74 C;  1U3O A;  2XHC A;  2NUT A;  3REU A;  1SF9 A;  2MIO A;  4MML A;  5GAM g;  1K9A A;  5CR2 A;  1E24 A;  3PCO B;  3OBW A;  2OTL Q;  5GMK j;  2ABL A;  3MP1 A;  3SHW A;  2RF0 A;  1E1O A;  2PUO B;  4JZ3 A;  1H4Q A;  1ADJ A;  1KHC A;  1SSH A;  2NUP B;  5C53 B;  2YHT A;  2LQK A;  5HK0 A;  1WQW A;  2OX7 A;  2RJF A;  4FYW B;  1Q81 R;  2QDL A;  2C8M A;  3L4G A;  2NUZ A;  1N8R C;  2ZT7 A;  2DL7 A;  2QI2 A;  2EQI A;  3KXT A;  2CZ0 B;  3TEE A;  2FO0 A;  3SEM A;  1GBQ A;  1V76 A;  3A31 A;  3VQY A;  3GF5 A;  4ZN3 A;  2A8E A;  2LNV A;  1SKU B;  1H4V B;  4PG3 A;  3HXW A;  1IGQ A;  4CC4 B;  1I81 A;  5EG2 A;  1WZO A;  3CC7 A;  1WYD A;  2E6N A;  5LJ3 g;  3M0T A;  2AKL A;  4M78 D;  1HD3 A;  2SEM A;  2HD0 A;  4J8O A;  2JOY A;  5GAO n;  3VYH B;  4DA4 A;  5KYX B;  1I5L A;  3CCL A;  5AYF A;  3VS0 A;  1YIT Q;  2RHI A;  3UT1 A;  3VS1 A;  4M7D G;  1NYQ A;  2X4Y A;  1TSF A;  3VRZ A;  2SRC A;  2KT8 A;  2EYY A;  2KBT A;  2LCS A;  2DIQ A;  4RTT A;  1TUG B;  3CCJ T;  2B8A A;  1YCS B;  2CIM A;  5GAO q;  2FRW A;  2E5A A;  2K5I A;  4C92 C;  4DQ2 A;  2ZZD A;  3JCM P;  3CCE T;  1NPP A;  2RMO A;  3EH1 A;  1W2B A;  1B76 A;  3LC0 A;  4ZIB A;  4YRF A;  5HCK A;  5KE2 A;  2COZ A;  1NZ9 A;  3PFS A;  2OI3 A;  4MDW A;  3QYG B;  1AOJ A;  1M1G A;  4D6W A;  5FWC A;  4BE1 A;  3ERR A;  1KG1 A;  3VBB A;  4LVM A;  1VQ9 Q;  1I8F A;  4RCB A;  3QYH B;  3TUP A;  2AKK A;  2PVO B;  1N9W A;  2DTI A;  4C5G A;  4FW1 A;  4P72 C;  3S3M A;  1Y7X A;  1IHW A;  4Q6G A;  2W0Z A;  2LT1 A;  4HA8 A;  2R5M A;  1YFN A;  2DIL A;  2Y90 A;  4C5E A;  3KFV A;  3M4Q A;  4HVU A;  2VKN A;  1WFW A;  4M75 F;  2YRV A;  2ART A;  3EG3 A;  2A37 A;  3BDL A;  3HXV A;  2CYZ B;  2MOX A;  1YHQ T;  1JJC A;  3A74 A;  3NTI A;  1D1C A;  1SSF A;  5DY9 A;  1SEM A;  5GAO m;  2QG9 B;  3J80 E;  4L59 A;  1USY A;  3CCV T;  1NLP C;  4J7F A;  2QDY B;  4BI3 A;  2V1Q A;  2PQW A;  3CPF A;  3TCJ A;  2E3C A;  2JW4 A;  1J3T A;  2V1R A;  3PTA A;  2DRM A;  5GAN 3;  2DXC A;  2MI6 A;  3OY9 A;  1TXQ A;  2L3P A;  5D6Y A;  2ED1 A;  4YP0 A;  3CCM A;  1WXB A;  2PNI A;  1K8A U;  3PZC A;  3CCV Q;  4PHC A;  1BYM A;  3HRK A;  1SPK A;  2HNI A;  4C8Q A;  3HXZ A;  3JB9 J;  1ZLM A;  1D09 B;  3TEH A;  4RTV A;  3G1Z A;  4X5O A;  2OTL A;  3KUF A;  2LJ0 A;  4FYY B;  3M4Y A;  4F16 A;  1J5W A;  2P84 A;  3CCR T;  2DDZ A;  4WF2 A;  2RK2 A;  5CKE A;  4M78 E;  3GBQ A;  12AS A;  1R0B G;  3LWH A;  1RAF B;  3CME A;  4FU6 A;  4QW2 A;  5ECA A;  1SG5 A;  4C92 D;  4J9F A;  3CMA Q;  4Q5W A;  1Y07 A;  4JS5 A;  5DLO A;  3TEG A;  4EIK A;  3SDZ A;  5CQY A;  1F1B B;  5GMK i;  2ZNI A;  2DQ3 A;  5CKB A;  3VRY A;  4JPB W;  1U5S A;  5K1X A;  1N8R U;  1HJD A;  1JO8 A;  2LQW A;  1HTT A;  5GAN 4;  4C8Q F;  1M30 A;  2LTO A;  3UA6 A;  2J3M A;  2DO3 A;  2LX9 A;  1NJ1 A;  1VYT A;  1G51 A;  2RNA A;  3HXX A;  1YIJ A;  1H64 1;  1RAE B;  3RDV A;  1X01 A;  4X9C A;  1H4T A;  3RES A;  3OYC A;  5LJ3 e;  3I5S A;  1VYV A;  2X3W D;  2CZ6 B;  2JMA A;  1ACM B;  3REB B;  4ZTF A;  3HY0 A;  2JS2 A;  3PVL A;  5GJV B;  1D1A A;  3CME T;  5KYY A;  1R0C B;  1LOJ A;  1KK7 A;  4M77 F;  2HQX A;  3EHQ A;  1Q82 U;  1G5I A;  4V2S A;  2XGT A;  1RAG B;  4NCX A;  1WHM A;  2LQ8 A;  3CC4 Q;  4M7D F;  4MZM A;  5F5W A;  2IY5 B;  3L2U A;  1BK2 A;  3C4S A;  3CPW A;  2DU5 A;  5L23 A;  3OYI A;  2LDM A;  2ATC B;  3JCM h;  1QKX A;  2Q7G A;  4P75 A;  2K2V A;  4F04 B;  4OB0 B;  1ZSZ C;  5C51 B;  1NPR A;  5IHN A;  1D0Y A;  1YIJ T;  1YJ9 A;  2QEX Q;  5KH6 A;  4Q15 A;  4RCC A;  1E1T A;  5IXF A;  3CXC S;  2D9T A;  2R57 A;  2OTL T;  1ZSZ B;  5KYU B;  2EW3 A;  2DD5 A;  4AFQ C;  3L2V A;  1RAD B;  2O31 A;  2DJQ A;  3Q1J A;  3GP8 A;  4YRM A;  3QHS A;  2QAZ A;  2EQM A;  2RQU A;  4DBR A;  2F1L A;  3G71 A;  2VAS A;  1Q81 U;  3I56 T;  3L2W A;  3HSB A;  1WJS A;  4BAC A;  1M1K U;  4E7S A;  5GAM j;  3HRI A;  1B07 A;  2KAF A;  4NL2 A;  4AMC A;  1IZ6 A;  1GBR A;  1HK9 A;  4J6W A;  1JXM A;  3REX A;  3HTZ A;  1Y71 A;  2ZZF A;  2C7I A;  5CVI A;  2DKG A;  3A5Y A;  4J9G A;  4PJJ A;  1NJI U;  3OYN A;  4C0D B;  1GXI E;  1U1T A;  2QHS A;  2K79 A;  1QCN A;  1AVZ C;  2EGC A;  4C8Q E;  4NL3 A;  4Z02 A;  4ZTZ B;  2ENM A;  3OS0 A;  5KYW B;  1M8M A;  2L8D A;  1QF6 A;  1ABQ A;  3C0C A;  4CC3 A;  3G6E Q;  4TQD A;  4ATO A;  3UA7 A;  3I55 T;  3HTR A;  4C92 F;  2P0K A;  3G71 T;  3H0F A;  1VQ8 Q;  4RTW A;  1UJ0 A;  2QA4 Q;  1VQK Q;  4BDY A;  2HMA A;  2GFU A;  2DZ9 A;  1YJ9 Q;  4H02 A;  1KJW A;  1K0S A;  4YCV A;  1N8R R;  3OSV A;  4XU1 A;  4BD3 A;  1WLE A;  3V7R A;  4A4H A;  4FYV B;  2KSS A;  3L2Z A;  3M9Q A;  4K11 A;  3A8O B;  4JJB A;  1YN8 A;  2EWN A;  1UJY A;  2M02 A;  3QJY A;  2NUT B;  1S72 Q;  2RJD A;  4RG8 A;  1EQR A;  2V26 A;  4IKF A;  3EAE A;  1I0C A;  2COY A;  2ZR3 A;  2D8H A;  5L8R E;  1KMM A;  2JMC A;  1YJN A;  5FU7 C;  4C8Q C;  4JRK A;  1B7Y A;  2H8H A;  4HCC A;  2KRO A;  4GLM A;  3VS4 A;  3RNJ A;  1M1K C;  2AZS A;  4XEO A;  2XG8 D;  2C0T A;  3OYG A;  2EYQ A;  3HKS A;  4J15 A;  4AT1 B;  4K86 A;  3VKI A;  3E9I A;  4G85 A;  5IT9 E;  1AZG B;  1K73 R;  3RAC A;  3TRE A;  2ZTG A;  3M0P A;  3X24 B;  1QVG S;  3QNE A;  2MYS A;  5KYW A;  5I21 A;  2AT1 B;  2NYS A;  2ZAE A;  2DIG A;  3QTC A;  2BZ8 A;  1Q86 C;  5KYX A;  4E7K A;  2VV5 A;  1HSQ A;  1VQ4 T;  4ZGE B;  3GOX A;  2RN8 A;  1RAB B;  2DL4 A;  1SER A;  2L89 A;  2MF2 A;  2DZC A;  1UUE A;  1VQP T;  3M56 A;  4KGX B;  4IUT A;  1UGR B;  4Z8A A;  3WVD B;  2OTJ Q;  2VC8 A;  1QVF P;  3CC7 T;  2CP6 A;  3JCM c;  2M51 A;  2GF7 A;  3MEY A;  2FHD A;  2FVU A;  2XKO C;  2YDL A;  3MP6 A;  5GMK m;  1B8A A;  4BDZ A;  1FYF A;  3F70 A;  1VQM T;  4H2S A;  2EVR A;  2BZX A;  1IRE B;  1USY C;  3LWI A;  3EGD A;  4YRI A;  1JJ2 S;  2P0L A;  2QK0 A;  2ZT6 A;  2KR3 A;  2NLU A;  4IUV A;  1GFD A;  2I2L A;  3PMI A;  3MF1 A;  3RKW A;  4F7U G;  2GTJ A;  3UPU A;  1PYS B;  1EFW A;  1X27 A;  1VQO T;  3CBP A;  1TG0 A;  4HWS A;  3OYL A;  1EIY B;  3VJP A;  3QII A;  1YFS A;  4CS3 A;  2F2W A;  4XTX A;  2ZPB B;  3PCO A;  2RB6 A;  3TSZ A;  4TVA B;  1UG1 A;  2KGT A;  3DLL A;  5CKH A;  1B7Y B;  1UHF A;  2FG0 A;  1OEB A;  4BI4 A;  4FSS A;  4WCI A;  4PKC C;  1VQ8 T;  2A08 A;  2JT4 A;  4L87 A;  3TQ7 P;  1RL2 A;  4YPF A;  5GAN 2;  1MMD A;  3HFZ B;  2ROT A;  1Y57 A;  4YRE A;  3C94 A;  3UWN A;  1EOV A;  4E7L A;  3JCM d;  1YHQ Q;  5D6X A;  1YJW T;  4H2X A;  2CP2 A;  2BE9 B;  4P71 A;  2DK3 A;  2DL8 A;  1Q82 C;  4M7D C;  3G4S Q;  4LD9 K;  1RAC B;  1TH7 A;  4M7A D;  1QWF A;  2ZNJ A;  1OOT A;  2DAQ A;  4OML A;  1VQ7 A;  1QCO A;  5GAO p;  1I1J A;  4VUB A;  1WXT A;  3A32 A;  2J6O A;  2D8J A;  4JJN K;  1E22 A;  1W6X A;  4KUI A;  4PJO E;  3H6Z A;  3R6N A;  5GJW B;  2GNC A;  1MNE A;  4JRQ A;  1WU7 A;  2DLP A;  2ZPG B;  2DD4 A;  1WI7 A;  4OMF B;  3M0U A;  4P3P A;  2XD0 A;  5GMK h;  4KGV B;  3CD6 A;  4XTU A;  4Z88 A;  3M4P A;  1Q82 R;  3JCM g;  2DTO A;  2KK4 A;  3BY7 A;  2YWW A;  2A0F B;  1T3S A;  1K73 C;  3MET A;  2J6F A;  4JLI A;  4TTV A;  2G6F X;  3EGX B;  3CC7 Q;  2QEX T;  3CME Q;  1N9S A;  1NLO C;  1E7O A;  1NEG A;  3CC4 A;  4E7H A;  3H0I A;  2E1H A;  1JRI A;  1MV0 B;  1AWX A;  4LNS A;  1OZ3 A;  4AG2 C;  1PHT A;  2F5K A;  1WJQ A;  5CO7 A;  5M9O A;  2RHQ B;  3DSQ A;  2LNH B;  2X4J A;  5E3I A;  4D8D A;  2J05 A;  4OMM A;  3QSU A;  5HKC A;  5I2S A;  2BTT A;  2WSE E;  2FYK A;  1T0J A;  2RHQ A;  4XU0 A;  1WHK A;  3OYJ A;  5HK3 A;  1CSK A;  3EHR A;  3DLM A;  1B70 A;  4B9X A;  2YSQ A;  4B9W A;  4KH1 B;  2RHX A;  2WSF E;  1NNH A;  4C0F A;  2KRN A;  4YCU A;  3E9F A;  1M90 U;  4M78 B;  4YRS A;  4PJO C;  1RUW A;  4M4Z A;  1OU8 A;  1VUB A;  1X2G A;  1PC0 A;  3H0H A;  3QJ6 A;  2LZ6 B;  4M7D D;  2X4X A;  3QDF A;  4TVA A;  3AHU A;  3IKM B;  1UFF A;  4MDX A;  1X69 A;  3HXY A;  3UAT A;  1WJR A;  4JJD A;  1M4Z A;  4KRT A;  4PJM A;  4XU2 A;  3MJX A;  2YUP A;  3JCM b;  1XOV A;  1BCO A;  3J7A F;  3I35 A;  1SRY A;  3M0R A;  3MEA A;  5LJ5 e;  5C52 B;  2K6D A;  2JTM A;  1VQN T;  4M78 F;  3EGX A;  1P92 A;  3P8V A;  3CCE A;  4PJL A;  4PJN A;  2L3R A;  2RI2 A;  3NEL A;  3NMZ C;  1UB4 A;  1YFR A;  1OQK A;  5AT1 B;  4JRI A;  2M0O A;  4JUV A;  3VS2 A;  3UF4 A;  2MPX C;  2ZGW A;  3QKJ A;  2QA4 T;  2HKN A;  2ZPE B;  4B6M A;  2JXB A;  3CCS T;  5K1P A;  1X54 A;  5C0M A;  1MMN A;  2QQB A;  3KFU A;  2Q5I A;  3I55 Q;  1MV3 A;  2YT6 A;  3G4S A;  3A5Z A;  5DM7 R;  5LJ5 h;  4J9D A;  2W10 A;  4Z89 A;  5C6S A;  3JB9 D;  2PZ1 A;  4ANJ A;  2QEX A;  4RDX A;  2EIF A;  3OB9 A;  1T0H A;  4RKU E;  2LMJ A;  1D3B A;  2KDS A;  4M75 G;  4EMK B;  2DRK A;  2FL7 A;  1WQ7 A;  3MPU B;  4LNP A;  4M75 B;  1RIQ A;  3INZ A;  4BE2 A;  2DU7 A;  3OYE A;  1ASZ A;  1AWJ A;  5HGQ A;  3EG2 A;  2ODR C;  1BB9 A;  3S6W A;  3IAL A;  5GAN h;  2M16 A;  2MWP A;  1KQS S;  5J39 A;  3CD6 Q;  2E3H A;  5FU7 B;  4R55 A;  4M7D A;  4TWA A;  3ME9 A;  3IKL A;  2P0P A;  3CCS A;  4FYX B;  3I56 Q;  1KC8 C;  2E6Z A;  2LVM A;  3BE3 A;  2E41 A;  4JDS A;  1VQ5 T;  3J81 E;  1QVF S;  3KBG A;  4HVV A;  1VQ9 T;  1Q7Y C;  4Y92 A;  2J6K A;  3CCR A;  11AS A;  4EMH A;  1M2O A;  5FU6 B;  1K73 U;  5FLX E;  1YIJ Q;  2DM1 A;  2QTV A;  1MND A;  1VQL Q;  2RK1 A;  1JXO A;  8AT1 B;  5CCA A;  4A63 B;  3OA6 A;  3CCE Q;  1PNJ A;  2ZCE A;  2KNB B;  4C0Z A;  5LJ3 f;  3RER A;  4QQ6 A;  4K87 A;  4N4H A;  1SHF A;  3UDC A;  1VQL A;  4XEM A;  1AWO A;  2K5L A;  1BBZ A;  1R8O B;  1JJ2 A;  3S3N A;  4M7A A;  5J26 A;  2GGR A;  4YRO A;  1ZQ1 A;  1ZHI A;  1M8V A;  2K9G A;  1D3B B;  4FL6 A;  2OTJ T;  1RAH B;  4HT8 A;  3QO8 A;  1PSE A;  4TVY A;  1JB0 E;  4OVA A;  4LXC A;  4UPA A;  1VIF A;  1EFN A;  4YRT A;  1RAI B;  2QYZ A;  3OYF A;  4H2Y A;  2F69 A;  5FU6 C;  1KD1 C;  4CRI A;  2LP5 A;  2O4X A;  3P8H A;  3EFO A;  3UGT A;  1LVK A;  1B34 B;  1C1A A;  2HKQ B;  2LJ3 A;  3HFO A;  4E7J A;  2E3I A;  3HY1 A;  2CJ9 A;  2J3L A;  4E51 A;  2XIC A;  2FRY A;  3CCM Q;  3LSS A;  4AG1 C;  2KI7 A;  2VGM A;  1TS9 A;  3M55 A;  4M7A B;  2ZXF A;  1YJN Q;  2HL5 C;  2PUK B;  1WXU A;  1HC7 A;  2ODR D;  3MHX A;  3L2Q A;  4Y28 E;  1W1F A;  3OD1 A;  2EPD A;  3CMA T;  5CQX A;  3OW2 A;  1NM7 A;  2DMO A;  1GGM A;  2V8K A;  3ICA A;  4KH0 B;  4ELY C;  4OMO A;  4H2X B;  2OTJ A;  1M27 C;  3VQX A;  5GAN 5;  3PMT A;  2EGE A;  4CI0 C;  1B34 A;  1G3S A;  1YJ9 T;  2RHS A;  2K57 A;  2LCL A;  1K0X A;  2YUN A;  1EVK A;  2I0N A;  2EGA A;  4XAX B;  3X26 B;  2ALY B;  3M59 A;  2D1X A;  1Z9Q A;  4XK8 E;  1BI2 A;  1NEB A;  1VQM A;  2BKD N;  3PNW C;  3VS5 A;  2VXF A;  3O5Z A;  3QPH A;  1AEY A;  2ALY A;  2K5F A;  1CKA A;  3OYD A;  1RLQ C;  2IIM A;  1YNZ A;  3MEU A;  3CCQ A;  3H9N A;  4H2V A;  5GAN j;  2RPN A;  3URG A;  3HP9 A;  2K3B A;  1QVG A;  4LVI A;  2CS7 A;  3MEW A;  1NYG A;  2V8J A;  1X6G A;  1G5V A;  4C8Q G;  4YRG A;  4XQ3 A;  3OW2 S;  2L3Q A;  3GPL A;  4YRJ A;  4GLK A;  2E5Q A;  2E64 A;  4KR2 A;  1NJ6 A;  3MF2 A;  3LX7 A;  2KMT A;  3P8B B;  2DE0 X;  4PFP A;  4OB2 B;  4M75 A;  2D6F A;  2EJ9 A;  4J9I A;  1M90 R;  4LDY A;  1X6B A;  3VYG A;  3V8K A;  4KBM B;  3FIF A;  2R58 A;  2RHZ A;  3M4G A;  4WJ4 A;  1VQ6 Q;  5KE3 A;  2AK5 A;  2BUD A;  1PSF A;  1ZA2 B;  2MWO A;  1S72 A;  1PWT A;  1VYU A;  3CCL Q;  1IGU A;  3EG0 A;  2DX1 A;  3JCM X;  4ME7 A;  1K9M C;  5GAO l;  2G3R A;  3LGF A;  4LN2 A;  7AT1 B;  2FPE A;  4M7A F;  3DB4 A;  3GLX A;  2LX7 A;  2O01 E;  1H3Z A;  4CH6 A;  2PMF A;  3PE0 A;  1QVG P;  2R5A A;  3ZFJ A;  3TSW A;  4BUG A;  1BI3 A;  1NJ2 A;  4AFZ C;  2E70 A;  1FYN A;  3M0Q A;  4YYE A;  1X2Q A;  2JTF A;  3I7F A;  5GAN 8;  1AHJ B;  1VQ7 T;  2RA2 A;  2DFU A;  1YWO A;  4LDU A;  3VQW A;  2VVK A;  3VQV A;  5HY6 A;  3SB2 A;  1G5H A;  1FWZ A;  2DXU A;  5KYU A;  2J06 A;  2X9H A;  1I4K 1;  1YGB A;  1B3Q A;  1ZSG A;  4P73 A;  2ZZG A;  4K88 A;  2ZT8 A;  1YIT T;  1K4U S;  2I4L A;  1QKW A;  4C92 G;  2VB6 A;  4OB1 B;  4M7D B;  1WPY A;  8ATC B;  2KEA A;  3SD4 A;  2LC4 A;  4OB3 B;  5KCO A;  3A8L B;  1HYO A;  2RHY A;  1TUD A;  4M77 B;  4UC4 A;  4YDQ A;  4M7A C;  3JB9 H;  2HQH A;  4PJO G;  3CC4 T;  4HCB A;  2O4X B;  1WYX A;  2B86 A;  3I55 A;  4P72 A;  2RQR A;  2EKO A;  4PJO B;  1ADY A;  4O2D A;  2CKK A;  3LH5 A;  3JB9 F;  2QTX A;  2COW A;  1Q81 C;  3SWN A;  2H3E B;  4KR3 A;  2K4Y A;  4EX5 A;  1BIA A;  4N4G A;  3CQT A;  2DVJ A;  3QWX X;  2G4C A;  3A5Z B;  1VIE A;  4DOV A;  5LJ3 d;  4FW2 A;  2VYT A;  3EGD B;  2ARS A;  4OMQ A;  4E6R A;  3G1J A;  2CP5 A;  2IY5 A;  1YIT A;  2DBK A;  1YHQ A;  4M77 A;  4HWT A;  3X20 B;  2KYB A;  1GCQ C;  3CXC A;  1MMG A;  2HBW A;  4CH3 A;  4EMK A;  4LDX A;  1BI0 A;  4N0A A;  3ZBD A;  3MP8 A;  1QQJ A;  3HFN A;  1YBY A;  1PKT A;  2ZPH B;  4JS4 A;  3I9Q A;  5IHK A;  4UP8 A;  2DEQ A;  2HCK A;  3NPF A;  3HL8 A;  3LLR A;  1VQZ A;  1BKB A;  2EYX A;  3PT9 A;  4HWP A;  2M1H A; 
#chains in the Genus database with same CATH homology
 3QO3 A;  4CS2 A;  3L1A A;  4F7U B;  1W4S A;  1KC8 U;  3WXM B;  4F7U E;  3A7A A;  5DLQ E;  4QVZ A;  1VQO A;  2ZR2 A;  4C0G A;  1YI2 A;  4M78 C;  3CCV A;  2CJA A;  3VU3 C;  3FEO A;  4IUP A;  3W3S A;  2MMP A;  4M77 G;  4X34 A;  2L5Q A;  2P0Q A;  4C8Q B;  4E47 A;  4BB7 A;  4IUU A;  2ZIN A;  4F7U A;  5J3B A;  1VQ6 A;  2AKW B;  4FIB A;  5GMK l;  3E1S A;  4II1 A;  3LSQ A;  3CBO A;  1JBM A;  4OF1 A;  1N9R A;  4JRP A;  3M53 A;  3HRS A;  2WSC E;  4BY6 C;  1YI2 T;  3RKY A;  3MCA B;  3G7Z A;  3BJU A;  1W66 A;  3BDU A;  3ASK A;  2JUF A;  5FRM A;  4C92 A;  5LJ3 h;  3CCU T;  2GQV A;  1PYS A;  2QQS A;  3JRZ A;  4P3N A;  3C12 A;  1M1F A;  2EQK A;  5LJ5 j;  1Y96 B;  3P8D A;  4HWO A;  3LGL A;  4LDW A;  4PJO A;  5ELO A;  1XTD A;  1FX7 A;  3R6O A;  3JB9 G;  1N27 A;  4QVD A;  3PIP A;  5GAN 7;  4LVJ A;  2NS6 A;  1MHN A;  1W2B S;  1NJ8 A;  2RO0 A;  2JN0 A;  1SET A;  3EFR A;  1FXX A;  3TU4 K;  1YJW A;  4CH4 A;  3JCM V;  3IG2 A;  1UGS B;  4ZN1 A;  1K8A C;  3M58 A;  1EVL A;  2DJZ A;  1X6O A;  2JNG A;  2C06 A;  2HQE A;  2CZ1 B;  4Y91 A;  2IG0 A;  4DPG A;  3E19 A;  2Q7H A;  5GAN f;  2QHV A;  3NET A;  3CMQ A;  4P3O A;  5LL6 S;  3SWN C;  4C5H A;  4J6X A;  2RHU A;  2XDB A;  4TVR A;  3HRU A;  2X4W A;  2XTI A;  2ZPF B;  3CD6 T;  2HBP A;  5GAM e;  4HCZ A;  3G6E T;  5A0L A;  2I4O A;  2RJC A;  3A7R A;  4O6J A;  4YRK A;  4YRP A;  2EL9 A;  1G3T A;  1OI1 A;  2IVW A;  4J83 A;  2WAC A;  5GAM h;  4DOW A;  1X55 A;  4WI1 A;  3CBM A;  3VUZ A;  3QZ9 B;  3DB3 A;  3OYY A;  4M75 E;  3OS2 A;  3CCU A;  2A7Y A;  1KD1 U;  2F5T X;  3HFV A;  3HHT B;  3SFM A;  3RKX A;  3CC2 A;  3X25 B;  2DXT A;  4KT0 E;  3LW5 E;  1YFT A;  4C8Q D;  2LT4 A;  4PLL A;  4RG2 A;  2DXB A;  4EMK C;  1IL2 A;  4FT4 A;  1ZBX A;  3NTK A;  3A8G B;  2RD1 A;  2JZ2 A;  4CS4 A;  3OYB A;  4AH6 A;  4EPC A;  3QXE B;  1LJO A;  4EDU A;  4FT2 A;  3QZ5 B;  3UH0 A;  3M54 A;  1NYR A;  1U1S A;  3CC2 T;  1QVP A;  3SWN B;  1BIB A;  5IN1 A;  3R07 A;  5GAM f;  4M75 C;  1M5Q 1;  3CCJ A;  3OMG A;  4YRN A;  4O5V A;  1VQ4 A;  3CCM T;  3T9N A;  4L6V 5;  2V8I A;  2E65 A;  1VQP A;  3RF1 A;  4GY5 A;  4ZTJ A;  4C5I A;  3OS5 A;  3OBY A;  3RGL A;  4HKE A;  4G84 A;  4M77 C;  2KY9 A;  2RHS B;  3NEM A;  3JCM e;  3JCM f;  4N0A C;  4UP9 A;  4XTW A;  3X28 B;  4PNO A;  3QO5 A;  2RH2 A;  1L0W A;  2AMC A;  2RI5 A;  3OYK A;  3ZEH A;  3E9G A;  1Q7Y U;  3V8L A;  1O75 A;  1LYL A;  1VQN A;  3JB9 I;  4A4K A;  2VUB A;  4EMG A;  1U8R A;  1O9S A;  3RL6 A;  1VQ8 A;  3RMQ A;  3BFM A;  3I56 A;  3VUB A;  3CPW S;  1G3Y A;  2AMC B;  2EAY A;  1YB3 A;  3NFC A;  4FM4 B;  4L5G A;  2YLB A;  2X35 A;  2M9U A;  3DKM A;  2LCC A;  3P8T A;  2ZIO A;  1QW1 A;  4M78 G;  5LJ5 f;  3QUI A;  3WVE B;  2P5I A;  4N4I A;  3OQ5 A;  4YRR A;  1WNL A;  4WJ3 M;  4QQG A;  5LJ5 g;  4YCW A;  4A53 A;  4QQD A;  4YRL A;  3OYH A;  4A4E A;  2EJF A;  2ZZE A;  4RMO A;  1UEB A;  4P73 C;  3L42 A;  3M5A A;  3PGG A;  4R56 A;  4YTL A;  2AHJ B;  1H4S A;  4M77 D;  2XU8 A;  4X9D A;  4OLF A;  5D6W A;  4J5Y A;  1VQ5 A;  5IAY A;  4XU3 A;  4IUQ A;  4HT9 A;  2VGN A;  4LDV A;  3GNF B;  4CH5 A;  1G3W A;  5I2M A;  4PL6 A;  4A4F A;  2D0Q B;  2A3L A;  2YLC A;  1RI0 A;  2K3Y A;  5LJ5 d;  3V7S A;  2RJE A;  1ASY A;  4RMF A;  3HRT A;  2Y4X A;  3LH0 A;  4UP7 A;  4P71 C;  2XDD A;  3RMS A;  1OYX A;  2EFI A;  1XNI A;  1M9S A;  4PJO D;  4PLI A;  2ARU A;  1QP2 A;  5GMK e;  4M77 E;  1KMN A;  4KQE A;  3A8M B;  1B70 B;  1Y96 A;  1C0A A;  3QO7 A;  2AKW A;  3RUX A;  4BW9 A;  3CEY A;  4M7D E;  1HXD A;  2DPP B;  4H2U A;  1VQK A;  3OMC A;  1BBU A;  4ZTU B;  4A54 A;  4C92 B;  3JCM Q;  4A4G A;  2QQ9 A;  1N6A A;  4XTY A;  2OAU A;  2XI9 A;  3FRN A;  2GFA A;  2RM4 A;  4J7I A;  3UGQ A;  1K9M U;  2DQ0 A;  2EJG A;  3CMA A;  1Z7M A;  1KOG A;  2VXE A;  4BY6 B;  2Q5H A;  1S72 T;  1QVF A;  3ER0 A;  1XQH A;  1KQ2 A;  1VQ6 T;  3OYM A;  3FDR A;  2MAM A;  3QG1 A;  5LJ3 j;  4OP0 A;  4KUL A;  1M90 C;  2CZ7 B;  1KQ1 A;  4MZT A;  3H8Z A;  1SES A;  2DTH A;  3MO8 A;  1VQK T;  3G4S T;  1MGQ A;  3OYA A;  2PME A;  5KNN A;  3RIR A;  5GAN g;  4LVL A;  3CCQ T;  1BI1 A;  1QP3 A;  4P75 C;  2K3X A;  4HT4 A;  4MZP A;  2ZIM A;  5FRN A;  4F7U F;  5GAN 6;  3L2R A;  2ZCF B;  4C92 E;  3A8H B;  4H2W A;  1X75 C;  3FB9 A;  4J6Y A;  4M78 A;  3LYI A;  5GAN e;  3HPW A;  4NOY A;  2QQR A;  3A7U A;  2RI3 A;  1X56 A;  1VQ9 A;  3NEN A;  1EIY A;  2QHU A;  4BI8 B;  2XDP A;  2Y4Y A;  4IUR A;  1UGP B;  4P74 A;  1EIF A;  2KVQ G;  4TQF A;  3FJP A;  3JCM W;  2I4N A;  2GCX A;  4ZGJ B;  3JAM E;  3VV0 A;  5A0G A;  4RQE A;  4PJO F;  4LD6 A;  4YRC A;  3PIO A;  1LNX A;  2XK0 A;  4BE0 A;  3TEH B;  1NJ5 A;  2ZPI B;  3V7C A;  1V29 B;  1NE8 A;  2BIV A;  2FB7 A;  3BW1 A;  1BBW A;  2QXF A;  2QQA A;  3GIB A;  5KCH A;  1QE0 A;  1OZ2 A;  4H2T A;  1Q86 U;  5GAM d;  5A0D A;  5A2Q E;  2PVG B;  4E7I A;  3L4G B;  3E9H A;  4P5N A;  4FSX A;  3P8Y A;  4OGC A;  3GNG A;  1JJC B;  4BWA A;  4JLG A;  1VQL T;  4LVK A;  3UFG A;  2PVD B;  2CGH A;  4XTZ A;  5GAO r;  3MQZ A;  2E10 A;  2KQW A;  3N5B B;  4YRQ A;  3FC3 A;  5GAN d;  3O8V A;  4M7A G;  1NJI C;  1WGS A;  4TVW A;  3JSC A;  2QHT A;  1ATI A;  2DVE A;  2CJB A;  4MMK A;  4ELZ C;  2JVV A;  1UGQ B;  1DJ7 B;  2HAX A;  3FLG A;  3HXU A;  4RQF A;  4C0D C;  4EO4 A;  2I4M A;  3C95 A;  3S3O A;  2E12 A;  3CCL T;  1KQS A;  4ZGD B;  1KHI A;  4XTV A;  3JCM J;  3OSS C;  5FRO A;  2EQU A;  4KUD K;  2H3J A;  5CAI A;  3QDR B;  2LRQ A;  4QVC A;  1YCY A;  4OGE A;  4HWR A;  2QA4 A;  5CKF A;  2Q7E A;  5ELN A;  2EQJ A;  4M75 D;  2PU9 B;  1Z7N A;  3G6E A;  5CIU A;  3MEV A;  3NTH A;  2ZT5 A;  3OS1 A;  3EFS A;  2XID A;  3HFZ A;  3M57 A;  4NS5 A;  2P4T A;  3WQZ A;  1X2H A;  3V8J A;  5CKD A;  1YJN T;  4HVC A;  4M7A E;  5CK9 A;  3QBY A;  4P74 C;  2XHC A;  3REU A;  4MML A;  5GAM g;  5CR2 A;  1E24 A;  3PCO B;  3OBW A;  5GMK j;  3MP1 A;  1E1O A;  2PUO B;  1H4Q A;  1ADJ A;  1KHC A;  5C53 B;  2YHT A;  2LQK A;  5HK0 A;  1WQW A;  2RJF A;  2C8M A;  3L4G A;  1N8R C;  2ZT7 A;  2QI2 A;  3KXT A;  2CZ0 B;  3TEE A;  3A31 A;  3VQY A;  3GF5 A;  4ZN3 A;  2A8E A;  2LNV A;  1H4V B;  4PG3 A;  3HXW A;  1I81 A;  5EG2 A;  3CC7 A;  1WYD A;  2E6N A;  5LJ3 g;  4M78 D;  2HD0 A;  4J8O A;  2JOY A;  5GAO n;  3VYH B;  4DA4 A;  1I5L A;  3CCL A;  5AYF A;  2RHI A;  3UT1 A;  4M7D G;  1NYQ A;  2X4Y A;  2DIQ A;  3CCJ T;  2B8A A;  2CIM A;  5GAO q;  2E5A A;  2K5I A;  4C92 C;  4DQ2 A;  2ZZD A;  3JCM P;  3CCE T;  1NPP A;  1W2B A;  1B76 A;  3LC0 A;  4ZIB A;  4YRF A;  5KE2 A;  1NZ9 A;  3PFS A;  3QYG B;  1M1G A;  4MDW A;  4D6W A;  4BE1 A;  3ERR A;  1KG1 A;  3VBB A;  4LVM A;  1I8F A;  4RCB A;  3QYH B;  3TUP A;  2PVO B;  1N9W A;  2DTI A;  4C5G A;  4P72 C;  3S3M A;  1Y7X A;  4Q6G A;  2LT1 A;  4HA8 A;  2R5M A;  2Y90 A;  4C5E A;  3M4Q A;  2ART A;  2YRV A;  4M75 F;  3BDL A;  3HXV A;  2CYZ B;  1YHQ T;  1JJC A;  3A74 A;  3NTI A;  1SSF A;  5DY9 A;  5GAO m;  3J80 E;  4L59 A;  1USY A;  3CCV T;  4J7F A;  2QDY B;  4BI3 A;  2PQW A;  3CPF A;  3TCJ A;  2E3C A;  3PTA A;  5GAN 3;  2DXC A;  2MI6 A;  3OY9 A;  5D6Y A;  4YP0 A;  3CCM A;  1K8A U;  3PZC A;  4PHC A;  1BYM A;  3HRK A;  2HNI A;  4C8Q A;  3HXZ A;  3JB9 J;  3TEH A;  3G1Z A;  4X5O A;  2OTL A;  3KUF A;  3M4Y A;  1J5W A;  3CCR T;  2DDZ A;  4WF2 A;  2RK2 A;  5CKE A;  4M78 E;  12AS A;  3LWH A;  3CME A;  4FU6 A;  4QW2 A;  4C92 D;  4Q5W A;  1Y07 A;  4JS5 A;  5DLO A;  3TEG A;  3SDZ A;  5CQY A;  5GMK i;  2ZNI A;  2DQ3 A;  5CKB A;  5K1X A;  1N8R U;  1HTT A;  5GAN 4;  4C8Q F;  2LTO A;  2J3M A;  2DO3 A;  2LX9 A;  1NJ1 A;  1G51 A;  3HXX A;  1YIJ A;  1H64 1;  1X01 A;  4X9C A;  1H4T A;  3RES A;  3OYC A;  5LJ3 e;  2CZ6 B;  4ZTF A;  3HY0 A;  3CME T;  1LOJ A;  4M77 F;  2HQX A;  1Q82 U;  1G5I A;  4V2S A;  2XGT A;  4NCX A;  2LQ8 A;  2IY5 B;  4M7D F;  4MZM A;  5F5W A;  3L2U A;  3C4S A;  3CPW A;  2DU5 A;  3OYI A;  2LDM A;  3JCM h;  4P75 A;  2Q7G A;  2K2V A;  4OB0 B;  5C51 B;  1NPR A;  1YIJ T;  1YJ9 A;  5KH6 A;  4Q15 A;  4RCC A;  1E1T A;  3CXC S;  2D9T A;  2R57 A;  2OTL T;  2DD5 A;  3L2V A;  3Q1J A;  4YRM A;  3GP8 A;  3QHS A;  2EQM A;  3G71 A;  1Q81 U;  3I56 T;  3L2W A;  3HSB A;  1WJS A;  4BAC A;  1M1K U;  5GAM j;  3HRI A;  2KAF A;  4NL2 A;  1IZ6 A;  1HK9 A;  4J6W A;  3REX A;  3HTZ A;  1Y71 A;  2ZZF A;  2C7I A;  5CVI A;  2DKG A;  3A5Y A;  1NJI U;  3OYN A;  4C0D B;  1GXI E;  1U1T A;  2QHS A;  4C8Q E;  4NL3 A;  4Z02 A;  4ZTZ B;  3OS0 A;  2L8D A;  1QF6 A;  4TQD A;  4ATO A;  3I55 T;  4C92 F;  2P0K A;  3G71 T;  4BDY A;  2GFU A;  2DZ9 A;  4YCV A;  4H02 A;  3OSV A;  4XU1 A;  4BD3 A;  1WLE A;  3V7R A;  4A4H A;  2KSS A;  3L2Z A;  3M9Q A;  3A8O B;  2EWN A;  3QJY A;  2RJD A;  4RG8 A;  1EQR A;  4IKF A;  3EAE A;  2ZR3 A;  5L8R E;  1KMM A;  1YJN A;  5FU7 C;  4C8Q C;  4JRK A;  1B7Y A;  4HCC A;  1M1K C;  4XEO A;  2XG8 D;  3OYG A;  2EYQ A;  3HKS A;  4J15 A;  4K86 A;  3VKI A;  3E9I A;  4G85 A;  5IT9 E;  3RAC A;  3TRE A;  2ZTG A;  3X24 B;  1QVG S;  3QNE A;  5I21 A;  2DIG A;  3QTC A;  1Q86 C;  4E7K A;  2VV5 A;  1VQ4 T;  4ZGE B;  3GOX A;  1SER A;  2L89 A;  2MF2 A;  2DZC A;  1VQP T;  3M56 A;  4IUT A;  1UGR B;  3WVD B;  2VC8 A;  3CC7 T;  3JCM c;  2GF7 A;  3MEY A;  2FHD A;  2FVU A;  2XKO C;  3MP6 A;  5GMK m;  1B8A A;  4BDZ A;  1FYF A;  3F70 A;  1VQM T;  4H2S A;  1IRE B;  1USY C;  3LWI A;  4YRI A;  1JJ2 S;  2P0L A;  2ZT6 A;  2NLU A;  4IUV A;  2I2L A;  3PMI A;  3MF1 A;  3RKW A;  4F7U G;  3UPU A;  1PYS B;  1EFW A;  1VQO T;  3CBP A;  4HWS A;  3OYL A;  1EIY B;  3VJP A;  3QII A;  1YFS A;  4CS3 A;  4XTX A;  2ZPB B;  3PCO A;  2RB6 A;  4TVA B;  3DLL A;  5CKH A;  1B7Y B;  4BI4 A;  4PKC C;  1VQ8 T;  4L87 A;  1RL2 A;  4YPF A;  5GAN 2;  3HFZ B;  4YRE A;  3C94 A;  3UWN A;  1EOV A;  4E7L A;  3JCM d;  5D6X A;  1YJW T;  4H2X A;  4P71 A;  2DK3 A;  1Q82 C;  4M7D C;  4LD9 K;  1TH7 A;  4M7A D;  2ZNJ A;  2DAQ A;  1VQ7 A;  5GAO p;  4VUB A;  3A32 A;  4JJN K;  1E22 A;  4KUI A;  4PJO E;  3H6Z A;  4JRQ A;  1WU7 A;  2ZPG B;  2DD4 A;  4OMF B;  4P3P A;  2XD0 A;  5GMK h;  3CD6 A;  4XTU A;  3M4P A;  3JCM g;  2DTO A;  2KK4 A;  3BY7 A;  1K73 C;  3MET A;  4JLI A;  4TTV A;  2QEX T;  1N9S A;  3CC4 A;  4E7H A;  2E1H A;  1JRI A;  4LNS A;  1OZ3 A;  2F5K A;  1WJQ A;  5CO7 A;  5M9O A;  3DSQ A;  2RHQ B;  2X4J A;  5E3I A;  3QSU A;  5HKC A;  5I2S A;  2WSE E;  2FYK A;  2RHQ A;  4XU0 A;  3OYJ A;  5HK3 A;  3DLM A;  1B70 A;  4B9X A;  4B9W A;  2RHX A;  2WSF E;  1NNH A;  4C0F A;  4YCU A;  3E9F A;  1M90 U;  4M78 B;  4YRS A;  4PJO C;  1VUB A;  1X2G A;  3QJ6 A;  4M7D D;  2X4X A;  4TVA A;  3AHU A;  3IKM B;  4MDX A;  3HXY A;  1WJR A;  1M4Z A;  4XU2 A;  3JCM b;  1XOV A;  3J7A F;  1SRY A;  3MEA A;  5LJ5 e;  5C52 B;  2JTM A;  1VQN T;  4M78 F;  1P92 A;  3P8V A;  3CCE A;  2L3R A;  2RI2 A;  3NEL A;  1YFR A;  1UB4 A;  4JRI A;  2M0O A;  4JUV A;  2ZGW A;  3QKJ A;  2QA4 T;  2ZPE B;  3CCS T;  5K1P A;  1X54 A;  5C0M A;  2QQB A;  3KFU A;  2Q5I A;  3G4S A;  3A5Z A;  5DM7 R;  5LJ5 h;  5C6S A;  3JB9 D;  2QEX A;  4RDX A;  2EIF A;  3OB9 A;  4RKU E;  1D3B A;  2KDS A;  4M75 G;  4EMK B;  2FL7 A;  1WQ7 A;  4M75 B;  1RIQ A;  3INZ A;  4BE2 A;  2DU7 A;  3OYE A;  1ASZ A;  5HGQ A;  2ODR C;  3IAL A;  3S6W A;  5GAN h;  2M16 A;  2MWP A;  1KQS S;  5J39 A;  5FU7 B;  4R55 A;  4M7D A;  4TWA A;  3ME9 A;  3IKL A;  2P0P A;  3CCS A;  1KC8 C;  2E6Z A;  2LVM A;  2E41 A;  4JDS A;  1VQ5 T;  3J81 E;  1QVF S;  3KBG A;  1VQ9 T;  1Q7Y C;  3CCR A;  11AS A;  4EMH A;  5FU6 B;  1K73 U;  5FLX E;  2RK1 A;  5CCA A;  3OA6 A;  2ZCE A;  4C0Z A;  5LJ3 f;  3RER A;  4QQ6 A;  4K87 A;  4N4H A;  3UDC A;  1VQL A;  4XEM A;  2K5L A;  1R8O B;  1JJ2 A;  3S3N A;  4M7A A;  5J26 A;  4YRO A;  1ZQ1 A;  1ZHI A;  1M8V A;  4FL6 A;  1D3B B;  2OTJ T;  3QO8 A;  4HT8 A;  1PSE A;  4TVY A;  1JB0 E;  4OVA A;  4UPA A;  1VIF A;  4YRT A;  3OYF A;  4H2Y A;  2F69 A;  5FU6 C;  1KD1 C;  4CRI A;  2O4X A;  3P8H A;  3UGT A;  1B34 B;  3HFO A;  4E7J A;  3HY1 A;  2CJ9 A;  2J3L A;  4E51 A;  2XIC A;  3LSS A;  2VGM A;  3M55 A;  4M7A B;  2ZXF A;  2ODR D;  2PUK B;  1HC7 A;  3MHX A;  3L2Q A;  4Y28 E;  3OD1 A;  3CMA T;  5CQX A;  3OW2 A;  1GGM A;  2V8K A;  3ICA A;  4ELY C;  4H2X B;  2OTJ A;  3VQX A;  5GAN 5;  3PMT A;  4CI0 C;  1B34 A;  1G3S A;  1YJ9 T;  2RHS A;  2K57 A;  2LCL A;  1EVK A;  4XAX B;  3X26 B;  2ALY B;  3M59 A;  4XK8 E;  1BI2 A;  1VQM A;  2BKD N;  3PNW C;  2VXF A;  2ALY A;  3QPH A;  2K5F A;  3OYD A;  3MEU A;  3CCQ A;  4H2V A;  5GAN j;  3URG A;  3HP9 A;  1QVG A;  4LVI A;  2CS7 A;  3MEW A;  2V8J A;  1G5V A;  4C8Q G;  4YRG A;  4XQ3 A;  3OW2 S;  3GPL A;  4YRJ A;  4GLK A;  2E5Q A;  2E64 A;  4KR2 A;  1NJ6 A;  3MF2 A;  3LX7 A;  2KMT A;  3P8B B;  4OB2 B;  4M75 A;  2D6F A;  2EJ9 A;  4LDY A;  3VYG A;  3V8K A;  4KBM B;  3FIF A;  2R58 A;  2RHZ A;  3M4G A;  4WJ4 A;  5KE3 A;  2BUD A;  1PSF A;  2MWO A;  1S72 A;  3JCM X;  4ME7 A;  1K9M C;  5GAO l;  2G3R A;  3LGF A;  4M7A F;  3DB4 A;  3GLX A;  2O01 E;  1H3Z A;  4CH6 A;  2PMF A;  2R5A A;  3ZFJ A;  4BUG A;  1BI3 A;  1NJ2 A;  2E70 A;  4YYE A;  2JTF A;  3I7F A;  5GAN 8;  1AHJ B;  1VQ7 T;  2RA2 A;  4LDU A;  3VQW A;  3VQV A;  5HY6 A;  3SB2 A;  1G5H A;  1FWZ A;  2DXU A;  1I4K 1;  1YGB A;  4P73 A;  2ZZG A;  4K88 A;  2ZT8 A;  1YIT T;  2I4L A;  4C92 G;  4OB1 B;  4M7D B;  1WPY A;  3SD4 A;  2LC4 A;  4OB3 B;  5KCO A;  3A8L B;  2RHY A;  4M77 B;  4UC4 A;  4YDQ A;  4M7A C;  3JB9 H;  4PJO G;  3CC4 T;  4HCB A;  2O4X B;  3I55 A;  4P72 A;  2EKO A;  4O2D A;  4PJO B;  1ADY A;  2CKK A;  3JB9 F;  2QTX A;  1Q81 C;  3SWN A;  4KR3 A;  2K4Y A;  4EX5 A;  1BIA A;  4N4G A;  2G4C A;  3A5Z B;  1VIE A;  4DOV A;  5LJ3 d;  2VYT A;  2ARS A;  2IY5 A;  1YIT A;  1YHQ A;  4M77 A;  4HWT A;  3X20 B;  3CXC A;  4CH3 A;  4EMK A;  4LDX A;  1BI0 A;  4N0A A;  3ZBD A;  3MP8 A;  3HFN A;  1YBY A;  4UP8 A;  2ZPH B;  4JS4 A;  2DEQ A;  3HL8 A;  3LLR A;  1VQZ A;  1BKB A;  3PT9 A;  4HWP A;  2M1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...