4XU3A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 263
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu3A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu3A01
4QVDA 3A5ZA 4YCWA 2ZNJA 3MEYA 2ZT8A 4XTWA 1RIQA 4P75A 4XQ3A 5LJ5j 3RESA 5GANd 4UP7A 3GIBA 4YRGA 4M78F 4OP0A 2EJ9A 4HVCA 1E22A 2AMCB 3M4PA 4XU2A 2ODRD 3RL6A 4X5OA 4OLFA 4E51A 1E1OA 1B7YA 4M78G 2ZINA 2AKWA 2ZT5A 2Q5HA 2ZIOA 4K86A 1LYLA 4TVWA 3REUA 2K57A 4PJOD 3JCMe 3V8LA 4M7DA 5GMKj 4M7AC 2RB6A 3HFNA 4M75A 4H2TA 2DXTA 5GANh 3HY0A 4C8QB 4TTVA 4YRSA 4P3NA 1LJOA 1IL2A 2CJBA 4YCVA 1WLEA 4CS4A 4M77A 4CH5A 2ZR2A 1H641 3M4QA 1N9WA 1H4QA 4XTXA 4EMKB 3A5YA 5LJ3d 2RHQB 3VQXA 1I8FA 1NJ5A 3JCMQ 4TQFA 2AMCA 2XTIA 3JB9G 2C7IA 5LJ5f 3RIRA 3RACA 4C92E 4P72A 4ZIBA 1ADJA 4M7AG 4J6YA 3JCMW 3JCMP 3HFOA 3V8KA 3A32A 4CS3A 4M78B 3EFSA 2J3LA 4P74C 4CH4A 4XTUA 2DTOA 4XEOA 3P8YA 2ODRC 2VXEA 4X9DA 4F7UF 2QHSA 2VXFA 2EAYA 1G5HA 3IKLA 1H4SA 3QUIA 5LJ3h 3RGLA 2RHSB 4PJOC 3VU3C 2DKGA 1H4TA 4J6WA 4EMKA 4A53A 4F7UG 2RHQA 3EFRA 4N0AC 4TVAB 5ELOA 1X01A 5K1XA 2QTXA 5GAMg 3PCOA 1U1TA 4AH6A 5GMKe 4RCBA 4H2YA 4HA8A 1EVKA 3HFZB 3RUXA 4EX5A 2FB7A 3A7RA 2P0LA 4PG3A 4M7AB 4A54A 4RMFA 2E3CA 4RQFA 3MF1A 4M78A 2DVEA 3HXYA 4YRRA 4RQEA 3VBBA 4C92D 1YGBA 2CJ9A 4K88A 3JCMX 2CIMA 4H2WA 3IG2A 3JCMd 5GAOm 4YDQA 4KR3A 2I4NA 2QHVA 1KOGA 4C8QF 2ARUA 2EJFA 4M7DE 2RHSA 3REXA 1YFTA 1X54A 4M75E 1USYA 2DJZA 2EL9A 4TVAA 4PNOA 3HFVA 3HRKA 3JCMJ 4HWPA 3JCMb 4F7UB 1GGMA 1SETA 4C8QG 1B8AA 4NL2A 4M77E 2XGTA 1D3BA 1J5WA 1EOVA 3HFZA 1EIYA 3IALA 5GANg 4UPAA 3PGGA 2YLCA 1FYFA 3I7FA 1WYDA 2FYKA 1B34B 3JCMh 4RCCA 4K87A 1YFRA 4J5YA 2IY5B 2ZCEA 3FIFA 5K1PA 4JRIA 2Q5IA 2ZR3A 4Y91A 2ZGWA 11ASA 4XU0A 4HWRA 1NJ2A 4CH3A 4C92C 5C53B 2DZCA 2DU5A 5GAN8 3ICAA 3A74A 2VC8A 4NOYA 2I4MA 4F7UA 4M7DD 5GAMf 3SWNB 2Q7GA 3P8VA 4M75D 1NJ1A 4ZTZB 4WI1A 2JN0A 3JB9F 1E1TA 3LSSA 4HT9A 4M77D 1B34A 3SB2A 5LJ3g 1L0WA 4M7AF 2YHTA 2HNIA 3TEHB 4WJ4A 1HXDA 1KMMA 4P73A 4TVYA 2DTHA 4XTYA 1NJ8A 1BIAA 1I81A 1BBUA 1X2GA 2ARTA 1HC7A 2ZNIA 4P71A 4ZTUB 4P75C 5GAN5 4M78E 4MMKA 5GAN2 3QO3A 3UH0A 1X2HA 1YB3A 4V2SA 4KQEA 1B70B 3V7RA 3PZCA 5LJ5e 2Q7HA 3HXZA 4UP9A 3HXVA 3AHUA 1YFSA 4YP0A 3L2ZA 2E5AA 1NNHA 3E9HA 5GMKh 2G4CA 4MMLA 3SWNA 4YPFA 3QO5A 3QHSA 4C8QA 4XEMA 4JLIA 4Q15A 5GAN4 4QVCA 2E65A 2DU7A 5I21A 2ZT6A 4M7DC 1NYRA 2I4OA 3V7SA 4M75C 4DPGA 1PYSB 3UFGA 4EMGA 1KQ2A 1JJCB 1KMNA 2J3MA 4PJOF 4BWAA 2DTIA 4M77C 3FB9A 1B70A 4YRMA 2ZTGA 3BY7A 5CAIA 2DQ3A 4NL3A 2DEQA 1VQZA 4M78D 1WU7A 3R07A 2E10A 3JCMg 3JB9J 3RF1A 2DQ0A 3W3SA 4PHCA 2ZXFA 5KNNA 3JB9H 4PJOG 3QO8A 2E41A 3V8JA 5GMKm 3DSQA 5HGQA 4P72C 12ASA 2PMFA 5GAOl 2ARSA 5GAMj 4H02A 1EFWA 2DDZA 4HWTA 4F7UE 4Q6GA 3NEMA 2DZ9A 4HT8A 4EO4A 4M77G 3HXUA 4YROA 4YCUA 1PYSA 2P5IA 1BIBA 3OD1A 3VQYA 3JCMc 1JJCA 4YRCA 3JB9D 3VQVA 1M8VA 1SRYA 2ZIMA 5LJ5g 4O2DA 4M7AD 4EMKC 4M7AA 1YCYA 4KR2A 5LJ5d 4H2XB 1B7YB 1G51A 2Y90A 2AKWB 5C52B 3BW1A 4DQ2A 5GAN6 4YRLA 4PJOB 4M7DB 1Z7NA 4YRFA 2CJAA 4M78C 5GANj 4YRKA 1M5Q1 4C8QE 1QE0A 4P3PA 4M77B 3JCMV 5GAN7 5C51B 3QTCA 3A7AA 2I2LA 5GAOr 3HXXA 2ZZFA 5E3IA 1SESA 5F5WA 3E9IA 4C92F 4BW9A 1ATIA 4P74A 5GAMe 4YREA 5LJ5h 4WF2A 1USYC 2E64A 1NJ6A 3VQWA 2DXUA 2Q7EA 1X56A 3FJPA 4H2XA 3JCMf 5GAN3 1BBWA 3V7CA 1TH7A 1X55A 4C92G 4L87A 3CMQA 4YRPA 2IY5A 3HRIA 3L1AA 3INZA 4PJOA 1MGQA 4N0AA 3HXWA 3BFMA 3L4GB 5GAOp 1G5IA 3A31A 3MF2A 3UGTA 4LNSA 1QF6A 3LC0A 1ASZA 1Z7MA 4H2VA 2I4LA 3NETA 5LJ3j 1JBMA 1LOJA 3WQZA 3ERRA 3QO7A 3BDUA 5GAOq 4C8QD 2QHUA 4HWOA 1I5LA 3KFUA 3PCOB 1WQ7A 4JRKA 5GANf 1H4VB 3RKWA 2QHTA 3HSBA 1I4K1 1LNXA 2RM4A 4JUVA 4H2SA 4G85A 4H2UA 5GANe 3UGQA 3TEGA 1WNLA 2ZT7A 4XTZA 3TEHA 4EMHA 2C8MA 1ADYA 4C92B 4M7AE 1HTTA 4P3OA 2ALYB 4UP8A 3NENA 4XU3A 4M7DF 3L4GA 3M4GA 4M75F 4P73C 4YRTA 1E24A 1EQRA 1ASYA 2EWNA 3HTZA 2CGHA 4P71C 4X9CA 1KQ1A 1NYQA 4M77F 4M7DG 5GMKl 4J6XA 3IKMB 1Y96B 4M75G 4G84A 3TUPA 3G1ZA 3P8TA 4YRIA 1D3BB 5GAMd 1B76A 4NCXA 1EIYB 4CS2A 1WPYA 4YRQA 3JB9I 4J15A 5LJ3f 1JRIA 3SWNC 3RKYA 4YRNA 3QNEA 1HK9A 2RD1A 3LSQA 4YYEA 4C8QC 3HY1A 5LJ3e 5DY9A 2YLBA 4C92A 3RERA 2E1HA 4CH6A 1SERA 1C0AA 2ZZEA 2ALYA 4YRJA 3RKXA 2RA2A 3QSUA 4XTVA 2PMEA 5GMKi 1U1SA 5ELNA 3NELA 4TQDA 5GAOn 4PJOE 1W66A 2EJGA 1EVLA 3A7UA 4TWAA 4XU1A 4WJ3M 1N9RA 3BJUA 5GAMh 2ZZGA 1Y96A 1N9SA 1WQWA 4HWSA 4RDXA 4M75B
chains in the Genus database with same CATH superfamily
3I55A 4YCWA 3MEYA 1Q86U 5LJ5j 4OF1A 4TVRA 5GANd 1K4US 1K9MC 5I2MA 4J9FA 1NJIR 2Y4XA 1OYXA 2AMCB 3CC7T 4XU2A 2QA4Q 3RL6A 4BY6B 3G71Q 2DJQA 2KDSA 2AK5A 1E1OA 2KNBB 2HL5C 2Q5HA 3ME9A 3KFVA 4FU6A 2K57A 4PJOD 3V8LA 4RMOA 1PRLC 2EYYA 2LRQA 3HFNA 4PLLA 4H2TA 3HY0A 1YWPA 2CP6A 3M53A 2CP5A 1WLEA 3IQLA 2M0OA 1RLQC 5LJ3d 1QVFA 3MJXA 1VA7A 1VQ7Q 1RABB 4JDSA 3CXCP 2LCLA 1G3SA 4QVZA 4KGXB 1ADJA 3JCMW 1VQ9A 4IUVA 3V8KA 5HY6A 3ULRB 2QK0A 4CS3A 3LLRA 2FG0A 4CH4A 4XEOA 3LGFA 1WJQA 2OTJT 2ZAEA 5KYXA 3EGUA 2F2WA 2L89A 2QHSA 2VXFA 1G5HA 3ZBDA 1YJ9A 3EG0A 2QEXA 2COWA 3VS6A 2JW4A 3MEVA 2LVMA 4EMKA 2RHQA 4TVAB 4N0AC 1X6GA 1X01A 3OYIA 5K1XA 2QTXA 4Z89A 4HVWA 2F2XA 2EQIA 1PCXA 2HMAA 2FRYA 1VQ4T 2CZ7B 4HA8A 3HFZB 1WXBA 3TEEA 3RUXA 1SPKA 2BZ8A 2FB7A 2P0LA 4M7AB 3I56T 2EGAA 3CCRT 1N8RR 2GNCA 2DNUA 2DVEA 1NG2A 4RQEA 1NLPC 3VBBA 1QQJA 3QYHB 4BUGA 1EIFA 2GF7A 3IG2A 3H0HA 1WGSA 2AZSA 3CC4Q 4E7IA 4R0KA 3CCLQ 1BI1A 2I4NA 2PVGB 4QKUA 4C8QF 2I0NA 2LMJA 2ARUA 3ASKA 1RAEB 4M7DE 2DVJA 2QA4A 1YFTA 2M0YA 1X54A 4M75E 4J7IA 4PNOA 4FCYA 3HRKA 2NYSA 3CQTA 2E5KA 4RTXA 2QAZA 4FYWB 4C8QG 3PE0A 3OYEA 3E9GA 3X28B 4UPAA 3PGGA 2YLCA 1FYFA 3I7FA 1VQKQ 1QWEA 1K73C 2MIOA 1OI1A 2KGTA 1TOVA 4IUPA 4KH1B 3VUBA 5CO7A 5K1PA 9ATCB 2Q5IA 3MCAB 1I0CA 2LJ0A 1VQMQ 1VQ7A 4CH3A 3SHWA 2GGRA 5C53B 3L42A 3GF5A 5GAN8 3ICAA 2PZ1A 3EGXB 2LCSA 4NOYA 4PFPA 5GAMf 2RQRA 4ZNXA 1Q82U 3QBYA 4DBHA 1MNDA 2P0PA 1NJ1A 1Q86R 4ZTZB 4WI1A 4C0FA 3A8LB 3LSSA 4CC2A 4HT9A 4QQDA 4OB0B 3TEHB 4P73A 4XTYA 1R0CB 3ZEHA 1BBUA 1HC7A 3E9FA 2K7AA 4RTWA 1KSWA 4B6MA 3QO3A 1X2HA 1IGQA 1QCNA 4UC4A 1SSFA 1VQ8Q 5LJ5e 5KYUA 2OI3A 1P92A 3HXVA 3C12A 4NS5A 2E5AA 3E9HA 5GMKh 3FC3A 3SWNA 3OSVA 2JMCA 1AWWA 3PMTA 4C8QA 1WIEA 2YUOA 4Q5WA 3G6EQ 2FZGB 2K5LA 2E65A 1UJ0A 1WYXA 3OYJA 4M7DC 5EG2A 2I4OA 2O4XB 3V7SA 1KQSS 4M75C 2JUFA 2PTKA 1YI2T 3UFGA 4EMGA 3CC2T 1UG1A 2RQVA 1MNEA 4ZTFA 3REAB 3MP1A 4EIKA 1AZEA 1VQZA 3VS7A 3GPLA 4J9DA 3JCMg 3JB9J 3RF1A 4PHCA 2ZXFA 1YJWA 1IHVA 2DA9A 3CEYA 3NMZC 1VQKA 3QO8A 3V8JA 5HGQA 2CP3A 4BY6C 4P72C 2PMFA 4AT1B 5GAOl 1H3HA 1QP3A 3CBPA 4GLMA 3A5ZB 1S72Q 3URGA 2RF0A 3BDLA 3HXUA 1VQMA 2Y4YA 3OYMA 4YROA 2MF2A 1RLPC 2GFAA 3JCMc 2HD0A 2KMTA 2DD5A 2K3YA 2MMPA 4MDXA 1M8VA 2OTLQ 2JS2A 3OS2A 4KT0E 1W1FA 2D6FA 1YCYA 2QASA 2M9UA 2Y90A 4JZ3A 4ATOA 3UF4A 4DQ2A 4Z02A 4YRLA 5IHIA 4PLIA 1UJYA 1YHQQ 2LQWA 3G4ST 1GCQC 4AFQC 5KYNA 1T0HA 3C94A 2E4HA 1QE0A 1VQLQ 2K4YA 3HKSA 4M77B 1VQ8A 3JCMV 5GAN7 5C51B 5GAOr 1QVPA 2ZZFA 2RH2A 5E3IA 1MMDA 4BW9A 2F69A 1ATIA 4BACA 1M2VA 4X34A 4YREA 4ZN3A 4OGCA 1USYC 2E64A 3P8DA 3R6NA 4E6RA 5CKHA 3G6EA 4FL6A 2DPPB 2CKKA 2XIDA 3L1AA 1WHJA 2KRNA 3H8ZA 1M4ZA 2KT1A 4N0AA 1NEGA 3OYLA 3HXWA 3AT1B 1R8OB 3SEMA 1G5IA 3A31A 2R5MA 3UGTA 1NEBA 1LVKA 3NETA 4JRQA 2MWPA 2EGEA 2RJCA 1Q82R 2AHJB 2C0OA 1RADB 3ERRA 3EG2A 2FRWA 2PNIA 4C8QD 5GAOq 2NWMA 1I5LA 4BI4A 1MUZA 3OMCA 2O9SA 2NUTB 5CQXA 3RKWA 4PKCC 4RTZA 3CCQQ 1Q7YU 3RMQA 3EG1A 1QKWA 3UGQA 4RTYA 4EMHA 1S72A 2V1RA 1H92A 1ZLMA 1ADYA 4C92B 1X6OA 2ZZDA 3OYBA 4C0DB 4M7DF 4JJBA 2L3QA 3OYHA 2HSPA 1YBYA 4M75F 1KQSP 1PD0A 1E24A 2EWNA 8ATCB 2A37A 4C0ZA 2XICA 3HTZA 4X9CA 4OMPA 3CBOA 4DOVA 4M7DG 5GMKl 3PIOA 3LWIA 4QQGA 4M75G 1FMKA 2IG0A 4G84A 2EYQA 3CCST 4YRIA 1UGRB 1MHNA 4NCXA 1EIYB 1WPYA 2CUDA 1YHQA 3JB9I 4J15A 2FL7A 3CMAT 1RI0A 4IUQA 4BDYA 2KRSA 1VQ6T 4MZPA 2RA2A 1M90U 1VQLA 2JM8A 1WA7A 2RHXA 3OS1A 2PMEA 1VQ5Q 3NELA 2CT3A 5CCAA 2EJGA 1M1KC 1H8KA 3QKJA 4LUDA 4BE1A 3UDCA 4A4EA 4XU1A 3H6ZA 3OYGA 4BE0A 4RDXA 2QQBA 1F1BB 3F70A 4QVDA 2DL8A 2ZNJA 2EIFA 2ZT8A 1ABOA 2CP7A 1NJIC 2KXCA 2YRCA 4Y92A 3EFOB 4UP7A 4J8OA 5CQYA 4LVIA 3GIBA 5KYYB 2EJ9A 3I55T 2RJFA 1E22A 4HVUA 1SG5A 3L2WA 2DYBA 3S3OA 4X5OA 4O5VA 3CCQA 2ZIOA 1NZ9A 5I2SA 4LDUA 2BE7D 2BUDA 2XDPA 5KYWB 2JTEA 2LP5A 4M7DA 1OU8A 2RB6A 3CCVA 4M75A 4HCZA 1KQSA 2WSEE 1LJOA 1Y57A 2VGMA 3EG9B 2ZR2A 1H641 2P0KA 2DF6A 4JJNK 3M4QA 2MOXA 1I8FA 1RACB 2L3SA 2GTJA 3EHRA 3JCMQ 1NJ5A 2AMCA 4K11A 4FSSA 2B86A 2BKDN 2QG9B 5GJWB 3JB9G 5FRNA 1I1JA 2L5QA 4F16A 3RIRA 3RACA 3C95A 4QW2A 4C92E 4P72A 3PFSA 4J6YA 1TXQA 5CK9A 5FU7B 4M7AG 1GXIE 2OX7A 3JCMP 1KHIA 1RAFB 2C06A 4M78B 2KROA 2WSFE 2J3LA 2EYXA 3QPHA 1EX4A 2JOYA 2ODRC 1MV0B 2VXEA 1MMAA 3OB9A 5CR2A 1VOMA 3DLMA 2DETA 2Z0WA 2A7YA 3A8GB 1IRXA 3IKLA 3OW2S 2X4WA 3RGLA 1ZSZC 4DEYA 1H4TA 4J6WA 4JRPA 1D1AA 3P8BB 3JAME 2LCCA 1GBRA 5GAMg 3PCOA 5FW9A 4AH6A 5GMKe 1VQ9Q 2QEXT 2AZVA 1TUGB 1XQHA 1Q7YR 1N8RC 2EFIA 4H2YA 1XTDA 3MHXA 2JT4A 1EVKA 4ESRA 2EW3A 1NYFA 2LQNA 2HBPA 4OB3B 4RMFA 3MF1A 3CMET 1GCQA 1A0NB 1BK2A 2CIMA 3QDFA 3CCUQ 5IT9E 1NYGA 2O01E 2QHVA 2PVDB 4CC3A 3MEAA 4XAXB 1V29B 2KR3A 2RHUA 1USYA 2DJZA 2F5KA 4TVAA 3RBBB 4HWPA 3MP6A 3VS3A 2JM9A 2RN8A 1SETA 1B8AA 1G3YA 1XNIA 4NL2A 2XGTA 1D3BA 3HFZA 1UGQB 2QA4T 5GANg 3IALA 1WDXA 3LX7A 3G71T 3I5RA 1NM7A 1WYDA 1X6BA 2NLUA 1YITQ 3JCMh 2XU8A 1ZUUA 1PM3A 3QZ5B 3GNFB 1Q81U 1AWJA 4IIOA 1BI3A 1K76A 1W2BP 1GRIA 3TSWA 2XKOC 4XU0A 4HWRA 1NJ2A 1UEBA 2X51A 4C92C 5CKEA 3L2UA 2DZCA 4YTLA 5IHKA 2QTVA 2GQIA 1Q86C 2I4MA 4M7DD 2EQJA 4OGEA 3P8VA 1CSKA 4M75D 3CPFA 5I22A 1VQ7T 4DBQA 1VQPA 4HCKA 2MCNA 2JN0A 2E6ZA 4RTVA 2EKOA 2KEAA 4HXJA 3SB2A 5LJ3g 1KC8U 2F5TX 3I9QA 2YHTA 4PFZA 4O6JA 3DLLA 4TVYA 1IZ6A 2BZXA 4A4FA 4XK8E 1BIAA 1I81A 1X2GA 2ARTA 1N6AA 4D6WA 2K5FA 2ZNIA 4P75C 4M78E 3UH0A 2LT4A 5DM7R 3X25B 2EYWA 4KQEA 4OMLA 4LVKA 1E7OA 3HXZA 2E3IA 1YFSA 1YJNQ 2JS0A 3PIPA 1OULA 2G4CA 1IO6A 3QO5A 3QHSA 2EPDA 3FJ5A 1JXMA 4JLIA 3CCUA 4QVCA 1OV3A 2DU7A 2ZT6A 4OB2B 3L2VA 3NTKA 1KQ2A 1OOTA 3CC4T 2ESWA 4CC4B 3CCLT 3CCJT 4BWAA 2A3LA 3FB9A 1U3OA 2ZTGA 1X69A 1WU7A 2ECZA 2E10A 3E1SA 3W3SA 2DM1A 1I5OB 2RHZA 2LX7A 4N4HA 1W2BA 3M0UA 2E41A 1YITA 2L8DA 12ASA 4Y28E 4ZTJA 1EFWA 2DFUA 4EPCA 1EFNA 1WHMA 4FYXB 3NEMA 2QQRA 2DAQA 2DZ9A 1VQKT 3OYDA 4HT8A 1KG1A 2DE0X 4M77G 3META 3NPFA 1JQQA 2P5IA 1BIBA 2K2VA 4DOWA 3VS0A 2W10A 3JB9D 3VQVA 5D6WA 2QQAA 1SRYA 2ENMA 5LJ5g 4M7AD 1VQMT 1YJWQ 4KR2A 3I56Q 3VRZA 4LDXA 2JTFA 5LJ5d 4H2XB 4GLKA 3U23A 1ZBXA 3EHQA 5D6XA 5C52B 1RL2A 3BW1A 5GAN6 4N4GA 1X2KA 2QQSA 4C5IA 1K0XA 2CJAA 4M78C 3OYNA 2XG8D 4LDYA 2YSQA 3J81E 1D0ZA 2L0AA 4BI3A 2KK4A 4GBQA 1YIJQ 2PVOB 3A7AA 2I2LA 1I07A 4AFUC 3A1PA 4BDZA 5F5WA 2NUPA 1YJNA 4C92F 4JJDA 2IVWA 1VQNQ 4E7SA 1X2QA 5HK0A 4CC7A 2DXUA 1SRLA 1VQ8T 2Q7EA 3QJ6A 3FJPA 1ZX6A 1QCFA 1Q81R 4BB7A 1TH7A 1X55A 2D0QB 4LXCA 4C92G 4L87A 2IY5A 1N27A 2CH4A 3OW2A 1ZSZA 2EQKA 2LNHB 1ACMB 1MGQA 1BBZA 2HSEB 3EAEA 3HRSA 2E3HA 1KIKA 5KYXB 3L4GB 2VGNA 2WACA 2ZPHB 5GAOp 1Q82C 3MF2A 1PG5B 2FHDA 1Z7MA 5FROA 3PTAA 2I4LA 3CCEQ 3EGDB 4FM4B 1PNJA 1FXXA 1DJ7B 1BB9A 1JJ2S 4E7KA 2DRKA 2YXYA 3KFUA 2EKHA 1WQ7A 4JRKA 5GANf 2DD4A 4PJNA 1OZ3A 4KH0B 1LNXA 2RM4A 1BYMA 4JUVA 2YUQA 3TEGA 5EC7A 2ZT7A 4XTZA 2GFUA 1ZQ1A 1G3WA 1XJWB 1UECA 4M7AE 2FPFA 1BU1A 1RAIB 1NE8A 4UP8A 1UE9A 4XU3A 1K8AU 4IUUA 3M4GA 3RMSA 2D8JA 3X26B 1S72T 2LQ8A 2LX9A 3H41A 2ZPIB 4E2FB 1YNZA 3TU4K 5D6YA 1WXUA 3I56A 3CCRA 1KD1U 3VUZA 2C0TA 2O88A 3G1ZA 3MO8A 2OTLT 5KCOA 3HL8A 4CS2A 1H3ZA 3I5SA 4YRQA 5CKDA 5LJ3f 3WXMB 1KHCA 3QNEA 1HK9A 2RD1A 1WI7A 2NUZA 4LDWA 2VB6A 4RG2A 2YLBA 4C92A 1SRMA 1C0AA 2ZZEA 3OBYA 2YUNA 2H3JA 1UGSB 4XTVA 1YHQT 1YIJA 3OSSC 8AT1B 1VQNA 1TUDA 1ZA1B 4OB1B 3O5ZA 2DRMA 4IKFA 1VQLT 4LE9A 1BI2A 1N9RA 2LQKA 2CSIA 5GAMh 1SEMA 1QCOA 1N9SA 2VASA 3PNWC 4LD9K 3OBWA 1ZBJA 3GOXA 3FEOA 5DY9A 1M27C 4XTWA 4P75A 1KFZA 4XQ3A 1V1CA 2AKLA 3S3NA 2ZCFB 5FU6B 4M78F 3H9NA 4OP0A 1G8XA 3CCEA 4HVCA 1AD5A 3VYHB 1UHCA 2YRDA 2ODRD 2OAUA 5CKFA 1Y71A 2GTOA 1B7YA 4M78G 2ZINA 1R0BG 2AKWA 2D1XA 5IH2A 5KYUB 2M1HA 3GBQA 4KUIA 1LYLA 1C1AA 1G3TA 2CYZB 2DIQA 1D1CA 3JCMe 1PC0A 5GMKj 4M7AC 1B07A 2DXTA 4RG8A 5GANh 1YCSB 4C8QB 2YDLA 4TTVA 4L5GA 4YRSA 3LWHA 3CCQT 4OVAA 1LCKA 1RI9A 2H8HA 2CJBA 4YCVA 4CS4A 2AKKA 2RQUA 2CREA 1N9WA 4XTXA 3CCMQ 3A5YA 3GLXA 4B9WA 4TQFA 5L23A 5FRMA 2C7IA 5LJ5f 4ELZC 1OPKA 4ZIBA 3M55A 1M3BA 3HFOA 3A32A 4LVJA 1JJ2P 3OYCA 3EFSA 3CCVQ 2KXDA 4D8DA 4XTUA 2DTOA 2R5AA 3P8YA 2K6DA 4X9DA 3I35A 1Z9ZA 1HYOA 1S1NA 2KQWA 1RAAB 1QLYA 3QUIA 2H3EB 5LJ3h 2RHSB 4ELYC 2P84A 1Q7YC 4LD6A 3VU3C 2DKGA 4ZGEB 3EH2A 3M0QA 4A53A 3EFRA 3M59A 4JZ4A 1U1TA 3T9NA 4PJJA 1KJWA 2X4JA 2XDDA 1VQ5T 2RHYA 1WX6A 2CP0A 4IIMA 3P8HA 3OYFA 2LNVA 4EX5A 3OS5A 4E7HA 2J6FA 3G1JA 1QVFS 2E3CA 4RQFA 4M78A 3PMIA 4E47A 2F1LA 1JO8A 4C92D 2LT1A 4EDUA 1YGBA 2CJ9A 3QXEB 4K88A 4IURA 1K8AR 4H2WA 1YFNA 1JU5C 2CT4A 1QVGS 1JEGA 4YDQA 3HTRA 4KR3A 1M1KU 1UHFA 2ATCB 2IPOB 3M5AA 1TUCA 2EL9A 2DIGA 5DLOA 4OMMA 2FPEA 1UGVA 4F7UB 2V8IA 4R55A 1NLOC 5IN1A 1GGMA 4HKEA 1OQKA 2DLPA 3EH1A 4M77E 4ME7A 4JLGA 3CCSQ 3WVDB 2QYZA 1J3TA 1B34B 2MYSA 2QDLA 1YFRA 4J5YA 2MWOA 1K9AA 2O31A 3L2RA 1Q95G 4A4KA 2ZCEA 1PD1A 3FIFA 3CCMA 3RNJA 1YN8A 4PL6A 4Y91A 4CRIA 1QKXA 1JJ2A 1UDLA 2HQHA 2J06A 3A98A 2ZPFB 4KULA 1VYVA 3REBB 4HCCA 2VC8A 2L3RA 5KH6A 3JRZA 3TSZA 2Q7GA 2A28A 4DBFA 3RDVA 4CI0C 4DA4A 2FVUA 3LW5E 3VV0A 2K3XA 1UGPB 3JB9F 1WHLA 2DL4A 1L0WA 3NFCA 4M7AF 1SKUB 2HNIA 2LTOA 4WJ4A 1HXDA 2DTHA 1ZUYA 2DL3A 4WTOB 3OS0A 2HKNA 3QG1A 4MMKA 1YB3A 2DXCA 2O2OA 4V2SA 4D8KA 4FIBA 3SD4A 1B70B 3V7RA 3KUFA 3C0CA 2KT8A 2Q7HA 4BE2A 1PKSA 2SRCA 3CXCS 3HRUA 3NTHA 1VQPQ 1UB4A 3PVQA 4MMLA 3CD6Q 1VQ9T 1QMCA 4XEMA 1WHKA 5GAN4 5M9OA 2D8HA 2KYMA 3FDRA 3MPUB 5I21A 1VQOQ 2CZ1B 3X20B 1BCOA 4AMCA 2AT1B 3X24B 1NYRA 5HK3A 4DPGA 1O9SA 1PYSB 3NTIA 1NPPA 2DX1A 5CIUA 3CCUT 1YJ9T 3LH0A 1JJCB 2V8JA 1KMNA 2DTIA 3QJYA 4M77C 4YRMA 3BY7A 5CAIA 3PT9A 3TCJA 4M78D 3R07A 3CCSA 3CPWS 1PKTA 5IXFA 3JB9H 1Z9QA 2RPNA 3DSQA 2PUOB 4E7JA 1HD3A 4E7LA 4PJLA 4ZN1A 1AHJB 1OU9A 2DDZA 4F7UE 3SDZA 1R77A 3A8OB 5KCHA 1YITT 2FZKB 4YCUA 1QVGP 1B3QA 3M0RA 3OD1A 2FEIA 2QQ9A 1M8MA 4R56A 1WFWA 2O9VA 2RQTA 4M7AA 1K9MU 4JJCA 4A4HA 1M90R 1G51A 1U06A 1D0YA 1SHGA 2HZYA 3THKA 4PJOB 3J7AF 4M7DB 4JPBW 1Z7NA 2HCKA 4YRFA 2VYTA 3HPWA 2KRMA 3UA7A 4M4ZA 1C6VX 4YRKA 3OYAA 5A0DA 3QYGB 2XD0A 4C0DC 3M56A 3A8HB 3HXXA 1SESA 1QP2A 3E9IA 1Q81C 5GAMe 2J6OA 2WSCE 2JMAA 2ROTA 3CD6A 1NJ6A 1WLPB 1ZA2B 2VWFA 2COYA 5DLQE 2RK2A 1X56A 4H2XA 5GAN3 1BBWA 2J6KA 3V7CA 1YJNT 1VQOA 3CMQA 1RAHB 4YRPA 2QI2A 4C5EA 2MI6A 1RAGB 3CC7Q 1PHTA 2LJ1A 3BFMA 4LNSA 1OX9A 1QF6A 1BCMA 3LC0A 2GBQA 4H2VA 3EGXA 1V76A 5GJVB 4ANJA 4AG2C 1LOJA 1YP5A 4J7FA 1KC8C 1AWOA 2EBPA 3WQZA 3UWNA 5A2QE 2QHUA 4HWOA 2DMOA 3PCOB 1HSQA 3NGPA 2QHTA 2BIVA 3HSBA 1I4K1 3DB4A 4H2SA 2X3XD 3M54A 4G85A 4H2UA 4KGZB 5GANe 2DO3A 3TEHA 1QVGA 2X35A 2OAWA 1B7TA 2K2MA 2C8MA 1GFDA 2A36A 2CUBA 3OW2P 2ALYB 1RUWA 2COZA 3L4GA 3L2QA 5FWCA 4YRTA 1EQRA 1ASYA 3VS4A 3EGDA 2CGHA 4P71C 5IXBA 1M2OA 3NHNA 1KQ1A 2HDAA 2JVVA 4M77F 4A63B 2XK0A 4J6XA 3CMEA 2R57A 1Y96B 4PK4A 2OTJQ 3M58A 3TUPA 1ZSGA 3P8TA 1D3BB 1M9SA 3CPWP 1B76A 4P5NA 2SEMA 2FO0A 3QZ9B 1YJWT 1JRIA 1TU0B 3QIIA 5C6SA 2O4XA 2KYBA 4HVVA 4ZGJB 4J9GA 4YYEA 3CBMA 5LJ3e 1TG0A 1SERA 4CH6A 4C5GA 2KAFA 2PUKB 4YRJA 3M0PA 4F17A 3QSUA 5GMKi 2D0NA 5CVIA 2JXBA 1VQ4Q 1FWZA 5ELNA 1PSFA 4TQDA 3CCJQ 2VKNA 5GAOn 1K73U 3TQ7P 1E6GA 4LN2A 1T0JA 4PJOE 3CCRQ 4KUDK 3D7SB 3A7UA 1O75A 4E7ZA 3G71A 1YIJT 3BJUA 5FU7C 3VS2A 1WQWA 1VQNT 4HWSA 4AFSC 5HKCA 3A5ZA 2RNAA 4QT7A 4RTUA 1RIQA 3OA6A 1T3SA 3RESA 3CC7A 2HQEA 3J80E 4YRGA 4BI8B 2JNGA 3M9QA 3UA6A 4ZGDB 1TS9A 3M4YA 2X4XA 4ORZA 5J3BA 3CXCA 4MZMA 1K9MR 3M4PA 3QWXX 1M3AA 3R6OA 4E51A 4OLFA 1EZZB 2OJ2A 4OMOA 2KE9A 3OYYA 2ZT5A 4FW1A 3CCET 2KVQG 5L8RE 4K86A 4QQ6A 4TVWA 3REUA 2RJEA 3S6WA 2NS6A 5AYFA 1SSHA 3EG3A 5ECAA 3G6ET 1NBEB 1CKAA 4P3NA 1IL2A 3E19A 1MV3A 4M77A 4CH5A 3OY9A 1BKBA 1H4QA 4EMKB 2RHQB 1Y07A 3VQXA 4J9EA 2LZ6B 4WCIA 2XTIA 1E6HA 3CPWA 1IXDA 4RTTA 3MP8A 1KC8R 2VUBA 2OTJA 1VIEA 6AT1B 3MQZA 2V1QA 2QGFB 1G83A 2KBTA 3ER0A 4P74C 3H0FA 1IGUA 2HAXA 1CKBA 2MPXC 2W0ZA 3QWYA 4F7UF 1AVZC 3MEUA 1LPLA 2EAYA 2IIMA 3RR6A 1H4SA 3CC4A 2CP2A 1VQ4A 2LDMA 3CCLA 4PJOC 3CCJA 3C4SA 4FW2A 4F7UG 2M16A 5C0MA 2RI5A 3VS1A 5ELOA 5IAYA 3OYKA 2CH4W 2NUTA 4JS4A 4RCBA 5D7UA 2GCXA 3MEWA 2BTTA 4Z88A 1K8AC 2XHCA 3A7RA 1ARKA 4PG3A 4A54A 5A0LA 5I11A 3HXYA 2HL3A 4YRRA 1ZUKA 3JCMX 1YI2Q 5FLXE 3JCMd 4MDWA 3CC2Q 5GAOm 1W4SA 4B9XA 1D1BA 1KOGA 1KD1C 4VUBA 3H0IA 2M02A 3PVLA 2EJFA 4AG1C 2RHSA 3VKIA 3REXA 2HEQA 2RHIA 4F14A 4KBMB 4BD3A 3HFVA 3JCMJ 3JCMb 2FPDA 3QDRB 3MKDA 1HJDA 1N5ZA 1PSEA 1BI0A 2E12A 2E6NA 2NUPB 1J5WA 1EOVA 1EIYA 2DERA 3BE3A 4C5HA 3E2UA 2FYKA 2B8AA 2ED1A 2PU9B 4FYVB 4RCCA 4K87A 1IREB 2BZYA 3N5BB 2ED0A 1JB0E 2IY5B 2QXFA 1ZSZB 3VYGA 1K73R 4RKUE 2HBWA 4JRIA 1OPLA 4Z8AA 2ZR3A 2ZGWA 11ASA 1XOVA 2RI2A 3GNGA 2DILA 1X27A 4DEXA 3SFMA 2D9TA 2DU5A 3A74A 3CCMT 2GQVA 2CS7A 4F7UA 1VYTA 3SWNB 2BE9B 2J7IA 4J9CA 1VIFA 2YRVA 3G4SQ 1E1TA 2ZPGB 3EFOA 1JXOA 4M77D 1B34A 4HT4A 1D0XA 3DB3A 3CCVT 1KMMA 5LL6S 5KYYA 1U8RA 2XDBA 4OMNA 4OMQA 1NJ8A 1FYNA 4P71A 3LGLA 4ZTUB 5GAN5 5GAN2 2G6FX 2EGCA 2JTMA 4FT4A 2ZPBB 4DBRA 1WHHA 3PZCA 1GCPA 2RO0A 4J9HA 4UP9A 1T3LA 4YP0A 3AHUA 3L2ZA 5KYWA 1NNHA 1M3CA 2CSQA 4YPFA 4L6V5 3G7ZA 2F2VA 1FMVA 2XI9A 2RI3A 3VRYA 2VV5A 1W70A 1YI2A 1SF9A 2DBKA 3FRNA 4Q15A 5IHNA 4LUEA 3CC2A 3EG9A 3JV3A 2R58A 1G2BA 3HRTA 1VYUA 1PWTA 1WHGA 5J39A 4PJMA 1KK7A 2YT6A 1GFCA 4RUGA 5AT1B 3A8MB 2J3MA 4LNPA 2MK5A 2PQWA 4PJOF 1WXTA 2YUPA 2K9GA 1B70A 2DQ3A 4NL3A 3UATA 2DEQA 2OTLA 2DYIA 2DQ0A 3FLGA 5KNNA 2QGGA 4PJOG 2DL7A 3GP8A 5GMKm 4II1A 1QW1A 3ZFJA 1UFFA 2A08A 2ARSA 5GAMj 4H02A 1TWBA 1X75C 4LVMA 3O8VA 3OQ5A 1Y7XA 4HWTA 3JSCA 4GY5A 4Q6GA 1M30A 2X3WD 4EO4A 1AZGB 1KD1R 2EVRA 1PYSA 2RQWA 3TVTA 2A0FB 3VQYA 2K79A 1JJCA 2G3RA 4KRTA 3UPUA 4YRCA 1TSFA 1M90C 1M2VB 2CZ0B 1TTHB 1ZHIA 2P4RA 2RMOA 1NJIU 2ZIMA 2L2PA 2P4TA 4O2DA 1GBQA 4EMKC 2EQMA 3CMAQ 3G4SA 1B7YB 2AKWB 1AEYA 4IUTA 2FZCB 1VQ6Q 3KBGA 4AFZC 3M57A 2L3PA 2LC4A 1K1ZA 2DXBA 4N4IA 5GANj 1W2BS 2DEUA 1M5Q1 2K5IA 1PRMC 1NPRA 2MAMA 2ROLA 4FT2A 4C8QE 4P3PA 5HCKA 2LJ3A 3QTCA 1VUBA 3OMGA 2EQUA 1QWFA 1OX8A 4P74A 2X9HA 1FMWA 2JZ2A 2M51A 5LJ5h 4WF2A 4J9IA 2DK3A 3VQWA 2YWWA 3UT1A 1WJSA 2HQXA 2E5QA 5A0GA 5FWBA 3JCMf 3VS5A 5KE2A 5KE3A 1VQPT 3HRIA 2ABLA 3INZA 3I55Q 1W6XA 4PJOA 3CD6T 2KSSA 2DL5A 2AIRB 2JJ9A 3WVEB 1D09B 3HHTB 1VQOT 2CZ6B 1ASZA 5CKBA 4L59A 5LJ3j 1IHWA 1JBMA 3M0SA 1UUEA 1U5SA 1Y0MA 3QO7A 3BDUA 1IB8A 4OMFB 4FSXA 1H4VB 2KI7A 2HKQB 1MMNA 1UTIA 2XMFA 1WNLA 7AT1B 2QDYB 1OEBA 2CDTA 4X1VA 1AOJA 1N8RU 3LH5A 2ZPEB 1HTTA 3DKMA 4P3OA 3VJPA 3HP9A 3NENA 4J83A 5FU6C 4JS5A 1FX7A 4P73C 2A8EA 4PFOA 1VQ5A 3LYIA 4C0GA 2E70A 1WZOA 1NYQA 1GL5A 3CMAA 4A4GA 4F04B 3KXTA 2VVKA 4MZTA 3IKMB 3M0TA 1QVFP 1VQ6A 3TREA 5J26A 1M1FA 5GAMd 4J9BA 1AWXA 1C0MA 2V8KA 3SWNC 3RKYA 4YRNA 3Q1JA 3LSQA 2RK1A 2DBMA 4C8QC 3HY1A 2J05A 3S3MA 2E1HA 3RERA 2V26A 2ALYA 3RKXA 1YWOA 1YJ9Q 2QEXQ 1MMGA 2RJDA 1U1SA 1M1GA 1AT1B 4LVLA 2K3BA 1W66A 2C0IA 2KY9A 1SHFA 4FYYB 3CMEQ 1EVLA 4TWAA 1WJRA 4WJ3M 2ZZGA 2P0QA 1ABQA 1K0SA 1Y96A 1M1KR 4LDVA 3ZL7C 1OZ2A 2X4YA 1G5VA 1X43A 4HCBA 2EYZA 4KGVB 4M75B
chains in the Genus database with same CATH topology
3I55A 4YCWA 3MEYA 1Q86U 5LJ5j 4OF1A 4TVRA 5GANd 1K9MC 5I2MA 2Y4XA 1OYXA 2AMCB 3CC7T 4XU2A 3RL6A 4BY6B 2KDSA 1E1OA 2Q5HA 3ME9A 4FU6A 2K57A 4PJOD 3V8LA 4RMOA 2LRQA 3HFNA 4PLLA 4H2TA 3HY0A 3M53A 1WLEA 2M0OA 5LJ3d 1QVFA 4JDSA 2LCLA 1G3SA 4QVZA 1ADJA 3JCMW 1VQ9A 4IUVA 3V8KA 5HY6A 4CS3A 3LLRA 4CH4A 4XEOA 3LGFA 1WJQA 2OTJT 2L89A 2QHSA 2VXFA 1G5HA 3ZBDA 1YJ9A 2QEXA 3MEVA 2LVMA 4EMKA 2RHQA 4TVAB 4N0AC 3OYIA 1X01A 5K1XA 2QTXA 1VQ4T 2CZ7B 4HA8A 3HFZB 3TEEA 3RUXA 2FB7A 2P0LA 4M7AB 3I56T 3CCRT 2DVEA 4RQEA 3VBBA 3QYHB 4BUGA 1EIFA 2GF7A 3IG2A 1WGSA 4E7IA 1BI1A 2I4NA 2PVGB 4C8QF 2ARUA 3ASKA 4M7DE 2QA4A 1YFTA 1X54A 4M75E 4J7IA 4PNOA 3HRKA 4C8QG 3OYEA 3E9GA 3X28B 4UPAA 3PGGA 2YLCA 1FYFA 3I7FA 1K73C 1OI1A 4IUPA 3VUBA 5CO7A 5K1PA 2Q5IA 3MCAB 4CH3A 1VQ7A 5C53B 3L42A 3GF5A 5GAN8 3ICAA 4NOYA 5GAMf 1Q82U 3QBYA 2P0PA 1NJ1A 4ZTZB 4WI1A 4C0FA 3A8LB 3LSSA 4HT9A 4QQDA 4OB0B 3TEHB 4P73A 4XTYA 1BBUA 3ZEHA 1HC7A 3E9FA 3QO3A 1X2HA 4UC4A 1SSFA 5LJ5e 1P92A 3HXVA 3C12A 4NS5A 2E5AA 3E9HA 5GMKh 3FC3A 3SWNA 3OSVA 3PMTA 4C8QA 4Q5WA 2K5LA 2E65A 3OYJA 4M7DC 5EG2A 2I4OA 2O4XB 3V7SA 1KQSS 4M75C 2JUFA 1YI2T 3UFGA 4EMGA 3CC2T 4ZTFA 3MP1A 1VQZA 3GPLA 3JCMg 3JB9J 3RF1A 4PHCA 2ZXFA 1YJWA 3CEYA 1VQKA 3QO8A 3V8JA 5HGQA 4BY6C 4P72C 2PMFA 5GAOl 1QP3A 3CBPA 3A5ZB 3URGA 3BDLA 3HXUA 1VQMA 2Y4YA 3OYMA 4YROA 2MF2A 2GFAA 3JCMc 2HD0A 2KMTA 2DD5A 2K3YA 2MMPA 4MDXA 1M8VA 3OS2A 4KT0E 2D6FA 1YCYA 2M9UA 2Y90A 4ATOA 4DQ2A 4Z02A 4YRLA 4PLIA 3G4ST 3C94A 1QE0A 2K4YA 3HKSA 4M77B 1VQ8A 3JCMV 5GAN7 5C51B 5GAOr 1QVPA 2ZZFA 2RH2A 5E3IA 4BW9A 2F69A 1ATIA 4BACA 4X34A 4YREA 4ZN3A 4OGCA 1USYC 2E64A 3P8DA 5CKHA 3G6EA 4FL6A 2DPPB 2CKKA 2XIDA 3L1AA 3H8ZA 1M4ZA 4N0AA 3HXWA 3OYLA 1R8OB 1G5IA 3A31A 2R5MA 3UGTA 3NETA 4JRQA 2MWPA 2RJCA 2AHJB 3ERRA 5GAOq 4C8QD 1I5LA 4BI4A 3OMCA 5CQXA 3RKWA 4PKCC 1Q7YU 3RMQA 3UGQA 4EMHA 1S72A 1ADYA 4C92B 1X6OA 2ZZDA 3OYBA 4C0DB 4M7DF 3OYHA 1YBYA 4M75F 1E24A 2EWNA 4C0ZA 2XICA 3HTZA 4X9CA 3CBOA 4DOVA 4M7DG 5GMKl 3PIOA 3LWIA 4QQGA 4M75G 4G84A 2IG0A 2EYQA 3CCST 4YRIA 1UGRB 1MHNA 4NCXA 1EIYB 1WPYA 1YHQA 3JB9I 4J15A 2FL7A 3CMAT 1RI0A 4IUQA 4BDYA 1VQ6T 4MZPA 2RA2A 1M90U 1VQLA 2RHXA 3OS1A 2PMEA 3NELA 5CCAA 2EJGA 1M1KC 3QKJA 4BE1A 3UDCA 4A4EA 4XU1A 3H6ZA 3OYGA 4BE0A 4RDXA 2QQBA 3F70A 4QVDA 2ZNJA 2EIFA 2ZT8A 1NJIC 4UP7A 4J8OA 5CQYA 4LVIA 3GIBA 2EJ9A 3I55T 2RJFA 1E22A 3L2WA 3S3OA 4X5OA 4O5VA 3CCQA 2ZIOA 1NZ9A 5I2SA 2BUDA 4LDUA 2XDPA 4M7DA 2RB6A 3CCVA 4M75A 4HCZA 1KQSA 2WSEE 1LJOA 2VGMA 2ZR2A 1H641 2P0KA 4JJNK 3M4QA 1I8FA 1NJ5A 3JCMQ 2AMCA 2BKDN 3JB9G 5FRNA 2L5QA 3RIRA 3RACA 3C95A 4QW2A 4C92E 4P72A 3PFSA 4J6YA 5CK9A 4M7AG 5FU7B 1GXIE 3JCMP 1KHIA 2C06A 4M78B 2WSFE 2J3LA 3QPHA 2JOYA 2ODRC 2VXEA 3OB9A 5CR2A 3DLMA 2A7YA 3A8GB 3IKLA 3OW2S 2X4WA 3RGLA 1H4TA 4J6WA 4JRPA 3P8BB 3JAME 2LCCA 5GAMg 3PCOA 4AH6A 5GMKe 2QEXT 4H2YA 1XQHA 1N8RC 2EFIA 1XTDA 3MHXA 1EVKA 2HBPA 4OB3B 4RMFA 3MF1A 3CMET 2CIMA 5IT9E 2O01E 2QHVA 2PVDB 3MEAA 4XAXB 1V29B 2RHUA 1USYA 2DJZA 2F5KA 4TVAA 4HWPA 3MP6A 1SETA 1B8AA 1G3YA 1XNIA 4NL2A 2XGTA 1D3BA 3HFZA 1UGQB 2QA4T 5GANg 3IALA 3LX7A 3G71T 1WYDA 2NLUA 3JCMh 2XU8A 3QZ5B 1Q81U 3GNFB 1BI3A 2XKOC 4XU0A 4HWRA 1NJ2A 1UEBA 4C92C 5CKEA 3L2UA 2DZCA 4YTLA 1Q86C 2I4MA 4M7DD 2EQJA 4OGEA 3P8VA 4M75D 3CPFA 1VQ7T 1VQPA 2JN0A 2E6ZA 2EKOA 3SB2A 5LJ3g 1KC8U 2F5TX 2YHTA 4O6JA 3DLLA 4TVYA 1IZ6A 4A4FA 4XK8E 1BIAA 1I81A 1X2GA 2ARTA 1N6AA 4D6WA 2K5FA 2ZNIA 4P75C 4M78E 3UH0A 2LT4A 5DM7R 3X25B 4KQEA 4LVKA 3HXZA 1YFSA 3PIPA 2G4CA 3QO5A 3QHSA 4JLIA 3CCUA 4QVCA 2DU7A 2ZT6A 4OB2B 3L2VA 3NTKA 1KQ2A 3CC4T 3CCLT 3CCJT 4BWAA 2A3LA 3FB9A 2ZTGA 1WU7A 2E10A 3E1SA 3W3SA 2RHZA 4N4HA 1W2BA 2E41A 1YITA 2L8DA 12ASA 4Y28E 4ZTJA 1EFWA 4EPCA 3NEMA 2QQRA 2DAQA 2DZ9A 1VQKT 3OYDA 4HT8A 1KG1A 4M77G 3META 2P5IA 1BIBA 2K2VA 4DOWA 3JB9D 3VQVA 5D6WA 2QQAA 1SRYA 5LJ5g 4M7AD 1VQMT 4KR2A 4LDXA 2JTFA 5LJ5d 4H2XB 4GLKA 1ZBXA 5D6XA 5C52B 1RL2A 3BW1A 5GAN6 4N4GA 2QQSA 4C5IA 2CJAA 4M78C 3OYNA 2XG8D 4LDYA 3J81E 4BI3A 2KK4A 2PVOB 3A7AA 2I2LA 4BDZA 5F5WA 1YJNA 4C92F 2IVWA 5HK0A 2DXUA 1VQ8T 2Q7EA 3QJ6A 3FJPA 4BB7A 1TH7A 1X55A 2D0QB 4C92G 4L87A 2IY5A 1N27A 3OW2A 2EQKA 1MGQA 3EAEA 3HRSA 3L4GB 2VGNA 2WACA 2ZPHB 5GAOp 1Q82C 3MF2A 2FHDA 1Z7MA 5FROA 3PTAA 2I4LA 4FM4B 1FXXA 1DJ7B 1JJ2S 4E7KA 3KFUA 1WQ7A 4JRKA 5GANf 2DD4A 1OZ3A 1LNXA 2RM4A 1BYMA 4JUVA 3TEGA 2ZT7A 4XTZA 2GFUA 1ZQ1A 1G3WA 4M7AE 1NE8A 4UP8A 4XU3A 1K8AU 4IUUA 3M4GA 3RMSA 3X26B 1S72T 2LQ8A 2LX9A 2ZPIB 3TU4K 5D6YA 3I56A 3CCRA 1KD1U 3VUZA 3G1ZA 3MO8A 2OTLT 5KCOA 3HL8A 4CS2A 1H3ZA 4YRQA 5CKDA 5LJ3f 3WXMB 1KHCA 3QNEA 1HK9A 2RD1A 4LDWA 4RG2A 2YLBA 4C92A 1C0AA 2ZZEA 3OBYA 2H3JA 1UGSB 4XTVA 1YHQT 1YIJA 3OSSC 1VQNA 4OB1B 4IKFA 1VQLT 1BI2A 1N9RA 2LQKA 5GAMh 1N9SA 3PNWC 4LD9K 3OBWA 3GOXA 3FEOA 5DY9A 4XTWA 4P75A 4XQ3A 3S3NA 2ZCFB 5FU6B 4M78F 4OP0A 3CCEA 4HVCA 3VYHB 2ODRD 2OAUA 5CKFA 1Y71A 1B7YA 4M78G 2ZINA 2AKWA 2M1HA 4KUIA 1LYLA 1G3TA 2CYZB 2DIQA 3JCMe 5GMKj 4M7AC 2DXTA 4RG8A 5GANh 4C8QB 4TTVA 4L5GA 4YRSA 3LWHA 3CCQT 4OVAA 2CJBA 4YCVA 4CS4A 1N9WA 4XTXA 3A5YA 3GLXA 4B9WA 4TQFA 5FRMA 2C7IA 5LJ5f 4ELZC 4ZIBA 3M55A 3HFOA 3A32A 4LVJA 3OYCA 3EFSA 4XTUA 2DTOA 2R5AA 3P8YA 4X9DA 2KQWA 3QUIA 5LJ3h 2RHSB 4ELYC 1Q7YC 4LD6A 3VU3C 2DKGA 4ZGEB 4A53A 3EFRA 3M59A 1U1TA 3T9NA 2X4JA 2XDDA 1VQ5T 2RHYA 3P8HA 3OYFA 2LNVA 4EX5A 3OS5A 4E7HA 1QVFS 2E3CA 4RQFA 4M78A 3PMIA 4E47A 4C92D 2LT1A 4EDUA 1YGBA 2CJ9A 3QXEB 4K88A 4IURA 4H2WA 1QVGS 4YDQA 4KR3A 1M1KU 3M5AA 2EL9A 2DIGA 5DLOA 4F7UB 2V8IA 4R55A 1GGMA 5IN1A 4HKEA 4M77E 4ME7A 4JLGA 3WVDB 1B34B 1YFRA 4J5YA 2MWOA 3L2RA 4A4KA 2ZCEA 3FIFA 3CCMA 4PL6A 4Y91A 4CRIA 1JJ2A 2ZPFB 4KULA 4HCCA 2VC8A 2L3RA 5KH6A 3JRZA 2Q7GA 4CI0C 4DA4A 2FVUA 3LW5E 3VV0A 2K3XA 1UGPB 3JB9F 1L0WA 3NFCA 4M7AF 2HNIA 2LTOA 4WJ4A 1HXDA 2DTHA 3OS0A 3QG1A 4MMKA 1YB3A 2DXCA 4V2SA 4FIBA 3SD4A 1B70B 3V7RA 3KUFA 2Q7HA 4BE2A 3CXCS 3HRUA 3NTHA 1UB4A 4MMLA 1VQ9T 4XEMA 5GAN4 5M9OA 3FDRA 5I21A 2CZ1B 3X20B 3X24B 1NYRA 5HK3A 4DPGA 1O9SA 1PYSB 3NTIA 1NPPA 5CIUA 3CCUT 1YJ9T 3LH0A 1JJCB 2V8JA 1KMNA 2DTIA 3QJYA 4M77C 4YRMA 3BY7A 5CAIA 3PT9A 3TCJA 4M78D 3R07A 3CCSA 3CPWS 3JB9H 3DSQA 2PUOB 4E7JA 4E7LA 4ZN1A 1AHJB 2DDZA 4F7UE 3SDZA 3A8OB 5KCHA 1YITT 4YCUA 3OD1A 2QQ9A 4R56A 4M7AA 1K9MU 4A4HA 1G51A 4PJOB 3J7AF 4M7DB 1Z7NA 4YRFA 2VYTA 3HPWA 4YRKA 3OYAA 5A0DA 3QYGB 2XD0A 4C0DC 3M56A 3A8HB 3HXXA 1SESA 1QP2A 3E9IA 1Q81C 5GAMe 2WSCE 3CD6A 1NJ6A 5DLQE 2RK2A 1X56A 4H2XA 5GAN3 1BBWA 3V7CA 1YJNT 1VQOA 3CMQA 4YRPA 2QI2A 4C5EA 2MI6A 3BFMA 4LNSA 1QF6A 3LC0A 4H2VA 1LOJA 4J7FA 1KC8C 3WQZA 3UWNA 5A2QE 2QHUA 4HWOA 3PCOB 2QHTA 2BIVA 3HSBA 1I4K1 3DB4A 4H2SA 4H2UA 3M54A 4G85A 5GANe 2DO3A 3TEHA 1QVGA 2X35A 2C8MA 2ALYB 3L4GA 3L2QA 4YRTA 1EQRA 1ASYA 2CGHA 4P71C 1KQ1A 2JVVA 4M77F 2XK0A 4J6XA 3CMEA 2R57A 1Y96B 3M58A 3TUPA 3P8TA 1B76A 1D3BB 1M9SA 4P5NA 1YJWT 3QZ9B 1JRIA 3QIIA 5C6SA 2O4XA 4ZGJB 4YYEA 3CBMA 5LJ3e 1SERA 4CH6A 4C5GA 2KAFA 2PUKB 4YRJA 3QSUA 5GMKi 5CVIA 1FWZA 5ELNA 1PSFA 4TQDA 5GAOn 1K73U 4PJOE 4KUDK 3A7UA 1O75A 3G71A 1YIJT 3BJUA 5FU7C 1WQWA 1VQNT 4HWSA 5HKCA 3A5ZA 1RIQA 3OA6A 3RESA 3CC7A 2HQEA 3J80E 4YRGA 4BI8B 2JNGA 3M9QA 4ZGDB 3M4YA 2X4XA 5J3BA 3CXCA 3M4PA 4MZMA 3R6OA 4E51A 4OLFA 3OYYA 2ZT5A 3CCET 2KVQG 5L8RE 4K86A 4QQ6A 4TVWA 3REUA 2RJEA 3S6WA 2NS6A 5AYFA 3G6ET 4P3NA 1IL2A 3E19A 4M77A 4CH5A 3OY9A 1BKBA 1H4QA 4EMKB 2RHQB 1Y07A 3VQXA 2XTIA 3CPWA 3MP8A 2VUBA 2OTJA 1VIEA 3MQZA 3ER0A 4P74C 2HAXA 4F7UF 3MEUA 2EAYA 1H4SA 3CC4A 1VQ4A 2LDMA 3CCLA 4PJOC 3CCJA 3C4SA 4F7UG 2M16A 5C0MA 2RI5A 5ELOA 5IAYA 3OYKA 4JS4A 4RCBA 2GCXA 3MEWA 1K8AC 2XHCA 3A7RA 4PG3A 4A54A 5A0LA 3HXYA 4YRRA 3JCMX 5FLXE 3JCMd 4MDWA 5GAOm 1W4SA 4B9XA 1KOGA 1KD1C 4VUBA 2EJFA 2RHSA 3VKIA 3REXA 2RHIA 4KBMB 4BD3A 3HFVA 3JCMJ 3JCMb 3QDRB 1PSEA 1BI0A 2E12A 2E6NA 1J5WA 1EOVA 1EIYA 4C5HA 2FYKA 2B8AA 2PU9B 4RCCA 4K87A 1IREB 3N5BB 1JB0E 2IY5B 2QXFA 3VYGA 4RKUE 4JRIA 2ZR3A 2ZGWA 11ASA 1XOVA 2RI2A 3GNGA 3SFMA 2D9TA 2DU5A 3A74A 3CCMT 2GQVA 2CS7A 4F7UA 3SWNB 1VIFA 2YRVA 1E1TA 2ZPGB 4M77D 1B34A 4HT4A 3DB3A 3CCVT 1KMMA 5LL6S 1U8RA 2XDBA 1NJ8A 4P71A 3LGLA 4ZTUB 5GAN5 5GAN2 2JTMA 4FT4A 2ZPBB 3PZCA 2RO0A 4UP9A 4YP0A 3AHUA 3L2ZA 1NNHA 4YPFA 4L6V5 3G7ZA 2XI9A 2RI3A 2VV5A 1YI2A 3FRNA 4Q15A 3CC2A 2R58A 3HRTA 5J39A 3A8MB 2J3MA 2PQWA 4PJOF 1B70A 2DQ3A 4NL3A 2DEQA 2OTLA 2DQ0A 3FLGA 5KNNA 4PJOG 3GP8A 5GMKm 4II1A 1QW1A 3ZFJA 2ARSA 5GAMj 4H02A 1X75C 4LVMA 3O8VA 3OQ5A 1Y7XA 4HWTA 3JSCA 4GY5A 4Q6GA 4EO4A 1PYSA 3VQYA 1JJCA 2G3RA 3UPUA 4YRCA 1M90C 2CZ0B 1NJIU 1ZHIA 2ZIMA 2P4TA 4O2DA 4EMKC 2EQMA 3G4SA 1B7YB 2AKWB 4IUTA 3KBGA 3M57A 2LC4A 2DXBA 4N4IA 5GANj 1W2BS 1M5Q1 2K5IA 1NPRA 2MAMA 4FT2A 4C8QE 4P3PA 3QTCA 1VUBA 3OMGA 2EQUA 4P74A 2JZ2A 5LJ5h 4WF2A 2DK3A 3VQWA 3UT1A 1WJSA 2HQXA 2E5QA 5A0GA 3JCMf 5KE2A 5KE3A 1VQPT 3HRIA 3INZA 4PJOA 3CD6T 2KSSA 3WVEB 3HHTB 1VQOT 2CZ6B 1ASZA 5CKBA 4L59A 5LJ3j 1JBMA 3QO7A 3BDUA 4OMFB 4FSXA 1H4VB 1WNLA 2QDYB 1N8RU 2ZPEB 1HTTA 3DKMA 4P3OA 3VJPA 3HP9A 3NENA 4J83A 5FU6C 4JS5A 1FX7A 4P73C 2A8EA 1VQ5A 3LYIA 4C0GA 2E70A 1NYQA 3CMAA 4A4GA 3KXTA 4MZTA 3IKMB 1VQ6A 3TREA 5J26A 1M1FA 5GAMd 2V8KA 3SWNC 3RKYA 4YRNA 3Q1JA 3LSQA 2RK1A 4C8QC 3HY1A 3S3MA 3RERA 2E1HA 2ALYA 3RKXA 2RJDA 1U1SA 1M1GA 4LVLA 1W66A 2KY9A 1EVLA 4TWAA 1WJRA 4WJ3M 2ZZGA 2P0QA 1Y96A 4LDVA 1OZ2A 2X4YA 1G5VA 4HCBA 4M75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVD A;  3A5Z A;  4YCW A;  2ZNJ A;  3MEY A;  2ZT8 A;  4XTW A;  1RIQ A;  4P75 A;  4XQ3 A;  5LJ5 j;  3RES A;  5GAN d;  4UP7 A;  3GIB A;  4YRG A;  4M78 F;  4OP0 A;  2EJ9 A;  4HVC A;  1E22 A;  2AMC B;  3M4P A;  4XU2 A;  2ODR D;  3RL6 A;  4X5O A;  4OLF A;  4E51 A;  1E1O A;  1B7Y A;  4M78 G;  2ZIN A;  2AKW A;  2ZT5 A;  2Q5H A;  2ZIO A;  4K86 A;  1LYL A;  4TVW A;  3REU A;  2K57 A;  4PJO D;  3JCM e;  3V8L A;  4M7D A;  5GMK j;  4M7A C;  2RB6 A;  3HFN A;  4M75 A;  4H2T A;  2DXT A;  5GAN h;  3HY0 A;  4C8Q B;  4TTV A;  4YRS A;  4P3N A;  1LJO A;  1IL2 A;  2CJB A;  4YCV A;  1WLE A;  4CS4 A;  4M77 A;  4CH5 A;  2ZR2 A;  1H64 1;  3M4Q A;  1N9W A;  1H4Q A;  4XTX A;  4EMK B;  3A5Y A;  5LJ3 d;  2RHQ B;  3VQX A;  1I8F A;  1NJ5 A;  3JCM Q;  4TQF A;  2AMC A;  2XTI A;  3JB9 G;  2C7I A;  5LJ5 f;  3RIR A;  3RAC A;  4C92 E;  4P72 A;  4ZIB A;  1ADJ A;  4M7A G;  4J6Y A;  3JCM W;  3JCM P;  3HFO A;  3V8K A;  3A32 A;  4CS3 A;  4M78 B;  3EFS A;  2J3L A;  4P74 C;  4CH4 A;  4XTU A;  2DTO A;  4XEO A;  3P8Y A;  2ODR C;  2VXE A;  4X9D A;  4F7U F;  2QHS A;  2VXF A;  2EAY A;  1G5H A;  3IKL A;  1H4S A;  3QUI A;  5LJ3 h;  3RGL A;  2RHS B;  4PJO C;  3VU3 C;  2DKG A;  1H4T A;  4J6W A;  4EMK A;  4A53 A;  4F7U G;  2RHQ A;  3EFR A;  4N0A C;  4TVA B;  5ELO A;  1X01 A;  5K1X A;  2QTX A;  5GAM g;  3PCO A;  1U1T A;  4AH6 A;  5GMK e;  4RCB A;  4H2Y A;  4HA8 A;  1EVK A;  3HFZ B;  3RUX A;  4EX5 A;  2FB7 A;  3A7R A;  2P0L A;  4PG3 A;  4M7A B;  4A54 A;  4RMF A;  2E3C A;  4RQF A;  3MF1 A;  4M78 A;  2DVE A;  3HXY A;  4YRR A;  4RQE A;  3VBB A;  4C92 D;  1YGB A;  2CJ9 A;  4K88 A;  3JCM X;  2CIM A;  4H2W A;  3IG2 A;  3JCM d;  5GAO m;  4YDQ A;  4KR3 A;  2I4N A;  2QHV A;  1KOG A;  4C8Q F;  2ARU A;  2EJF A;  4M7D E;  2RHS A;  3REX A;  1YFT A;  1X54 A;  4M75 E;  1USY A;  2DJZ A;  2EL9 A;  4TVA A;  4PNO A;  3HFV A;  3HRK A;  3JCM J;  4HWP A;  3JCM b;  4F7U B;  1GGM A;  1SET A;  4C8Q G;  1B8A A;  4NL2 A;  4M77 E;  2XGT A;  1D3B A;  1J5W A;  1EOV A;  3HFZ A;  1EIY A;  3IAL A;  5GAN g;  4UPA A;  3PGG A;  2YLC A;  1FYF A;  3I7F A;  1WYD A;  2FYK A;  1B34 B;  3JCM h;  4RCC A;  4K87 A;  1YFR A;  4J5Y A;  2IY5 B;  2ZCE A;  3FIF A;  5K1P A;  4JRI A;  2Q5I A;  2ZR3 A;  4Y91 A;  2ZGW A;  11AS A;  4XU0 A;  4HWR A;  1NJ2 A;  4CH3 A;  4C92 C;  5C53 B;  2DZC A;  2DU5 A;  5GAN 8;  3ICA A;  3A74 A;  2VC8 A;  4NOY A;  2I4M A;  4F7U A;  4M7D D;  5GAM f;  3SWN B;  2Q7G A;  3P8V A;  4M75 D;  1NJ1 A;  4ZTZ B;  4WI1 A;  2JN0 A;  3JB9 F;  1E1T A;  3LSS A;  4HT9 A;  4M77 D;  1B34 A;  3SB2 A;  5LJ3 g;  1L0W A;  4M7A F;  2YHT A;  2HNI A;  3TEH B;  4WJ4 A;  1HXD A;  1KMM A;  4P73 A;  4TVY A;  2DTH A;  4XTY A;  1NJ8 A;  1BIA A;  1I81 A;  1BBU A;  1X2G A;  2ART A;  1HC7 A;  2ZNI A;  4P71 A;  4ZTU B;  4P75 C;  5GAN 5;  4M78 E;  4MMK A;  5GAN 2;  3QO3 A;  3UH0 A;  1X2H A;  1YB3 A;  4V2S A;  4KQE A;  1B70 B;  3V7R A;  3PZC A;  5LJ5 e;  2Q7H A;  3HXZ A;  4UP9 A;  3HXV A;  3AHU A;  1YFS A;  4YP0 A;  3L2Z A;  2E5A A;  1NNH A;  3E9H A;  5GMK h;  2G4C A;  4MML A;  3SWN A;  4YPF A;  3QO5 A;  3QHS A;  4C8Q A;  4XEM A;  4JLI A;  4Q15 A;  5GAN 4;  4QVC A;  2E65 A;  2DU7 A;  5I21 A;  2ZT6 A;  4M7D C;  1NYR A;  2I4O A;  3V7S A;  4M75 C;  4DPG A;  1PYS B;  3UFG A;  4EMG A;  1KQ2 A;  1JJC B;  1KMN A;  2J3M A;  4PJO F;  4BWA A;  2DTI A;  4M77 C;  3FB9 A;  1B70 A;  4YRM A;  2ZTG A;  3BY7 A;  5CAI A;  2DQ3 A;  4NL3 A;  2DEQ A;  1VQZ A;  4M78 D;  1WU7 A;  3R07 A;  2E10 A;  3JCM g;  3JB9 J;  3RF1 A;  2DQ0 A;  3W3S A;  4PHC A;  2ZXF A;  5KNN A;  3JB9 H;  4PJO G;  3QO8 A;  2E41 A;  3V8J A;  5GMK m;  3DSQ A;  5HGQ A;  4P72 C;  12AS A;  2PMF A;  5GAO l;  2ARS A;  5GAM j;  4H02 A;  1EFW A;  2DDZ A;  4HWT A;  4F7U E;  4Q6G A;  3NEM A;  2DZ9 A;  4HT8 A;  4EO4 A;  4M77 G;  3HXU A;  4YRO A;  4YCU A;  1PYS A;  2P5I A;  1BIB A;  3OD1 A;  3VQY A;  3JCM c;  1JJC A;  4YRC A;  3JB9 D;  3VQV A;  1M8V A;  1SRY A;  2ZIM A;  5LJ5 g;  4O2D A;  4M7A D;  4EMK C;  4M7A A;  1YCY A;  4KR2 A;  5LJ5 d;  4H2X B;  1B7Y B;  1G51 A;  2Y90 A;  2AKW B;  5C52 B;  3BW1 A;  4DQ2 A;  5GAN 6;  4YRL A;  4PJO B;  4M7D B;  1Z7N A;  4YRF A;  2CJA A;  4M78 C;  5GAN j;  4YRK A;  1M5Q 1;  4C8Q E;  1QE0 A;  4P3P A;  4M77 B;  3JCM V;  5GAN 7;  5C51 B;  3QTC A;  3A7A A;  2I2L A;  5GAO r;  3HXX A;  2ZZF A;  5E3I A;  1SES A;  5F5W A;  3E9I A;  4C92 F;  4BW9 A;  1ATI A;  4P74 A;  5GAM e;  4YRE A;  5LJ5 h;  4WF2 A;  1USY C;  2E64 A;  1NJ6 A;  3VQW A;  2DXU A;  2Q7E A;  1X56 A;  3FJP A;  4H2X A;  3JCM f;  5GAN 3;  1BBW A;  3V7C A;  1TH7 A;  1X55 A;  4C92 G;  4L87 A;  3CMQ A;  4YRP A;  2IY5 A;  3HRI A;  3L1A A;  3INZ A;  4PJO A;  1MGQ A;  4N0A A;  3HXW A;  3BFM A;  3L4G B;  5GAO p;  1G5I A;  3A31 A;  3MF2 A;  3UGT A;  4LNS A;  1QF6 A;  3LC0 A;  1ASZ A;  1Z7M A;  4H2V A;  2I4L A;  3NET A;  5LJ3 j;  1JBM A;  1LOJ A;  3WQZ A;  3ERR A;  3QO7 A;  3BDU A;  5GAO q;  4C8Q D;  2QHU A;  4HWO A;  1I5L A;  3KFU A;  3PCO B;  1WQ7 A;  4JRK A;  5GAN f;  1H4V B;  3RKW A;  2QHT A;  3HSB A;  1I4K 1;  1LNX A;  2RM4 A;  4JUV A;  4H2S A;  4G85 A;  4H2U A;  5GAN e;  3UGQ A;  3TEG A;  1WNL A;  2ZT7 A;  4XTZ A;  3TEH A;  4EMH A;  2C8M A;  1ADY A;  4C92 B;  4M7A E;  1HTT A;  4P3O A;  2ALY B;  4UP8 A;  3NEN A;  4XU3 A;  4M7D F;  3L4G A;  3M4G A;  4M75 F;  4P73 C;  4YRT A;  1E24 A;  1EQR A;  1ASY A;  2EWN A;  3HTZ A;  2CGH A;  4P71 C;  4X9C A;  1KQ1 A;  1NYQ A;  4M77 F;  4M7D G;  5GMK l;  4J6X A;  3IKM B;  1Y96 B;  4M75 G;  4G84 A;  3TUP A;  3G1Z A;  3P8T A;  4YRI A;  1D3B B;  5GAM d;  1B76 A;  4NCX A;  1EIY B;  4CS2 A;  1WPY A;  4YRQ A;  3JB9 I;  4J15 A;  5LJ3 f;  1JRI A;  3SWN C;  3RKY A;  4YRN A;  3QNE A;  1HK9 A;  2RD1 A;  3LSQ A;  4YYE A;  4C8Q C;  3HY1 A;  5LJ3 e;  5DY9 A;  2YLB A;  4C92 A;  3RER A;  2E1H A;  4CH6 A;  1SER A;  1C0A A;  2ZZE A;  2ALY A;  4YRJ A;  3RKX A;  2RA2 A;  3QSU A;  4XTV A;  2PME A;  5GMK i;  1U1S A;  5ELN A;  3NEL A;  4TQD A;  5GAO n;  4PJO E;  1W66 A;  2EJG A;  1EVL A;  3A7U A;  4TWA A;  4XU1 A;  4WJ3 M;  1N9R A;  3BJU A;  5GAM h;  2ZZG A;  1Y96 A;  1N9S A;  1WQW A;  4HWS A;  4RDX A;  4M75 B; 
#chains in the Genus database with same CATH topology
 3I55 A;  4YCW A;  3MEY A;  1Q86 U;  5LJ5 j;  4OF1 A;  4TVR A;  5GAN d;  1K4U S;  1K9M C;  5I2M A;  4J9F A;  1NJI R;  2Y4X A;  1OYX A;  2AMC B;  3CC7 T;  4XU2 A;  2QA4 Q;  3RL6 A;  4BY6 B;  3G71 Q;  2DJQ A;  2KDS A;  2AK5 A;  1E1O A;  2KNB B;  2HL5 C;  2Q5H A;  3ME9 A;  3KFV A;  4FU6 A;  2K57 A;  4PJO D;  3V8L A;  4RMO A;  1PRL C;  2EYY A;  2LRQ A;  3HFN A;  4PLL A;  4H2T A;  3HY0 A;  1YWP A;  2CP6 A;  3M53 A;  2CP5 A;  1WLE A;  3IQL A;  2M0O A;  1RLQ C;  5LJ3 d;  1QVF A;  3MJX A;  1VA7 A;  1VQ7 Q;  1RAB B;  4JDS A;  3CXC P;  2LCL A;  1G3S A;  4QVZ A;  4KGX B;  1ADJ A;  3JCM W;  1VQ9 A;  4IUV A;  3V8K A;  5HY6 A;  3ULR B;  2QK0 A;  4CS3 A;  3LLR A;  2FG0 A;  4CH4 A;  4XEO A;  3LGF A;  1WJQ A;  2OTJ T;  2ZAE A;  5KYX A;  3EGU A;  2F2W A;  2L89 A;  2QHS A;  2VXF A;  1G5H A;  3ZBD A;  1YJ9 A;  3EG0 A;  2QEX A;  2COW A;  3VS6 A;  2JW4 A;  3MEV A;  2LVM A;  4EMK A;  2RHQ A;  4TVA B;  4N0A C;  1X6G A;  1X01 A;  3OYI A;  5K1X A;  2QTX A;  4Z89 A;  4HVW A;  2F2X A;  2EQI A;  1PCX A;  2HMA A;  2FRY A;  1VQ4 T;  2CZ7 B;  4HA8 A;  3HFZ B;  1WXB A;  3TEE A;  3RUX A;  1SPK A;  2BZ8 A;  2FB7 A;  2P0L A;  4M7A B;  3I56 T;  2EGA A;  3CCR T;  1N8R R;  2GNC A;  2DNU A;  2DVE A;  1NG2 A;  4RQE A;  1NLP C;  3VBB A;  1QQJ A;  3QYH B;  4BUG A;  1EIF A;  2GF7 A;  3IG2 A;  3H0H A;  1WGS A;  2AZS A;  3CC4 Q;  4E7I A;  4R0K A;  3CCL Q;  1BI1 A;  2I4N A;  2PVG B;  4QKU A;  4C8Q F;  2I0N A;  2LMJ A;  2ARU A;  3ASK A;  1RAE B;  4M7D E;  2DVJ A;  2QA4 A;  1YFT A;  2M0Y A;  1X54 A;  4M75 E;  4J7I A;  4PNO A;  4FCY A;  3HRK A;  2NYS A;  3CQT A;  2E5K A;  4RTX A;  2QAZ A;  4FYW B;  4C8Q G;  3PE0 A;  3OYE A;  3E9G A;  3X28 B;  4UPA A;  3PGG A;  2YLC A;  1FYF A;  3I7F A;  1VQK Q;  1QWE A;  1K73 C;  2MIO A;  1OI1 A;  2KGT A;  1TOV A;  4IUP A;  4KH1 B;  3VUB A;  5CO7 A;  5K1P A;  9ATC B;  2Q5I A;  3MCA B;  1I0C A;  2LJ0 A;  1VQM Q;  1VQ7 A;  4CH3 A;  3SHW A;  2GGR A;  5C53 B;  3L42 A;  3GF5 A;  5GAN 8;  3ICA A;  2PZ1 A;  3EGX B;  2LCS A;  4NOY A;  4PFP A;  5GAM f;  2RQR A;  4ZNX A;  1Q82 U;  3QBY A;  4DBH A;  1MND A;  2P0P A;  1NJ1 A;  1Q86 R;  4ZTZ B;  4WI1 A;  4C0F A;  3A8L B;  3LSS A;  4CC2 A;  4HT9 A;  4QQD A;  4OB0 B;  3TEH B;  4P73 A;  4XTY A;  1R0C B;  3ZEH A;  1BBU A;  1HC7 A;  3E9F A;  2K7A A;  4RTW A;  1KSW A;  4B6M A;  3QO3 A;  1X2H A;  1IGQ A;  1QCN A;  4UC4 A;  1SSF A;  1VQ8 Q;  5LJ5 e;  5KYU A;  2OI3 A;  1P92 A;  3HXV A;  3C12 A;  4NS5 A;  2E5A A;  3E9H A;  5GMK h;  3FC3 A;  3SWN A;  3OSV A;  2JMC A;  1AWW A;  3PMT A;  4C8Q A;  1WIE A;  2YUO A;  4Q5W A;  3G6E Q;  2FZG B;  2K5L A;  2E65 A;  1UJ0 A;  1WYX A;  3OYJ A;  4M7D C;  5EG2 A;  2I4O A;  2O4X B;  3V7S A;  1KQS S;  4M75 C;  2JUF A;  2PTK A;  1YI2 T;  3UFG A;  4EMG A;  3CC2 T;  1UG1 A;  2RQV A;  1MNE A;  4ZTF A;  3REA B;  3MP1 A;  4EIK A;  1AZE A;  1VQZ A;  3VS7 A;  3GPL A;  4J9D A;  3JCM g;  3JB9 J;  3RF1 A;  4PHC A;  2ZXF A;  1YJW A;  1IHV A;  2DA9 A;  3CEY A;  3NMZ C;  1VQK A;  3QO8 A;  3V8J A;  5HGQ A;  2CP3 A;  4BY6 C;  4P72 C;  2PMF A;  4AT1 B;  5GAO l;  1H3H A;  1QP3 A;  3CBP A;  4GLM A;  3A5Z B;  1S72 Q;  3URG A;  2RF0 A;  3BDL A;  3HXU A;  1VQM A;  2Y4Y A;  3OYM A;  4YRO A;  2MF2 A;  1RLP C;  2GFA A;  3JCM c;  2HD0 A;  2KMT A;  2DD5 A;  2K3Y A;  2MMP A;  4MDX A;  1M8V A;  2OTL Q;  2JS2 A;  3OS2 A;  4KT0 E;  1W1F A;  2D6F A;  1YCY A;  2QAS A;  2M9U A;  2Y90 A;  4JZ3 A;  4ATO A;  3UF4 A;  4DQ2 A;  4Z02 A;  4YRL A;  5IHI A;  4PLI A;  1UJY A;  1YHQ Q;  2LQW A;  3G4S T;  1GCQ C;  4AFQ C;  5KYN A;  1T0H A;  3C94 A;  2E4H A;  1QE0 A;  1VQL Q;  2K4Y A;  3HKS A;  4M77 B;  1VQ8 A;  3JCM V;  5GAN 7;  5C51 B;  5GAO r;  1QVP A;  2ZZF A;  2RH2 A;  5E3I A;  1MMD A;  4BW9 A;  2F69 A;  1ATI A;  4BAC A;  1M2V A;  4X34 A;  4YRE A;  4ZN3 A;  4OGC A;  1USY C;  2E64 A;  3P8D A;  3R6N A;  4E6R A;  5CKH A;  3G6E A;  4FL6 A;  2DPP B;  2CKK A;  2XID A;  3L1A A;  1WHJ A;  2KRN A;  3H8Z A;  1M4Z A;  2KT1 A;  4N0A A;  1NEG A;  3OYL A;  3HXW A;  3AT1 B;  1R8O B;  3SEM A;  1G5I A;  3A31 A;  2R5M A;  3UGT A;  1NEB A;  1LVK A;  3NET A;  4JRQ A;  2MWP A;  2EGE A;  2RJC A;  1Q82 R;  2AHJ B;  2C0O A;  1RAD B;  3ERR A;  3EG2 A;  2FRW A;  2PNI A;  4C8Q D;  5GAO q;  2NWM A;  1I5L A;  4BI4 A;  1MUZ A;  3OMC A;  2O9S A;  2NUT B;  5CQX A;  3RKW A;  4PKC C;  4RTZ A;  3CCQ Q;  1Q7Y U;  3RMQ A;  3EG1 A;  1QKW A;  3UGQ A;  4RTY A;  4EMH A;  1S72 A;  2V1R A;  1H92 A;  1ZLM A;  1ADY A;  4C92 B;  1X6O A;  2ZZD A;  3OYB A;  4C0D B;  4M7D F;  4JJB A;  2L3Q A;  3OYH A;  2HSP A;  1YBY A;  4M75 F;  1KQS P;  1PD0 A;  1E24 A;  2EWN A;  8ATC B;  2A37 A;  4C0Z A;  2XIC A;  3HTZ A;  4X9C A;  4OMP A;  3CBO A;  4DOV A;  4M7D G;  5GMK l;  3PIO A;  3LWI A;  4QQG A;  4M75 G;  1FMK A;  2IG0 A;  4G84 A;  2EYQ A;  3CCS T;  4YRI A;  1UGR B;  1MHN A;  4NCX A;  1EIY B;  1WPY A;  2CUD A;  1YHQ A;  3JB9 I;  4J15 A;  2FL7 A;  3CMA T;  1RI0 A;  4IUQ A;  4BDY A;  2KRS A;  1VQ6 T;  4MZP A;  2RA2 A;  1M90 U;  1VQL A;  2JM8 A;  1WA7 A;  2RHX A;  3OS1 A;  2PME A;  1VQ5 Q;  3NEL A;  2CT3 A;  5CCA A;  2EJG A;  1M1K C;  1H8K A;  3QKJ A;  4LUD A;  4BE1 A;  3UDC A;  4A4E A;  4XU1 A;  3H6Z A;  3OYG A;  4BE0 A;  4RDX A;  2QQB A;  1F1B B;  3F70 A;  4QVD A;  2DL8 A;  2ZNJ A;  2EIF A;  2ZT8 A;  1ABO A;  2CP7 A;  1NJI C;  2KXC A;  2YRC A;  4Y92 A;  3EFO B;  4UP7 A;  4J8O A;  5CQY A;  4LVI A;  3GIB A;  5KYY B;  2EJ9 A;  3I55 T;  2RJF A;  1E22 A;  4HVU A;  1SG5 A;  3L2W A;  2DYB A;  3S3O A;  4X5O A;  4O5V A;  3CCQ A;  2ZIO A;  1NZ9 A;  5I2S A;  4LDU A;  2BE7 D;  2BUD A;  2XDP A;  5KYW B;  2JTE A;  2LP5 A;  4M7D A;  1OU8 A;  2RB6 A;  3CCV A;  4M75 A;  4HCZ A;  1KQS A;  2WSE E;  1LJO A;  1Y57 A;  2VGM A;  3EG9 B;  2ZR2 A;  1H64 1;  2P0K A;  2DF6 A;  4JJN K;  3M4Q A;  2MOX A;  1I8F A;  1RAC B;  2L3S A;  2GTJ A;  3EHR A;  3JCM Q;  1NJ5 A;  2AMC A;  4K11 A;  4FSS A;  2B86 A;  2BKD N;  2QG9 B;  5GJW B;  3JB9 G;  5FRN A;  1I1J A;  2L5Q A;  4F16 A;  3RIR A;  3RAC A;  3C95 A;  4QW2 A;  4C92 E;  4P72 A;  3PFS A;  4J6Y A;  1TXQ A;  5CK9 A;  5FU7 B;  4M7A G;  1GXI E;  2OX7 A;  3JCM P;  1KHI A;  1RAF B;  2C06 A;  4M78 B;  2KRO A;  2WSF E;  2J3L A;  2EYX A;  3QPH A;  1EX4 A;  2JOY A;  2ODR C;  1MV0 B;  2VXE A;  1MMA A;  3OB9 A;  5CR2 A;  1VOM A;  3DLM A;  2DET A;  2Z0W A;  2A7Y A;  3A8G B;  1IRX A;  3IKL A;  3OW2 S;  2X4W A;  3RGL A;  1ZSZ C;  4DEY A;  1H4T A;  4J6W A;  4JRP A;  1D1A A;  3P8B B;  3JAM E;  2LCC A;  1GBR A;  5GAM g;  3PCO A;  5FW9 A;  4AH6 A;  5GMK e;  1VQ9 Q;  2QEX T;  2AZV A;  1TUG B;  1XQH A;  1Q7Y R;  1N8R C;  2EFI A;  4H2Y A;  1XTD A;  3MHX A;  2JT4 A;  1EVK A;  4ESR A;  2EW3 A;  1NYF A;  2LQN A;  2HBP A;  4OB3 B;  4RMF A;  3MF1 A;  3CME T;  1GCQ A;  1A0N B;  1BK2 A;  2CIM A;  3QDF A;  3CCU Q;  5IT9 E;  1NYG A;  2O01 E;  2QHV A;  2PVD B;  4CC3 A;  3MEA A;  4XAX B;  1V29 B;  2KR3 A;  2RHU A;  1USY A;  2DJZ A;  2F5K A;  4TVA A;  3RBB B;  4HWP A;  3MP6 A;  3VS3 A;  2JM9 A;  2RN8 A;  1SET A;  1B8A A;  1G3Y A;  1XNI A;  4NL2 A;  2XGT A;  1D3B A;  3HFZ A;  1UGQ B;  2QA4 T;  5GAN g;  3IAL A;  1WDX A;  3LX7 A;  3G71 T;  3I5R A;  1NM7 A;  1WYD A;  1X6B A;  2NLU A;  1YIT Q;  3JCM h;  2XU8 A;  1ZUU A;  1PM3 A;  3QZ5 B;  3GNF B;  1Q81 U;  1AWJ A;  4IIO A;  1BI3 A;  1K76 A;  1W2B P;  1GRI A;  3TSW A;  2XKO C;  4XU0 A;  4HWR A;  1NJ2 A;  1UEB A;  2X51 A;  4C92 C;  5CKE A;  3L2U A;  2DZC A;  4YTL A;  5IHK A;  2QTV A;  2GQI A;  1Q86 C;  2I4M A;  4M7D D;  2EQJ A;  4OGE A;  3P8V A;  1CSK A;  4M75 D;  3CPF A;  5I22 A;  1VQ7 T;  4DBQ A;  1VQP A;  4HCK A;  2MCN A;  2JN0 A;  2E6Z A;  4RTV A;  2EKO A;  2KEA A;  4HXJ A;  3SB2 A;  5LJ3 g;  1KC8 U;  2F5T X;  3I9Q A;  2YHT A;  4PFZ A;  4O6J A;  3DLL A;  4TVY A;  1IZ6 A;  2BZX A;  4A4F A;  4XK8 E;  1BIA A;  1I81 A;  1X2G A;  2ART A;  1N6A A;  4D6W A;  2K5F A;  2ZNI A;  4P75 C;  4M78 E;  3UH0 A;  2LT4 A;  5DM7 R;  3X25 B;  2EYW A;  4KQE A;  4OML A;  4LVK A;  1E7O A;  3HXZ A;  2E3I A;  1YFS A;  1YJN Q;  2JS0 A;  3PIP A;  1OUL A;  2G4C A;  1IO6 A;  3QO5 A;  3QHS A;  2EPD A;  3FJ5 A;  1JXM A;  4JLI A;  3CCU A;  4QVC A;  1OV3 A;  2DU7 A;  2ZT6 A;  4OB2 B;  3L2V A;  3NTK A;  1KQ2 A;  1OOT A;  3CC4 T;  2ESW A;  4CC4 B;  3CCL T;  3CCJ T;  4BWA A;  2A3L A;  3FB9 A;  1U3O A;  2ZTG A;  1X69 A;  1WU7 A;  2ECZ A;  2E10 A;  3E1S A;  3W3S A;  2DM1 A;  1I5O B;  2RHZ A;  2LX7 A;  4N4H A;  1W2B A;  3M0U A;  2E41 A;  1YIT A;  2L8D A;  12AS A;  4Y28 E;  4ZTJ A;  1EFW A;  2DFU A;  4EPC A;  1EFN A;  1WHM A;  4FYX B;  3NEM A;  2QQR A;  2DAQ A;  2DZ9 A;  1VQK T;  3OYD A;  4HT8 A;  1KG1 A;  2DE0 X;  4M77 G;  3MET A;  3NPF A;  1JQQ A;  2P5I A;  1BIB A;  2K2V A;  4DOW A;  3VS0 A;  2W10 A;  3JB9 D;  3VQV A;  5D6W A;  2QQA A;  1SRY A;  2ENM A;  5LJ5 g;  4M7A D;  1VQM T;  1YJW Q;  4KR2 A;  3I56 Q;  3VRZ A;  4LDX A;  2JTF A;  5LJ5 d;  4H2X B;  4GLK A;  3U23 A;  1ZBX A;  3EHQ A;  5D6X A;  5C52 B;  1RL2 A;  3BW1 A;  5GAN 6;  4N4G A;  1X2K A;  2QQS A;  4C5I A;  1K0X A;  2CJA A;  4M78 C;  3OYN A;  2XG8 D;  4LDY A;  2YSQ A;  3J81 E;  1D0Z A;  2L0A A;  4BI3 A;  2KK4 A;  4GBQ A;  1YIJ Q;  2PVO B;  3A7A A;  2I2L A;  1I07 A;  4AFU C;  3A1P A;  4BDZ A;  5F5W A;  2NUP A;  1YJN A;  4C92 F;  4JJD A;  2IVW A;  1VQN Q;  4E7S A;  1X2Q A;  5HK0 A;  4CC7 A;  2DXU A;  1SRL A;  1VQ8 T;  2Q7E A;  3QJ6 A;  3FJP A;  1ZX6 A;  1QCF A;  1Q81 R;  4BB7 A;  1TH7 A;  1X55 A;  2D0Q B;  4LXC A;  4C92 G;  4L87 A;  2IY5 A;  1N27 A;  2CH4 A;  3OW2 A;  1ZSZ A;  2EQK A;  2LNH B;  1ACM B;  1MGQ A;  1BBZ A;  2HSE B;  3EAE A;  3HRS A;  2E3H A;  1KIK A;  5KYX B;  3L4G B;  2VGN A;  2WAC A;  2ZPH B;  5GAO p;  1Q82 C;  3MF2 A;  1PG5 B;  2FHD A;  1Z7M A;  5FRO A;  3PTA A;  2I4L A;  3CCE Q;  3EGD B;  4FM4 B;  1PNJ A;  1FXX A;  1DJ7 B;  1BB9 A;  1JJ2 S;  4E7K A;  2DRK A;  2YXY A;  3KFU A;  2EKH A;  1WQ7 A;  4JRK A;  5GAN f;  2DD4 A;  4PJN A;  1OZ3 A;  4KH0 B;  1LNX A;  2RM4 A;  1BYM A;  4JUV A;  2YUQ A;  3TEG A;  5EC7 A;  2ZT7 A;  4XTZ A;  2GFU A;  1ZQ1 A;  1G3W A;  1XJW B;  1UEC A;  4M7A E;  2FPF A;  1BU1 A;  1RAI B;  1NE8 A;  4UP8 A;  1UE9 A;  4XU3 A;  1K8A U;  4IUU A;  3M4G A;  3RMS A;  2D8J A;  3X26 B;  1S72 T;  2LQ8 A;  2LX9 A;  3H41 A;  2ZPI B;  4E2F B;  1YNZ A;  3TU4 K;  5D6Y A;  1WXU A;  3I56 A;  3CCR A;  1KD1 U;  3VUZ A;  2C0T A;  2O88 A;  3G1Z A;  3MO8 A;  2OTL T;  5KCO A;  3HL8 A;  4CS2 A;  1H3Z A;  3I5S A;  4YRQ A;  5CKD A;  5LJ3 f;  3WXM B;  1KHC A;  3QNE A;  1HK9 A;  2RD1 A;  1WI7 A;  2NUZ A;  4LDW A;  2VB6 A;  4RG2 A;  2YLB A;  4C92 A;  1SRM A;  1C0A A;  2ZZE A;  3OBY A;  2YUN A;  2H3J A;  1UGS B;  4XTV A;  1YHQ T;  1YIJ A;  3OSS C;  8AT1 B;  1VQN A;  1TUD A;  1ZA1 B;  4OB1 B;  3O5Z A;  2DRM A;  4IKF A;  1VQL T;  4LE9 A;  1BI2 A;  1N9R A;  2LQK A;  2CSI A;  5GAM h;  1SEM A;  1QCO A;  1N9S A;  2VAS A;  3PNW C;  4LD9 K;  3OBW A;  1ZBJ A;  3GOX A;  3FEO A;  5DY9 A;  1M27 C;  4XTW A;  4P75 A;  1KFZ A;  4XQ3 A;  1V1C A;  2AKL A;  3S3N A;  2ZCF B;  5FU6 B;  4M78 F;  3H9N A;  4OP0 A;  1G8X A;  3CCE A;  4HVC A;  1AD5 A;  3VYH B;  1UHC A;  2YRD A;  2ODR D;  2OAU A;  5CKF A;  1Y71 A;  2GTO A;  1B7Y A;  4M78 G;  2ZIN A;  1R0B G;  2AKW A;  2D1X A;  5IH2 A;  5KYU B;  2M1H A;  3GBQ A;  4KUI A;  1LYL A;  1C1A A;  1G3T A;  2CYZ B;  2DIQ A;  1D1C A;  3JCM e;  1PC0 A;  5GMK j;  4M7A C;  1B07 A;  2DXT A;  4RG8 A;  5GAN h;  1YCS B;  4C8Q B;  2YDL A;  4TTV A;  4L5G A;  4YRS A;  3LWH A;  3CCQ T;  4OVA A;  1LCK A;  1RI9 A;  2H8H A;  2CJB A;  4YCV A;  4CS4 A;  2AKK A;  2RQU A;  2CRE A;  1N9W A;  4XTX A;  3CCM Q;  3A5Y A;  3GLX A;  4B9W A;  4TQF A;  5L23 A;  5FRM A;  2C7I A;  5LJ5 f;  4ELZ C;  1OPK A;  4ZIB A;  3M55 A;  1M3B A;  3HFO A;  3A32 A;  4LVJ A;  1JJ2 P;  3OYC A;  3EFS A;  3CCV Q;  2KXD A;  4D8D A;  4XTU A;  2DTO A;  2R5A A;  3P8Y A;  2K6D A;  4X9D A;  3I35 A;  1Z9Z A;  1HYO A;  1S1N A;  2KQW A;  1RAA B;  1QLY A;  3QUI A;  2H3E B;  5LJ3 h;  2RHS B;  4ELY C;  2P84 A;  1Q7Y C;  4LD6 A;  3VU3 C;  2DKG A;  4ZGE B;  3EH2 A;  3M0Q A;  4A53 A;  3EFR A;  3M59 A;  4JZ4 A;  1U1T A;  3T9N A;  4PJJ A;  1KJW A;  2X4J A;  2XDD A;  1VQ5 T;  2RHY A;  1WX6 A;  2CP0 A;  4IIM A;  3P8H A;  3OYF A;  2LNV A;  4EX5 A;  3OS5 A;  4E7H A;  2J6F A;  3G1J A;  1QVF S;  2E3C A;  4RQF A;  4M78 A;  3PMI A;  4E47 A;  2F1L A;  1JO8 A;  4C92 D;  2LT1 A;  4EDU A;  1YGB A;  2CJ9 A;  3QXE B;  4K88 A;  4IUR A;  1K8A R;  4H2W A;  1YFN A;  1JU5 C;  2CT4 A;  1QVG S;  1JEG A;  4YDQ A;  3HTR A;  4KR3 A;  1M1K U;  1UHF A;  2ATC B;  2IPO B;  3M5A A;  1TUC A;  2EL9 A;  2DIG A;  5DLO A;  4OMM A;  2FPE A;  1UGV A;  4F7U B;  2V8I A;  4R55 A;  1NLO C;  5IN1 A;  1GGM A;  4HKE A;  1OQK A;  2DLP A;  3EH1 A;  4M77 E;  4ME7 A;  4JLG A;  3CCS Q;  3WVD B;  2QYZ A;  1J3T A;  1B34 B;  2MYS A;  2QDL A;  1YFR A;  4J5Y A;  2MWO A;  1K9A A;  2O31 A;  3L2R A;  1Q95 G;  4A4K A;  2ZCE A;  1PD1 A;  3FIF A;  3CCM A;  3RNJ A;  1YN8 A;  4PL6 A;  4Y91 A;  4CRI A;  1QKX A;  1JJ2 A;  1UDL A;  2HQH A;  2J06 A;  3A98 A;  2ZPF B;  4KUL A;  1VYV A;  3REB B;  4HCC A;  2VC8 A;  2L3R A;  5KH6 A;  3JRZ A;  3TSZ A;  2Q7G A;  2A28 A;  4DBF A;  3RDV A;  4CI0 C;  4DA4 A;  2FVU A;  3LW5 E;  3VV0 A;  2K3X A;  1UGP B;  3JB9 F;  1WHL A;  2DL4 A;  1L0W A;  3NFC A;  4M7A F;  1SKU B;  2HNI A;  2LTO A;  4WJ4 A;  1HXD A;  2DTH A;  1ZUY A;  2DL3 A;  4WTO B;  3OS0 A;  2HKN A;  3QG1 A;  4MMK A;  1YB3 A;  2DXC A;  2O2O A;  4V2S A;  4D8K A;  4FIB A;  3SD4 A;  1B70 B;  3V7R A;  3KUF A;  3C0C A;  2KT8 A;  2Q7H A;  4BE2 A;  1PKS A;  2SRC A;  3CXC S;  3HRU A;  3NTH A;  1VQP Q;  1UB4 A;  3PVQ A;  4MML A;  3CD6 Q;  1VQ9 T;  1QMC A;  4XEM A;  1WHK A;  5GAN 4;  5M9O A;  2D8H A;  2KYM A;  3FDR A;  3MPU B;  5I21 A;  1VQO Q;  2CZ1 B;  3X20 B;  1BCO A;  4AMC A;  2AT1 B;  3X24 B;  1NYR A;  5HK3 A;  4DPG A;  1O9S A;  1PYS B;  3NTI A;  1NPP A;  2DX1 A;  5CIU A;  3CCU T;  1YJ9 T;  3LH0 A;  1JJC B;  2V8J A;  1KMN A;  2DTI A;  3QJY A;  4M77 C;  4YRM A;  3BY7 A;  5CAI A;  3PT9 A;  3TCJ A;  4M78 D;  3R07 A;  3CCS A;  3CPW S;  1PKT A;  5IXF A;  3JB9 H;  1Z9Q A;  2RPN A;  3DSQ A;  2PUO B;  4E7J A;  1HD3 A;  4E7L A;  4PJL A;  4ZN1 A;  1AHJ B;  1OU9 A;  2DDZ A;  4F7U E;  3SDZ A;  1R77 A;  3A8O B;  5KCH A;  1YIT T;  2FZK B;  4YCU A;  1QVG P;  1B3Q A;  3M0R A;  3OD1 A;  2FEI A;  2QQ9 A;  1M8M A;  4R56 A;  1WFW A;  2O9V A;  2RQT A;  4M7A A;  1K9M U;  4JJC A;  4A4H A;  1M90 R;  1G51 A;  1U06 A;  1D0Y A;  1SHG A;  2HZY A;  3THK A;  4PJO B;  3J7A F;  4M7D B;  4JPB W;  1Z7N A;  2HCK A;  4YRF A;  2VYT A;  3HPW A;  2KRM A;  3UA7 A;  4M4Z A;  1C6V X;  4YRK A;  3OYA A;  5A0D A;  3QYG B;  2XD0 A;  4C0D C;  3M56 A;  3A8H B;  3HXX A;  1SES A;  1QP2 A;  3E9I A;  1Q81 C;  5GAM e;  2J6O A;  2WSC E;  2JMA A;  2ROT A;  3CD6 A;  1NJ6 A;  1WLP B;  1ZA2 B;  2VWF A;  2COY A;  5DLQ E;  2RK2 A;  1X56 A;  4H2X A;  5GAN 3;  1BBW A;  2J6K A;  3V7C A;  1YJN T;  1VQO A;  3CMQ A;  1RAH B;  4YRP A;  2QI2 A;  4C5E A;  2MI6 A;  1RAG B;  3CC7 Q;  1PHT A;  2LJ1 A;  3BFM A;  4LNS A;  1OX9 A;  1QF6 A;  1BCM A;  3LC0 A;  2GBQ A;  4H2V A;  3EGX A;  1V76 A;  5GJV B;  4ANJ A;  4AG2 C;  1LOJ A;  1YP5 A;  4J7F A;  1KC8 C;  1AWO A;  2EBP A;  3WQZ A;  3UWN A;  5A2Q E;  2QHU A;  4HWO A;  2DMO A;  3PCO B;  1HSQ A;  3NGP A;  2QHT A;  2BIV A;  3HSB A;  1I4K 1;  3DB4 A;  4H2S A;  2X3X D;  3M54 A;  4G85 A;  4H2U A;  4KGZ B;  5GAN e;  2DO3 A;  3TEH A;  1QVG A;  2X35 A;  2OAW A;  1B7T A;  2K2M A;  2C8M A;  1GFD A;  2A36 A;  2CUB A;  3OW2 P;  2ALY B;  1RUW A;  2COZ A;  3L4G A;  3L2Q A;  5FWC A;  4YRT A;  1EQR A;  1ASY A;  3VS4 A;  3EGD A;  2CGH A;  4P71 C;  5IXB A;  1M2O A;  3NHN A;  1KQ1 A;  2HDA A;  2JVV A;  4M77 F;  4A63 B;  2XK0 A;  4J6X A;  3CME A;  2R57 A;  1Y96 B;  4PK4 A;  2OTJ Q;  3M58 A;  3TUP A;  1ZSG A;  3P8T A;  1D3B B;  1M9S A;  3CPW P;  1B76 A;  4P5N A;  2SEM A;  2FO0 A;  3QZ9 B;  1YJW T;  1JRI A;  1TU0 B;  3QII A;  5C6S A;  2O4X A;  2KYB A;  4HVV A;  4ZGJ B;  4J9G A;  4YYE A;  3CBM A;  5LJ3 e;  1TG0 A;  1SER A;  4CH6 A;  4C5G A;  2KAF A;  2PUK B;  4YRJ A;  3M0P A;  4F17 A;  3QSU A;  5GMK i;  2D0N A;  5CVI A;  2JXB A;  1VQ4 Q;  1FWZ A;  5ELN A;  1PSF A;  4TQD A;  3CCJ Q;  2VKN A;  5GAO n;  1K73 U;  3TQ7 P;  1E6G A;  4LN2 A;  1T0J A;  4PJO E;  3CCR Q;  4KUD K;  3D7S B;  3A7U A;  1O75 A;  4E7Z A;  3G71 A;  1YIJ T;  3BJU A;  5FU7 C;  3VS2 A;  1WQW A;  1VQN T;  4HWS A;  4AFS C;  5HKC A;  3A5Z A;  2RNA A;  4QT7 A;  4RTU A;  1RIQ A;  3OA6 A;  1T3S A;  3RES A;  3CC7 A;  2HQE A;  3J80 E;  4YRG A;  4BI8 B;  2JNG A;  3M9Q A;  3UA6 A;  4ZGD B;  1TS9 A;  3M4Y A;  2X4X A;  4ORZ A;  5J3B A;  3CXC A;  4MZM A;  1K9M R;  3M4P A;  3QWX X;  1M3A A;  3R6O A;  4E51 A;  4OLF A;  1EZZ B;  2OJ2 A;  4OMO A;  2KE9 A;  3OYY A;  2ZT5 A;  4FW1 A;  3CCE T;  2KVQ G;  5L8R E;  4K86 A;  4QQ6 A;  4TVW A;  3REU A;  2RJE A;  3S6W A;  2NS6 A;  5AYF A;  1SSH A;  3EG3 A;  5ECA A;  3G6E T;  1NBE B;  1CKA A;  4P3N A;  1IL2 A;  3E19 A;  1MV3 A;  4M77 A;  4CH5 A;  3OY9 A;  1BKB A;  1H4Q A;  4EMK B;  2RHQ B;  1Y07 A;  3VQX A;  4J9E A;  2LZ6 B;  4WCI A;  2XTI A;  1E6H A;  3CPW A;  1IXD A;  4RTT A;  3MP8 A;  1KC8 R;  2VUB A;  2OTJ A;  1VIE A;  6AT1 B;  3MQZ A;  2V1Q A;  2QGF B;  1G83 A;  2KBT A;  3ER0 A;  4P74 C;  3H0F A;  1IGU A;  2HAX A;  1CKB A;  2MPX C;  2W0Z A;  3QWY A;  4F7U F;  1AVZ C;  3MEU A;  1LPL A;  2EAY A;  2IIM A;  3RR6 A;  1H4S A;  3CC4 A;  2CP2 A;  1VQ4 A;  2LDM A;  3CCL A;  4PJO C;  3CCJ A;  3C4S A;  4FW2 A;  4F7U G;  2M16 A;  5C0M A;  2RI5 A;  3VS1 A;  5ELO A;  5IAY A;  3OYK A;  2CH4 W;  2NUT A;  4JS4 A;  4RCB A;  5D7U A;  2GCX A;  3MEW A;  2BTT A;  4Z88 A;  1K8A C;  2XHC A;  3A7R A;  1ARK A;  4PG3 A;  4A54 A;  5A0L A;  5I11 A;  3HXY A;  2HL3 A;  4YRR A;  1ZUK A;  3JCM X;  1YI2 Q;  5FLX E;  3JCM d;  4MDW A;  3CC2 Q;  5GAO m;  1W4S A;  4B9X A;  1D1B A;  1KOG A;  1KD1 C;  4VUB A;  3H0I A;  2M02 A;  3PVL A;  2EJF A;  4AG1 C;  2RHS A;  3VKI A;  3REX A;  2HEQ A;  2RHI A;  4F14 A;  4KBM B;  4BD3 A;  3HFV A;  3JCM J;  3JCM b;  2FPD A;  3QDR B;  3MKD A;  1HJD A;  1N5Z A;  1PSE A;  1BI0 A;  2E12 A;  2E6N A;  2NUP B;  1J5W A;  1EOV A;  1EIY A;  2DER A;  3BE3 A;  4C5H A;  3E2U A;  2FYK A;  2B8A A;  2ED1 A;  2PU9 B;  4FYV B;  4RCC A;  4K87 A;  1IRE B;  2BZY A;  3N5B B;  2ED0 A;  1JB0 E;  2IY5 B;  2QXF A;  1ZSZ B;  3VYG A;  1K73 R;  4RKU E;  2HBW A;  4JRI A;  1OPL A;  4Z8A A;  2ZR3 A;  2ZGW A;  11AS A;  1XOV A;  2RI2 A;  3GNG A;  2DIL A;  1X27 A;  4DEX A;  3SFM A;  2D9T A;  2DU5 A;  3A74 A;  3CCM T;  2GQV A;  2CS7 A;  4F7U A;  1VYT A;  3SWN B;  2BE9 B;  2J7I A;  4J9C A;  1VIF A;  2YRV A;  3G4S Q;  1E1T A;  2ZPG B;  3EFO A;  1JXO A;  4M77 D;  1B34 A;  4HT4 A;  1D0X A;  3DB3 A;  3CCV T;  1KMM A;  5LL6 S;  5KYY A;  1U8R A;  2XDB A;  4OMN A;  4OMQ A;  1NJ8 A;  1FYN A;  4P71 A;  3LGL A;  4ZTU B;  5GAN 5;  5GAN 2;  2G6F X;  2EGC A;  2JTM A;  4FT4 A;  2ZPB B;  4DBR A;  1WHH A;  3PZC A;  1GCP A;  2RO0 A;  4J9H A;  4UP9 A;  1T3L A;  4YP0 A;  3AHU A;  3L2Z A;  5KYW A;  1NNH A;  1M3C A;  2CSQ A;  4YPF A;  4L6V 5;  3G7Z A;  2F2V A;  1FMV A;  2XI9 A;  2RI3 A;  3VRY A;  2VV5 A;  1W70 A;  1YI2 A;  1SF9 A;  2DBK A;  3FRN A;  4Q15 A;  5IHN A;  4LUE A;  3CC2 A;  3EG9 A;  3JV3 A;  2R58 A;  1G2B A;  3HRT A;  1VYU A;  1PWT A;  1WHG A;  5J39 A;  4PJM A;  1KK7 A;  2YT6 A;  1GFC A;  4RUG A;  5AT1 B;  3A8M B;  2J3M A;  4LNP A;  2MK5 A;  2PQW A;  4PJO F;  1WXT A;  2YUP A;  2K9G A;  1B70 A;  2DQ3 A;  4NL3 A;  3UAT A;  2DEQ A;  2OTL A;  2DYI A;  2DQ0 A;  3FLG A;  5KNN A;  2QGG A;  4PJO G;  2DL7 A;  3GP8 A;  5GMK m;  4II1 A;  1QW1 A;  3ZFJ A;  1UFF A;  2A08 A;  2ARS A;  5GAM j;  4H02 A;  1TWB A;  1X75 C;  4LVM A;  3O8V A;  3OQ5 A;  1Y7X A;  4HWT A;  3JSC A;  4GY5 A;  4Q6G A;  1M30 A;  2X3W D;  4EO4 A;  1AZG B;  1KD1 R;  2EVR A;  1PYS A;  2RQW A;  3TVT A;  2A0F B;  3VQY A;  2K79 A;  1JJC A;  2G3R A;  4KRT A;  3UPU A;  4YRC A;  1TSF A;  1M90 C;  1M2V B;  2CZ0 B;  1TTH B;  1ZHI A;  2P4R A;  2RMO A;  1NJI U;  2ZIM A;  2L2P A;  2P4T A;  4O2D A;  1GBQ A;  4EMK C;  2EQM A;  3CMA Q;  3G4S A;  1B7Y B;  2AKW B;  1AEY A;  4IUT A;  2FZC B;  1VQ6 Q;  3KBG A;  4AFZ C;  3M57 A;  2L3P A;  2LC4 A;  1K1Z A;  2DXB A;  4N4I A;  5GAN j;  1W2B S;  2DEU A;  1M5Q 1;  2K5I A;  1PRM C;  1NPR A;  2MAM A;  2ROL A;  4FT2 A;  4C8Q E;  4P3P A;  5HCK A;  2LJ3 A;  3QTC A;  1VUB A;  3OMG A;  2EQU A;  1QWF A;  1OX8 A;  4P74 A;  2X9H A;  1FMW A;  2JZ2 A;  2M51 A;  5LJ5 h;  4WF2 A;  4J9I A;  2DK3 A;  3VQW A;  2YWW A;  3UT1 A;  1WJS A;  2HQX A;  2E5Q A;  5A0G A;  5FWB A;  3JCM f;  3VS5 A;  5KE2 A;  5KE3 A;  1VQP T;  3HRI A;  2ABL A;  3INZ A;  3I55 Q;  1W6X A;  4PJO A;  3CD6 T;  2KSS A;  2DL5 A;  2AIR B;  2JJ9 A;  3WVE B;  1D09 B;  3HHT B;  1VQO T;  2CZ6 B;  1ASZ A;  5CKB A;  4L59 A;  5LJ3 j;  1IHW A;  1JBM A;  3M0S A;  1UUE A;  1U5S A;  1Y0M A;  3QO7 A;  3BDU A;  1IB8 A;  4OMF B;  4FSX A;  1H4V B;  2KI7 A;  2HKQ B;  1MMN A;  1UTI A;  2XMF A;  1WNL A;  7AT1 B;  2QDY B;  1OEB A;  2CDT A;  4X1V A;  1AOJ A;  1N8R U;  3LH5 A;  2ZPE B;  1HTT A;  3DKM A;  4P3O A;  3VJP A;  3HP9 A;  3NEN A;  4J83 A;  5FU6 C;  4JS5 A;  1FX7 A;  4P73 C;  2A8E A;  4PFO A;  1VQ5 A;  3LYI A;  4C0G A;  2E70 A;  1WZO A;  1NYQ A;  1GL5 A;  3CMA A;  4A4G A;  4F04 B;  3KXT A;  2VVK A;  4MZT A;  3IKM B;  3M0T A;  1QVF P;  1VQ6 A;  3TRE A;  5J26 A;  1M1F A;  5GAM d;  4J9B A;  1AWX A;  1C0M A;  2V8K A;  3SWN C;  3RKY A;  4YRN A;  3Q1J A;  3LSQ A;  2RK1 A;  2DBM A;  4C8Q C;  3HY1 A;  2J05 A;  3S3M A;  2E1H A;  3RER A;  2V26 A;  2ALY A;  3RKX A;  1YWO A;  1YJ9 Q;  2QEX Q;  1MMG A;  2RJD A;  1U1S A;  1M1G A;  1AT1 B;  4LVL A;  2K3B A;  1W66 A;  2C0I A;  2KY9 A;  1SHF A;  4FYY B;  3CME Q;  1EVL A;  4TWA A;  1WJR A;  4WJ3 M;  2ZZG A;  2P0Q A;  1ABQ A;  1K0S A;  1Y96 A;  1M1K R;  4LDV A;  3ZL7 C;  1OZ2 A;  2X4Y A;  1G5V A;  1X43 A;  4HCB A;  2EYZ A;  4KGV B;  4M75 B; 
#chains in the Genus database with same CATH homology
 3I55 A;  4YCW A;  3MEY A;  1Q86 U;  5LJ5 j;  4OF1 A;  4TVR A;  5GAN d;  1K9M C;  5I2M A;  2Y4X A;  1OYX A;  2AMC B;  3CC7 T;  4XU2 A;  3RL6 A;  4BY6 B;  2KDS A;  1E1O A;  2Q5H A;  3ME9 A;  4FU6 A;  2K57 A;  4PJO D;  3V8L A;  4RMO A;  2LRQ A;  3HFN A;  4PLL A;  4H2T A;  3HY0 A;  3M53 A;  1WLE A;  2M0O A;  5LJ3 d;  1QVF A;  4JDS A;  2LCL A;  1G3S A;  4QVZ A;  1ADJ A;  3JCM W;  1VQ9 A;  4IUV A;  3V8K A;  5HY6 A;  4CS3 A;  3LLR A;  4CH4 A;  4XEO A;  3LGF A;  1WJQ A;  2OTJ T;  2L89 A;  2QHS A;  2VXF A;  1G5H A;  3ZBD A;  1YJ9 A;  2QEX A;  3MEV A;  2LVM A;  4EMK A;  2RHQ A;  4TVA B;  4N0A C;  3OYI A;  1X01 A;  5K1X A;  2QTX A;  1VQ4 T;  2CZ7 B;  4HA8 A;  3HFZ B;  3TEE A;  3RUX A;  2FB7 A;  2P0L A;  4M7A B;  3I56 T;  3CCR T;  2DVE A;  4RQE A;  3VBB A;  3QYH B;  4BUG A;  1EIF A;  2GF7 A;  3IG2 A;  1WGS A;  4E7I A;  1BI1 A;  2I4N A;  2PVG B;  4C8Q F;  2ARU A;  3ASK A;  4M7D E;  2QA4 A;  1YFT A;  1X54 A;  4M75 E;  4J7I A;  4PNO A;  3HRK A;  4C8Q G;  3OYE A;  3E9G A;  3X28 B;  4UPA A;  3PGG A;  2YLC A;  1FYF A;  3I7F A;  1K73 C;  1OI1 A;  4IUP A;  3VUB A;  5CO7 A;  5K1P A;  2Q5I A;  3MCA B;  4CH3 A;  1VQ7 A;  5C53 B;  3L42 A;  3GF5 A;  5GAN 8;  3ICA A;  4NOY A;  5GAM f;  1Q82 U;  3QBY A;  2P0P A;  1NJ1 A;  4ZTZ B;  4WI1 A;  4C0F A;  3A8L B;  3LSS A;  4HT9 A;  4QQD A;  4OB0 B;  3TEH B;  4P73 A;  4XTY A;  1BBU A;  3ZEH A;  1HC7 A;  3E9F A;  3QO3 A;  1X2H A;  4UC4 A;  1SSF A;  5LJ5 e;  1P92 A;  3HXV A;  3C12 A;  4NS5 A;  2E5A A;  3E9H A;  5GMK h;  3FC3 A;  3SWN A;  3OSV A;  3PMT A;  4C8Q A;  4Q5W A;  2K5L A;  2E65 A;  3OYJ A;  4M7D C;  5EG2 A;  2I4O A;  2O4X B;  3V7S A;  1KQS S;  4M75 C;  2JUF A;  1YI2 T;  3UFG A;  4EMG A;  3CC2 T;  4ZTF A;  3MP1 A;  1VQZ A;  3GPL A;  3JCM g;  3JB9 J;  3RF1 A;  4PHC A;  2ZXF A;  1YJW A;  3CEY A;  1VQK A;  3QO8 A;  3V8J A;  5HGQ A;  4BY6 C;  4P72 C;  2PMF A;  5GAO l;  1QP3 A;  3CBP A;  3A5Z B;  3URG A;  3BDL A;  3HXU A;  1VQM A;  2Y4Y A;  3OYM A;  4YRO A;  2MF2 A;  2GFA A;  3JCM c;  2HD0 A;  2KMT A;  2DD5 A;  2K3Y A;  2MMP A;  4MDX A;  1M8V A;  3OS2 A;  4KT0 E;  2D6F A;  1YCY A;  2M9U A;  2Y90 A;  4ATO A;  4DQ2 A;  4Z02 A;  4YRL A;  4PLI A;  3G4S T;  3C94 A;  1QE0 A;  2K4Y A;  3HKS A;  4M77 B;  1VQ8 A;  3JCM V;  5GAN 7;  5C51 B;  5GAO r;  1QVP A;  2ZZF A;  2RH2 A;  5E3I A;  4BW9 A;  2F69 A;  1ATI A;  4BAC A;  4X34 A;  4YRE A;  4ZN3 A;  4OGC A;  1USY C;  2E64 A;  3P8D A;  5CKH A;  3G6E A;  4FL6 A;  2DPP B;  2CKK A;  2XID A;  3L1A A;  3H8Z A;  1M4Z A;  4N0A A;  3HXW A;  3OYL A;  1R8O B;  1G5I A;  3A31 A;  2R5M A;  3UGT A;  3NET A;  4JRQ A;  2MWP A;  2RJC A;  2AHJ B;  3ERR A;  5GAO q;  4C8Q D;  1I5L A;  4BI4 A;  3OMC A;  5CQX A;  3RKW A;  4PKC C;  1Q7Y U;  3RMQ A;  3UGQ A;  4EMH A;  1S72 A;  1ADY A;  4C92 B;  1X6O A;  2ZZD A;  3OYB A;  4C0D B;  4M7D F;  3OYH A;  1YBY A;  4M75 F;  1E24 A;  2EWN A;  4C0Z A;  2XIC A;  3HTZ A;  4X9C A;  3CBO A;  4DOV A;  4M7D G;  5GMK l;  3PIO A;  3LWI A;  4QQG A;  4M75 G;  4G84 A;  2IG0 A;  2EYQ A;  3CCS T;  4YRI A;  1UGR B;  1MHN A;  4NCX A;  1EIY B;  1WPY A;  1YHQ A;  3JB9 I;  4J15 A;  2FL7 A;  3CMA T;  1RI0 A;  4IUQ A;  4BDY A;  1VQ6 T;  4MZP A;  2RA2 A;  1M90 U;  1VQL A;  2RHX A;  3OS1 A;  2PME A;  3NEL A;  5CCA A;  2EJG A;  1M1K C;  3QKJ A;  4BE1 A;  3UDC A;  4A4E A;  4XU1 A;  3H6Z A;  3OYG A;  4BE0 A;  4RDX A;  2QQB A;  3F70 A;  4QVD A;  2ZNJ A;  2EIF A;  2ZT8 A;  1NJI C;  4UP7 A;  4J8O A;  5CQY A;  4LVI A;  3GIB A;  2EJ9 A;  3I55 T;  2RJF A;  1E22 A;  3L2W A;  3S3O A;  4X5O A;  4O5V A;  3CCQ A;  2ZIO A;  1NZ9 A;  5I2S A;  2BUD A;  4LDU A;  2XDP A;  4M7D A;  2RB6 A;  3CCV A;  4M75 A;  4HCZ A;  1KQS A;  2WSE E;  1LJO A;  2VGM A;  2ZR2 A;  1H64 1;  2P0K A;  4JJN K;  3M4Q A;  1I8F A;  1NJ5 A;  3JCM Q;  2AMC A;  2BKD N;  3JB9 G;  5FRN A;  2L5Q A;  3RIR A;  3RAC A;  3C95 A;  4QW2 A;  4C92 E;  4P72 A;  3PFS A;  4J6Y A;  5CK9 A;  4M7A G;  5FU7 B;  1GXI E;  3JCM P;  1KHI A;  2C06 A;  4M78 B;  2WSF E;  2J3L A;  3QPH A;  2JOY A;  2ODR C;  2VXE A;  3OB9 A;  5CR2 A;  3DLM A;  2A7Y A;  3A8G B;  3IKL A;  3OW2 S;  2X4W A;  3RGL A;  1H4T A;  4J6W A;  4JRP A;  3P8B B;  3JAM E;  2LCC A;  5GAM g;  3PCO A;  4AH6 A;  5GMK e;  2QEX T;  4H2Y A;  1XQH A;  1N8R C;  2EFI A;  1XTD A;  3MHX A;  1EVK A;  2HBP A;  4OB3 B;  4RMF A;  3MF1 A;  3CME T;  2CIM A;  5IT9 E;  2O01 E;  2QHV A;  2PVD B;  3MEA A;  4XAX B;  1V29 B;  2RHU A;  1USY A;  2DJZ A;  2F5K A;  4TVA A;  4HWP A;  3MP6 A;  1SET A;  1B8A A;  1G3Y A;  1XNI A;  4NL2 A;  2XGT A;  1D3B A;  3HFZ A;  1UGQ B;  2QA4 T;  5GAN g;  3IAL A;  3LX7 A;  3G71 T;  1WYD A;  2NLU A;  3JCM h;  2XU8 A;  3QZ5 B;  1Q81 U;  3GNF B;  1BI3 A;  2XKO C;  4XU0 A;  4HWR A;  1NJ2 A;  1UEB A;  4C92 C;  5CKE A;  3L2U A;  2DZC A;  4YTL A;  1Q86 C;  2I4M A;  4M7D D;  2EQJ A;  4OGE A;  3P8V A;  4M75 D;  3CPF A;  1VQ7 T;  1VQP A;  2JN0 A;  2E6Z A;  2EKO A;  3SB2 A;  5LJ3 g;  1KC8 U;  2F5T X;  2YHT A;  4O6J A;  3DLL A;  4TVY A;  1IZ6 A;  4A4F A;  4XK8 E;  1BIA A;  1I81 A;  1X2G A;  2ART A;  1N6A A;  4D6W A;  2K5F A;  2ZNI A;  4P75 C;  4M78 E;  3UH0 A;  2LT4 A;  5DM7 R;  3X25 B;  4KQE A;  4LVK A;  3HXZ A;  1YFS A;  3PIP A;  2G4C A;  3QO5 A;  3QHS A;  4JLI A;  3CCU A;  4QVC A;  2DU7 A;  2ZT6 A;  4OB2 B;  3L2V A;  3NTK A;  1KQ2 A;  3CC4 T;  3CCL T;  3CCJ T;  4BWA A;  2A3L A;  3FB9 A;  2ZTG A;  1WU7 A;  2E10 A;  3E1S A;  3W3S A;  2RHZ A;  4N4H A;  1W2B A;  2E41 A;  1YIT A;  2L8D A;  12AS A;  4Y28 E;  4ZTJ A;  1EFW A;  4EPC A;  3NEM A;  2QQR A;  2DAQ A;  2DZ9 A;  1VQK T;  3OYD A;  4HT8 A;  1KG1 A;  4M77 G;  3MET A;  2P5I A;  1BIB A;  2K2V A;  4DOW A;  3JB9 D;  3VQV A;  5D6W A;  2QQA A;  1SRY A;  5LJ5 g;  4M7A D;  1VQM T;  4KR2 A;  4LDX A;  2JTF A;  5LJ5 d;  4H2X B;  4GLK A;  1ZBX A;  5D6X A;  5C52 B;  1RL2 A;  3BW1 A;  5GAN 6;  4N4G A;  2QQS A;  4C5I A;  2CJA A;  4M78 C;  3OYN A;  2XG8 D;  4LDY A;  3J81 E;  4BI3 A;  2KK4 A;  2PVO B;  3A7A A;  2I2L A;  4BDZ A;  5F5W A;  1YJN A;  4C92 F;  2IVW A;  5HK0 A;  2DXU A;  1VQ8 T;  2Q7E A;  3QJ6 A;  3FJP A;  4BB7 A;  1TH7 A;  1X55 A;  2D0Q B;  4C92 G;  4L87 A;  2IY5 A;  1N27 A;  3OW2 A;  2EQK A;  1MGQ A;  3EAE A;  3HRS A;  3L4G B;  2VGN A;  2WAC A;  2ZPH B;  5GAO p;  1Q82 C;  3MF2 A;  2FHD A;  1Z7M A;  5FRO A;  3PTA A;  2I4L A;  4FM4 B;  1FXX A;  1DJ7 B;  1JJ2 S;  4E7K A;  3KFU A;  1WQ7 A;  4JRK A;  5GAN f;  2DD4 A;  1OZ3 A;  1LNX A;  2RM4 A;  1BYM A;  4JUV A;  3TEG A;  2ZT7 A;  4XTZ A;  2GFU A;  1ZQ1 A;  1G3W A;  4M7A E;  1NE8 A;  4UP8 A;  4XU3 A;  1K8A U;  4IUU A;  3M4G A;  3RMS A;  3X26 B;  1S72 T;  2LQ8 A;  2LX9 A;  2ZPI B;  3TU4 K;  5D6Y A;  3I56 A;  3CCR A;  1KD1 U;  3VUZ A;  3G1Z A;  3MO8 A;  2OTL T;  5KCO A;  3HL8 A;  4CS2 A;  1H3Z A;  4YRQ A;  5CKD A;  5LJ3 f;  3WXM B;  1KHC A;  3QNE A;  1HK9 A;  2RD1 A;  4LDW A;  4RG2 A;  2YLB A;  4C92 A;  1C0A A;  2ZZE A;  3OBY A;  2H3J A;  1UGS B;  4XTV A;  1YHQ T;  1YIJ A;  3OSS C;  1VQN A;  4OB1 B;  4IKF A;  1VQL T;  1BI2 A;  1N9R A;  2LQK A;  5GAM h;  1N9S A;  3PNW C;  4LD9 K;  3OBW A;  3GOX A;  3FEO A;  5DY9 A;  4XTW A;  4P75 A;  4XQ3 A;  3S3N A;  2ZCF B;  5FU6 B;  4M78 F;  4OP0 A;  3CCE A;  4HVC A;  3VYH B;  2ODR D;  2OAU A;  5CKF A;  1Y71 A;  1B7Y A;  4M78 G;  2ZIN A;  2AKW A;  2M1H A;  4KUI A;  1LYL A;  1G3T A;  2CYZ B;  2DIQ A;  3JCM e;  5GMK j;  4M7A C;  2DXT A;  4RG8 A;  5GAN h;  4C8Q B;  4TTV A;  4L5G A;  4YRS A;  3LWH A;  3CCQ T;  4OVA A;  2CJB A;  4YCV A;  4CS4 A;  1N9W A;  4XTX A;  3A5Y A;  3GLX A;  4B9W A;  4TQF A;  5FRM A;  2C7I A;  5LJ5 f;  4ELZ C;  4ZIB A;  3M55 A;  3HFO A;  3A32 A;  4LVJ A;  3OYC A;  3EFS A;  4XTU A;  2DTO A;  2R5A A;  3P8Y A;  4X9D A;  2KQW A;  3QUI A;  5LJ3 h;  2RHS B;  4ELY C;  1Q7Y C;  4LD6 A;  3VU3 C;  2DKG A;  4ZGE B;  4A53 A;  3EFR A;  3M59 A;  1U1T A;  3T9N A;  2X4J A;  2XDD A;  1VQ5 T;  2RHY A;  3P8H A;  3OYF A;  2LNV A;  4EX5 A;  3OS5 A;  4E7H A;  1QVF S;  2E3C A;  4RQF A;  4M78 A;  3PMI A;  4E47 A;  4C92 D;  2LT1 A;  4EDU A;  1YGB A;  2CJ9 A;  3QXE B;  4K88 A;  4IUR A;  4H2W A;  1QVG S;  4YDQ A;  4KR3 A;  1M1K U;  3M5A A;  2EL9 A;  2DIG A;  5DLO A;  4F7U B;  2V8I A;  4R55 A;  1GGM A;  5IN1 A;  4HKE A;  4M77 E;  4ME7 A;  4JLG A;  3WVD B;  1B34 B;  1YFR A;  4J5Y A;  2MWO A;  3L2R A;  4A4K A;  2ZCE A;  3FIF A;  3CCM A;  4PL6 A;  4Y91 A;  4CRI A;  1JJ2 A;  2ZPF B;  4KUL A;  4HCC A;  2VC8 A;  2L3R A;  5KH6 A;  3JRZ A;  2Q7G A;  4CI0 C;  4DA4 A;  2FVU A;  3LW5 E;  3VV0 A;  2K3X A;  1UGP B;  3JB9 F;  1L0W A;  3NFC A;  4M7A F;  2HNI A;  2LTO A;  4WJ4 A;  1HXD A;  2DTH A;  3OS0 A;  3QG1 A;  4MMK A;  1YB3 A;  2DXC A;  4V2S A;  4FIB A;  3SD4 A;  1B70 B;  3V7R A;  3KUF A;  2Q7H A;  4BE2 A;  3CXC S;  3HRU A;  3NTH A;  1UB4 A;  4MML A;  1VQ9 T;  4XEM A;  5GAN 4;  5M9O A;  3FDR A;  5I21 A;  2CZ1 B;  3X20 B;  3X24 B;  1NYR A;  5HK3 A;  4DPG A;  1O9S A;  1PYS B;  3NTI A;  1NPP A;  5CIU A;  3CCU T;  1YJ9 T;  3LH0 A;  1JJC B;  2V8J A;  1KMN A;  2DTI A;  3QJY A;  4M77 C;  4YRM A;  3BY7 A;  5CAI A;  3PT9 A;  3TCJ A;  4M78 D;  3R07 A;  3CCS A;  3CPW S;  3JB9 H;  3DSQ A;  2PUO B;  4E7J A;  4E7L A;  4ZN1 A;  1AHJ B;  2DDZ A;  4F7U E;  3SDZ A;  3A8O B;  5KCH A;  1YIT T;  4YCU A;  3OD1 A;  2QQ9 A;  4R56 A;  4M7A A;  1K9M U;  4A4H A;  1G51 A;  4PJO B;  3J7A F;  4M7D B;  1Z7N A;  4YRF A;  2VYT A;  3HPW A;  4YRK A;  3OYA A;  5A0D A;  3QYG B;  2XD0 A;  4C0D C;  3M56 A;  3A8H B;  3HXX A;  1SES A;  1QP2 A;  3E9I A;  1Q81 C;  5GAM e;  2WSC E;  3CD6 A;  1NJ6 A;  5DLQ E;  2RK2 A;  1X56 A;  4H2X A;  5GAN 3;  1BBW A;  3V7C A;  1YJN T;  1VQO A;  3CMQ A;  4YRP A;  2QI2 A;  4C5E A;  2MI6 A;  3BFM A;  4LNS A;  1QF6 A;  3LC0 A;  4H2V A;  1LOJ A;  4J7F A;  1KC8 C;  3WQZ A;  3UWN A;  5A2Q E;  2QHU A;  4HWO A;  3PCO B;  2QHT A;  2BIV A;  3HSB A;  1I4K 1;  3DB4 A;  4H2S A;  4H2U A;  3M54 A;  4G85 A;  5GAN e;  2DO3 A;  3TEH A;  1QVG A;  2X35 A;  2C8M A;  2ALY B;  3L4G A;  3L2Q A;  4YRT A;  1EQR A;  1ASY A;  2CGH A;  4P71 C;  1KQ1 A;  2JVV A;  4M77 F;  2XK0 A;  4J6X A;  3CME A;  2R57 A;  1Y96 B;  3M58 A;  3TUP A;  3P8T A;  1B76 A;  1D3B B;  1M9S A;  4P5N A;  1YJW T;  3QZ9 B;  1JRI A;  3QII A;  5C6S A;  2O4X A;  4ZGJ B;  4YYE A;  3CBM A;  5LJ3 e;  1SER A;  4CH6 A;  4C5G A;  2KAF A;  2PUK B;  4YRJ A;  3QSU A;  5GMK i;  5CVI A;  1FWZ A;  5ELN A;  1PSF A;  4TQD A;  5GAO n;  1K73 U;  4PJO E;  4KUD K;  3A7U A;  1O75 A;  3G71 A;  1YIJ T;  3BJU A;  5FU7 C;  1WQW A;  1VQN T;  4HWS A;  5HKC A;  3A5Z A;  1RIQ A;  3OA6 A;  3RES A;  3CC7 A;  2HQE A;  3J80 E;  4YRG A;  4BI8 B;  2JNG A;  3M9Q A;  4ZGD B;  3M4Y A;  2X4X A;  5J3B A;  3CXC A;  3M4P A;  4MZM A;  3R6O A;  4E51 A;  4OLF A;  3OYY A;  2ZT5 A;  3CCE T;  2KVQ G;  5L8R E;  4K86 A;  4QQ6 A;  4TVW A;  3REU A;  2RJE A;  3S6W A;  2NS6 A;  5AYF A;  3G6E T;  4P3N A;  1IL2 A;  3E19 A;  4M77 A;  4CH5 A;  3OY9 A;  1BKB A;  1H4Q A;  4EMK B;  2RHQ B;  1Y07 A;  3VQX A;  2XTI A;  3CPW A;  3MP8 A;  2VUB A;  2OTJ A;  1VIE A;  3MQZ A;  3ER0 A;  4P74 C;  2HAX A;  4F7U F;  3MEU A;  2EAY A;  1H4S A;  3CC4 A;  1VQ4 A;  2LDM A;  3CCL A;  4PJO C;  3CCJ A;  3C4S A;  4F7U G;  2M16 A;  5C0M A;  2RI5 A;  5ELO A;  5IAY A;  3OYK A;  4JS4 A;  4RCB A;  2GCX A;  3MEW A;  1K8A C;  2XHC A;  3A7R A;  4PG3 A;  4A54 A;  5A0L A;  3HXY A;  4YRR A;  3JCM X;  5FLX E;  3JCM d;  4MDW A;  5GAO m;  1W4S A;  4B9X A;  1KOG A;  1KD1 C;  4VUB A;  2EJF A;  2RHS A;  3VKI A;  3REX A;  2RHI A;  4KBM B;  4BD3 A;  3HFV A;  3JCM J;  3JCM b;  3QDR B;  1PSE A;  1BI0 A;  2E12 A;  2E6N A;  1J5W A;  1EOV A;  1EIY A;  4C5H A;  2FYK A;  2B8A A;  2PU9 B;  4RCC A;  4K87 A;  1IRE B;  3N5B B;  1JB0 E;  2IY5 B;  2QXF A;  3VYG A;  4RKU E;  4JRI A;  2ZR3 A;  2ZGW A;  11AS A;  1XOV A;  2RI2 A;  3GNG A;  3SFM A;  2D9T A;  2DU5 A;  3A74 A;  3CCM T;  2GQV A;  2CS7 A;  4F7U A;  3SWN B;  1VIF A;  2YRV A;  1E1T A;  2ZPG B;  4M77 D;  1B34 A;  4HT4 A;  3DB3 A;  3CCV T;  1KMM A;  5LL6 S;  1U8R A;  2XDB A;  1NJ8 A;  4P71 A;  3LGL A;  4ZTU B;  5GAN 5;  5GAN 2;  2JTM A;  4FT4 A;  2ZPB B;  3PZC A;  2RO0 A;  4UP9 A;  4YP0 A;  3AHU A;  3L2Z A;  1NNH A;  4YPF A;  4L6V 5;  3G7Z A;  2XI9 A;  2RI3 A;  2VV5 A;  1YI2 A;  3FRN A;  4Q15 A;  3CC2 A;  2R58 A;  3HRT A;  5J39 A;  3A8M B;  2J3M A;  2PQW A;  4PJO F;  1B70 A;  2DQ3 A;  4NL3 A;  2DEQ A;  2OTL A;  2DQ0 A;  3FLG A;  5KNN A;  4PJO G;  3GP8 A;  5GMK m;  4II1 A;  1QW1 A;  3ZFJ A;  2ARS A;  5GAM j;  4H02 A;  1X75 C;  4LVM A;  3O8V A;  3OQ5 A;  1Y7X A;  4HWT A;  3JSC A;  4GY5 A;  4Q6G A;  4EO4 A;  1PYS A;  3VQY A;  1JJC A;  2G3R A;  3UPU A;  4YRC A;  1M90 C;  2CZ0 B;  1NJI U;  1ZHI A;  2ZIM A;  2P4T A;  4O2D A;  4EMK C;  2EQM A;  3G4S A;  1B7Y B;  2AKW B;  4IUT A;  3KBG A;  3M57 A;  2LC4 A;  2DXB A;  4N4I A;  5GAN j;  1W2B S;  1M5Q 1;  2K5I A;  1NPR A;  2MAM A;  4FT2 A;  4C8Q E;  4P3P A;  3QTC A;  1VUB A;  3OMG A;  2EQU A;  4P74 A;  2JZ2 A;  5LJ5 h;  4WF2 A;  2DK3 A;  3VQW A;  3UT1 A;  1WJS A;  2HQX A;  2E5Q A;  5A0G A;  3JCM f;  5KE2 A;  5KE3 A;  1VQP T;  3HRI A;  3INZ A;  4PJO A;  3CD6 T;  2KSS A;  3WVE B;  3HHT B;  1VQO T;  2CZ6 B;  1ASZ A;  5CKB A;  4L59 A;  5LJ3 j;  1JBM A;  3QO7 A;  3BDU A;  4OMF B;  4FSX A;  1H4V B;  1WNL A;  2QDY B;  1N8R U;  2ZPE B;  1HTT A;  3DKM A;  4P3O A;  3VJP A;  3HP9 A;  3NEN A;  4J83 A;  5FU6 C;  4JS5 A;  1FX7 A;  4P73 C;  2A8E A;  1VQ5 A;  3LYI A;  4C0G A;  2E70 A;  1NYQ A;  3CMA A;  4A4G A;  3KXT A;  4MZT A;  3IKM B;  1VQ6 A;  3TRE A;  5J26 A;  1M1F A;  5GAM d;  2V8K A;  3SWN C;  3RKY A;  4YRN A;  3Q1J A;  3LSQ A;  2RK1 A;  4C8Q C;  3HY1 A;  3S3M A;  3RER A;  2E1H A;  2ALY A;  3RKX A;  2RJD A;  1U1S A;  1M1G A;  4LVL A;  1W66 A;  2KY9 A;  1EVL A;  4TWA A;  1WJR A;  4WJ3 M;  2ZZG A;  2P0Q A;  1Y96 A;  4LDV A;  1OZ2 A;  2X4Y A;  1G5V A;  4HCB A;  4M75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...