4XVCA

Crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMPLDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYVIGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVEDTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRYIGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERVMSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIETLLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPEGKQAIARIGEFLRKQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interdomain Hydrophobic Interactions Modulate the Thermostability of Microbial Esterases from the Hormone-Sensitive Lipase Family.
pubmed doi rcsb
source organism Environmental samples
molecule tags Hydrolase
molecule keywords Esterase E40
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xvcA00
1TQHA 3C6YA 2XLBA 1MNQA 5JAHA 5ALUA 4QEKA 1AMNA 2JGMA 2XUHA 1LPOA 5ALVA 4MJ3A 4QDUA 5HF5A 3HABA 4ZXFA 3B5EA 1YSCA 1W52X 1JU3A 5C7YA 1LGYA 1GQRA 3KXPA 3UUEA 4ZREA 1VOTA 4RNCA 4FMPA 4HXFB 5AKJA 2XI4A 4UBIA 4Q3OA 2YH2A 4ETWA 1YCDA 4Y2XA 1CUWA 1X70A 3X3HA 4DIUA 5K3EA 1ZI6A 3GUUA 4KE9A 3WZMA 1AKNA 1ZD2P 3BXPA 3H18A 1LPSA 4WDQA 5CXUA 2O2IA 2C4HA 4U2CA 1EHYA 2J3DA 2ES4A 2RONA 3C6XA 3F97A 4UBJA 4X90A 3G0IA 4BVJA 4HRXA 1XRNA 2XMCA 2ORYA 3S8YA 5ALWA 5CW2A 4H7KA 1LZLA 5AKIA 1QIMA 2QS9A 2Z8ZA 5DYYA 5EIHA 4AQDA 1E8DA 5BWCA 1QIGA 4J7AA 3ZLTA 1BCRA 1XZFA 1O6FA 5AH0A 1MX9A 4DNFA 1BEZA 4NMWA 1CRLA 1P0MA 4GW3A 1K6EA 3OURA 4BP8A 2Y1KA 4OB6A 1A8QA 1CUBA 2GBIA 4D9JA 1TIBA 3AIKA 4BVLA 3TEJA 2HADA 1IVYA 1EDBA 3BF8A 1CUHA 2H7YA 1QGED 4OB7A 2Y2VA 2PU7A 2RHTA 3HYSA 3VISA 2LIPA 3QMVA 2PM8A 1ZOIA 1XQXA 2ZJFA 3DQZA 5KWJA 1UK6A 1DU4A 3R41A 4NS4A 5DWDA 3VDXA 1SC9A 1E5TA 1UOPA 1XQWA 4CFSA 2C58A 1GPNA 3H1BA 3STXA 1CUIA 5JAOA 3OTQA 1TCAA 1J2EA 4M0MA 1NU6A 2HFJA 1XZJA 2ZYIA 2HRRA 3WKAA 2AJDA 2QUAA 2WJ4A 4WFKA 1B41A 5AM5A 2O2GA 5ALFA 1AURA 4A23A 2AJBA 4G8CA 5LYYA 3FYUC 1R88A 2QZPA 4HZGA 5HCUA 4UFPA 4AX4A 3V1LA 1XZMA 4QDTA 4MYSA 4PW0A 2HA3A 4ITVA 1CUZA 1ZIYA 5HK9A 3I2HA 1LPNA 1FJ2A 3BJRA 3DLTA 1QOZA 1CUGA 4PNZA 2BJHA 1YB6A 5DYWA 3BL8A 4F60A 5A62A 4TGLA 3D7RA 3YASA 1G4HA 4X95A 3H0CA 4KAJA 2B61A 2GZRA 3STUA 2IIVA 4ARAA 3AFIA 4TVKA 2I03A 2IITA 3PUIA 2BCEA 3VKFA 2C5GA 1THGA 2VT6A 5JYCA 1FFAA 2OCIA 5HQ3B 4EZIA 3H1AA 4A16A 5CT5A 4X92A 2WG2A 4C89A 1QONA 2PUJA 3KD2A 1X2BA 2DHDA 4AZ0A 5EHXA 2E3JA 1Q84A 2VA9A 3O9VA 1YR2A 2XMSA 3G0GA 1LBSA 1UT6A 4UBKA 2NW6A 1XQYA 2XUKA 3A2LA 4H18A 4UHHA 1QJ4A 5HKBA 5ALKA 4HVTA 1LPBB 4A5SA 3IDAA 3WK7A 2DQZA 4X7BA 1CFJA 4X94A 2X8BA 2XUJA 4J0DA 1VJ5A 2DHEA 5AKZA 2Y6UA 3WLAA 4BCCA 1E89A 4G9EA 1YS1X 4FNGA 1TRHA 4N8SA 4ZGBA 2WTMA 4V2IA 1ZD5A 3C6BA 5AKEA 2OPHA 1ODSA 3A6ZA 5LZ7A 2BFNA 1ZGCA 3WWDA 1BN7A 5EHQA 1CUSA 1FFBA 5FDFA 2WIDA 1MX1A 5JZSA 1GT6A 3LIIA 1O6GA 4CIAA 1TKRA 3O4GA 2V97A 1W4LA 3QMWA 5C8XA 4JUIA 4FBMA 5FRDA 3QYJA 4KJXA 3K9BA 3ESCA 5BOVA 1JKMA 3L1IA 5FV4A 2VAVA 2AJCA 4QE3A 4C4YA 1MPXA 1IUOA 1Q0RA 3W2TA 1LPPA 1A8SA 4E46A 3I6ZA 1BROA 5KWIA 2GZSA 3IBTA 2PU5A 3AZOA 1J06A 1W6RA 4F5ZA 1UK8A 5EIEA 2OQVA 5LZ8A 4BTLA 5CTAA 5HZGA 3KSRA 5K3BA 3W06A 4FBLA 4Q1VA 3ZLUA 5HK8A 5ALJA 1THTA 3D4LA 4OD0A 2FUKA 3DNMA 4J0JA 1C7JA 3R3VA 3PF9A 1QO9A 4YASA 2CZQA 3BF7A 1JMYA 4P92A 1TK3A 2HA6A 3B3QA 1R50A 4DTCA 4GDMA 2XLCA 1P0IA 3ANSA 2ECFA 1H23A 5IVDA 1IUNA 4AB1A 4UHBA 2W22A 2HA2A 3AIMA 4L0CA 4BE9A 4L72A 1B6GA 3D2CA 4KE8A 4E15A 2CBGA 2PPLA 2BUAA 3G0BA 2WLSA 1BS9A 1M33A 4I19A 2XMGA 5ALZA 5AK5A 1MT3A 1QIIA 4IQ4A 2JGFA 5LZ4A 4WDRA 5IVIA 1HDEA 3OM8A 5LZ5A 2HRQA 4X00A 1EA5A 3WKDA 3NGMA 5A7HA 5JATA 3E1GA 2VTVA 4KRXA 3ESBA 3GBSA 2G4LA 2QTBA 3IB3A 1WB4A 3G0CA 3H17A 3PFBA 4W1SA 2DHCA 1XZGA 1ODTC 1H2WA 4Q05A 3H2GA 1ZICA 1ZD4A 2HM7A 2OLEA 1UKBA 3O4HA 4ZV7A 3G9UA 3C70A 4DYHA 4LYEA 1EX9A 2BGRA 2JEZA 4AZ3A 2X76A 3DL7A 1XRRA 5CMLA 5KREA 3F96A 4B9EA 1AC5A 3LP5A 3I2GA 4RPCA 2XQIA 1JU4A 1MTZA 2WHPB 1YAJA 2OCKA 4BAUA 3PFCA 5ISMA 1BU8A 2FX5A 1L7RA 4E11A 2WUGA 4C87A 3UMJA 3EQ8A 1QLWA 1R9MA 3DYIA 3O95A 3JW8A 2PUHA 5E4YA 2OGSA 3WWPA 1BEEA 3STWA 2PX6A 1S8OA 3IUMA 3I2FA 1VA4A 1WOMA 4B82A 2D0DA 4HXEB 1UZAA 3IURA 2QVBA 3AINA 5CH3A 4UBMA 5JASA 3C6ZA 2XMQA 2PVSA 1DINA 4C88A 4FWBA 4HAIA 1SFRA 1H22A 2WIKA 1AGYA 2H1IA 3ED1A 4DNQA 2VATA 4Q3KA 2XMBA 2DQYA 2VJBA 4H77A 1MAAA 1XZLA 2GBCA 1YASA 4TPKA 2J4CA 5AI6A 3RARA 4EHBA 2OAEA 4FNMA 4RE6A 2Z5GA 5AM0A 1CUAA 2JGJA 2WKWA 3WWCA 4AXBA 4EY5A 2G5PA 5ALYA 3OPMA 4X97A 2J4FA 3T52A 1R1DA 1F0NA 1EB9A 2CUTA 4K5QA 4Z49A 1W75A 3HI4A 3AIOA 5T4HA 3G7NA 5I8PA 5HQ3A 5ALLA 4X85A 2FJ0A 4Y2SA 1CLEA 1G5FA 4K6GA 1HLGA 1ORVA 3PI6A 3R40A 4YK7A 3ESAA 5AM4A 2WFMA 4X93A 1DWQA 3IA2A 1WHTA 4J0HA 5AI5A 4X6XA 3IIIA 5AM3A 3ZWQA 5CT9A 4QWWA 4J0IA 1ORWA 2JF0A 3HSSA 5D3ZA 1EDEA 4GBGA 1CV2A 5JD5A 4IO0A 4OYLA 3MGAA 2WG0A 4J0KA 3QH4A 4QWMA 3PDCA 4FOLA 4EA6A 3WQHA 1XZCA 2XB6A 3H2IA 3I2JA 3WWEA 2OQIA 2XT0A 5D6OA 1Y7IA 3WK5A 1CEXA 3IULA 4KE7A 4DMCA 4KE6A 3V9AA 4KR0A 2EDCA 5AKHA 3N0TA 4PSDA 4Y2QA 5AI8A 2PBLA 5JD6A 5CT8A 1BN6A 3RK4A 4C6HA 3VJMA 2GYUA 3CXUA 3BDVA 1CVLA 1ZJ5A 3MUNA 1EDDA 3ZPXA 1CUJA 3D5EA 4BC1A 3EIOA 4NVRA 7YASA 2YXPX 4DNOA 1GZ7A 2Y2UA 5CURA 3ICVA 3O4JA 3ZLVA 3TGLA 3G9TA 1GPKA 1CUFA 3WIBA 2QJWA 4P9NA 2I3ZA 3R3UA 2RIPA 4KYVA 2OXEA 2I78A 4I4CA 3FLBA 4W9RA 1UOQA 4H7FA 1IMJA 1ZI8A 3WK4A 3M83A 5HF6A 5EIAA 4MQLA 3STTA 4DNPA 3R0VA 1N1MA 4X71A 5ALHA 2PSEA 1DQZA 3M81A 1XRLA 1KU6A 3F9CA 4UHFA 5AP9A 1QIHA 1A8UA 5LKAA 1EI9A 1XQVA 4EBBA 3KWFA 4X6UA 2GYWA 2RHWA 1UXOA 1D07A 2Z8XA 2O7RA 4QNNA 3BE8A 5AKKA 1ZI9A 3AUKA 2EEPA 4EY4A 5LIPA 3FVRA 2K2QB 1JFRA 1EVEA 2WG1A 2C0QA 2WUDA 3HXKA 1GQSA 3RLIA 3PUHA 3F98A 3W05A 5K3AA 1NU8A 4AN1A 4W1RA 2BGNA 1N5RA 1Y37A 1DX4A 2OAGA 1XFDA 5AM1A 3AILA 2G5TA 1EK2A 1XRQA 4MWTA 5ALPA 4BYMA 5H3HA 1ZD3A 5IVKA 2WUEA 4LIPD 5FXMA 4K2AA 3DJYA 3JYHA 4P08A 1UOOA 1BCSA 2B9VA 1IZ8A 4LXHA 4XJVA 4CG3A 3KDAA 2ZJ7A 3CCBA 2DFPA 2V96A 2ZSIA 2XUQA 2XUPA 1Z68A 3M3DA 4WCVA 2WHQA 4CI9A 3DYVA 2WFLB 3C43A 5AJHA 3STVA 4H35A 2IX9A 1CPYA 3HRHA 3WZLA 5FLKA 4Q3LA 3I2KA 4UFNA 2GBGA 5AK4A 4BP9A 4GI1A 1Q83A 1K4YA 4GXNA 2O2HA 3KWJA 3K6KA 5E2IA 4Y7DA 2I3DA 4B84A 1Q0ZA 1W76A 3S2ZA 5IVHA 3U1TA 1PV1A 3NWOA 5FUMA 2Q0XA 3DEAA 3VVMA 1MAHA 1MU0A 3QBJA 4FHZA 1ACJA 3BWXA 5JAPA 3HC7A 2R11A 4G5XA 4GECA 3R3YA 5DTJA 3FYUA 3CN9A 2HIHA 5HFNA 5A7GA 2VJDA 4JYPA 1ETHA 2XUGA 4BAZA 5SYMA 1F0PA 2DCMA 2AXEA 1DT5A 3I1YA 3C8HA 3WYDA 2HFKA 1FFCA 5K5EA 2XQGA 4XWGA 5EGNA 4ARBA 4OPMA 4AMYA 2Z3ZA 2VT7A 4BATA 5FP0A 3NOXA 2HL6A 5AK3A 5ALQA 1ODCA 4BZWA 1CUEA 5C8VA 3LCRA 5DNWA 3W04A 2ZYSA 5D7BA 3LIPA 5K3FA 2C0PA 1JJIA 4CCYB 2WIJA 1ISPA 2XUFA 3C87A 3STYA 1XZEA 4H7EA 3BJMA 2CJPA 1R9NA 5DTIA 4B9AA 3GZJA 4AO7A 1ACLA 4B0PA 5A2GA 1K5PA 4Y2YA 2HA7A 2BUCA 4J0GA 5C81A 3GA7A 5DJ5A 5YASA 1QO7A 2BUBA 3MVEA 2WFLA 3WA6A 4EB0A 1CIJA 1CUUA 3WI7A 2ZYHA 1XLVA 4UHEA 2J3QA 3DDUA 2JGEA 4OCZA 3GROA 3UUFA 2OCGA 5KBYA 2WHRA 1VXRA 2QOEA 1W1IA 2AJLI 4P93A 4I3FA 3F67A 2PKYX 5D3KA 4E14A 1EH5A 2VAXA 1CUXA 1ZJ4A 5AM2A 5AIBA 5K3CA 1XLWA 4K6KA 1P0PA 1YA8A 1JJBA 2WILA 3H2HA 6YASA 3HZOA 1WB5A 4DSZA 1PJAA 4X3CA 5E4TA 4IH1A 4UBLA 1EVQA 4G8BA 1XROA 1VE6A 1IZ7A 2QRUA 1GXSA 5DYTA 1LPMA 4MQMA 5AKGA 4UHCA 4Q82A 3W9BA 4BZZA 3D2BA 3RKSA 2QMQA 1U4NA 1GKKA 5IKXA 4DLNA 3ILSA 1JMKC 1HKHA 2ZVDA 4XX1A 1DT3A 4EY8A 1UK9A 2VF2A 5AO9A 3ESDA 3V1KA 1XZIA 1K8QA 2HA4A 4B7ZA 4HTAA 4X91A 2HU5A 4FLEA 4BE4A 4PSUA 3U0VA 4L9AA 3BDIA 3WK8A 4W63A 4IH9A 5LP1A 1MN6A 1XZDA 3IUNA 3HLKA 4BAGA 1VA5A 1YB7A 3A70A 4H7JA 4Y2UA 2ROQA 2V9ZA 5T4EA 1G66A 1WPRA 2OGTA 2WHPA 2PSFA 4G9GA 4LKOA 1QIDA 4G1FA 5FOQA 3WKCA 1ZIXA 3WYNA 1RWQA 3H19A 4QDXA 2WQZA 4H7HA 4F0JA 3L1HA 4JNCA 2WU4A 1P0QA 2XUDA 4BBZA 1UKCA 1CQWA 4PSCA 4KAAA 3I1IA 1DQYA 1F8UA 2WSLA 2XUIA 4PQEA 3D2AA 1R4ZA 1CQZA 4FFVA 2GYVA 4XVCA 4N5HX 5J3JA 3FNBA 4BCBA 4BCDA 4KEAA 3WJ1A 2RI6A 2HDWA 5LZ9A 5ALOA 5DLPA 4QLOA 4XIIA 3PE6A 2X5XA 2B4KA 2H9YA 5CH8A 5JANA 2RAUA 2CMFA 1R3DA 5JAUA 4UPDA 3KOOA 1U2EA 2DSNA 4IH4A 2VJCA 4Y2JA 2JGIA 3SC2A 2VQ6A 3Q8WA 1DTEA 4HRYA 3L1JA 3FSGA 3FWHA 1VXOA 4B6GA 3C45A 4GWLA 3DOIA 4O08A 2O7VA 3JWEA 2CB9A 1EK1A 4FDMA 1FSSA 1XZHA 2XMDA 2VSQA 5JIBA 3WA7A 1QIJA 4INZA 1FFEA 5FKJA 2WJ3A 1YA4A 3D0KA 3FBWA 4CCYA 3E3AA 2ZYRA 1EINA 2WM2A 4ROTA 3WL7A 4MEBA 3E4DA 1H2ZA 1QTRA 1MJ5A 5AKYA 4B83A 1CR6A 1N8SA 1XZAA 2C7BA 2XUOA 3O4IA 1HQDA 3EBLA 1I6WA 2C5FA 2XMRA 4PF1A 5K3DA 5BWBA 2EDAA 4FKBA 4LXIA 1E3QA 3FCYA 4ZWNA 3G9ZA 3HEAA 3R3WA 3V1MA 1XLUA 1CUVA 4HS9A 3EQ7A 5A7FA 4AN0A 4FLFA 3DL4A 5IH7A 4ZRDA 2PSJA 3VJKA 1VE7A 4B80A 1J1IA 3LLCA 2QM0A 3WMRA 3ZV7A 2HA0A 3ANTA 1EB8A 1QIFA 3FAKA 2WUFA 4BDSA 1C4XA 1X2EA 3FSGD 3AZQA 2CEKA 5AHXA 4S0XA 1T2NA 4OUKX 2Z3WA 2XUAA 5ALGA 1UWCA 3CN7A 4G4IA 5HF9A 5ALTA 5EI5A 3H2JA 4BRSA 4ZI5A 4DMKA 4RGYA 3BIWA 2P8SA 5DNVA 5JD4A 5A71A 1USWA 1QIEA 3DCNA 3FLAA 5ALIA 5K3FB 2HHAA 4U2BA 4PV7A 4EY7A 1WPXA 2ZJ6A 4LYDA 3MUOA 2PL5A 4U2DA 1YAHA 5JARA 3RM3A 4H7DA 1JI3A 3DD5A 4IHAA 3WK6A 4EUSA 1WCYA 1KU0A 2QT9A 3SX4A 3G9XA 5JADA 1UKAA 3OG9A 4QLAA 5CRIA 1LZKA 1BE0A 2D5LA 3FVTA 3O0DA 4B81A 4BC0A 4KAFA 2QXUA 2B20A 2JBWA 4FFWA 1XRPA 5A6VA 3G02A 4M0FA 1LBTA 1SOMA 2JGLA 4BRZA 4ZV9A 3AZPA 4BDTA 4UBNA 5BV7A 1LNSA 1F6WA 3TJMA 1PFQA 4UHDA 1WHSA 5CXXA 4C01A 1SCIA 3WK9A 1AQLA 1GKLA 1TCCA 1H2XA 4KACA 4YPVA 5LZ2A 3SWWA 3C8DA 3WJ2A 5ALXA 5T4FA 4DMFA 5AKXA 1HPLA 1H2YA 4WFJA 1DX6A 1K63A 1XKLA 3DS8A 1GGVA 4JEIA 2HU8A 3V48A 1TCBA 3W9UA 4MYDA 3D59A 5FPQA 1WB6A 4Y2VA 2JEYA 1LLFA 5HKAA 2H7CA 2XE4A 5F4ZA 3PF8A 4OU5A 4DMHA 2OG1A 3R3XA 1A7UA 2YASA 5C8ZA 4YX9A 4JYMA 4BB0A 3VVLA 4AO8A 4LXGA 1RP1A 2XQJA 5ALMA 2UZ0A 5JZBA 1AZWA 5CH5A 2G63A 2VJAA 4N5IX 1CUYA 3T4UA 5LKRA 4KRYA 2OGZA 4GEGA 1Y7HA 2WIFA 1NX9A 1E66A 4OYYA 3ICWA 3ZI7A 4Y2PA 3C5WP 4AMZA 4K6HA 3DKKA 1QFSA 1U65A 2R8BA 3NUZA 5CT6A 4CG1A 4CIBA 1XRMA 4N8DA 3N2ZB 2OCLA 2W6CX 1UK7A 2YYSA 4OSEA 4W1QA 2QXTA 5ALSA 2XQFA 4J03A 5ALEA 1T4MA 5T4BA 3A2MA 1MX5A 1MNAA 4NZZA 1JT2A 4FTWA 5I9IA 3DKRA 5EHNA 4QZVA 2QR5A 3EF3A 5ESRA 1L7QA 4W1PA 1IUPA 1FFDA 1XZKA 2JGKA 3WIOA 4UUQA 3DOHA 1QFMA 1HBJA 3TRDA 3LS2A 4B0OA 4EY6A 3D3NA 1BRTA 2PSHA 3G0DA 2WJ6A 1VLQA 3QPCA 1SCQA 2RGUA 1YS2X 5DNUA 2FJPA 1C7IA 2WIGA 3QITA 2ONCA 4G4GA 3WKBA 3BIXA 3WL6A 4G4JA 1L7AA 1VZ3A 4L3WA 2WFZA 1WM1A 2HA5A 3QPAA 1AUOA 5ALRA 3G8YA 3OC0A 4OU4A 3R3ZA 2ACEA 4WJLA 4U2EA 3QPDA 2WU3A 3OOSA 4CG2A 1JJFA 1U8EA 3I2IA 1OXMA 3PICA 1OCEA 5E4JA 1QZ3A 3P2MA 1N5MA 5JZ9A 4F21A 4CCWA 2XMZA 4Q34A 1XZBA 1HL7A 4GHWA 4UFOA 2V98A 4G8DA 5AIAA 3FYTA 4C4ZA 2XQKA 3HACA 5AI9A 3Q0TA 3HJUA 1QTIA 4B85A 5AICA 3AJAA 4BTVA 1A88A 5JALA 3FYUB 2VEOA 3FOBA 2CKMA 1XKTA 5CBKA 1OILA 3IUQA 2HU7A 1E8MA 4U2FA 4BVKA 1DWOA 1QE3A 2QUBA 4PO3X 5AK6A 4QDOA 5AOCA 3VJLA 2H7XA 4RE5A 2AJ8A 2BAGA 1E8NA 1QIKA 3M82A 3WKEA 4WY8A 4GLBA 5EFZA 3EQ9A 3WL5A 4Y9SA 4DGQA 3E0XA 2QKYA 3IVMA 3GELA 3O9MA 4UBOA 4OB8A 2Y6VA 3WL8A 3F8SA 4M0EA 2QJRA 4DM7A 4U2GA 5ALDA 2DR0A 4FLMA 4H0CA 1GPLA 3WWOA 4QDZA 1KEZA 2ACKA 3H04A 1EXWA 1DWPA 3VXKA 5AI4A 2WTNA 4WY5A 2PSDA 4H7IA 3I28A 1CUDA 4HXGA 5AI0A 2GBFA 5ALNA 3V1NA 5HFAA 4AO6A 1G42A 3H2KA 1SCKA 4MWSA 4Y2RA 5I7UA 1J07A 4WFIA 1VZ2A 3A2NA 3QMMA 4JH0A 2BKLA 3C5VA 3QVMA 4C4XA 5EHZA 1CUCA 4X6YA 1MO2A 1VKHA 3QZUA 3CCCA 3FLEA 3GFFA 3QM1A 4N8EA 4LHEA 1RYYA 4MXDA 5CT4A 1ZGBA 4Y2TA 1UFOA 4MEAA 5HF8A 3FCXA 5LLSA 3SK0A 4J0CA 5SYNA 3B12A 4DSAA 4QA9A 4J3JA 5AKLA 1TAHA 5FPPA 1LPAB 3I6MA 5AOAA 2XDWA 3K2IA 1AX9A 2JIDA 3IUJA 3I6YA 2ZSHA 5AOBA
chains in the Genus database with same CATH superfamily
1MW9X 4IDHA 3DEZA 5LBTA 3C6YA 2XLBA 3V4PB 3DL0A 3LF2A 5CBPB 4MW9A 2PUCA 1TF5A 2N1MA 2BSXA 2EC5A 2ZJYA 2QMZA 3LG2A 3W0LB 2WZQA 5ALUA 5JAHA 2Q0HA 5HGXA 3WQQA 1XWFA 1T25A 3HN2A 5A05A 2CDNA 1IHYA 3ANMA 4BNJA 1VPDA 1YKSA 3MXOA 4EL5A 1JVSA 2RGCA 1UIMA 3DKVA 4K6OA 5HF5A 1Z0KA 1EGAA 4IIUA 3DBVO 2PZBA 4ZXFA 5EQTA 4RFSB 2B2NA 1T3LA 2PH1A 3B5EA 3PNBA 4KIFA 4L57A 5FUYA 4AKTA 2VTBB 4WEOA 1SC6A 1O5IA 3G2OA 2WWYA 2DPYA 1U7UA 1LK0A 1PL6A 2ZYWX 1QF6A 1RAEA 2ZBEA 1SZDA 2FDRA 3C7CB 3H9GA 4FZ3A 2ACWA 4B47A 1SVLA 2FW7A 2WJJA 2P9BA 4OFWA 4TUYF 1N2CE 3GLUA 3PE4A 4HDNA 2CNNA 5GV7A 2C07A 3HBFA 3UUEA 3S81A 4ZEWA 5JC1A 4P3NA 5DISB 4ZREA 2C9DA 5IU6A 3V8VA 3B3GA 5C4GB 4P2BA 3VKVA 1DFGA 2B36A 4I8IA 5JSFA 2DXIA 2XI4A 2GK3A 3W3AD 4BQNA 2YH2A 4ZV4A 2R6ZA 3DOUA 3HLTA 5DN6A 3RC8A 5BNFA 4XJXA 1YUBA 3CH4B 1CIVA 3TNYA 4EO4A 4ZOQI 1JQKA 1QO0A 3BE5A 3H7IA 1DXQA 3DBRB 1XCMA 1ZI6A 3CO5A 4HLUC 4NDZA 3GUUA 1DV2A 4KE9A 4O2AA 5CVUA 3WZMA 3KKLA 5JRZA 2I65A 3R1IA 1PU2A 3BXPA 4WTOA 1LPSA 4LJ6A 1P2BA 1QWSA 5JNTA 4G0UA 4DQVA 4RPKA 4JJ8A 1ISIA 2RD2A 2ZU6A 2VP6A 3AR4A 3TSWA 1QP0A 4EGQA 1J0AA 1AU9A 2CLKB 4MYRA 2RONA 3S40A 3N76A 1FK8A 3A1DA 4CGZA 5CLIA 4DA9A 4UBJA 1POWA 2H9AA 2CV1A 5KYUB 2A0FA 3G0IA 3LYAA 3U9LA 4Q4CA 1RI4A 3NHAA 4TLCA 5F7OA 1JR3E 1XRNA 1IN6A 3FR8A 4HNGA 4ES6A 2EYQA 1XNJA 1L8XA 1SHZA 1X7ZB 3PU6A 4H7KA 2N3ZA 3UN1A 3GHYA 2HDHA 2DBYA 1KL7A 2Z98A 5D87A 2QS9A 3DQQA 1E2LA 2J5KA 2YWJA 4G09A 4XTRA 3FNHA 4LISA 5E6UA 5EIHA 1K9SA 1WCXA 1P7PA 3I9KA 5C1DA 2IDJA 3PA8A 4WCFC 5AVJA 1E8DA 1U0EA 3AHFA 1E1DA 5ENZA 5TJ9A 4J7AA 2PLFA 3E22A 3ECAA 3B1VA 3INRA 4IJKA 2OZPA 3RBVA 3PHHA 2W4IA 1JJVA 3IV6A 3EVEA 4V02A 4LZPA 3CLHA 4PRZA 4M0KA 4N0QA 5FFMA 3R3SA 3PLNA 1U2GC 1NBEA 4R81A 1R5JA 4CLEA 1DBPA 3UUGA 4L0MA 2IS1A 1PQPA 3G8CA 3HZZA 1LY1A 5FR2A 3V8RA 1AV6A 2I66A 5K2MA 3KKMA 1XVVA 4A10A 1GSAA 1GSIA 1MLDA 2H2HA 3M5WA 3N0RA 3U62A 1E3WA 2V9CA 4L6AA 4YUWA 2VQEB 1P4RA 3EDQA 3FDFA 1MB3A 2J6IA 4IKPA 3SQOA 2VDWA 4DPMA 3DV0B 4OB6A 1FVFA 1TCVA 1FLDA 2CK3D 1EQAA 2FSPA 1A8QA 2CJXA 1LC3A 2JJ1A 2ZJ3A 2QMEA 1SCBA 2GBIA 2ZT8A 4Q47A 4BVLA 1L4UA 4OF4A 3FVVA 5ICFA 1QHGA 3TEJA 1JYFA 1N2GA 2OXFA 3VU3A 4G25A 1Q7RA 3D4IA 3ABIA 3E9QA 2W2LA 3FZYA 1K08A 2RJ3A 3HKBA 1VG9B 4NQZA 5LUBA 3CB4A 1KOLA 1J5EB 2DE0X 4M3NA 2WK1A 1CUHA 1T6ZA 1GZ5A 3OJLA 4B3BA 2Z83A 3KP1A 4LCEA 4NZ9A 2ZUTA 4Z4GA 4KXUA 1PV2A 2YWHA 4OUDA 3CTPA 3PQ8A 4LZJA 4OB7A 4DC1A 5JR3A 4DV4B 2O8EB 1DGQA 1FMJA 1GILA 3EE6A 4N5DA 1SCDA 3CVJA 3N3AC 2OV3A 3BGIA 2BH2A 2LIPA 3H05A 1GOTA 5JFOA 1Z62A 3WYEA 5FWXB 3AGQA 5EA2A 1K5GA 3B6KA 4HLCA 2P4HX 5F9HA 1XQXA 4YMLA 2ZJFA 3M6LA 4KQ1A 1CJSA 1DO8A 4E5VA 5KWJA 4G5OA 2I55A 3PGLA 3BFJA 4K9RA 1TJ3A 3URMA 4DNXA 4C3OB 3OE4A 1IBSA 1PZXA 1UCFA 1TF7A 2CJWA 4DB2A 1GNRA 3EIFA 1K98A 5DWDA 4FEYA 3ND8A 3S7TA 1H8EA 1U9IA 4GMKA 5JYDA 3QKRB 3T6KA 5FOSA 3U13A 1XVIA 3IS3A 3D7SA 3BFKA 3GGSA 3L6EA 2PD6A 3IO3A 2B37A 4YAGA 5KJFA 3HUTA 3GPDG 3L4BC 1OX5A 4KOEC 3GUVA 2C8KA 2QGNA 1ZWKA 1OLSB 3DC7A 3M6XA 3ME5A 2AWNA 2V58A 2YW2A 4JLVA 3T1QA 1I3OA 3Q7QA 3W1VA 3SQWA 2WVJA 4F9FA 2EF1A 4OJTA 5DXJA 4ALLA 2PXAA 2B82A 5ELMA 3A0RB 1Q95A 4BX9A 3T0FA 4DWWA 1D0SA 5EHGA 3DVSX 1ULZA 2I4TA 4J6EA 1RQLA 1RYHA 2NX2A 4KQEA 5C8YF 1JEJA 2C3MA 4EGFA 1C8KA 3SGLA 5COAA 3HL4A 1AT1A 1IEXA 2ZYIA 2B8WA 2HRRA 2R00A 4DV3B 2XY4A 2R1TB 1CNEA 1UDBA 4XASA 3T15A 1D6NA 2WJZB 4DLVA 1X19A 1MO3A 5JSKA 3DAYA 4QEDA 1ID8A 3AUJB 5CNMA 1TZMA 2IU0A 4D6PA 1O9GA 2CXXA 2RHMA 5AM5A 1UBRS 2O2GA 3BSSA 5ALFA 5BWMA 4FR2A 4PYQA 4HNQA 2HK9A 4R1PA 3W4IA 4BQRA 4V0SA 1I0IA 3QVJA 4YI3A 2GKGA 3HFGA 1OAAA 2FZWA 1FPQA 1N6NA 1H94A 1VSBA 3G2MA 3IC5A 2OMKA 3A9CA 3IYLW 4OHYA 3FM9A 2A4MA 3FYUC 2O2ZA 3GNQA 3TS1A 2C7OA 1E62A 1R88A 2W2NA 5HCUA 3RK0A 2O8NA 1Z4NA 5HA5A 1SBCA 3JQ6A 4AX4A 4UFPA 5FBVB 1TA0A 1YRBA 2GR9A 1GV1A 2I8AA 4KQFA 4PW0A 5CIYA 2EQ5A 3CPJB 1ZH4A 5DHFA 1YDFA 3AVXA 3D4NA 2TMGA 3RRMA 1CUZA 3N9IA 4GE0A 1ORIA 1Q57A 1RQNA 1T1IA 4NX2A 3KVVA 2XRYA 3PJDA 2GEKA 5K99A 2JHPA 4BVBA 2H1SA 2Y0CA 1U0JA 3C74A 2I1VB 2P6OA 3L4BA 2R7AA 1UFKA 3VYRB 5DYWA 3BK2A 1EFPB 2C42A 5CK4A 4BN0A 2RKOA 1LLCA 3AI7A 2VPWA 2VSNA 3GDWA 3YASA 2B8EA 2GARA 3C8UA 4JNKA 5FJIA 3ZXYA 1WAMA 3DUFA 4Q9KA 3KALA 1EFTA 2NO7A 2IIVA 4ARAA 3K2QA 2R47A 5HTKA 4E1BA 1I4DD 1QP4A 2PX5A 3THWA 3NM6B 2QRMA 2IITA 4RVOA 4IEEA 2KLBA 4IVQA 1T2FA 4YUZA 3L7LA 3I42A 3LY9A 3EDMA 4TKUB 1EP1B 4C22A 5L4LA 5BQ5A 2DCUA 5JYCA 2DYKA 5DHQA 1Z0SA 3RSGA 3Q41A 3R0XA 3ORQA 5DHPA 2GN2A 5REQB 1QNFA 4EPRA 4PX9A 4U0KA 3NHPA 4GWKA 3ZTWA 1ZVVA 5JCPA 3KD2A 3PXCX 1XZQA 2B5VA 1J9EA 1B6TA 3MINA 4ZMBA 2NMVA 1Q84A 2GVNA 2PRKA 1V1MA 4MB2A 4BNLA 1KJWA 2RARA 1GY8A 3I64A 3IP1A 4PTLA 4Q1DA 2GO1A 5KAMA 4TZKA 3JPWA 4DAEA 1UT6A 1FEZA 2ODPA 3VYUB 3JQ8A 1DHRA 1E9FA 2NW6A 4XVUA 1MPTA 3A9WA 4IG9A 5DBIA 4K8RB 3BL5A 5HJ5A 1SKUA 2FMIA 4KQIA 1EBUA 3LHKA 4HBZA 1XQYA 2IWHA 3OLYA 5LDHA 2Z6VA 3HR7A 2C84A 2DHQA 4HNHA 1QJ4A 1Q7CA 2C31A 2PS9A 5E6SA 4CEIA 3KAKA 3LXMA 3QVTA 4XLZA 2ILVA 4TZ0A 4NG5A 5ALKA 2I87A 3QLUC 4HVTA 4QHYA 3UHPA 4EEXA 1IC6A 3WK7A 2FEKA 1HG0A 3LJKA 5KJCA 4LW8A 2IV3A 3GUYA 1XTZA 5LQAA 4PG6A 3C7AA 3RVOA 3CINA 1ONPA 3ECSA 4UEOA 2Q0QA 2ZUSA 2FQ1A 3WGVA 3SBXA 3GNTA 1IZZA 1I1HA 1VJ5A 2B1RA 2DHEA 4AY4A 3KETA 2QU8A 5AHKA 4D82A 1T0PA 3WHPA 4GYJA 5EQJB 4AAYA 4IM7A 2QJFA 2OM6A 2Z09A 1ODFA 4CLOB 5MF6A 1TKAA 1L5FA 3BWVA 3ENQA 3LWDA 1MH9A 4IG4A 4L6CA 4G9EA 5G2OA 3PJFA 4AFNA 4LOJA 1TRHA 1GEEA 4QG7A 2P77A 4EO7A 2XD4A 3E70C 3Q7TA 3G2NA 4LYHA 3PYMA 5FWDA 2WU8A 4LF4B 3VV2A 4DBLE 4RJLA 4Z4IA 1PUIA 3CC8A 4BFWA 1WMEA 2VPTA 3VI3B 3VRHA 2ZW9A 4I4TB 1JMVA 4F9TA 4HAZA 3FRJA 3UHFA 4NR0A 1BN7A 1VHTA 1DC7A 3OJCA 2HMYB 1QMPA 2CF6A 4K1XA 1ILWA 2ZJOA 1TXGA 2ATIA 2P3SA 2Q2QA 4AURA 4BWYA 3WLPA 1MX1A 1Z06A 2WIAA 3TEMA 3OVMA 1NYRA 4H15A 3F6YA 2QN7A 1O6GA 2A0UA 2HSEA 2NVOA 2Q6LA 1TKRA 2IY8A 2V97A 3FJ1A 3LBFA 4IIJB 2IL1A 3F6BX 2H18A 1JVBA 2CCGA 2BGIA 2RGWA 4WXHA 4CT0A 1SQ0A 4GR5A 1OZHA 3CNOA 1KY3A 1IAQA 2A84A 2AI3A 2QMUA 1Z5NA 2AEMA 2H00A 1COWA 3HL0A 3FWKA 4LZZA 5C8XA 4JUIA 1YHYA 2TS1A 2ZJ4A 5KVVA 1QZUA 2AFVA 2VAWA 2WRZA 2BY4A 1Z13A 2FEWB 2FLVA 1GGJA 2Q1XA 1CD5A 2Q29A 2JANA 3B89A 3HFJA 4HLUA 5A3SA 3AFNA 5K0TA 1NX6A 2G80A 1T15A 3U7EB 3OU7A 3EK2A 3D8UA 1B8PA 1Z5VA 3HCDA 4W7IA 4XOIA 1NIPA 5BOVA 5U4XA 4K6FA 4D81A 2A1UA 2H85A 4HEA1 5I7AA 4H6XA 3UVEA 1W581 1A9YA 1JS1X 3CG4A 3EWNA 4H1HA 4C7JA 5DW0A 4GZMA 1CXZA 3W2TA 3D6MA 4L5BA 1TAQA 2FCRA 5FPKA 2CXTA 4KB5A 3DULA 3AIIA 1DKPA 4CMAA 2B2CA 3MTEA 2HHJA 2B8NA 1OTYA 1UQRA 1A8SA 1ZLXA 5JNSA 4FYYA 4TMWA 1XAGA 1JPJA 1O2DA 4XVRA 3PP8A 4CF7A 5IJZA 5KWIA 1W0JD 4ZRMA 1BO6A 2QRZA 1SUEA 3D6JA 4BNNA 4UNRA 1OREA 5EIEA 1UBUS 4RNDB 3OCJA 2OV2A 1ZIDA 3TTUA 2Y9PB 4MW0A 4HT3B 1VGQA 3N74A 1FTNA 3KJZA 3UT5B 4YP0A 1FXWF 5D3MA 3OWOA 3WB0A 2F3RA 3KSRA 3B3FA 5T64A 2NZUG 5H9WA 4F3RA 1KY2A 4MDHA 5K3BA 3FAZA 1UMBA 1ZD1A 1LRJA 3P8ZA 3ZLUA 1YE3A 3KQTA 5BV8A 1P6UA 1E59A 2OV6A 3PD7A 5ALJA 2JZOA 3NGXA 2FU5C 3BSYA 3D4LA 2XYQA 3CWQA 3L7IA 4KQMA 1Z82A 3T0IA 4B31A 1KMMA 4C78A 3UTCA 5GMOA 1KWGA 3HN6A 3B36A 3M6IA 3OO0A 4NU0A 2XSZA 4IGEA 4LJ5A 1QGYA 3LA8A 5DI3B 3ZD8A 4FIZA 1EEXB 3C7KA 4C05A 1JN0A 1H69A 2GN0A 2PKQO 4YJGA 3UV3A 3X2SA 3T7JA 1JMYA 3LV8A 5DZSA 4RC9A 3QOWA 1G16A 1XVUA 1C9MA 3JAKA 4IUYA 4P92A 5E9AA 3TCXB 4BNVA 4BMSA 1LS1A 1TK3A 1RJEA 2EGUA 2Z95A 3C24A 3FN4A 1NJ1A 2A9QA 2MYUA 4U1RA 1BD4A 3ANSA 1W94A 3VA7A 1V3VA 3JALA 1DO2A 4NK5A 4OFXA 5IVDA 4OKSA 5A2QA 4Z0TA 1FYDA 1J39A 4LWQA 4KLRA 4UHBA 5KDDA 2OG2A 1CTQA 1GYQA 2W22A 2MSDB 3WC4A 3MD0A 5C1OA 3I73A 3UQYS 3A6FA 1E4EA 4HB2A 2I6UA 4B6SA 5CFZA 1E69A 2EBUA 1R74A 2EZUA 2ZRBA 3HCNA 2XBMA 1B6GA 2J48A 4LSGA 2BRUA 4CPDA 3VU9B 4AS1A 4KE8A 1IJBA 3HNOA 5SY9A 3GL9A 4G26A 2BDTA 3B38A 2PUVA 3R4CA 3DE5X 4YCJA 2Q3CA 2XT6A 3ILYA 1EWQA 2OUKA 1DEHA 1GVHA 1SVMA 3T34A 3G17A 3G0BA 3UWKA 1BS9A 1WHTB 1ADJA 3TCKA 4I19A 4MINA 2XCUA 2CDCA 2Q28A 2B99A 4GGMX 2PANA 4PYOA 3KO8A 2R1VA 5EMLA 1QS0A 4F2GA 4JR0A 4MR7A 2PO7A 1XTRA 5KOHB 3PKZA 2F3PA 2GBPA 5K8JB 3L49A 2C59A 1QIIA 1Z12A 2JGFA 2ONJA 2D1YA 1RLJA 1DDIA 5IVIA 3U3XA 3NKVA 5E4FA 1A50B 5CHYA 2GA8A 5IPFA 2VDRB 3U1VA 4I1PA 4UU8A 4CNQA 1XWWA 2P9JA 4JX9A 1E2BA 1BAPA 1NW3A 4X00A 1MORA 5FTWA 4BLWA 3S1SA 4KI7A 3EEYA 2QSUA 1EA5A 3E8XA 4YCSA 4PEVA 3WKDA 3C85A 1U1DA 4DV5B 4WXYB 5FD8A 4GR4A 3T9BA 2IYOA 5TJHA 3SVZA 4A73A 1V11A 3HXQA 2DFKB 2JLUA 4N49A 4D41A 4KH0A 4JQOA 3R9XB 1LRKA 3JZFA 4Q1CA 3LRTA 3GF4A 1Z33A 1LUAA 1Z35A 3IB3A 4HI0E 4YGXB 3H17A 2HREA 4CKYA 1QZXA 3LCCA 1T4CA 3HJFA 3WL3A 1GAXA 4WBXC 3FKJA 1CSEE 3LDFA 1KZ4A 3KJGA 3MLAA 5ITZB 2Q1YA 3PNLA 5JWRA 4F4CA 3C39A 5J1SB 3WY9A 1BXGB 3H99A 1H2WA 1RADA 1D6MA 4JBNA 5DFAA 4Q05A 2EATA 1TT5B 3DDSA 3BUSA 1FTWA 2OUIA 4Y1EA 3VX4A 1NP3A 1ZICA 2OESA 4J3FA 5A0VA 1QLHA 2OE2A 3K8OE 1V7PC 2EV9A 3PJGA 4ZK2A 5JNRA 4HFJA 5ICSA 4W5TA 5EZ6B 3G9UA 3FZNA 4XA8A 5ITSA 2J5RA 2Q07A 3QX3A 2EWVA 2HOQA 3HGMA 2JEZA 1K66A 4MS1B 4TSFD 3K94A 3RRFA 4QAJA 3GT3A 4Q93A 4YAUA 3SNKA 1ZISA 1NRXA 5E6RB 3ZV5A 4LQDA 3T5PA 1NVMB 4P4LA 2WV9A 3TX6A 1Z0IA 2RH9B 5GINE 4B9EA 3CVXA 5HOQA 1LD3A 2XQIA 1DUIA 2IHZA 4FS3A 4LTNA 2JAXA 5DW3A 1MA0A 2HBRA 1YWGO 2YVLA 3GZ4A 4TS1A 3VR3A 4YDQA 1OWPA 1ZA1A 3P9NA 2DUMA 4X41A 2JFGA 2QL7A 1T3SA 4RQBA 3PFCA 1MV8A 4NJEA 5A4DA 2ACVA 1VCNA 1BOOA 1ZOLA 1YZLA 1Z6AA 3KQOA 4WNCA 1X80B 3AY3A 3TW6A 4E11A 1IOVA 5LN1A 4UOZA 4KIGA 4FINA 4IVRA 3MYYA 3JQQA 1F0YA 2Q5CA 1T2EA 1SY7A 3ZV3A 4V1CA 1XDGA 4C87A 1G3IA 3UMJA 3O93A 3QLEA 4D4HA 4MITA 4HUJA 1S6YA 2H5LA 2OCXA 2BGUA 1Q5PA 4JQYA 2KQUA 3OTGA 5TT0A 4ALNA 3DT9A 4W4TA 2BT4A 3CUTA 1U3CA 3LUBA 1N34B 1EUCA 2SKEA 2PUHA 3DMTA 3EXFA 1ZJYA 5E2BA 2OGSA 4FOTA 4C6SA 4DR3B 1H1DA 1IONA 3DEJA 2FYTA 3HY3A 4DCPA 1T29A 1OTXA 3STWA 2E6KA 1RXVA 2XJ9A 4FCCA 1S8OA 2F8SA 4YUVA 3GA0A 2RH4A 1V7CA 3GRUA 4DKJA 3FIUA 2GPBA 3TRIA 1LV8A 1PI3A 4JJEA 3RQSA 1U3TA 1KOFA 1FP1D 2OM2A 3H2SA 4RK0A 4YCCA 5CH3A 1FS6A 3HTXA 4G37A 2Q7OE 5JASA 1NZJA 4S1PA 1OC4A 4KIJA 1Z9BA 1SHLA 2KHZA 2HXGA 4LJKA 4ND7A 5BNIA 1DINA 4YS6A 2GD0A 1X1QA 2PRIA 1Q0PA 2DBVO 2H1IA 2JCBA 2YN2A 1TYAE 2XMBA 2DQYA 2IE0A 2BFWA 3RYIA 4H77A 1XZLA 2JNWA 3S27A 3QHAA 5ITWA 4ZT2A 4TPKA 1N9GA 3KTAA 1C3JA 4GPD1 3R7DA 3J81k 3PT5A 5EQFA 1KE1A 4D0RA 2F90A 3X2FA 2YIDA 4MROA 4RE6A 2ZAMA 2VDKB 2P30A 2Z5GA 4YT8A 4OV6B 3UB2A 1BHJA 3CX4A 3QVVA 3W6PA 1KJ8A 5G4KA 1CUAA 4K88A 4MULA 2RK4A 5A04A 1R0YA 5FH9A 3GMDA 3I12A 2YV2A 2W6JD 2GM3A 2QG6A 1QYWA 4MCAA 3AL0C 1X8XA 4YIHA 3F7MA 1KMHB 4XB6B 4BEWA 5J4LA 1QRDA 2ZTHA 5K0GA 3EPHA 4QXAA 1LK7A 2Z3VA 3LM8A 4FJ2A 5IYZF 4IUCS 2D0PB 4NY1A 3WLKX 1SURA 4LXQA 3AKDA 2VNSA 4IEIA 5EJMA 1Z16A 4YT4A 2PVPA 1L7XA 4CM3A 1K68A 4K5QA 2CNOA 4Y30A 5CNIA 1U2QA 2WF7A 4EGCB 3PGA1 4PBTA 1A0OA 2AZMA 3HYNA 4L7QA 1M0TA 3AIOA 4BWFB 4JYAB 2QX6A 1BZYA 4FX2A 1U1EA 3OZVA 1Q1EA 4RDIA 5I8PA 1TMOA 1J9ZA 2PMFA 1SEPA 4H3KB 1T9GS 1WDLA 3E7WA 3H3XA 3JR3A 4Y2SA 4L3OA 2QTLA 1F12A 1BD3A 3F3KA 2H1HA 2YRWA 4RCVA 3RYCB 1SJ9A 4KFRA 3R8FA 5DT2A 3BQMB 4YCMA 1V39A 2IE8A 3COWA 4BLOA 5BR4A 1AKTA 1EZ4A 1KR5A 3E5RA 5DHRA 4YQEA 2O8CB 1CY1A 4DLBA 2SHKA 4UQLA 2J8ZA 3JQ9C 2Z6UA 4O4LB 3WLLA 1YR3A 3MC1A 2J7PD 4NABA 1ZRNA 1KE2A 3JRNA 4PZ9A 4JI1B 4YK7A 1F6DA 3B52X 5BYJA 4LV8B 2QW8A 3OETA 2A0XA 4X93A 2VUTA 1CR0A 5HJEA 1EFAA 2FR1A 4U6NA 4YNBA 1U8YA 1X9GA 4EA8A 1JHXA 3TUZC 2OBMA 2SNIE 4C6TA 3QTLA 1U6JA 2ZI7A 3U56A 1E3MA 1EFPA 3VC2A 4Q9DA 5AI5A 4HAUA 1MHPA 4X6XA 1Y6FA 5AM3A 1UMDA 2OO5A 3O8DA 4FXOA 4RMIA 2AOWA 2QX8A 2XNDA 2XYRA 2ZYVX 1YS4A 3AV0B 3ORFA 4L4SA 4TQAA 3UNXA 5NLLA 2H3HA 4KZKA 4NICA 3K05A 3NIFB 3GLFA 2AYZA 3CSUA 3G5MA 2RGAA 1GZUA 4HPWA 5D3ZA 3VZQA 4BNIA 1EDEA 4GBGA 5HXAA 5ILOA 3TJZA 2QNRA 2ZB7A 2I6TA 4B34A 1OVGA 4OYLA 4RD3A 4TL9A 2QP9X 1MABB 1OHHD 1N4AA 1J9GA 4JZKA 2R60A 4BHTA 5JW6A 5JWOA 3K6JA 3BM5A 4J0KA 3QH4A 4QWMA 3HM2A 5J4KA 3PDCA 4EA6A 1CEQA 5JSZB 2F3TA 4X5OA 1XZCA 3JYPA 4YP1A 1BVUA 1OYYA 3I2JA 3N75A 3I6BA 3W5AA 4KNYA 5JJKA 4E6PA 3U48A 3HU5A 3OPQA 3WLSA 1JA9A 3AEZA 3B1JA 2GZ1A 4D42A 5D6OA 3KSDO 1AXGA 3L4EA 1Y7IA 2P2ZA 1R4NB 2I62A 4QOIA 5IDVA 5CB4A 3WMGA 1K7SN 3IULA 4D8YA 1G5PA 2X22A 3O1JC 1V1RB 5IAGA 1Z6TA 2HDOA 2FKAA 1DQSA 4KE7A 4LE1A 5LCXA 4DLKA 4YRAA 1JLRA 4BN5A 1DFHA 3CF2A 1G5IA 4BJ1A 1MDBA 2P9YA 2VOEA 4YXWA 4DMCA 4KE6A 4MQ5A 5ICCA 2AFRA 1VL5A 3LWNA 5TE9A 2RHDA 4KR0A 2W6JA 3MWEB 3FMOB 1N8KA 2ZZKA 5AKHA 3ZVNA 1MR3F 1RJ9A 4C0KA 3ICOA 5DHSA 3QQ5A 3BJEA 3EXG2 3W8RA 2G25A 4DDUA 3U4QB 1BDJA 3JZIA 5JD6A 4EL0A 4I1VA 1W8DA 4LDNA 4V38A 3HKCB 2XE7A 3KYBA 1WMDA 4ZCMA 4RTNA 2ZULA 2R48A 1IH8A 4DLWA 2YQ4A 3GOQA 3VJMA 4HDKA 3LK7A 2IIPA 2PZ8A 1KH1A 1MJGA 2QE7D 2VHJA 3K1TA 4M9RA 1RQXA 3CXUA 2E55A 4GYKA 4CKWA 2H8GA 1H4VB 3CUUA 1W0CA 4E2ZA 1KBOA 5KCZA 3KU4A 1O9HA 1L7OA 4I5FA 5IANA 4LV6A 1WETA 1JKJA 4P84A 3PWTA 3ZPXA 1NW6A 2NLOA 4ZO4A 4M9CA 1Z3IX 2BGMA 2D1TA 1JFLA 1E1QA 2JIRA 2HIGA 2FK8A 2PBZA 3EIOA 3SEZA 4BC1A 4MJXA 1CKEA 4ZKDA 1QMGA 3QUTA 1V41E 2GCEA 2XXAA 4S1OA 4UREA 4OHZA 4LY0A 3V6LA 1BGXT 1KPHA 2J9XB 2JD0A 1NDHA 2ZR9A 3O4JA 3Q4GA 2BTQB 2O19A 4LBWA 3TGLA 4MRMB 1JSCA 2JVKA 1VKRA 2PUFA 5A5FA 4N6GA 1WSWA 1BS2A 1CUFA 4A9AA 1LVGA 4M7PA 4QOSA 4XDGA 1FF9A 5BPFA 4P9NA 5H9VA 4E7OA 3RFCA 1PT6A 1G18A 3JQAA 1LVHA 2OV8A 4B3TB 3A1FA 4KYVA 1B0ZA 1YL5A 4MQ4A 1RD4A 5DBHX 5IZCA 3RYHB 3AG6A 5L9AA 5MDHA 2WW8A 1C9DB 4ZDIA 1V47A 1AZSC 1E2KA 1HV8A 3E9NA 1H2HA 4H7FA 1E4VA 4JL6A 4UDNA 2YYAA 3RK1A 1U98A 3S2FA 4PNHA 4FFMA 4IIFA 1VG0B 1GPAA 2B7BA 4D43A 4JXZA 3HXTA 4IGIA 4FDVA 1WBBA 4ZANA 5JO9A 2WAMA 3WK4A 1T24A 4WNAB 1Q22A 2YZKA 3SN6A 3AHJA 5EIAA 1P7WA 4MQLA 4D80A 4XCVA 1SOAA 3KZMA 3LOUA 4EQ6B 3EF1A 4FYPA 1OH5A 1JSZA 1N1MA 1NBIA 1XTKA 3WLQA 1JFTA 4JL5A 5BORA 1E2MA 3MCAA 1DQZA 1GAWA 3TQCA 2AUMA 1OHHA 3EPRA 1TGYA 3ADDA 1XRLA 1KU6A 2PZLA 3CXRA 2PRZA 4UHFA 2I29A 2VF8A 3PDHA 1QIHA 4RJ2A 3U26A 5IXSA 5LKAA 2EZ9A 4NARA 3Q15C 4MKFA 2WKQA 4HZIA 2BC9A 4RY8A 5B2FA 8OHMA 4FD3A 2O2DA 3M4JA 2Z8XA 1G6Q1 2QRLA 3IMGA 4GI2A 4TVSA 3BVPA 3TAXA 1M7GA 3IP8A 1W5TA 3B9RA 3WGHA 1PX0A 2HSGA 3BE8A 3NZEA 5BMOA 5LFAA 2YHSA 4G0MA 1F14A 1O58A 1ZI9A 1WY5A 4JKIA 1NC3A 3V2HA 3PTAA 4IV0A 4DS3A 4JJGA 3TB4A 2CFRA 3ACCA 3CLUC 4UAVA 3FVRA 3BQ9A 4C7KA 4MV3A 5BUCA 1JFRA 3NH6A 3C3BA 3CCFA 3ZNNA 4YAIA 2J59A 2IGTA 4I5EA 4LYYA 1IATA 1UJ5A 2ZANA 3DBHA 3FMGA 2EFHB 2QRPA 3HY4A 3KQQA 3NBXX 1ORRA 3HS3A 4IDAA 4QUJA 4YRTA 3F98A 4BB9A 2E49A 4GX0A 1V8PA 1TMGE 4R9RA 4O33A 4D0SA 1SUDA 2CMHA 3AOGA 2GN6A 3MINB 3PLRA 4DPLA 2BZGA 4JBHA 1PS0A 4RX1A 1PJSA 3T9EA 1PTJC 4AN1A 3NYRA 4OMDA 1N5RA 1IULA 3P1JA 2QTZA 1DX4A 5EPOA 3TE7A 5L8VA 2MSLA 2VXOA 1GZ6A 1W0KA 3NBZC 1F8GA 2Q4OA 2BM1A 3PTZA 4UUAA 4AZWA 4AT1A 3IJEB 1CY4A 5AM1A 5BN4B 3IGFA 3KVYA 3UT6A 4KKVA 3WYBA 3I5YA 3HPQA 3UF0A 2QBYA 2O1SA 3X1JA 2HHLA 1KI7A 4FT2A 4G86A 4Y9UA 2FSIA 2MR5A 5EJ9A 4BYMA 3GGOA 2HMWA 2QTRA 5I8ZA 2IIQA 1AQ6A 3GCXA 4HJXA 2XCLA 4DMMA 2XR1A 3A04A 3LX8A 4ILKA 4KQ2A 5FXMA 3WBKA 3RCBA 3TIFA 3V8EA 3H0KA 3DJYA 5G4LA 4DCCA 2ETXA 4WZAA 4J1NA 2CLEB 1M5RA 4BYGA 1B00A 4AG6A 3S7ZA 2OCAA 1J49A 3FUVA 1T13A 4OJKA 1CQXA 4DABA 2EHDA 2YWDA 2B9VA 1J22A 4JY7A 3KDAA 2QE6A 5LDDC 5H59A 4EEKA 3UGTA 3EISA 4QL3A 2A30A 3GMTA 2ZSIA 1YDGA 3DB2A 1JZTA 2XUQA 5CFRA 1KPIA 2X77A 1UP6A 2XDYA 1PO7A 3H1TA 1Q7GA 4CI9A 4BGVA 4NSNA 4XDYA 3U19A 3FOAA 4QYIB 3K0HA 3WIVA 2F8MA 3G49A 5KVQA 4HATA 1YTLA 1U7ZA 1YULA 1W49A 2IX9A 5ERYA 5KTOA 5L3QA 5TRTA 4BFXA 2X0RA 4AIIA 5DGHA 1MB4A 1W85A 3KU1A 2P27A 3I0NA 3CLTC 1ZGHA 4O2RA 3E5MA 1U7TA 4O2BF 4WK4B 2GCOA 3ZHVA 3VKHA 3OA0A 4TXLA 1T2UA 3P9RA 3QQPA 2Z4RA 4MMZB 4LJ7A 4F84A 3LUDA 2JH9A 4BP9A 1U1CA 2AVDA 1N2CB 1S8FA 4K05A 4C7XA 3H13A 2JJ2D 3ITNA 3GPCA 1XHFA 3GGDA 1HYHA 1V16B 2CYAA 3EZ7A 3T99A 4FDTA 4Y7DA 4B84A 5I5GA 3O1HB 1X7WA 2Y4OA 1W76A 1JIXA 3D7NA 3DCJA 3NAGA 3RIMA 5BNZA 4XB1A 2CB0A 1M2FA 1KH2A 2AN3A 4JC4A 4CV0A 4LOIA 4BV8A 2CUNA 3QTTA 4BB5A 4ZZ1A 5GGXA 1UC8A 1I36A 4MPRA 2IOHA 2JIZA 1C30A 1JDBC 2QDKA 3QBJA 2WD7A 4DB4A 2JCSA 3NS7A 1TZ2A 3ETGA 2HWUA 3MJEA 5JAPA 1VIVA 2Z9DA 2MSKA 3EG9A 1JPVA 1JB9A 1PT8A 3FNIA 3HC7A 1WVIA 3K53A 4RKFA 5TGDA 4G5XA 4QJ3A 4GECA 1XKQA 1HLDA 4ALIA 3TL6A 4R16A 1BQ3A 2HO4A 4I50A 1J8VA 4OXRA 3VH4A 1P2FA 4R2JA 1FJGB 4KVFA 5HFNA 3LW7A 1MFPA 2JGRA 1TI7A 5CVEA 2FDXA 4F4DA 2MHCA 2W90A 4A0SA 4JYPA 3UJNA 3NTUA 4QFDA 1ZUWA 4Q7QA 1T8TA 1UPUA 3R74A 2R4UA 3DZDA 2PUBA 1IJEA 3BTOA 1DV1A 1RWBA 3I9FA 5D6NA 4RKWA 5JAMA 3RIGA 3I1YA 1FRNA 3N2EA 3WYDA 1JG4A 4M1SA 1XP8A 1KAGA 2A0YA 4ZI2A 5CA1B 4ITRC 1FFCA 4RVFA 4CQMA 1T8UA 4YAEA 1NBMA 2XQGA 3A4YA 1UBHS 1YGYA 4D1YA 5EGNA 2JDID 3MWLA 1V1RA 1VDMA 4GL4A 4WWHA 4URFA 3ZU4A 4F4HA 1LH0A 1FZTA 2VT7A 4BATA 3I0ZA 4KTVE 2WMYA 2IHVA 4LI3X 4P58A 4RSRA 5F3WB 4JENA 4AMUA 5EWJA 3AC0A 4HFNA 2OZLA 5AK3A 2JFBA 2H9IA 2ZGVA 1ODCA 1RM5A 1WCWA 4FP9A 2PNFA 3FNFA 1RLTA 4HAWA 1T9KA 1KEEB 1PTJA 3AERA 4ESOA 3A1CA 1A2QA 2C1ZA 3IAS1 4R83A 3PK0A 2XECA 3JWGA 5IXYA 1EIZA 2CMDA 5DCYA 2E7ZA 2C1EA 3KPWA 1FYWA 1EAYA 1YCHA 1ID1A 3WFJA 3RGGA 4IOMA 4K9PA 1JJIA 1GAQA 2IOFA 3FY4A 2RDMA 3LUFA 3TQHA 3TZQA 4DLPA 4EKNB 1QQ6A 4K6CA 2BMDA 4A6PA 1Z28A 4CCYB 1H4QA 4NCAA 2A2ZA 5MHTA 3LBYA 4IQFA 3MERA 4PGGA 1LDGA 2XUFA 3H83A 3C87A 2H65A 4TV8A 2P9HA 4PONA 1SU4A 4MW7A 3STYA 1GIAA 3NYIA 5KUTA 3L0BA 3ADKA 3CUVA 4K87A 3UIEA 3G0OA 3QFRA 3ZZNA 4B9AA 2G06A 2Z56A 2PSSA 4IL5A 1XN4A 4AF6A 4NC9A 1WBDA 4WSOA 3L6BA 4Y2YA 2GF2A 3DZKA 2A0WA 3MWYW 2BUCA 1G5TA 2G4CA 3G85A 2CUKA 1PJCA 1YQTA 2UAGA 3LLSA 4B4OA 5CA0A 3RSZA 1BJKA 1SM4A 3HVHA 3ITKA 3MVEA 5K0SA 3QEAZ 4LF9B 1DLJA 3DHVA 1X39A 5INTA 3R7SA 6CHYA 4EB0A 2EHJA 4PZZA 3TG2A 6ADHA 4P4SA 3B9QA 3U5TA 2R6R1 1CUUA 5L6LB 1RAHA 3JAKB 3UWDA 1MZPA 1NN3A 2QR3A 4UHEA 5DWQA 2ID4A 3C6QA 4JVLA 4QTZA 3DTVA 3GROA 4FT4A 1M8GA 2WHRA 3ABZA 4OI1A 1VGRA 4A2CA 2WYIA 3L2OB 5C32A 1BHQ1 1WU8A 3KAJA 4DIDA 1MA3A 2GOYA 2F1JA 4P93A 1C7FA 1NKVA 2HNKA 2JI6A 4I3FA 3VFDA 4JYZA 2AC7A 2PKYX 3EVZA 3M6FA 4F3CA 2GZMA 2NV0A 3SYKA 1EH5A 5KQMA 2B9EA 2QP3A 2WPDD 1CUXA 4PU0A 5G41A 2BCGY 5BURA 1P44A 5AM2A 2ZIEA 2IYNA 2ATEA 3JVEA 3OOHA 4WZAB 5K3CA 5KCMA 5CAEB 5AIBA 5IAOA 1UDWA 3HHEA 2WILA 1U9ZA 1JJBA 2HK7A 1P5HA 3IPLA 3NBFA 4QT0A 3VZBA 4A2PA 4ZDJA 4LFBB 5DN6D 3RJMA 4L7VA 5FNZA 4GG1A 3ZGXA 4DXDA 4F92B 3SVLA 3R23A 5CHEA 1M2NA 5T5QA 3TLXA 4E2FA 1ATIA 2FFAA 1WB5A 5HBRA 1NOKA 2Y99A 4CEJB 4RVUA 4KMOA 5E4TA 5K09A 2O1XA 1ZMOA 1UBSB 2G88A 4HKTA 4UBLA 1R10A 4J7XA 3B82A 1TMYA 3HB1A 1W4CA 4BQQA 4AJEA 3ZNOA 3WYCA 4LPSA 2QRUA 4OX9Y 2GWRA 2VHZA 1GXSA 4RA9A 4RIHA 1I6MA 4MQMA 1SUCA 4LZNA 4UHCA 1T9CA 3W9BA 5HM8A 4EFLA 4L4RA 4ENQA 1C8LA 5EJ2A 1KYZA 1LF0A 1QH8B 2O05A 3INGA 3T38A 5B6IA 4WMLA 5MN4A 4CQNA 1ZLYA 3QFCA 4WKCA 1WXIA 2ZVDA 4C29A 2O8DB 4RULA 3SS8A 4GX5A 4O6VA 2VF2A 3EPKA 1U2RA 2UZ1A 1GCGA 3GJXC 1C1DA 1FVOA 3HBMA 1ZIPA 3LECA 3NKLA 3F9IA 2C99A 4MLPA 1VBFA 2G08A 4PC3A 4AKGA 3N8IA 1H1TA 2FPIA 3QEMB 1JG1A 5TQ2A 1RRKA 1T2AA 3BH0A 1DQNA 1G4UR 1OA0A 3Q3IA 4LDRA 3NPMA 5BT9A 5KNDA 5IHPA 1FW6A 4FLEA 1T5IA 4PSUA 3EWIA 2JKZA 2VF5X 1BWPA 4O4IB 5T3YA 4YEDA 4Y0NA 4L9AA 3FJYA 3RVBA 1NQAO 3WK8A 3U3KA 5BRJA 1E2NA 1NIJA 3RFTA 4YMWA 2XODA 4LZLA 2AEJA 3FKSD 2AQ8A 1MN6A 3SU8A 5LP1A 4H1WA 1ORDA 1ZBQA 2VXYA 2XOXA 3KTOA 2GXQA 4CBVA 4ED9A 1NG9A 1EE1A 2X5KO 2QAGB 3IE1A 5ESXA 1WNTA 2QN9A 2Q49A 4ENVA 4XE5A 1F4PA 2QRJA 4H7JA 4FGLA 1QVZA 4L0QA 3O26A 5JE8A 3NDIA 4OHKA 4ETMA 3LUKA 2UYOA 3MCVA 4KXXA 1K3FA 2WJYA 2UYGA 1BEUB 5T4EA 1UFVA 2PZAA 4YDSA 5B53A 4IHKA 1CY2A 3HM9A 3MT8A 4D96A 3LSYA 3A8TA 2IEGA 1U3FA 3VO8A 2PSFA 3COSA 4N41A 1F2UB 4DT1B 2CWDA 5TGTA 2EX4A 1JDTA 2W6ZA 2CYCA 3PHGA 3EVGA 4RVHA 4ZC1A 3UXYA 3FRIA 5LVAA 5BWLA 5LXTA 1DRJA 5FULA 4CFYA 3NIGB 1VE1A 5AUQA 5JXGA 1H5QA 1GL6A 3RVKA 3UA4A 4EKEA 1N33B 1ZWLA 2A58A 5IG2A 1X7DA 3RSLA 3H19A 4DQ0A 2IOYA 1YMQA 5HDBB 1JKXA 5AJVB 4RTLA 4F0JA 4M37A 5IEJA 4AECA 4MOWA 3SS9X 2O2JA 1PEKE 1QFZA 1P0QA 3AYZB 2RKBA 3DWFA 3GG2A 3KZ1E 1XB2A 1K92A 2VF4X 2V7QD 3B5IA 1RHJA 3PZRA 2XVZA 1KI6B 5JVDA 4MVJP 4GI3A 2R1UA 3BSWA 4XW2A 4BBZA 1TUGA 4YDHB 1L7MA 5B3JA 1OLOA 4IRMA 1CQWA 2JFNA 1P2VA 1R8YA 4PSCA 5A06A 5I7FA 3SVTA 2Z6QA 2ZUVA 3VSBA 4YUYA 1F8UA 3HZHA 3TAUA 4OKNA 3L02A 1V5IA 4JBGA 2XUIA 2V1XA 4ND5A 3D2LA 2CJYA 2XWJI 2ALJA 3L7DA 3EZ9A 4Z2YA 1YKFA 2BD0A 1V5EA 2C04A 3E82A 4JGGA 2DUNA 2IXAA 4ZI7B 2GD2A 4D9BA 1EP9A 4FFVA 1F7UA 3FNBA 1AZTA 4BCBA 1QPBA 2ONKA 2C4NA 2QZ9A 5ALOA 3U44A 1YXMA 3TQQA 4GRDA 4B6PA 1D4AA 3V7FA 1S3IA 2ZG6A 2IYPA 1RSZA 2Q5FA 3KHUA 4DCOA 4C0LA 4MKHA 2X5XA 2HYIC 2HT6A 2WJPA 1BH6A 3JCZA 4HWKA 1GGNA 3PQDA 1HEIA 4Q1BA 4RZQA 5I9TA 4PYKA 2X0DA 1U8XX 5JANA 2P35A 4XWTA 4BOYA 2V7UA 3DTNA 5AJZA 4GL2A 1Q0HA 2D8AA 3DFKA 2CMFA 3OT1A 5JAUA 1YVPA 2Q2OA 1PJQA 1U2EA 4L3VA 3RUDA 1DTWB 4W5JA 4IXNA 1RMTA 1T0JB 1L5NA 5IKPA 2EKDA 2W98A 1V96A 3UAZA 4MRPA 2WTXA 2ATCA 1BXKA 2WU1A 4FYJA 5L4SA 1EBBA 1HLPA 3MIIA 1B8NA 1E7WA 2YWCA 3EUEA 4LRQA 1B15A 1N0HA 3F5FA 4B32A 1JJ7A 2EL9A 2VQ6A 1IBMB 2AN1A 2G7ZA 4M6WB 1VB5A 1YVUA 1L3BA 3HDTA 1UINA 3FSGA 3FWHA 4L27A 4TMXA 4XUEA 5TC4A 3TRKA 4B6GA 1IVSA 3DOIA 4AJ9A 4FYVA 3S6JA 2IX3A 3ZVKA 1UZUA 2JFXA 1EK1A 3WOVA 3H5RA 3QIAA 4I5IA 3GUZA 2MOKA 3KQPA 1HDXA 2CNWA 1HETA 4ZTZB 2AQIA 2G3YA 3TTVA 1Z8DA 1XZHA 5BVGA 3K09A 4OQFA 5JIBA 4WOKA 3E22B 1M2WA 3F7NA 2H16A 1HC7A 1USKA 2I2WA 1QIJA 3IR5A 4J1TA 4PLYA 1N92A 4XIYA 3ZW7A 2P0AA 1OU0A 1YA4A 3EASA 2C9ZA 3FDZA 3QLVA 1PJBA 4UU7A 3ZDEA 4Z51A 4ZIRA 1Q1AA 3E3AA 3BXHA 1IZ9A 4YHBA 2ZYRA 1OIWA 1OT3A 1VL0A 3ER6A 3GRZA 4FXPA 5I7SA 2CEAA 1ILEA 3Q3HA 4UXIA 5F2OA 1EINA 4PZPA 5JTTA 3DGEC 3KJHA 1BE8A 1JRLA 4A0RA 1CC1S 2I1LA 3KEGA 1KZ1A 1TEVA 3K35A 4IDOA 5FFFA 2WINI 5HE8A 4B43A 4EJMA 3TZBA 5FPTA 3A1TA 4MEBA 4DVGA 5JAIA 1VHLA 4MUMA 3F3MA 1H2ZA 4WGFA 4K3UA 3AO0B 1BXRB 4Y1RB 2YN4A 4Z9BA 3EZ6A 2AMLA 2MCFA 2EGGA 5IJ9B 3R7BA 4GE3A 4NAVA 4AZSA 5G40A 5EP3A 1DG1G 3R9WA 1CR6A 2NZJA 3B6ZA 4RQTA 4X0EA 3Q3CA 3TMKA 5JJLA 1VJGA 1BTOA 3QLJA 1CK4A 2R9VA 2XF2A 1G41A 4E5SA 3M8KA 2W6MA 4KVZA 4KNWA 2OBXA 1KVRA 2SECE 3MQFA 4MW1A 1IYZA 2P4UA 4MYTA 4TX1A 4C0HA 3ZDFA 2W42A 4M98A 1KF0A 2BFFB 1VL1A 3EBLA 1I6WA 3L6UA 4I66A 2OFPA 3PUKA 4UVDA 2C5FA 2XMRA 1NZDA 4PF1A 4KXWA 1R4AA 1DDOA 3R5HA 2I91A 2AZTA 3K0KA 2EOAA 3F49S 2AOUA 4K2HA 4K9QA 2BZSA 4Z4CA 4KFCA 1GG8A 4DBVO 2YUTA 3G9ZA 1P75A 3V1MA 1NJGA 2JZCA 1NW4A 4GBMA 2G4VA 1U7PA 1NXWA 3ONVA 4R41A 4DYDA 2NTVA 5A7FA 4AN0A 2GJKA 4HB3A 4KGDA 1CR2A 2FF5A 3KDSE 3OESA 1JB1A 4HD8A 4LRUA 4QREA 3M9LA 4OK5A 5JI2E 4ZRDA 2QP4A 3A6EA 3VJKA 1G7TA 2YOHA 2JD1A 1VE7A 2X15A 1J24A 4R2MA 3KPVA 1FJXA 2B35A 1J1IA 2XDQA 4Q9HA 2XGJA 3GRAA 3U60B 4WK0B 4RM2A 3SZRA 4N0PA 1GKYA 2JA2A 3ROXA 2PLRA 3PFGA 1T5BA 2E37A 4KYIB 3BRWD 2HR1A 1HZZC 1KAHA 5LP6B 4XQGA 2OFOA 1F2VA 3KLMX 2WUFA 2V7EA 5DWVA 3LWBA 1AXEA 1SZCA 4QYTA 1HNNA 4M76B 5IJWA 4JKOA 4N5LA 3FBTA 4RYDA 1C4XA 2AL7A 2J87A 2RH5A 2CL7X 5EGSA 1E4YA 1ZMBA 2BFDB 3R0ZA 4MA5A 3C7DB 3VU1A 4OQDA 1M1YA 4M0LA 3ZQKA 4N6OA 4TZTA 4MUXA 2ANBA 2V7XA 5H80A 2VKTA 1M66A 1SXJA 1T2NA 4LZOA 5GQSA 2W8BB 3V7WA 5KWSA 4M60A 2QVYX 2PX3A 2JJ1D 4CCAA 1N0UA 3IDQA 1U1IA 4MP3A 1U9YA 1UWCA 4EUHA 1JILA 1L8QA 1JXAA 1K7CA 1Z4JA 4WIAA 2OD9A 4PZCA 5ALTA 3O84A 2X2PA 4GYWA 4ZC8A 4MX8A 3Q6NA 1U1FA 3ZZUA 1HFWA 4ZI5A 3BHJA 4OIFA 2WWRA 2HWWA 3B5JA 5JT1A 5E3JA 1IN4A 5KKCA 4RGYA 4V24A 2JJYA 4IFEA 5DNVA 3OF2A 2WHXA 5JD4A 1XKXA 3P9YA 3I1FA 3TOVA 2GAJA 3BWMA 4C7BA 5HIJA 4ICIA 1V6AA 4BRUA 4R9UC 2BP7A 3OWHA 2ZRIA 4U7FA 2GPJA 2HRBA 2VYVD 3MA0A 4URYR 2G6BA 1PIWA 3C3KA 4HNAB 3AKEA 1DCKA 1E3DA 3FRHA 3SF8B 1N3IA 3VR5A 5K8UA 4CEIB 1WPXA 2GEBA 3F46A 1D2EA 2GAAA 5IULC 1W7AA 3MUOA 2PL5A 4U2DA 4E5PA 4E31A 4J2TA 2WYHA 4MV1A 4BMXA 1FCJA 4ZCIA 5CCBA 4OJNA 4H7DA 2NG1A 4L5CA 1GA6A 1C0KA 1B3BA 1DKRA 4HFMA 5DYGA 1KU0A 5C51B 4JI0B 1S9HA 4BNYA 3QVLA 1PJZA 1WJGA 4XGRA 1DI0A 3MN1A 5UKDA 1QQTA 4ZJPA 3SX4A 3S1LA 4RMGA 2WPNA 4UUPA 1IBLB 4ATNA 2I7XA 2Q1TA 3C8MA 3LTNC 2VZEA 13PKA 1AK2A 1UKAA 1YJAA 4S24A 3AOEA 1OXTA 3A10A 4NH4A 4QLAA 3ZE8A 2EFEB 1BE0A 2D5LA 2GXSA 3I45A 3I4CA 4UNQA 3M3HA 4B81A 2LCIA 1OT5A 4ESVA 2R6DA 2B20A 1EZ1A 2RE8A 1CF2O 1LTKA 2JBWA 3K31A 4EI2A 1XRPA 3QHPA 4YAOA 3A4TA 3OCCA 4LKRA 4MWEA 4OFBA 3TRJA 3ZK7A 1H4SA 3JZDA 3TDKA 1ORTA 4AJNA 2O4UX 1LBTA 4OAQA 4NIMA 3CVOA 2OLJA 4AY3A 4W9NC 1XA3A 4BRZA 1KYWA 3GLIA 1BXGA 2IVZA 2ZU0C 3DMHA 3JWIA 4KPGA 3AZPA 4PGAA 3U3ZA 4WBNB 3OQ1A 1RKQA 3FJOA 1LLQA 2O7QA 3C7TA 1R0XA 2Y1OA 4CDMA 3QJ5A 1ZEJA 1WLYA 4QU8A 1GZDA 5IBPA 3GT0A 3OZBA 5AVQA 2W00A 1FBTA 4JBLA 4N7MA 5F76A 3LXXA 4FW9A 1MOZA 1L1FA 3N0XA 4IPTA 4YPFA 1QF7A 2Y1EA 3L8HA 3MILA 1D2HA 3BMOB 2YHBA 4JLNA 1LSSA 3OEYA 4AI6A 1L7DA 3CPEA 4KK3A 2EJBA 4MUBA 3FA2A 1FLNA 1SXJD 4UCFA 3TZLA 1H2XA 4BLTA 3KQUA 2R8XA 1ZZGA 4YPVA 2FGKA 4MPPA 5F9MA 1NTOA 1V0JA 2O2YA 3AG5A 4UXJA 1AQJA 3DMFA 1EFHA 4E5NA 5T4FA 1Y8QA 1B8UA 1GA4A 3DUFB 4BGIA 5IYZB 1HPLA 2IPMA 1VYHA 4F8JA 3UTDA 5ES4B 4ZIRB 1YTUA 1K63A 2WR8A 1XKLA 4N5MA 4OHPA 4P80A 3JQEA 3G0HA 1VKJA 1JNXX 1XEWX 1SN7A 1HFJA 1M6WA 1JIKA 1MJFA 3A26A 3LA6A 3GGGA 1CZUA 4YJHB 4ZVLA 3EA4A 5L3RA 3WTCA 4QOGA 2RMKA 4L5YA 2NTYC 2HMVA 3JZAA 4EUKA 4DREA 4KQJA 2YMMA 3CIFA 3A3PA 5LJIA 3ZHTA 2EFDB 2QIOA 1U63A 1C5KA 2E4UA 2IXEA 1ZY2A 4MYDA 1YJ5A 3HFSA 3ZD9A 2Z58A 3D59A 4A26A 5IDQA 3TIXB 1U8AA 3T4XA 4YRRA 2GLXA 3U09A 4FB5A 4TT3D 5JJCA 1KFCB 2B4AA 2IYXA 3ZCVA 3TZKA 2AN5A 4YALA 1P39A 4LDZA 3PF8A 2RKWA 5IZ4A 1GQQA 4RACA 1RTKA 1N1DA 3KV1A 3CJRA 3O8NA 4OU5A 4QXOA 1YMVA 1DBWA 5TB5A 2NSDA 4KZPA 4OP1A 5EJEA 2X4GA 3K0FB 2DPMA 1HT2E 2NZ2A 3EEQA 1AIPA 2QUZA 3IFSA 2I7DA 1SUPA 3VSEA 4Q24A 3JRWA 5D3QA 5FI5A 4EPYA 1DVRA 2C2HA 3VVLA 4P3YA 1UP7A 4RVCA 2EG5A 3V7NA 1SG0A 2PTHA 3Q3JB 1RP1A 5TMDA 3BMCB 3GBVA 3VNBA 2W48A 3I4LA 4RZSA 3C2QA 3DBRA 4X1OA 2AMYA 2E1RA 1R2QA 2OOKA 3PX7A 2VJAA 2E82A 1P9OA 4G5SA 4RHXA 1XBTA 3IT2A 1NWHA 4MRRA 2MYPA 1CDEA 3WO1A 4KODA 3OF5A 4RQAA 3C5EA 1PK9A 4GKKB 4M88A 1I32A 5KPDA 3F7TA 4ND2A 1RXYA 1E66A 3SHTA 3UXEA 1Q12A 3ICWA 2AK3A 4L76A 1KRWA 3B1XA 3NFRA 2BTQA 4J9VA 4LBZA 1OA1A 1FP2A 1VP9A 2XVAA 3KOWA 3B13B 3ISVA 4PTZA 2C00A 4QSHA 5DYIA 2J41A 4AMZA 2A14A 2QGZA 2ZBPA 3SJUA 4AZ0B 2HQ1A 2IK8A 3EDOA 3LCUA 3D3WB 4LE2A 3R6GA 1PDVA 1B1AA 1QC5A 4K6HA 1V1JA 1KMNA 1U65A 4D7AA 2JG3A 1DUSA 4CMJA 2PT7A 1V9SA 3NUZA 5CT6A 1Y7LA 2CFSA 1D1TA 2HU2A 5BR8B 3QVKA 4N8DA 4ZVNA 1VKZA 5BSEA 3FHLA 2P68A 3F74A 4KXNA 2OP1A 2VP4A 4HGZA 3ZWMA 3RR2A 3NM5A 5KTMA 2GMWA 4W1QA 2YYSA 4OSEA 4PANA 1I5EA 4HH1A 5ALSA 4CM4B 4J03A 2VAPA 1UJ2A 5KTPA 2JA1A 2MTBA 4C0BA 1T4MA 3E5NA 9ABPA 2YNMA 4DEYA 2GVDC 3PSAA 3TLKA 1V16A 1MNAA 5KSOA 1XMJA 1X1AA 1KVSA 1ZG3A 3B60A 1KSFX 2EZ4A 3GNSA 3HKEB 3KJQA 4LVOA 2GNAA 4HGOA 1SBQA 5EHNA 1FLVA 5DMHA 1NGSA 3BIOA 4QRHA 1XPRA 4Z9XA 4RDCA 1BH2A 1Q0SA 3IB6A 1GEGA 4JP2A 4H3VA 1EEHA 1EU1A 3EAQA 1KZGB 3IHTA 5AJXA 3T7TA 2PJDA 4F97A 5BVGB 1HMPA 3BWYA 1KSHA 3VKGA 1S2OA 1PUXA 4N76A 1Q91A 1U2DC 4NPCA 1TLTA 4QRIA 4FZ5A 4D57A 2ENWA 5C7OO 2I7VA 1HBJA 2FW9A 2JK1A 2JL1A 3H9JA 2D62A 3OZGA 1PFKA 3VPXA 4EY6A 5B55A 1O94A 2A4KA 2PSHA 1P19A 2NVBA 2OPBA 3O2QB 5GTDA 1SCQA 2GPSA 2WJAA 4K9DA 1E4EB 1PFUA 4F3NA 1FYVA 1YS2X 5F1OA 4DCGA 2R751 2FJPA 2J9FA 3EC7A 1M73E 1NLUA 5AHWA 3WGQA 5KTNA 5L51A 5LQJA 1HZZA 1XD2B 3JD2A 2DULA 4POAA 4GKBA 4UUBA 1QOPB 1P77A 3BZBA 2ONCA 2GQ0A 3LX4A 1PZEA 3DZFA 4CLRA 1SUWA 1OSNA 3P9KA 3IAM1 3Q2KA 1RZRA 4MWGA 2DLNA 3WKBA 4F7WA 4TLDA 1DKUA 4MVJF 4OYRA 4RD2A 4BMYA 4OBEA 4TLBA 1G4AE 1I4WA 2GM5A 3TUIC 3K6SB 4O8CA 4M21A 3K4HA 1VZ3A 4L3WA 1ZCAA 5I9MA 3GJ6A 3G8YA 1O54A 3OC0A 3ONEA 2PYIA 2V45A 3HG7A 1TIKA 3R3ZA 4C30A 5EEHA 5JMWA 3RUHA 4EO9A 3QXXA 1Y8QB 1WCV1 2ACEA 2IU3A 1HE4A 1ZGAA 2ZYDA 4ZVSA 1DIAA 4FKZA 5HQJA 4DCVA 3NJRA 2YKGA 1JJFA 3CX8A 4DR6B 4JT9A 2ZK7A 1L5LA 3NPAA 3WDSA 1NDQA 4FGZA 3EXHC 3GEMA 1ZINA 3T3DA 2CL0X 2J0UA 4GLLA 5AW4A 2IYSA 2JH8A 2YVQA 3PICA 1OCEA 4QBTA 4OA8A 3P2IA 5E4JA 3WJ7A 2HRZA 1O57A 1I6LA 4OEHA 4UHKA 2Q45A 2ZB8A 3A2KA 1GM5A 1JEOA 3MGCA 4P5EA 1I7DA 5IJ0B 3SLRA 3P2MA 3WGUA 5A5VA 4AD8A 1GPBA 1X15A 4BIMA 4D3XA 1N5MA 2INGX 1QLJA 1AGRA 1E3TA 1LDMA 3GCZA 3VX3A 8LDHA 1K7EB 2OB2A 3BRQA 4Q34A 4MKZA 3ZXXA 1XZBA 1QH9A 2HPHA 2CKDA 3RTAA 1A76A 1J2YA 2O7SA 2VTBA 4PYLA 2PZJA 1XC7A 4UFOA 2Y1CA 4G8DA 2X40A 3DZBA 1AA9A 5AIAA 5AJUA 1UANA 1DAOA 3CLTD 4FHCA 5JVDB 3TL2A 5B4TA 2UXCB 1OYVA 2E4AA 4NRDA 3X1MA 4YJ2B 4EFMA 3F5SA 1L4HA 2QYSA 1URPA 4DMLA 3HB7A 1SVWA 1S2IA 1P2DA 1AV7A 1QTIA 2K5UA 4IIHA 1SQ6A 4EUNA 5GONF 4F7DA 1T1RA 1T8YA 2M6SA 2N9UA 2DUUA 2C95A 2QAIA 3IKVA 4PX3A 2V65A 3U7RA 4HEJA 1S9DA 3RC1A 1F06A 1ZR2A 1I3MA 1ZVMA 4ZK6A 1H9AA 5DXAA 3LQFA 2J46A 1A88A 2UDPA 2GXAA 1Y48E 1E96A 2CKMA 3HBJA 3MWDA 3NFYA 2HC9A 2RB5A 4HQ6A 1A04A 1II8A 3RSFA 4V0LA 3RUCA 1H1LA 1XIVA 3WDLA 1MOSA 4BKOA 4IDEA 2M98A 1MRNA 5CDTA 3ZGOA 4CF4A 2IUEA 2L17A 3ZE7A 2Y93A 1QE3A 5FEMA 3UH1A 1HDRA 1EM6A 3KEMA 4PO3X 2NTJA 2WJGA 2XA9A 1D7AA 1L5QA 1G17A 1B2LA 2OFWA 3QWAA 4F4IA 3LNCA 4DLYA 4ND4A 4ZVOA 1YRAA 1E8NA 3Q8KA 1HE5A 1FW8A 3BIFA 1E2HA 3SF0A 5KQSA 3PR2B 4FU0A 1GA1A 1H5UA 4WY8A 2M9MA 4XCXA 5EFZA 5H16A 3WL5A 4B2YA 4WN3A 1HNZB 3B9BA 4RV9A 4DGQA 4RCYA 5EIOA 1V9LA 3BGOS 1P1RA 2QU7A 4YROA 5KNLA 1E9EA 1WG8A 3TMAA 3VZSA 5FBKA 2LXNA 1MIOA 3GELA 4U00A 1OFGA 4ZCTA 2I7CA 1A2BA 2P5UA 1KPGA 4RYLA 3DD1A 1HFEL 3PT9A 1R64A 1SHJA 5G1PA 2HLHA 2YICA 5I51A 3WL8A 5IKEA 1SK9A 1MT0A 1YBVA 4WEQA 1L4LA 2V3VA 4DCMA 3CQ9A 1OB2A 2DR0A 4ARSA 3COVA 5T7BA 1M6EX 3HN7A 1B1CA 4RLHA 4D9KA 4AY2A 2I0FA 2AFIE 4FW8A 1PF7E 4GKAA 5IC5A 1JR6A 1K7FB 3O3NB 2C5LA 2R6FA 4H0CA 4HMPA 4M8NE 3WBBA 4IWXA 4TZ6A 4MR9B 2NXCA 4DSTA 1RQRA 1RHMA 1LK5A 4RPHA 4V0QA 3VR3D 1M2GA 1EXWA 3FX2A 1DWPA 5F4BA 4KO8A 1Z7WA 3QK7A 3VXKA 2WTNA 5BR7A 3FW1A 1FX0A 1ODIA 3M4NA 4IDGA 3FIJA 1H8HD 3PNYA 2XCRB 1WNFA 2CUZA 2ZBGA 1E7QA 3EHDA 5AI0A 2VBGA 1EVZA 1PQUA 1W46A 5IJ9A 1NYLA 1XNQB 4LXXA 4KLZA 4PZDA 5J2UA 3DEYX 4R3WA 4PS1A 3HVIA 2XBUA 1CE8A 1OFVA 2W37A 4TM7A 1SVSA 1QDLB 2AYYA 3PIIA 5JXWA 2BEUA 3PR3A 4J29A 2GM4A 2FW1A 2BFEB 3QEBZ 1QRSA 2Q27A 1N0WA 3SHWA 4Q7JB 3V8PA 5HIKA 4OGGA 2YL2A 5ITZA 1VZ2A 1E5VA