4XVCA

Crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMPLDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYVIGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVEDTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRYIGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERVMSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIETLLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPEGKQAIARIGEFLRKQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase E40
publication title Interdomain Hydrophobic Interactions Modulate the Thermostability of Microbial Esterases from the Hormone-Sensitive Lipase Family.
pubmed doi rcsb
source organism Environmental samples
molecule tags Hydrolase
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xvcA00
3FYUB 4X85A 1W75A 2XMGA 5AM1A 4B9AA 4EY8A 5HK9A 4G8CA 3OG9A 3PICA 3IUQA 1EHYA 3NUZA 2OLEA 3IB3A 5CT4A 2I3DA 2C4HA 4IH4A 1CR6A 3T4UA 2G5TA 3S8YA 4P92A 5AICA 5JD6A 1AC5A 4JYMA 4E15A 3VKFA 1OILA 2QZPA 4Q3OA 1UWCA 3C6BA 3GELA 1YAJA 2WG1A 1DWQA 5IVDA 2XT0A 1XKTA 4OCZA 4BDTA 3BL8A 2XUAA 3V1KA 4UHEA 5LIPA 3C6ZA 1Q0ZA 3ZWQA 5EHXA 5KBYA 2I78A 2PL5A 4OSEA 2ACEA 4MYDA 5FOQA 2CBGA 3VDXA 1YASA 2HL6A 5AK5A 5AKKA 1XZKA 1AZWA 2FJ0A 4AMZA 3DKRA 2VJAA 1CQZA 3AZPA 3QM1A 3DOHA 4KRYA 1EVEA 2Y2UA 5AI5A 2X5XA 5AK3A 5T4FA 2BGNA 1XZDA 5ALOA 4C88A 3G0IA 1MT3A 4WDRA 5FPQA 4BCCA 1XQWA 1QIJA 3H0CA 5JANA 3MGAA 4BE4A 4H7HA 4GHWA 4AO8A 1BRTA 4NS4A 1WOMA 3ANSA 4XIIA 1XZLA 3PDCA 4Q34A 5YASA 1ZGCA 4UHBA 4L0CA 2DR0A 5FKJA 4BYMA 1UFOA 1XZAA 4MJ3A 5CH3A 2W6CX 2XMZA 3AZOA 7YASA 1YS2X 1EB9A 4LHEA 4EUSA 5I8PA 2ZYSA 3WL6A 4UBLA 1Y7HA 2DFPA 4A16A 1VA5A 4KAFA 3FWHA 1QE3A 5EGNA 5I7UA 4U2EA 2ES4A 5ALDA 3CXUA 2DHDA 3PI6A 5IVKA 2XUPA 3KWJA 4M0MA 1F8UA 4P93A 5ALLA 1T2NA 3ICVA 2WFZA 2ZJ6A 5JYCA 2H7CA 3G0DA 4JH0A 3UUFA 2I3ZA 4LIPD 3H2HA 1U8EA 3IVMA 1VE6A 1GT6A 1EDDA 3WL7A 4BTLA 3WWDA 3VXKA 2XUKA 2RHWA 1K5PA 3ESCA 4MQLA 3FAKA 1CLEA 3WK7A 5ALTA 4B0OA 3F98A 5AK4A 5BWBA 4X6XA 5LZ9A 5CW2A 4H7KA 2AJCA 4KR0A 4C4XA 4ZGBA 3W05A 3D2BA 5A2GA 4HVTA 3ICWA 4X6UA 4UFNA 1M33A 3FCXA 2O2HA 4YX9A 3BXPA 1THTA 5HQ3A 5E2IA 3U0VA 2HU7A 3I6ZA 2RONA 2QTBA 3C8HA 3V9AA 1UZAA 2VJCA 1Q84A 5HKAA 4DMKA 3BJRA 1DQZA 5JAHA 3CCBA 5AKEA 2B4KA 1MU0A 1HLGA 1ISPA 3BDIA 2WJ6A 3F96A 3WKDA 1GQSA 1JI3A 1H2XA 4FLFA 3KXPA 1JU3A 2NW6A 3DJYA 1EINA 5LP1A 1MNAA 3HACA 1ZGBA 2J4CA 3IDAA 2DHEA 5EFZA 1WHTA 4J0KA 2Y6UA 2VA9A 5LZ2A 1B41A 4HTAA 1GKLA 3AFIA 3M83A 2QR5A 2XMDA 3AJAA 4WY8A 1Q0RA 4JEIA 4I4CA 2HHAA 5AKIA 1EK2A 3I2GA 2JF0A 3LLCA 3ZLTA 4OB7A 5AO9A 4BVLA 1VXOA 2Z3ZA 1E8DA 1IZ8A 5ALXA 4X71A 3BIXA 3BF8A 3C43A 3RK4A 2HA3A 5CURA 1G66A 4W9RA 3DEAA 4BC0A 2QMQA 3QBJA 3RM3A 4YK7A 4B84A 1VZ2A 3DS8A 3C6XA 1ZIYA 3C45A 3ZLUA 4WJLA 4Q05A 3WK9A 2IIVA 1SCQA 5AM4A 5E4TA 1A88A 1DU4A 2DQZA 3ANTA 4QLOA 3HYSA 1L7QA 3R3YA 5K3BA 4HXEB 4BAUA 1BEEA 5AM0A 2PVSA 4ARAA 3SC2A 4FTWA 2VJDA 2HRQA 1XQXA 3HXKA 2GBGA 1P0QA 5EHZA 5CT9A 1QIEA 3HC7A 3W2TA 3WLAA 3DYVA 1RWQA 4K6KA 1HL7A 3BIWA 2G63A 3EQ9A 4Y2XA 3A2MA 3LIPA 5HFAA 3SK0A 3IUNA 2WUFA 4AN0A 4OB6A 3ZI7A 3WKCA 1EDBA 4KE6A 5BWCA 2WHPB 4KYVA 5AHXA 2OG1A 2BKLA 1WPRA 3TJMA 2GBIA 3PF9A 5K3DA 5JZSA 3R41A 4MEBA 3G0CA 4FNMA 1WCYA 5A62A 3PFBA 1MN6A 2OAEA 4KE7A 1SOMA 1TCBA 4ZV7A 4IO0A 2WSLA 4IH1A 3WK5A 2GBFA 5BOVA 2I03A 1IVYA 1ZD4A 2E3JA 4AXBA 5ALNA 4KE8A 1EA5A 1WB4A 1BROA 4H77A 5AP9A 4GW3A 2ZYIA 4BZZA 1Z68A 1TCAA 2HA4A 4W1RA 2YYSA 2BUBA 1A8UA 3R3VA 4MWSA 2ONCA 2HIHA 1QZ3A 1C7JA 1AURA 3IA2A 1LPSA 3I2KA 1ORVA 2XUIA 1DINA 1XRMA 1UKBA 4MYSA 1HPLA 2GYUA 2PUJA 3F67A 3P2MA 5KWJA 3G9ZA 2C7BA 4ZV9A 4NMWA 1WPXA 1N5MA 4UBJA 5AIAA 1CUSA 3O4HA 2HA0A 4X90A 2JGLA 5LKAA 4QE3A 1EI9A 1X70A 1TK3A 1XRQA 1E8MA 2H9YA 4BRSA 3VVMA 5K3FB 4DTCA 4H7JA 3F8SA 2QUBA 2RIPA 2H7XA 3O4IA 3YASA 2JGMA 4EY5A 3STVA 2Z8XA 2ZSIA 4YASA 5HKBA 4S0XA 1QLWA 4J7AA 5AM3A 2EDCA 1CUHA 4QWMA 4J0IA 4UBKA 3B5EA 2WUGA 3I2JA 3IULA 5K3CA 4WFIA 1UK6A 4HRXA 3ZPXA 4Q82A 3KOOA 3L1HA 1UK8A 1TQHA 3VVLA 3L1IA 4B7ZA 3D2CA 3PUHA 2XQJA 4UHHA 1R9MA 3WKEA 1MJ5A 3R3ZA 2G5PA 1IUNA 4P9NA 1U4NA 4X91A 4CIBA 1BU8A 2WG0A 3LIIA 4RGYA 1ODCA 4BVKA 3H1BA 5T4BA 3BE8A 3DCNA 3LS2A 4CIAA 3F97A 1GKKA 4GBGA 4QDTA 4QDZA 4IHAA 1H2ZA 3GUUA 2VQ6A 5AI8A 1LPPA 5E4JA 1LLFA 2ZJFA 4BB0A 4ETWA 4LXGA 5ALEA 1CUCA 2BUAA 3OC0A 3QYJA 3VISA 3QPAA 1K63A 4QEKA 1JKMA 1J07A 2XMQA 4X92A 1QONA 5FLKA 4OU4A 1OXMA 1MTZA 1O6FA 1TKRA 4AO6A 1E66A 5ALPA 1EK1A 1UK7A 4OYYA 5DTIA 2O2IA 5DNWA 3DL7A 2JGEA 5DNUA 2O7RA 2OCIA 2XMBA 1JMKC 1GQRA 1QOZA 3O9MA 4X3CA 1LNSA 1CUAA 1G42A 4MXDA 5DTJA 4U2GA 5ALYA 4PV7A 5CH8A 2ROQA 4Q3KA 4N8DA 4G1FA 3S2ZA 1FFBA 1FSSA 4C01A 3UUEA 1GXSA 1DWOA 3D59A 5AM5A 3VJKA 1O6GA 3FNBA 5CRIA 1ZD3A 1P0MA 1MAAA 1XQYA 2FX5A 2C5GA 2WFLA 4CCYB 2JGJA 3FYUA 4KRXA 3PUIA 5HFNA 3A6ZA 1FFAA 3WYNA 2JIDA 3UMJA 3HI4A 5DYWA 3IURA 2CB9A 3ESDA 5AI9A 1UT6A 2PPLA 2JGIA 4DSAA 1FFEA 3RKSA 3WWPA 1XRPA 1IUPA 4Y7DA 1AUOA 1JFRA 3WKBA 4IH9A 2HA5A 4CFSA 1WM1A 3AIKA 4XVCA 1UXOA 1XLVA 4W1QA 3M81A 5CT8A 3FBWA 3OM8A 5DYYA 4DMCA 2XUOA 4FLEA 1DWPA 1FFDA 5JZ9A 4RNCA 5K3EA 1E89A 4QDOA 4F21A 3BDVA 5AKXA 1R4ZA 3X3HA 3I2IA 4K5QA 2B20A 4FKBA 4Q1VA 3EF3A 4B82A 1CEXA 4UFPA 4M0FA 1DTEA 1U65A 4EHBA 3I2HA 1K6EA 4RPCA 2XQIA 3G8YA 3QITA 1ZI9A 4WDQA 1R1DA 3G9XA 2O7VA 2WJ4A 5D3ZA 1XROA 3D7RA 3DL4A 4G8DA 4KJXA 5FDFA 1QIHA 1R88A 4D9JA 5EIHA 1VLQA 2VT7A 4CG1A 1YB7A 2ACKA 4BZWA 2ZYRA 2AJDA 4IQ4A 4P08A 2VAXA 4I19A 1U2EA 1QIDA 4J0HA 3ESBA 5HK8A 4Y2JA 4DNOA 2WIDA 1ACLA 3EBLA 4L3WA 1TAHA 2WKWA 3FSGA 1THGA 3QMWA 5HF8A 5ALIA 2WFMA 4B81A 4FLMA 3TRDA 3C8DA 5AKHA 5JARA 1MX5A 3AUKA 3R40A 5IVHA 2XDWA 4U2BA 5JAUA 5AJHA 1VA4A 5ALZA 2X8BA 1ODSA 2WTMA 4QA9A 4UHDA 4ZXFA 1MO2A 4DGQA 5T4HA 4KAJA 5ALHA 1CUGA 1PFQA 4K6HA 2ZYHA 3QH4A 2JGKA 3B12A 2WIGA 3D4LA 4HZGA 1EXWA 2RAUA 4M0EA 2AXEA 3FLBA 5LZ4A 4MWTA 1ZIXA 1T4MA 3DKKA 3STTA 1QO9A 1BS9A 4LYEA 3E1GA 3H04A 3V1MA 1X2BA 2HA7A 4A5SA 1I6WA 4KACA 5JATA 5A71A 2GYWA 1EB8A 3U1TA 3G7NA 1CUYA 1QIFA 3WIOA 1S8OA 4G4GA 4DSZA 3WK8A 4WY5A 5CT5A 4UBIA 3E4DA 5CXXA 3HLKA 4H7FA 3H2KA 4RE5A 4BATA 3W9UA 4Y2UA 4H7EA 5C81A 2PSFA 1B6GA 1CUDA 5SYNA 3O4GA 2PX6A 2BCEA 4DIUA 2CEKA 2YH2A 2HU5A 4PF1A 4KEAA 1TCCA 2VSQA 3WYDA 1ZI6A 5ESRA 1AMNA 3RARA 5AKZA 3WK6A 1QIGA 2YXPX 1A8SA 1CUEA 5AOAA 2JEYA 1JJIA 5D6OA 1UK9A 4ZREA 1N1MA 4BVJA 4OB8A 3FVRA 1TRHA 5FP0A 2OGSA 2QOEA 2WU3A 4U2DA 4FFWA 2V97A 5HCUA 2YASA 1C7IA 2WIFA 3N0TA 1DT3A 4O08A 5HF5A 4G4IA 3JW8A 3QMMA 4G9GA 4FBLA 5DWDA 1ZD5A 3KD2A 3D0KA 1HQDA 2PUHA 2ORYA 3M82A 1VE7A 2HDWA 4X6YA 3D3NA 1W1IA 1LPAB 3IIIA 1J06A 1R9NA 2HFJA 4FOLA 5D3KA 3W9BA 4KE9A 4N5HX 1QFMA 1HKHA 4EBBA 3W04A 4H35A 2WIJA 3IUJA 2Y6VA 2C0QA 3WL8A 5CT6A 1W76A 3C70A 3H2JA 1CQWA 3H2IA 4DMFA 3K6KA 1J2EA 3DQZA 3NWOA 3OOSA 1QTRA 3FOBA 3HJUA 4DNPA 1IZ7A 2ZSHA 3EQ7A 1JT2A 3GROA 3IBTA 1H2YA 4N8EA 1QTIA 5ALSA 4WFJA 1A8QA 1SCKA 1L7RA 2CJPA 4L9AA 1ETHA 5AH0A 3GFFA 2H7YA 5KWIA 4UHCA 1QGED 4NVRA 2XLBA 2GBCA 3WKAA 2CUTA 2VT6A 2LIPA 4UBNA 2QM0A 4C4ZA 4TPKA 3Q0TA 4QDUA 4UPDA 2HU8A 4KAAA 2OCLA 1XZHA 3R3WA 1CUFA 3AZQA 1QJ4A 4E14A 5JADA 1MPXA 2R11A 4BE9A 2WU4A 1HDEA 1YB6A 1CRLA 4BTVA 5LZ7A 2EDAA 4GI1A 5LZ8A 2Z5GA 5ALUA 2C58A 4GEGA 4Y9SA 2XQGA 1CUWA 4UUQA 1UKCA 1ZOIA 2BAGA 1D07A 5C8XA 4BAZA 3GZJA 3DLTA 2WHRA 1CUUA 1WHSA 3WA6A 2QXUA 3C87A 1YA4A 4J0DA 4TGLA 5CH5A 2C5FA 4GDMA 2J3DA 5CXUA 5ISMA 4DNFA 4FDMA 3G02A 3MVEA 2FUKA 3G0BA 3WIBA 1W52X 1J1IA 1H22A 2OQVA 1QIKA 3AINA 5AOCA 3AILA 3WJ1A 2DQYA 4DM7A 5T4EA 2CZQA 1DQYA 1EDEA 4LXIA 2QRUA 2XI4A 2XQKA 3JWEA 2H1IA 5K3FA 3FSGD 4MQMA 5BV7A 4CI9A 5HZGA 1FJ2A 4EZIA 5ALQA 4W63A 1SCIA 3PF8A 3FLAA 4K2AA 4E11A 3VJMA 4JYPA 3F9CA 3T52A 3BWXA 2G4LA 2VF2A 4AQDA 2OQIA 2WG2A 3DYIA 1LPBB 2HADA 2QXTA 3OPMA 1YS1X 1XZIA 2HM7A 3IUMA 4F5ZA 1F6WA 3AIMA 2J4FA 4H7IA 2B9VA 4W1SA 2B61A 2GYVA 5CTAA 4AN1A 1AX9A 1F0PA 3O95A 3FYUC 3AIOA 2WJ3A 5ALKA 1CUBA 2DCMA 2BJHA 4A23A 4XWGA 3ZV7A 3WMRA 5DYTA 3FCYA 1UKAA 5C8VA 1VKHA 4AX4A 2XB6A 4GXNA 3VJLA 3GBSA 3MUOA 5EI5A 4EY6A 3K2IA 3I28A 5ALGA 3HSSA 4AZ0A 2VEOA 3WWEA 1XRNA 3LCRA 3PE6A 5HF9A 3BJMA 1CUVA 1G4HA 4B83A 4MEAA 4BCDA 4QWWA 4B80A 1JMYA 5CMLA 4HS9A 3QMVA 5EIAA 4HRYA 3D2AA 3C5WP 1MAHA 3H19A 4H0CA 4N5IX 1VXRA 4J0GA 4ZWNA 1NX9A 4B0PA 3OTQA 1YAHA 4X7BA 1DX6A 5E4YA 4PSCA 4PSUA 4WCVA 1ZJ4A 1QIMA 1GPLA 3HABA 4Y2QA 1BN6A 1E5TA 2XMSA 4INZA 2JEZA 2PSHA 4XX1A 1KEZA 3C6YA 1XZFA 5DJ5A 4C87A 1CFJA 5CBKA 3WQHA 2XUQA 3KWFA 1GZ7A 5A7FA 4XJVA 3EIOA 3RLIA 1CUJA 3K9BA 5AI0A 4PNZA 1H2WA 5C7YA 4CCYA 1BN7A 4PSDA 1E3QA 1ZD2P 2EEPA 4Y2TA 1KU6A 5D7BA 3A70A 3MUNA 2BGRA 4BAGA 4BCBA 5HQ3B 2AJBA 3BF7A 3Q8WA 3G9TA 1CVLA 1VOTA 3STXA 4H7DA 1IUOA 4UFOA 4EY4A 1N8SA 1ACJA 4G9EA 2XLCA 4HXFB 5DLPA 4EY7A 4CG3A 3G0GA 1CUZA 2HA6A 2J3QA 1BCRA 4G8BA 4EB0A 3SX4A 1G5FA 1MX1A 2D0DA 2WUEA 4X95A 3V1LA 2WILA 3TGLA 3LP5A 5LYYA 1XLUA 3NOXA 3V48A 2XMCA 3ZLVA 1DT5A 1R50A 2HA2A 2Q0XA 5DNVA 5AKYA 4H18A 2DHCA 3O4JA 1KU0A 3FYTA 4LYDA 2OGTA 2VJBA 1UOPA 3WWCA 4DLNA 5AKGA 4Y2SA 3CN9A 4BDSA 3I6MA 5JIBA 1SC9A 4HAIA 1X2EA 5JALA 3WA7A 3SWWA 1LPNA 1XZMA 3CN7A 4BP9A 4PQEA 5LKRA 2PM8A 4FBMA 2XUHA 2QUAA 1AGYA 3QPDA 5HF6A 3ED1A 2QJWA 2GZRA 4GECA 5ALFA 5FPPA 3OURA 5ALMA 1XZGA 1EVQA 1EX9A 2PBLA 1YCDA 2BFNA 3ILSA 4GLBA 3EQ8A 4Y2PA 2W22A 4QDXA 3R3UA 1QO7A 1XQVA 4BP8A 2ECFA 1JJFA 3STWA 3HZOA 2D5LA 4N8SA 5AIBA 3O0DA 1CV2A 2P8SA 5A7HA 5H3HA 4AZ3A 3WI7A 1USWA 1ZJ5A 5FXMA 5A7GA 2QJRA 3PFCA 2O2GA 5EHQA 4JUIA 4YPVA 4X93A 4HXGA 5I9IA 4K6GA 2XE4A 2XMRA 4F60A 1PV1A 4J03A 2JGFA 3N2ZB 1CUXA 2WM2A 1AQLA 2BUCA 2CKMA 2WQZA 5ALVA 1LZLA 4F0JA 2R8BA 2HRRA 1SFRA 1QIIA 4DMHA 1LBSA 1YR2A 3DDUA 4I3FA 3NGMA 5AOBA 1Y37A 3I1YA 2XUFA 4UHFA 5EHNA 2RHTA 1L7AA 2XUJA 5J3JA 2JBWA 5IKXA 2RGUA 3A2NA 3R3XA 4J3JA 2ZJ7A 4X94A 2WTNA 4FNGA 2OXEA 3B3QA 5JASA 2RI6A 2WUDA 3H1AA 3WJ2A 1GPKA 1ZI8A 3QPCA 2OGZA 4LKOA 3ESAA 2VAVA 4QZVA 4OYLA 5AKJA 1EH5A 1OCEA 1XRLA 3JYHA 6YASA 4B9EA 2OAGA 4AB1A 3WK4A 1W4LA 1K8QA 5EIEA 5FUMA 5ALRA 1XZCA 2IITA 4UBMA 2PKYX 4E46A 4DNQA 1JJBA 1LGYA 2OCGA 5AKLA 4ROTA 5JD4A 3WL5A 4L72A 4J0JA 5ALWA 3W06A 3A2LA 2WHQA 5IVIA 1WB6A 2PU5A 3I6YA 5AM2A 2QT9A 5JD5A 1XZEA 3FVTA 5JAOA 4C6HA 1NU8A 3WZMA 2UZ0A 1C4XA 1CPYA 1W6RA 2XUDA 5ALJA 3R0VA 4Q3LA 1CIJA 4LXHA 4BC1A 3D5EA 4B6GA 4DYHA 4FMPA 3WWOA 1WB5A 2WHPA 4WFKA 2AJLI 1Q83A 2Y2VA 1XZBA 1ZICA 4PO3X 3G9UA 3FLEA 4CCWA 2VATA 1CUIA 1N5RA 2WLSA 4G5XA 5AI4A 1UOQA 2OCKA 1ORWA 4RE6A 4EA6A 1BE0A 2OPHA 4OD0A 4GWLA 4C4YA 1LPOA 4PW0A 4J0CA 2V9ZA 4G4JA 3C5VA 4CG2A 2ZVDA 5KREA 1YA8A 2PSDA 2PU7A 1TIBA 1VJ5A 5FRDA 4OU5A 4Y2VA 4JNCA 2Z3WA 2QS9A 3L1JA 1QFSA 5C8ZA 1XRRA 3TEJA 1Y7IA 1P0PA 1E8NA 3CCCA 4U2FA 1VZ3A 4Y2RA 4UBOA 4AO7A 2PSJA 5AI6A 4QLAA 4ITVA 1YSCA 5A6VA 3O9VA 2K2QB 3V1NA 4AMYA 1R3DA 3DNMA 1MNQA 2C0PA 2QVBA 4TVKA 4W1PA 4V2IA 1XFDA 4QNNA 1FFCA 3HRHA 3DOIA 4OPMA 3M3DA 5FV4A 2V96A 4BRZA 1HBJA 1RP1A 2XUGA 3HEAA 1NU6A 1BEZA 1GPNA 1H23A 5K5EA 4U2CA 4BBZA 1IMJA 1JU4A 2PSEA 1PJAA 2V98A 3QVMA 4ZRDA 5LZ5A 3QZUA 4ZI5A 2X76A 5F4ZA 5SYMA 2HFKA 2IX9A 2Y1KA 3H18A 3STUA 5AK6A 3I1IA 1K4YA 5JZBA 1MX9A 2VTVA 3KSRA 2WIKA 1P0IA 4X00A 4OUKX 3WZLA 3I2FA 5JAPA 5LLSA 4Z49A 1UOOA 3GA7A 1XKLA 3H2GA 1ODTC 4NZZA 1RYYA 2DSNA 4C89A 4X97A 2QKYA 1F0NA 5IH7A 3DD5A 3E0XA 2XQFA 1LBTA 4Y2YA 3E3AA 1A7UA 1LZKA 3STYA 5K3AA 4FHZA 1GGVA 4B85A 2GZSA 4ARBA 2FJPA 1XZJA 2AJ8A 2Z8ZA 1DX4A 4FWBA 3KDAA 1AKNA 1LPMA 1BCSA 1XLWA 3H17A 4FFVA 2WFLB 2CMFA
chains in the Genus database with same CATH superfamily
4E13A 1SBCA 2NO4A 4X85A 4RHFA 1CQIB 1GITA 2WJYA 2XMGA 1BH6A 1NUUA 5AM1A 1QKIA 1E6KA 1BGVA 2B1GA 1II9A 3DW1X 3IDFA 4K28A 4YQFA 4RMJA 2CNDA 1LJLA 3DTYA 5BSWA 1HYQA 2YWDA 3PICA 1NJSA 5EHGA 3VSBA 3IUQA 3WNVA 1OFUX 2O5VA 3C6QA 3RR2A 2FH5B 3VYSB 4JYCA 1MOSA 2IZ1A 4Q4DA 2OLEA 1IM5A 1PLKA 2OUIA 1SUWA 3KS9A 3SI7A 3ZW8A 5IDQA 1P18A 1BDBA 1IHOA 1MC4A 2BHTA 3DEYX 3QRWA 4RJLA 1QGAA 2PY6A 3E5MA 1SAYA 4IH4A 4U1RA 4UU8A 4KSBA 3U3DA 4EFNA 2G07A 3T4UA 2BEUB 3CLKA 2A0KA 3NV7A 3L04A 5BR4A 1A8PA 2WPDD 3V4PB 5AICA 4Q16A 3S2YA 1OI2A 3TLXA 1X92A 3V33A 5JNWA 3A1TA 3KYCA 2WB4A 4E15A 4CM1A 5GJCA 1JE1A 3DR5A 1AGPA 2CLOB 2WMNB 2VBGA 2ZTSA 1D2HA 2H3EA 1P8AA 1XU7A 4MWCA 4Q3OA 3C6BA 3GELA 3UJHA 1YGPA 3IAEA 5IJ9B 3B6IA 4NZOA 1XCOA 3GYGA 1Q7TA 4K3VA 4DSUA 4EB3A 3UKJA 2Q3JA 2HB6A 1ZUNA 1DWQA 3NM4A 3NT2A 1Y8ZA 1KY4A 2PRZA 1PZFA 2IYLD 4BMVA 3CZCA 1L7OA 4AROA 4GE0A 3D4IA 5LIPA 1TU3A 2GVNA 4HPWA 4TN1A 3AJ8A 4YAWA 4BMZA 1Q0ZA 4H7PA 3ZWQA 5JVDA 2R6ZA 5KBYA 3F71A 3JRXA 1IQRA 1FU8A 2VH2A 4HQKA 1D5CA 4OSEA 1B1AA 4KFRA 2CBGA 3ANMA 4QUEA 4CNBA 3MS4A 5AK5A 1Q0PA 5AKKA 3L92A 4HBGA 4JX9A 3S2FA 3TCXB 2C9YA 4PCUA 4PN7A 3GLIB 1AZWA 3EQ6A 3H16A 4FBGA 1Y3AA 3R1IA 2CL5A 1TUBB 3QXXA 4EKIA 3O3CA 3K09C 1LY1A 2R1ZA 2VJAA 2WWWA 3BZBA 2VXCA 3AZPA 4MS1B 3ZN2A 4D46A 4EO7A 4GKJB 4FGLA 3H8SA 3SNHA 1FJHA 2Y2UA 1VB3A 2X5XA 2EX0A 4HDKA 4ZPJA 5T4FA 2PLFA 1XZDA 3O0TA 2VZ9A 1R0KA 4R51A 1XDWA 3AEUB 5CYOA 2XA9A 4JBWA 1DV1A 2VDUE 5CPFA 4C88A 3BYZA 1MT3A 4WDRA 5FPQA 4NMLA 4BKMA 1CNFA 9ATCA 4D26A 4RD6A 4B34A 1OB5A 1NRWA 4FCVA 3PXAA 5FCDA 1XQWA 3Q87B 3UB2A 4EDHA 4RO0A 3ZHSA 4BVEA 3L9XA 3MGAA 1FLDA 4GFDA 1S8AA 5EINA 1URPA 4GHWA 3WIVA 3RYFA 2FPGB 3EX7C 4WLFA 1G7CA 1OHHD 4UE6A 3WADA 4HEJA 3BB3A 3M6MD 2R1TA 2NV2B 3ZV4A 1WOMA 4O59O 1F14A 4JI6B 3G2HA 3LUCA 1QHNA 4J76A 1K86A 1RRVA 1U2ZA 4M1MA 2WD9A 5DHRA 2HSDA 1DJNA 2J3KA 1JHDA 2ZZKA 1MOQA 4Y1EA 4N1AA 5J59A 4BVAA 3PDCA 1BCRB 3CF0A 4Q34A 2VDNB 4YMWA 1THZA 3PT5A 4OYHA 1JGTA 3D7KA 4HH3C 2D2IA 3FPHA 5C52B 2JG3A 5K05A 4UHBA 2ZQZA 3D3WB 2FPLA 2OLKA 3EC1A 4EKDA 1GZ6A 1Z0DA 5FKJA 2B8TA 2HY7A 2IHKA 1UFOA 2AFRA 3OM0A 1XZAA 5F4BA 2DQ4A 5CH3A 4BFVA 1HNXB 3BCRA 3U7GA 1YQWA 4JGBA 2XMZA 4A7PA 2HX1A 2RMKA 3LK7A 2ZB3A 1E4OA 2A86A 4LOAA 1P7PA 1RLJA 3AZOA 2J3MA 5ERYA 4D5GA 4EHAA 1TT5B 1RRMA 3JR3A 3QEKA 3K4QA 4L85A 3ESYA 5I8PA 5G3YA 3S55A 3U44B 2X77A 3IAHA 4UBLA 4R8KA 1P33A 2ECKA 4XLLA 1VA5A 5KPJA 5EGNA 3CMMA 5I7UA 2VPQA 1CZUA 4KBYA 3U4DA 7REQB 1UJMA 2ES4A 2FK8A 2AMJA 3BE4A 1UCFA 3IEKA 5BN4B 2HQSA 4G0QA 2QTAA 1GPH1 3H5NA 4C0WA 5B58C 4NK5A 1NAHA 3D8HA 4NOKA 1LX6A 2IP2A 4R68A 3L9WA 1G1AA 4P5EA 3ML1A 3HU2A 3U1VA 3OMLA 1SNYA 2WY2D 4COKA 1Y9DA 1PV2A 2XAAA 3HR8A 5E7JA 1F8UA 3LLVA 4GKKB 1N2CB 4TV8F 2PK3A 1E1YA 5EZSA 3W8NA 3I2YX 1QV7A 1U9JA 1V7CA 2H7CA 4DA0A 3ZW9A 4PZ0A 1RXWA 4JH0A 2H57A 2NZXA 4ZVQA 4D92A 5CA1B 3H2HA 4DCGA 1DVRA 2AG1A 2XDAA 4MO9A 3QUAA 1GT6A 3OIVA 3R8CA 3U4CA 3ZBTA 5I7EA 7MHTA 2N1BA 4I4TF 1E94E 4K6OA 4ZICA 4L4ZA 4MKIA 3R7FA 5HE8A 3NHPA 3LQ2A 2J46A 4BLPA 2O5CA 3H5IA 2ZAIA 2MMCA 3DZGA 3ESCA 4U7FA 1XAGA 4BV3A 1QPZA 1RYNA 4JP5A 3SXUA 1HSZA 2Z58A 1H3FA 4QQRA 2DERA 4KSCA 5DGTA 3WK7A 4A91A 3WLOA 5IN4A 5FTWA 2DMRA 1U8ZA 2II6A 1NZFA 2O8VA 5AK4A 2XXAB 3QVSA 4XM2A 2G08A 1PK7A 4YRTA 2NTVA 4LV6A 5CW2A 4H7KA 3S1AB 1Q3HA 2FSVA 4Q3BA 3NONA 3SZRA 1TB4A 3FHLA 4N82A 3OZGA 3R4VA 5JQGF 3D2BA 1I30A 2A94A 2PKRA 4MKZA 3SBDA 4HVTA 1G63A 4TQ9A 4F93B 5M34A 3GUVA 4X6UA 3I8SA 4ARIA 1CJKC 5FBWB 3UKDA 4YEDA 2E37A 1J20A 1M33A 5FL7D 2ONJA 1Y1KE 3WGZA 2A67A 3I73A 5TR9A 2OVBA 3ND9A 2UUBB 4GYWA 1HDCA 4F4JA 3I09A 4Q5IA 3BXPA 2J59A 2QGNA 2WTXA 1GP2A 1GUZA 2P9CA 2FE4A 5LCXA 3TOXA 1UMDB 1VKNA 4N3CA 2X1VA 4Q9NA 3LHSA 4LOIA 4BN0A 5ER9A 2XODA 3RAEC 2R2AA 3LSTA 4RGVA 5K09A 4MVXA 1DOZA 5IAGA 5GADl 2NZ2A 3DZHA 3B70A 4LJ5A 4I3HA 4DMKA 1KETA 2PIDA 1RM0A 4RPIA 4UMDA 2PUEA 4FN4A 4HQRA 3BJRA 3M1AA 4I9UA 4I1UA 1WDKA 4J91A 1C0PA 2D8MA 3KUDA 4GZ6A 2OVFA 1RLIA 3NAGA 2B4KA 4E4RA 3K9HA 3BFVA 1MU0A 3Q4GA 1HLGA 3QFSA 2LCQA 5EJ4A 4LS3A 3LL7A 1YJ5A 2XW6A 4IDCA 1JZSA 2QQEA 2JI7A 1PDOA 4UAUA 1FMTA 1JI3A 1NC3A 1T0JB 2CHGA 4L4XA 4FLFA 1B0ZA 2IXAA 3U4QA 1T6XA 3DJYA 1E18A 3MS2A 1Y5LA 2HCJB 1V16A 4RETA 1E77A 2AWNA 5KKAA 5B3JC 1S4MA 1JFSA 1EIZA 1JR3D 1RWMA 2CJWB 2WMDA 3I9OA 4IDOA 4TT3D 3RYIB 4R84A 3BMXA 4ZGWA 5T57A 5DZSA 4RDXA 4C0KA 1LNZA 1SUPA 1C7QA 1PZHA 1E64A 1EBUA 2W2LD 1ZGBA 1EGAA 1NQWA 2L42A 4LHYA 5A2QA 2Y1XA 1KORA 5EHIA 5EFZA 5JZVA 1L4KA 1AN9A 2BOVA 4I4LA 4YLEA 1C81A 3NHFA 3QVKA 4YAEA 5F9MA 3WZ2A 4G23A 4J94A 1AD2A 3I30X 1JL3A 4IY1A 2Z2KA 1C1XB 4DUGA 4F96A 2AVDA 3M83A 2QR5A 2XMDA 1RJGA 1SQFA 1BJKA 1RZUA 3AJAA 4GOKA 2I7DA 4WBSA 4ZOLA 3WGUA 4CEHB 3JQAD 1E6WA 1VMIA 1CJBA 5THKA 2B8WA 5CXQA 3QVTA 3BMOB 2JF0A 4UM9D 5CA0F 3TLJA 3U56A 2TMGA 1NF3A 5LU8A 1RRCA 3EFBA 3QOFA 4CM7A 4EX6A 2OFPA 2WLTA 2XJ4A 3MAGA 1CHNA 4TLLB 3U80A 1U1FA 3WL3A 1AK1A 1SK9A 5ALXA 5DSXA 5LYJB 4M46A 3B1ZA 3W2HA 4KQ1A 1EX1A 2RIRA 2VK4A 2HTEA 3OU6A 5CVDA 3VDMA 1DADA 1NHWA 1WQ3A 3K30A 4XUDA 5I9MA 4G0VA 2ZQ5A 2I6SA 3TW8A 5CEEA 1ECBA 3GP3A 1CZLA 1R8XA 2J0UA 1ONNA 3QBJA 5F1KA 1ESZA 1BW9A 4XCXA 4LY6A 4HQNA 2I4OA 4IIJA 1FP1D 1TYCA 3ETGA 3UGTA 1VZ2A 2REXB 2V5VA 1U0OC 4Q4JA 4Q4HB 4BFTA 2DX7A 3C6XA 3M3HA 1T1RA 4KFSA 1KSGA 2JAXA 1BHO1 2YY7A 4WJLA 3ZLUA 1FNCA 4MARA 4D9HA 4WBNB 3BREA 1F1BA 3CTPA 2PGOA 3WK9A 4EPVA 1DIHA 1HYEA 2IBSA 3G5AA 1SCQA 3EJ6A 3IUPA 3M6XA 2V7TA 2FG6C 4KN9S 4L3WA 4M8NE 1PNOA 1NSFA 2CF5A 1M6HA 3DKIA 4CMKA 3ENWA 2VYQA 1NUPA 1CW2B 1OC4A 1W5TA 4XR4A 1IIBA 4GXTA 4PGAA 2PRJA 2V0CA 1P4HA 1DU4A 2PFGA 3LXRA 5ES3A 1TD9A 2MCFA 4BNXA 4O63O 5IDWA 4RPLA 4QLOA 4M87A 4AJPA 2WJAA 1O4VA 4HXEB 1J8YF 5FI1B 2G9RA 4DILA 5BYAA 1OTHA 4EF5A 1TYEB 4BGUA 4EHDA 3QUQA 2PVSA 3A7DA 3AI1A 2OHXA 3LPMA 3F1LA 4PGFA 5B1YA 4X7MA 4ARAA 3SC2A 5JHGB 1H66A 2QIPA 3C41J 3NTQA 4JWTA 3T34A 1XQXA 2ZRKA 1JSCA 5L53A 5EHZA 4JBHA 1YDFA 1QE5A 4O2BF 2OCAA 3JQFA 1YHNA 3GNQA 2BVNA 1KGDA 1YKGA 1WNFA 2BMVA 1PZEA 2QX9A 3E7DA 3LKDA 3QNUA 1M6EX 1UIRA 1PW7A 3IQGX 5DX1A 4EFMA 4ZZ0A 3B2EA 4E1VA 5C2JB 3DYVA 1XEAA 3V2GA 1AK9A 1HL7A 1G5RA 1RHQA 2B1IA 2Q5QA 2ZT6A 3AR6A 2VUIB 3O6VA 2XVAA 3FZYA 3GY0A 4FFNA 1HTTA 2CNWA 2E1RA 3N70A 4ND1A 4C43A 4YMUA 4BJ1A 2ZBFA 3SK0A 1K7YA 4C0HA 2WUFA 4JB2A 2C4WA 3PR1A 3ZI7A 3SJUA 2LWIA 2EKDA 4ZAGA 3OEYA 3WKCA 1GQQA 1EDBA 2MSKA 2PUWA 4QU8A 4IOMA 3OTGA 4B1FA 5FWAA 4KYVA 1EQ2A 3OX4A 1YU9A 1T0HB 4Z51A 5EIXA 4ZT3A 5B30A 3VOSA 2PQ0A 2YFYA 1KR5A 3WVNA 1NVAA 5LFAA 3ZHUA 1WPRA 1XYVA 2AOTA 5T67A 4QJ3A 2V8BA 3K9QO 2ZSAA 3KQVA 2QTWB 4OP3A 2BGLA 4BGIA 5A1JA 3SXPA 2C9BA 2XKKA 4BJHB 2AQIA 3TYXA 4P6VF 3R41A 2HCTA 2LTAA 4FT4A 5IJ0A 2TRSB 4L8FA 2WVJA 3PUZA 5D84A 2R65A 1WW3A 5A62A 3OUTA 4Q48A 4B6OA 4C2UA 1PT5A 4M6WA 4D0RA 3ZD6A 3Q6NA 4HUQA 1PEYA 5L45A 1N8KA 3VC7A 3IKTA 3QU5A 3L0YA 4DL9A 2IEIA 2P9QA 4IH1A 1CQPA 3NHLA 5MDHA 2FN8A 3CJQA 5TS2A 4QRIA 3T5CA 1IVYA 3MRVA 4CQLB 1K97A 1ZD4A 1V39A 1O96A 4IWYA 3SDBA 1WO8A 4A0FA 4OLJA 1SVIA 2UZ4A 1LW7A 2C3OA 1S7CA 4FHGA 4KE8A 4QOEA 5EE9A 3LBYA 1DC6A 2RJ3A 3B2QA 5T5QA 1GRCA 1YUMA 1E0KA 3LY9A 4KCGA 4QYMA 3VBEA 4P4SA 5KNDD 1PVVA 2G72A 2YJ5A 1M6NA 3W34A 1T5SA 5EUCA 4H77A 5IYZB 2Z2JA 4CHTA 1CETA 1SHJA 4EARA 1Z68A 1D8TA 4FWTA 3I83A 3D0OA 4A0HA 1P44A 1U8YA 8AT1A 5I47A 4H1HA 5K0NA 4D9FA 3F4LA 3SQMA 3OQIB 5C37A 2BUBA 2X6QA 4QBKA 5LWQA 1R5NA 3X1JA 4X65B 1JEYA 1RWWA 1O87A 1HC7A 5DMHA 4C2TA 1DIRA 1X38A 5M7EA 2ZIZA 4CM4A 5TVKA 2BGJA 4UOEA 1Z6GA 4IXDA 4MWSA 3PYLA 3CBGA 4LWPA 2G83A 1A5AB 1XMPA 5G1PA 4CU2A 3K2BA 1USKA 3LVBA 4JDUA 3F7NA 4G5QA 1GQFA 1SZJG 1JZQA 3HJCA 5FF9A 4ESVA 3GDWA 3UM9A 4E2YA 1SBYA 2HQ1A 2QR3A 3G88A 2VRNA 3B52X 4OH1A 5FOTA 3FPEA 1MIOB 4W99A 1GT91 1UBKS 2XX3A 3EXIB 1ZAKA 5C9ZA 2QQ0A 1KBOA 5AHRA 1YTUA 3CO0S 1Y6QA 2I66A 4D0NA 4D8WA 3GMSA 4EP1A 3I2KA 4PM4A 2GZ1A 3DMFA 2PWZA 5IUKC 3OE5A 2EP5A 1FNDA 2FZWA 4Z7JA 1J9ZA 3NO4A 1DAGA 1S8NA 2QQFA 3DV9A 4TMYA 2A0YA 1S2GA 1U2SA 1YD7A 2OHFA 3M5WA 3F8WA 4MYSA 3A6PC 3PC8C 4CL0A 2GYUA 3F67A 4EGSA 3H9UA 5IT9A 1BKYA 3OF2A 2C4NA 3PNOA 1JLHA 1J2RA 1G8HA 1M1YA 5KWJA 4Z3OA 3G9ZA 3ERCA 4FGSA 2YHUA 4QOGA 5E95A 1WL8A 4JHXA 1G8SA 1N5MA 4KHPB 1W85B 2B1RA 3CKKA 4OFWA 2QZ9A 1FSPA 2P4UA 1W59A 1P39A 4YC7A 3EZ7A 3O4HA 1T0UA 1V25A 1Z29A 4LWZA 4UATA 4XZ3A 5DNAA 1GTVA 1Z16A 4EKGA 6REQA 3LECA 1S01A 1KK2A 4X90A 1Y3HA 4AP6A 4PYLA 1EI9A 3HCEA 4YYZA 1C30B 1X70A 5F5LA 3FOCA 1FW8A 1GPAA 2YWRA 3E9DA 2OCXA 2FUG1 3MAJA 2GEVA 1E8MA 1WXWA 3VHLB 1M0WA 4Q4AB 2EHDA 2I4LA 4BRSA 1RNLA 3UZUA 4N6NA 3D7MA 4Z0NA 2XAUA 4Q66C 3GNSA 4H7JA 2DFVA 3VR6A 2RIPA 2Z09A 3MPUA 3A4TA 3O4IA 3OZBA 3BQMB 1VCMA 4Y67A 3ZXYA 5U9CA 4GLFA 1JSLA 4PRLA 3GT3A 5HKBA 2ZSIA 5ICMA 1DPFA 1SWVA 2I1VB 4BKQA 2FPOA 3AONB 4J7AA 4BO2A 1F0KA 1EUQA 3SR3A 4JU8A 3VZCA 4WLNA 2X5OA 2ZREA 4EY3A 3JQ7B 3GJ0A 5AM3A 1QGDA 5BQOA 1H65A 3D8BA 3PX7A 3JQ9A 2J5KA 4WZAA 4LCJA 3QWBA 3K9WA 3EARA 1AKYA 1CUHA 2FQ1A 2ZANA 1QVAA 2J7PD 2VHUA 3VBCA 1PG5A 4RF5A 4A2PA 4EAAA 2QMUA 1C8VB 1Z33A 5HJ5A 4R9RA 4BU0A 1L5FA 1PG0A 3FSRA 3MCWA 1I1QB 1N6OA 4CLEA 3HQ4O 4HN4B 2GEKA 4ZVPA 3RASA 2C99A 2ZTHA 3ZPXA 3L1HA 3V8BA 2O05A 5BYKA 5JS8A 5I7HA 4FW8A 3HFSA 2B0CA 2Q5JA 2PHZA 3HHEA 3OM9A 3D5QA 4K9LA 2EJTA 4G6ZA 4YJFA 3WTCA 4ALJA 3PKJA 4OJTA 4URUR 3ZE6A 4AECA 3S3TA 4GMFA 1NQTA 1JXQA 2OBXA 5E0KB 2GCNA 2O1SA 4ZQBA 2ZYDA 2Q5EA 1UP6A 4O4JA 1V96A 1XD2A 4LRXA 4OLHA 4PNHA 3SLRA 1RPJA 2V7EA 4TTSA 2X3FA 3DMTA 1DBIA 1D8AA 3GVIA 4REOA 4BX2A 5ECYA 5ESDA 4D2IA 3RF6A 2NSJA 1XU9A 2Q3MA 4P9NA 1U4NA 4A2CA 5LNK1 1PL6A 5JCJD 1BU8A 2WG0A 4LMRA 3LIIA 1NJ1A 2QORA 3GVXA 4HGOA 3H97A 3GGOA 3KLMX 4LFBB 1M1YE 3HJAA 4B75A 2CUKA 5T4BA 1E3TA 2ZB4A 3LS2A 1GSOA 4OSPA 4CIAA 3OCCA 4OI4A 3F97A 5CA1F 1SGWA 2RBGA 3KYCB 2NVUA 4EI8A 4Q7QA 3OD1A 1LF0A 1NUSA 1GKKA 2ID4A 3CJTA 3EOBI 4JWKA 2C8VA 1NW7A 4JBIA 4QDTA 4QDZA 5E9JA 5EEGA 4C14A 1ODFA 2CE2X 4Y8VA 3H42B 1DKPA 4MICA 3P96A 5AW4A 1HT3A 5K4HA 1VG1A 2IXGA 1KC1A 2H29A 2ERCA 2VQ6A 5AI8A 4D4GA 1QF7A 3PX3A 2DB3A 4G25A 2P91A 4HWSA 3JARA 4ND5A 1LJ8A 2A58A 3K0SA 1L4BA 4UTNA 2EBFX 4WN9A 5DBHX 4P83A 4KO2S 3EC2A 5EVJA 1SH7A 2QMHA 2ZJFA 1E9AA 4UZFA 3ZJ5A 4BB0A 1JDNA 1UP4A 1M7GA 3QELB 4LEIA 2IH4A 4C03A 1CUCA 1YRYE 2PMDA 3OC0A 1X7YB 3BUSA 3QYJA 2R00A 5LQAA 4PPNA 3HBAA 1YJCA 4WZBA 1CJMA 2ZE7A 3BBLA 3S7ZA 2GNAA 1WVMA 4QEKA 1OH7A 4MJLA 1JKMA 1EVYA 3KQKA 1XTRA 3W5IA 3L7DA 4PGGA 1J07A 3OKFA 4R98A 3OTHA 1RRGA 2FGJA 2JFZA 4X92A 5FLKA 4GZ3A 3U62A 4D8TA 8MHTA 3DMPA 4KQJA 1O6FA 1SKYE 4MYTA 4WZAE 1NVUQ 4OX9B 4YIKA 1KRWA 5HMLA 1A7KA 5ALPA 3NRBA 3ITDA 1DC7A 2DFLA 3WP1B 4HDKB 3WQQA 1PL0A 1KDVA 2IU3A 3INNA 1CRWG 1NR1A 3C1UA 3LLSA 4UCWA 2IYYA 3JZFA 3MLBA 4X61A 1H6CA 3HY3A 3CPEA 3QW4B 1N7GA 1J0EA 1S2MA 4X3CA 2CXOA 1CX9B 3A9VA 1P4RA 1TW3A 1CY2A 2IFTA 3NHJA 5CP8A 3MYRA 3VZQA 1D1TA 2GEUA 1E3IA 1CUAA 1Z5WA 1ZH2A 2GN2A 3Q11A 5JDIA 5IS2A 1IN1A 4B7UA 3F6CA 3QMPA 1RBQA 1L9XA 3G59A 4HH0A 1VSBA 2R1TB 1YQTA 2P2SA 5CH8A 1DIAA 2ROQA 1N2JA 2UZ1A 4G1FA 4Q3KA 4YGYA 1RAGA 4C6TB 2BGMA 3RGWS 2VNSA 3TX2A 1QNLA 2O2DA 2C1EA 1Z73A 4BO9A 4D3ZA 3TJZA 4E7PA 5KJ1A 1GXSA 1DWOA 3HDVA 1N9GB 3VJKA 4G5GA 4XD7A 2UU9B 5ERGB 1H6BA 5BWMA 3ICPA 4GU5A 2LD4A 3P9CA 1DFGA 3U19A 3O7MA 4L78A 3THRA 1JDBB 3KT6A 4KO1S 1ODLA 1Z8NA 4F4CA 1H6DA 1XVUA 2FE1A 2C5GA 8ABPA 2DKOA 1VIDA 1XC7A 4G0MA 4NONA 1ULHA 3PRKE 1DJMA 1JR6A 3ZWPA 3BEDA 5GOTA 3H83A 4QTTB 1Y42X 3X2FA 1CZKA 2DOKA 2O4CA 3CT6A 5DCYA 4CCYB 4MYHA 4F2DA 3PUIA 3B2NA 3K1ZA 3A6ZA 4MV3A 1WDWB 4REQB 1NVVQ 3D6HA 1L4HA 2HLHA 5KOYA 1PIWA 2XDQB 3IOYA 4KMOA 4QRHA 3TZHA 4JL5A 1H05A 4DG5A 2HJRA 4A6DA 1QZZA 3P9ZA 2OL4A 4BKRA 2IYAA 3EVCA 5C5CA 1XR3A 3IR5A 2XRFA 2ZRPA 3HKDA 2QRNA 2FZLA 1LJUA 3M6AA 4XSHA 4ZQCB 3RFXA 3T06B 1ENZA 4X8MA 1KERA 1BYIA 1C3VA 4WZBE 2PZMA 4JJAA 4A2WA 5LYJF 3M7IA 3H13A 2RH8A 4YQEA 2WEKA 1WD7A 3PVSA 1A9OA 5CM2Z 1IUPA 5TDHA 1Y6RA 3UN1A 3V4SA 2FN4A 3OZRA 4EGCB 3ADDA 1YS9A 2IYNA 1FBNA 4LXUA 4FR2A 9MHTA 1AK2A 2C83A 2HHJA 1GSHA 2NUBA 2A3RA 2R8PA 3SXUB 1WM1A 1I7QB 3AIKA 4KQMA 4XVCA 4XWAA 2IF2A 4ZAYA 1A9XA 3LC0A 5G0WA 1L9KA 3MSCA 1X1SA 3L41A 3NJRA 5TGDA 2BEVA 5C7OO 2FNAA 3AQ4A 5AUPB 4LGMA 2A35A 4WBNF 4YUAA 5CT8A 3WTBA 3RANA 5DYYA 4IJ6A 3AR3A 1DPGA 3PD1A 1V3QE 2XUOA 3D3EA 4YH1A 1N7JA 4DJDC 3QE9Y 2VJPA 5DHSA 5AW0A 5IWAB 4RNCA 4X1IB 4KVZA 1L1FA 4RIFA 2EBUA 3EAFA 5KDDA 1BS1A 2FSVC 1E89A 3OPXA 4FILA 2IT1A 3KTFA 2EW8A 4EG8A 1RI3A 3IAS1 3ZWVA 2XCTB 4EELA 2EBHX 2C2MA 1Z0FA 5TSDA 2IHJA 5EKXA 1R4ZA 1V4BA 1NVXQ 1QTNA 4FQ5A 1CE8B 1W30A 1J09A 3I2IA 1TK2A 2FEPA 4MGKR 3M3PA 4Q1VA 2CXQA 2NV0A 4IIXA 4RVNA 1A2KC 3UANA 2IBTA 4KNYA 1OD6A 2BTOA 3A6EA 3H9CA 3B6MA 4R4JA 1GL3A 2V7WA 2Y93A 1M66A 1HV8A 1U65A 2R8ZA 2GCOA 2YIDA 3HKEA 3OLCX 3S8MA 4BJ6A 4Q39A 4AS2A 4BGDA 2VYNA 4XQGA 2C4KA 1P7YA 4FHFA 2ZUBA 3F6RA 5GVSA 1D6SA 1GQ2A 5CLGA 1P1CA 1TK9A 4CTMA 1OXSC 3MQFA 4O2AA 1B8OA 4BO3A 1ZI9A 4Q7JB 1S4QA 1L0BA 2YL2A 1R1DA 3PRJA 4GWKA 1KYYA 3O21A 2Q07A 3HPRA 4B6JA 4ECAA 2HBRA 2GFQA 4DF3A 5KSZA 4OGKA 3JWPA 4E33A 2WJ4A 2CT8A 3D7RA 3DL4A 4L3OA 5FDFA 2YC2C 1BXZA 3O1IC 3SLKA 4I6EA 5CGZA 1L1EA 3MJDA 3RS7A 1ORIA 3VPHA 1KVTA 4H31A 1WV0A 3ABZA 3ELWA 3G85A 4E88A 1WZIA 2ZYRA 1YNSA 4RHEA 4YMSA 4ZQFA 4BLSA 1ML4A 2ZBRA 3FA2A 3OQBA 3C85A 4IQ4A 3IT1A 4BO5A 3JQ8B 3U4QB 2C7OA 1HE5A 3PC6A 1NVTA 1T8RA 1YRLA 5JCZA 4I0WB 1E1CA 4MW4A 1QHHB 3V7WA 1U8FO 2DRIA 3FF1A 5I7OA 2FCAA 1JKXA 1VLJA 3PR3A 4J0HA 1NDQA 3PEYA 1VJ1A 1Z2AA 2VJLA 5TLSA 1P91A 1WV1A 1R0CA 4MDHA 4AZ3B 1P31A 3OFSA 2ZM5A 2QMYA 2JRCA 4MLZA 1GZ3A 4P7FA 1UXIA 3PFNA 4KWHA 4P3PA 3V4RA 4C2BA 1B1CA 2FHPA 1XP5A 3QMWA 4OJYA 2ICAA 5HF8A 3S6JA 3UW3A 5KVVA 2Q21A 3CUYA 2PFSA 2C2ZA 2ALJA 1UQTA 4ZOLB 2NPFA 2IU4A 2FHSA 1OA0A 2PGIA 2G06A 5IVHA 3OIWA 2F3QA 4DCNA 2XUZA 4WXEA 4PZUA 4NYIQ 5EJEA 1TLFA 1NSYA 4QXOA 4FC6A 1Y3FE 2A88A 4WCFB 4NEQA 1MENA 5EY5B 3SJ7A 1OOEA 4KREA 3GDFA 1ODSA 1VKJA 5IYZF 4QA9A 5J2TA 2X41A 3GPLA 1T2DA 1BKDR 2YXNA 4OHVA 3EIFA 1GTZA 1R0ZA 2YJ3A 3GUHA 3OLQA 4LDJA 2PAFA 4KAJA 4F9TA 2HQOA 4ND2A 1EPUA 2JAWA 1VG8A 3OECA 1KI3A 3DWIA 3OJWA 2WWXA 3MRSA 4K6HA 4BBPA 4DT1A 4XIFA 1KDZA 3A6LA 4PQYA 1UFKA 3TW8B 1E9VA 4WL0A 2J3HA 2OHVA 4IGEA 1XF9A 3AR2A 2Y67A 2PH5A 4Y6LA 3HKCA 5TGTA 1PR2A 3VSAA 1EXWA 1CK4A 1H5NA 4FOPA 4IIJB 2HIMA 4IOKA 5GIOE 3W78A 1XTIA 1KJIA 4M0EA 4EZEA 4Q4JB 4UC0A 2AXEA 2ZR0A 5LZ4A 3E22A 4HN2A 4F6RB 2GPAA 4WOPA 2J9FB 3DAOA 4Y9TA 3NTOA 2X4DA 2G77B 4CRWB 1ZIXA 3L46A 1Y8CA 2PGJA 3H2YA 4AQYB 1S8FA 4JLUA 1VCNA 1ZOLA 4LYEA 1DQSA 1ECPA 2GTHA 3E1GA 4N01A 2OHGA 2MU1A 2HA7A 4LE0A 5EJ2A 2ZVPX 4BNZA 1E9RA 4NJMA 2GJ9A 2B34A 3GEDA 3IEUA 3IKJA 2YHAA 2H4WA 1XTJA 1AJEA 2VP9A 1SB9A 2ZT7A 2DBRA 2O1XA 3C7KA 5JC8A 5A71A 3SC2B 2QLLA 5CCBA 1GD1O 2AI2A 3A9TA 2Q6VA 1CUYA 2NUPA 1N6PA 3TOSA 4QBHA 1V8FA 3KELA 5FNZA 1A72A 1W2GA 2C04A 3VI3B 2EIXA 1E6CA 3BILA 3L5OA 4MMZB 2V0GA 4WY5A 3NVKI 2QTZA 4UBIA 1RWXA 3AP2A 4HWKA 1NE7A 1A4XA 1DAMA 1Q6YA 4C1NA 4UE3S 4IYRA 1SQGA 3JS5A 2B4YA 1YI0A 4L6CA 4F3NA 4B3HA 3PQDA 4M0UA 4ZO6A 1B6GA 1U99A 1RTKA 2VTBA 1X13A 3G5LA 3KQYA 2VI5A 4RD4A 2PX6A 1NN5A 2BCEA 4PQGA 5ETJA 1GM5A 4PF1A 4EGJA 5GINE 4KEAA 2V54A 3T7AA 3RQSA 4JB0A 4WINA 3VOAA 3W2IA 2IA5A 3HADA 1GSIA 3VAYA 2AOTB 4Y6SA 5IT5A 1OFTA 1RAIA 4MR8A 4F1WA 1LTKA 2O2ZA 4AU1A 4RTMA 2TSYB 3HP4A 4IXNA 4LY0A 5LU9A 1MXHA 3DAPA 4KX5A 5BOSB 3ZNPA 2ZXUA 4XLTA 4M89A 4TMZA 4RBNA 5IJ0B 4KLNA 4MQ4A 4OK5A 4I1PA 4II3A 2P7IA 1N3BA 1MB3A 3ESQA 1SC4A 1V95A 4BVJA 3T0IA 1UXKA 4OB8A 2W2OA 1E6UA 1TRHA 5FP0A 4E2XA 3VNBA 4ZO8A 2ZR7A 2BEJA 2NO1A 3QSGA 1BVRA 4NCIA 2PTGA 4WXRA 2JIZD 5LJIA 2OSBA 4XOIA 4FFWA 1RI2A 2EEZA 4YCJA 1U2DA 5H82A 3P9IA 2G4CA 5TJHA 4CFZA 4X9XA 5JNSA 4ZVMA 3UMMA 2P0AA 2Q0HA 5F7JA 2FZ5A 2XKJE 4BX9A 4ZTUB 2O2YA 3MN1A 3EB9A 1O96B 2ORWA 1C7IA 1QMGA 2BFDA 2WIFA 3I3SR 5DLYA 3WMFA 2I0FA 3QQPA 2B4QA 3JW8A 2Q46A 3EGIA 2YY5A 5DSTA 1JA1A 5B1EA 2G4VA 3TZCA 1HG1A 4RW0A 4EVIA 1Q22A 4FBLA 8LDHA 2CNKA 2GJ8A 4W9MC 5DWDA 4CWAA 4J1QA 3LQYA 3N07A 1P4GA 5IJWA 2FZ4A 3RHTA 1X7GA 1HYHA 4V0LA 4C1BA 1XZPA 3PA6A 3LDUA 3OEWA 2XOEA 3T3OA 2PUHA 2CMKA 5F12A 3M82A 3NC0C 3GLSA 4L57A 3F7OA 2A9JA 2OCBA 2O2SA 3NGLA 4GBED 2WWRA 4MVJM 4A3SA 3GN1A 1W1IA 2CXNA 2Y8EA 3EEBA 5DGCA 3H2ZA 1NQOA 1ZC3A 2CJFA 5AVZA 1CSEE 3KQWA 1P1BA 3UMFA 5IK2D 2GO7A 3P71T 1J06A 2YHIA 4ZRNA 4KJZA 4ODIA 3UAYA 3QE2A 4JOCA 4H60A 5EP1A 3R3JA 4KITB 5HIJA 2CFRA 2X22A 5CCDA 1DOHA 1W2HA 2GK3A 3DAHA 3MJRA 4Q7MB 4QU9A 4TSFA 4HWTA 3W04A 4JI0B 1KO8A 4LJ4A 2FWRA 2QTNA 2FUG6 2WIJA 1A7JA 3IUJA 3ZTYA 4KDEA 1ZRMA 1NN3A 3LRTA 4POOA 4MLCA 5EZYA 1IPFA 1M1UA 1Q50A 1WCV1 3MCTA 2C0QA 1SC1A 5FV7A 3SJBA 3AVOA 3RKUA 1LVGA 2PMFA 4E5SA 2HF2A 3WYEA 4MV7A 4FZJA 4DMFA 2D5CA 5BV8A 4Z4FA 2XOXA 5G0SA 2GN0A 3K6KA 3OJ0A 1AZTA 1J2EA 3IA7A 4FDAA 3DQZA 1JE0A 1N2OA 1KZYC 2FW7A 1R7RA 1GGKA 2P3LA 4Q93A 4Z8XA 1XI2A 3HA2A 4M1QA 3AW9A 1LRJA 1Z0UA 3N2GA 1YWGO 3RVDA 4FONA 2RGCA 1V8PA 5GONA 2MHCA 2JEOA 4IV0A 1XEFA 2ZSHA 4V0NA 2DKNA 3LHDA 3Q5GA 2E0IA 3MHPA 2R5WA 4WE3A 1M74A 5FT9A 4Z4GA 1PGQA 2ZBDA 1XNGA 5ER6A 3SR0A 5D3MA 3A2KA 4KSYA 3PQ4A 3H5OA 1ZZGA 2XZLA 4X1KA 1TTHA 2BT4A 5DRYA 4EGFA 2JFUA 2FRDA 4GOLD 1H5QA 3SZLA 4UXHA 1S2NA 3GJZA 4HB0A 3GROA 2FMKA 3IBTA 2GN8A 2H3HA 2H5EA 3IVCA 3GRKA 3HN6A 2UYHA 3F9IA 2IDKA 3R9XB 4EYGA 1W0JD 2Z5VA 1TQ8A 5P21A 2QX8A 3GRVA 4C4AA 1A8QA 4F3KA 1ONBA 3MB5A 2BDEA 1KYXA 1C8BA 2DYKA 2OFFA 1L7RA 1EE1A 2VS1A 1Y9EA 3TE7A 4R6XA 5AH0A 5BV2P 1D6MA 3GIWA 1QKJA 4P3NA 4PWZA 2E4YA 3AV3A 4QBFA 5FL7A 4ZGGA 2A1TS 4UHCA 3MBOA 3TB6A 3WX0A 5M5BA 4IDEA 3OE1A 5LNK6 2GZMA 2XLBA 3IS3A 4IFIA 3T9BA 4WUTA 3FDZB 4BLQA 1ZMTA 2H0AA 4GSKA 3JQ9C 3AGPA 1GPMA 1M2OB 2YWBA 4MPPA 4MR7A 3T8YA 4Z2AA 1EFAA 2ZULA 3RQIA 3L0BA 4K8RB 4RDCA 3FFTA 1NVKA 3VH1A 3SC4A 5HOQA 4KQFA 2HMAA 4H1TA 2QM0A 2AFIA 3AP3A 1WXEA 4C4ZA 3AP1A 3NIDB 3DVSX 1HT2E 2ODBA 3EGXA 3LVFO 2OEPA 3M6FA 3RVOA 2G82A 4GGPA 5GWXA 3ZZ0A 4GYKA 2QENA 5I7FA 2WA2A 3EFHA 4HN9A 1M7BA 2Y92A 4QT0A 1D0SA 4WLUA 1GQOA 2W90A 1CUFA 3FOWA 3Q15C 4LY3A 5F1YA 5FQOA 3P94A 2F43A 2HDHA 5DYNA 1E63A 3DO5A 3I5UA 3BIFA 4HGPA 2QA5A 1KMHA 3JASA 4NJEA 2CY0A 1L7XA 1TJ5A 2W71A 4FOOA 5FQNA 1XD2B 3C3CA 3TBFA 1NJ5A 5KZMB 1QDLB 1SIOA 5D5QA 4ASUA 2XZOA 3I0NA 3KT3A 3DMTC 4GI1A 1NURA 4TT3A 4Q1DA 1UBTS 4W6ZA 4FPXA 1TAGA 2NPIA 5IXYA 1CBUA 1I7PA 2CD7A 4HQFA 2AF4C 2DPHA 2H6EA 3BMQB 2CHEA 3PKZA 3W90A 2I62A 2PLWA 2NZUG 2F59A 3VV2A 1P2GA 4RL4A 3WNBA 821PA 4RFSB 4FYKA 3R3HA 1WSWA 2PLAA 3GVHA 2AQHA 4UASA 2NVUB 3FBTA 2NVOA 2YVLA 4P2BA 2BAGA 5DXFA 2VDVE 1D07A 4Q1BA 3V7YA 5HM8A 2N75A 5F52A 4ZTZB 4A9AA 1G98A 1UJ4A 3D43A 2A2ZA 3AHIA 1YKSA 1X8KA 1FLNA 1PUXA 3A6DA 1E7SA 2I71A 2JGAA 3EEIA 1FDWA 3JQAA 4HFRA 3V80A 4HH4A 3F2IA 2IHNA 3WA6A 1U0LA 1W0KA 4D99A 2OLJA 3HDYA 3BD7A 3ETHA 5DHPA 1N5KA 4MPTA 4WN9B 2IDMA 2O14A 3B5IA 4GDMA 5CH5A 421PA 1NKTA 4E2WA 4ZCRA 3ZZNA 3I4FA 1FPMA 2QR2A 1HUQA 3G02A 3D8TA 2ZUSA 4ND3A 4D6PA 4G4SO 3RAFC 2QM8A 4ZYTA 3KXKA 1BHQ1 3MVEA 4LCEA 1PJTA 1H2HA 1XX6A 2IY9A 3RUDA 3UHJA 1J1IA 3PA8A 5FA6A 4TMXA 3GP8A 2R751 2PO5A 1O5IA 1QIKA 2DLNA 2CB0A 4XEHA 4YAOA 2OQVA 3AINA 3L7BA 4MVCA 5AOCA 2JHAA 3R76A 4YT4A 1NNUA 3A31A 3A28A 1UANA 3SZ3A 3ZYCA 2C2KA 4ZZ3A 3WJ1A 3WBFA 2ZIFA 2ZRAA 1DQYA 3ECCA 4EK9A 1CDEA 1V7ZA 5JXIA 4LYAA 3UV7A 3WFJA 3GFBA 2C3MA 4ESHA 1QANA 3N75A 2XI4A 1AS3A 1VRWA 4YXWA 5A03A 3PFHA 3AJRA 5DEIA 2AFIE 4MCHA 4Q6WA 4HAWA 4HNHA 1D9ZA 2PX3A 1QQ7A 3ZXUB 1YIDA 2HLPA 3JWEA 2H1IA 5K3FA 4ND7A 4XQEA 2GM9A 3UBMA 3FSGD 5BV7A 3UK6A 2Y27A 4PN3A 2YY6A 3T1YB 2Z6VA 4OATA 4CI9A 3NBMA 2CVZA 1BAPA 4MEJA 3M4JA 1Z83A 3R20A 3KL4A 3LC2O 4W63A 5FWNA 1SCIA 3EHDA 3N6VA 1ZM9A 5JDIC 1TGYA 1MTOA 2J87A 3FLAA 5DNCA 4D9IA 5A3QA 2TS1A 1O8BA 4JYPA 4C08A 4EGAA 1YUNA 4CM3A 3Q6IA 1JLMA 1M6VB 1W48A 2E18A 2GB4A 4G0NA 3TMAA 4Q4CA 1XMVA 3D7NA 3X43A 3E70C 1GXSB 4AQDA 2WG2A 2NQ2C 3CUTA 1B8UA 3FNQA 3RTBA 2VTDA 3MIIA 4K8OA 4RH3A 4WGFA 3TSOA 1LPBB 4TL9A 2PMWB 4B2IA 2J0EA 5JYBA 3K1YA 2RHLA 1UJCA 4FFBA 3EEOA 1RXVA 1PYDA 2JCVA 4CLRA 3T5BA 4Q19A 5IULC 2BM1A 2J4FA 3HKBB 4WESB 1N34B 4JI7B 3RS0A 1HH4A 4YRGA 3TZLA 4FGJA 4AJEA 1FUUA 2OM6A 4HSEA 1HEUA 4WOJA 1GRRA 1T2VA 1KK1A 2GYVA 3CLVA 4C3VA 5EJMA 1AX9A 3GRCA 1P2DA 3F5DA 1X7ZA 1K6MA 4I5IA 2Y66A 2KW5A 4C7KA 4CT0A 5IJZA 2NP6A 5CLLA 5LBUA 3SR4A 4ZDJA 5L3SA 3WLJA 4BYGA 4ZYVA 4XH9B 2FPMA 4CLDA 2QE6A 4ZOLF 2PS1A 3CNEA 2BJHA 4L5JA 2DQKA 1Q1ZA 3ZV7A 3WMRA 1TDJA 521PA 3EYAA 3TIIA 5JY6A 2Z4TA 4RHUA 4JJFA 1C3JA 1SIUA 3PTAA 1Z7GA 2H1VA 3AX6A 5C8VA 3BERA 2XNCA 6Q21A 2HHHB 3E2IA 2OTCA 3VJLA 4BO4A 3IAS6 1MP0A 2WJIA 3QOXA 1OQAA 2JLWA 1E2IA 3RWBA 3AR4A 3EXAA 3NXKA 5EI5A 1UEJA 3LBHA 1E1QA 1UR5A 3FMIA 5ALGA 4F2HA 1MW8X 1PL8A 3LSYA 2QN2A 3GV0A 2C9MA 3GGGA 3PE6A 5GGYA 3SKXA 5MFZA 3UK2A 4JR1A 2RBKA 4I8IA 4WJZA 1FU7A 3WIDA 2C4TA 5BMVA 4CODB 1F2UB 5HG0A 1RXSA 1GHTA 2IV7A 1G4HA 4S05A 1I51A 1W49A 3EH1A 4I6JA 4BCDA 4QYWA 3CZRA 4N54A 3DFFA 2YVAA 4B80A 3SF8A 4DQ0A 4DAOA 4IIJF 4AMBA 4ED9A 1YC2A 2HMVA 1NR7A 2Q5CA 2RGYA 3C4JA 1IN5A 3LQKA 4I1YA 4EG5A 2ZATA 3RSZA 4H0NA 3ZV3A 2D7DA 5JBIA 1BMFD 1SBTA 4RWEA 2UXCB 1OAKA 1E1RD 2PXCA 4K87A 4H27A 2RHDA 4IO1A 4RIIA 4HRYA 4LFCB 2PH7A 1D2AA 2PUTA 4MUJA 3IT3A 1Q20A 4KMMA 1Y3DE 5B3AA 3LG2A 3VR5D 4BQFA 2VZ8A 4TLDA 4HQLA 5IVPA 1WW2A 4B31A 1Z9BA 1J9EA 1L7EA 1PZXA 3CJRA 1YR3A 4KXUA 4JSYA 1GFWA 4NIMA 2F1RA 3LT0A 3VU3A 3TMYA 2IUYA 1Z6QA 3TKLA 2FPIA 3A26A 4NAHA 3ZHQA 1ST2A 2BKAA 3TLZA 3G17A 3FPKA 3H1EA 3MWDB 3NFYA 4YI5A 5IEJA 3KU4A 3FFBA 1WDLA 2D3TA 2IZ7A 4KP7A 2MSLA 2W6ZA 3BRWA 4WACA 4E5MA 3OZIA 3EVAA 4JI8B 4W7SA 1TE2A 4B0PA 4LV8B 4YUYA 2Y0CA 4HF7A 2UVDA 3OLVA 1SD5A 4D9MA 1YAHA 3FUCA 4UM5A 5D86A 4HUTA 5EJ9A 2GCOB 2G9UA 1DX6A 3HKEB 1Y3CE 5JSQA 2UXDB 3R0IA 3O8QA 1ZJ4A 2EZUA 4EFKA 1X9GA 4YFYA 1PCXA 3DOCA 1KZ4A 1Z62A 5HZHA 5GTDA 1SUFA 2E6KA 1ZIOA 5CFMA 2WWHA 4IQ0A 3R0JA 2QN3A 3WGOA 3ZQJA 3CE6A 2CMDA 3QX9A 3MHTA 4INZA 2XBMA 4WKCA 2JVKA 3EZXA 1PEDA 3IYLW 2LVBA 1JHZA 3PXCX 4NZPA 4EWLA 2PJZA 3H1FA 4XX1A 3NT4A 2PX8A 3EMKA 3T7JA 3C6YA 2AR7A 1XZFA 2R6CA 2ACWA 1JLRA 5CLQA 4C87A 1K5DA 4RTLA 3D8UA 1DKNA 2FSPA 2X40A 3QHAA 1JHXA 4M8SA 5A4FS 5CBKA 4FIZA 4B6QA 1ESCA 2VG8A 2H4ZA 2ANBA 3BT7A 1LK5A 1OGIA 5A7FA 1XQ6A 1VP9A 2WNSA 3GX1A 5DLDA 5ARCA 5BYBA 4EY8A 3FPAA 2MOKA 1KFCB 3FB1A 4XWOA 1VLZA 1PAUA 1IBRA 5AI0A 1HQCA 4MAFA 1G4UR 2DR3A 2QUKA 1Z0ZA 4RQAA 5CIQA 1UPAA 4O4LA 5MN4A 1USVA 2X3YA 3U61B 3GGCA 5T8KA 5G0UA 4XGIA 4HNAB 3ZX4A 1SBQA 3LPDA 1OC2A 5EXEA 3EZ2A 1E3QA 3QENA 2XMPA 4IL5A 3QLEA 5D5PA 3OLXA 3RU2A 4CV3A 1VE9A 2HOQA 1XTQA 4MTLA 1G9SA 3MUNA 2P9GA 4A1OA 1G18A 4GF5A 4IX9A 5HQ3B 4YO8A 1X1DA 2BF7A 2VRBA 3BGWA 3VNUA 4DJAA 4OY3A 1K68A 3BF7A 3UJPA 3L07A 5HIKA 1BYUA 3I5AA 3QBTA 5FHRA 3STXA 3ZOZA 4H7DA 4UFOA 4E21A 2V3CC 4HK4A 4EY4A 5DHTA 4LRWA 1N8SA 2ZIAA 2A5YB 2I2XB 4UTPA 3ZK9A 2TMYA 4PLTA 1CRPA 1M5UA 2J7PA 2HWKA 1FP4A 1LXCA 3A11A 1ISHA 5J2TB 3CW9A 3G0GA 1IAQA 3IUBA 3C3KA 3UC5A 1ELOA 4G1CA 4B6FA 4G8BA 3IEPA 5B7GA 5I7SA 3SX4A 4JYZA 4PG8A 1XEWY 5FTKA 3BEOA 1PGJA 3TRFA 3OIGA 4GPAA 4DT1B 1DDOA 3DZFA 4J6EA 2G1PA 1PHRA 2J09A 1CJSA 2WILA 4N3AA 4RMHA 4QM7A 4RL6A 4DV4B 4XJXA 3K0EA 1F51E 3NCHA 3O8OA 3U37A 3IOEA 1DUSA 3GMDA 1DT5A 3O8LA 4Z5XA 1AKWA 1E2JA 1N2ZA 2Z98A 2WVHA 4FKZA 1VL6A 5E4FA 1KAMA 3I45A 2XT9A 3T7IA 4H1VA 3DGFC 2HSWA 3E22B 3PNMA 4HAUA 1NYLA 3D7LA 5AKYA 3RVKA 3TLKA 2DHCA 5FO1A 1GVNB 1Y98A 1TECE 1Z8DA 2L0XA 2MMGA 3NOVA 4IIFA 3NKVA 4WOBA 5DB4A 3SZOA 1QH8A 4KODA 4QVKA 4D3FA 3NNSA 1K98A 2QJFA 1PSWA 2F1IA 1IQUA 2ZIXA 2ZRCA 3QU9A 4Y2SA 1KE2A 5L8VA 5H1YA 3KR0A 3TIGA 3FKQA 3CN9A 2WFAA 3DTNA 3PVCA 4FSXA 1LRLA 3I6MA 1FRNA 4CMJA 4ENVA 1IHDA 4URVR 3WICA 5TQVA 1Y6FA 3HJFA 4XARA 3TN7A 3WA7A 3SWWA 4ZYYA 2Q1YA 2GD0A 5M04A 3ND8A 1VI5A 2EKBA 2PZEA 1FVFA 5NLLA 3JYLA 1FDOA 2HCFA 3RUFA 5JYEA 3OBBA 1IZ9A 5KC9A 2CBXA 1SHTX 4NFLA 4FBMA 2XUHA 1I4DD 2M2IA 3OJOA 1PX2A 3QPDA 4G56A 4LXXA 5HF6A 2H5LA 1H1LA 5EP2A 1OR8A 2QEQA 2QJWA 4DY4A 1S0UA 1B73A 3UT5B 2GZRA 3M5PA 2Z43A 2HJWA 3W9YA 3G0OA 1UWLA 2C92A 2VJYA 3H0EA 1LV8A 1XRSB 4DLBA 1JG2A 4LSWA 3LQQA 1O6ZA 1ZY2A 3TE6A 1T9GR 1EX9A 3G8BA 4ZOBA 4OXXA 1RPAA 3ICEA 3ILSA 1DP4A 2NUAA 2GKSA 3F3KA 2YXLA 4DCUA 3IUYA 4MKRA 4QDXA 1WU8A 3U4AA 1EE9A 2HRDA 3ZX5A 2ZUTA 2Z04A 4RIGA 2YYYA 4JXZA 4D80A 1EBBA 2KE5A 4R8RA 5CR9A 3UXEA 5KNCD 3KDPA 3ZDBA 2E89A 3BGDA 3I01A 2ZT8A 3GP5A 1VKRA 4LC1A 2P4SA 4WLOA 4MR8B 1JJFA 4YRBA 4AJ9A 3MMXA 4UNIA 1VIMA 2QZZA 2Q45A 3C2QA 4X8OA 1T5IA 1PZMA 1P19A 2P6OA 1U5CA 5DN9A 5DOZA 3H84A 3LKBA 1G38A 2UZ3A 2P8SA 2D54A 3UOGA 4F5YA 2RHOA 4JSTA 3CR3C 1NWHA 3H3XA 5IRCD 3IEIA 4BGEA 1YQXA 3LY7A 1Q6ZA 1USWA 5L4SA 4RVDA 3AM5A 3BBPA 4FINA 5A7GA 1U4SA 1W9MA 1WUJS 1MAUA 2QJRA 2XWJI 2O2GA 4Y6QA 3STHA 3M9XA 3RJ9A 3W7BA 3OHSX 2XTZA 1ONOA 3C97A 2CVHA 4MRAA 1E6LA 1SG6A 1T2UA 3FYDA 1KDYA 4DJ5X 1U2DC 1E3WB 1O9HA 4YNBA 3TQHA 4TXMA 1WLSA 3URMA 4D1YA 1AV7A 2CL0X 1Z56C 3D02A 3IC5A 5EKTA 1QV9A 1K06A 2BW0A 2JGFA 3LAWA 3N2ZB 1CUXA 1H2AS 4MUYA 4Q3EA 2YIMA 2AMLA 1AQLA 2WM2A 1QCDA 1YU6A 4KV9A 1E1KA 2BUCA 3OPVA 2CKMA 2N0SA 5ALVA 1CS0A 1LZLA 3VR4D 4Q7KA 3IPRA 5BWOA 1SURA 2O07A 1PF7E 4F56A 4DMHA 5IASA 1U3DA 1ACMA 2QN6A 2B82A 1GAJA 2IVZA 4QO7A 2QY6A 2Q8PA 3LL4A 2GKGA 2AZDA 3GF4A 1H6AA 4D02A 4DHWA 3NHRA 1Y37A 2WABA 4P5DA 3N8DA 4G9BA 3WMEA 2QUZA 4IDQA 1DV2A 3OTIA 5AQEA 5BSVA 2X3UA 2PUAA 2FPRA 2BHNA 2W6JD 3GEBA 1P1HA 1VLMA 1RYDA 1WG8A 1WMEA 1YZLA 2JBWA 3N58A 1KYWA 3RO7A 5JH7A 4OI1A 1BSVA 1IM2A 5KMGB 1BTOA 1UOEA 2QJOA 1XWFA 2C5BA 2RGUA 1UMBA 3IMEA 1GFSA 4HDRB 4LTMA 1OWOA 4MQBA 5EWJA 1X86B 4J3JA 2ZJ7A 3RW9A 3S27A 5EQJB 1ZAYA 2H4YA 1FUIA 1RRFA 3IHTA 3O4RA 1SD2A 3ZYZA 3ELUA 1Z2OX 4RYLA 4XR9A 2XBUA 2OXEA 1OZGA 3T4PA 1GPBA 4Y1RA 4KOAA 2ZBQA 3OY2A 5HS6A 2NUTA 2YBEA 3RC3A 4BRWA 3SE7A 4HGYA 3ADPA 1MLDA 4ZQEA 4HDMA 2CW5A 3ZTTA 1JLSA 3HWSA 2NMVA 2GLTA 2OBBA 4J2OA 3EDMA 4U8GA 1M3SA 1KJJA 5LQRA 4LF4B 2IPMA 4L75A 4OQNA 4TSRA 5GM2A 5HX7A 3MQ4A 5JTUA 1XNJA 1PK8A 5IPFA 2OGZA 3N2GB 2YFKA 2FF5A 1IOVA 2HXYA 1NVVR 4NEHB 3RSHA 1LF5A 3ESAA 1R64A 1IOZA 2V4UA 1BS2A 1QYIA 3BHJA 1W8IA 4QZVA 2G9ZA 1Z5PA 2F9MA 4QARA 4PYRA 4Z1OA 1SOAA 1EH5A 1CEQA 2QLTA 2C8LA 1ZGGA 4GX1A 2RI0A 2VT3A 1RKXA 5BSUA 4WBXC 4EHIA 3CEAA 3WK4A 3KE8A 4R1OA 3IBCA 2Q1UA 3LO5A 1EKXA 1K8QA 2NXEA 2WSIA 1O94D 3FRJA 4CF6A 5CDSA 5EIEA 1XP8A 2FRDC 1LDGA 1ZN8A 2QX7A 2YQ4A 4RZ3A 4DNPA 3OT4A 4BEVA 4RFVA 3VO2A 1XZCA 1WUKS 4ZFNA 2IITA 3F5FA 3HWRA 3D4BA 1LGYA 2QYTA 4TL8A 4HNUA 2E55A 4LJKA 5K0BA 4IG4A 1U8CB 3D6FA 4J0JA 2B2NA 1G64A 1SY7A 3HXPA 1AA9A 2CFCA 2JCXA 5DYGA 3W06A 4DMMA 4RJTA 3H8WA 1WB6A 4QUKA 4MW0A 4IHKA 4Y6GB 1G5IA 1OIWA 5HTKA 2H5JA 3RRYA 3PHHA 5SY6A 2ODTX 4DRYA 1EHIA 3HP1A 5FLXA 3AFMA 1GZUA 2IHBA 5J4YA 3K5WA 3VU9A 1MOZA 4EB6A 4I5GA 5ITSA 1PFGA 3PJRA 2CXSA 4FJ0A 1LQUA 4N3NA 2JJQA 1NU8A 3T94A 1G5TA 2OP0A 2AFIB 2IPXA 4QXRA 4FUTA 3L7CA 3IOMA 2VK1A 4HDNA 2DAPA 2ETXA 3LE8A 1I2AA 3CX3A 1KQOA 2QYOA 1CPYA 4IAOA 4RMNA 3W4KA 2XUDA 2QD2A 1U7UA 3UMGA 4DARA 1RM5A 3DEIA 1DQRA 5C80A 3SQNA 3FWKA 3I37X 4WTOA 1L5ZA 1ZQ9A 2ONZA 4GD3Q 1ZJ6A 4E5YA 1U0RA 2F43B 3B36A 4NJOA 4Q9JA 4ZJPA 3OAAD 3OTOB 4L5YA 4W6QA 3UPDA 3JASB 2O8BB 5KOIA 3C7DB 1ZMXA 3HWWA 2HPVA 3R6GA 2NO6A 2KX7A 4GE3A 1IHYA 3CPSA 3ENNA 4ENUA 1DJLA 1YOVB 2JLXA 3U09A 1XXHA 2CLMB 4WZ6A 3DB1A 1EFUA 2BBOA 1C9JA 5JWHA 4DR4B 1RWOA 1K8ZB 3QU7A 1JKJA 3T3IA 2VLIA 1BO6A 2W4IA 2ZB8A 1BDIA 3NHUA 3Q85A 5DMXA 3ZK8A 5JAIA 1NNI1 1J0XO 4FZRA 4XCVA 1ZICA 2QI9F 4PO3X 3TKAA 3V4VB 3IELA 5K6AA 5F9FA 2OC4A 1XQ9A 1RJ9B 2OFOA 4WA8A 1GV0A 3R7WA 3L4SO 3PGVA 4JASB 3W2FA 1KI9A 4EPWA 2OCKA 3CKYA 1XIVA 2V1UA 4UHJA 5B7NA 4ZRMA 5FUWA 1ORWA 1Y7TA 4RE6A 1KO5A 3UQYS 1QM5A 5GY7A 2OPHA 3ZE7A 1KSFX 3QWIA 4NBLA 5KQMA 2NAPA 4GM1A 2GILA 2PUBA 3TD6A 2C84A 2JCYA 3FNGA 2AFVA 2ZVDA 1II8A 1UBEA 1FQWA 5KREA 3SQWA 2VO1A 1VSVA 2PU7A 2XB9A 3TVYA 1VJ5A 5CG2A 1JFLA 3L18A 3ABOB 4OU5A 4XD2A 3TAHA 2FRXA 2BLNA 2QS9A 1UDBA 2V6MA 5IEBA 1V1JA 3AUYA 2FR0A 1YMUA 4KR9A 5C35A 2CVQA 1CR0A 1P0PA 4IHJA 1E8NA 2XYGA 4G5RA 2WE8A 1PWHA 3PHLA 3ADCA 1NLYA 3CCCA 5MHTA 1PGPA 1AKVA 5E3HA 2AC7A 3P4UA 1VZ3A 2VIIA 4Y2RA 4UBOA 2IEGA 4F6CA 5B7QA 2NU8A 5AI6A 1PT6A 5A0FA 4JLNA 1QB7A 3DT6A 4GPIB 1NMEA 4DCOA 4EHJA 4UQLA 1YSCA 3VU1A 1E32A 1WABA 4F4HA 2AXQA 4BECA 3AJ9A 2H85A 2H8KA 3JVDA 2EFGA 3MJCA 4R40A 3RRXA 3S68A 4AMUA 4B76A 3HTXA 4MUNA 3KOMA 2FP4A 2PXAA 3PGJA 4N6OA 4Y7CA 1QS0A 3KQSA 2JASA 2ZBGA 3PNYA 4MVJD 1MNQA 1EK6A 3KJNA 2H2IA 4GH5A 4PS1A 3R5TA 1ML3A 5LXTA 2UUAB 3DONA 4B33A 2QD5A 5B36A 3FWNA 1GRQA 4U7WA 2R68A 3MBKA 4NYIR 1S96A 1YZUA 3ZE0B 1CXZA 2O23A 1Z75A 2V96A 1NQVA 3I5MA 1JQBA 2R48A 3JWIA 3JQGA 4JITA 3NWPA 1EFCA 1YQDA 1HBJA 1OPRA 2WA1A 1JILA 3HE3A 2JH9A 5DOVA 1BEZA 1U04A 3MYYA 2PQ6A 4ZYZA 5K5EA 1O9BA 1IMJA 2QD3A 5DGHA 2ZYGA 2PSEA 1MKYA 3H3JA 2ZVQX 1PJAA 4MIKA 1SUEA 1Y5MA 1COWD 1RU3A 3VVCA 3S44A 3G8AA 5EKSA 5JI2E 3MCUA 3QVMA 5JFGA 2BPOA 3ZHCA 2P3OA 5IZCA 3SP1A 1BMDA 3AHHA 2X76A 4PLZA 1XMQB 1AVTA 4RQUA 2AFHA 1WMDA 2FDXA 3DUFA 2GLXA 1TJYA 4A4DA 1NMXA 4OJQA 2IU0A 3STUA 2GEDA 1T9CA 1YXMA 2POQX 4MB0A 1RAEA 3I1IA 4XA8A 5J63A 1C0EA 1ZOPA 1LFAA 5T6BA 2OA0A 4F38A 5KUTA 1K4YA 3P52A 4GSYA 1RI1A 1E79A 1Y4SA 1MX9A 4LX0A 3NVDA 2VTVA 3KSRA 4X20A 5EE5B 1KY5A 3ZOKA 4ID9A 3QTLA 3FUUA 4OUKX 2LUOA 16PKA 3NU1A 4LZWA 3I2FA 5L4LA 1DEXA 2R7NA 2ZUUA 2EIHA 3ICQB 5TEVA 3W3AD 4XGNA 4MPJA 3F0TA 5LLSA 2FFBA 1JEEA 3E3MA 3ZD7A 3ZIDA 2A33A 5HGJA 3GA7A 1DSSG 5GAJA 2W43A 2AUNA 3KVVA 3O90A 1G5HA 4PHFA 4RY8A 1DAOA 3NNDA 4G24A 4QJ4A 4RGQA 3OPYI 4NZZA 3EXHA 3ZDXB 1QHFA 1BE8A 4C89A 1SXIA 3MGBA 1O0CA 2QKYA 3EUWA 4L9RA 1FPQA 5IKPA 5KQRA 1K6XA 1H9AA 1KEPA 2EOAA 3K71B 1H1TA 4HEA6 3DV0A 2GM3A 4TYPA 5J2TF 4YJHA 2I7VA 3VR2A 4NBRA 1HE4A 1O97C 1LZKA 4ZO7A 2XGSA 2JIZA 3EDOA 3HVKA 3STYA 5KTMA 3P0JA 2XRYA 4AICA 3KWLA 3OZXA 4OKNA 3V46A 3KVNA 1SVSA 1D1QA 3UWSA 4AMGA 1MC8A 2GZSA 5FUYA 1CEEA 4FZ3A 3TL6A 4CM6A 5TPZD 1XZJA 2A5LA 3U5TA 4YPFA 3O9ZA 5LN1A 3SF8B 3VUFA 2O7QA 2VYVA 4DWOA 3KDAA 5AXCA 5LOVA 1LPMA 3EQ2A 5EERA 2GNPA 1E2PA 3EA4A 4P3XA