4XVOA

L,d-transpeptidase from mycobacterium smegmatis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
TPVEVAQVEPAAGAVVGVAHPVTVRFAEPVTDRRSAERSLRIASTDTSAGRFRWPEAAVMEWTPDEFWPAHSTISLSVGGVKTSFNTGAEVLGVADIDAHTFTVSVDGEVLRKMPASMGKPKFPTPRGTFTALAKEPVVVMDSRTIGIPLSDPEGYKLTVNHAVRVTWGGVYVHSAPWSVGSQGYANVSHGCINLSPDNAAWYYDMVSVGDPIIVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L,D-transpeptidase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords L,D-transpeptidase
total genus 49
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4xvoA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xvoA01
4QR7A 5DVPA 4JMXA 4QTFA 5DC2A 3TURA 4A52A 5DU7A 4LPQA 3U1PA 5E1GA 4XVOA 4HUCA 3ZQDA 4LZHA 4A1KA 1Y7MA 5LBGA 1ZATA 2HKLA 3VYOA 5E5LA 3TX4A 5DCCA 3VYNA 3ZGPA 5E1IA 4ZFQA 3ZG4A 5K69A 4GSRA 4K73A 4A1IA 4Z7AA 4QRBA 4JMNA 5DZPA 4GSQA 5E51A 2MTZA 3VAEA 5D7HA 4QRAA 4A1JA 5DZJA 5LB1A 5DUJA 3VYPA 4GSUA 4HU2A 3U1QA
chains in the Genus database with same CATH superfamily
2JB6A 3TH4T 1UHVA 4N8VA 2E6PA 1GAFL 4R2GD 2C7UB 4CVXB 1H6UA 1XH1A 1XF4B 3UCRA 3MXWL 1QSEE 5JR1L 3ASNB 3FH5A 4UQDA 3W39A 5DO2D 2ADGA 4LFHD 5IHUH 5SWZE 1HCVA 1QWHA 3MX0B 3OHXC 5IK3A 3N6YA 5I1HH 4P5KB 5AB1A 4TTDD 2Y23A 5GRUL 2M2DA 3IE9A 2C3XA 4PJ5A 4GSUA 3MRMA 3WFEL 4KDTC 4EXPX 5L9DL 2P24A 4LOVA 5LHDA 1I31A 1R24A 1NANI 5D72H 5B39B 1ZVSA 1I9EA 2VN6A 2AW2A 5TF0A 3EYQC 1T2JA 1T1ZB 2JB5H 5FFOA 4DPRA 2NY2D 3F3HA 3GGWA 3MFGB 4Z7OE 1N4XL 4JKWA 3U4EB 5FPIA 2D73A 4HUUB 4U1HA 5L8JB 5J6GB 4M8QA 3HZKA 2TSBA 4LSSL 5DHYB 2J55A 3HI6L 1FFPB 3H1ZA 3CQFA 3ESUF 4UQEA 2NNAA 1QYGH 1A64A 1IKFH 1Q72H 1N6UA 4V1DA 3Q3GB 4GXFA 4ZPVA 3BZEB 1JRHH 1J9QA 3D85D 3VG0H 2EYRB 4WHYH 1NC4D 3SGEH 4YDZA 3M6DA 2XXCB 1MOEA 3RB5A 4TOYH 2XWBA 3GSOA 3NA9L 4MD4B 5JQ6L 1ACXA 1E5YA 4AI7A 5FDWB 3RQ3A 2Q7NA 2QJDA 4WW2B 3PP4L 3LS4L 5K39A 4PJBB 5F7LB 4ALAL 5IM7B 4ESKA 3GIVB 1UJTA 2JCWA 4F7CA 1CDJA 5CLZA 2GIYA 3APNA 5C08D 3K6IA 2ZX7A 5AL0A 4DO4A 2AJ3A 5J6SA 3X3GH 1FVCA 1JD9A 1MRDL 3NACH 1BZQK 3MSPA 4U6HA 1NMBL 2ZP9A 1KCSH 2ALAA 5K93A 3C60B 2DQFA 3LZRA 3SPJA 4X5XA 3V0GA 4Q58C 3V2AR 4MQXD 5AD0B 4QRTA 4AG4L 1NBZB 2WJ5A 5GRXG 3KPSB 2CO7A 3NFNA 1QHOA 1UC6A 4JANB 1PDKB 1Q0EA 2XXFA 3GWJA 3MX0A 1H0DA 3NPSB 4K0OA 2ID5A 4J2XA 2R1YB 4UV4H 1DQKA 2FSEA 3HJ0A 4GO8A 1OWRM 4IBZA 4LVNC 5AKRA 1E7VA 4MS8C 3APFA 4JDZB 1CYGA 3PWVA 2GT9B 5ITFA 3BPLB 2WZPD 2O5NA 1UGKA 2BP0A 3GPEA 3ZDZE 2FHBA 3VXQA 5LBGA 3FTSA 3ULAB 1MFAL 4PS8A 5CEXB 3DTXB 1IGFL 3IJHA 3PDGA 5D7EA 2G3NA 3RTQD 1OL0A 3TIEB 5K9OA 5LKNA 3Q3GA 3IJ7A 4AGNA 4AIXA 3EYFA 3Q8EA 3QC6X 3P0YL 3TNMA 1UG9A 3VI4B 1L9MA 4Y2LA 5CGMA 3TBVA 2AQQA 3SN6N 3K7UA 3LKRB 1AH1A 1EPFA 3D50A 3HZKB 4LO9A 4F58L 4X9YA 1ZLWK 1NGXB 3IXTA 4PCYA 1U93A 1PFCA 3LXCA 3PWLB 1MW3A 5DA4A 4HHAB 1LWJA 4RAUA 2MJWA 3MRPA 2ROXA 2AAVA 1SXCA 2APFA 2YD9A 2NYKA 1BQHA 4EN3B 1YYML 4XN7A 4F7PB 5JW5A 1UM5H 4AE1A 1S7XA 1JVLA 1QW8A 5I6XC 1XTLA 2Z8SA 4HEPG 1B4JH 4N5ED 3OG6B 4PJGA 2ICWB 3TCLB 5A2IH 4N1CA 1OPGH 4K7PY 4U1LB 1PDKA 3OSVA 4KHTL 4YUEH 5JMRA 1ZHKA 3ETBJ 2HFTA 3O3DA 1JWUB 2EIBA 3IM1A 4O5LL 4N2MA 5IP4A 4XN8A 1I9JL 2G75A 3EO9L 4DP0X 5DQDH 4BK5C 2RA1A 2JSFA 5AYUH 4M1CC 1EBAA 2D3LA 2FECL 2ZWYA 2WNWA 3LSOA 4JX0A 4PJ6A 1IC7L 1UOVA 5JW4R 5E6IC 2PXYC 5JIHA 5EUKA 5L2KE 2LHAA 5EA0L 4JFEB 3ZT7A 2WANA 5GJSH 2B7DT 3TJHD 3AXLA 1AFVL 4KDTA 3EBIA 5BXFB 3B9VA 5EH1A 2PTVA 1MY7A 4LSTH 3TBCA 3VGDA 2YGOA 4NB7A 5CJOH 2G2PA 1E2VA 3ELQA 3WYRA 4RGNC 3OD3A 1E9PA 2C3VA 5KS9B 1G5AA 2BSBA 3ARDB 2XICA 4MA1B 4HETA 2ENSA 3W57A 4ZUSA 4ZYKA 3WTXA 3VXQB 3ZTJH 1D9KD 1C16A 2I85A 3KPRA 3PE9A 5TTRA 1L6PA 4N2CA 4A7QA 2YAOA 1LWRA 4LASL 2FUTA 3SD5A 4HJEA 3L3GA 1F11A 2Y9RT 4JRXB 2OS7A 1VFOA 2JI3A 2VDNL 3BYTA 1MCFA 2YD8A 4GBXB 5BJTA 4NSKB 5I1IH 2P24B 1O9VA 4GSDH 4MS6A 2R1XB 4MMZB 1DSYA 1MLBA 2NZ9D 2VSMB 1TU2B 4YDJB 1CG9B 3LX9A 1JPGB 3H85A 4QRQB 2COVD 3HCVB 1M7UA 1NFKA 5KEZA 1NGPL 2WXQA 5KJ7E 4N8CL 1NGPH 3EGDA 3WD5H 4X4YB 4POZD 3S35H 3EJPA 2DBJA 2W0LA 1IARB 4DN4H 4J27A 1O9ZA 4NRXB 4AL8L 2ZXAA 2ITCA 3QG6B 1PYWB 1E4KC 3ZHDA 1IQDB 1TLKA 3ETBF 1S7XB 3T2NL 2OMWA 4K3DH 3ETSA 4BZ1A 4QXWA 5FA3B 4P3DA 1I1FA 4JBSA 3QUGA 4TUJB 3FQNA 5FO9B 1H3PH 4OZ4A 1WUNT 1Y6MR 3NP4A 4GQ9L 4XP9L 4DCQA 1I1AC 2F58H 1P4IL 2MCPH 1KPRA 2AJVH 4NQDA 3RGBA 2FDBP 4G6FD 4KI5C 2VR5A 4MRCA 3P9MB 4YXLL 4ZW6A 5FDWA 4H8UA 2VXSL 4J4PD 5KBLA 3RDTC 1LEGB 5AVUB 4NQTA 4DPCX 1A3LH 2WINA 4U05A 2XXGA 2WYTA 1HSAB 1J8SA 1F58H 2CRMA 3J2PA 4ACPA 5I1DB 5GS1B 3II3A 1WGOA 2ZCLH 3CN2A 1RZJC 3REWA 1F3DH 4J7RA 3VGHA 1Q4NX 4X5LA 1TEYA 4MNQD 3PWPB 1AKJD 4XNQA 1LE5A 1H3VA 3NZHL 4ONHA 4KO7A 4LIQE 1K4DA 3LAFA 1P69B 2G30A 1SYSA 3VCLB 5ILTL 3FONB 3FL7A 4OZHA 3FCBA 5C7ZA 3LVEA 3AWFA 3WS6A 3ZHKA 3ZT6A 3H9SD 5E95B 1DQQB 5LNGA 3CWGA 4QHKI 1PG7X 5E51A 3FTZA 3EGSA 4KNQA 1IAKA 4P5TB 4F91B 5EU5A 1LO2H 4MNGB 3MODL 1IQWH 5IOPB 1GY1A 3L1OH 4P23D 3L6FA 2NY4D 2AEQL 5L4FA 3QDAA 4A1KA 4ZFZB 5DS1A 3UO1L 1UUSA 2E8YA 1IUZA 5E6ZA 2I07B 3U6XA 3ZRFC 1J05A 1IKNC 2K8MA 3OZLA 3O4LD 5ESQB 2YRZA 4N90D 1E5AA 2DH2A 4JO3L 2G5BB 1IC0A 3HN3A 4QAWA 5D7JC 5IB2B 3U30B 2WLYA 1ICTA 5ADOL 3CSPA 1AO7B 3EUDA 5I75B 3BO8A 2YMXH 4G83A 4QT5B 3BN3B 3GYRA 5I1LB 3GXDA 4JGMA 5E56A 4PY8J 4MDJB 4QXUL 4WEUD 3N04A 3RY6A 3TO4D 6FABL 4NQDB 3KYNB 4RBPK 1DVXA 1BFTA 4HOMA 5FYJH 2VMJA 5HHOD 3FRUB 5DUBB 4F7MA 1TT6A 2OK0L 3QRGL 3OKDA 1UA6H 3PWUB 2CXGA 4M1GH 5J89A 1JPST 1BBDH 2NDFA 2RQEA 4FQPA 4KDWA 3LH2H 4C56B 4XTRD 4ZBJA 4YN3A 2H3XC 3EF4A 3M7FB 4IDLA 3QARA 3C5SA 4YLCA 3F5WB 2AJYH 4JL2A 4HF5L 3K2UL 3TLRA 3U6XS 1QKZL 3RX8A 3B2VL 4HGKC 4OD3H 3VYOA 1KCSL 3WKYA 1P4BL 1TJHL 4MNGA 4N28A 4R90H 5TPWL 2YGPA 3WFDH 2WOYA 5T3XL 1YNLL 2GUOA 2FBRA 3JV4A 4HXAH 5MEQB 1XIWA 2QVMA 3HG3A 5IVXE 5I30L 2DYPA 4ALAH 3BWSA 1CFSA 4BZ1H 5E5RB 2ITFA 4N0YL 4FC3E 1FG9C 2Y7MA 3JVGC 4AZ8A 4MX7B 5JXAL 3O11A 5T1LD 4C59B 2VO5A 3TPKA 3HW7A 1B2WH 5D7JD 1ZHNB 1JG9A 3ME0B 1CGTA 2VDPL 3APDA 3FHAA 4OLWL 3RY4A 1NCDH 4PJBA 1IFHL 2J20A 3KPRB 3MRNA 4JFDB 4WEBH 4BJLA 1TF4A 2EVFA 3VE0B 2X4RB 5J9PB 4OFIA 1T5WA 1TVBA 1L5GB 5HJ3A 1UXWB 4NQEE 1VSCA 1YUKB 3OKLB 3NMEA 2ESVD 4JY4A 5HHOE 4FD0A 2ZSVA 4JHAL 2EYRA 1SY6H 4EBQH 2BOLA 3F65A 5DMIL 2VDLH 1E27A 4G8IA 4ODBD 3C87A 4U1GC 3SO3B 4IRJB 4B95C 4UT6L 4ZFGH 5E2UL 2P8PA 3T8VA 2G4EA 1TMCB 1T20A 4XN5A 5DJZA 4UTBH 3HI5L 4KMLB 1MFBL 1OAQH 2NW2A 4PTTB 5TJWK 4EUPG 4ZFQA 6CGTA 1A1NA 1IGTA 4Y7MA 2J4WH 1WZAA 1KGCE 3HAEH 2F08A 3X1BA 1U3YA 1XGTB 1IC5L 3NZUA 2ZG2A 1NCHA 4DT2A 2XOTA 5B1BB 5DK0A 2W8CA 4N1HB 1UOKA 3Q44A 1VACB 2KPWA 4E5XB 1J1PL 4QRTB 4DGIL 2HH0L 3U7YH 5H4YA 2BLFA 2E9GA 1CN4A 4UZSA 4C54A 5ES4B 3K4DA 2VZSA 3VA6A 1XH0A 1DQLH 4CNIA 1XL6A 2E9IA 2LLLA 1U2CA 3LEXA 3BIAX 1MG3C 1PZUB 1NGXA 3ZIYA 2EACA 4KJWD 4DGIH 4M48L 5IJKA 5F0PB 3D39B 2PO6D 5SX5H 3SD2A 1CFBA 2YK1L 1SYVA 3SO5A 2GBVA 2ZKMX 2JJWA 2K8QA 2V2XB 1T1XA 4O2EB 5LCVL 3US1A 3VFPA 5HJ3B 2KC0A 2B5IC 3BPCB 3QEGH 1HHGB 5B8CC 1AI1H 1V54B 1P5VA 4WRLA 2VH5L 4AQZA 1WLHA 1CU4H 3QNXA 5CCKH 5I73C 2X4QB 4FNRA 5ADPL 4HK0B 4XBMA 2IPUG 2G3ZA 1OARH 2BVQA 3SE3A 5CU5A 3L9YA 4A2LA 3HB3B 3UZQA 4ZFOL 3VXNA 1Z32X 3DSNA 3TA3B 3ZL4H 4EF3A 4BUHA 1RFDL 1XT5A 4FYSA 4JFHD 5EBLA 4LPCA 3Q7JA 4R84A 4X9BA 3EOBA 3MBXL 3NJLA 1NSNH 2H3NB 3QQDA 2FO8A 2EXWD 1IKFL 4FXTA 1E4XI 1HOCB 4M93B 3EGXA 4D0CB 1SMAA 4PJGB 2Q76B 4ABWA 1ZK5A 2B1HL 4PWJA 1JNHA 4TQEH 4MZ2A 2J1XA 3D0LA 2O5ZL 1DO6A 1ILUA 1Q9OB 4LPTA 4JGNA 5F1KC 4FTVA 43CAB 5AVXB 1AIZA 4Y89A 1S7SB 2OYPA 1QR4A 4YPGA 5GGSA 2EINB 3QORD 4K5PA 2ALWA 4ZTEA 4B9GA 4WKZA 1WH0A 3SPGA 4RWYL 5DJDB 5J3HC 1JXJA 1FYHB 4M7LL 4Q2ZB 5I1LA 1U91A 2HTKD 4EZJA 4B97A 3BMVA 5HVFB 2BNRD 5J56B 1Z0MA 2VUKA 2V9RA 4AC2A 5HHXL 3WFDL 4GH7B 3DVGB 3H0TA 4Y5VC 1KYOJ 1XX9C 4PJ9C 4BCZA 2TAAA 6TAAA 4U1SA 5H35B 3VFNA 1BP3B 2WJ7A 4L3EE 2A9MH 4AJWA 1YEIH 1O7DE 5LGJB 5F3BB 4HKBB 5SV4A 1HJBC 5A7BA 3OJVC 1LNUB 2AXFB 3KEHA 3FSAA 5HYJB 2ARJB 2CGZA 1YNTB 3MR9B 2AXGB 3MRHA 3U9WA 1XHHA 4OM0H 3D2UA 5HY9A 3S3JA 3U4BH 3D52A 4N5EC 4KZEL 2W9DH 4NQQA 3BPOB 1G4MA 4B9IA 3VYNA 4JKLA 2VJ0A 1E2ZA 1HH9A 1Z9SB 3B2UC 4OFQA 1W0VB 1S7QA 3ZZ1A 3HFML 3RWCB 4GPVA 3V6BR 4Q0XH 5EOQH 1P7QB 3VVWA 5IQMA 2K70A 2YMXL 5KANG 4X4YA 1AP2B 1KTLB 1KEML 4PV8B 3QFJB 2JF1A 4K9EL 2R0KH 4Q9CA 1G4RA 2D7QA 3O3AB 3TEXA 4Y4KD 2H0EA 4HS3A 3HG1E 4J2QA 1HL4A 1YEFH 4M62H 5HYEA 1RK1B 2SEBB 3VFUA 2FT7A 1W16A 1UWEL 5EU7E 2BNRE 2YD5A 3CVHB 3OAWA 1X5YA 5TDPA 2K6YA 5MEPA 4Q6IC 2OI9B 2DM7A 4APXA 4CVXA 2I5YL 4J3OH 5H37H 2OSLB 2B3RA 4CW1B 1BD2A 1ILSA 3UBXG 3HC0A 4IRJD 1PNDA 4WJ5B 4XP4H 4L3ED 1PAMA 1REIA 2X89A 5FW6A 2VSDA 5FM4A 3TBWB 4F80A 3I6SA 1T22A 4I9XA 5IMMB 1OK0A 3LYRA 4QY8A 5IQLA 1KJ3H 1MW1A 3K1KC 4WY7L 3A6OA 1K4CA 2W94A 4Z77A 1U3HA 3DX7A 4P9HL 1VGEL 4MWFB 2DZEA 1V7NL 3VFRB 2P8LA 3RKDC 3FSWA 2YMOA 1XD1A 5IESL 5BV7B 4BEIA 3ARPA 4NAJA 3DV6B 3L5IA 2O30A 3VYPA 2F5AH 3S9DB 1CICC 1X9LA 4IBSA 4DTGL 3DX0A 3ORJA 3SKMB 4F8QA 1BF2A 4JN2B 1MHPL 3LKNB 1JJUA 3GSRB 3WN5C 3VFVA 2DY2A 4Y1SA 2XT1B 3MRCA 2PF6A 3CZEA 3S4SA 5I16A 3SJVE 1MCNA 4XO4A 3VH8B 5I9QB 3GHEH 2B16A 4PJFB 4ZXBD 2GSIB 2WKOA 3BAEH 3ZDXB 5E00B 4K94L 4KK8D 4EPSA 1H5BB 4X4XA 1KV7A 4KKQA 3RVVD 3BDYL 2BHUA 4PREB 3OR7A 4AYBA 1U95A 2DEWX 3V5KB 2R69H 1KPUA 3KWWB 5B39G 1KJ3L 2C5DC 1RV6X 1S3RA 2IFGA 3QNFA 1YN7B 4ZTOH 4WCYL 5EOCJ 3SDXE 3T3PB 4B41A 1Y0LB 1YEDB 4GQRA 2X44D 3EJZC 3QJQB 2CCLA 2UZIH 1BXXA 3SDYH 3LDBB 3VI4F 1TYJA 1HXMA 3FCSA 3TBWA 1T21A 5IMMA 3W0WB 4LSVL 1VB9A 1UGNA 3BUDA 3GSXA 3ZKNC 1W91A 4CW1A 4GFXA 4JJHA 3BGMB 4LLUB 3PWVB 4LKXB 3G6AB 2EDNA 5IBUG 4E42B 3D0AA 3T65B 1Q94B 2H1LM 2DQMA 5MEQA 3PPEA 1X5HA 5E4OA 1LTXA 1SDDB 1VZHA 2ZPKH 3I75B 5E2TL 5CBEB 1M71B 3QAZC 1NLBL 1QSVA 1XGPB 1ZV5A 3FAWA 4KITB 2EZ0D 1W72B 3C5SB 2UXTA 3B9KB 4E41A 5I76A 2BP5M 1MVUB 4Y4FB 3OR6B 2BERA 4DIXA 2LLGA 4AE0A 4UM8A 5C0AA 3FSOA 1ZSDB 3IDNA 3HC4L 5K9JH 5EF1A 4L1SA 4MJHA 4PJFF 4AY0A 2I60H 4ODTL 4P46C 3QO1B 1XGYH 3NH7H 4IBQA 3DGCR 1O9WA 1AGDA 4M43L 3R7RA 1BMGA 3FT4B 4FFTA 1KIUB 5AOZA 1N7MH 2CHZA 4TMPA 2GHWB 3QULB 4TSBL 5DZAA 3AT9A 4IEFB 4X50A 1AZZC 2EH7L 3KDMA 5CJXC 4O2FA 2NNFA 3T0ED 1LO4H 3NCFB 2XWTB 3ZE0E 4HYTB 1EGJH 2RFXA 1MREH 5EZJA 1UXWA 1HC1A 5FR3A 4HGWA 1KTRL 1PSKL 3AY2A 1TJMA 4Q89A 4UYPA 3QUXC 3MI6A 4OIIH 1LILA 3FO0H 2WLLA 3OF6A 3BDYH 3LSOB 2K3TA 1UQSB 4I0CC 4ADIA 1DVFA 3DHMA 2Z7UA 3MU3A 5KVGH 1JPEA 3DYOA 1FYTB 5BOZG 4A6YH 3JWDH 4H88H 2XXMB 4UM9D 3GZKA 4ZDHB 2DKMA 5DVKA 1XGUB 2VZVA 1L6XA 1LP9F 2VSCA 3WHXA 3IU4H 4NNYB 1U8NB 4WU7B 5T3ZL 4Z76B 1W72A 1FSKC 3L16A 3FU5A 5E6YA 4NRZB 2A9NH 4PTUB 1WFNA 5CD3A 2FR4A 5C6TL 4PG9B 3LN4B 1OM3H 1FC2D 2XWRA 4CSZA 4KOCA 3K6OA 3JXAA 1KN4H 2Q86A 3SDAA 2BNRA 5AVZB 2EEBA 2O5YH 3IMSA 4R4BA 3S7GA 4S1RH 3UP6A 2FJGA 3NQKA 2A38A 5CEYB 2X2HA 1CDUA 5CS7A 1XXFC 5HP5A 4WY7H 4PJEE 2EO1A 4RMBA 2XRAH 1M05B 3PWPD 4XXDA 3KH3A 2QVTA 3NA4A 3STLB 4OM1H 3IAGC 1FSKB 1NGWB 3HAEB 5E99L 2R2EA 2FECI 3QXUA 3FTUA 3HR5A 3QHFH 5IHZB 1WV7T 1KN2H 1KTBA 3MLPA 2UVFA 3I9IA 3MYJB 5AZEH 4ANUA 4ZUWA 5LCVA 3JWNG 2CJUL 3BPCA 3IETA 1FLRH 2YPLE 4KY1H 3T08A 1RZKC 3QULA 4XMLL 5C08A 2Q2EB 2X87A 1CC3A 1P7HL 4H1LA 3FUHA 3AW5A 3F7YB 2PPFA 4DPAX 4F3FB 4YAQB 3PP4H 3RWHB 1I8AA 1F2QA 1YEEH 3FF8A 3UYOD 3WAJA 3KGTA 5EO0A 5T5FA 1ETZA 2HG5B 2FWUA 4JFSA 4JHWL 3OQ3B 3FB6B 4D9LH 1E4WL 1JN6A 4O58L 3BUYA 5C0DB 3NFSL 3VSUA 5I66B 4M4RA 1FGNL 2XVLA 1KZQA 7FABL 5F6HI 3LRSB 2FATH 4MJJA 2OMTB 4P9ML 2BS9A 5DC9B 2ZXWB 3F58L 2JNZA 2YD4A 3QXTA 4L8BA 2EDJA 5AAWC 4ZNEE 4WSKA 2OTWA 2DQHH 2J6WA 3B9DA 3HNVL 1INQA 1F90L 2CG9X 3GO1H 3G6DH 4JFZL 3BE1H 3PWPE 4JN1L 4RH4A 1G7PB 1MSPA 2ZXBA 3WFCH 1K4DB 1R5IB 2AQSA 1KNOB 3KL0A 4H26A 5F7WC 4BSVB 1CTNA 5D7LA 1JI1A 3SDDB 1RK7A 4N2DA 4NM8H 4F2FA 3IWUA 5B4MD 1I1YA 3QJHB 3HR5B 4MSWB 4RSYA 3P4OA 5EOTB 4KMTH 5KJ4A 4YVUA 1YY9D 3S8GB 4LHQB 4JQVC 1WCBA 4F1SA 3OKYA 2ED6A 1PW3A 3KLKA 2Z7WA 3PNRB 4OFVA 1T1WA 2Q2LA 2IANA 4PLJD 4PHZA 1L0XA 1NKRA 3OKOB 4XXCC 1FFNA 4ELKB 3AM8C 1GGTA 4ZUVA 2OL3B 5JA8B 3ZGHA 3FDWA 3H9SE 1Q0XL 3V0FA 1I7ZB 1RZ7L 2YJLA 3NESA 1RMFH 2G9HA 1UACH 4PP1C 4A1IA 4LBAA 25C8H 2NY1C 4QMEA 4FCAA 1ZA3B 4U1HB 4WFEE 2PTTB 3LY6A 2C3GA 2WNGA 3Q13A 1JPTL 4NT6A 4UT9A 1MI5B 1Y1DA 1GW6A 2QADD 3GHPA 2UY6A 5F9OL 1EEQA 1JCVA 5CP3H 4P0DA 3OGOE 4A6YB 4NDMA 3FHEA 4PRPA 1NL0L 1VFBB 3LRHA 1WAAA 2CUAA 4O9HL 4B3EA 1DJXA 3K3QA 2KHAA 1ZT4A 1OQXA 1T0MB 4B60A 3KJ6H 4AEIH 3AITA 3O4LE 3ML9A 4X5QA 3VWKD 5B4MC 1MHEA 4TTGA 2AHIA 4WW2A 1TIUA 1XAUA 3IJSB 1GGIL 4RZCA 4Y4HC 4FMVA 3L3IB 1LEIB 2CU9A 1U3HB 3DX7B 4XWOC 2RFXB 4PRIE 4DGVL 4MNGE 1RSFA 1OAZH 1VZIA 1NC2A 5JO5B 3EYFB 4Y7OC 3UTZA 1D5ZA 2IADB 3VI4A 4LOFA 4FULA 3A6BL 2VMDA 3SE4A 4XVSH 2YARA 4R96A 5GJTL 4BK8A 3WGUB 3OB8A 1BEXA 5E9DE 3U0PA 3RGVC 2PR4L 2KUTA 1TZOA 2X4SA 2Z64C 2BSED 2VUOA 3GINA 3U79A 3ARZA 3D3VD 4ODSL 3KPPA 4MD0B 3WFCL 3AG2B 4QJ4B 1GOGA 3LMJH 2IEPA 1HQ4A 3V0WH 4FX5A 5MEOA 2LE9A 2UVEA 4F2MB 2R2HA 4CC1A 4EEEA 3BSZA 4J3OG 2YHGA 3FO0L 5H37G 3T6QC 2YAHA 2YA1A 1MPAH 3L4ZA 3QCVH 3SY0A 2DJSA 1NUGA 1ADQL 1GJIA 4HJSA 4NS0A 2XA8H 1R3HB 1UCBH 2A77H 1PIGA 3N85H 1AQKH 4Z7VE 4DERA 1CPUA 3ISRA 4NRXA 4XPGL 4L0YA 4CRPA 4NNPH 3NZSA 1G7HA 1NCBL 2RAMA 3PQYE 4DQOL 2E56A 1KXTB 1T0OA 4U3SA 1SRDA 5FYLE 5GPRA 35C8L 4OT1H 3BH4A 5TGBA 2VDRL 5DT1L 1T20B 4PRID 1QFUL 1BSIA 7PAZA 3T09A 2ZUUA 5CGYC 1TZGL 3PQYA 3MYJA 1FG2A 4E41D 5IG7B 5K9KA 3IETB 1TXKA 5F96L 5EO9B 1WC7B 5DGQA 3CDYA 3F83A 3VD5A 1DVUA 1D5ZB 3C8KA 1ID2A 4PBVC 2WXOA 2WINB 2QZQA 2VDML 4KZ0A 4TL4A 5DZLA 5DRZB 1IKNA 2Z65C 2OR9L 1XZ0A 3FUDA 1O6TA 1A7QH 5C0EA 4G8GA 2JCCE 4Z7WB 4H5SB 2QPEB 3IS1X 1ACZA 1QEXA 1DQJB 2WBJD 3DX8B 1F4XL 2IOOA 3D9AH 3OMNB 3KNBA 4K73A 2JMRA 3I9PA 1R24B 4D0DB 2ICCA 1YA5A 5I1AA 1QZNA 3CAFA 2CKNA 3SBWC 3K46A 1Q1PA 2R0KL 4G8AC 4KK9D 1Z7JA 4DGYH 1NBCA 5BV7H 3DUSA 1A7RH 1MXGA 2HN7A 5EU6E 4KTDH 4MJID 5CKGA 1RZFL 1HXKA 2J2ZA 3LN5A 3NEEA 3ZOAA 4LKCB 3BYYA 1PLAA 3BUBA 2H1XA 3VGFA 3PL6A 3U46A 1RSYA 4ZS7H 2DQIL 3ARBB 1G9NH 2YD2A 5IVZB 3LV3A 1BVOA 1SHSA 2VUYA 3DSNB 3TA3A 3AXHA 5G4MA 1S5HB 4FQJL 4M6OH 2XN2A 4WDIA 2VQ1A 3O0RH 4HK3N 3RAJH 1JL8A 3L7EB 4NC0B 4LP4A 2FL5B 2BVQB 2D2OA 2P48B 4OUOA 3N2JA 2BZ7A 5I74B 2IBBA 5G55A 4AUJA 2I9TB 1WQVT 1NAKH 1Y18A 4W9DC 1IAIL 2F6AA 1I7UA 3FUJA 3H9ZA 1UT1A 3KDMB 2KMWA 3SE8H 2D2CC 4XN4A 4XCYB 1JGVL 1SF3A 4I3RL 1ZLVH 1BVZA 2Z31D 3IDMB 4ZOEA 4IMKC 2VE6B 3MUGA 5ENWA 3UAJC 2EEDA 4JZJB 1LO3H 4DZBA 1QRNA 2CPUA 1GYVA 4HC1A 4HH9A 4DNLA 2NY3B 1LGVA 3TTSA 4X6EA 1JZIA 2CAKA 3CN3A 4QOKB 1A9BA 3IFPA 3QFDB 3WSQL 5DD5H 5MHSE 4B0MM 2VIRB 2NOYA 2HP4A 3VQMA 3ZL1A 5KOMC 5KSVA 1CJYA 1KYDA 1JGUL 3P0GB 4DOHB 4M5ZL 4N3TA 5EDXA 2VXUH 4JFFD 1U8NA 4WU7A 1XIWD 5D5MA 2V8MA 4EI0A 2DLFH 4JO4H 2KDGA 4E9TA 1HCFX 3C2AH 2BY1A 3QIBB 2JJVA 5EU3A 4NOFA 1AJ7H 5IQ9A 2RCSH 4FQXA 3L3HB 1IGIH 3PNWA 4YZFE 5D2LB 1XF1A 2WXMA 3RZCC 1QSFB 2VLJD 4WUUA 3WJLC 4Z7QE 2AXGA 2CUHA 4K8RC 4AKOA 2RH0A 3PWJA 2HT2D 4K5OA 1KCUH 2EEFA 3TBVB 2Y1YA 3G9AB 3EJQA 4PJ7E 3CIAA 4R96B 5LGJA 3W5NA 3VWKA 5ISZB 4FE9A 1OE1A 3D2UD 3IMWA 3P0YH 1YG9A 2OMXA 4NGHL 2K45A 1NEZB 5DF0A 3BO8B 1L5GA 4RRPG 5C3LD 1P1ZB 1TZIA 4ZX4A 3D7PA 1EMTH 3HLKA 4JRYD 5JUEH 2IMNA 3MBEC 1A6PA 4FQQB 5DDHB 1R3LA 4ERSH 5C1MB 3BRGC 1T04B 4R26L 1A6AB 4ELDA 1F4YL 3MLZH 5FOBB 3EIFA 4X4ZA 4YEEA 2BCKB 4BRVA 2XZAL 1N0XH 5D9SA 1JV5A 4QTHA 4RGMC 3CH8A 3X14A 4ZSOE 4TN9A 4FG6D 3S3PA 4X8XA 1Z5YD 2IAAC 3KPOB 4PRPD 4OF3A 3RFRA 3CVCA 5HGHB 4WENB 1NPUA 2E59A 3IJEA 4J12A 1ZHBB 1MHHA 3FQWB 5H2BA 1SXBA 3L5JA 1QA9B 4WI9A 2CM6A 5BQDA 2DMHA 2IGLA 1FRGH 4IBTA 1NDTA 2I5YH 2XBTA 4D8PB 1T83A 4JAMB 4AUUA 3PGFH 5LXVA 3LRSA 1XGRA 4N1EA 2IG2L 2P1YA 1T4KA 2DJMA 1MCOL 2XDHA 1OSZA 3CFQA 3GD1C 5KSVB 4NO0B 4AMKL 1UH2A 5DUPH 2GEEA 2OP4L 1RIVL 4YEFA 5E2UH 3IKKA 3RGVB 2V7NA 2R29A 3M46A 4IDJH 4FZ8H 3RURA 4JM4L 4PJEF 4PCTA 1V7NH 4EZKA 1WS8A 4XPAH 1P4LA 2DLGA 2ZT9C 3ATEA 4YX2L 3KYKH 2OV0A 4MA7H 3WUWB 2ATAA 1P7QD 1A7QL 2AZUA 4DFHA 4ZW8A 4Q9BA 5JHDE 1CIDA 1XZ0B 1ETA1 2C1OB 1D5IL 1NEZA 3DUUA 2DKSA 2V2XA 1GYCA 2QDWA 3QUXB 4Q6YA 3UMNA 5J8OA 1UOWA 3DO7A 2MPAL 3LH9A 1UWXK 3VD3A 5B38G 5I26A 3WE1A 3PIQB 2P43B 3U9UB 5IROD 1WCBB 1AFVH 1NSNL 5AW7B 4FQ1H 1BD2D 2EKSA 3ZE2E 2Z31C 3MV7E 3QDME 1XCQA 4IBVA 2J12B 5T1KD 4MDIB 4ZSOB 1OE3A 3CSYB 1I9JH 1J86A 5B7FA 5JW3L 4NZUL 3K4ZA 3RWDA 3DPDA 1D7DA 4G9FB 4W9EC 5EBWA 3U9PL 2E86A 3OKMB 3WFHA 3L95B 5J6HA 1T5XB 2XN9D 3L9EA 3M1BA 1HOCA 5FYLL 2VITA 4JAMA 4M7JL 1WZLA 2W88A 1OSYA 1NMAH 5B22A 1A6VL 3RWJA 3VFMB 4WFGD 2XV6B 3BH8B 4A39A 3QHTC 5D4QA 5BO0D 1XF4A 2MTZA 3JWNH 5IV2B 1PG7L 2YUZA 1E27B 2WKGA 3EYUH 1F0LA 2Y2WA 4DFIA 3HAEG 3KHQA 4MCYB 4PJDF 5EU7C 3ARGD 2XC8A 3PHOA 4WK0B 1MUJA 2CBPA 3RVUD 2A73A 4YGVB 1B4LA 4PJ8B 3EJRA 4PY8I 1G94A 2P8MB 3F01A 1IKOP 5EEWA 2DWEB 3IDMA 1Q9LA 2E7LA 4LLUA 3F7PC 1T1XB 3EDJA 1UB6A 1NIEA 4CU6A 4BQCA 1L9PA 1HHGA 2KLRA 1R33A 3CQQA 2GJZA 2FQGA 4JPVL 1II4E 4OZGB 1H8OA 5DEGA 4X9GA 2AAAA 3TO4C 4PRIA 2H9GB 5LXGH 2Z0BA 5DMKB 4HUNB 1HKLH 2CM5A 1CE1L 4XCCL 5C0CB 3H2QA 4W9GC 4XCCH 3RFZA 3OAYH 1WFUA 5D2NB 2YXVA 1CB4A 2VDQH 3FT4A 2CSPA 3BVDB 1ASQA 4UV4L 4Y1AB 2IPKA 4KKZA 3AABA 4MJIA 1F56A 3L4WA 5AOLA 1I85C 5AZEL 3QIBA 2VDLL 4XNUL 3ABLB 4XPFL 3M1OA 5IQ9B 5D1XE 2B1HH 1AY1L 3HBGA 5J6HB 5D1QA 3DHPA 1B90A 4FLQA 4MBOA 5GZND 4FNPA 3GTNA 1IV8A 4HJJH 1R17A 1RUQL 12E8H 3B4NA 3QGVA 4Z1PA 4HJ0D 1AC6A 1HU8A 2D9QB 1E4XH 3RWDB 3GMLA 2CR3A 3IFOB 5FEBA 2NW3B 2ZCZA 1SJVA 5KYWB 3HLAA 4L48A 2OYMA 4LGPB 3OLEA 4G8EB 4NI3A 5DHDA 3LB6C 1A14L 2PW1B 2XQBH 5F7FA 5AZ2L 1A21A 2MQGA 3EXJA 1LDSA 1VDGA 1H15A 2ZCLL 2ZG1A 3AC0A 5C7XL 1IEAA 4KXDA 1V7ML 5BW7C 4KQ4H 1GYWA 4AYGA 4NQUA 1KG0B 1R3LB 4P5TC 4HDIB 4CGTA 1FJ1B 2VXSH 4LARL 4XH2A 3D30A 1YECL 3IFNH 4BFFA 3C8KB 1TJHH 1T7XA 5A43C 3TXAA 3SZ6A 2DLEA 5FKPA 4IGBB 3UERA 4AW4A 3PLYA 2P8MA 3SIKA 3UYPA 1CF1A 1UXLA 4OGXL 4GUCA 2LFGA 4N2KA 1JWSA 4HX1A 3RBSA 3DVFA 2DQTL 4ONGL 4P2OD 1EERB 4ZQTA 3V0WL 3N44B 5J0BA 2DQTH 2CGYA 4NQDD 1TQSA 1KTKE 43CAA 1QRNE 2WYHA 4LVNB 5DQ9A 3LRGA 2ZUQB 3FTXA 4KNUA 1A3RH 4C55A 4F20A 3PL6B 1XGRB 3BD3A 4FQXD 1ZS8B 2Q86B 3SDAB 1FFTB 3OF6D 3BJ91 2DQGL 3M7OA 1VEPA 1J48A 3TJPA 1J5IA 2OZ4L 4LK4A 2GTWA 4G1MB 4Y4HD 5GGQH 2DLTA 3SPVB 3MRCB 1YQ2A 2NRDA 1IBYA 3QJRB 4KJPC 2W1NA 2A83A 3GI9L 3QDGB 1IM3B 2QSTA 2MTAA 2N1KA 1DEDA 3CTTA 5E8DH 4F8TA 1CZ8H 3RUGF 2XQBL 4F7CB 1TQCB 1NJ9A 4Q9RH 4UTBL 4LEXL 5IMKA 3GSVB 3CUPA 4OZFA 3TT1H 1EDYA 2HG5A 3L54A 4B50A 4Z3JA 1WPCA 3KGUA 4CAGA 2C4XA 3OLDA 3VWJC 3U9UA 1YMHA 2VO8A 1MCRA 2W60A 2QBWA 3G6JF 1FFOB 5HGAA 3SDAD 4HDIA 5CSGA 2APBA 3D8MA 1L7IH 1LO5B 1W0YT 3FTWA 5DK3A 3FU6A 2X3BA 2ZOLA 1IC4H 4R7DB 4YIQA 1E4KA 4WHTA 4UOJA 1Q0YH 1Z2KA 4UB0L 3DGGB 2YSSA 4PJCA 3F64A 3QT2A 3DX9B 1QBBA 4KFZC 5D7SH 4AIZA 4OBRA 4NJ9H 2FWLB 3OJ2C 4K55A 3FN3A 4K4KA 4PLJC 1JUFA 5KBMA 2ZONA 4HIIA 1E6JH 3WNJA 1RJLA 4N0UA 3CZUB 1XBRA 4ENED 4P49A 1OGTB 1MIMH 4DK6A 5I0XA 2PCPA 3HFFA 4GW4A 4OQ1A 5MENB 5C6PB 1YY9C 1KTCA 1PFOA 1M53A 2Z0UA 3EO9H 1RULL 4I7ZC 5DFVC 1KJVA 5LGHL 2D7TL 3L3HA 3PNWB 4YLQT 3W56A 3RZCA 4AIOA 1TDQA 2PXYB 1WAAF 5DK2A 5IVOA 3LPOA 4JN2A 2HVKA 1DUYB 3TJHC 4F7TB 2NY6B 2WQUA 3VFWB 1VFUA 3GJEA 3HE6D 3WKNA 2WBJC 1PEWA 2W91A 4TVPL 3WS3A 3QCUH 4F57L 5FF6B 4U1KA 2OW6A 3FUIA 1MVUA 3QCTH 4FHKA 4Y4FA 5C0IA 3S88L 2V2TB 2B5IB 5BNXD 1XF2A 2CKBA 2IFFH 2XN9A 3VXRB 4A6YL 4R7NA 1DDTA 2QDVA 4S0HA 3DSFH 1F11B 3CZGA 3R0NA 1M2VA 2F7RA 1BAWA 1JK8B 4NENB 4XWGL 4NKDA 3UEQA 3H9SB 4EZMA 3HMWH 5IR1B 1TITA 1AACA 3ZO0A 4B9FA 3GXIA 3QJOA 2Z8VC 2PTUA 3RNQA 2CMRL 2X4QA 3VXTA 3VSQA 4IS6B 3SJVA 1XF5B 4JDVA 4OH2A 5F9JB 3HZMB 5EEUA 2HMID 4G9FD 1F45A 4HHGA 4JREB 4U1NB 4UUJB 2X6VA 5TF1H 4BDVA 2X2IA 2KYIA 3SKJL 1FNSH 2NY4C 2YSSB 4RMSA 1G7LB 5CCHE 2ZUYA 4N8CH 4ZT1A 5ID0B 2HTLD 3MLYL 1FZMB 2Q87A 4WUKL 1MJ7H 3QUZA 2WO4A 1FFOA 2YWZA 2RACA 1MHCB 4WHDA 1D5RA 1R46A 1V10A 4IOSD 1C1EH 3KWXA 2AEIT 1I85A 1H3UA 3O4LB 4BH7B 4M43H 4RZCB 4YBQC 1T4KB 1KBVA 2CO6B 1U95B 3EGXB 4HZAA 5D1QC 4D0CA 1BZ7A 3GB7A 3GJFH 1H0DB 1OZTG 4WWPA 1CDIA 3KPRE 3OMIB 1QI4A 3MV8D 1EVUA 4U1IB 4KY1L 2X9YA 1CE6A 4ZO7A 1PEZA 2V6HA 2D03L 2E47A 4L4TB 5E5MA 1I1AB 5AAWA 1TENA 5EZLA 1P4IH 2MCPL 3HEIB 4M1DL 1RURL 3HJEA 1PD1A 1O75A 4G7YL 3LOWA 1U8KA 4OM1L 2AABL 1WZKA 1DUYA 5TQ0H 3CGTA 4XN1A 4FL4C 3PWPA 1UM6H 3MC0A 4QAMB 4V11A 2YRPA 2WCGA 4MQXC 2VLRD 4IBWA 2AXWA 2ZX6A 1AVAA 1JZEA 1L9OA 2R4RH 1BLNA 2DAVA 3KCPA 4XCEB 3FONA 5C0BA 1FIGH 3BD4A 1JZ7A 5I8CB 4G2AA 1FWXA 1AANA 2JJTA 2Y6TE 1LE9A 1A3QA 5AALA 4E5XG 4LRNH 4XC3H 4NUMA 2GFBB 4P8QA 1FAIH 2J1KA 5BO1H 1OK8A 3LD8C 3T3ME 4UNTA 4WO0A 2D0FA 1UWYA 4YQXH 1QHPA 4WCYH 5EU4B 3V0IA 4X7FC 3O2WL 1RUAH 1MZYA 1FFPA 3KS0J 3L5WA 1BMZA 2VNCA 3F05A 4DPBX 2PKDA 4MZIA 3W5MA 2I07A 2FWOA 3SO3C 2AEOA 3JTSB 1FE8H 3X2QB 4GUOA 4XP1L 3BVWA 1T80A 4B96A 1G7JB 5FC9A 2Q3ZA 4P2OA 2V9UA 2YLKA 4JFED 5F89B 1AZRA 4LSDA 1FZKA 2D03H 3I6KA 2CUMA 1LJMA 3V79C 1Z0NA 3PQYD 2GAZA 2J8OA 3A24A 4GXVL 3L95A 4M7KH 5EZLB 3X11A 1CBJA 4F7KA 1QSZA 3BAXA 2NY2C 1CQYA 1I8KA 2DBLH 1PD6A 3NUKA 4WFFD 3ZGIA 5L6YL 4UNVA 2AK4D 2FNBA 1NCWH 4ZUTB 2GITA 3H3BC 3ZYJA 4JDEB 5G4NA 3QSKB 1C9SA 4XNQB 1P0SE 5ITBH 2YGNA 3P40A 1I4FA 4PJ8C 4N6RA 4OF8A 5JXEC 3O6MH 5DEJA 4XC1L 4XZUA 1WHOA 3UROR 2GBAA 5DRZA 3QXDA 2WBJA 5FM5M 5A2AA 4XP6H 5HYSB 1DLHA 4Q4EA 1MCPL 1GJUA 1TETL 4L0PB 3FQ1A 2V17L 3E6FA 5FHBL 5D7KD 3L3GB 5FYKD 5K9QI 4M1DH 2IAND 4ZO9A 2Y36L 1FIEA 1N3NB 4PJ5E 3U1QA 1QFHA 1I3VA 1IGCL 1AG0A 1SVBA 2NY3D 3MCKB 4FEIA 5LBSA 4GINA 4PRHD 4TM9A 4TXVB 4PVLA 5M7QA 3DK2A 4GEIA 4XWGH 4PYGA 3QS3A 5I9QC 1WUZA 1FVEA 2YQGA 2GJPA 3U46B 2R56H 3W11C 4LAQH 1J1XL 5DJAA 2ZKXA 3LV3B 4Y8DC 3A4FA 3V4PB 3IDIB 3ULUE 4N20A 4AYDC 2EVJA 2BSDA 2FGWH 2K6ZA 2J1ZA 3NZ8A 4A68A 3VI3F 1JXKA 3VFVB 3HNTL 4ACTA 3T2QA 3KZ8A 1QX1A 4YDIH 1A22B 1TQCC 5IQOA 2ZSWA 3DPBB 3ZDYE 2PW1A 3VH8A 5DUJA 3QEGL 5DURD 4J39A 5DD0L 2ZZUT 3D48R 4OF5A 3G9VA 4ZX6A 2OMTA 3VWJB 1KEMH 1KTDB 3FRPB 5AOJA 2I25N 1O6SB 1YN6A 1AQDB 2UY7B 4EQ3A 1JRHL 3JZ7A 1KV3A 4XPBH 1DQIA 1T5KA 4ODVL 3DURA 4YXHL 3ZGPA 4NC1C 3D18A 2DI7A 3MA7B 4JFTA 4XODA 4IRJA 4IKKA 2YOCA 3NIFE 5CUSH 3T1WA 1TNMA 3NJKA 4DZBB 2F54A 3KPNB 3ZE2F 3C6LC 3V6FB 3VQ1C 4BDVB 1HSAA 4LB8A 5D7JB 3CZNA 2QQLL 4L1DA 2WZ5A 1L6ZA 1CICD 4U31A 4HG4J 5BV7L 3HS8A 4PJ5D 1G43A 1MELA 2F53E 1U8OB 2YGVA 5G5DA 4JO2L 1IM3D 5B1KA 2ZJSL 3N43F 2ZCKL 5FECA 4ZFOB 4JPWL 1BXUA 2WBJB 1U42A 4JPQA 3QZBA 4DEPC 5FGCB 5CD5C 2VT0A 4X6CF 5HYSA 3ULUD 4Q9RL 1X7QA 5EUOE 4L2LA 5AB2A 1S7WB 2FBOJ 1KIPA 1FORH 1HL8A 3GGWB 4LESA 5EUOF 1INQB 3VB9A 3ZUCA 1S5IH 4LP5A 5KSBA 2J44A 2XVKA 4YE0A 3UCQA 4IOSA 4PJ7B 1M42A 1A5FL 3LDBC 3P54A 4H8WC 3K6SA 3CU1A 1KGWA 1YAZA 4A2HA 1GAFH 4WZ9A 4D7PA 4IRSB 1R3HA 5IFHL 4ONFH 4ZAKB 3VWJA 4DEUA 3VFTB 2DM4A 3GXMA 1DVYA 3SB3A 2WVSA 5IMLB 1CDCA 1K8DB 1VADB 2MHAA 3KPSD 4KVCH 4RIRB 4GBXA 3RPIA 1BREA 1L0PA 5A6MA 1I8MA 4TYUA 4PW3A 3AROA 1MJJB 1ANUA 3BQUA 1P5UA 3FT2A 3ZE1F 4X6DE 5DYOB 3P2BA 4LVHC 1KWKA 4PCSA 3QPKA 1GC1H 3IDXH 3ROOB 4DOHE 3ULVE 3KPOA 5AOIA 3ZQ9A 2EIKB 5EV7A 3V4UL 1TJGH 5E6IB 3C6SB 4N0UB 4I48B 5IFAH 1KC5L 1G1CA 3CSFA 4PI2A 1KOAA 2B1OA 1MQ8A 1OWWA 1YMHB 5A40E 4G1EB 3TO4B 2UUDH 1RPKA 2L0DA 3OHXB 3UH8A 3L2LA 3BFQG 1MJUL 2J8UE 4FJ6A 5FUZL 3JV5A 1FRGL 4PBXA 1TTFA 4IYKA 1QLEL 3GRBA 5ID1A 5IHWA 1DFBH 1Q9OA 2JJSA 3WO4C 3MUZ1 4OLZH 1Y7VA 4CADB 4JPIA 3B2MA 4KJQD 3M17A 3PP3H 5I6PA 3QXAA 4WI2A 3QIWC 4OF7A 4JZOA 5DRNA 1QTPA 2JB5L 1I8KB 5DO2C 5CD3B 2FR4B 4PJHF 5EN2A 2NX5E 2VW7A 4I5BB 4KXBA 1W2KT 3S37X 4NUJA 3BOVA 4IRSA 2CRYA 2W0FB 4L8DB 4ZAKA 1S7RB 2M1KA 2EE0A 5CO1A 4ZX3A 4OGYL 4HISA 4JCLA 4FEMA 3BZ4B 4FXKC 2DB8A 3I6GB 4FFZH 1NAMA 4NN6B 4XBPB 2EKSB 4TPRH 3AS3A 5F6IC 1A8ZA 3DK0A 4BYHA 4X8CA 2H6PB 5L7XL 1OAQL 5KYXB 2B8OT 1YNTA 3ECQA 2XWDA 5TFSL 1G9EA 4MDIA 4I77H 4L05A 2AJZA 5DWPA 1EJOH 3MCLH 3DOSB 4H2AA 1SMOA 3ARGA 4QRFA 5JHDD 1NCJA 3QUZB 3QPXH 1QO3A 2DLFL 3IGKA 3FRUA 2WGNB 1OTTC 5DUBA 4BKTC 3RNKB 2FX9H 4XN2A 2FX9L 2A0LD 5LBVA 1MAJA 1UVQB 3TZVD 1UZGA 2YPVA 3DHUA 2YD7A 2Z91A 1I82A 4O02A 1OSEA 3MAWA 2HVJB 1R3JB 5ANHA 1TZHA 1K5NA 4BA0A 5IW6B 2Y5QA 4WI8A 1BLIA 5GGSB 3PAZA 4W81A 3ECUA 2GW5A 3P4NB 3H2WA 4R3SA 5LGHH 4WLCA 3BRFA 1QVOA 4EIUA 3QUZC 1VFAB 1U8LB 1DVQA 1MUJB 1DCLA 3WG7B 2XN9E 3UTSA 3PJLA 1YEFL 4TPRL 1I9RL 5DEZA 4DJMA 5GGVL 3DV4A 3E2HC 1DLFL 3BH8A 3MQIA 4ICWA 4L9DA 5E8NB 3GUFA 4L4JA 5EN2B 1E3ZA 3U7AA 1NFDE 5IB3A 4FLSA 5AAMC 3RKDD 4Y8AA 3FBKA 4ZW3A 1O7SA 3LCYA 3QXAB 3ZQWA 4IJ3B 3BDXA 3EO1A 4TLSA 4RFEA 1FNLA 2CDFA 3CLFL 4LLWA 3ZL2A 3MV9B 3BJLA 3MYZA 3REVB 5D71L 4C83B 5I1CH 2MH4A 3MMEA 5HI4C 1BOGB 2X88A 1KCVL 2HRLA 2H1PL 3BLBA 3G6DL 4JFZH 4ZMVA 2W9DL 3D39D 4HJGB 3C5JA 1NCCL 5BVJA 4A52A 1PZBA 4LL1A 5D2NE 1RMFL 4ISVB 4LLAA 2EDWA 4NEHB 3AREA 4JRXE 4BKLB 2OXHB 3CSBA 4OLVL 2E76C 3VI3B 2H9GA 4G8IB 4UBDD 3JQOB 2B0SL 1NQBA 1CD1B 4QXUH 5J1TC 4ZUUA 5AL8A 4YSOA 1VCAA 1Z9NA 5AWNL 4WAFA 1ZT7B 1E40A 1EA9C 2GFBA 1M7IB 3T3MF 3MRDB 3TBTB 4J3OC 5IHLB 2H7WA 2AV1A 3CC5B 5DJ8B 1IGYB 2FQDA 3GSNB 3MKGA 3VRLE 2JQAA 4RX4D 3HZYA 2Y06L 3NCYS 4RWYH 4XPTL 2WO2B 5C70A 2HKFH 4G5ZL 3VD7A 3IJ8A 3TFBA 3V52H 1I1FB 3BP7B 4GRWF 1G9HA 3ZDYF 3VXPB 3FQNB 5AVYB 3QA3B 5DEFB 5DVOA 1R34A 3IF1B 4WDIB 4PRPB 4LSUH 2DQHL 4GG6F 1JNHB 2OR8A 2EYTA 4HD5A 2AMUA 3MJ6A 1U0QA 4OZGE 4AENA 2Z4TA 2YAMA 1GSKA 4JR9L 3SQBA 2QSCL 5B1AB 2Q6WB 5DYFA 3O3BB 1QLEB 2JJSC 3KPQA 4LLDB 2D4DA 1YECH 3IDJB 4V2CB 3QORB 4JHBA 3KBPA 4L4VB 3ARUA 4S2SB 2H45A 2ICES 3FCUB 4HZLB 4XNMB 3NFSH 1HH6B 1KCRH 2VDPH 3KVQA 4PMFA 5BS0B 3G6AA 1SHXA 1R3IL 3P2TA 5AKVA 1QR1A 1QRNB 3RG1C 1IGJA 1MH5A 2A9DA 3NZHH 3ZTNH 4DQOH 3D2TA 4XCFH 1SQMA 5GRYA 5IOKA 1IE4A 2ENJA 3P4LA 5F97E 2WLZA 4Y1TA 4B27A 2DYPD 4AVHA 5ICZA 2IPUK 4F8NA 3VD1A 3AAZB 2CJUH 1J5OL 3MREB 4ES9A 2HFFA 5T1LA 4APQD 2VDNB 4PGEA 1AD0B 4NQDE 2QKIB 2WSDA 4F7EA 4G3YH 1YPZB 1U3NA 2VZOA 4TQHA 1CR9L 2XG5A 2X0VA 1U3ZA 1U58A 1F8TL 2HJKA 4XE5B 4YHPA 3LZOA 3QVAA 1T6VN 4D9QD 1NJ9B 3V5KA 4P9HH 4UTAL 5IMKB 1DQLL 1QZ1A 4IIQA 5TE6H 4QO1A 3US9A 1E7UA 3DIDA 3QDGA 1KGIA 3MLRH 3O3AA 1IM3A 3FT1A 3PXLA 5T5NG 1RZIB 1JZGA 2LR4A 4FHBD 3UPAA 3S3SA 3VFSA 4XMVA 1T0NA 4OR1A 4YDVB 2HH0H 3UTTB 5IREA 3K72B 1JZHA 5DMYA 5D1QE 4KUZH 2QL1A 4HUXA 3BQUD 1N64H 4K3GA 3ROLA 2J1WA 2BIQA 2GSGA 3H3PL 3PJSA 3V9CA 2YJQA 3MFFA 1NBQA 2L3BA 1PZ5B 1NOLA 5EEZA 1AD9B 3VD2A 4GSDL 3BVNA 5EBLB 4NCDA 3MRQB 1T3FB 2GC7C 4LSQH 4PWGA 1D6VH 3MJ9L 1DVFB 2PCYA 2BSTA 2DN7A 2PCPB 3U1SL 4JY5L 1GGIH 3V95A 1L0YA 3E38A 1I8LC 2R56L 4O9HH 4BFRA 5C2BH 5JMOC 5F3BA 1KB5L 3CMGA 2Q7AA 1NPJA 2FVNA 1BEYH 2UYLA 1KIPB 1A02N 2IIJA 1K5NB 2A6KB 2ZP0T 4HZ1A 2JJUA 3EFDL 2R2BA 1B6DA 3MREA 1B9ZA 5DHYA 5F71A 3CFJB 3TIDB 5F9DC 1GGBH 4OCYH 5F9OH 5C2BL 3VM5A 4QRUA 4OM0L 1NCDL 1L9QA 3VXRE 3T0EB 4R97C 4AQ8C 2XWCA 2OJZL 1CMOA 3F04A 4NM4L 4YHZH 5E1GA 3P11H 3O9WA 3KM2A 1YDPB 4NKDB 3KG5A 5IVXF 4BWUA 1K8DA 1VADA 4RIRA 3KLHD 2V9TA 4OJFL 4ZMAT 5DD1H 2Z4QA 5D1QD 2NT1A 2ZXQA 3UDWC 3VXRA 3EFOA 1MJJA 3HC3H 1YUHB 4JQVA 4LLWB 5DQDL 3RWIA 3UG3A 1X4YA 4UAOC 4DP4X 5D1QB 5KVEL 1XGQB 4P3WA 1KBGL 5BQ7B 5TDNA 2R29L 4I4WA 4MA8L 1NBVL 1XWVA 2ERJB 5EU6B 1FE8L 5JW5B 1MAML 2Q1EA 2ZP8A 3V5DA 3IB4A 4DVRL 1JXFA 3VRJB 3ZXAC 1HINL 5FUCC 1H3PL 4PN6A 1BFVL 1BF8A 1OGAB 1RUAL 4P07A 1QPPA 1JHKL 3QQ9D 4CC0A 3BQUC 3MV7A 3QDMA 3F6JA 4IRSD 1JZ2A 2AFNA 4URTB 3PWNA 3ATDA 2NY6D 3U4KA 2WKLA 3DJ9A 5E08L 2X1WL 3BW9A 3RPKA 2VWEE 1DQDL 5H37A 1ET7A 2VWEC 1CGXA 1MHCA 3GRGA 4OZIA 1FJ1A 2P5WD 2QHRH 4FF9A 2YIHA 4YOKA 2LFEA 2R2BB 3S2AA 4HUWA 2CE6A 4FZEL 1GZHC 3OKEB 3UGEA 3N0PB 4NXSA 1PZAA 4DUWA 4IKJA 4XHJC 1J10A 4JO3H 2R2CA 5C0BE 5PAZA 2D9CA 2QKIC 4NM4H 4Z0XB 5C07B 2X9ZA 2OSLA 3N1QC 4DVBB 4QRSB 4BWWA 3MV8E 2J6EH 3TESA 2H26B 1UT9A 5ETUA 2MQ0A 4XBPA 3RZWA 2ARWA 3I02A 5LGYA 12E8L 3QDJE 3ILPB 1MRFL 2CDGB 3DUHA 5I5JA 4YHNA 3QHFL 3QIWA 1JGIA 3ARGC 3LNGA 1S3KH 3PABA 2YK1H 3WNMA 2GTWB 1NFDA 3F6IA 3GJFA 3QZNA 2XWZA 5TDNB 4P5MB 2J5LB 4ZFFB 1J8RA 5C09E 5EZPA 2XQYA 1S7RA 3LXBA 4MMZA 2ZCHH 1T1YA 1JPGA 3VDBA 1DJSA 1YUHA 2Y5TA 4F3FA 2K78A 5E94B 4Z3IA 3TS8A 4K23L 5F6HJ 2CGRH 3X3GL 3MO1B 1MZZA 3SDAC 1JPFB 4ZOCA 4YL9A 1AR1C 1ZGLM 4N2IA 2JFCA 2FX8H 3K91A 3SE4C 3ERXA 4J3UA 4JM2D 2E6JA 3RBGA 4FQQA 4KI5E 4LKXA 3U36A 1KJ2L 2QHRL 5ELIA 1KIRB 1BJ1J 2NSQA 2QV2A 1OPGL 4BZ2L 3HFMH 3CFCL 4IK6A 5F7EL 3VRLF 3BISA 3E1ZA 3LHPH 4Z7WE 1P9MC 1DBKL 3CDGA 2CBQA 3FQTB 3FCTB 1MPAL 4JDTL 2UZXB 2YMTA 1XR9B 3N9GL 4UT7L 4L4VD 3LS5L 4ZFGL 2LU5A 2VMFA 2BH0A 4YPJA 1G7PA 4HUUA 1J87A 1SJMA 3BH9B 1LEKB 4PYHA 2Y07L 4PW4A 3VU1A 2A9ML 1P7BA 4XPTH 2MTPA 4HCRH 5J4MA 1AHKA 2DIAA 4M5YL 5E5UB 1AD9A 1EWHA 1YYLH 2VDLB 1CGSH 2VXTH 3FMGL 4WFFE 4KGLA 4PRAB 1MDTA 2L4OA 3E80A 1NAMH 3IFNL 2AK4E 3GJEB 4JRFA 2CO2A 5IB3B 1LO4L 1PQZA 2GB2A 4UAOB 2XFXB 4UQBA 3FFDB 2X3AA 5DD3H 5GGVH 3V4VL 2BFGA 3SKUD 1CG9A 1IAIH 2HLFD 1M56B 2BWDA 2DQDH 2APVA 5L2JB 1HKFA 4X9IA 5DVLA 4Y4KB 4M6AA 4X9HA 2Q10A 4PGJA 4HKBA 2BJMH 2A6IB 1F18A 3RDTD 5J1SC 2AXFA 1MEXL 1HCYA 1KYAA 4AV5A 3QUYC 5K33A 1U41A 4KI5D 5D7KE 5FYKE 3KJ6L 4X6DF 1E4XL 4UDUB 3KM1A 1JIBA 4UILH 3NN8B 4WI6A 1LO5A 1E3FA 4GAGL 4JR9H 4J3WA 1FVEB 5HGGS 1JZ4A 4I9WD 4AGMA 1XCTB 4KTDL 2HKHH 2RB8A 4Y1AD 1GW0A 5D70L 1WZMA 1WG3A 3QUZD 4U6XB 5D70H 1JBJA 3G5XA 2MEJB 1PX8A 4Z0BL 3F12A 4HJ0C 5ESQA 3MROB 2NXZD 3MDJA 4H0GA 4P3CL 4ZMQA 1OD9A 4NQVB 1QUNB 3NIGB 4K7PH 5DHVA 2BFVH 2OSXA 4YFLF 3GMMB 2HAZA 4A2GA 1ZGLP 2O5XL 1A9VA 4RESB 3HMXA 4I18B 4X99B 2OMUB 2BNRB 3QWOA 3DO3A 3P0VH 1A7NH 1HOEA 2R51A 3CX2A 3V0EA 2FO1A 4PRAA 1RJZA 2X89D 4HIEB 4B3VA 2FJHB 4WW1A 3T2PA 1P2CA 2DQFB 3HRZB 3OAYK 1PZCA 3QEQE 1JTOA 4OAWB 4WTXA 3RU8L 4N2LA 4M8VA 3FFDA 1A3RL 4ODUB 5ICXB 3SDCD 3GQFA 1CVRA 4F9LA 3VW3L 4NO3B 4RMQA 5FA4B 1KGXA 3L9RB 4N3UA 3MJ7B 5KVFE 2JXMA 4AL8C 1MCCA 4ODHL 1EEYB 3EYUL 5T8IA 2C9PA 3J7HA 4UOZA 3MRPB 2BP8B 4S1DC 3GMRA 1S2EA 1BIIA 2X4NB 1NWOA 3CXHJ 3II1A 3ZW3A 3W9EB 2HSIA 5CN3A 3FUMA 3HC2A 4ANKA 1UWFA 1Z66A 4I9WE 1NMAL 2GJZB 3IXTB 3LIZL 1H19A 4HUWB 4KO6A 1HWWA 3NRFA 3BMWA 1BW8A 3SBQA 2GI0A 3EYOB 1GC1C 1KXQA 1EZSA 3QCTL 3FB7B 4QRRE 4NFDA 3S88H 4KJQC 2IAMA 4PQXA 3MRBB 3WIHL 5FM8A 4B7IA 2XWJA 2G5BA 4WI0B 1L7TH 1M05A 1XBDA 3LNFA 3ARFC 4ELMB 4AK1A 2O5YL 3CC1A 5F7YC 4JFEA 7TAAA 4WWKC 3P4MA 2APWA 4O02H 1WFJA 4Q4IA 3UAFA 3CU7A 4FAAB 1KPUB 3ECVA 1NCUA 1Q38A 3KWWA 4JQXC 4PJEB 3GBDA 4N9OB 2W59A 3I3DA 4M3JA 2OTWB 1KY7A 4ES8A 3QEQD 2PP7A 3KPSE 2PP8A 2VKWA 4MJ6A 3SKNA 2J43A 4ZMYA 2Y5TB 4KKLC 4AV4A 1T0NB 3NJHA 4YDVA 4HJJL 3BCDA 1K3ZA 4HUXB 1NEZG 2Y25A 3TPUB 5HDQL 4RDBA 4RFNB 2XJLA 4PLOB 1QQDA 3KVDD 5AVSB 3UYRH 4U1JA 2E75C 4JFQB 4H7VA 1X7TA 4P99A 4JRXA 1DQJA 4HWEH 4M62L 1MFBH 3ZDZF 5IHHA 2NY0B 2Y06H 4PVBA 5I5IA 1J9SA 5DCCA 1G7MA 3HS0B 3BVUA 4PVMA 3ZE1B 1WBZA 4HAGA 1C16B 5CINH 3RTQC 3T0EA 4K9EH 1K9TA 3SYCA 4PWIA 4GB9A 2X4SB 5T1DH 3WFBH 4QRRD 2DQUH 2W9LA 1NIDA 1P9MA 2QSVA 3LH8A 1G7QA 3G7TA 1QKZH 1FHGA 2O61B 4GLRI 3UDWA 5GGQL 1AZNA 1HQRA 1CK0H 3L4VA 5KS9E 3VGGA 2WW8A 2AK4A 3QP3A 2ADIA 4U2YA 5FHAL 1BFOA 3C6LA 1MWAB 1BMWA 3OGCB 3QE5A 3IXAA 4H26B 5DQJA 5DTFB 1R75A 1E5UI 3ARBA 5IVZA 25C8L 1INDH 2R9HD 3PHQB 2HCZX 4WUUB 3VXUD 1CTMA 4DP8X 2D7PA 2W65A 1HCZA 1XB8A 5CJQH 4HT1H 2ITCB 3QG6A 4ODVH 3VDCA 5ICUA 1G7HB 1IQDA 4HCFA 3U30C 4F9PC 3GMOA 1JHLL 5KVFH 1SLXA 4M6NH 1C12A 2QHLA 4MD5A 3WIHA 3ZYOA 3L8QA 2L7QA 5T1DL 3S34L 4P23A 2QQKH 1P5UC 3MUJA 3HE6B 4XOAA 3ZMNA 2NNXA 1M7DA 1XQ4A 1L9RA 3HBZA 3ZMEA 3OJDB 4DP9X 1Q8MA 4FFWD 2X12A 4ZNCD 3UP1A 2A0LC 3POCA 1QVOB 1RUPL 4JFOB 5JZ7D 5A16B 4LQFL 3O6LH 1WBYA 3MXVH 4TSAH 5I1DA 4LDOB 3LQAC 1A8JH 3DGGA 4JREC 3E6FB 1EJ8A 3PHSA 4FXLA 4DAGH 3LPFA 3BW9B 3EF7A 1XFPA 4XO5A 1F5WA 1GIGH 1H3WM 3P9MA 2DI9A 4JM2F 5HDBE 1HQRB 1EXUB 2EH8H 4AGQA 2DWYA 4OV5A 1QI5A 4PG2A 1WA2X 4DZ8B 2K1MA 2M26A 3R18A 3OPZH 5C0FB 1AS8A 3HG5A 4LU5L 1QSFA 4JDEA 4Q7DA 3PWJB 1IM9A 1D5MB 1ZT1A 3QXWA 4HJGA 5D1ZI 2EEXA 1IJ9A 4R4BB 2A2QT 1I4FB 1WT5A 4HD9A 4AMKH 3WTTA 2PLTA 1PZDA 4UQAA 4IIZA 1QATA 1N6QL 1PBYA 4GT7A 5CLTA 1RLWA 4HKJA 1KLGB 2DLHA 3IU3A 2FSDA 4ZTPH 3S3BB 3GMNB 4NO2B 3FRPA 1RL1A 1AI1L 5DZOA 1P53A 3AUWB 4LOEA 2AK1L 5HDOA 3S5LG 1KACB 4FFVD 4RA3A 1AHWA 3QRBA 3RFZC 4NPYB 3RAJL 5E9DB 5FUOL 1RZ8A 1ITCA 1X5LA 2R2HB 4FNLL 2WO3B 3ZZLA 3RYMA 4GKSA 1TEGA 4BA8A 1XR8A 1JXGA 1PGRB 3G5VB 3IAQA 2FEEI 2ICWJ 3G3LA 2Z34A 4PW9A 4F15B 4YAQA 1P84K 2GC4C 5I8OH 3O2VH 3W1ZA 4MDJA 4ATTA 1IGYA 5EO1A 2IC2A 2ZUSA 1J5DA 4R5VA 3ECWA 5F7UA 2WZ6A 3CLEL 4KOBA 3WO3B 4XNAA 4ANXA 3LEVH 4J3OF 4WKZB 2CR6A 5KAQG 4M7KL 4WFHE 4GBXD 3X1EA 1PNCA 4XVUC 3HNTH 4QCIA 1NBYA 2ADFH 1CLCA 3M86A 2G5RA 3PQYB 1IT9L 1Q9KA 3KPMB 4TRPL 1J0IA 4V33A 3JVFC 2F58L 2V7NB 1RHHB 1Q90A 1EAPB 2GT9A 1Q1JL 1MCDA 4CN4A 3MUHL 1NC4A 4MCMA 5KVGL 2F54B 3KPNA 3QUMB 3L7FB 2DMKA 3S98A 5F88A 5AAMA 1NGZB 1BVNP 1YEGL 3K0YA 1CFSB 4R8WL 1S4IA 5BZDB 4OSUH 2HKHL 1GIGL 3U82B 4DKTA 3ULUH 4PRHB 3KLAB 3IFLL 2W0FA 2FZ3A 4S11A 4O4YL 4U1MA 1BVKA 1YPZF 1YEHH 4MCNA 3O6FB 2P28B 1NLDH 2BIHA 4CBZA 1FA4A 1CXFA 1W0VA 4MKMA 1YPZE 2OX5A 1FORL 4PR5B 5F7HA 2XTJC 1FFNB 4HHAA 4L29A 5FGBA 2R4RL 1KUMA 2OL3A 5I6NA 4PJXE 2OCFD 5EUOA 1NCWL 5I24A 1IO4C 4QTIH 7PCYA 3UPRB 1N8ZA 1AD0A 2QSQA 1RP8A 1FCGA 2Q8BH 5DLLA 4G7RB 4NQVA 1HL9A 5EU4A 4PJCE 1AQHA 3GTVA 1TPXB 1ET8A 1BPVA 1F2XK 1V5JA 5GSRB 1YYLL 1UFUA 3FMGH 5F2FA 1ZE3H 4XBEL 1F13A 3IGAB 3T8MA 3WKPA 5E7FA 3MNVB 5BS0E 4D9QE 2GVYA 4HIHB 3MRKB 3OKLA 3OZKA 4HWZA 4IU2A 4WEEA 3BCFA 4JGUA 2FUQA 1R3KB 5IHUL 3UBGA 4CSTA 1BD2B 2XTJB 1HZHH 1BBDL 3WMPA 5GXBB 1DEEB 3HLAB 3QUHA 4RFNC 1UH3A 2IBZX 2ETWA 3LEXB 4LL4A 1FNEA 4JUSA 4E5XA 3ZKMD 2A73B 4YGVA 4YHIA 3THMH 1PZ5A 5J57B 1U8PA 4XNZC 2JELH 1U36A 2V8LA 4MA3A 1RZFH 3EO0B 2GITB 4MHHG 4EIGB 4L8DA 3BUTA 4LLYA 4R4ND 1QABA 1VHPA 2XU9A 3KLAA 4M7ZC 4F93B 3CHQA 5TQ2H 1JZ3A 3VM7A 4YDKH 3HS9A 3IT8D 3P1VA 1UFGA 3AM8A 1Q9WB 4TULH 3EO1B 3RGVD 1DANU 3EXLA 4ZJ9A 4OAWA 4X8JA 4JHWH 3D9AL 4D9LL 1SDDA 1WISA 3I75A 4HPYH 1A9BB 4KQ3L 2BY0A 3OXSA 5I71C 1M71A 4FNSA 2H8PB 2F8XC 4HMCA 4QF1B 4OCRH 4LAQL 3WEBA 1EX0A 4OB5L 4BM7A 3WJJC 5I19H 4EJ1C 3NJMA 2WQSA 2WD0A 4JKNA 4EN2A 5JYLA 4JK0D 1K6QH 1PLGH 4HWNA 4KX8A 2I9LA 1IQWL 2FQFA 3O9WD 2IOIA 4OV5B 1LQBC 4YHKL 3MCKA 4N26A 1ACCA 2IDUA 2BOBB 1DBMH 3LIZA 4CBPA 2Z8RA 1L9SA 5ABAA 3T0AA 3K71A 3TU6A 1CF8H 3VXRD 1A6TB 4OFDA 4O2EA 2MQCA 5E8PA 1CLZH 3FB7A 4K5LA 2DWTA 4MB4A 1I53A 4G9DB 1CFVL 1YEDA 3PPSA 1KFGA 5F96H 3SPCA 2Q8AL 4FTVB 4XP6L 1LM8V 4AT6A 1BM3L 3EZ8A 1OAXH 4JKKA 1F3RB 2NPLX 1BZOA 2VQUA 2YR3A 4JVUA 15C8H 4OIFA 3V5DB 3LKOA 3X12B 1LK3H 2Z3FA 2H6PA 43C9B 1RUKL 3L3DA 3V4VA 2VDRH 5DT1H 1IEAB 2YKLL 4GJTB 5IW3A 1BQSA 4EI6A 2IDSA 1BV8A 3VD0A 4OCWL 5CILL 3MGTB 2WMPB 3D0LB 2DQJH 3KE0A 5F9WC 4UV7L 5EHFA 4Q56A 5TF1L 2AJXL 1F58L 5D7SL 1TQWA 4UI2A 4MRBA 1JYWA 1UCBL 2A77L 1LMKA 2WLJA 4JG0H 4P57B 1DR9A 5LCVH 1V3MA 4DWHA 2CK0H 1OEZW 1DBML 1DVTA 1YZZA 3DX1A 4UMSA 4FCHA 4HX1B 4OLUL 5FIEA 3HPLB 1CWVA 3MRMB 5I1EL 3K2KA 2X6UA 4U7KA 4JFDD 2R23A 2XPGA 5GZOC 2BIOA 4UOW1 2F74B 4M61A 1KTJA 1MNNA 2ROYA 1X6NA 4QWWC 1X44A 3M1CA 3UOAB 2XNAB 4YFEA 4GIOA 2F1BA 5LNEA 4LCCC 5JQHC 1YMMA 5I6XB 1QTYT 1J8HD 3DGDA 2J7LA 4ZFOA 1HNFA 5L8KB 5BO1L 5C0CA 3FT9A 3AXIA 3ES6A 4JS7A 1A7NL 4ZPTA 2X5PA 4F9PA 4A7TA 5T1LB 5DJ8A 1M3IA 1SHMA 2Z93A 4NUGL 2EYSB 4IEFA 4PBDA 3V10A 4EAEA 4GUPA 5LN8A 2B4CC 5C8JB 1QYGL 2UX6A 1EFXA 5FX3A 4UIKH 3AS0A 4LKCA 4XMWA 2BSCA 2FX7H 2VW6A 3EKCA 4YBLB 2XIIA 3QUKA 1O7VA 4NENA 4UINL 5FO7A 4PIRF 1KJMB 3RIAF 1BPLB 1UJ3A 2WVUA 1S9KC 2Q20A 4TQIA 4ISVA 4XO3A 1BQKA 1EEZA 5IMLA 3ULSA 5KYWA 5D71H 1IC4L 4X5XB 4Z0BH 3TX4A 2MQ3A 4FXGC 4OZIE 1I8MB 3BP4B 5JHDB 1WAPA 3D69A 1HE8A 1P7QA 4EDWH 3KPQB 2OCCB 3NEOA 4WJG3 1KBGH 1UUNA 3RB7A 3HB3C 3N0AA 4WUUD 3VXUB 3GLAA 4MNQB 2UZXA 2V5YA 3ML8A 3NJVA 1NTDA 2P46B 5SWSD 2ZYIA 1CFQB 1I7TB 1QPKA 5FYKU 5MENA 1PY9A 2KPNA 4DZ8A 2EDRA 3GXNA 1M6OB 5AENA 1G9ML 5EEXA 4X6EB 3NBNA 5FUCE 5DMKA 3RX5A 4IRZH 4CC4C 2DM3A 3UYPB 5AEAA 1Z1WA 2CH8A 2XWEA 4JFFA 3VH8G 4KUZL 1DEEA 2ENQA 1GR7A 4DESA 4K9JA 3IVKA 2ZJSH 3HC0B 4ORGB 3NP3A 3QJUB 1CXHA 5DRWA 1NAML 2Z93B 1SXAA 2VC2H 2L04A 1KNOA 3ZDXF 2R0WL 4W6YB 3KXFD 1LD9B 2QTVA 3CFEB 5F7DB 1U8QB 1MAKA 4K9EC 1DUZB 3SHSA 5F7AA 3WTUA 5DFWH 4FQXB 4UQIM 1JK8A 4PREA 3T4AA 5L4JA 2MCG1 5IR1A 1PLCA 3FFCB 3LMJL 2G60H 1X5KA 4K94H 2XG4B 3FQRB 3EG9A 1RZ8B 4JJOA 1E0OB 4U3XA 5DHEA 3GMLB 3IFOA 2GSIA 4AZUA 2VC2L 2VL4A 4PJ9B 3I6GA 5L2JA 2GJ6A 1R5VA 3CFCH 3SGJA 3CH1B 4H13C 4KRMB 3CZLA 1X3DA 1DBKH 4P2YA 3X3FH 3QWRD 5EPMB 1X5MA 2DQCH 1CYXA 1E4WH 1KJMA 4IRZL 5M94B 2AMGA 5C0AD 3KWUA 4PD4J 4LVEA 3KAAA 2B9BA 3L3JA 4JJ5B 4Y1AA 3I50L 1QEWB 1ORSA 4DEWA 2AEPL 3CIQA 1UATA 4HUKB 2B2XH 2AGJL 4AW7A 3GMMA 1THCA 2F18A 5GHWL 3PGDB 3Q2VA 2VLKB 5FKAA 3O45B 4HIXH 5E2WL 2ISDA 3VWJD 4Y1AE 2UWEF 3QR1A 1JZ5A 4NJ9L 2D0HA 1FP5A 2X1QA 4PRBB 1ZKAA 4P46D 4QTFA 5DU7A 2WLMA 2YD1A 3KXFE 1MY5A 4KPHH 2VB5A 3EH2A 2ZAHA 4ZUSB 3AXLB 4M8QB 1HXMB 4ZYKB 4ODXB 2BDNH 3C5ZD 4EMZA 4BSVA 1IU1A 4MA7L 3JWOC 4UZGA 4XOBA 1UYWH 4JHVA 2IH8A 3V0JA 2J73A 2XQYK 4BHUI 1EO8L 1AMXA 1MDAA 2QKSA 2XFGB 4YZFF 4A2FA 2P5EB 5E8DL 4QTIL 1BIIB 2X4NA 3O6FA 4OFPA 5J6GA 1W80A 4S10A 3Q5OA 4CNIB 1IILE 4PJIA 4AQ8A 4X42A 3QZWB 4AL8H 5KTEH 3TP4A 2V2TA 2HTKC 2XN9B 5KYNA 1BHGA 1VESA 1SJHA 2C34A 2VDPB 1WRFA 1IVTA 3LHAA 2DD8L 2CLZB 3X3FL 5C0AE 4AYFB 3D08A 1A3LL 4L1BA 2UZIL 1NFDB 1VRSA 3FZUC 3ABMB 4UANA 5BRZB 3G08B 3ZDXE 4KKBC 4UMGA 1NDGA 5EBGA 4XAKD 3GLEA 1JHKH 2D7OA 4PJ9A 2YN3A 3DOIA 2AJVL 1IFHH 2YAQA 3QUYA 2WLLB 5K39B 3LZPA 3AACA 1RY7B 2FWOB 3P73B 5CHNA 5DJAB 3SCMC 4UZUA 4RLDA 3Q6GH 3P3UA 3UZQB 3OKNB 4HFWB 5EZJB 1G7JA 5HTSA 3SDXF 5KAQF 3QFJD 1F1DA 3AU1B 3ZZQA 1TLMA 4ZNEA 2XWJB 4XBGB 2FEJA 2GI7A 1IMHC 3VXSE 1GGUA 1MCOH 3GSNA 3RVVC 3HG4A 1BG9A 2J3SA 4HBCL 5D5MF 3I6LD 1OAKH 2A74B 5F8QC 1B0RB 4ZW5A 4J3TA 3FN0L 1P4BH 3IDYB 4ODXA 3MRFB 3UO8B 1OCRB 3HPJA 4B9PA 2AJSH 2ITDB 5C7XH 1RUMH 1KXHA 3QDGE 3TIEA 3B8SA 4Z7WF 5K9OB 3TZVA 5IWLC 1MQKL 2ENPA 1PJ9A 2QQNH 1YSOA 1IAOA 1SUHA 3IDGA 4G42A 3WTVA 2FD6H 4XVOA 2CQVA 3GBNL 3U48A 1HDMB 5IV2A 4QI3A 3UACA 2RCSL 3NSJA 3BRDA 4HSCX 4LQ1A 3ESVF 4K3EL 4LASH 5CUSL 2NY5C 3WJLA 4U1JB 3ULVC 1DTUA 4N9GB 4R26H 1BCIA 3KW8A 3ZBMA 1ZY9A 4P2RE 1YNKL 1GMIA 4ZFFA 4ZD3H 5KZCD 5B3JE 1CFMA 3MRJB 1B0WA 3ARED 2ATKB 3KYKL 4JRYB 3FC8A 5A2LH 2PWDA 1MJ8H 2LOEA 2VLRB 3NIFF 4W9LC 4XNUH 3SY0B 4H1LB 1S7VA 1Z5LA 1X7QB 5TFSH 4IBYA 2HX8A 4KKBD 4N8PA 4NN6C 2AJUH 3W2DH 1U92A 4BFBD 1DSFH 3HA0A 3LZFL 4JFYA 3MRHB 1J88A 1ETZB 3RIKA 4BUGA 1W6LA 2Q3AA 3B7TA 4NHCL 2X6CA 1RKRA 3D07A 5ID0A 2WQAA 3UJIH 1MRCL 2OYLA 1OP4A 4CDHA 2BNQD 1AO7A 1LO0L 4BQ9A 1XCTA 3OLIA 4FQCL 4WQOA 3H3PH 1B0RA 2LVCA 4JO4L 4QT5A 1G9NC 3TFKD 3O3UN 5IHZA 2ZKWA 1ECYA 4I2XA 5FGRA 2ICEA 4Y2NA 5K69A 4QKXB 3MJ8B 4FFYA 1H8SA 5F7NC 2B77A 3IWVA 1HHHB 4IS6A 1NFIB 1WJ3A 1QASA 2NR6C 5IW1B 1IVLA 3B3BA 4LHUG 5GGSY 3B2UD 5EWIH 3QO0B 1A6VH 1JVOA 3VI3E 3HPLA 1BYNA 4XRCB 3A47A 1AXSB 5T33L 1OHZA 4OW6A 3ZJAA 4XNYL 4HA1A 1NCAH 1OLLA 1I7RA 2WXFA 4FJZA 1EXHA 1OW0A 5IB4A 4TS6A 4DP2X 4LNRB 1MHPH 4K5NA 3MRLB 1C08B 2OMVB 2QZ5A 4AXWA 5F0JB 2EH7H 2E7BA 1SGKA 2X38A 4GP8B 1OP3K 8FABA 4KVPA 1NDMA 3BGAA 3KLLA 5KVEE 1DO5A 1I9IL 2FJFB 4AYMC 1D5MA 1ZT1B 3WIIL 4YS4A 4UQ3B 1I7ZA 1A65A 1LMIA 2DEXX 2Q8AH 1VIWA 2VW4A 4MJ2A 3RIAK 4X2UA 4OGAD 4J3VA 4J6RL 3ZKXC 2Z31A 1AGBB 1BECA 4LMQI 4O4YH 4GO9A 2D4FA 3QNYA 4FKEA 1NCOA 1MCIA 1KBBA 3HMXL 4ONFL 1X4XA 4XMXA 5ESAA 5EIIB 1I1YB 1YEGH 1ZWIA 3ES6B 3QJHA 5GGTH 2IBGA 4OUUB 4W9CC 2WUBL 2FL5A 2VQ4A 1HL5A 2I7SA 3TYFA 2BK8A 3B5HA 5TE7L 4PY7B 2YRLA 1PKOA 3NSXA 1CXEA 3AREC 4PJIE 3ZX1A 2DWDA 1H5BA 4FQLL 4NZTH 5MENE 4TUJA 5FO9A 2RD0A 2ZWLT 3QR2A 3TWCL 1B3JA 5IEKA 4YSSA 1AQDA 5D6CB 2QGCA 4KVNL 5HDBB 4PIBA 5G4OA 3GEFA 3CXDL 3MCYA 4H44C 3AQZA 3DJTA 5JPNC 1AAJA 1K8IB 3RVTD 5KVFL 4Q0XL 2XKUA 1XSJA 1ZANL 3LXUX 1S8DB 2B08A 5ICXA 4I3SL 1ET5A 3JTSA 1RZJL 1Q72L 2DTML 3NABH 1QA9A 4P2CG 4AEHH 3A5VA 2WWKO 2Y7OA 1UA6L 4C56E 1LE5B 5D1ZA 4YSEA 3ARWA 3FPYA 4CGUB 1CD0A 1HQ4B 2PO6C 1U8LA 2ZX9A 3BN9D 1U8QA 3QWRA 4I3SH 3TONA 3DKHA 2B2XL 4KO9A 3ULVL 5DZPA 2C1PB 4LF3B 2IQ9H 4IK7A 5D93B 2G9KA 4Q74A 1ODUA 2ITDA 1YEIL 2GBUA 2HJFB 3FN9A 1TYEB 1GH7A 1ZTMA 3GHEL 4GG6B 4ZK8A 3OQRA 2RJMA 1DJWA 1SN2A 2C3VB 5KBNC 4A1RA 5FYKH 4G59C 4JRLA 4BCXA 2A7BA 5F93C 4BD4A 1P4LB 3WBDA 2XA8L 1A4BA 3WUWA 3GNMH 2DDQL 2Q7YA 3EOTL 3MV11 4BUQA 1ML0A 3R4RA 3LZFH 4LEBA 4PS7A 1KELL 3B2PA 2CA3A 4G7VH 1DLHB 1J05B 2JKIS 1C5BL 5F9WB 5D6DC 4GXUM 3DOSA 4RISH 2R8SH 1O6SA 1YN6B 4NBZB 3NCWA 3JWNC 3BWZA 5D93C 2Q3XA 2YQBA 1AKJB 2MSPA 3D18B 3DTUB 3VFGH 2QADB 3QBTB 2MCMA 2XN1A 3EDKA 2XV0A 4PG2C 2DMCA 1S9WB 2EIZB 4X0KB 5BW7A 1H3XA 5D6CA 3LKPA 4Z7IA 4IMLB 4LE8A 3EDFA 1SM3L 3MBXH 4FNTA 2OA9A 2F54E 2DWXA 3MNWB 4L5FH 4QPEA 3RWEB 1HAUA 4DW2L 2VL5A 4EIZC 2FD6L 3Q1SH 2E7HA 3DX8A 1XB6A 3DXAA 2VDQL 1G9MH 1KYOK 4ELMA 1ZA6A 3KYOA 2FGWL 5GGTA 2BMKB 2DDQH 1WZ1L 4PSPA 3L9BA 1F4WH 5JHLL 4P2AA 5JDSA 3ALWA 3P4MB 4DKFL 1YNLH 2X42A 3B43A 5EZOH 1H3TA 5ID1B 1E67A 5LXGL 2XQYG 1G7QB 3GM0A 5JIQA 2TRYA 3FUKA 5AG9A 1WAAE 1IIIA 2J72A 3LEYH 4PJAA 4YK4B 4ZQKA 2J5LC 3LKQB 3T3MB 4DQAA 5AB9A 1A6ZA 3QIBC 2P5PA 4AEFA 1U8MB 4NYLB 5JOEA 2A6JB 1SXZA 2A9BA 3DX4A 4N2EA 4IQHA 4Q2ZA 4GMSH 1UD5A 3UG4A 2GJ6E 1TJXA 4E36A 2IPTH 2HT3C 1IBDA 1SF5A 3VE0A 4JFQA 4AZ8B 4ZMZA 2E27L 2WXKA 1QD0A 5L2KA 2J6EL 1QR1B 1PLBA 1G6VK 3TBYA 3GK8L 3ME0A 2BC4A 1O5PA 4ZS7L 2WIIB 3QUYB