4XVOA

L,d-transpeptidase from mycobacterium smegmatis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
b'TPVEVAQVEPAAGAVVGVAHPVTVRFAEPVTDRRSAERSLRIASTDTSAGRFRWPEAAVMEWTPDEFWPAHSTISLSVGGVKTSFNTGAEVLGVADIDAHTFTVSVDGEVLRKMPASMGKPKFPTPRGTFTALAKEPVVVMDSRTIGIPLSDPEGYKLTVNHAVRVTWGGVYVHSAPWSVGSQGYANVSHGCINLSPDNAAWYYDMVSVGDPIIVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase
publication title L,D-transpeptidase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 49
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4xvoA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4xvoA01
5DZJA 2MTZA 1ZATA 4QTFA 4A1KA 4ZFQA 4K73A 5DC2A 5K69A 3U1QA 4JMNA 5E1IA 4A52A 4GSUA 5DVPA 4QRAA 5E5LA 4QRBA 4HU2A 4Z7AA 5DCCA 2HKLA 5DZPA 4A1IA 1Y7MA 4A1JA 3ZGPA 4GSRA 4QR7A 5E1GA 5LBGA 3U1PA 3ZQDA 3VAEA 5LB1A 3VYPA 3TURA 5E51A 3TX4A 4LPQA 4JMXA 3ZG4A 3VYNA 4GSQA 3VYOA 4HUCA 4LZHA 5DUJA 5DU7A 5D7HA 4XVOA
chains in the Genus database with same CATH superfamily
4H0HB 1DO6A 1PCXA 3A6CL 4UYPA 2H1PL 2OL3L 4BRJA 3L16A 2PPFA 2DQHL 1LP9F 3L3DA 1IC0A 3B9DA 1E9QA 2E86A 3H9SD 3SGJA 3UACA 2QPUA 5EZLA 3U48A 4OVUA 2D9CA 2J6EL 5IVZA 4M7JH 2BHYA 2PP8A 2R9HD 4HP5A 4LKCA 3RL2B 3U2SA 4KWUA 3SY0A 5FK9A 4IJ3C 3LQAL 4A6YB 3IDXL 4NO3A 3RWFA 4CVZA 5AUMB 2W95A 4LQFH 1BOGB 1E40A 3BKJL 4LVHC 2EYRA 1LMKA 2DEXX 1T5WA 4AQ8A 2OMXA 2Y1AA 3UERA 4L4VD 1BMWA 2BS71 2WLIA 4PV9B 4Q89A 4TV3A 2C3XA 4QKTA 4GRWE 1PLBA 2QADD 4KI5F 3ASOB 3ZL4L 4OF3A 3CZGA 2XWBB 2XQYK 2GFBB 5D7KD 3BEWB 2E9GA 3P0VL 3VJ6A 4X8XA 1WFIA 4JFHD 4R2GD 2OA9A 1A3LH 5F7FA 2XZQH 3TBWA 3P73B 1DZ0A 1RUAH 2LU4A 4S1SH 2AK4E 4DWHA 1PDKB 2VR9A 3QHFL 3K81A 5L0QB 2WANA 3RDJA 1ZLUK 3CDCA 4WUUD 3TT3H 2AJUH 5D9SB 4ETQB 1AS8A 3LXBA 4KXZH 4QRBA 5L4JA 3PGDA 2JTYA 4IRZA 2BP0A 5FW8A 5I15L 2F1BA 3X12B 4PMEA 1A9EB 5FEBA 2P4AB 2E5EA 1ND0A 4LB8A 2OKMA 4BFIB 3QSKB 3B2XA 5IHZA 5M7QA 2N7BA 3L5JA 4AK1A 5JHBA 2FATH 1CGXA 4H8WC 4JL1A 3REVA 4ENED 4HWEH 1RSYA 1D5RA 2C3VB 4XBGB 3G7TA 1OM3L 4P5RA 2PCPA 3CSYB 3D07A 1J1PL 3O81A 1I8KB 2IAND 2JF1A 1EO8L 4GI6A 5FA3B 3TJHD 3LYRA 3M7OA 4LLMB 2PW1B 3L3KA 4MYPA 3PWNB 4RLDA 4WJG3 5F7BA 4EN3B 1NEZB 2FEJA 1RUML 4IRSD 5A7EA 4AQ1C 2BNQB 1ZHBA 3MU3A 2YPLD 2WKGA 3KW8A 4BGDA 1TQBC 2PLTA 3NFSL 4L3CB 1GL4B 2ZWKA 4PH8A 4ADIA 1MAMH 5HHPB 3MRCB 3O11B 3QIWC 2VIRA 1J8SA 3RVTD 3WIFA 4OV5B 1V3JA 5IKCB 1QSFA 1VFBB 5GS0L 1A7OH 1RVFL 2HMIC 1QATA 1EXUA 2WLMA 3DX7A 3MA7A 5D4JA 1RZPA 3SE8L 3T4AC 1MHPH 3N40P 4U2ZA 2YEZB 4FQXA 4BELD 3MYZA 2NY3B 2CXGA 1F8TL 4DQOL 3OKYA 2DJMA 5H2BB 2NUTA 4CSSA 1OTTD 4CC0A 2HRHA 1GJIA 2VMDA 3SPJA 1GW0A 1LDPL 2OMTA 1F4XL 4FTVB 5HPOA 4XOEA 3H2PA 3F7YB 3MRGB 2Q8AH 4GBXB 5FUOH 1QO3B 3ETTA 2BXYA 4NYLB 4QOKA 3QNYB 5L7XH 4QYAA 3BAIA 4YN3A 3G5YB 5A2LH 4DH2A 3VXUB 3IJHB 2JNZA 1ZLWH 3GHBH 1IJ9A 5F96H 4BKLA 1IBBA 1QMUA 3V0WL 3PS6A 1MG2C 5JDSA 4Z3GA 3S35X 5D1XC 2YD8A 2E6JA 1T04B 2XWJB 3UGEA 3UP1A 2JKXA 5DHVH 1F90H 1RZGA 2AANA 5F7MC 3KYMB 2QVMA 1YAZA 1PIFA 4HLZH 4JQXA 1L3NA 4N2GA 1UOKA 1S9VA 2XX1A 3K6OA 3KNBB 4QYOA 3T3PF 3VFUB 4KTYA 2P42B 5HGHA 3JZYA 2HX9A 1JBJA 5E9DB 1U3YA 1UG9A 1C16A 4NRZA 4H13C 5IQNA 1BG1A 1GKEA 1ZA6A 1HH9A 4GSRA 1KOAA 3FT2A 2WQXA 3MLTA 4M48L 2DLTA 3ECQA 2ZUWA 4A55A 4Z6AT 3JV5A 2YBGA 3TZVB 4ZZKA 3CXFA 2VC2H 4NQTA 2XA8H 1MCBA 2N1KA 1YUHA 2FB4H 3KPRE 4LQ1A 3ZOAA 2FWLB 1KGCD 2VLKA 1M53A 4KVPA 5F6HI 3QORA 1CURA 2AC0A 5C7XL 3SQOL 3T0EA 4PB9H 3DSFL 5KTEL 5J6HB 3HR5A 4OLZH 5FR3A 4L4TE 1ZIAA 2AQ2A 3N9GL 5BZDA 4WFED 2CKBL 4OGAC 3ZSSA 5EEWA 4GI8A 4OI9A 4P5MA 4YBHA 4E2OA 4KK6D 1QNIA 3HUJA 2VKXA 2F61A 1S7RA 4NUJB 4D8OA 1JVLA 5HYJD 2E8ZA 4G11A 4Q4EA 1U4EA 3TYGL 3W9EA 1G9HA 3TLRA 5IHUL 1A47A 4N2CA 4XPHH 2O4EA 4KO9A 2FWOA 1ZLVK 1IT9H 4GLRH 3TEWA 3VXMB 2EDBA 4KVNH 5F44A 1GS8A 3L17A 4AM0Q 2HJLA 1XHHA 1JDCA 3ECWA 4QPEA 1TENA 2LAGB 4J6RL 4NN7B 5D55A 3U4BL 3WJMA 4QTFA 1RUQH 5IK3A 4PMFA 3RE0A 1QI3A 1WPCA 3QUMH 1WIPA 5DFVD 5FOJA 2YO3A 5DVPA 1QI4A 3VGHA 4KY2A 5CSZA 3U1SL 3M88A 4YBQC 1FGNH 2IDSA 4OIBA 1B90A 5I0VA 4D9RE 1UWEH 2AMGA 2IDQA 3IE9A 1FC1A 4J3OC 4X6EB 3PQYE 4YX2H 1BF2A 3ES6A 3POHA 4AENB 2OTWA 5CJXC 1HINH 4P23B 4DPAX 1XR8A 2NUPA 2ZICA 5IHHA 4EUPH 3V0GA 3QIBD 3RJDA 3H9SB 3IYLW 1XGUB 3MRHA 3DHMA 4OUUB 5LCVH 3CFUA 2G2RA 1BVNP 3MV7E 4RRPM 4YXHH 2AEQH 1VGEL 4L9LC 3AWGA 4QOKE 5C70A 5FX3A 1YECH 3KBEA 4R26H 2CGYA 4RGNE 3TWCH 2ZQKA 1XSJA 1J5DA 5DCCA 4HHGA 4L1BA 2Q76B 2KLRA 4UTAA 5E2UL 2BWQA 2I27N 3N6YA 3BVWA 1IGFH 2R7EA 3DI3B 1ML0A 2OMWB 2VLJD 4P07A 4CVXA 1OGAD 2V6HA 3DO4A 5D5ME 1PX3A 2MOGA 3NCJL 3JT2A 1VACB 5DD5L 1DVFA 2Z3FA 1J5HA 4A1KA 3VI3A 3VA6A 2R2CA 1CD9B 2GIXA 2ZXCA 1WYJA 1JYNA 1HYSC 2EINB 4IMKA 2B9AA 2A1WL 5FM4A 4ZW8A 5EV7A 1A4JB 4Y5YB 2VERN 3HTLX 5DQ9A 4V11A 4OGXH 3GMQA 3CX5J 4BJLA 4R2GB 5AVTB 2Q20A 4QR7A 1CD1B 3TO4D 1HH6B 3FCTA 4JUTA 7PAZA 3KLSA 4OFPA 4HOWA 2BERA 4HUCA 2VLKE 1LWJA 4UU9B 2Z93B 2XZAL 3V0EA 1JGVH 3S3CB 3CFCL 2WLKA 4QNPF 1S9YB 4LVEA 2EYTB 1P1ZB 3NIFF 3KBPA 5EC2B 4MZ2A 4Y7MA 3Q13A 3DOSB 3NCXA 1BECA 3I6KA 1NFDF 5EU7E 3RA7H 3VWKA 4QWWC 4E9YA 2KLTA 2HWZL 4R6UA 1E0OB 2CNZA 3EOBA 3UYRL 4WWKD 1FSKB 3VU2A 5EOTA 2R56L 4DP1X 1I8MA 4Q6IC 3KS0J 4G43B 2AVGA 2NDGA 4UAOB 1R24A 2MCPL 1OAKH 2HG5B 2X4UB 3CSFA 4NC0B 4O51A 4YK4C 1RZ7L 2AJZA 1EWHA 1DFBL 4G8FA 3WFHA 2IANB 1YA5A 4PJEA 2H3NA 3CFQA 1E5BA 2CBTA 3PAYA 3NJNA 4M1DH 3AVEA 4LPUA 3HB3C 4RGOL 4ONGL 4WSJA 3SCMD 4EDWL 3JUZA 3ULUE 4WSKA 2QSCL 4KK8C 4URTB 2IPUG 3TASA 4AQ8C 4HKZB 5C6TH 3LEXB 4HIJA 4JHVA 5HHVH 3HPJB 4PRIE 1M1XB 5GSVB 5KANI 3CXDL 4GKZA 4TSCH 4Y16A 5IWLA 3BT2L 4JGMA 3UTSA 4B3EA 2V33A 2KHAA 1J9SA 3RGVC 4OFYA 2AQSA 1JK8A 4MB5A 1U2HA 1HZKA 2F68X 4P4KA 5CWSB 3L9RA 4JFPA 2C34A 1BQLL 2I60H 3ESNA 1BJ1J 4GS7B 3CMOL 3QDJA 5IESL 2A83A 4LPCA 2CUIA 3LHPL 1W8NA 5EG6C 1CXHA 3V4VA 4NNPH 2APTA 1U8QA 1RZIA 1KPVA 1MRFL 2O6EA 5DDHA 3HZKA 5DC9B 4AZUA 2WWMD 3UCRA 2Z65C 5E95B 3O3DA 5I5MA 2Z1KA 1TZGH 3MN8A 1C5CH 1XFPA 5LKNA 2CJUL 3X3FL 2WBKA 3SDAA 3FB6A 4EKJA 4GUQA 3VI3E 5FB8B 3FO1B 3NQIA 3X17A 2IXQB 3EIFA 2W60A 3KPOB 4XNZB 4OLXL 1Z6JT 5GIRA 4IJ3B 1XMWA 2V8MA 3IAPA 3V55A 4B3VA 4MBOA 4M4RA 5DJ0A 6CGTA 4FFYL 4IK7A 1FLTX 1MVUA 2DB8A 2WIIA 3T65A 2MEJB 4YDNA 5FUCE 3FB7A 4JCWA 2XQ0A 3F04A 3E3QE 5DHYB 4AL8C 2DS4A 3NCFB 1P5UB 2EDMA 2IQ9H 2GBUA 2YD3A 4LPXA 3S6CA 2IFFL 3ZDZE 4HIIB 4Z5RB 2QMKA 1T2QL 3V4PB 4JDVA 3JWOH 3CN3A 5EB9A 1QBLH 2OAAA 3LQZB 1NIEA 2E9WA 2QSTA 3B6SB 2CHWA 3MUZ1 4BYHA 3J2PA 5E6IC 3HG1D 2MFNA 4YSSA 3BUIA 4FQCL 3VGGA 32C2B 4NZTH 3QPXL 1F58H 2G4EA 4FQXC 5C0CA 2BNUB 2BOBB 1FVDB 3IJYB 4HJGA 4AUJA 3L5WA 3C08L 1X6NA 1S7WA 1EANA 1ET8A 2KZKA 2AXFB 5HHXL 1LHZA 1O7VA 2CGRH 3CVHH 1U95B 2DMGA 1NANH 3MAWA 4AEIH 1KTDA 2NY0D 4MCYA 2W9LA 3EBIA 3PYCA 1M42A 1CG9B 4F2MB 2YGVA 2D0FA 4RGNC 5JUEH 1SBSL 1K4CB 3QI9C 3KPNB 4OAWB 1HEZA 4YPJA 5ICZB 4HS6A 4ZSOA 5ESAA 1FNLA 3MV9A 5HDLA 4ZPVA 2WTRA 2NNAA 1HNGA 4KGJA 2H8PA 1WQVT 4KKBD 3HHRB 4LSTH 1M7IB 4P2QA 4UV4L 4PBWD 5DO2D 3AS2A 1QPKA 2DWDB 3Q5TA 3CZFB 4W93A 1HHGB 4JFQA 5E6SB 4JZNA 3WS3A 7PCYA 4PWEA 2EXTA 5IROC 5MEND 4U6HA 4FFWD 5F8QC 4JQXC 1KJ2L 4Z76B 5F7UA 5GS0D 5JW4N 2YRBA 2CWRA 2Y5TB 5CZXC 3PWVA 4N25A 2BIMA 2AW2A 3V10A 4ZW3A 3Q2LA 1PU0A 1PMYA 5IW3A 1BQHB 4LIQE 1XXDC 1TYRA 4MD5B 4IRJA 1TNMA 1IGTA 2XXGA 5DUMH 1XF4A 3DV6A 4D3CH 3CFKA 5I0WA 4RETB 2JQMA 4K3DL 5HTSA 2OR9H 3BVXA 2LLNA 3I9GL 3GEFA 2WKLA 1OF2A 2ERJB 1VGKA 4PJIB 4DVRL 4ZNEE 1W0VA 3APMA 3QAZB 2DI7A 4PJGB 4JMNA 2Y7LA 1QUPA 4ALAL 2VITA 2F8IA 5EU7C 2UX7A 4XNQB 2J8UB 1MREL 5E8OA 4LNVA 4CILA 2AQQA 3P77A 2F54D 1OGAB 5EN2A 4LL9A 3WY1A 1L0XA 4PWKA 4C55A 5DD0H 1I4FA 2AV7A 4UCFA 4M7LH 3OB0H 3SKMA 2XXMB 4HCRA 2YQ3A 4HUWA 4UOQA 2UZPA 2WLYA 4JN2A 5FA4A 3ZMNA 4H26A 4WCYH 1VRSA 5CINH 2X3BA 2QQKH 1QRNE 2VDOL 2A0LD 1FL3B 4MQ7A 3TVMA 1RK0A 1F3JB 2OP4L 4OZHF 3U7WH 1ZANH 3TO4B 5I6NA 5L2KE 2GTZB 1UM5L 2PTVA 3M1BB 4Y4FC 4YHIB 1U3HD 3MUGA 3NH7H 2OZNA 1INDL 3BWAB 5C0CE 3WFBH 1KBKA 5D7SL 1XEDA 4Z7VB 3LRSA 1K9TA 2D2OA 1II4E 3ISWA 4DT2A 3EXLA 4NZUH 1LE5A 3BO8B 3A4EA 4HSAC 4MNQA 4M4PA 3C5SB 1LLAA 3JWDC 4M62H 5DK2A 1QLEL 2VDLL 4FG2A 1QTSA 4NERA 3UYPB 1E4HA 3GSNA 4JDZA 5FCSH 5F9DC 1EERB 1FAIH 1MWAH 4MJ6A 4HIHB 5T1MB 1CBVL 3ZHFA 3SOBL 3AJ7A 4BK8A 5I1LA 2Z4QA 2DEWX 3FQRA 1M05A 1D7FA 3D9AH 3E9UA 4ZSOE 5FFOA 1ZDQA 3MV9E 3MXVL 1XGQB 3BQUA 3GS0A 4IBLT 3MODH 4DVBA 3MUY1 4WEBH 1QLFB 5BZXA 3K1KC 3IN0A 3R4DA 2K78A 5JO5B 5L9DL 4YSAA 4ANUA 2K3TA 2X4OB 5AW6B 1BJMA 2UY6A 1A6AA 1CFBA 25C8H 4JN1H 4U1NB 2F08A 1DVFC 5C09D 4N24A 3WMSA 3UBXI 3P2TA 1F4YL 4KMLB 3QDAA 1QFWM 4U1JA 3V5DA 3W9DB 1ZLEA 4IMKC 4F57H 3AGVA 3IEAA 1KEMH 3VD7A 1AGDB 5HDBF 1PAZA 4FRWA 2AJSL 2BCKB 3DHJA 3OR7B 3SKOA 3WFCL 4AIZB 5CEZH 5MHSD 2DQCH 4QF1A 1FO0L 4PI2A 4LESA 3KM1A 4I5BA 4KRPB 1GZQA 1UA7A 2P80A 3FQXA 3W39A 4EDXA 1T0MB 3K7UA 4S0HA 5FUCC 1B0GB 3BW9B 4F7MB 1SHMA 4HMCA 3EJQA 2XTLA 1DVXA 3E3QC 4FLOA 4NN6B 3MRNB 2YPVH 4QRRD 3RUGF 2HP4A 1CTMA 3LDBC 3RTQA 1Q94B 1LP9A 2JJUA 4PI0A 1FF5A 3FO0H 3QZWA 4GRWB 3ZDYF 3G6AB 3VWKC 1Y6NR 2JCCA 1E4WL 2P5ED 4HU2A 4MHHI 5FYLL 3RAJL 2RAMA 2ZT9C 5IV2A 4UT9A 4H25A 4NRYB 3HI6H 3OMNB 1AXIB 1FZOA 2D0HA 4UINL 4XPGL 5C8JA 2EIKB 1T21A 1U8JA 3N43B 1M3JA 3CZLA 3GSRA 3P54A 1Q0XH 5F7HA 5FM5M 3KJ6L 5EMYA 3KDMA 3EYOB 3HFFA 5AVUB 3WGVB 3GMOB 5GJSL 5GGQH 5HHNA 1HJCA 4YDKL 2OI9C 1UTDA 1UH4A 2ADIB 1JERA 1PFCA 1GW6A 2N3JA 3KM2A 3VMPA 3D09A 3Q6GH 4ZFGH 1NIBA 3NZ8A 2K3HA 5AYUH 3UZQA 1G9NC 3VFRB 4BUHA 2V2TB 1P5VB 3IKCA 3KXFA 3DHPA 3QK0A 4O5LL 1I1FA 4DERA 5DJXB 1SOQA 5C0AB 3VCLB 3PWJA 3KWWB 3RI5K 2J4WL 1JFQL 1GZHA 5EU5A 2BVYA 1TQWA 1PZBA 5IWLC 4ODHH 3BCFA 3B8SA 3OF6D 2DQEH 3BKMH 5T3XH 5I71C 5FCUH 4NZJA 4KFMA 1YNTF 1P4BL 2BNRE 3K3QA 1EX0A 1M56B 1LXMA 2VAJA 4P5SA 5FGCE 4PG9A 1ZAGA 1NCCL 3EYFB 2ENQA 1IQDB 1XCXA 5BVJA 3LZRA 3O41A 4BA0A 4NJ9L 3VE0B 2LLLA 2ALWA 4GG6E 3FRPB 5HY9B 2O61A 1VSCA 3PHOB 1MCWW 1WF5A 4MYWB 5E9AA 4X0KB 1SDYA 2FWUA 4XVJL 4N28A 1KLFB 5IJVB 3DJSA 2BC4B 3ARBA 4NQCA 1E8WA 1WWBX 2JSFA 4HH8A 4K23L 4KH2A 1U21A 2VMFA 5INDA 2VRKA 1NGYB 2BVOA 1CDJA 3UCQA 4X6CF 4Q6IB 5I17B 1YJDC 3FONB 3W2DH 2FX7H 4X7SH 1MHEB 1A6PA 3G9AB 4R4FH 4YK4B 5CCKH 2AI0L 4M8QA 3CCHA 2Q3AA 4I4WA 2DQDL 4JZJC 1SMDA 4LASL 2IADB 1IAOA 1DL7H 2WWOA 3EXJA 3FUNA 4L1TA 2NZ9D 2Y2YA 4M6NH 5D7JC 1OHQA 4WJ5A 4V2BA 3VXNB 4LAJH 2N56A 4YFLI 3VUAA 4Y4HD 2ZXWB 1LP9E 1JG9A 4DN4L 5EUOF 3SDCC 5A3ID 1GY2A 5JW4M 5EFIA 2G0LA 2JCCE 1LO5A 3G6JB 1ZVHA 4OJCA 4DSYA 1V7MH 1NIDA 4BZYA 4OB5L 3ROLA 3L2LA 4FLRA 3ARFD 4TNWF 1AZBA 3T1WA 5ADPL 1AY1H 4MFHA 4D7PA 2R1XB 3KLAA 3TNNA 2NMSA 3STZA 3RGVB 2TRHA 3TJEL 3K6IA 1DE4B 4HK0A 2DMBA 3G5WA 2KQNA 5HDQH 5JYMA 1HKLH 3OPZH 3WY3A 4X4YB 3ZZSA 2AXGA 3GJFH 2F54B 4ZMWA 4XB3A 2A9NL 2XBTA 4AYMC 4WK0B 2WZ0A 1Q9LA 3IETA 5L2JB 4TLKA 4BQ6A 2ARWA 3S2CA 1YY8A 4KAQH 4OLYH 4WWOA 4Z0XA 3S8GB 1RUPH 4TUKH 4KI5E 3DSNA 3KPRB 4YFEA 4QJ5B 3NDYE 3QO0B 5JOPD 4MA7H 1T6BX 4O4YL 1E3FA 2Y6SD 1QRKA 4E5XA 4NHCL 5CSBA 2FO4B 1NFAA 4L4TB 2VISB 3EGDB 1WISA 4X6FB 4N2EA 4O9HH 3QXAA 3B9VA 3IWVA 3FUEA 2X4NA 2G4GA 5CMAA 3MNVA 1RZQA 1NLBL 1U8OB 1SLUA 3K72A 1E42A 3EH5B 3DV4A 3FTSA 4Y9CA 3C60D 3PGFL 4BZ2A 3LKSA 4K7PX 1BQ5A 2YK1H 2DQIH 3BD5A 4B97A 1PQZB 4FLHA 4TN9A 3LN9A 3FZUC 3ILQC 2PCXA 1VEMA 3CXHK 3NZHL 5HJ3A 3VSUA 4NQCE 3RVVD 4N8UA 3JWNC 2KL6A 3BSZH 3GMRB 1CDYA 3IJEA 1CN4A 1CDIA 3QNXB 5H35A 2CKBB 4WTXA 1IGIL 4YGVB 1U8NA 4G8EA 2HLAB 3MZGB 5E6IB 2PF6A 3HE6A 2LQRA 1Z5LA 4TQEL 4Y88A 1RXLA 4MMXC 3K4ZA 1O9ZA 3SDXB 2QPDB 2HFFA 4GKSB 2PYFB 1OP3K 3HVDA 2ZUQB 1JV5B 3KGUA 5BRZA 3VFVB 3HFML 5DZPA 1UWXH 2RBLA 4G6AD 3LZQA 1NCAH 3A21A 4TSAL 4H0IA 5DJCA 5GRZA 3WO3B 4WU7B 2ADYA 2V2WB 3MV7B 1EZLA 2RFXA 4NX0A 4XP9L 4XAWL 4JM2D 3C2AH 4Z3EA 1B0WA 1J1OH 3HPLA 4FZEL 4RGNB 1YEHH 4XCEA 3Q5YA 3QI9B 3LRHA 1AZUA 1C5BH 2EEFA 3PJSB 2R0LL 3MI6A 5SWZA 3AG4B 4EPSA 3O9WD 3OMIB 1O0VA 5I8KH 4BH8A 2VJ0A 5GPRA 1A2YA 3P2DA 1YEGH 4UUJA 1TO4A 5GZOD 3UJJL 2CK0L 1V3MA 4HPYL 1RCYA 4F8LA 2EDRA 1JYXA 5DSCB 1AHMA 2EACA 5D5MB 3CHRA 5GRXG 2Q5BA 4QDGA 5B7EA 2W07A 3TV8A 1SXSA 1FH2A 3CH1A 5I1IH 4X5XA 3EOTH 1I1AA 3D0LB 1D5ZB 4ODTL 3AXLA 3ZDWA 1DQQA 2YMXL 2EJ1A 2A6KB 4YHZH 5T3ZL 3VG9C 3KL5A 1JP5A 3G08B 4JGUA 5AAWA 3S9DB 3KMDA 2W9DL 1GS7A 3DBXA 1MVYA 3LIZH 2P5EB 4X7EC 1BBJB 5K9KA 2ZNWA 2XN9A 3B37A 3K91A 3PXLA 1PLCA 4FQ2H 1SDDB 3FU6A 3KR3H 4LXFA 4MLIA 3X14A 4GRLA 5IHLB 1HAUA 3T8VA 3I6SA 3MMEB 4E42B 4WEMB 2WVSA 4OZGF 3T09A 4GYBA 3VFPA 1PKQA 3TBYA 3MRMA 3WHXB 1CIUA 3II2A 1A21A 4JFDD 1Y0LA 4B5ZA 4G42B 1E4JA 1TQTA 5JXEC 1PEZA 1CXKA 3D05A 4BDVA 4H1LH 2HJKA 3RFRA 1N0XH 2DLFH 3O0RH 3LNDA 1AANA 3R06B 4RZCA 2Y7OA 3PCYA 3RX9A 2F18A 4GMSL 3IXAA 5ICYB 1CWVA 2H1LM 3BWUC 3NCCB 5AKSA 1UATA 3AXHA 1XF2B 1TYJA 4Y2DD 3WFEH 3WS6C 3HC0A 1FNGB 1LEGB 4KXAA 4N9GA 3LOWA 4IS6B 2OZ4L 1SJXA 1AGBA 2CBOA 3H6AA 2XG5B 4XCCH 4M00A 3GS4A 1F6FB 3TIDA 3NZUA 1I7TB 2AQTA 1NFDA 3FOLA 1WZKA 4RDQG 3ULVL 1MSPA 3KWTA 1ETJA 3LS4L 2PN5A 3MV8B 4EXPX 4HC1L 5H37A 4PRIB 5BRZE 1FJ1A 2CJSA 2VYRE 4GO8A 1MCDA 2B1OA 5DYOA 3DK0A 2FHFA 3S0PA 1W2KT 2ICWA 1G43A 3A4FA 1XGRB 5I8CB 1UB6B 1E4XH 1WD9A 2EE9A 4RWYL 5FWQA 1JGEA 3ZE0E 3VNZA 2Y5EA 4X2UA 2W91A 2Y36L 4BHUI 5IQ7L 4K9EL 1OGSA 3IF1A 4LHUG 2K6WA 4JRXA 3ZUNC 4NQUA 5LCVA 3FUHA 3BRDA 1DYZA 3C9NB 3OLDA 3ZHKA 5BV7H 4RDQF 4HF5L 4ONOA 1KGUA 1RMFH 2NRDA 1HOEA 3E6FB 5CKAA 2EVHA 2NX5A 1NCNA 5IR1A 3NN8B 1H8OA 3PHAA 1RU9H 3L7FB 4H8QA 1N8ZB 2NYYC 1G7PB 3BKYH 2H5UA 1WAPA 2XQBH 3H4HA 4OD2B 1VFMA 3WNKA 4Y4HB 4FFTA 4KO5A 3WUWG 4J39A 4UDTB 2YFOA 5AOLA 3RX7A 3ZTNH 5KSUB 3QIUC 1FYTD 2A3TA 2P8MA 3L9BA 3WDJA 4RISL 2EE6A 1X4YA 3RL1A 2CR3A 3LV3A 4QCIA 5AVZB 2XN9E 5TD4A 2FE0A 3UADA 1E6JH 2YAOA 3N2JA 1J8HB 2VXVL 3FN9A 3BXNA 4DW2L 4Y4KC 3LRLA 5FYLD 2G60L 4YFDB 1ZSHA 1MELA 2X40A 3MA9L 1H3PH 1PFOA 3QARA 5I18H 2R0KL 2ED7A 2X3CA 4KC3B 5CD3B 5T33L 1IRAY 3LMJH 3OJDB 4KJWC 1PKQE 1PLGH 3O3BA 1XF5B 2DQUH 1KUMA 5I74B 3GGWA 4L1LA 5DZVA 1S7QA 2FNBA 3Q2VA 3TH3T 4XWGH 4MMYA 2X6CA 4YUEL 3RWJA 3VX0A 4JFFB 2ZYRA 4WDIA 2HFEB 3GBMH 3IDYC 4EJ1C 1OZTG 2LE9A 3NG5A 4AUUA 5I1HH 1P2CB 2L04A 4LGRB 4L3EB 1V3KA 5AWNH 5EIQA 3UTTA 4LLWB 5I66A 3I6GB 3D3VA 3OLEA 4M9OA 3IS0X 4DKFL 2WQWA 4R5VA 1SXCA 4G8IA 1HAWA 35C8H 3MO1A 1M2OA 2M83A 4ODSH 3UC2A 2CAKA 4HALA 2GJZB 2Y3NA 1YQ2A 1F18A 3GNML 2OI9B 3A6CH 4L1HA 2H1PH 2OL3H 4Z7WE 3K71B 4ZUWB 4QHNB 3WKPA 2DQHH 4YSDA 4CUCA 1XCTA 2GC4C 4KBPA 5E99H 3MGOB 1KNOA 2J6EH 3B2MA 3HRZB 4W4NA 2F53B 4GI9A 3DO3A 2VLME 1KJ3L 4N1HB 2NXZC 3OAUL 3WBDA 3LQAH 1JNNL 1R3JB 4OLWL 4YR6A 4IOFD 1FZKA 5AYTA 3QZPA 3WE1A 1ETZB 3F6JA 3PDDA 3OV6A 3PRZA 1KB5L 1EZUA 2XTSA 5GQBA 1BFSA 3NA9L 1E9PA 5TGBA 1DN0A 2H0EA 5AVWB 1I31A 4YHYC 2FK9A 3WXWL 1BZ9B 3MX0B 3AUWB 2R2EA 2CO2A 4CDHA 1G6RL 1HILA 3QJQB 4ACTA 4QI3A 1JF6A 1ZK5A 3ZL4H 3BN9D 4G1EA 5EU6B 5EZIL 3GXPA 3CN1A 1BPVA 1W72L 2Q86A 3IDNB 4W70A 3QEGL 2AAAA 4YHOL 3P0VH 5E4IA 2J5WA 2FBRA 3ECVA 4NO0D 1IGJA 4NKOB 2C1PB 2Q6WA 1R3IL 3OAYH 1U8CA 3QHFH 2QEJA 4ONHA 2VZUA 3UTOA 2OJ1A 1NTDA 3Q7JA 5TE4L 2LGNA 2Q3ZA 4TUJB 3CFBA 4LCUA 1I8IB 1LD9A 4FZ8L 5EC1B 1AS6A 1UKQA 3F6IA 4X8CA 3LS5L 5C6WH 2IF7A 4PREB 4JK0D 1JNHB 5I15H 4JZJB 5C0JB 3SDDD 1XZWA 2D7TL 3KW7A 3DPBB 2W1NA 2HPOA 3BH4A 3MRQA 3U6XS 1ZPUA 2RR3A 5KVEL 3X1BA 3NFNB 5D7JB 4E9LA 5T1LA 1XEUA 2FX9L 5ANMA 1ZVNA 2GEQA 1WGOA 5G4NA 4WO4A 2SODB 2WK2A 2GC7C 3ASWA 4JHBA 4BE5A 2AJVL 1OM3H 2WGXA 3IDUA 2XBZA 4W6WB 3H3PL 3SDCB 2QKIC 1EO8H 4Q56A 2CO7B 5D2NA 4LBAA 2R1YA 5EU4B 5DZ9A 3UEQA 3H42L 1INQA 3HE6C 2K45A 4XPBL 4ODWB 5AD0A 1OB1A 1RUMH 3QT2A 5AOMA 3KLHC 4I18A 5D1QD 1QBML 4KFZC 1QEXA 3E0GA 4BUQA 6PCYA 3KVPA 3NFSH 3GXUB 1D5BA 5DF0A 2NSMA 1NAMB 3SGKA 1ANUA 1EFXB 1YMHB 4IGBB 4XCNB 1JZ8A 2F8VA 1UGNA 2VDOB 4NLHA 3SKJL 4P3DB 3ARTA 5GS0H 1RVFH 3MOQA 4N0UB 2WKOF 1ECZA 4LAQL 2WB7A 3SE8H 2XJLA 3UAEA 1IKOP 5I19L 1IEHA 4Y5VC 3E1F1 3FRUA 4BV1A 1F8TH 4DQOH 2X4RB 3QNZA 3PXHA 3U4KA 1FE8L 1IAKB 3PFQA 4B50A 2HVJA 5J1TC 1F4XH 5JW4R 4KZEL 2R69L 3OZLA 2BOCB 5CN1A 2OYPA 3KZ8A 5IEKA 2VDLB 4QRSA 3FTGA 3HZYB 3OG4B 1A4CA 2YA2A 2K7QA 5I76B 1I3UA 1RZJL 1BVKA 1R46A 4U6VL 3EUUA 4ABWA 2BDNL 3VWJA 3F2LA 1YZZA 2L7EA 4TKWA 5AAWC 5GGRA 4C83B 4L3AA 2MTZA 1A8ZA 4I0PD 2YSTA 4IEFB 3V0WH 2MHAA 5MERA 3P1VA 1KGXA 4F7TB 1LNUB 3OC8A 4AYFA 3QZBA 2GTWB 1A1MB 4LKXA 2J57A 3LKPA 4ZUVB 1Z1WA 3PDOB 3QG6B 3H9ZA 5L4FA 3P9LB 1QEWA 5BUAA 3C12A 4EIBA 2DV6A 4JLRA 4ZMXA 1U8KB 5B39B 1G94A 4MMXB 9CGTA 4UTBA 1MN4A 1OEZW 1WWCA 1LTXA 1SMOA 4HUXA 4J3BA 2QV4A 3ZYIA 5KYWA 2QFRA 3RY4A 2YKLL 4U1IB 1EVUA 3D39E 4XHJC 4M48H 4HHWA 2EVIA 2GJ6D 5CCGE 2E75C 4WWPA 5FUZL 2P26A 2EDEA 5JZ7C 4YLQT 3T3MB 4NT6B 2QT6A 3FQ1A 1LO4L 1S7XB 3CFEA 1FPTH 5C7XH 3FU3A 1I9RL 3OD3A 1IAIL 2DICA 3DSFH 4PJ8D 2WQSA 5KTEH 1QR1A 3SE3A 3W82A 5T3ZD 2HFGL 3C5JB 4KKCD 3L4XA 3L6FA 3N9GH 4HWNA 3RUGA 1VADA 2GG1A 4UDUA 5KZCD 4UWQB 3U0TA 4OF5A 1TPXB 4PLKD 1LEIB 5CR1A 2J55A 2Z6FA 3F6LA 1XGPB 4ZYKA 3SQRA 4MTMA 1X7QB 2W81C 1E5YA 2Z92B 1RLBA 3CHOA 1SYSA 2ZF9A 1UASA 3TEUA 1EEZA 2NDFA 2NNFA 5B4MC 2VE6A 1N6QL 3D18A 1ZXQA 3GMMB 1HQ4B 3QW9A 4XP1L 2A6JA 4ZJ9A 1NCGA 4OLVL 5F0MB 3U4BH 3DMMA 4X9YA 3QZOA 3GXIA 5FGCB 5F7WC 3U1SH 3QUZA 2AQPA 5F0JB 1FFTB 4MNGA 2APVA 5LNDA 4P2RA 1ZGLA 4LOVA 3R4RA 5FGBA 3HCVA 3IK2A 1C08A 5LVEA 5E5RB 2QELA 3LX9A 3UG5A 3GSOB 5LBSA 1ETA1 4QT5A 3S3BB 4JFVA 3ISRA 1PZ2A 1VGEH 4ZFZA 2PTTA 3MQIA 3O6FB 4B6ZA 4WENB 2IBZX 3H53A 1YNTA 2WSPA 2CHXA 1JI2A 3HG4A 4M6OL 5AOKA 1FNEB 4X83A 3QBTB 3QUXD 5E2UH 3ULVD 2VDPL 4D94A 3VH8G 2WWKO 3BKCL 2I85A 5DHEA 4XZUA 5BCAA 1HOCB 3NCJH 5DD5H 2OTUB 2X4PA 1Z9SA 5CZVH 3ECBA 2IH3B 1NOLA 2WJ7A 3QWOA 2K0RA 4GG8B 2KPNA 4PP2B 1JFHA 2ZWSA 4N5EC 4O2FB 4NN5C 3EJZD 5SWSA 4JGJA 4ANKA 5EA0L 2YPVA 3MSPA 4X6CA 1NCTA 1FG9C 3TYFB 3VW3L 4FJYA 4EEEA 3GTTA 3CHXA 5GGSA 3CZJA 3LNFA 4AH2A 3QDGD 4TMPA 3FFDB 2YEQA 3AGWA 4QO1B 5HVWA 4UIMA 4X5QA 2V0AA 3VRIA 3CFCH 2VZ1A 4IRZL 3EF4A 3R19A 4L1DA 3RP1A 3LNIA 2ITCB 3DUSA 4X8JA 4GW4B 1OQXA 2DQFA 3RUGE 4P99A 2VTFA 5EOCL 3K1DA 2E9IA 4E41E 4PJ5D 3B3IB 1Z0NA 2HWZH 3UYRH 4Z7UB 2ZAIA 3G5XA 1GVIA 3HHMA 4HGWA 2LV4A 5IMKB 4GAAA 5E6ZA 2MCPH 2EVJA 4JFTA 1KJMB 2IALA 2QQNL 1XVSA 4G7YL 4X4XA 5T8IA 1YPZE 1RZ7H 5FF6B 4BFFA 1DFBH 4YEFA 1D5MB 2OSYA 1CLYL 5DRZA 2IPUK 3QIUB 3SJVD 3OZ9L 1NFKA 4JPVL 1T83A 4JANA 1E30A 2L8AA 4LARL 4NHUA 4RGOH 4ONGH 1TNNA 2EYSA 1BA9A 1AG0A 4L23A 5IQ9A 4EDWH 1JTTA 1LGVA 2QSCH 2XIDA 2VDQB 1QLRA 1ODUA 4JFSA 3Q44A 3MLSL 1JD7A 4Y4KB 4N90D 2JKWA 4Q0XL 4G72B 1U8PA 3FCGA 1WFJA 3MREA 2VAAA 2XCMC 5F0LB 1Z9LA 4P2RE 5MEOA 5F9JB 2HH0L 4C8XA 1W0WA 4NQDA 4M8RA 2HT3C 2O5NA 3UTPD 3CQQA 2WXIA 3CXDH 1Q9OA 4OM0L 1SM3L 3BT2H 4X7DC 4PJDE 1NICA 3N41F 2K7PA 1V10A 4S1RL 4YSCA 1IB5A 1OCZB 3EZJB 1PF3A 1W6WA 3OX8B 2ID5A 4GQZA 3IJSB 2BO0A 3BP4B 1BQLH 5CZKA 1S5HA 4HWZB 3CMOH 1MDAA 1S7TA 3ZQXA 1X9UA 5HHOB 5IESH 4F7EA 3LHPH 2ZSWB 5JQHC 1NQBA 4HSCX 5HGDB 4PWFA 1MRFH 3MLRL 2WMPB 2VQTA 5CIPH 2EDFA 3T6WA 4M7ZB 5BQ7B 1HCYA 1S9XA 5LGHL 2QR0A 2IPKB 1T80A 2ZE0A 1JWMA 2CJUH 3X3FH 1H6EA 3T2NL 3QYNA 2VLRE 1BEYL 5I73C 4I0PB 4ZXBB 1D6EB 1A7PL 5MP6L 1Z7JA 5C0BA 3BWSA 5CGYC 2DL9A 5F1IB 1RZ8B 3ZDXB 3PHQB 3P4MB 4OLXH 3DX0A 4PTTA 1AGCB 2X2HA 4R7DA 2NXZB 4W9DC 2G2PA 1HXMB 2X0UA 4M1GL 3QIWD 5SWSE 4HH9A 3TO2B 5EBWB 1W16A 1ZVSA 4A52A 3PWLB 2WSDA 4FFYH 3K6SB 3ARDC 4GRMB 4AT6B 4PJ9A 5C0NC 5ECJE 1N0LA 1XGYL 4N68A 4CDGC 4XMTA 5CP3H 3MKGA 1IUZA 2QHLA 5D8JL 3FB5B 1IFGA 2WAHA 2IFFH 2FWSA 4OZ4B 3DETD 1T2QH 1U93A 5DVNA 5HHMB 5IFHL 4DKEL 3EJPA 3BEVB 4C54A 1DJXA 5B38G 3ME0B 1ZIBA 2GJ6B 3QFJD 3KS0H 1OB0A 2A74A 2OMVB 2WLLB 3IM1A 3CLWA 4C56A 1ADWA 3A4AA 4YDVB 4FQCH 2XC8A 5GZNA 3QPXH 4DEPB 2Z31A 4XP4L 1BEXA 3UMNA 1YEWA 3IMVA 4PJ8B 4WV1A 4YHML 3BZFA 5HHXH 1JPFA 3BYTA 3MRRA 2VO5A 3GQFA 3MRJB 3WL9A 3IJ9A 5D1XD 3C75A 1T20B 2IAMC 2IBBA 4KK5D 4L1SA 5D6CB 5D7LE 5I1JL 4OZFB 3DX8A 2N0MA 3FU0A 4EI6B 3C87A 1SBSH 2DM3A 2XY1A 2GY7B 3HE7C 1TZOA 4F80A 3GPSA 3G5VB 3EOAA 3LD8C 3NK4A 1EDYA 3V0IA 1OT1A 2J25A 4U3CA 4XO8A 3ULUL 1JNJA 1J11A 2XV6B 3BAJA 3UBXB 3FQNA 4I3SL 4HKBB 3PAVA 3O2VL 4IKKA 5DQDL 4OZGA 5D93C 3UJTL 3S7GA 2UV3A 4GT7A 4YE4L 1QR4A 4F91B 2F2HA 1TQUA 3EGSA 3H0TB 1BJ1H 2F9BT 4YSQA 1KJ2H 1MUJB 1RZKL 1MRCL 4GO6B 1H3GA 2AK1L 2FJGA 4KQ3L 1HHKA 3SKNA 3QEQA 2QPSA 3JWDL 3PV6B 1YEDA 5E8DL 4HUUA 2EVFA 2C4FU 2IWGA 1AC0A 1HIML 5I28A 1RHFA 5HYEA 1T1YA 1N10A 1U33A 5JQIB 4CN6A 2FIKA 3WTXA 4OGAD 4K3DH 3ZL2A 5HI4D 3JZ7A 3STLB 2BZ7A 3I9GH 3JXAA 5DS8B 3ZE0B 5LNGA 2Q10A 1N59A 3JUYA 2GITA 4UTAL 1E5CA 4DVRH 1MJ7L 1G7MB 2XZCL 5C0BE 1O5PA 4Y5VB 4WTQA 1P7KB 4ALAH 4WFGE 4RX4A 5DVOA 1QUNB 2KT6A 1MREH 4NI3A 4Y1AA 5DWUL 2NNRA 4B9ZA 3EJYC 1N7ML 2FJHA 4JVWA 3DIFA 1NBZB 2CO6A 1BZ7A 4GXUN 4R4BB 4PCYA 1TU2B 4WO0A 2Y2WA 4YBQD 2QSQA 3WUZA 1SOSA 4GKNB 1COBA 4J3OD 2CLVB 5G5DB 1NKOA 43C9A 1WZMA 5DZNA 4DFHA 2MQCA 1CFSB 1JZJA 4ZD3L 1QFUH 2OP4H 3AQYA 4UAHA 1F41A 4HAGA 4LVNC 5FO9B 3D2UD 1UENA 3OL2A 1A7QL 3DO7A 3RWCA 1HX0A 4EIUA 3NABL 4F5CE 2PNDA 5CP7A 1INDH 1DCEA 5D7SH 1JPEA 2X05A 4Z7OE 1QYGL 2VDNB 3FT4A 3NJMA 4DPRA 5FGBC 3MNWA 1THAA 1P9MA 4OI8A 1E5UI 3NA4A 1QFHA 1PZDA 1RK1A 3IAGC 3ZE2B 5SX4H 4HAFA 3UO8B 2EP6A 2H32H 1J5OL 1QLEH 1T4KA 3T2PA 3F5WA 1AACA 4XHQA 3LVEA 3WHE1 4F8OA 1L9NA 2WM0A 3C6LA 3FN0L 3WY2A 3CXHJ 3FNKA 1OP5H 3DDFA 1CBVH 4JFEA 3SOBH 2H0JA 5FO8A 2IQAB 3S2AA 3VI4F 2XNAA 5I1EL 4LHUA 5T1KB 3C2SA 2FHCA 3MXVH 4WTZG 4J4PA 1KIPB 5AAMA 5KJ7E 5E23A 1OAUL 4YXLL 4XVTL 3PNWA 1HYSD 1XSOA 5E8NA 1CR9H 3U25A 1M6OB 2A6IA 1G9NL 1ET7A 5I0DA 3OPUA 4OZGE 4JFUA 1NC2D 4NC2B 5GSRB 4PWIA 2VDKB 4P05A 3RU8L 5ALCL 2EE3A 3RWDA 4EVNA 5FKAB 3O8XC 1CFMA 1U92B 4JPKL 1R47A 1F4YH 4LEXH 1DEEB 3GWJA 3QEQE 4L4JA 4LLDA 4PRNA 3UZVA 3NIGF 4GUOA 2F19L 5K93A 2SEBA 4QY8A 4MA8L 1OOWA 1BWWA 3MNZB 4PRAA 4GUPA 3T77B 5B8CC 4W4OA 1IC5L 4H8VA 1FO0H 1MJJB 2BRQA 2P8PB 3LVTA 4Y9FA 2ATPA 3ILPA 3OQ3B 4PGBB 4CBPA 2VQ4A 1U42A 2FT6A 4EF3A 1C5DA 1ID2A 4QTHA 3IMTA 1U8LB 3VXRE 4CU7A 2NR6C 4FLQA 4NNYB 3V4VL 1QHQA 5IUCA 4N8VG 2Y3AA 1KGYE 1CXLA 3MLZH 2WY3B 4XGZA 1BD2E 4LF3A 2FO1A 2H3XC 3EGXA 2E4TA 5F1OB 3ZKXC 1E4WH 5FYLH 3OKOA 3RAJH 5KYNA 2ROXA 3MBEB 4O58L 5JHDA 3HB3D 3V4UL 2OMYB 2OCCB 3FTZA 1KLUA 4UINH 4HPHA 3P9WB 1JK9A 1SHSA 3RWHB 1YJDL 1NGPH 3GKZA 1P1VA 1I85A 4GW1A 3ZHDA 3KJ6H 4DN3L 1F1GA 2PXYA 5CF3A 4FGMA 3VQ2C 5C2UB 3DARA 3PL6A 1A3RL 3GD1C 1HXYA 2FYYA 5GJSH 4M1CC 5BXFB 3GINA 4ELDA 5DUBB 4YDKH 1CGWA 4H8PA 4HIXL 1OSEA 4AQEB 4QRPA 4ABUA 2FT7A 4BXVA 3CDZA 1AHWC 1N70A 2WYHA 5CBAA 1GGUA 5A2BA 2G30A 1CICC 1ZD6A 1IEBB 1TVBB 3QGVA 1OV8A 5IF0A 1FNHA 3Q0HA 2ESVA 4O5LH 4YSEA 4F2EA 1RPQA 5IMMA 3P2BA 1FL5A 4Q7DA 2EIBA 4ADGA 2J4WH 1JFQH 3VFGL 1E50A 2DJUA 5KJ4A 4GW5A 2B59A 2NY4D 3NCEB 3OKKA 3QQ4B 1WLHA 4NN5B 3T6XA 1B9ZA 1P4BH 2H6PA 4HFWB 4PJFF 4NRXB 5DUPL 1O7DC 5AG9A 1ROCA 2V3FA 3EG9B 5FGRA 1F3DJ 2CUHA 3W1ZA 1WCQA 1NCCH 3WTUA 2Q9OA 5M95B 3UX9B 5E8EA 4NJ9H 3K80A 4OZIB 3ELQA 1KGJA 1KTLA 2FUQA 5MI0C 4XVJH 3EKCA 5FFLA 3LPFA 4GH7B 3ARGC 4O2EB 1EV2E 3NFPA 2Z8RA 4OCMC 3NDZE 4K23H 3C8HA 2ZIDA 4NUMA 1Z3RA 3AMLA 3NIDF 4L5FE 5EPMB 1BV8A 5AW2B 1UHVA 1UM6L 2BS8A 4JQVC 4ERSL 2OL3A 4GQPH 4R4NC 3IGKA 5ESVA 1UH2A 3B7SA 4KXZI 4Z7NE 2AI0H 4WVRA 4ZTOL 2DQDH 4XMWA 2XPYA 1KENH 3PF2A 2J6EA 1QSFD 2QDWA 4LASH 1P4UA 2AJYL 3LKQA 4PJ9C 3G5ZB 4XI5C 2TSBA 2JE8A 1K4DA 3AU1A 2A73B 1QD0A 2BY2A 1PG7X 4D9RD 4FQXD 4LSRL 4PJAB 3TBTA 2PETA 1NEZG 3NJIA 4DN4H 5L6YL 2JWYA 5AZ2L 3KPQB 5D7IE 2A74C 1IARB 3MHZA 2P49B 3Q8CA 2OJEB 4PRPE 4KJQC 4PR5A 1UKSA 3ZE1E 5JHDE 4AC4A 4OB5H 4LZKA 1DBKL 4LSUL 2Y72A 5GZNC 3AU0A 5ADPH 4NWTL 4QOKD 4YO0A 3OBAA 2YUXA 2EC9T 3TJEH 1T6VN 3ZHLA 2P7TB 5GJTH 2B1AL 4B96A 4FI6A 1PPIA 3RFZC 1TTFA 2WOYA 3FFCB 1WAAF 3UH8A 4CADA 2GVYA 1L9RA 2RACA 5AW5B 2HLFC 1H5BC 4YNYB 3ROOB 5HBBA 3FQWB 4HCRL 2A9NH 3D39B 2Z7ZA 5JW4Q 5ANHA 1U58A 1JV2A 3VXOA 2QKSA 2OK0H 3LZOA 4MJJA 3GIVB 3QPQD 3EJSA 4G6FD 1SXAA 4N85A 4PJHE 1Z9PA 3MFFB 3ESOA 4O4YH 3DKHA 2AZAA 4JG1L 3I50L 1BFOA 2EZ0C 4HX1A 5I73B 3CVCA 4NHCH 4GXUM 1TJHH 5A16B 4ZNCD 1T6WA 4M61B 1JZHA 4GNKB 5E1AA 3WAJA 4QJ3B 3RX5A 2ICES 2WAQA 3HW7A 1WD8A 2IIJA 4J3UA 2V5MA 2DMHA 3QWRA 1UYWL 1NLBH 3SPVA 4K7PH 2YOCA 4KX7A 1UD5A 2VLKD 1H3VA 3PGFH 3QORD 4G1MB 3ZK0A 2HT4C 4MSWA 3T0ED 1IKNC 1TITA 1CGYA 4Q9QL 1A6ZB 3Q6FA 5GS3A 3GSNL 3OKDA 4NOFA 1VFUA 4CVWA 2HX7A 4OSUL 5F3HA 2JELL 3S96B 2H1XA 3NZHH 5L8JB 4AW7A 5J6GB 4JG0L 1DDHA 5CCJA 3NOIA 1KSRA 4HHAB 1IGIH 1GC1C 4BH7B 4Q9RL 3MKKA 4KNUA 4X4MA 4TQEH 3V95A 1JN6A 4DESA 5IG7A 3BUDA 5EBMB 1AE6L 3HFMH 1E65A 4LCYB 3UYOD 5J1AB 3QO1A 1NC2B 1IIIA 3VXTA 2NY2B 3ULUD 4TSAH 4DGIL 1TJIL 4MDJA 3SBQA 5IB5B 3SPHA 3FQ4A 2IAMB 4H20L 1SEBA 4XP9H 4XAWH 3KYAA 2X44D 2ZTBA 2Y22A 4MNHA 4FZEH 4WY7L 3MYJA 1MLBB 1J87A 3HE7B 2R0LH 1MCIA 3LD8B 2R0WL 3SE4C 4NQEA 4BFNA 1X7SA 1E9QB 2J12B 1UWYA 2H0FA 3UJJH 2YD5A 1S7SA 4HPYH 1ZCRA 5EZLB 1EUUA 4HZAA 4I9XA 5B3NA 1L7IH 3W0WA 4LSPL 1OGTA 1P9MC 3KWXA 1LDSA 3LKRB 4ODTH 5FK9B 3BN3B 5T3ZH 3RDTC 4N2MA 2R1WA 4AVHA 1QWUA 4GLRI 4UT9L 3L4CA 3KDPB 4G3YL 5EBGA 2W9DH 1VFOA 2HCZX 2P3YA 1KTRL 2IJ0C 3FPXA 1A3ZA 4RQQA 1DEDA 2IMMA 3PHSA 3APNA 4U0QB 4CGTA 4R8WL 3Q48A 5TQ0L 2YAPA 2BFVL 2YC1A 4XNAA 5F7NC 2PYEA 3GXFA 2VT0A 2UWEA 1DVFD 4FKKA 4GXVL 2NXYC 3HZVB 2ICWI 5FPIA 5DLLA 4QXWA 2IH1B 3VJ6B 2APSA 4HIQA 4OFKA 2MQ0A 3MJ8B 4FYSA 1NAKL 4KUCD 4U1LA 3SQBA 3X11A 5BZZA 5DRXA 1VEOA 5HGAB 2YAMA 4AJVA 2OJZL 2NY6B 1NCOA 2BY3A 4WTWA 2M1KA 3FQUA 4GMSH 1K5NB 1E27A 3TN0C 3CN4A 4TNFA 3CBJB 3PGDB 3TBSA 1ORSA 1BP3B 2BP0B 2H45A 3VD2A 1K6QL 3N42B 3VH8A 5IVXB 5IW1B 4LRIC 2RGSA 3VWKD 4YBLC 3MRDB 2VCOA 1JHTA 2KDYA 1BPLB 2OZ4H 5IHZB 1RPKA 4LOFA 1N5AB 1WT5A 1X5XA 4POYA 1HSBB 4X4ME 2WLJA 1Q72L 1PTZA 2PWEA 1CL7L 4O02A 2ARJQ 2ZXEB 1HHHA 2IDCA 3ATAA 1P6AB 4HC1H 5BJTB 3EDEA 3FYIB 1MCWM 3VFWB 2WZ5A 3A22A 1DVZA 2MIZA 5DTFA 5JYLA 3ZUCA 4ZBJA 3D8MA 4RMTA 5AW8B 1A5FL 5BO1L 4FA7B 2J71A 3QEHA 3BC9A 5K9OB 1ZHBB 5BS0B 1AQDA 2Y36H 1H0DB 5H94B 3PL6C 3T71A 5IQ7H 1IQWH 1ZLUH 4K9EH 1AQ8A 3Q3GB 2VIRB 3VXSE 5F3BB 5AYQA 2VM4A 2EKSB 1S9WA 2QPFA 4Y16D 4NQEE 1UT2A 2I32A 3UTSD 4HF5H 2HTKD 1ETB1 1NJ9B 3MA7B 1UVQA 3WAKA 4OFYD 2EEBA 4Z7QB 2CA3A 2BP8A 3W0WE 1KGWA 4LSQL 3LY6A 1AH1A 4XXDB 1UD4A 2CO4A 2WLNA 3F7LA 3B5HA 4P4KD 5B3SB 3MRBA 1RZFL 2ZYIA 4HD5A 4A7GF 2DMCA 2EUVA 3LN5B 3QG7L 4F27A 1KBPA 3APCA 2O5YL 4IHOA 1SOKA 4QRQA 5FKPA 2FTAA 3T5WA 1ZV9A 4DW2H 3OHXC 5F88A 2PYEE 3MRIA 5F1SA 2G60H 3QULB 1B6DA 2UWEE 5EIIB 3MA9H 3SDAD 3U79A 2PR4L 2R0KH 1WHOA 5T33H 3WELA 1RUAL 1S3RA 3PU7A 5KEZA 1F11A 1OE1A 5CM1A 5DEFA 2WLHA 2AJUL 5EOQL 2EO9A 3WSQL 3BFWA 3DXAA 4YUEH 3WE6A 1D9KC 3RQ3A 3BAWA 1T0PB 2FLMA 1RZGB 2RMNA 2VUKA 4HUVA 2C3GA 3L81A 4MJIB 4Y9EA 3WNLA 4DZ8A 1N3NB 1VESA 1S9VB 2EICA 4TNVF 4TTDC 2DM2A 4QYOB 1TFPA 1QBAA 4DKFH 2B7DT 3FO9B 2DWEB 4HWEL 3MBWB 4U7MA 2R39A 1G7IA 4TUOA 4DHLA 5IT2L 3L4VA 1NGWA 4TNGA 4U6TA 5DJ6A 3X1EA 3FT2B 3GNMH 4PGEA 3DECA 1FCCA 1XD1A 1MOEA 4BZ2L 2EE0A 3JVFC 1A4KA 1U0QA 3W37A 3MZTA 4XCYA 5C0CD 3QORB 3DURA 4F8QA 1CICB 1H3WM 1ZTXE 2BVPB 4HKXA 4PRHA 5TFSL 1E4KC 3W3BA 4NPKA 2F5BL 1B9KA 4S2SB 5EEYA 3AWFA 4LLQB 1KJ3H 3S5LA 5J89A 2AABL 1RSFA 3OAUH 4X0NA 3IMRA 1JNNH 1LM8V 2YUWA 4GP4B 1X9LA 4OLWH 1UUNA 3T6QC 5I5RA 3V8OA 2WZ6A 1AOZA 4R7NA 1XMEB 1I1YB 1XDTT 5KBPA 4TQPA 3HRPA 2DN7A 4DKAA 1KB5H 4KKQA 4N87A 2ZAHA 1RJZA 1GGCL 3NA9H 2YD9A 3MV9D 2AFNA 2FVNA 3TP4A 3ALXA 4K5NA 3WXWH 4F3FA 3AAZA 3DIDA 1SN0A 1SLWA 1S8DA 3WJMB 1G6RH 4D0DB 2HX8A 4P2QD 5AKVA 5FM8A 4UOW0 1T1ZB 3PP3K 1IC4L 2X6AA 4X8GA 1AGFA 4ILDA 5MI0B 4ODXB 1W72H 1XIWA 2E7LA 1WBYA 3QEGH 4YHOH 3CDGB 1K8IA 4ZMVA 3V0VA 3GI8H 3D6GA 1ZHNA 3BP7B 4MX7B 3LZLA 3N44B 1Q1JL 1MH5A 1R3IH 5J0BA 2HKFL 4L8DA 4PHXA 2OTWB 3K4AA 3RJOA 2EABA 4A2MA 4B60A 5TE4H 1DTUA 5D1ZC 1QASA 5J12B 1XR8B 2J44A 2NUPB 1FGVH 3GDBA 1XBDA 1NANI 2ED8A 1MAKA 4FZ8H 4IRJD 5JPNA 1K2DA 3OTTA 3MRHB 3FZUD 3LS5H 3ILQD 4KMTL 4ZUTA 1T0NA 4HEME 1X9RA 2D7TH 3CC5B 3TBBA 1YMMA 4D8PA 3DX1A 4F15C 3O3EA 3SYOA 4HAKA 3MRFA 4YSUA 3VD4A 2OV0A 2FX9H 3B2DC 4EIGB 2Q3XA 5HJDA 4ZPTA 2CDGB 2YD0A 5C08A 1ZLVH 1KCVL 4I3GA 5J11C 4XNUH 3ZL1A 2AJVH 1D7BA 5HD8C 1S7UA 3H3PH 5EF0A 4NNXB 3DXAE 1UXWB 3VQLA 4F37F 4AX3A 2KDGA 2WBJC 4WHTA 2E7MA 3H42H 2DYPB 5DVLA 4DKTA 4EZLA 4K3EL 1H3TA 3GJEA 4XBEH 4XXCC 3WO4C 3DC0A 1EJ6A 4Z7OB 3F7VB 5I1DB 1QBMH 5IBLC 4Q9BA 3TVMD 3IDIA 1YDPB 3RFZB 4RMWA 4J3WA 2OPCA 2X4SB 1R3LB 5ETUA 4LSVL 4Q52A 3A6BL 3SKJH 4TNEA 2ZG3A 1M2VA 2YPKB 4XX1E 8PAZA 1H15A 3QQDB 1AO7B 2E59A 5GRJL 4LO9A 1N2RA 4LAQH 4ORGA 4PRHE 1VKXA 3EBAA 1FFPA 4ISVA 4DNLA 4HD9A 5I19H 4ZAKB 4P2YA 3MOAL 3KJ4C 4MQSB 1A1OA 4MNQD 3DGGA 4PV8A 3HS9A 5F7DA 1A3QA 3I6KB 2CRMA 2BCMA 3AC0A 4JE0A 4V1DA 4A67A 4BXSV 1FE8H 4KVNL 5K69A 1UXSA 3F84A 2JK5B 3C5ZA 3HS0C 3UPCA 2R69H 3BVNB 3LH2L 4I87A 4PJIF 1I8MB 4RRPG 4P57A 2EDDA 3AS1A 3EHBD 1R24B 2DEYX 2WUCL 2YZ8A 4PJGF 1RZJH 4U6VH 5BQDA 3ULAB 2AJZB 4P49A 1A7RL 2BDNH 4G8FB 3BQUD 3BD4A 4J3VA 4PJEB 5DJZB 5DRNB 5IOPA 2C9QA 4NKDA 4P59L 2NLJA 4JRYA 2WXPA 1I8LA 3NAAH 1SXBA 3CFIC 3VI4A 4PY8J 2IMNA 4E0RB 3S36L 3KPPB 3UIZA 4RIRA 5KSAA 4KTEL 3U6RA 3AREA 4HIJB 3U1QA 1V8HA 3DTXB 1R5IA 2BIOA 4OH2A 4J3OH 4OW6A 5J8OA 6TAAA 1JXJA 2XXFA 3H2QA 4GAYA 4N2AA 4R26L 3EJUA 4QXTB 1ZTMA 5E7FA 1CDHA 3EZ8A 1C12A 2VUOA 1NA8A 1BD2B 1DCLA 1Z5HA 4MXVF 3UTSB 1NBYA 5FO2A 1T7VA 4NPYB 5ISZA 7CGTA 2P80D 4WNQA 2ZCLL 1MCFA 2EIZA 1NGZA 4IOSA 1ZT4A 5F9OL 5FUZH 4P4KB 4JFPB 1DSYA 4RSVA 4FN0A 4MAZA 1MI5A 4KDTA 3BIKA 4N0CC 3S37X 2VDML 4WTZA 2OXGA 3QDJB 3RTQD 3UZEC 2PWHA 5C08E 2VB5A 1NIAA 2GAZA 1I9RH 4ZFOB 3V4VB 1IAIH 2CIKA 2X4TA 4F1SA 1U8QB 3ZZLA 1QA9B 5DDHB 1KLGB 2HFGH 2UVEA 1FN4A 3CBKB 1KV3A 2DLHA 3O3DB 2CUMA 2LVEA 1KIUA 3GTNA 4MXQC 1ZWIA 5JA8B 5IHWA 4MMZA 1OAXL 1Y1UA 2NY1C 1IV8A 2E4FA 1XWVA 2OMUA 3PJLA 3IJ8A 1IIKA 4WI0B 5H4YA 3UXFA 2AJ3A 1DQJA 2YFNA 4FCAA 5GIRB 3H8NA 3RDTB 3JTSA 1E9OA 1N6QH 2VKWA 4JVPA 4C59B 4XP1H 1HSAA 4OLVH 2JB6B 3BVTA 1U3ZA 2PO6B 4MASA 4Q9CA 4Y2DA 5F97E 4G9DA 4YHKL 3KXFD 3O45A 4KI5D 1NCUA 4XRCA 4LL4A 1GTFA 1TO5A 4DQAA 4N8VA 4S11A 4EI5A 4Y5XC 2NXYB 4C4BA 3TGXA 1YC8A 4YXKL 1WC7A 1RFDH 4P5TA 1K8DA 1CXFA 2VGLM 5CU9A 4CKVX 2WXHA 1OPOA 4TQHA 4AC2A 5CJBA 5E0QA 4GRWF 1S7WB 2BWIA 2XWXA 2OSLB 3EYSL 5B1JC 4J23A 4HULB 4PJFA 5T1JA 4ZMZA 1Y18B 3W57A 1FFNB 4DO4A 3GUTB 3RL2A 3MJ9A 4UIKL 1KTDB 1OARL 3TN0B 3TF7C 2FO8A 2HLEB 4MCYB 4P04A 4A6YA 2VDPH 3ARBD 4JAMA 4NQCD 3N43F 3WLWC 1WHPA 1CI3M 1IFHL 4M5ZH 2YJQA 3CUPB 3BKCH 5AUMA 3SODB 1BOGA 4Q4IA 3AABA 3FU7B 1MJUL 2JKNA 2DM7A 1BDYA 2F8OA 3FCSB 1XF3B 2WTRB 3A47A 2A9ML 4PJBE 1LJMA 3TEZA 4P2QB 5TH2B 4POZD 4PV9A 1XR9A 3DVNB 4PJ7E 4JFQB 4U1MB 4PRPB 4NUGH 2IAAC 5EA0H 3FRPG 1RJCA 4IBZA 3GLDA 2CRYA 3B1TA 4B27A 3NP3A 3NIGE 1CF1A 3VW3H 1WV7T 2XFXA 2XWBA 2Q8BL 2GFBA 3LPWA 4OKDA 3FQ2A 2VXQA 4KJPD 3S8FB 2Z91B 5DD1L 4IRZH 1KZYA 3VGAC 3QC6X 5EEVA 4IRJB 1UJTA 2KZWA 1E3ZA 2VABB 1I1CA 5D9SA 5DZAA 3U1PA 2GYSA 1T66C 2IG2L 2LVCA 4JKMA 3L54A 4Y19B 1OF2B 1TMCB 5IB1A 1A9EA 3MLWH 1CDCA 4RGMC 1SJHB 3WIHA 4BFIA 2QQNH 3GXDA 4G7YH 3QR0A 1N5YH 1G4MA 2K4AA 2ZCKL 3SBWA 5JHLA 1KMGA 1D7DA 1CLYH 3P77B 3C09B 4UBDC 4XBGA 1NC4B 3DTUB 3OZ9H 4PLJD 4JPVH 2D3VA 3CSYA 1KN2L 5CJQL 2VW7A 4LARH 4FDWA 4PP1C 1I7ZB 1I8KA 5DURB 5FA3A 1WAAA 3RNQB 4PHZA 4LLMA 1G1KA 4HJUA 3VO0A 2P8LB 3CBRA 3MLSH 4H26B 3OHXB 2ITDB 3C8DA 1ZY9A 4EN3A 4Q0XH 1L6ZA 1HVXA 1NEZA 2GK0B 1KB9J 1RK0B 3HR6A 2BNQA 2HH0H 3ULSB 5B22A 4L3CA 4AXWB 1VF5C 1QW8A 3DX9A 1XIWC 3GXTA 1TVHB 3MRCA 3O11A 1SM3H 4ICXA 4LE8A 1F4AA 4OM0H 2E7LC 4DUWA 3SY6A 4OV5A 1F2XK 4FNUA 4S1RH 5IKCA 3CZSA 1EZVY 1VFBA 1XB3A 3KCPB 3LRSB 4YDIL 3L45A 4GFTB 4LHQB 1MFAL 3GKWL 4JKKA 1KIRB 5G2NA 1NDGB 2C3WA 1M71A 1MDTA 2H0PA 2X1WL 3V5HB 1JHKL 1I3GL 4JBSA 5F9AC 5JW5A 4BKTC 2NT0A 4OJDH 1YG9A 2D4FA 3MC0A 2X2IA 2YN3A 2FLRT 2GW5A 3LB6C 5CLZA 4FTVA 5LGHH 3CV5A 1LK2B 3MRGA 2Q7YB 4GBXA 3HE6D 4L18A 5F8RC 5C0GB 4NYLA 4AM0B 5DJYB 4BIKA 2QMJA 3F58L 3QNYA 3T2NH 2ITEA 4NKIL 4GAGL 1BEYH 1FH5L 3G5YA 4LMQE 2RQEA 1A7PH 5MP6H 4JREC 3VXUA 3IJHA 5BRZD 2OR8A 2X89A 4FNRA 3IFPB 4GEIA 1HXKA 4M1GH 3HAEB 2KQMA 2BP3A 4OQ1A 1TZIB 2YXFA 4D3CL 3L7EA 5JIQA 2W65B 1T04A 2DW5A 2XWJA 4YLCA 4U1JB 1XGYH 3KYNB 4S1DC 4UTBL 1YRKA 3HN8A 3LZNA 4B9JA 4BFOA 3KYMA 4FEIA 3WOVA 3OR6B 4QF1B 5SWZD 2HRPH 5CNHA 3WMPA 5AB1A 5IFHH 1GZQB 4DKEH 3KNBA 3VFUA 3ZGPA 4P2AA 1TTGA 3PE9A 3MGAA 1XQ4A 3GBLA 1YLBB 2XJKA 4XWOC 1CQKA 4HIEB 1U8IB 5K5YA 2AV1B 1F4WL 1IM9B 1WZLA 3AZUA 1I1AD 3OKEB 3RTQB 4B9GA 4A7UA 3HBPA 1MHHA 2ZYHA 1OCWL 4XP4H 5LG1A 3QZWB 4JQIH 3ZTJH 1PZCA 4YHMH 4UQ3B 4YLBA 3FH7A 3RZCA 1T1WB 4P9ML 3U0PB 5IV2B 4DP9X 5EUKB 3HIZA 2XN9D 4H25B 2ADJB 1CYXA 2O93L 5J6HA 2VW4A 5FV1L 1SF5A 1ZANL 2AF2A 3GSRB 4GRLD 5I1JH 3ZR6A 1WAAE 4NZRL 2AQRA 3B7TA 4G7RB 4NUJA 3Q8FA 2WHVA 4DK5A 2DI8A 3UTQB 4P5KB 4JM4L 3ZBMA 3E38A 2X9WA 3ULUH 3O4OC 3KH3A 1BAFL 5D71L 5CEXA 4I3SH 3TESA 5KSAC 3VXMA 2MKLC 3O2VH 1P0SE 4M62L 1UCTA 3O6ML 3KXFB 3UJTH 1O6TA 2WBJB 4YE4H 4PWGA 4WK2B 2NSXA 1ODAA 4P48A 1FIGL 1PKOA 2Y7QB 5IGXL 4WI2A 1RZKH 1MRCH 5JZ7D 4KQ3H 4LVOB 5GGRY 5LBSL 3JWDH 1E2ZA 3CPLB 1L0QA 1K3IA 4X6EA 1BXUA 5E8DH 5A6LA 5D5MF 3WKQA 1HIMH 3PWPB 4AENA 2WQAA 3KPMB 3W5NA 4WI3A 5DJ2B 4P23A 4Z77B 5C2BL 4FTVE 5DHDA 2YIHA 4D7BA 4HJ0D 3ZTJG 3K2MC 4KDTC 1XGUA 1BVZA 3QJHB 2VMEA 4OUUA 3O41B 1J8RA 4TOYL 3C6SA 4U49A 4PLNC 5C0EB 3O3UN 4UTAH 5EWIH 3SO3C 1MJ7H 2XZCH 3VXSB 2G5UA 3VXUE 2HAZA 3VAEA 3ARBB 5B4MD 3KJ4B 2XX0A 4WI9A 1DVQA 3A3YB 2Q76A 4JPQA 5DWUH 3IJ7A 1N7MH 2J21A 5AG8A 3HS0B 2YR3A 2BVOB 3ABZA 1MF2L 4G8GE 5A6IA 2R27A 3F3HA 3U46B 5ABZA 5KS9B 2VLLB 2YPVL 4JRXD 1RHHB 4AUYA 3WKYA 2XFGB 4I48B 3BZEA 1UZ6E 4QXUH 3CLEL 5E03A 1WA1X 1AKJB 3QUYB 2XKUA 4HV8A 3RVUD 5E9DE 5LHDA 3TURA 2X4QB 1A7QH 2NX5D 5CEZE 3MACL 4OLEA 2J6WA 3NABH 2JIXB 2HG0A 1CD1A 2CDEA 4ZO7A 3MCG1 4H0GA 5JPMC 2C9VA 2ZOOA 5AKRA 4R0LC 5AW9B 1QYGH 4WJKB 1Q0XL 2ZUSA 4MAYC 3BUQA 1KGIA 1HDMB 4UU9A 3GXNA 3V5KB 3K2KA 3K6NA 1KT2B 3JBG7 3BZ4B 4GP5B 3L5HA 1P1ZA 4N2HA 3ROLB 5EC2A 3ZKSD 2A9AA 5C07B 5E2JA 3DOSA 4HXAL 3EJTA 3FN0H 1NIFA 1SUJA 1WFNA 4KHXL 3STZB 4A7GA 1E4XI 4XTRC 2FDBP 3CIAA 1QKZL 4RMQA 3S98A 5MEQB 5I1EH 1XH3A 1KFAL 2X28A 2X4UA 3Q2CA 1OAUH 2FQGA 2ZCZA 1R33A 2Q2EB 4XVTH 4U1GB 4XR8C 5ID1B 2ZCHL 3VXME 3WEAA 1G9NH 4P46A 4G80B 2XV0A 1OL0A 2B8OT 2ZOKB 1UACL 3IPFA 3QQ9C 1QBBA 2W0FB 3RPIB 5ALCH 3RU8H 2P48B 4LCCC 1IFRA 3UTTD 3VD9A 3D3VD 4X5WB 4JPKH 1ADQA 3VXQB 5JW3L 4HKZA 2NY1B 3H9HA 1X5JA 4F2FA 3LEXA 3T0XA 5C3IA 2HZHA 2ZXGA 2MMXA 4ZMAT 5IW6B 2J8OA 2F19H 1VHPA 3HPJA 4BBWA 3O4LE 4MA8H 2XIBA 1B4JL 4HJEA 3FN3A 3FSVA 3SDYL 4YS4A 4JO8A 1M1XA 1J05A 2X4NB 4IU3A 5GSVA 3B3BA 3T3PB 3V8CA 3QUXA 2AXJA 5E08L 3DV4B 1D3CA 4HC1A 3BSHA 4ZS6C 2GBTA 3H9SE 1E43A 1TQVA 4K8RC 5I1CH 1ONQB 2OSXA 4CN1A 1OP5K 2J88L 3RI5F 1OVZA 3GMLB 5L0QC 4MJ5B 5E6YA 3VFSB 3ARSA 1PD6A 1OLLA 2W5PA 5CWSA 2D7NA 3W2DL 4KUCF 5EZJB 5DA0B 5C0IB 2Z35B 4PBDA 1DVSA 2R2HB 2QV2A 1EIBA 4M5YH 4KZCA 4O58H 3V4UH 3OKMB 4MQTB 1T3FB 1DL7L 5KWYC 4C58B 1YJDH 4TLTA 2HFFB 2M26A 3POCA 4DN3H 5BPPA 3SBWC 4XNXL 1DBML 1MW2A 1A3RH 3PDGA 5CO1A 5L4IA 5I1KL 3EAKA 3FO1A 2WCSA 5KVDE 1DJYA 2IXQA 3KPOA 3TBVB 4HIXH 1SDAB 2HT3D 3N1GC 1FFOB 5EZPA 4OIFA 1MLCB 1UJ3C 2OYMA 4A37A 2VN6A 3U4EB 4CNIB 4YQXL 2J2ZB 3FBQA 4JFHE 4PU2A 2CIIB 4EN3C 2F58L 3MJ7B 2R0ZL 2DL2A 1TDQA 3PY9A 1UZ8B 4LOUD 4LNRB 5SWZB 4BCZA 3VFGH 1OD9A 2UYLB 3MRKB 4G7VL 1WH0A 4JFYA 5DHYA 5I5JA 4BH8B 5JNYA 1P53A 4Z5RA 1I3RB 1A0QL 1AD9A 4HIIA 5FIEA 2PPDA 3UDWC 1XB6A 3P0YL 3V4PA 1MW3A 3SBPA 4JHAL 4KPHL 2GSIB 3OG6B 5E2WL 3SJVA 3AB0C 3LQZA 4FERA 5DFWH 1ZJBA 3B6SA 2PMZA 3I75A 3AXLB 1OF0A 4IOIB 1DQQB 5T1LD 3RWGB 4LCWB 2EC9U 2NQCA 32C2A 3T04D 4WO4D 1CBJA 5LWYL 2F7IA 2FH6A 1OP3H 5DHVB 4HGMA 2I24N 4W9IC 1FVDA 3IJYA 4HBCL 1ZT7B 4J7RA 2AXFA 4LL1A 1U8HB 2UZYB 3UO1H 2IANE 3P3UA 4GRLB 1IX2A 1U95A 2WQ8A 4CSPA 3GYRA 1DJIA 4GBXC 1MCCA 3ILDA 2MPAL 3J8F7 1CG9A 4XO4A 1M7DB 3TA3C 4F2MA 4N8CL 5LDSA 1UM6H 4ERSH 3T0DA 1A1NB 1K4CA 4OAWA 2YPLE 5ICZA 3NGBC 2VC2B 3PAZA 1ZJAA 2ADGA 4C57C 2ZKWA 1LEKB 3FT3B 1EJOL 3I9PA 3SHSA 4X99B 1RULL 2H4EA 4I2XB 4ZTOH 1IMHC 3NJHA 3CDFA 1M7IA 2AJYH 2DWDA 3CZFA 1T7XA 3WFZA 1S78C 4I7ZC 1HHGA 2XPZA 3A0OA 2NTSP 4F1ZA 1A4BA 1SQ2N 1S2EA 4RA3A 1JIBA 4KDVA 2FD6L 4LSRH 2BSSB 4Z76A 1WO2A 2N4IA 2Y5TA 4BWWA 5CGMA 5LN8A 5L6YH 1PJ9A 5AZ2H 4RFNB 2X12A 5F71A 1BQHA 5FGSA 1AGBB 1TLMA 3EFFB 5TF1L 1R5WA 4MD5A 1DBKH 4LSUH 2CLRA 4NWTH 5DMGC 3TZVC 3B9KB 3OB8A 4HFUL 3TIDB 1XBRA 1J7VR 5IQOA 3VWJD 3QUMB 2B1AH 4LDOB 4PJIA 1YEHL 3ZX1A 3D52A 3S34L 5HI3C 1GGYA 4X50A 2GY5A 4P9HL 4PJGA 3W38A 2ICWB 2P5WB 6PAZA 3GK8L 4HCRH 5MEPA 4ETYA 3MR9B 5DFTA 4RESB 3HNSL 5JOEA 4XE5B 4BZ1A 4EUPB 3IF1B 3VB9A 4G9FB 4RA0C 4JRXB 4ZUUB 4AJWA 4JG1H 3M8OL 3I50H 4YGAB 5FWRA 1FL3A 4LOEA 1AP2B 3SOTA 3V7AG 4I77L 4NN7C 2NX5B 1I7UB 1F3JA 1F3DH 3CDYA 4QEGA 4RRPA 4OU3A 2JJVA 4W9ZA 3VVVA 4QMEA 1MNUL 2GTZA 1QVOB 5KBLA 1JF1B 2EXWC 4FFZA 5EHFA 4YHIA 4WW2C 2X2UA 3BWAA 1QFOA 4Q6YA 1KGCE 3JWNG 2P8MB 1U4FA 5ACZB 1YY9C 1UB5B 2L3BA 4Z7VA 4EO5A 4Q9QH 3RL1B 4U0RC 3GSNH 3LV3B 1L0YA 5B39G 3I02B 4OSUH 2JELH 3BO8A 4N6QA 2D3NA 1VFAB 3U2IA 3C5SA 1JHLL 2XV3A 4WFEE 4JG0H 1JZ6A 5LAXA 5LQBL 1BVLA 2HRLA 2EO7A 3UYPA 2R2BA 3WIIL 1R0AL 5D96C 2XETA 3EDDA 4Q9RH 5T1MA 3RILA 1IEAB 4HIHA 4F2ME 1TSHA 2D3JA 2R9HC 1RJLB 2J43A 4XNDA 3LCYA 2V2XA 4P2OB 1AE6H 1XGQA 4GSQA 3BGMB 4FULA 1QLFA 4L5FL 3DMMD 4H2CA 1SY6A 2VDRL 4DGIH 1TJIH 3Q06A 3UTTB 3D3VB 2PTUA 3FO2A 3QUZD 4H20H 5LUMA 2D2CC 5F7LB 3WKMH 1WIUA 2WCGA 1CLZL 4WY7H 3LXAA 4P2RD 3HG3A 4PS7A 3W9DA 2YD7A 4DETA 3OXSB 4HDIB 4FTDA 1CU4L 1AGDA 2R0WH 2XN1A 2YGPA 4Y5YC 2CUAA 1JF5A 3IN2A 3O4OB 2BCKA 4XP5L 2DWXA 2JJSC 3THMH 4R2GC 1IU1A 5CJ8A 4FL4B 1KG0B 2WZAA 1T0MA 3U9UB 4LSPH 4TVUA 1XH2A 3ZVVA 1B0GA 3BW9A 4F7MA 4WHYH 2WQUA 3CSBA 5DXWA 5KANG 3MRNA 3RKPA 3QE5A 4PJBB 4PJIE 4APXB 2QL1A 4G3YH 1Q94A 1QACA 3P11L 1FZKB 4PJ7B 4PJGE 2XWEA 1JZ2A 3MV11 3JSSA 4PAZA 4BINA 4I1PA 1QNZL 2J8UE 2P24B 4R8WH 2VLJE 5E00B 2BFVH 1OGAE 1P7QB 1E9PB 3D4ZA 1EDQA 1QSEB 4ENEC 3O8XD 3QDMB 1DLHB 4GXVH 4UAOC 1MFMA 2XT1B 4Y2OB 3H54A 3Q05A 2AK4A 4CJ1A 2W80C 3EYOA 3FK3A 3GMOA 5SWSD 3TJHC 2P5PA 1OD7A 2ADIA 2Z7UA 2OMZB 1NAKH 4PS3A 4UQCA 1KYAA 4PGCA 4WZ9A 1G9MC 3WN5B 2ATAA 3BLKA 1EEQA 4GG6F 3CX2A 4ONHB 2OJZH 3S3PA 2V2TA 1MHCB 1P5VA 4ZMOA 2JQZA 5DJXA 4Z7VE 5C0AA 3VCLA 1XCWA 3KWWA 3LH8A 4AY0A 2HA1A 3RVTC 1F45A 4WFHE 1K6QH 1AR1D 2CO1A 4WHYG 3L2MA 4XWGL 2X1QA 4JPSA 4HIPA 4UMGA 4RAUB 3GBML 5ANMB 4XNYL 5I1HL 2VOTA 3S97C 4WO4B 1Q72H 3BWUF 1KWKA 1CL7H 5JPMB 1LL1A 2WSKA 3EYFA 3L3OC 1IQDA 1IVLA 4JHZA 1OTTC 1IKFL 2EEAA 3D4YA 3ESMA 4GOSA 4GS7C 4IDJH 3VE0A 3GI9L 4M1CD 3FRPA 5HY9A 2CO3A 3PHOA 4CW1B 4U1HB 4X0KA 4UQ2B 1KLFA 3NTCL 5AD0B 2BC4A 4DO5A 3KVQA 4PIBA 1A5FH 5BO1H 2WWNA 1S5IL 4TUUA 5HDOA 1AZCA 3WD5L 1OXYA 2J5LC 5T3XD 1GIGL 1R5VB 1M3IA 2I26N 1NGYA 1JPSL 5E99L 2JCCF 4Q6IA 4NQDD 4XNZC 5DJDB 3IBEA 4JHWL 5I17A 4J3TA 3FONA 1MHEA 2GUOB 1UEYA 5JIKA 4UQ9A 5GS1C 4HK3J 5SWQB 5A2IH 1OCCB 5TDNB 3RIAK 4LGPB 3CVHB 4W9KC 1IILE 3KPSB 1OSPL 2IADA 1H19A 2YN5A 4OZHB 1TUPA 4LSQH 2UZIL 1FBIL 3T1FB 3MBXL 4JO3L 4LCCB 4FQHB 2UX6A 5HYSB 1N64L 3NK3A 1P5UC 2FQDA 3VXNA 1RZFH 4I85A 4TNVK 5FHAL 3SPIA 3QG7H 5KUMA 1MIEL 2O5YH 3ECUA 1GGIH 4Z7UF 3TEXA 3VDBA 4QRSB 4MA3B 3FTGB 2O6CA 5KSVA 1XCQB 3CIQA 3QEUB 3VWJB 1WG3A 3DJ9A 4RFEB 4YHLL 1FA4A 1F42A 2PR4H 1CZ8L 5KYYB 4MS6A 2Z34A 3RGVA 1GPOL 1UD2A 2C9UA 5C0BD 1DE4A 4F7PB 1CQYA 2NSQA 2QLYA 4WFGD 4GQRA 2BIHA 1EK3A 4GAJL 3DI2B 4U1KB 5EOQH 4X4YA 3WSQH 1ZEAL 2GBVA 4KY1L 1SN5A 4L29B 2IWFA 5LXVA 1KXQA 4PJ9D 4XI5D 3VMNA 3IRPX 2JKJA 4TLSA 4Y8DC 5L2JA 2ICCA 3LPPA 1BX2A 3DX6B 4BFBD 3KPRA 5C0AE 2R8SL 3QO0A 5IT2H 3I3BA 3L3JB 3QH3B 2YAHA 3QCTL 5KYWB 5KUKA 5A7BA 5CN3A 1MFDH 4RVBA 2VL5B 2FH8A 3O3AB 4L4TA 9PCYA 2O6FA 3BYYA 2VISA 3EGDA 4P8QA 4BZ2H 1HHJB 3B5TA 4X6FA 4C56D 1NOAA 3KYKL 3A5VA 3H3KA 1ROWA 2PABA 2V7HA 5IB2B 1UJ3B 5GZND 4Z7AA 4Q2ZA 5E70A 5F89B 2Z31D 2OQJB 1U8OA 4LGSB 5AVYB 5TFSH 2VUYA 1QR1B 2F5BH 2AABH 2G3MA 4KZ0A 3QXDA 3A23A 2EO1A 2R29A 1CMOA 3LKOB 3CZKA 1PQZA 3QIBC 5DK0B 2H6UA 4XMVA 3U0TB 2HLFD 1CB4A 4NSKB 4W9GC 4MAUL 3RB7A 2DWTA 2A4CA 2W0PA 3ZDYB 2H2SC 1J0KA 3AB0B 4ZX3A 5JDJA 4M3KB 4L0ZA 3QNXA 2ERJC 1SYSB 5LBVA 1GGCH 1T7WA 4FNPA 1WITA 5E6IA 1Q9WA 2KZ1B 1FC2D 3QAZC 5DD6B 3SDXA 2A6JB 4I88A 4GKSA 3PQYA 2PYFA 2EZ0D 4Y1TA 1IM3B 4MD0B 2NPLX 4JEGB 4E5XG 1IC4H 1JV5A 4HMDA 3NJFA 1TKWB 2ZXAA 5MENE 1BF5A 3KHOA 4LLVB 4F37K 3ATBA 4PQXA 4WU7A 1EAPB 2V2WA 5TDPB 3BUYA 3MV7A 4DP8X 1Q1JH 3TCLA 3QEQD 3TA3B 3OMAB 2HKFH 1MWAB 1WBXA 2HT4D 1YO4A 1RL1A 2CRIA 1IBHA 3QI9A 4A7VA 2CCVA 3NGBB 3PJSA 3CSPA 3S35L 1U91B 4QT5B 4KMTH 5ILTH 3TO4C 1VLXA 3RZWA 3UBXG 3I2CL 3G6JE 3KEDA 4G8GB 4OD1L 5DSCA 5D5MA 3VXRD 3DTDA 5IROA 1ASQA 3Q01A 1KCVH 3D0LA 2DKSA 3FXIC 2A6KA 1KBGL 4RX4D 3G08A 4FHBD 4U3XA 3D50A 1KYOK 4WI4A 4LP8A 1OWWA 4Y1AD 2CJ3A 2XTJD 2YBRB 3NCYS 2WVUA 2F54E 2GT9B 5AVQB 4WWKC 5JLZB 1O6SB 1KXQE 3CVDA 1S7VB 1SDDA 4K3EH 3ECBB 5EF3A 4E42A 4W81A 2YAFA 4MHHG 1FPTL 2B0SH 2GUYA 4F58L 2B5IB 4HK3N 4X6CB 1FNAA 2CA4A 1S46A 4LSVH 3SCMC 3A6BH 3WHXA 1KWGA 1BG9A 2WJ5A 1EO7A 4FD0A 5FYKE 3QXVA 4QAWA 2YWYA 2EXYD 4JQIA 4I0CC 5DLMH 3N55A 3MRPB 5DK3A 4AZ8A 5KYXB 2A4ZA 3CLFH 5GRJH 3VRIB 1JOIA 2GCYB 3UL4A 1FFRA 4AGNA 3IFLL 3R06A 1PZ5B 3MOAH 3BI9X 5FYKU 4G2AA 2DQFB 4NCC2 3ZE0F 4KKLD 4Z7IA 3C6LD 4KRPC 4W9CC 1VDGA 1ZTXL 5EUOB 3LH2H 2Y9RT 4O02L