4XVUA

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
301
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSLADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 103
structure length 301
sequence length 349
chains with identical sequence B, G, H
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xvuA00
2P6NA 3RRYA 1G8YA 1K5DA 1GNRA 5FTKA 5B58C 1HTWA 1ZRHA 2AD1A 3NDBB 4B3FX 2P2LA 5IRCD 4TWZA 3CIOA 4JLVA 3DZDA 2XB2A 3B1ZA 4P32A 3ZDQA 3EZ7A 4FI3C 4G1UC 1IAQA 4FMBB 2NO7A 4DDTA 2GCOB 3AKYA 5CK4A 2ZJ5A 3SHFA 3BORA 3LXRA 4YDHB 4BZXA 1Z0DA 4EFNA 5D3QA 3I61A 1EFCA 5CB8A 3REFA 4PXAA 1DADA 1IXZA 3PFIA 4GMXA 1W4CA 1NN0A 1ZCBA 4DT1B 3CH4B 3EAQA 5CIQA 1GRQA 3M1IA 2P3SA 4JL5A 3D3QA 5EXSA 4BFYA 1W1WA 4BUJA 3NHAA 1CKEA 4HAZA 1F2UA 2WBLC 2PEYA 4NCHA 1D9XA 3OEHA 4FD2A 4OYHA 3HU1A 3ZGXA 2KBEA 1QG2A 4DHEA 2ZE5A 3NKVA 2C77A 5KSYA 3MMPA 2GETA 4GNKA 1E2EA 4PANA 3QEOA 4RZXA 1GKYA 4V0LA 3GJ0A 2C95A 4KYUA 2QT0A 3BFVA 1QHYA 2GEVA 3WYFA 4LJ8A 3R9XA 1KIMA 4EUNA 1FPMA 3KZ1E 2NZ8A 2G88A 2GK6A 5AK0A 3CONA 5HTKA 3AVWA 3K0AB 2R65A 3X2SA 1TU3A 6Q21A 1A2BA 1HUQA 4QNRA 4G5GA 5EP3A 5TY0A 1CXZA 2PJRA 4DLWA 4RD3A 2NGRA 2ZANA 1FMJA 2ZI6A 3A1TA 1YQTA 2YWEA 4G01B 1PV4A 2NZJA 4ABYA 4DDUA 4C30A 2H16A 4P4SA 1IN8A 4NCIA 1KSFX 1NSTA 2PCLA 2ZVQX 4NH0A 2QQEA 1W4RA 2OESA 4BFZA 5DNYB 2EWVA 4TZ6A 2HUPA 4PSKA 1OJLA 1XTJA 1MRSA 1NY6A 1SZPA 4IEIA 1YZKA 1Z6YA 4GOXA 1L7VC 1QG4A 2QRNA 2C9OA 2CXXA 1DAEA 2NO9A 3NH6A 3U4QA 1P4SA 4TQAA 1W47A 3QPWA 1ZNZA 4XVQA 1EK0A 1KJWA 1EX6A 1UDWA 5KDLA 2ZYWX 3K0CC 1KKMA 4BLQA 2XNSA 2GEDA 4AG5A 3LVRE 1WE2A 3FTQA 1LW7A 5HKKA 1N6OA 4CGZA 2WIBA 4LOAA 2IUTA 1LB1B 2IXFA 3CBQA 3SZRA 4XJXA 3EPKA 3AVVA 3VFDA 3FWYA 3UWKA 2A30A 4KBGA 2C99A 2YZ2A 2XSZA 4I1SA 4RFSA 4XH9B 3T1OA 1XNJA 2ZJBA 4WZ6A 3LH5A 2ORIA 3I5YA 5FFMA 1XFAA 3SHWA 4F92B 4MGYR 3B78A 5JEEA 1SGWA 1XZQA 5TVKA 5TV2A 2VSXA 4G5OA 1UKVY 4BPBA 4YMUA 1M74A 1KO1A 2QAJA 3QXSA 2ONKA 4D4MA 3CW2A 1E9DA 5L3QA 2CK3A 1E9SA 4XWAA 1Z08A 4PC3A 4DUGA 4QBFA 3W6NA 1CBUA 3CZQA 4R2IA 5EE9A 1W5TA 3IEUA 3DMDA 1E1RD 4WAUA 1HEIA 2ZRJA 1E69A 1RJ9A 3CR7A 3VHLB 3B2EA 4UNRA 1NIPA 4NDZA 3C5CA 2B8WA 3CWZA 2P65A 4OJKA 1NY5A 4YONB 4BASA 2IS4A 4B6FA 2FDCA 4OHXA 2ZEJA 3KUCA 2XXAA 4Q9IA 1MO5A 4PQFA 1KDOA 2F9LA 4NZYA 5JS8A 1KHTA 3HJNA 2ZE8A 2IEZA 1P6XA 2VP9A 1AJEA 2QN6A 2V54A 3B1XA 4W5JA 5IHPA 4Q4HB 1EX7A 1ZNWA 2FPMA 3X1WA 3WXMA 1FUKA 2DWPA 2OE2A 4DIDA 5CM9C 1MOZA 4DLZA 1P2TA 2REBA 3GJ7A 2OV2A 1OXSC 4GOJA 4TMKA 1MO4A 2QTHA 3RC3A 3KKMA 5CM8B 4MUAA 2RGBA 1XMVA 2ZJYA 3PUVA 5HPYB 1Z63A 3THYB 3IUYA 1FFHA 1IM2A 1VYTA 2R6FA 3F0TA 2DHRA 4Q48A 5FI1B 1Z5ZA 3NBFA 3ND9A 3A1SA 1M7HA 1XEWX 3NVAA 5BN4A 2JDIA 3E2IA 3P4XA 5IDVA 1G9XA 1GUAA 4PSVA 1OH6A 2CL6X 4MKIA 2P5TB 4HDOB 1FP7A 1X8LA 2YC2C 3RSLA 1GDDA 4JKYA 1TPZA 3B6EA 3GJ3A 1YZNA 1QHHA 1X8JA 3BC1A 4DLTA 1S8FA 1HYQA 2HEIA 3LD9A 2R6CA 4Z1MA 4M8NE 2XX3A 4JJZA 4C0HA 3OIUA 1S4QA 4Q4JB 1X86B 3IQWA 2XTMA 4LHYA 2GBLC 2FPLA 2HXYA 3F5FA 4HAWA 1TF7A 4DB4A 1J90A 3MJRA 2Q3FA 5HCIA 5EZ5A 1S9DA 2GVZC 3PEUA 2YOHA 4XTRA 2G0TA 2NO1A 3MWYW 3SC3A 1OLOA 4OL0A 4XOIA 3PENA 1OKKA 1AM4D 2X2EA 1P73A 3FE2A 1NMYA 3BJIC 5E95A 4GFDA 5FUVA 4L9SA 1VG9B 4IDOA 5KU1A 1D8TA 1T3SA 2QENA 1E0AA 2XJ9A 4JS0A 4RFSB 4LJ5A 1NJGA 3HR7A 1OT3A 4KO8A 3DO6A 1XD8A 4AWXA 4Q1EA 2IUSA 2JDID 3F3YA 1ZYUA 2UZIR 5JWOA 2QNRA 4UXHA 4KODA 1L4YA 1CRPA 1G6OA 1H65A 2ZU6A 3TIFA 2W83A 4RVCA 2JATA 1TL7C 2OXRA 1Z6XA 3BB4A 3KXIA 3NBZC 3U4QB 5E7IA 1RYFA 1TADA 4W5HA 2F1RA 3CWQA 1SVLA 1ZM4A 2NMVA 2FSIA 4Z1MD 3QVUA 1ZNYA 4LPSA 1ZIPA 4OQFA 3OEHD 1OPXA 1VCIA 4EAQA 5KTYA 3E70C 3CM0A 2VIIA 2MSEB 4NE2A 2C04A 4DDWA 1CU1A 1G5TA 3AGPA 1XMSA 2XOKA 5LB4A 3RWOA 4AKEA 4XVUA 5BYJA 2G1JA 3THWB 5F9FA 1Q22A 5LPNA 4KFTA 1MRNA 1QHGA 2IS6A 1V5WA 1ZP6A 5M04A 3SJBA 4PTLA 1OKKD 1TNDA 2IC5A 4CIDA 1KNQA 3KQKA 1XMIA 4HYYA 5FOSA 2W58A 3Q3JB 1JAHA 4D4JA 3PUXA 2V55B 1NLFA 1II8B 1K5GA 3TK1A 1LV7A 1XCMA 3FDIA 2V4ZA 4JMPA 2QMUA 3QF7A 2PT5A 4D0GA 1VHLA 4ZV4A 3B9PA 4IW3B 5DHFA 4Z8XA 1DAKA 1TMKA 4FN5A 2ECKA 1JI0A 4UJ5A 3OE7A 4HLCA 5LD2C 3KJEA 4URVR 3KDSE 1P5ZB 4BFWA 1G20E 1Q3TA 2A3RA 1YR8A 3C7KA 3A4NA 3KUDA 1W0JD 1SXJE 2EFEB 3NIBA 2HLDD 1Z0FA 4TTQA 2QI9C 3KXKA 4IXMA 4PPFA 1GOTA 4A9AA 1IY2A 2O0JA 1VHTA 1ZUNB 2DY1A 1ETUA 2WIAA 4Q4JA 3UK6A 1Z6GA 2B8TA 2ZR0A 4DVGA 4DEXA 1E4VA 3I8SA 5F2EA 4EPRA 1NF3A 3VX3A 5HKKD 1T5LA 3P1JA 3O47A 3A58B 3MLEA 5DYGA 1YZGA 2ANCA 2OLKA 2QUZA 2NTYC 3CNLA 3TQFA 3CRRA 3GJXC 3QVVA 3ADKA 2XSZD 2J0UA 3CRW1 3WP0A 3P4YA 3ICQB 1G1MA 4RD2A 2CHGA 1W46A 2ASEA 2W2VA 2F55A 1E2MA 2XJ4A 3DKPA 4GRAA 5EXTA 2Z43A 2GJ8A 2IYZA 2YWGA 2YOFA 3HDTA 2BHRA 4W5WA 4IVQA 4EJSB 4HAUA 2ZI9A 2WJIA 2GRJA 2O0KA 1PUIA 4KHZA 4M21A 4YC7A 3ZVMA 1XD2A 2CK3D 3SJAA 2VF8A 2ZI3A 2QY9A 4O2RA 1E32A 2NQ2C 4PO9A 2XTNA 1W0JA 3HPQA 2I1VB 1CLUA 1TUEA 2HLDA 5AUOB 1W2HA 1E1RA 1TQ2A 2JAQA 1N0WA 3QKRB 3R8CA 1AZTA 3W34A 4ZIRA 3Q72A 4NYMR 2EU8A 5TXGA 2ZM5A 2QBYB 1GL6A 1E9CA 1AA9A 2R62A 2DWOA 5LDDC 4E09A 2PJZA 4EPYA 4XSHA 2DYKA 3FOZA 1EG7A 3TE6A 4HZIA 2V1UA 1M8PA 1G7SA 4Q1BA 1NVVR 1BYIA 4II7A 4US1R 2PZGA 5JJKA 1A5TA 3TR5A 1UF9A 1JXOA 2CCGA 2ZVPX 1IN6A 4CW7A 4TMZA 5CYPA 3L0OA 2EFHB 3H2YA 1S96A 4ZDWA 1QHHB 4QJ3A 4GOKA 1E9FA 1NG9A 1KI2A 2O8FA 1G17A 4XIGS 3GLFA 2BEJA 4DLYA 1MR3F 3WNBA 3QQ5A 1L2TA 1ESNA 4MH0R 2J1LA 4OHWA 1FZQA 1ZVQA 5DN6D 1BIFA 2FFAA 3FB4A 4DZZA 3X1DA 3GLHB 2FU5C 4WZAE 3OIWA 2JLWA 1BO6A 1E3MA 2J0QA 5JCPA 2CEAA 2WPDA 2GEUA 3AKCA 2GF0A 1YZQA 5JS7A 1XEXA 2WKPA 1JJVA 4LHWA 3RS3A 5C4GB 1ZNXA 1S3GA 3Q7QA 3LV8A 1OW3B 4CEJA 1QHXA 2N46A 4MA4A 3A36A 2NOAA 1E2LA 1N6IA 4IJMA 2VL7A 4B3GA 1S0UA 2QTVB 1NVXQ 4U5XA 2GXQA 3R7WB 3W5IA 1JR3A 2XITA 4TTRA 1NG1A 2IWHA 4A0FA 3T1TA 3O8BA 1DAGA 2ZI4A 3EIEA 3T5DA 4D6PA 5HZHA 4QGHA 4HI0E 3LA6A 3WP1B 4LV5B 1TU4A 3MFYA 4M1KA 4EDHA 2E1RA 2HV8A 5BQ5A 3GEIA 5GJCA 4B48A 5KOYA 3ZS9A 2HXSA 4OK6A 4D0LB 5JJLA 1T3LA 4Q02A 3L2OB 1RYHA 2VF7A 2D4HA 1FTNA 1NKTA 2UVQA 4HZUA 3QBTA 3AVPA 1L4UA 3AEZA 3L82B 4JLAA 4DWJA 2ZRAA 1T9HA 2KJQA 2D7CA 4JLJA 4ZI3A 3GPLA 3I62A 5DLQC 1W48A 5FUXA 4DSNA 3TVTA 1KK0A 1G8HA 1KSHA 1SKYE 5L3QB 1G4UR 3QG5A 3SR0A 2VLIA 4FMCB 1N6KA 3GLHA 4UJ3A 3PCRB 4JYCA 4RD1A 3GJ4A 1CJVC 2O8CA 1EESA 2RB4A 2Z4SA 3QEJA 4Q21A 4OI2A 4AKHA 2WPDD 4IXNA 1R4AA 4LC0A 1LS6A 2QM8A 4K81B 3A1WA 2YOGA 4MYHA 4YQFA 4JLBA 3KQUA 2VP0A 2CVHA 2QGNA 5KNDA 3AUYA 3I92A 2C96A 2WWIA 1T8TA 2FJUA 4LJ9A 3GLHE 4M1MA 3MGCA 4JIMA 2A9KA 1F2TB 3MUFA 4BLPA 2WHXA 1JR3D 3U7HB 3AVXA 2V7QA 2VSOA 4LUCA 3IIKA 3BB3A 2H17A 1HURA 2FFQA 2RHMA 2XOKD 4FIDA 2NG1A 3K0EA 4LPKA 3WYGA 5JHHB 1KI4A 3K9HA 4DBLC 4PHTA 1KK3A 1CS4C 1SXJD 1XBTA 4Z51A 3UMRA 3TVDA 4IFBA 4S35A 5EZ6B 2BJVA 2ORWA 1P9WA 2ZREA 4RCZA 3ZVRA 4M0LA 2F6RA 3RS5A 3K70B 4H9GA 5E7MA 2IYQA 2AWOA 1G8FA 2V6IA 1KNXA 3DZ8A 4MYTA 1HY3A 4AK9A 3E5HA 1XWIA 4TL7A 4A1FA 1HE1C 4KFSA 4ZKDA 2A78A 3PEYA 3KTAA 1N6HA 4A2WA 3K53A 2X77A 4QRHA 1SQ5A 3OE7D 1F48A 3K0SA 1P61B 3D6TB 2YVUA 3EARA 1GNQA 3ZVLA 3AVYA 2RCNA 4AC9A 4PPGA 3W3AA 3ASZA 1N6LA 2H57A 4OBEA 2JLQA 1DOAA 1N3BA 1VCOA 2VBCA 2V7QD 2VO1A 3F8TA 3TW8B 4GZLA 1E4YA 3KKPA 2ZR7A 1XCPA 1XTQA 3G0HA 2OFOA 3REGA 4XTCS 1Z28A 3VR2A 1F2UB 1KDTA 1DPFA 1X1RA 4E5UA 3K70D 1FQKA 1Z0KA 3BAFA 4IOMA 1SXJA 1XTKA 3IBYA 4LHZA 2ZJZA 2O5VA 4QHTA 4C3ZA 1E0JA 1T0HB 4URWR 2QGZA 2ZRNA 1DVRA 2R6AA 4U00A 1E2IA 1RRPA 1ZD1A 3CX8A 1U90A 2GK7A 1JR6A 5K8TA 1YE8A 4RCYA 4B6EA 4C9BA 1JJ7A 3L43A 4LX0A 2CVFA 3CRQA 4IRUB 4NYJR 3KQHA 4HEJA 4IKEA 1E96A 3BD9A 1H8HD 2ZJAA 4Q1DA 2BEKA 1P60A 1M7BA 4IEEA 4LSGA 1TF5A 5JLJA 1JB1A 2BOVA 4US2R 3ZLJA 1DEKA 2ONJA 3RYTC 4D0NA 2KB0A 1SHZA 4GBMA 4G3XA 2FA9A 4PAMA 1YJ5A 4HAYA 3FHCB 3BIFA 4MKHA 4JZKA 2GAAA 4LBVA 3SU8A 1N5KA 5L3VA 1T91A 3GEHA 4N0DA 3CR8A 4US0R 5K8UA 2BKEA 3P26A 4BECA 2R8RA 3LXXA 3R20A 1N5LA 2V1XA 1JQJC 5CJ2A 2IUUA 1CULC 3GFPA 2WAXA 1IJEA 1R10A 5EP4A 1ZAKA 1NVWQ 2BWJA 2QZ4A 2REXB 4RZ3A 4KXFB 4CEIB 3UWOA 5SZIA 3NC0C 5CYOA 2D62A 2AX4A 4GDFA 4OI0A 1VG1A 3R7WA 1JPJA 4H1UA 3TKLA 2IF0A 2Q9AA 2OAQ1 3JZMA 3QOFA 4HB0A 1U81A 3LQQA 4BLOA 1B0UA 3GEEA 3U6BA 1S1CA 1DAHA 1OH5A 5DN6A 4Q9JA 1Q44A 1KZ7B 2BM1A 2IYLD 1Z07A 4JLOA 1ELOA 1UDXA 3T1VA 1N0VC 2XTZA 2YNMA 3WRYC 1ZD9A 3FHOA 2QMEA 4AYWA 2ZE6A 2BBWA 2CLDX 1SVKA 3GLFE 1QZXA 1CJUC 4NKRA 2BJWA 1LVGA 4DCTA 4PQRA 5TDHA 1UKZA 2IHYA 3U6KA 2FN4A 4I99A 4V0NA 3K70C 4IVPA 4L16A 4DLVA 3KJGA 4OI4A 3ZIAA 4JBYA 3THXA 2JA1A 3U61B 4Q4LA 4FINA 3WHKA 3NEYA 4JJKA 3NTUA 3B60A 5UKDA 3W3ZB 1XPRA 4HZUB 1I4LD 2VH5R 3K9LA 1GZSA 1JQLB 3LFUA 3N2EA 5LB2A 2ERYA 1Z83A 3RWMB 4F91B 3GLIA 4CEHB 1Z47A 4RY2A 4TYNA 4HB2A 4NHOA 2WJVA 4Q1AA 4PZYA 3VU9A 1T6NA 1E2PA 2V8OA 3AVTA 1X6VA 3IBGA 1D5CA 5J4HA 1E9BA 1XCGB 4NCNA 5DIFA 1U94A 4IOLA 5LBIA 2C98A 4LCBA 4AIIA 1XTIA 1A7JA 3QKUA 1JXMA 2QBYA 3FKSD 4AYTA 2RGNC 3GCGA 3FMPB 4EQ6A 3WNDA 4YMVA 1HT2E 2UKDA 2NO0A 4M22A 4ZCMA 3U60B 4QJ4A 4P4UA 2GJSA 4JT2A 4POAA 3CPJB 3UIEA 5AJWA 4EPTA 2VHUA 5KO2A 1NRJB 3HWSA 4B43A 3IKJA 4X8OA 3QIAA 1CJMA 4Q9LA 2VSFA 1IN4A 2ODWA 3SJZA 1IOZA 4BFTA 3A8TA 1E9RA 1N5IA 4EQ6B 2VP6A 1EFUA 3W9YA 2YJTD 3ZIAD 4NU0A 1HE8B 2ZUBA 1NLZA 5DISB 1HT1E 3RVBA 2AKYA 4Q9HA 5FTLA 1UBCA 4RFVA 1R5NA 3HYRA 3TW4A 3WY9A 3KKNA 2QPOA 4BLSA 1DO2A 3PUWA 2HCBA 3MJHA 1N25A 2O8FB 3CF2A 1NKSA 2FNAA 4QGGA 3EIHA 1QVAA 1G5PA 3QSYA 4CEHA 2Y8EA 2BMEA 5C4MA 5AUQA 2V6JA 2QP3A 3UXMA 2PZEA 3SBEA 3BWDD 1OH7A 5FPKA 4DLSA 1SVSA 3IDQA 2CL0X 2JASA 5AUNB 5G3YA 3L8YA 4JLKA 3BFXA 4HLDA 4DCSA 3THXB 2BCJQ 5DI3A 2XGJA 1ZM7A 5JEDA 521PA 1KMQA 5EP2A 3THWA 4B34A 1SHKA 3CX7A 3DKVA 1NVUQ 1CEEA 4Z8YA 3OZXA 2PLRA 1UEJA 1ZJ6A 2GAOA 3C41J 3H4MA 1TF2A 2GCOA 1P3JA 3UKDA 4AG6A 4TYYA 4A8JB 2ZSEA 2GTPA 2ZRIA 1U8AA 4KJZA 1A82A 3MD0A 1OIWA 3LW7A 2RGXA 3CLVA 3FPAA 2IF2A 5JRZA 1VIAA 3A1VA 5BXQC 4GPTA 4BE7B 3LLUA 3OESA 2BBTA 1Q57A 3HP1A 3MG9A 5G40A 1XF9A 1UBEA 2G1KA 2OSBA 3SDZA 3W6PA 3EX7C 4NPHA 2HCJB 4YDSA 4CYMA 3U3RA 4TL6A 2HF8A 4XVRA 1XXHA 4PC7A 3L8ZA 1I4DD 2IL1A 721PA 2QEQA 1VMAA 2QORA 4M4SA 5KSPA 4QOSA 2W6ID 4L4UA 3DMNA 1OB5A 3M0EA 1NN3A 1UM8A 2FGJA 3K9NA 4QGFA 2FZLA 4B76A 5J4VA 2GBLA 4M9XA 3G5UA 1TAGA 2FEOA 2A5GA 1OFIA 2A2ZA 5ELXA 3QE0A 5FOVA 4A15A 1LFDB 3VX4A 3TAUA 1UEIA 4QHYA 4PAQA 1BKDR 3OEEA 2C2HA 1H8HA 2PL3A 4LBYA 2OCAA 4O3MA 1U8ZA 2ZITA 2GJ9A 1OFTA 2AWNA 4ZKEA 3C4JA 1E9EA 4MRPA 2E87A 5B30A 4CEIA 3CNOA 3FKQA 2ZRKA 1G18A 1K8RA 4LYAA 4Q18A 2ZE7A 4MKFA 4GT1A 2R2AA 4MDEA 4D25A 3K8YA 1DAFA 1GNPA 4M9ZA 4XD7D 4B35A 5JZVA 3A37A 2QL6A 2OCYC 3U7FB 3RANA 4OQXA 5C1BA 3VNVA 3LO5A 2IS1A 4I4LA 1GM5A 5J4KA 1WXQA 1FNMA 2QT1A 2X1VA 4FCVA 1E9AA 2O8EA 4Q7KA 4BFVA 2WWYA 1KI1A 3QXCA 4ARZA 2W6IA 1NNEA 3UATA 3WBKA 1XPUA 3QENA 1I2MA 1WQ1R 1UKEA 1DELA 1LY1A 2BDTA 2HDNB 1E2HA 3QUSA 1R0YA 2GJAA 1Z6TA 3RS4A 1Y3AA 1NP6A 3O8RA 4BGDA 3EW9A 4NYMQ 5DGXA 1ZC3A 4B73A 4DJTA 2G83A 4G5RA 1FQJA 2NPFA 2GKSA 3D8BA 3V4FA 1QBKC 3AVQA 5HZKA 3P32A 1S2MA 3S1AB 4JSYA 2WWXA 1CR0A 3QF4B 3FFBA 5JMTA 4ZDJA 3DL0A 1MT0A 1KI7A 4Q19A 2ZYVX 1KO8A 1JNYA 1VPLA 4M53A 2G3YA 2G6BA 1Z22A 1LNZA 3KTAB 3KJHA 3ETLA 3DOFA 2RGDA 2A7QA 1WB9A 4JSTA 4D4LA 2P67A 1VIYA 3DM9B 5FPYA 4A82A 3GFTA 2AFIE 4XD7A 2QM7A 1OXVA 1PUJA 4LBZA 1VG8A 5EXXA 4Q1CA 2Z83A 3NXSA 2MMCA 3K09C 1MH1A 4DB2A 3GD7A 2EWWA 3LRPA 3MAAC 4PQYA 1XJ0A 1ZMXA 2TMKA 2PH1A 2WMOB 3KKQA 2VP2A 1D2NA 4J0QA 5A4JA 1Z0AA 1F60A 1OIXA 2EQBA 4Q4HA 1XD9A 2DPXA 2IYYA 1US8A 1TX4B 4HUQA 4C2UA 1KY3A 1YRBA 3ZJYA 4KYIB 3TBKA 1YRAA 4FCTA 3X1ZA 3LY5A 4LZZA 3I72A 1C9KA 3Q7PA 1U8YA 4DCVA 1Q1ZA 1YR6A 3PV0A 1FP6A 3GLGB 3FKSA 3LNCA 1NN5A 1S1MA 1ZM3A 5EUMA 2VYFA 3T1QA 4DC9A 3RDPA 1P2UA 2W00A 3AP2A 1ODFA 3B82A 2Q9CA 2VTKA 3WYAA 1OFHA 2FGKA 1KSJA 4GSYA 4HB3A 4GL2A 1GAJA 3DHWC 3AUXA 1PLJA 2ZI5A 4KI0A 4XWOA 1KI6B 4OK5A 4NL4H 2DBYA 2PX3A 2Z0MA 3SYKA 2ZPTX 4YMTA 1VKJA 1GKIA 4TMTA 4HUQB 1KGDA 2GWHA 1TQ4A 2Q3MA 3T06B 3BXZA 3CX6A 5JI3E 1LF0A 2HYDA 2VHQA 2WV9A 2VEDA 4NCKA 4Y0AA 2IWRA 4HB4A 4CEJB 1AZSC 2C9YA 5FI0B 3FFAA 2N42A 4PR0A 4DXAA 4WBSA 3ADDA 4G0NA 2P5SA 3T15A 1LS1A 5G41A 2RMKA 1E2GA 1K6MA 4KCGA 3THOA 3CZPA 2QAGC 4HLUA 3TJZA 4WVFA 2JLZA 2WJGA 221PA 4U02A 4LWZA 5IT5A 2JLUA 1GFIA 1KI3A 5CK5A 4B3CA 2XZPA 3EIQA 4TYQA 2KBFA 1CF4A 2PCJA 2H7VA 3NEJA 4LDJA 2KSQA 1JALA 4KBFA 1GSIA 4MGIR 1XX6A 4P3YA 3IGFA 3ZD6A 2ORVA 2PMDA 3KB2A 3QNUA 4BRUA 3QPUA 5KPDA 2OBLA 1OHHA 2GHIA 4LJYA 5FBLB 2LWIA 2ZS9A 3LDAA 4GP6A 1XEXB 3VHXA 2IYUA 2WM9B 4UXIA 3ND8A 5D3MB 2SHKA 5KYKA 5GADl 1GKUB 1OSNA 4NMMA 1H8EA 3VR3A 4DSTA 4TMWA 2REOA 2BVNA 2FFHA 2IA5A 4BZQA 3SQWA 3I1FA 3UANA 1RRGA 3M4YA 3QKRA 4O2LA 4JL6A 2RAPA 4QC2A 3AF1A 5J4YA 1YR7A 5H1YA 1HQCA 3PUZA 4DDVA 5H68A 2H92A 4NBSA 3B8HA 3GQBA 3IEVA 1KDPA 3IHWA 4G5QA 4PFSA 4B44A 3G82C 4Q7JB 1TTTA 3Q5EA 4P4TA 1J8YF 1G3UA 2WKQA 2OCPA 3DEFA 621PA 1AS2A 2B7CA 3Q9LA 1UPTA 3N5CA 4M9SA 1SVOA 3OF5A 1IY1A 2OFXA 2KI5A 4D81A 1SULA 4PX9A 4V03A 5DYIA 2EFGA 4DIEA 3CF6R 2JLXA 2J59A 2ZU0C 3CB4A 2DB3A 3QF4A 3KFXA 2FOLA 1IN7A 3ZQJA 2F3TA 3A4LA 3W8NA 5FTNA 2WMNB 2J46A 2BC9A 1CP2A 3AF0A 4DCNA 1COWD 1PJRA 2NO6A 2GVDC 3OEED 4K46A 3ZQ6A 2F9MA 3HU3A 4LBWA 2BCGY 1H8ED 4R7ZA 2ATVA 1CTQA 1Z0IA 5TB5A 2FFBA 4DLXA 4B3BA 4LYHA 4N1AA 1OXTA 1R0XA 5KDDA 3TUJC 3AF3A 2E9SA 4C0LA 4EJSA 3AV0B 1BMFD 2IYRA 4PO1A 3U3MA 4E07A 3U2QA 1KKLA 4Q01A 5GJBA 3B9QA 4LJAA 2KE5A 3E1SA 2IXGA 2IK8A 2WSSD 1MO3A 5JSZB 1AQYA 4M2LA 1C1YA 1E0SA 1D2EA 3RRZA 1QVRA 4KAXA 3U3JA 2HF9A 2IYWA 4ESVA 2EYUA 4QFMA 4ESHA 3RS2A 5JWRA 4ASUD 1UADA 4NYIQ 3BRWD 5A0FA 4QM7A 1G4AE 4AKIA 2QSZA 1OYYA 3EPLA 3I4LA 2Z4RA 4V02A 2J9RA 4JT4A 3KXLA 1OXXK 4MRRA 4A0RA 2QE7A 4M1TA 4DSOA 3EG5A 2OO7A 1COWA 4OQLA 4DT1A 4X8HA 2VP5A 2MMGA 1CJTC 1J70A 1KJYA 5ANRB 4FWTA 4KV9A 2QMHA 4RZUA 1G5RA 3K9GA 4G5SA 4BFXA 4QBHA 5B57C 4RZ2A 1E6CA 1KO4A 4IHQA 3ZYCA 4BWYA 1EWRA 5BN5A 4TTPA 2VQSA 2WKRA 1QDEA 3VR5A 2AL7A 2DCUA 5CITA 3K09A 2ZYTX 3DVLA 2BV3A 2A5DA 3IPYA 4DKXA 1DAMA 5DE3A 3FMFA 3TH5A 4LRWA 4PHGA 1EFTA 3K0FA 1KJZA 3I32A 2WAYA 2WSSA 2R6GA 1TEXA 2GILA 3EC2A 1G7TA 3Q5DA 4JLMA 2CJWA 3OHMA 3A4MA 1E2QA 2FEMA 5CDFA 3TSWA 1OB2A 4BFUA 4TL9A 4NP6A 4TYWA 2XZLA 3AF2A 1XEWY 1FX0A 4WXPA 3GJ6A 1ZM9A 2ODNA 4GMDA 2FF7A 3I73A 1U0LA 2FSHA 2QSYA 4K8OA 3VAAA 3W5JA 1VECA 5K8LA 2VHCA 2XNDD 1RE0A 1VCNA 2OAP1 1T0JB 4B2LA 3VR4A 3EZ9A 1ZINA 2V9PA 2L0XA 3A6PC 3GLIE 3NBYC 4A2PA 3WHLA 3EPJA 4F4IA 1P9NA 3RABA 2ZAMA 3LX8A 1Z2CA 4HAXA 2XXAB 1G3IA 2LCFA 3EZFA 1XPOA 2GCPA 3CPEA 1U9IA 3L0PA 1IHUA 3EWSA 4NTZA 3P20A 1XEFA 1Z06A 3C8UA 4AYXA 1RIFA 2KWIA 2P6UA 4FMCF 1M2OB 5SZKB 1CR2A 2ZETA 4A0HA 2C9CA 4LHVA 1NN1A 4M1OA 4TN1A 1N5JA 3B7GA 4ERNA 3UPUA 3B13B 1XTSA 4M1SA 3RRMA 3BBPA 4KU4A 4M1YA 1DE0A 5KHOC 1E2JA 3QXXA 5EE1A 3BH0A 4HSEA 3RSOA 5KSOA 5FOUA 2O0HA 1I2DA 1JECA 421PA 4A92A 2YYZA 1PZNA 3VR1A 2FX3A 2GNOA 2HT1A 3SBDA 1DS6A 2C8VA 3MWKA 4I1OA 4UNQA 2GCNA 3KL4A 1GIAA 2OFWA 1XJCA 3RAPR 5C18A 4TLBA 2OXCA 2ZRMA 2Q0HA 2JGNA 5KUTA 1EWQA 1VYUA 2NPIA 2EYQA 1P75A 2RKOA 4DSUA 4LJ4A 2RGGA 5AR1A 1AN0A 2VHJA 4TSFD 5L3RA 2J7PA 1OHHD 3X1YA 5FL3A 5JI2E 1IXSB 2D2EA 2XB4A 3LBNA 5AJZA 1VYVA 1D9ZA 1WP9A 4CT4B 2F3RA 2Q21A 3QXJA 4DCUA 4OHYA 2ZUCA 1W4BA 2DFKB 2ZAOA 3JVVA 4QXAA 4TMXA 4CVNA 2PMKA 4IDPA 1CJKC 4QHSA 3IIJA 4V0OA 5FR2A 4TYPA 2P0EA 1SKQA 3NWJA 1R2QA 4BFSA 2J45A 5J47A 1RJ9B 4B2IA 1IONA 1ANKA 3RLFA 2WJHA 4Q00A 3TSOA 3R8FA 5EP1A 2H8KA 4RD6A 3RRNA 4V0KA 2GF9A 3MSXA 1FX0B 3TGPA 1M7GA 2WJJA 2OG2A 2ZRHA 4KSCA 5J4LA 3JVUA 2OILA 2MSCB 1WRBA 1BOFA 2ZR9A 5CLLA 4ARZB 1W2GA 4MRSA 1WBBA 2Q9BA 4LJ6A 3VKGA 2J5XA 1NMXA 1KK1A 1OH8A 2FG5A 4CDGA 3CUEF 5E3HA 3C14C 2IS2A 1XDBA 3K0AA 3I3SR 4LK2A 1NBME 4F4CA 3GLFB 4UKDA 4A0GA 5BN3A 3ZH9B 3H84A 4LHXA 3T34A 1GWNA 1G16A 4JVLA 4TLEA 2J7PD 3N70A 4EPXA 4MYCA 2O52A 1ZD8A 2FV8A 3I8XA 3SQXA 2IYSA 3NBXX 3LBIA 1RC8A 2ZRPA 5JFGA 1NJFA 3LBHA 3GJ5A 1SXJB 1T3HA 1U9IC 2AXNA 2PBRA 2ZTSA 2JJ1D 4L5BA 4GZMA 2PX0A 4OK3A 1Z0JA 3ONWA 4UNSA 1BMFA 2WZQA 1KAGA 2YINC 3H0KA 5FBRB 4PO8A 3NG1A 4HDQB 2J87A 1KO5A 3H86A 4JBWA 5KDOA 5EXPA 5L3SA 3PXGA 3KQNA 3PEVA 2V3CC 4KVGA 3CNNA 1KZGB 5FOWA 4IOKA 1S9HA 1A4RA 1XMJA 1DTSA 2OCBA 4CRWB 2B92A 1W0KA 2F7SA 2OLJA 4ASUA 1SKYB 3CKLA 1UBGA 1E79A 3VR6A 4ZDIA 2QRZA 1MABA 4ACBA 1Z3IX 1G7RA 2DFLA 5DH9A 2QQ0A 3TAHA 4N3NA 3L0SA 1J8MF 4C0SA 4AURA 4U7DA 1EFRD 1ESMA 4BQSA 2ZS7A 1D6JA 3B1WA 5FOXA 2J0UB 3KKOA 2QE7D 1YHNA 4EPWA 1E94E 4I1UA 1KYIA 1G3MA 2B6HA 3EZ2A 5H70A 3K0CA 1XU4A 1U2RA 4B47A 2WTUA 2Q6TA 4NYJQ 2W0MA 5SZJA 4FWIB 4WXRA 2ERXA 2W0SA 3EPHA 2HYIC 2DFNA 1CRQA 3HR8A 1C4OA 1KI8A 4C7OB 2PZFA 2BMJA 2ZRLA 2WOOA 3W6OA 1FL9A 1NLYA 1OE0A 5B2ZA 1UKYA 2O8EB 4LGMA 2WWWA 3LW8A 1J99A 2BM0A 4TL8A 4V0MA 1D2MA 1E2DA 2F1IA 4FMDB 2X19A 4I81A 1AKEA 2WVJA 2BBOA 4LV8B 3OIVA 1Q1BA 3B1VA 5JRJA 3D7MA 4EFMA 1W0KD 4YMWA 2RGNA 2CE7A 4OJQA 1E79D 1II8A 1Z8FA 3EA5A 1WBDA 4EJSC 4LYFA 2YV5A 5EUQB 1R8QA 4W7SA 2IT1A 1P7CA 2DR3A 4QL3A 3TUZC 2O8BA 5EJEA 2CLCX 2XZOA 2O8CB 4ZCIA 2XNDA 2IYTA 3QG1A 1G8PA 2GZAA 2AK3A 2BKUA 4JLNA 1F3OA 1PLKA 4PHHA 5F9HA 2ANBA 1DG3A 3ZZ0A 1RFLA 5D3MA 4RD0A 1KOFA 4RSGA 2WSMA 3GMTA 5G3ZA 3H1TA 1AQUA 1X8KA 3T61A 1SVMA 2Z6VA 4EIWA 4RKEA 3C16C 4URYR 3T5GA 2B21A 5AUPB 1HV8A 1WA5A 2GESA 4A6XA 1ONBA 5FR1A 3MCAA 4B74A 5KNBA 2XEXA 1G21E 1RW4A 5CLQA 1XXHB 4YMSA 2D3WA 4F7WA 3PG5A 5IF9A 3A1UA 2F43A 4R9UC 3CRVA 4Y0VA 4EKDA 3U3KA 3C5HA 4QBIA 4LC1A 4YLGA 2IYVA 4IDQA 1HH4A 2AK2A 3B1YA 2QMOA 4KLNA 4C0KA 4URXR 1P2SA 2A5JA 3VU9B 2CHQA 2CE2X 2ZRBA 1IJFA 2O8DB 3L0IB 3ICEA 1G41A 4M9QA 3LAWA 1RKBA 3V4RA 3K1JA 5FTJA 3U3OA 3ZVNA 1TQ6A 2CBZA 2CHVA 2CDNA 4DLUA 3RS7A 3J81k 3I5XA 4ILEA 3FVQA 2JJ2A 4PSAA 2ZRDA 4QJ5A 1YZTA 4KITB 5FBVB 3KJIA 3GP8A 2OUKA 2WWHA 2G9NA 4Q4AB 2H18A 1J7KA 1WCV1 3O8CA 4B71A 4TSFA 1Y63A 3ASYA 2ZRCA 2EVWX 3OFNA 2B7BA 1G64A 5AJVB 3FMIA 4PZZA 1X3SA 4TLCA 2YWFA 3PR1A 5C2JB 2OHFA 1GP2A 2R9VA 3QXHA 1CR4A 2W6JA 2VP4A 1FOEB 1OIVA 2IBMA 1B23P 2ZUDA 1R6BX 4L9WA 1CR1A 2O8DA 1IN5A 1IBRA 1XB2A 3FYHA 3ADBA 2ZRFA 3CPHA 2IHBA 2A5FA 3JZAA 3SNHA 4F93B 5HR5A 3B5JA 5CB6A 4NCJA 2QAGA 3IO5A 1OV4A 4QNMA 3BOSA 2OBMA 5JCZA 3QPVA 4NYIR 3PUYA 3PVSA 1ZM2A 5F98A 3AH8A 4B3XA 4C0JA 1W7AA 1ZW6A 2IXEA 2R44A 1L8QA 4IFEA 2CCKA 3CF0A 3ADCA 3U7GA 1XJQA 1Q12A 2MSDB 1QRAA 2GJKA 5BYKA 2JJ2D 2HJGA 4YXWD 5H8WA 5AJYA 4QM6A 2HJVA 1OXUA 1YKSA 1A1VA 2ZSFA 2J0VA 2I3BA 2RGCA 5FUYA 4PC6A 4Z54A 4P4SB 1FUUA 4TT3A 3IILA 3VKWA 2YC4C 4MGZR 1NIJA 3ZD7A 4C2TA 3KQLA 1YR9A 1N6NA 4BEBA 3BS4A 4KLZA 2F1JA 3KFVA 5J40A 2C5LA 1R8SA 4RD4A 3KX2A 2W6JD 4DLRA 3TSZA 3VMFA 5DI9A 3BE4A 4XSGA 4JVMA 1KI6A 1AK2A 1FMLA 1II9A 2JJ8A 2QAGB 1UJ2A 3AM1A 2AN9A 1T4GA 1E2KA 4BLTA 5C46F 1DAIA 2JJ1A 2CL7X 3HU2A 1HA3A 3PQCA 1T8UA 2ZIAA 2BBSA 2BMFA 4Q5IA 3W8RA 1F5NA 4OKSA 2WWFA 4PC1A 1DARA 1PLLA 3U44A 1E2FA 2D06A 2RHDA 1O87A 3AKDA 1BH2A 4XWKA 3TMKA 2VA8A 2FPKA 2C03A 2D2FA 4LV6A 4DEYA 5FPSA 2JLRA 3SFZA 3NDPA 4Q7LA 3WBJA 2ZS8A 2FE4A 1JBKA 1G6HA 4B75A 1ZC4A 3OAAA 4L15A 4AD8A 1RPZA 2EFDB 1QHSA 4HDCA 1Q3HA 2O8BB 2ZJ2A 1R5BA 5FL7A 4CT5A 4X8MA 2LKCA 4YXWA 4Q4AA 5G53C 3T35A 5GVSA 2K5UA 2VHTA 3RC8A 1JR3E 1VG0B 4PAOA 1P9RA 2JIZA 3M6AA 3KB1A 3TRFA 3UMSA 1IXRC 1LF5A 3PITA 3OIYA 3QI2A 4IVRA 1FW6A 1JPNA 4HUTA 2OBNA 3X1XA 4JYBA 1EFRA 4ON9A 4TT3D 2JEOA 4C0QC 3CRMA 3QBVA 2ODEA 5FBWB 1CIPA 2ZJ8A 2OEPA 4A4DA 1GL9B 3BH6A 1WDTA 1NBMD 1QF9A 5FPHA 2FSFA 2GZDA 5GVRA 1FNNA 5TMPA 1R0ZA 2YKGA 5SZHB 1P72A 4TMVA 5KSZA 3DOEA 4X8LA 1PVOA 2EFCB 5E7JA 1GITA 4C7OA 5JHGB 2EW1A 1G7CA 2RGAA 2QPTA 3MRSA 4M1WA 3W90A 3SYNA 4BLRA 1N2CE 5TARA 4D4KA 2CNWD 4RJLA 5FH9A 1JEEA 5IK2D 4C4PA 1EFHA 4OQMA 2AR7A 4Q03A 3TNFA 4E03A 2QTFA 4NONA 4AKGA 2QROA 2ZROA 2JLYA 1AS3A 3WMEA 1IQPA 1GG2A 1E2NA 3WMFA 2AD5A 3SEAA 1BS1A 3OAAD 3EWAA 4ZDKA 2FWRA 3PJRA 4N0EA 2I4IA 1XZPA 3HPRA 3AVOA 4LY6A 4WIAA 5LD2B 1G3QA 2A5YB 1UBFA 3K0FB 4PC2A 3WMGA 4ACAA 2ATXA 3EA0A 5P21A 1F2TA 1W5SA 1MO6A 1MKYA 1TUIA 4ZI2A 1KMHA 1N6RA 2YHSA 3SN6A 5FOTA 4A8JA 4B3DA 5B64A 3AGQA 4MRVA 3SJCA 4P33A 5L3SB 3GJ8A 4IDHA 4FMDF 4JLPA 1Z29A 3PEWA 1GVNB 1EGAA 2AFHE 3AB3A 3BB1A 3IPXA 3TLXA 5AJXA 1DO0A 3IHLA 2IW3A 1J2JA 2CCJA 2WJYA 3WNCA 2XAUA 2OM2A 2PEZA 1YVDA 4MGKR 1W44A 2QU8A 5DI3B 3NC1C 5FPTA 3U7EB 4C0AC 1F6BA 1KTVA 4UNNA 5FBQB 1UAAA 2QP9X 1DG1G 4MITA 2CNWA 3IQXA 4OHVA 4DRZA 3R9WA 2J7KA 4B2PA 4D82A 2C78A 3FGNA 1M6NA 4R98A 1GRRA 2FZ4A 1OYWA 1TQDA 1ZUHA 1N0UA 2J41A 821PA 4AY2A 1KO7A 4FXPA 1GL7A 3ZZTA 3DPUA 4O25A 1KK2A 2ZSDA 3BK7A 2J0SA 1JEDA 4UQOA 3NH9A 1U98A 1YZUA 1YZLA 2JLVA 3IIMA 1KMHB 1KSGA 3RNLA 4AI6A 2X2FA 3CO5A 1AIPA 3QKTA 1RRCA 1E1QA 3RS0A 2H1LA 3TQCA 3VTKA 4JLDA 1XTRA 4H1VA 1Q0UA 4KFUA 1W49A 4QBGB 1NL3A 3MWJA 1MABB 2D7DA 4WW0A 1XXHE 1AGRA 4Q66C 4D26A 1RVDA 1ZU4A 3OFND 4P0TA 1E98A 1KY2A 2NIPA 1QHIA 1BYUA 3UG6A 4Q47A 3QJYA 2AXPA 4W9MC 4B33A 1W36B 1HQYE 1OF1A 5JWHA 1A2KC 1O3YA 1SVIA 2AHOA 1QHNA 3SS8A 5K8IA 5AWFC 4HLUC 8OHMA 4PZLA 1XRJA 3UG7A 4D80A 2PT7A 4HAVA 3TR0A 3ZZUA 1W36C 1NI3A 1YU9A 1AGPA 1UFQA 3EASA 2X8AA 3EXAA 3VQTA 2ZSBA 1Q1EA 2GDJA 4FCWA 5HE8A 4B32A 1NVVQ 3V9PA 2PLFA 3QKSB 1KDRA 2Q3HA 1VCMA 3FMOB 2GXUA 1P62B 5JBQA 1T5IA 4JBXA 3FHTA 4KVAA 4GI7A 3R9IA 3AQ4A 4PHFA 3U44B 2RH5A 1Q1QA 2IEYA 1VDZA 3SE0A 3PIRA 4URZR 2IYXA 1E1QD 5GJVC 1Z2AA 4ITRC 2RGEA 2G0NA 2W2TA 1S3SA 1SXJC 4LI0A 4MDFA 2G77B 2QA5A 1GRNA 2FMXA 4CF7A 4WOPA 2F1HA 3BERA 4JVNA 4MKGA 4ZPXA 2WWGA 1ZUIA 5EE0A 3DM5A 4JL8A 1TEVA 1AKYA 4L8GA 2D74A 2CLSA 3ZS8A 4R71A 4URUR 2YWHA 2VRWA 4R2HA 1US8B 2ZQ5A 3LWNA 3ECCA 121PA 1VTKA 4MQBA 3SI7A 1Z6AA 4QKQA 4C0BA 4LJ7A 1WMSA 4OQNA 3RHFA 3Q85A 4HATA 2IX3A 3THYA 3N2IA 4A8JC 1ZIOA 2ZSAA 4TZ0A 5DSZA 2FH5B 2ZJOA 4TLDA 1Q20A 3SFVA 1ZCAA 1M1YE 1MV5A 1W4AA 1G8GA 4LYJA 2ZI7A 3SOPA 3GLGE 2QP4A 5DO9A 1II0A 4D2IA 4BEJA 1GTVA 5J5CA 1X1SA 3QY0A 4WA7A 3CH5A 5JECA 4MUBA 2WICA 4QG7A 1I4TD 2OZEA 5L8VA 2FSGA 5FTMA 1ZBDA 5F3WB 5KNCA 4ZCLA 1SVWA 1R5OA 2H5EA 4DUGD 1EXMA 5HCNA 4EFLA 2BIFA 1WF3A 4MRNA 3LX5A 1KAOA 3IO3A 3S1AA 4BRWA 5EE5B 4F38A 5GJWC 1E99A 1U0JA 2GZHA 4FW9A 5EE3A 3Q8XB 4OI1A 4A6PA 4IOJA 4V0ME 1G19A 3B85A 3AVUA 1AS0A 1R7RA 1NSFA 5E4FA 5FL7D 4PPNA 3GLIB 1XP8A 3VNUA 2QG6A 3GFOA 4TQ9A 2N1BA 4RKFA 4BZPA 5CIWA 4UXJA 2JIZD 1IY0A 3D31A 4GP7A 4QGAA 3TUIC 1JAIA 5CDFE 2AKAB 2WOJA 3P27A 2CJWB 4OHZA 4WZBE 1U99A 1ZU5A 2ODBA 2R6DA 1G3RA 1NBMA 1R0WA 3AKEA 3DDCA 4JVSB 4O0MA 4CZ2A 5A5GA 1W36D 2DWQA 3O8DA 1P2VA 3WRXC 4UNPA 2VPPA 5FUWA 2GA8A 5EQTA 1LTQA 3LQRA 4KFRA 4A36A 1E0KA 2J3EA 5DHAA 1GILA 5HE9A 3BGWA 3BH7A 4KSBA 1OFUX 4S2EA 4Q9KA 1U0HC 1FTSA 3BFKA 3C15C 2DFTA 2JCSA 3GLGA 5JSZA 4E22A 2GXAA 2BMDA 3QKSA 3LVQE 5IK2A 5KPJA 4JKIA 3U5ZB 2OT3B 1V43A 4ZO4A 4TQUS 4Q1FA 3V00A 5JJIA 4MYUA 3SYLA 4TLAA 2QPAA 2JLSA 4A2QA 1KI9A 4HLQB 4I1VA 5CJPA 1G291 3EC1A 2F43B 4ZIRB 4IDNA 3AF4A 4EPVA 1NMZA 1RRFA 2I1QA 3NHBA 2W2XA 3LLMA 2CMKA 4F4JA 2P6RA 3AP3A 1Q21A 4P31A 3VKHA 3T12A 5BWMA 1N6PA 2ZYUX 1RZ3A 3MWLA 2ZXUA 2UZ3A 1M34E 2ZRGA 2LKDA 1XD2B 4PPQA 4Q7MB 1DBSA 5BW8A 3EZ6A 2HT6A 3UMFA 2GXSA 3AP1A 2Z5FA 3HYTA
chains in the Genus database with same CATH superfamily
1EP3B 4DRXB 5B58T 3QGMA 4G63A 3GUYA 3O5AA 3RSHA 3QTLA 3DLPX 1K5DA 5FTKA 3K7EA 3MJCA 3LVFO 1XEAA 3MHTA 2P2LA 3LF1A 4TWZA 2ZLBA 3L9WA 1DFHA 4JLVA 1FLAA 1VBMA 4MVJE 2XB2A 5IT4A 3ZDQA 3EZ7A 4YRQA 2C7GA 2J9XB 1WOMA 3TZCA 1IAQA 1PGPA 3A31A 2NO7A 2H3EA 3O4RA 4DDTA 3OKFA 4BFLA 4KOEC 3OUTA 4G86A 3D6HA 5CK4A 5EWMB 2VDJA 1KQNA 1NF8A 2B4KA 5IG2A 1GLGA 3IAEA 5D3QA 1Q7BA 1DKMA 1XL0A 5CB8A 3E7XA 4AJNA 1GD1O 4KUGA 1C2YA 1G8MA 3SR4A 1YS9A 3L7NA 1LLUA 1X13A 1RCFA 3ZK8A 3GUZA 4X62B 4ZWNA 1GTSA 1ZCBA 3A9RA 4G1BA 2PNJA 3SVZA 2GPTA 1SC4A 3DTVB 3WAKA 2GYYA 1U11A 1B8PA 1GRQA 3M1IA 4EI7A 1TTPB 1QANA 2O1WA 2WA2A 4ODIA 1JIQA 4WFIA 5HRAA 2CMDA 4HAZA 1RQ7A 3LQYA 1IOWA 3EVDA 1D9XA 3OEHA 5JTTA 1CC1S 2FQYA 1D7OA 1IIBA 5CEEA 1QG2A 8LDHA 3GJYA 4MSUA 5GY7A 1JQ5A 3T1NA 1ECFA 4UD2A 4UC0A 2ZE5A 4DHEA 5KSYA 3A3YA 3HKEB 1SQ0A 1UR5A 4INOA 3BE5A 2GETA 1EAYA 2NVWA 3MMPA 2E48A 4K88A 4G0VA 3FCXA 1RR6A 5H16A 1USKA 3BTSA 3NT4A 4JZYA 1RLMA 4LOLA 1OXMA 2R68A 4EUNA 1FPMA 3B2NA 3DWEX 1EWYA 2WYOA 2GK6A 1JA0A 5E6SA 5AK0A 4YGYA 4BWFB 3OWHA 3ZWVA 4RPGA 6Q21A 4UMDA 3KV1A 1D4OA 1GQRA 1NDQA 1TXGA 5SY6A 3PLAE 3LLCA 2JGKA 5BN4B 4LTDA 1CK4A 4RHXA 5KREA 5D6OA 1GADO 5KNBH 1FMJA 4HTFB 1DINA 4NJOA 5TPWB 3VUEA 4CFSA 1YQTA 5AW3A 1YUBA 4NQZA 4E2XA 4F9TA 1IN8A 1FDRA 4NCIA 1KSFX 4QDOA 3RTDA 3KNZA 4F97A 2GBGA 2QQEA 4BFZA 5DNYB 2JH8A 4IO1A 1ICIA 2OA0A 2DGDA 5AKYA 1LPBB 3DEAA 2C5FA 1KOGA 3C3JA 3FTEA 3DDHA 4KXLA 3C6ZA 3DT8A 4PSKA 1BTOA 1NBWB 1XTJA 4ZGWA 4IEIA 1YZKA 1Z6YA 4BIMA 4IINA 4KQKA 3GOQA 4HNSA 1YCGA 1IU9A 3QWAA 3G0IA 4LMBA 5CBPB 2CL5A 2GEKA 4HDKA 1Y6JA 3BDAA 3QPWA 1GAXA 2AVDA 2ZVDA 3KQOA 3KHKA 4BLQA 3BHIA 3L04A 5TIIA 1KKMA 3PC6A 2XGOA 4QTYA 3PWZA 2FAXA 1B3RA 4AG5A 1E89A 3D9QX 1PT8A 3OD5A 2SKDA 1WCIA 3DP7A 3GXOA 3IQEA 2WIBA 4LOAA 4QBKA 5CCDA 1LB1B 1SPXA 3CBQA 3KZOA 3L0DA 3LPDA 5BWOA 5J43A 1X7XA 3EPKA 1CR6A 3FWYA 3UWKA 1NASA 3G02A 5JYDA 1WKVA 2OQRA 2JZCA 1TTQB 1UOEA 2X8JB 3TR6A 4GKVA 4I1SA 1FVFA 1UZLA 4RFSA 4EF5A 5K20A 2ZJBA 3HUFA 1R4MA 2XYVA 2Q5CA 3HLYA 3LKZA 4PZ0A 1M1XB 2ORIA 2XNCA 5EZQA 3I5YA 2X58A 1DPGA 5FFMA 1QGUB 2D1RA 1RWNA 4XUCA 2QVCA 5ARDA 3KM0A 3B78A 1U5CA 2Q3DA 5JEEA 1E2BA 1W88B 5TVKA 4RZSA 2VSXA 4MPRA 2BE9A 3HXKA 1MA3A 4I4TB 3W0LB 2VJMB 1BX3A 3GJSA 3O0DA 2O23A 1XMXA 2YV1A 3GDHA 2IQIA 4X0EA 3WWPA 4GC9A 3RUFA 1KO1A 1YBHA 1C50A 1JHPA 2ONKA 3CW2A 1J56A 4L78A 3RBZA 3NQ41 1QGUA 2CK3A 2OC4A 1DG9A 3ASUA 3H5AA 2XTJA 4PC3A 4EG6A 3JWEA 3CZQA 3FYDA 2OHGA 1U2ZA 3OO1A 2O3QA 4I50F 3WB1A 2YICA 4CMHA 4R2XA 4NK4A 1BZYA 2BFCB 2NADA 1RHRA 5EE9A 2OCIA 2GN9A 3WGHA 4UNIA 5LQDA 1V6SA 1B73A 1HEIA 3VHLB 4UNRA 3NDIA 3AU8A 3N86A 2B8WA 4ZV9A 3I62A 4OJKA 4P0QB 2JHFA 4YPFA 3M5WA 3P2IA 1CVLA 4YONB 1PZFA 4DXHA 5K0CA 3EQ9A 1UXOA 2IS4A 2FDCA 4TTJA 3KUCA 1YDGA 2ODQA 2F9LA 5E4TA 2SICE 5KWIA 4B0PA 2EFJA 1E3SA 5T4BA 1IBSA 2PTHA 3H13A 1MB2A 4XLTA 5DP2A 3KBBA 4O4JF 1W9MA 1D4FA 2Z2KA 3JD1A 3OH8A 4JR1A 4LS3A 1EFPA 1DQYA 3DOUA 4Q4HB 4F86A 2FPMA 3ZY6A 2QV7A 1XTVA 2DWPA 2OE2A 1MOZA 1Y5LA 3KLMX 2REBA 4AU1A 6ADHA 3SX4A 1S2NA 3NONA 3ZHCA 1OXSC 4GOJA 1TECE 3ONEA 2ZJ3A 3GNQA 4MWZA 3E5MA 2VJPA 3O9ZA 4WBXC 2OZVA 4MUAA 2RGBA 3RC3A 2YIVX 4YY3B 3I1YA 4P98A 5HPYB 3TI9A 1Z63A 4C88A 3FKJA 2HIMA 3X1KA 1KEUA 1M2KA 3UAVA 4I55F 5FI1B 3HLKA 1Z5ZA 3RUPA 3ND9A 5F7OA 1M7HA 4R68A 5BN4A 5JBNA 4W5TA 2OPHA 3R8XA 5ALPA 3PFHA 4V1CI 1WP4A 4OMDA 5E9AA 4MLDA 5A06A 3HXPA 2PLAA 1TAUA 2I2XB 4KQ6A 2GX6A 2C3YA 2X6RA 3OPQA 3RSLA 2V3WA 3DC2A 1IH8A 1YO6A 2XY4A 1W5BA 1P4GA 2DBRA 1X8JA 1XAHA 3FBWA 4G4SP 1DV2A 4HN4B 2XUKA 1E6LA 1JHRA 4WK4B 3TMAA 2HEIA 4K28A 4UEQA 4UMVA 1AMNA 1QS0B 2R6CA 3LD9A 4M8NE 4ENSA 3VPHA 2CDBA 4PLPA 3LL4A 4JFAA 1HQDA 5AOCA 3OIUA 3RRJA 3RROA 4EHAA 1HSOA 4Y6QA 4LHYA 3DZJA 2FPLA 2V4MA 2BKVA 4ZZIA 1Z4KA 2O54A 3PTAA 1OWMA 1W25A 4TPKA 1YVPA 3O4IA 4NICA 4IQFA 3T9DA 1LSUA 1A04A 3UMGA 2NTJA 5C35A 4U3JA 5K05A 2NVUA 4RPHA 5HJEA 1OLOA 3OZUA 1N75A 4ER0A 3FDZB 1XVVA 4Z4HA 3T1YB 4CCWA 2M9MA 1OKKA 5TVGA 3ESZA 3PNLA 3N53A 2VDRB 3NTQA 2A1UA 5KU1A 4GFDA 3ZHRA 4DXDA 1Z7WA 1QXSA 2XJ9A 2FMUA 5L4LA 1XZDA 3HR7A 3K30A 2GPWA 3OCJA 5GQSA 1BVHA 2H5JA 1XD8A 3DOIA 2IUSA 3NT5A 2JFBA 3WMRA 4MR9A 2B2CA 3RTBA 1T5HX 5CVJA 1TUBA 3H5VA 4GMKA 4JNCA 4UXHA 5LQMA 5KAMA 1L4YA 1S3IA 3N2ZB 4LN1A 1G6OA 2PWBA 1PDOA 1N8NA 3AI7A 3O2QB 3TPCA 3FPJA 5FDFA 1JIJA 4CL3A 1O8CA 4S1PA 2JATA 3CH7A 3GVHA 4JJIA 3WDMA 2OXRA 4WWHA 4Y6GB 5BWCA 3RAFC 4RF2A 4PGHA 3BB4A 1RACA 1V41E 2BI7A 3Q12A 1QJ4A 5A4DA 3LF2A 2G0AA 5E7IA 3U4QB 4IFEA 3ILSA 3R2JA 5B12A 1QP7A 1O97D 2FSIA 3A9SA 1ZNYA 1VLVA 1DDIA 2IITA 2WHPA 3GHHA 3MS4A 3VSBA 1VCIA 4ZT3A 4GZ5A 5EZYA 3CM0A 1YBAA 1LD3A 1OV6A 1ZG3A 2G82A 3F98A 3ZEIA 3H87A 1MNQA 1BGXT 1EU1A 1JKIA 2NQTA 4BJ3A 4BVAA 4KV7A 1XMSA 2FSVC 3O1HB 4QRIA 3OTOB 5G4KB 2G1JA 3THWB 5F9FA 4ALKA 5KHAA 5LOVF 3NRBA 5A62A 5JU6A 4U7FA 3FZEA 1XNRB 1NZDA 4YPVA 3EFEA 5M04A 1GGKA 3SJBA 3FA2A 3TQIA 1PZGA 3FLBA 4CIDA 4V1CB 1XMIA 4IHJB 3ICCA 3MGBA 3CZMA 5FOSA 1N9KA 4TTTS 1QSGA 2PO5A 1EUDA 3IELA 1D03A 4BC0A 1H2EA 3KC2A 3M4XA 3MTQA 5ALJA 4D4JA 4ZOQI 3TK1A 1II8B 3UCFA 2AZMA 4OMFG 2V4ZA 3A04A 4PCVA 3KG2A 5IKEA 2EC5A 4YCAA 1VHLA 4AJIA 1WPGA 4OHRA 2RG7A 3F7TA 1C1XA 1U9JA 2R1TB 1CUDA 5CX1A 2ECKA 3GCXA 1OROA 5DP1A 3E61A 3FPEA 4RC9A 2V96A 4DMGA 2FW7A 5LD2C 1NLMA 3KDSE 4NS4A 1QVWA 4BFWA 1COZA 4QJIA 2HWXA 1YR8A 4ROTA 4IL5A 4EJ0A 1R0CA 1UBUS 1XXLA 3KBOA 4F3CA 5JTUA 4L07A 4W1QA 3M8KA 1NRXA 1GPMA 3KXKA 1V7PC 3HDGA 1QG6A 1GOTA 4R05A 1RVV1 2X0IA 3LFHA 4O2BB 1ETHA 4Q4JA 1ETUA 4QT0A 1B1CA 1W5EA 3SIPA 4J3NA 2B8TA 2TMYA 2PO7A 4MQ5A 1CY4A 4OKIA 1L5RA 3PBKA 4U2GA 3VSAA 1QYCA 3C6MA 3I8SA 5HKKD 1UINA 1D1SA 4ZI7A 1NVTA 3EXFB 5BR1A 3A58B 4ZT2A 2QUZA 1TQHA 3F97A 3GJXC 1VE1A 3FAKA 3ELYA 3EIXA 1PFGA 3TWOA 1LXCA 2XSZD 4PM4A 4X1IB 1QYVA 5C1IA 4GI1A 4TKUA 1L7PA 2Y1WA 1CQJB 3ICQB 2XQIA 5AVYA 2CZGA 4ZFNA 2ABWA 2JGLA 2XCUA 2O3UA 1XA3A 1W46A 2ASEA 2ODAA 3L3BA 4INZA 4RD2A 4GRAA 3PC3A 2AF3C 2F64A 1J2RA 2MINA 2Y68A 2YWGA 3HDTA 4F6RB 4MULA 4NCXA 4IVQA 4G23A 4DV6B 3AUSA 2IEDA 1SBYA 5F76A 2ZI9A 3BGSA 1JZTA 2GRJA 1NW4A 2J9GA 2PTGA 1PUIA 1VFPA 1TLTA 4LWPA 4TWBA 4KHZA 4WUTA 3RC1A 3T9CA 2AOUA 1HPLA 3EC7A 3SJAA 1LVHA 4L27A 3SNKA 2VF8A 4DA9A 5KC9A 2Z6QA 4CCSA 4O2RA 3TDNA 2VYVD 2NQ2C 1YZHA 2NNLD 3HKCA 4R8SA 1W0JA 2EL7A 2PGNA 2H9YA 4M0MA 2I1VB 2BTQA 2HLDA 4DPMA 3I6BA 1E1RA 2Q4BA 4F3YA 4W6QA 4ZIRA 5AP9A 2DU8A 3GR6A 3ZCVA 2FUNB 4I5GA 4B2YA 4AAYA 4Z4CA 2R62A 2DWOA 2CSXA 1JDNA 2PJZA 3L1KA 3V1KA 5JNTA 3BDVA 4IRXA 3FOZA 1RTKA 1I5RA 4AP5A 1ZH0A 1OGYA 1G7SA 1KR5A 4R1UA 1GFZA 3FNFA 1B7GO 1S8AA 1YR3A 3TO5A 2XW6A 4CKXA 3OBBA 4Q3AA 1JT2A 5CYPA 1J21A 1ZR4A 3L0OA 2BI8A 3FZGA 2ZR8A 3H2YA 1S96A 3SYTA 2X9GA 2VR1A 4UU8A 5G0WA 4KXQA 1RYZA 1TJ5A 5KCMA 1PN3A 3FJYA 1ZGZA 4TVOA 1WDMA 3QX8A 3ZXSA 2CV2A 2F3UA 3WNBA 3QQ5A 3DPSA 4MH0R 1O57A 2CXPA 1DO8A 4ZT6A 1Z5VA 2YWDA 5IT0A 3FB4A 2F9FA 2YMPA 3LC1O 4Z9FA 2OAEA 2V58A 3X1DA 3B9BA 1KF0A 3IOEA 4I14A 4WZAE 3B3QA 3CG0A 3OIWA 1YBFA 1BO6A 1FRNA 5AVQA 5FPPA 2Q07A 3NT2A 4N18A 2VNIA 2GARA 1PAUA 4TV9A 4MS3B 2C4MA 5K0EA 3NHZA 3M6WA 2XODA 2Q50A 4LHWA 3RS3A 1VJDA 5K0BA 2CSUA 5AXCA 4II2A 3MJSA 2XIJA 4X3OA 4CEJA 1I3MA 1TUGA 2N46A 4QTXA 4BVKA 4CM7A 1J07A 3A36A 4ZMBA 4N6OA 3EPPA 4FIZA 4J03A 4B3GA 4FNOA 1ATIA 3H9BA 1V4BA 2JGRA 1GPH1 5H3LA 5LSAA 2JCBA 1TK3A 1VE7A 1MC5A 2O2XA 2RSLA 3CKKA 1JMYA 3GDWA 4J6FA 3W5IA 1J1UA 4J0IA 1NG1A 2VDWA 2ZAIA 1HDRA 3MGKA 4DTCA 1DAGA 2XWSA 3MCWA 1ZMTA 4W1PA 4Z86A 3T5DA 3VC7A 4D6PA 1F8GA 1U0SY 4J8PA 2OP1A 4LV5B 4M8SA 2F17A 3S68A 3WLJA 1QH8B 4M1KA 3HJUA 3URMA 3KALA 4EDHA 5BQ5A 3IAUA 3ZS9A 1VZ2A 2FVXA 2VDQB 3G8BA 3IP7A 1BN6A 1KZ6A 2IHZA 2QIOA 2YJZA 3L2OB 1GJRA 1OFGA 2PZLA 4IGAA 2RBGA 4WA8A 3EY9A 1RYHA 2XCRB 1FTNA 2UVQA 5BSUA 3AIKA 3Q8WA 4IH1A 1BXRB 3AEZA 1E3JA 4IUBS 4CLRB 4DWJA 3VOSA 4Z0HO 3ZJTA 5IVDA 4KB5A 1TGVA 5DLDA 3A2LA 3V4VB 5T8KC 1RXIA 2PGDA 1KSHA 4L6AA 4QFDA 3OTGA 3T7EA 3C3XA 4IJVA 2P27A 4UTVA 1I3LA 3PCRB 4RD1A 3I34X 1CZHA 3TBHA 4MGEA 5EIEA 1GQQA 5BN1A 3KB8A 5CH5A 3ZLTA 2OHOA 4V0RA 2XYQA 1SEPA 1XDWA 2QM8A 3ESAA 2X7JA 2ZWIA 3PR3A 1F4PA 4K81B 2YOGA 4ENUA 4G81A 1PZMA 4JLBA 4LDQA 3E9QA 3H2JA 1WUKS 3MCZA 1YI1A 3RVSA 2YYYA 3PJFA 5LNK6 4U39A 3E9ZA 1P3DA 4FYJA 2HM7A 2W8BA 1I4OA 3TQSA 1EVKA 3WBFA 1EUYA 2PJDA 1DQNA 1EWVA 1Z4PX 3MGCA 4CKCB 4LCJA 1I10A 5JAPA 1C3XA 1J06A 1Q1NA 5F33A 3TPFA 4FKBA 3ZD8A 3AVXA 3HCRA 3UUWA 3TRJA 2WU8A 3ZK7A 3D2CA 4D9JA 3UVEA 1A9OA 1TI7A 2HIAA 2VN8A 2G6TA 1U5AA 1D6NA 5JXWA 2M2IA 2X0RA 2AXQA 2XOKD 4FIDA 4YUXA 1XNQB 3VO9A 4E2FA 1D09A 3K9HA 3MIZA 3IEMA 4TXMA 5FOQA 2ZJ7A 2WF9A 4DN6A 1CS4C 3KLNA 1XBTA 3UMRA 1A9QA 1D3AA 4PLHA 4PLZA 4W1SA 1XRNA 1YHYA 3BEOA 3FWPA 3K31A 5EZ6B 3MA0A 5EC8A 3ZTTA 2ZREA 3FUTA 3P2YA 1UPBA 5FB3A 3TFOA 1RMYA 3BYZA 3T4PA 3VU0A 1DWPA 3WLTA 3PYMA 4UAGA 1GGNA 2V6IA 3DZ8A 1G8FA 4JC5A 2GN8A 2Y0PA 3E03A 1YB7A 2BGLA 2NWQA 4DSAA 1UEXC 4KFSA 3LT0A 3WJ7A 1P74A 5IJ0B 1DDOA 2BRUA 5FWAA 2I9KA 3HBJA 2ZWMA 4A2WA 3EFHA 4BQFA 4IDCA 1SQ5A 3HGTA 3CVWA 3P8ZA 3W4JA 4K6FA 1TUBB 4PWYA 2YVUA 4BX2A 5D1HA 1JPUA 4MR9B 5A04A 1QUEA 1E63A 3EARA 5A4IS 3GRVA 2PUCA 4DILA 2QX6A 3WK7A 2O5RA 1UAYA 1D4AA 3W3AA 1YS4A 1MPXA 1MX1A 1T5BA 4BQNA 5HIAA 2WSYB 5CH3A 4ZU3A 3ZU2A 1L1QA 3R7FA 1DOAA 1VCOA 1UANA 3O1IC 3ZY5A 1N3IA 3QU7A 4GECA 1QIIA 1IWBB 3D7KA 4Y6LA 4Q34A 5IXYA 4E30A 1T2UA 1ZMRA 2IY8A 4FD3A 3IMEA 2VYNA 1YJ8A 1YULA 4OHKA 1F2UB 1KDTA 2HWWA 1DPFA 4YMIA 1X1RA 4E5UA 3BAFA 1ABBA 1SXJA 2FZ5A 1KY4A 3Q2OA 1ZICA 4DJEC 1GLNA 2NU6A 2ZJZA 2O5VA 1KGSA 3E23A 1SIBE 4YCSA 3CKMA 1J9GA 2D2XA 4GLFA 1LFAA 2EJBA 3V48A 5HDQA 1PRYA 2ZRNA 1DVRA 3HN7A 4PE5B 4D8XA 2NUTA 1E2UA 1ZD1A 1MAVA 4ARSA 1C8VB 1JR6A 5KKCA 1KH3A 1PR5A 1P6UA 2N1MA 4CMIA 2Q29A 2HD4A 1DRWA 4TZTA 1RCUA 3IT0A 3T41A 1FRFS 1L3BA 2IP2A 4NYJR 4CI0B 4X91A 4HH1A 1NBOA 4E70A 4JI4B 3ME5A 2D2VA 2YXBA 3BD9A 1LTHR 2JAOA 1NJ1A 2WF7A 3QVLA 2XMQA 1DXOA 1LRKA 5AVTA 2BEKA 1T0IA 3OLCX 1E6KA 1TF5A 5JLJA 4UZFA 4K9KA 3F9CA 3HEMA 3O1LA 5AK5A 8ADHA 3SWWA 3ZLJA 3ND6A 4E2YA 4GBMA 5IBPA 2P4HX 1KU6A 5HG0A 3RU9A 4KR0A 1YJ5A 1UC5B 2C5SA 1NM5A 3FHCB 1VPEA 1JF8A 1T8RA 5BSTA 2HLPA 5AKKA 2C2MA 1OLUA 2I76A 5T57A 3W5SA 1O9GA 2YJGA 3G6KA 3CR8A 4US0R 4PRYA 3RJ9A 3DFIA 2DOKA 1YQUA 4TGLA 5FKJA 1I7QB 2Q7DA 3ABSB 4D4IA 4CLHA 1O97C 2IHNA 1Z25A 1Z4JA 2N75A 3TKAA 3UY4A 2Q3LA 2QM3A 3F7OA 3FSGA 4XQ9A 3RVKA 3CLRC 3BRQA 3ZWKA 2REXB 1Z2PX 5KTMA 1EK2A 3EEIA 3Q3IA 4LZLA 4EW2A 2D62A 4KRYA 4BVEA 4U2CA 1GTG1 1H1LA 1VG1A 2OWEA 4WBNB 1IB0A 3WDSA 2Q9AA 2MT9A 3QOFA 4PZCA 1W9HA 1TAHA 1U81A 2O4CA 2WF6A 1C7QA 4HB0A 4TUYA 4BLOA 3SC4A 5LYJA 3O9MA 3I6ZA 3R76A 4C6TB 1BNCA 2O3JA 4R1SA 4Q9JA 4JJAA 3MCTA 2A1TS 3ZWMA 4JLOA 2YS7A 2CKDA 2PK3A 4WJZA 2E4UA 2XTZA 1M2VB 2YNMA 3ZDBA 1H3FA 1DRKA 1QYRA 1UZNA 2BFAA 2RCYA 1BHO1 3WRYC 3PXAA 2Y77A 4L4XA 3ROKA 2PKYX 5AKGA 3I0NA 4XWWA 4H7KA 1MUUA 1WNTA 4W8HA 1CZRA 2QMEA 3P0RA 4YREA 1YCHA 4AYWA 3S8EA 2DC1A 4YP5A 3VNQA 5TT1A 2QL5A 3CJQA 2BJWA 2EHDA 3Q7TA 4PQRA 3C7CB 5K3SA 1O0BA 3VNRA 4V0NA 4H6PA 2RKBA 4L16A 1GPYA 2IXBA 3FZYA 3LHFA 4FYVA 4ZAVA 4AKSA 1YDHA 1OASA 3MILA 4V38A 5FO1A 5E6UA 2Z04A 4AROA 5JQGF 5LMCA 1G9TA 4NBKA 3GA0A 3ZGVA 2BEUA 3ET4A 3OEYA 2FMFA 4O5AA 2VXBA 2SCUB 3TEMA 4XKJA 1I4LD 3IJ5A 2Q5HA 3N6XA 4IUCS 1XPRA 3K9LA 5TMBA 1JQLB 2MU1A 3U4DA 3WX0A 2ERYA 3DV2A 3BFPA 2VT3A 1KL7A 4MI1A 1T4MA 1R12A 1JU3A 2W71A 2UZAA 4PZYA 4EUSA 1NDUA 3OJWA 2V8OA 4D79A 1I6LA 1Y48E 1X6VA 1XLTA 1KDZA 5K3EA 3IBGA 4LOIA 4JBHA 5J4HA 1E9BA 2BFWA 1DOHA 4HTAA 5DIFA 4K9RA 4WBNA 1I0IA 1U94A 5LBIA 2FXVA 4LCBA 4AIIA 1A7JA 4ZCQA 1JXMA 2I4MA 2OYCA 3FKSD 2WE7A 5CBPA 1N0HA 3D7NA 3FMPB 5JNVA 4MROA 1HT2E 1F6WA 1QPBA 1ESDA 1XL1A 4PHCA 4MLPA 3K94A 5BSVA 3W5CA 4R8KA 5K3BA 3P0JA 4QJ4A 2OXTA 5D1NA 4JT2A 4DCGA 4OM8A 4POAA 1M0EA 1WD7A 1WPQA 2VHUA 2PUWA 1SUIA 3JZIA 4G5YA 3IKJA 5D3KA 1EXVA 4X8OA 1HL3A 2M1XA 1J5PA 3Q88A 2VSFA 3KQMA 2JGFA 1PJAA 2GO7A 1E9RA 1N5IA 4GP9A 3WOVA 2VP6A 1HE5A 3WJAA 1PU2A 1IN1A 3WGNA 2ZOSA 3BK2A 3E58A 2W7TA 2O1EA 3R0ZA 2ZUBA 3U7GA 3KPUA 2XT0A 1R5NA 3TW4A 1SB8A 1T2AA 3PU6A 3MJHA 4RPIA 5SYNA 4CTMA 1C7FA 2D0DA 3PFCA 1GZDA 4ALMA 1LPMA 1XVUA 3CF2A 3KQTA 4O4JA 3EIHA 2FPPA 1TVEA 2UZ0A 2NP7A 1G5PA 4R3UC 3PVZA 3BTOA 3Q10A 2BMEA 4MWOA 1R4NB 5DM0A 5AUQA 2CUNA 3G9ZA 3QW4B 5C4MA 4XGQA 3N2YA 2FZVA 4OHUA 1QAOA 4XYGA 1UFKA 4KWHA 1WVIA 1I9GA 1SVSA 2W93A 1NLUA 4K87A 5BRNA 4G1CA 4DV4B 4ZAZA 5INTA 2K2QB 5G3YA 5HMMA 1RXWA 3GBPA 1PKXA 1J25A 3ET5A 2I8CA 4P5DA 4HBZA 4X1YA 5DI3A 5BSRA 4DCSA 2XGJA 3AUFA 5EP2A 4F2GA 1N33B 3BWBA 5EJ7A 3DQZA 4RK1A 4KIUA 2P35A 4UMFA 1YB2A 1V1JA 4L4RA 3UW1A 3JQCA 4BMZA 4RVSA 3B6IA 3C43A 1UEJA 2V5VA 1RWBA 4JH0A 4UEOA 3O6VA 3U9TA 5MGNA 3H5LA 3HADA 1PZHA 1XJWA 2GAOA 2Z8YA 3DNFA 3K1AB 4ZOLB 5KYNA 5L7TA 2BFNA 1HDEA 4FC6A 1TF2A 1X1CA 5EWMA 5IFLA 4TYYA 1F6DA 2W5UA 4YN3A 4QYMA 1U8AA 4KJZA 3G8AA 4PRKA 3C8MA 4TKLA 4L3WA 4HRXA 3FPAA 2PLWA 2IF2A 4R41A 3Q5GA 2PUBA 1O5IA 5EKSA 5BXQC 4WNCA 2X6TA 4H6VA 4NENB 2VYCA 1U5BA 2QW8A 2Z08A 4GPTA 3SZGA 3V8PA 2Z58A 5IT9A 1Q57A 5JYCA 1MB0A 3AF6A 2C7RA 4B4WA 4HPXB 4DV5B 2G1KA 3W6PA 4A27A 4CYMA 1AHIA 4XQ0A 3RASA 2R7AA 3ZDAA 1BAPA 1Z2OX 4K2AA 3EDCA 3HDVA 2QEQA 3AM5A 5IARA 4I6JA 2VP3A 4FILA 1EFKA 2VJAA 4DNPA 2VQDA 2JFXA 2AG6A 4H59A 4MV0A 1OB5A 3M0EA 1UM8A 4N48A 1JFFA 5LXTA 2OHJA 2GZSA 3K9NA 5DWQA 4BKUA 1MTOA 4ZEXA 3BWXA 3CLHA 5JZOA 3SX2A 4I4CA 4AF7A 2A5GA 1OFIA 4TM8A 5DV9A 1ZA2A 3RFCA 3QE0A 1UC9A 2A33A 4YUZA 4UTNA 4NZPA 5JZMA 3H2HA 1LFDB 1M2WA 2G8LA 4I9UA 5B7QA 3B48A 2QJFA 1EFAA 2I8AA 3CRNA 3DDSA 3OEEA 2WHQA 5JO9A 2C2HA 1H8HA 3CCFA 5K8VA 2VDVE 4P4LA 2A86A 4AUNA 4LBYA 2ZITA 1KFCB 4MJ7A 4UTRA 3QVXA 1V1MB 4JXZA 1NUTA 4J3FA 1GTRA 2XNKA 4YB8A 3TW8A 1IVSA 4URFA 1BJKA 5IN5A 3R9XB 2ZRKA 4LHEA 1G18A 4UCXA 2IH2A 4LYAA 5AVJA 3UB4A 5HVNA 3ACCA 4QQRA 5KQMA 3D3WB 4D25A 3UMMA 4BO0A 4F56A 3QSYA 2WLTA 4WXMA 1WF6A 5KYXA 1LDGA 1E6MA 5C1BA 4E7PA 5A03A 2UUBB 4K26A 3SZOA 5J4KA 1T5DX 4UDNA 5TQJA 4GLOA 1FNMA 2QT1A 4UPEA 1E9AA 5REQA 1GA1A 2BELA 2VDKB 3OCYA 4M88A 2I2AA 1G2PA 4HT3B 4KX3A 3NORA 1NNEA 3WBKA 3QENA 5DW0A 4G26A 5ADUS 5ENDA 3T0GA 2NTNA 3FYTA 4CLRA 2BDTA 3VZSA 2K7ZA 2HA3A 3RS4A 2X5NA 3ECSA 3ZCRA 4BFCA 4BGDA 4NYMQ 2Z2IA 5DGXA 1ZH6A 1V6AA 4HWKA 3C3AA 2WUEA 4QRDA 1BQ3A 1V96A 2HU2A 2XKKA 1BD3A 4RENA 4BNFA 4BTVA 2ENUA 1ZONA 4BNUA 5ITVA 3KKKA 2UYHA 1QH8A 3TD2A 3AVQA 2DP4E 3C1AA 3P9XA 4R16A 2J85A 1ULUA 1YDWA 2WWXA 2I0FA 1IJKA 1EWKA 1M5UA 3SSMA 5JMTA 5JQWA 2XDWA 3BXHA 1GRVA 3F1LA 3K05A 4Y2UA 4OPMA 4UULA 5BOSA 1KPIA 2AN4A 3TPZA 1DMRA 5LBTA 3V8NA 1VPLA 4M53A 3QVGA 4I2NA 5K0NA 1PJ4A 3WIUA 3KTAB 3WZ2A 4EMTA 3DOFA 4ND3A 5E6RB 2HRRA 3DM9B 2ZBQA 2MOKA 2XIQA 4YHHB 4A82A 3GFTA 4XD7A 3ZR4B 1VG8A 1EYZA 3G5LA 2O1XA 3KJFA 3Q6IA 4KE9A 3K71B 3JQ7B 3NXSA 1G6KA 4N82A 4QPJC 2QN3A 4QQNA 4WCVA 1S3FA 5DYYA 1OA1A 2O8NA 3HBFA 3KKQA 4BIIA 5ES4B 1QONA 1D2NA 2YJ6A 2Q7XA 5C8YA 1NPYA 4ILKA 4EHNA 4JP1A 1TX4B 3DZGA 2BT4A 3OTQA 4H7IA 5TT0A 1YRBA 4N01A 2FUG1 1JQBA 1G2OA 2JI9A 4GMHA 1V3UA 3D5TA 4IIJF 4U9IS 5KJEA 5TJHA 1ODKA 4U7PB 4RA9B 3LY5A 3MSCA 5I4CA 3Q7PA 1CF9A 4DCVA 1EKXA 3Q9UA 2GDZA 1P4JA 2B5VA 4FT4A 2P7HA 4ZVMA 3WFJA 4F7DA 3QE4A 1DIHA 2ICAA 2ZB8A 4HQ6A 2NU8A 5C7IO 2FKNA 3AY0A 1ZM3A 2QTGA 4YAGA 3DQQA 3FIJA 1OLSA 3FOEC 1N36B 2NV0A 5CU7A 4FEEA 3HDQA 1OBCA 2GN0A 4MVYA 4RY0A 5CA1A 3PNKA 3DFUA 2I7DA 3BCRA 3KYCA 1QU3A 3VTZA 2AA3A 2EP7A 3AUXA 1TD9A 2ZI5A 3HN6A 4XWOA 2DBZA 1HETA 5GGXA 3PUJA 1A9XB 5F7XA 2IY9A 1VKJA 1EX1A 1R5JA 4TMTA 2OL4A 3ZNNA 5ISMA 1R8YA 1Y7TA 4TKZA 5GMOA 1G5IA 2Q3MA 3CX6A 4BPRA 2VHQA 4IRMA 1QCYA 2RI6A 2WPNA 5JDIC 1RS0A 4EHLA 2FDRA 1Z8NA 3FFAA 4PR0A 4UHKA 3GG2A 4OXKA 3DFFA 1TZJA 3I2JA 5GM1A 3T15A 1XU9A 2P5YA 3DAGA 5KX5F 1ODIA 2A58A 3JTMA 4XEUA 1K6MA 2BL4A 3TOCA 3L8CA 4KCGA 1E64A 2DT5A 3O0TA 2QAGC 3V1MA 1ZXBA 4B6JA 4OBWA 3LY9A 2A0UA 2QNIA 3HZHA 2WJGA 4KPGA 4WVFA 4XFDA 3WV4A 3VU1A 4U02A 4PYJA 1NOJA 2P77A 4PQEA 2XOEA 2IBSA 3K5WA 5JQGB 1MW8X 2QTTA 4ZCTA 3ELUA 4B3CA 2XZPA 2G72A 3QSGA 4LXHA 4ESOA 1ZL2A 3M49A 5ABPA 1JALA 1GZUA 2Y1EA 3DBIA 3JATA 4MV9A 3ZQUA 5HNKA 3Q0TA 4C7KA 4P3YA 4B0OA 2E89A 4IEFB 4XM0A 1JWBB 3DNPA 5HF6A 2M98A 4OAOA 2FN9A 3HNRA 3I42A 3JASA 4UFOA 2WYUA 5FBLB 1ZMOA 2ZCUA 3CVVA 1U1DA 2ZS9A 2IYUA 1JIKA 3FTCA 1MB4A 4IIBA 3ED5A 3V6LA 3D4BA 4WGFA 1CHNA 1OSNA 1C7IA 1NVGA 1PGQA 1F8FA 3VR3A 4OX9B 1JAXA 3IQZA 3ZQ4A 4RHEA 4TMWA 4URHA 5A71A 3MUOA 1Y8ZA 1ESZA 3KS9A 3WGLA 1SAYA 1CQIA 5EQJB 5TF4A 1JQEA 1MEJA 1RRGA 2F4NA 3QKRA 1YQGA 3GH3A 3S2FA 4CIXA 5GTDA 1ISPA 1YR7A 3MRTA 3KT3A 4U9HS 1AKNA 2YVLA 2JGEA 4HGOA 4BQPA 4E33A 1GTL1 3P2EA 2SKCA 3SYMA 2R1TA 3H42B 2ZAGA 5BWNA 3QTTA 5AKIA 3COJA 4MEJA 2JIDA 3U31A 2OCPA 3GGJA 4FEAA 1AS2A 4GEKA 4RHCA 5I8ZA 1UPTA 3JYQA 2GUWA 4HFNA 4DARA 1POXA 2BSAA 4ZALA 4Q3KA 1U6IA 2OFXA 1NZFA 1U7TA 2KI5A 4V03A 4D81A 3EFOB 2EFGA 4DIEA 1SCUA 5JNUA 2H48A 1TJPB 2JLXA 1ZLXA 4Y6OA 1VKOA 2HGSA 1GUZA 2J59A 5M5BA 1C4KA 4WKBA 1TIKA 3QF4A 4Y2HA 5KNDH 1IN7A 1Z5NA 1H6BA 2DSTA 5KTNA 5TS3A 2MR5A 1MW9X 1C8LA 2G70A 3JALB 4YS6A 1PJRA 3IT1A 1EM8A 1ZPDA 1NW7A 3PXBA 2JGIA 4LBWA 3PIIA 1NVFA 1V11B 2AW5A 3GMSA 4M6WB 3DBLB 4M7PA 4BUZA 4C0XA 2GPYA 3GJRA 4ALLA 2Z5VA 3B36A 4W4TA 2JVIA 2FFBA 3W3AH 3RK1A 4DLXA 4B3BA 4BYGA 4LYHA 4AXXA 2B82A 2FW0A 4K0KB 4HVLA 1ZVVA 4EJSA 1EZ1A 1PJ2A 1U8TA 2YQ4A 3K2EA 2ISSD 3C0KA 3MPUA 3V2UA 2AH5A 4A6EA 5JCXA 3O3NB 1KKLA 1SCBA 4QOFA 4LJAA 5LIPA 4CEHA 4M9RA 1CIJA 4RVOA 4OLBA 1KZYC 2VK4A 1XHFA 1SG9A 1XZ8A 2A9QA 2WSSD 3E9CA 1ULZA 3QX7A 2EBHX 5JSZB 2EFYA 2X0EA 2QW0X 4WLUA 1C1YA 1E0SA 5KTKA 1JXQA 3HE3A 1QVRA 1JRLA 4ESVA 4HDNA 4BV2A 4ESHA 4QGSA 1YV9A 3RS2A 4GIBA 1TZKA 1K2WA 4ASUD 4C43A 3K20A 3RHSA 3UKOA 3G68A 1X0VA 5E2IA 2O2EA 1G4AE 3HCWA 2QSZA 4MAAA 3T3GA 3I2KA 4ZQCB 1USWA 1OYYA 3NHFA 5BR8B 5F3RA 3EPLA 2W70A 4E15A 4U3JB 1EGVB 1SXHA 5I6DA 2QZZA 5L3RA 3S8YA 3IA7A 4GYYA 2VJNA 4TTSA 1JPVA 5DTIA 2IUFA 3TRHA 3AG5A 4DMLA 4QAQA 1TT7A 2GI4A 2OVFA 4DSOA 3EG5A 2OO7A 2Z6AA 4ZJUA 1X87A 4X8HA 1YT5A 1DP4A 1G5FA 1XRSB 4KV9A 4KDFA <