4XVUA

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
301
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSLADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 103
structure length 301
sequence length 349
chains with identical sequence B, G, H
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xvuA00
2KBEA 3GCGA 1ZM3A 2OFXA 2QP3A 3NEYA 5D3MB 5DNYB 1AJEA 5K8LA 2A3RA 3IIKA 4N3NA 2GAAA 3KQKA 1IBRA 1VYUA 621PA 4QJ5A 5G53C 3EC1A 1BMFD 3AGQA 3PUZA 2QZ4A 4QG7A 4JLDA 2DPXA 3L43A 3DKPA 2F6RA 4A2WA 3NVAA 2YJTD 4Q7MB 1H8EA 4XSHA 3EA5A 4P4SB 3W3AA 4G3XA 4PC7A 2F1HA 3T1QA 2P6NA 2RGNC 3EWSA 3QKUA 1P2TA 2VHTA 4XTCS 4RD3A 4LY6A 2Q21A 1E4VA 2C04A 5H70A 5JI2E 3NC0C 4CVNA 2FGKA 3WMGA 5FFMA 2A5FA 4RD0A 3HYTA 4KITB 2ONKA 3OAAD 5JECA 5JMTA 1ZBDA 1NNEA 5ELXA 2ZPTX 1Q1QA 1E1RD 2PLFA 2OEPA 3AKEA 4PQRA 1EXMA 4I1OA 1A4RA 4HYYA 3AKDA 3SZRA 2J0VA 1UF9A 4GL2A 3I8XA 1KJZA 1FMJA 3IGFA 3ETLA 1XDBA 4IOMA 4HAXA 4YXWD 4B3CA 5KSZA 4BZPA 2IYQA 1DO0A 3EASA 2GEDA 3NIBA 5FOSA 2JDID 5EJEA 4IW3B 5H68A 3RVBA 4UJ5A 1VTKA 5GJCA 3DHWC 4ZCLA 4QJ3A 3FMFA 5JRJA 2REBA 2WJJA 4PSVA 1G7RA 3RAPR 3QXXA 4L16A 4PX9A 1KMHA 3EWAA 1G7CA 3BFVA 2ATVA 3G82C 3FHOA 2V6JA 3WHLA 1BS1A 1S8FA 2DBYA 1NIJA 4D4LA 2YC4C 3CR7A 1J8YF 5L3RA 4MRRA 3GP8A 1S2MA 3DVLA 1YZGA 3PIRA 3VHLB 2NIPA 2OO7A 3TVTA 3C8UA 2OSBA 2ZVQX 3AVPA 1E4YA 1QG2A 3CPEA 3HU1A 5E95A 3THWB 1IOZA 1R4AA 3LWNA 4JBXA 4Z8XA 3GLGB 1S1MA 1G8PA 2EU8A 2BKEA 4KFRA 2WMOB 2P65A 4PC3A 2GBLC 3D8BA 4K46A 2V4ZA 3U7GA 2VSXA 2VH5R 4MRNA 4O2RA 2OCBA 1OFHA 3VFDA 2QROA 3B60A 4LYJA 1CEEA 1BYUA 1WE2A 1U9IA 2D2EA 2FE4A 1IN4A 2BM1A 3PEVA 4P32A 5EE5B 1H65A 1NVWQ 2KB0A 2ZRBA 3FFBA 2FSIA 3NBZC 4LV6A 5TXGA 3C5CA 4HLCA 2AD1A 3A1TA 2EFDB 3U6KA 1VCOA 2PMKA 1BYIA 1JALA 2ANBA 2NO6A 3KFXA 3P27A 4JKIA 5EXXA 2REXB 2GWHA 2CHVA 3HYRA 3AKCA 3X1XA 2CLDX 4IVQA 4D82A 4CYMA 3QF4B 2F1RA 2BVNA 5JLJA 3UIEA 4F93B 3LBIA 1PUIA 1SXJB 1G5PA 3C41J 5DYGA 1FNMA 1KTVA 2GEUA 3IILA 2H57A 3EG5A 3KKOA 221PA 2J46A 1S4QA 4P4UA 4NKRA 3HR7A 4BUJA 4KAXA 2CCGA 1EFTA 1XMJA 4FXPA 4Q7LA 4IJMA 3GLFE 1K8RA 1H8ED 1DPFA 1E9EA 3BRWD 3MFYA 1OXUA 3EZFA 4Q7JB 1GKUB 2EYUA 2RB4A 4GMXA 4ACBA 4QFMA 1QHHA 3TE6A 4IFBA 2CEAA 1UKVY 2WM9B 2WWGA 4L9SA 4Q18A 2P0EA 3M6AA 4Q00A 4TT3A 3ICEA 1I4DD 3BXZA 4ZCMA 5JI3E 3DPUA 2I1QA 4JLBA 2DFLA 4G5RA 2X77A 3ZLJA 1T3HA 4CRWB 5IK2D 1G4UR 1BO6A 2DWQA 4M1SA 1E2HA 3LLMA 4D0NA 2R9VA 3IIJA 3X2SA 4Y0VA 3CRMA 3LAWA 4ARZB 2P6RA 2CBZA 3HP1A 2BMFA 4W7SA 2EFCB 4LBYA 2W0MA 4OQNA 4B47A 3A8TA 3T35A 4RZXA 4PFSA 2OBNA 4N1AA 1IAQA 2WKQA 3AP1A 2D06A 1E2LA 2BMDA 2OE2A 4MUAA 1NL3A 4Q01A 1XZPA 1XD2A 5IK2A 4BEBA 4AKHA 3B2EA 4BLSA 5FBRB 2NMVA 1E98A 1UBEA 1P73A 3B82A 3BWDD 2ZRHA 4K8OA 2R44A 3F5FA 2BBSA 4RZ3A 1ZC3A 4LJYA 1T5IA 1JBKA 3BK7A 1Z28A 4TT3D 5AJXA 3RABA 5JJKA 1U0LA 3QI2A 1HUQA 2Y8EA 2XEXA 2B7BA 3L8ZA 1OLOA 3K0AA 3UATA 4D80A 2IEYA 3HDTA 2XXAB 4ZIRA 1P61B 4HB0A 4QC2A 2VPPA 4FIDA 1XF9A 2WJGA 3BS4A 3AB3A 4IDOA 4E03A 3U7FB 3GPLA 4RKFA 1QG4A 1T3SA 4A15A 1OIVA 4HUQA 4L8GA 1Z22A 4B35A 1D2EA 4HATA 3EIHA 4HB3A 3TW8B 2FMXA 1US8B 1U90A 1Q1ZA 2UZ3A 4RFVA 1S1CA 4V0NA 5DN6A 5EP4A 4YQFA 1W4CA 2PJZA 3D31A 1W1WA 2ASEA 4JSTA 4UXIA 1IN6A 5FPKA 5LD2B 5LB4A 3L2OB 4LJAA 4YMTA 2E87A 1EX6A 4OHVA 3FKSD 2JIZD 5GJWC 4QGAA 4KJZA 3I5YA 3GLHB 3M1IA 4DKXA 3T1OA 1TF7A 2OG2A 3T34A 3THXA 5CYOA 2I1VB 2ORWA 3I73A 5KSYA 4LBWA 4YC7A 5CJ2A 3B7GA 2BMEA 2P6UA 5C18A 3AP3A 2PX3A 3NDBB 2FF7A 1E9AA 1E2PA 1U99A 4JT2A 3ZD6A 3QXCA 5JHHB 2BJVA 1MR3F 4XIGS 2IS2A 3M4YA 4CT5A 1WB9A 1Q57A 2HLDD 2HV8A 3DL0A 2Z4RA 3MWKA 2CXXA 1N3BA 3GLFA 2UKDA 2PZGA 2HDNB 2N42A 4ASUA 521PA 2C95A 3W8RA 2VQSA 1E9SA 2XXAA 3GEHA 5JJIA 2A2ZA 3EARA 1XPOA 4GZMA 1OHHA 1KI6B 4C0AC 2OV2A 1GUAA 3W6NA 2GVZC 4DXAA 2ZI9A 2IX3A 2YWEA 4Z1MD 1Q1EA 2F9LA 4DLWA 3T5GA 4ZPXA 1GVNB 3QKRB 3K0EA 4MYTA 1CU1A 3RLFA 2GZHA 4UXHA 2A78A 3QIAA 4GNKA 2O8DA 4IVRA 1FP7A 1U0HC 2IK8A 2ZROA 3U60B 2YWHA 4A82A 2OFWA 2QAGB 1GITA 1T4GA 2GCPA 4Q1AA 4I1VA 2QGZA 4XD7D 5AR1A 3QF4A 4LGMA 4QBGB 3TUIC 8OHMA 1J70A 4M1WA 3CRVA 1L8QA 3KUCA 1V43A 2WPDD 4MRVA 2WWYA 2J3EA 4MITA 5KDOA 2DCUA 2FZLA 5FR2A 3UG6A 5FOVA 1RE0A 1T6NA 1DELA 2ZJAA 4D2IA 1EG7A 1Y63A 5KPDA 4XWAA 4B73A 3GEEA 3DOFA 3NHAA 3T1VA 2GJ8A 5JS7A 4EJSA 4V03A 4C2TA 4PQFA 4GFDA 2PZFA 4KV9A 5FI1B 2WOOA 2G9NA 2QL6A 4PPNA 4XVQA 5IHPA 2R62A 1NVVR 4LOAA 1OH8A 4IHQA 5C4GB 3EPKA 3I92A 5EE1A 3I8SA 3EA0A 2AXNA 5E7IA 2JLUA 4QXAA 4CEJB 3QUSA 3IHLA 3JVUA 1KI9A 2XZLA 4M9SA 2VP5A 2J7PA 2B7CA 1NG9A 1CBUA 1SULA 1HEIA 3QBVA 1TAGA 4E07A 1XXHA 2IF2A 5KUTA 1K5GA 6Q21A 3K70D 3U4QB 3REFA 3MRSA 4I99A 2CLSA 5B64A 2DFTA 3BERA 3DOEA 1GFIA 3NG1A 3TUJC 4TMTA 3O47A 2WJVA 2ZJ2A 2A5GA 1PJRA 5FTMA 2F3TA 4JJZA 4DJTA 4IOKA 3E5HA 3WYFA 3BE4A 3RRZA 2BBTA 1X86B 5HCIA 3ZVNA 1RRGA 2FPMA 1HT2E 5CIQA 3RS7A 4YMUA 3TKLA 5B30A 4TMWA 1JPNA 5JRZA 1TUEA 3FTQA 4QGFA 4RD4A 1E2IA 3QOFA 1HE1C 4G01B 4JIMA 4ZDJA 3VTKA 3AUXA 3I3SR 1KK0A 4H1UA 5KDDA 2IYWA 3GJ3A 4LJ5A 1U81A 5IT5A 3U7HB 5BWMA 2GTPA 3BH6A 3O8CA 2ZRMA 2XNDA 2A5JA 4W9MC 4BLPA 4B2IA 4IFEA 4Q1EA 2ZRPA 3RWMB 1XEXA 1U8YA 2CE7A 4OHYA 4WA7A 5BN4A 3K8YA 1G3RA 3QY0A 3H4MA 2KBFA 2J7KA 4KVGA 1M7GA 4ESVA 1ZCAA 1FOEB 3D6TB 1KAOA 2J5XA 2GJSA 2GA8A 3A1UA 4OQLA 1LNZA 4Q9KA 4A8JA 2ZYWX 3EIQA 5D3QA 2MSEB 4FCWA 1FPMA 2VYFA 3EC2A 2X2EA 3OFNA 1PVOA 3AVWA 2R2AA 3RDPA 4JJKA 1KY3A 2V1UA 1N25A 1YQTA 1W4AA 1IJFA 1EX7A 4B48A 2J0QA 1QDEA 3QEOA 4Q21A 2FZ4A 4JKYA 2ZE5A 1P72A 3JVVA 1D2MA 2IUTA 2Q3FA 3LXRA 3P4XA 5HR5A 3A4NA 3GD7A 4QHTA 3CBQA 2OXCA 1CP2A 1GDDA 2O8CA 3QENA 1Z29A 1P62B 2D74A 4B74A 3V4RA 1COWD 2WSMA 4HUQB 1E1QD 1R6BX 2X8AA 5JCPA 4BLTA 3EPHA 4LJ9A 2ZRLA 1UDXA 2H18A 3AVQA 2VP9A 1KMHB 1S9DA 1G1MA 1OB5A 3H1TA 1TU4A 4LJ6A 2ZAMA 1HY3A 2CL0X 1Z6GA 3NXSA 5FOUA 4O2LA 3OHMA 3B1ZA 4PHFA 3BBPA 1MOZA 1S96A 4DCNA 4EKDA 1I4LD 2W6JA 2WWXA 3THWA 1QZXA 2ZRGA 1TEVA 2H17A 3Q85A 4RVCA 3GLGA 5ANRB 2Q9BA 3EXAA 1T0HB 2Q3MA 4NBSA 1ZNZA 2O8EB 2FV8A 2ZJOA 3LO5A 3B1WA 4Q1BA 2ZS9A 2XJ4A 2ZITA 3KJHA 4LDJA 4D0GA 1XFAA 3LD9A 3W34A 2DFKB 1KK1A 1Z0FA 4NH0A 3EIEA 3LBHA 4PHTA 3WY9A 4QHSA 3G0HA 3PEYA 4LJ4A 4JLVA 3KXIA 4DLUA 2DFNA 2OXRA 4MYHA 3SJZA 2XTNA 4DDVA 2YHSA 1XTKA 4PZYA 1AS3A 3UMSA 2G77B 4DDUA 4NYJR 3ASZA 2XNSA 4LCBA 2JCSA 3TRFA 3TAHA 3WXMA 1G21E 3CZQA 1E32A 4ZI3A 4BFYA 4PAOA 1B23P 2PBRA 2IT1A 3WBKA 4BFSA 4D0LB 2ZSAA 3TQCA 4EUNA 1JNYA 3MWYW 4PO9A 3FHCB 4URZR 4EFMA 3FYHA 4HDQB 1UJ2A 1UFQA 5FOWA 2YWGA 1ZM4A 2AL7A 3N5CA 3GJ6A 4H9GA 3NBXX 1HV8A 1NLFA 5IDVA 4G5SA 3GFPA 3L0SA 2WSSA 5AUPB 1VG8A 4B75A 1KHTA 1MKYA 2F1IA 3BIFA 1P2UA 3V4FA 2GJKA 4NE2A 5EE9A 5JHGB 1SHKA 4UKDA 2BCGY 1AA9A 2ZAOA 3IBYA 1LVGA 1NBME 3U2QA 5DSZA 3OEEA 3GEIA 2WAYA 4ZCIA 1G8GA 1SVLA 1N0WA 1VYVA 3CNNA 1DAFA 2Z83A 1YZLA 3RWOA 1CLUA 1KSJA 2EFHB 2Q3HA 1GRQA 3BFXA 4KSBA 4U02A 4EQ6A 421PA 2CK3D 4R2IA 4DT1A 1OV4A 3KQNA 1Z06A 1WBBA 3CX6A 3K9NA 1G4AE 2G3YA 2W0SA 3R8CA 2IW3A 1F3OA 1EFUA 2IYZA 4S2EA 1II8B 1P75A 1G16A 3SHWA 2OLKA 4DUGD 1ZU4A 3NTUA 4CZ2A 3M0EA 1NP6A 1R8QA 1KNQA 5JEDA 1KI4A 3TR5A 3OIYA 3TVDA 3VR4A 4C9BA 5SZHB 1KI8A 5DH9A 4AC9A 5FR1A 3KQHA 3RRMA 3L0OA 1N0UA 5FBVB 5HKKD 5J4VA 4R9UC 4TLEA 4C30A 3G5UA 3QEJA 1NI3A 4DCVA 5A5GA 5JZVA 4LC1A 2QT1A 1CJKC 1LB1B 2QTHA 1R7RA 3RS2A 1KDTA 4XH9B 4C0JA 3BJIC 4MDEA 3A1WA 2YKGA 5CK5A 2EVWX 1UM8A 3ADKA 4WZ6A 3LXXA 2WIAA 3F0TA 2WWWA 4L5BA 5AJZA 3WHKA 5J40A 5JWOA 4PAQA 1GNQA 3FPAA 2W2TA 2XITA 2ZYVX 3B9PA 4M0LA 3TW4A 3ZJYA 2R6CA 2XNDD 4Q7KA 5TV2A 2V7QD 4GP7A 4DDWA 2G83A 2ODWA 3GFOA 4EIWA 2J7PD 5BXQC 4UQOA 5EE0A 1RJ9B 4HEJA 3VR2A 5K8UA 1KMQA 5FOTA 3PG5A 3WNDA 1GRNA 1GKYA 3GJ8A 4WZBE 2GXUA 4JL5A 1ZUIA 4X8MA 5IRCD 3IO5A 3HJNA 2C9OA 1T0JB 1D2NA 1AKEA 4ZDWA 3WRYC 2PT7A 5EP3A 1Q3HA 1S0UA 3CH4B 4PAMA 4ZIRB 3WP0A 2XJ9A 3KTAB 5LPNA 4OKSA 5CK4A 1KYIA 1A82A 1CR0A 3VR1A 4MH0R 2V6IA 1II8A 2XAUA 4OQMA 3T12A 5AK0A 4K81B 1Z63A 2ZU0C 3BB1A 5TARA 1V5WA 4C3ZA 3DO6A 3K9GA 1X6VA 2JIZA 2IYVA 2JGNA 3O8DA 4MKFA 2JLQA 3QKSB 4MGKR 2OBMA 1G18A 5LD2C 1W36B 4JVLA 5EQTA 2CJWB 4F91B 1G17A 2ZI6A 3K9HA 3OEED 2FDCA 2EWVA 2ZETA 1M7HA 3CUEF 1SQ5A 3E70C 2O0JA 4URYR 4ARZA 4Q48A 1SVOA 3AP2A 3FOZA 4NYJQ 2HXYA 4DLTA 4PC1A 4KO8A 1SKYB 2GXQA 3R7WB 2OUKA 1KI1A 2X2FA 3QPVA 2CMKA 1PLJA 1XEFA 2C03A 5P21A 3CIOA 3NEJA 3FGNA 3N2EA 1GAJA 1YRAA 4DLSA 2J45A 5HKKA 4PO1A 3SJAA 2V9PA 1K6MA 1SVKA 4MKHA 2IYUA 2DHRA 2JASA 4I1UA 4RD6A 1LF5A 3UMRA 1IY1A 2EW1A 5E7JA 2LKDA 3PR1A 4Q4LA 4B32A 1D9XA 3JZMA 4V0KA 3ADBA 3GLHE 2XB4A 1OFUX 3ZS8A 1SVWA 5AJVB 2C99A 5FPYA 3VHXA 2NG1A 5JSZA 2CVFA 3P1JA 5K8IA 1EFCA 1L7VC 4JZKA 1MV5A 1RFLA 1Q44A 1NJFA 1ZM2A 2G88A 4X8OA 1GILA 1S3GA 2DWOA 4Z54A 3ZVMA 4Q4JA 4EPXA 1CR1A 1QHYA 1VIYA 3AVOA 2P5SA 4M1OA 4OHWA 4PO8A 4QM6A 1NLYA 1G8YA 1P3JA 2F1JA 3CW2A 1RYFA 5D3MA 1DG3A 3MD0A 2R65A 3QPWA 1YR8A 2ANCA 3R9XA 2IA5A 1F6BA 4KODA 2H7VA 2IYRA 3SQWA 1NN1A 2VP2A 3IKJA 4B43A 1AS0A 2R6GA 3WMEA 5FPTA 1M1YE 1GP2A 3D7MA 4MDFA 4B3GA 1T8TA 3PUVA 2QSZA 3LH5A 3LNCA 4KBGA 2HF9A 1VCMA 2QMUA 5EXSA 2ZRIA 1SVSA 2ZR7A 3TUZC 1A7JA 1E2EA 2XTZA 4RCZA 4BFZA 3OESA 1T9HA 2ZS7A 3ND9A 2Z6VA 1SKQA 3U3KA 2P2LA 2BWJA 3X1ZA 3UXMA 1NRJB 4ZV4A 5JWRA 1ZVQA 3T1TA 5CM8B 2ATXA 2AK3A 3QKTA 1NMXA 2FPKA 2PEYA 1YE8A 3AF2A 3W5JA 1VIAA 4Q19A 4KFUA 1MABA 2GXAA 1ESNA 4TZ0A 2EFEB 4QNRA 2A5YB 4PR0A 4O3MA 1XJQA 1E1RA 1G64A 1NVVQ 1XTJA 2WAXA 4DLZA 3IUYA 2EQBA 3W8NA 4D26A 4BASA 3AUYA 1M6NA 4DCSA 3GLHA 3KB1A 2FU5C 1ZIPA 1XRJA 4HI0E 2V7QA 1L2TA 4G1UC 4P4TA 4FMDB 1HE8B 5KYKA 1CTQA 3SBDA 2FH5B 3VKWA 4Q4AB 2BHRA 4YXWA 4TQ9A 3W90A 1WRBA 2JJ1D 1IXRC 2HJGA 5CLQA 4DLYA 3CNLA 4IDPA 2VHJA 3Q7QA 2O8BA 4F38A 5KOYA 3U7EB 5CB8A 1SXJD 1FW6A 1OYYA 5SZJA 2JEOA 2G1JA 4JLJA 1XTSA 3RS4A 4A8JB 4NCKA 5DHFA 5EXPA 1XCPA 4US1R 1B0UA 4KI0A 4KYIB 2HT1A 3VU9B 1G3MA 1RW4A 3ZZUA 3DM5A 1TQ4A 4HB2A 5EP2A 1A5TA 4C7OB 4URWR 2HYIC 4ZDKA 2ZSDA 4AYTA 2NO1A 2QTFA 2IF0A 2W58A 4LYFA 1P5ZB 5KDLA 2JJ2A 1IN8A 1WMSA 1G6HA 2JLSA 5CM9C 3ADCA 4HLUA 3PITA 1XZQA 4KU4A 1XD8A 3EZ6A 3CF2A 5DLQC 1W49A 3F8TA 3HU3A 1Q1BA 4A92A 5AUOB 4WAUA 1U0JA 4LX0A 4OQFA 5AUQA 3UMFA 4BEJA 3TSZA 4DVGA 3VKGA 4D6PA 2VBCA 4KFSA 4Q9IA 1P4SA 1P60A 5FH9A 3OZXA 1DEKA 2QORA 1GTVA 3WP1B 1GL6A 4GPTA 4RD2A 4AKEA 1MT0A 1OJLA 3LBNA 3L82B 3FDIA 2H8KA 3ND8A 4JVMA 4U7DA 1W0KA 4B6EA 3QVVA 1WCV1 2GZDA 4URVR 2FG5A 1AM4D 1GL7A 2JJ2D 4C0KA 4S35A 2CNWD 2WWIA 4LWZA 3RRYA 5B58C 3I72A 2D62A 5FBWB 1JEEA 1HH4A 3AH8A 3NBFA 2VRWA 5CB6A 2W6JD 3RS5A 1FZQA 1OPXA 4IDHA 5F98A 4NL4H 4NDZA 4B44A 1WDTA 3MG9A 2IS1A 4TYQA 1E99A 1YVDA 2ZVPX 4W5JA 2QAGC 1G291 1SVMA 1ZM9A 1NKSA 5FTNA 4B2LA 2FX3A 4EDHA 4LHZA 1PZNA 1ODFA 2PH1A 4BE7B 2VIIA 3OEHD 5EP1A 2IYSA 3W6PA 2WJIA 2OCPA 2FSGA 2GDJA 5J5CA 4BLRA 1CJMA 4JVNA 1FMLA 2O52A 5BYJA 2OAQ1 2J41A 2R6AA 1ZINA 2AFIE 3HPQA 4P33A 1DADA 1XEXB 5J47A 1XNJA 4XOIA 1DG1G 1U8ZA 4Z51A 2NPFA 3PCRB 2JJ8A 4PHHA 4Q47A 4AIIA 1D8TA 4GT1A 3U5ZB 1I2MA 2BMJA 3I5XA 2QG6A 3SFVA 3F3YA 1W5TA 4B3DA 2OHFA 4F4JA 4U00A 3NC1C 4LHVA 4D4JA 5DIFA 3SYNA 4FCVA 4ON9A 3OFND 2ZR0A 3NH6A 2Z4SA 1ZW6A 3B5JA 1Q20A 1GRRA 4BFTA 3K70C 3MCAA 3MMPA 3CNOA 3EAQA 4TLAA 3RS0A 3VAAA 1ZMXA 1OXSC 1P9RA 3K0AB 3MSXA 4XWKA 2QN6A 3I32A 2VTKA 4XVUA 2OESA 2ZIAA 5EE3A 4M9XA 1T8UA 5HZKA 1OE0A 1CJUC 1P2SA 4A0RA 2A9KA 1GZSA 5E7MA 5KU1A 1TADA 3S1AB 5DI9A 1E1QA 2JA1A 4KHZA 3ZQJA 4A36A 4JLPA 2ONJA 1UKZA 3ZIAD 3RHFA 4JL6A 4DLXA 1DAHA 2JDIA 2YOGA 3B78A 4EPYA 1AZSC 3IHWA 3UK6A 3ICQB 2KE5A 3PQCA 4A2PA 5EZ5A 4OI2A 4Q9HA 4C0HA 3ZZ0A 2C8VA 3EPJA 5G3YA 4PSKA 2NO9A 3Q3JB 2RHMA 1KDPA 2HT6A 1S3SA 2KJQA 2QTVB 3PUWA 3UWKA 5KNCA 3RC8A 1AQUA 2GKSA 1OHHD 4B2PA 3L0PA 1FL9A 1VG1A 4C4PA 3CLVA 5UKDA 1E2KA 2PEZA 2MSDB 1G9XA 3U3OA 3SS8A 1R2QA 2CE2X 4MYCA 2P5TB 3VR3A 2JLYA 5H8WA 2IL1A 3N2IA 4LV5B 1CF4A 4KCGA 2BV3A 2I4IA 3ZS9A 4B33A 4HAWA 4D25A 4Q1FA 1E2MA 1OSNA 1CR4A 5BQ5A 2GK7A 3B1VA 3I1FA 2D3WA 4XD7A 4A0GA 1HT1E 3W3ZB 2QU8A 4Q02A 4M9ZA 1U8AA 2ZJ5A 2HEIA 2HCBA 3H2YA 5TVKA 2D2FA 5A0FA 1RRCA 4M4SA 1VECA 2F43B 1NSFA 4YMSA 4NTZA 1M74A 3NBYC 3UPUA 1AIPA 1LTQA 3KTAA 721PA 3IDQA 5CITA 2GF9A 4GMDA 3AVVA 1ZNYA 3LA6A 4TTRA 2Q9AA 3FKSA 4KYUA 4TL6A 1NN0A 5FTLA 1KK2A 1RIFA 2QA5A 4EPTA 4TYYA 2QAJA 1UADA 1XJCA 2W2XA 2GESA 4LSGA 1W0KD 4FCTA 1G3QA 2A5DA 4TTPA 1ELOA 1HQYE 4FMDF 2O8BB 1ZUNB 1HURA 3AVUA 2UVQA 3BORA 2AK2A 3RYTC 1NY5A 3IPXA 5JJLA 4BLQA 2ZRCA 2ODBA 4NP6A 5F9HA 1UBCA 4PANA 2AR7A 4HLQB 2GHIA 4PXAA 3BD9A 3WYAA 1NJGA 2ZU6A 1FNNA 3FE2A 1T91A 3B9QA 3TSWA 4HLUC 4A6PA 2P3SA 1NSTA 2ZJBA 3THXB 1F2TB 3CF0A 1ZNWA 2PL3A 1F2UB 3MAAC 3MWJA 3DM9B 2ZE7A 4QOSA 5FBQB 3CPHA 2G6BA 1DS6A 1N6KA 1LS1A 2RGCA 1CULC 5DI3B 4BECA 2GETA 1ZD9A 3A58B 3DMDA 1BOFA 4LZZA 1W4BA 2FPLA 4OK6A 1YJ5A 2PJRA 4HAYA 1E2FA 3LVQE 5E4FA 2Z0MA 4TYPA 4GDFA 1Z8FA 2GJ9A 2GILA 1W36C 2R6DA 1P9NA 1XXHB 2FOLA 1G8HA 3PUYA 4Y0AA 1VCNA 1W2HA 3K0FB 5J4LA 5EUMA 3DZ8A 2OZEA 4Q4HB 1J2JA 2AWOA 1KDOA 2QRNA 4RJLA 5HZHA 3CWQA 4DB4A 4E09A 1XXHE 4JLKA 2VHQA 1W0JD 2CCKA 3B6EA 3QG1A 1XEWX 3GJ0A 1XPUA 2WMNB 1Y3AA 3THOA 1XPRA 1FQJA 4Q4JB 2QPOA 1G7SA 4LPSA 1J99A 5KSPA 4EPVA 1W2GA 2ZSEA 3MWLA 1GNPA 4NONA 3K09A 3DDCA 1JXOA 2GCNA 1D9ZA 2EYQA 4Q66C 3BH0A 4LPKA 4PSAA 2F7SA 5GVRA 5IF9A 4C0SA 1DO2A 1N2CE 2QT0A 2ZRAA 4J0QA 2NPIA 1U9IC 4B71A 1OF1A 3GFTA 4DSNA 3FMIA 4TL9A 5EUQB 1KIMA 1U98A 3EZ9A 4MKGA 4PTLA 5FUXA 4HAUA 5DE3A 3WYGA 2GBLA 4RZ2A 3Q9LA 2CNWA 1EFHA 1XMSA 3LQQA 3RS3A 1VHTA 3CPJB 2N1BA 2WPDA 3AF1A 3OIUA 4OJQA 1ZM7A 1Q3TA 1QHHB 3BB4A 3GJ5A 3D3QA 1RRFA 4R2HA 2J9RA 1XMVA 2ERYA 3K0CA 4IEEA 3R9IA 2V3CC 3O8RA 1R5OA 3CF6R 1QHNA 3KKNA 3L0IB 2IS6A 4LHWA 2NO0A 3MGCA 4UJ3A 2FFAA 4WOPA 2WJYA 2BIFA 4HZIA 1TEXA 5HCNA 4A1FA 1RZ3A 1AZTA 1IQPA 1N5JA 2JLWA 1SHZA 1Q12A 4POAA 3C4JA 2FA9A 3J81k 2IHYA 4RZUA 1KDRA 2IYYA 1H8HD 1KJYA 4HSEA 4LHXA 4CF7A 2YWFA 4M9QA 5CJPA 1UPTA 2TMKA 3AVXA 1X3SA 5CIWA 5TMPA 4NU0A 3AF4A 3PVSA 3AQ4A 4GRAA 5B2ZA 1ONBA 4CT4B 2QGNA 1N6HA 3SDZA 4QKQA 2WTUA 4V0ME 1F5NA 1G19A 4Q1CA 2F3RA 1GWNA 1YKSA 1OW3B 2E9SA 2FFQA 3RRNA 5C46F 3RANA 1KZGB 2CJWA 5FL7D 1Z6XA 3PV0A 1TTTA 4P3YA 5A4JA 2DY1A 4B34A 1R0ZA 1VG9B 4M1KA 2QENA 2Q0HA 1QHGA 5JEEA 4NYIQ 1FX0A 1KK3A 1X1SA 1VMAA 2RGNA 1OH7A 2QM7A 4WVFA 2ZYTX 1JJVA 1HYQA 4HLDA 1IY2A 1W44A 4Q4AA 1YRBA 3Q72A 2VP4A 2C2HA 1JAIA 2YOFA 4B76A 2GXSA 3QJYA 4CEHB 5C1BA 1JECA 3WNCA 2HF8A 2RGXA 2UZIR 3MLEA 1E0SA 1FFHA 2BKUA 3UG7A 1Z08A 3SR0A 4NPHA 1GIAA 3A4MA 3Q7PA 3OE7D 3WBJA 1AGRA 1DOAA 4G0NA 2IBMA 1OB2A 2JLRA 1UBFA 3C16C 4NZYA 2IYTA 4ERNA 5HPYB 1OIXA 2VP0A 1DVRA 3PXGA 1JR3D 5BYKA 5TY0A 1X1RA 4AG6A 3PJRA 4UNPA 4FD2A 1YR7A 4FMBB 4BZXA 4DIEA 1OFTA 4EPWA 1F2TA 1W0JA 4YLGA 1NBMD 2C78A 1RC8A 4NYMR 4I1SA 5L3VA 3P32A 3K9LA 4V0LA 3TH5A 3SHFA 4CW7A 4TSFD 5FPHA 2C96A 121PA 3OEHA 5GJVC 3IEVA 4JS0A 1ZD1A 5FL3A 2BDTA 5AUNB 2PCLA 2WKPA 3C7KA 1IN7A 4D4KA 2IXGA 2WIBA 4IOJA 4NHOA 3IIMA 1W36D 4IDQA 3X1YA 2XSZD 1WA5A 2B21A 2PX0A 1D5CA 1DAGA 5H1YA 3TAUA 2YV5A 1TPZA 3SQXA 4TYWA 4JLNA 2BEKA 1UEIA 2OLJA 4IRUB 4D81A 2ZRJA 3ZD7A 2XX3A 4LBVA 1E2NA 1DAEA 5L3SA 3KXLA 2J87A 1TUIA 1Z6AA 1II9A 3LFUA 3VNVA 3A36A 1H8HA 2IWRA 2VLIA 1Q21A 2HYDA 3K53A 3QNUA 4EFNA 1NKTA 2AKYA 2CK3A 1M2OB 4NYIR 3NWJA 2AXPA 1NY6A 3CKLA 4GSYA 4NCHA 1VYTA 4JBYA 5TDHA 1QHXA 2ZUBA 1CKEA 1DE0A 4GZLA 1W7AA 3BH7A 2ODEA 1N6LA 4KFTA 4OJKA 4C0BA 3BFKA 4QHYA 4CEJA 3Q8XB 1R5BA 2ZJ8A 3P26A 4IEIA 1ZUHA 4XVRA 1KGDA 2B6HA 4AK9A 3VX4A 2VP6A 2H92A 2QUZA 4L4UA 1COWA 3ZDQA 3QBTA 4GI7A 2NTYC 2ODNA 2QPAA 3A1VA 1AS2A 1E2DA 2ZREA 4EAQA 4EJSB 3T15A 2WJHA 3H86A 1WBDA 4ZKDA 1KO5A 1HA3A 4TL7A 4ITRC 1W5SA 4BRWA 2BM0A 1NVUQ 1G5RA 1MO4A 1VCIA 1ZJ6A 3NKVA 4IDNA 1BMFA 4OI4A 4E22A 1KI3A 3UWOA 4XWOA 5B57C 4N0EA 1NF3A 1IXZA 3LVRE 2ZI5A 1A2KC 2ZSBA 2GVDC 4TTQA 4OHZA 3K70B 4LYAA 2G1KA 2QP9X 4M21A 4QGGA 2NOAA 2AN9A 2WHXA 4XSGA 3TMKA 2QQEA 2ZR9A 4ESHA 3PEWA 2JJ1A 1KKMA 3B1XA 2CHQA 5DYIA 4HZUA 4IVPA 2YC2C 3GLIB 3OAAA 4QJ4A 3EX7C 1G3IA 3N70A 4N0DA 3S1AA 2PMDA 3CX8A 3U3MA 3CZPA 1KI2A 3VR6A 1ZNXA 2RMKA 1LFDB 1UDWA 3OF5A 3KQUA 4B3FX 4DSOA 1L4YA 1MRNA 3U61B 1CJVC 1J90A 4OBEA 3E2IA 1RYHA 2KWIA 4DEYA 1JEDA 1N5LA 4IOLA 3SU8A 4Q03A 1CJTC 3EPLA 4BFVA 1E79D 3I62A 1NN5A 1JR6A 1U2RA 4A8JC 2NQ2C 4TYNA 3U4QA 3GLFB 4ZO4A 2BBOA 2QEQA 4F92B 1XX6A 1R0XA 2CCJA 1QVAA 1KO7A 1ZD8A 3KL4A 4JYBA 3V9PA 1MO3A 2RGBA 1MH1A 1N6RA 3KDSE 4KXFB 4RKEA 4G5QA 1F48A 4G5OA 5LBIA 1N6OA 3E1SA 3T5DA 2FEOA 1P2VA 1JR3A 2C77A 2O8CB 4I4LA 1E3MA 1TMKA 1W48A 3LLUA 4DHEA 1TQDA 2MMCA 3QXJA 2H5EA 2O5VA 1G6OA 1M7BA 5EZ6B 4E5UA 4TLDA 3I4LA 4AKIA 3RSOA 1R0WA 3VQTA 1AK2A 2DYKA 3QE0A 4TMVA 1I2DA 4LV8B 2J0SA 2XSZA 2IUSA 3ADDA 3FB4A 3DZDA 1AQYA 2CL6X 4GP6A 2G0TA 1VKJA 3AGPA 1X8JA 2IC5A 3B85A 2QP4A 3FFAA 4OHXA 2AWNA 1XCMA 4NCNA 4UNNA 5E3HA 2GF0A 2ZQ5A 3K0CC 2YNMA 3KUDA 5JBQA 3U44B 4QBFA 3GLIE 1ZIOA 2C98A 3B13B 1GL9B 1Z5ZA 2O8EA 2C9CA 4TMZA 1JQJC 4NCJA 3U3JA 4A9AA 2AD5A 3ZIAA 2J1LA 4HDCA 4JLAA 5CLLA 5DHAA 4LUCA 4CEHA 1KSHA 2ZI3A 1ZYUA 2RHDA 3AVYA 3LX5A 1UAAA 3CX7A 1E2QA 1JR3E 2ECKA 1WP9A 3SFZA 4QL3A 3IO3A 4Q9LA 1R10A 5JS8A 2ZANA 1KAGA 2IUUA 1CRPA 3U6BA 4PQYA 1Z3IX 4GOKA 1C9KA 2V1XA 3GJ7A 3GQBA 4PC2A 3K0FA 4Z1MA 2ZE6A 4IKEA 1VHLA 1CS4C 2BOVA 3DEFA 4OK3A 2WVJA 4KLNA 4YONB 3TBKA 1Q0UA 1ESMA 1ZC4A 3SC3A 1KO1A 3LRPA 3KX2A 3QQ5A 1JPJA 1IN5A 4AYWA 2OILA 2BJWA 4JYCA 4V02A 1SZPA 1YZQA 3A4LA 2WOJA 2FJUA 1GNRA 821PA 2JAQA 2J59A 1GKIA 1K5DA 2JLVA 3PEUA 4I81A 4QGHA 2G0NA 1NLZA 4LYHA 3U3RA 4DC9A 1J7KA 1GM5A 2OCYC 3FMOB 3LW7A 3GJ4A 4Z8YA 4JBWA 3HWSA 1DAKA 1KSFX 3KFVA 1SKYE 3R20A 1TF2A 1N6PA 4P0TA 4BWYA 1BKDR 4IXNA 3CB4A 4M1TA 2B8WA 3HR8A 2Z5FA 3KKMA 2VF7A 1E94E 1FTNA 1QF9A 3ZYCA 5AJYA 1LY1A 1Z0AA 3SBEA 4BFWA 1YZKA 5AJWA 5SZIA 4FN5A 3BGWA 1MO6A 4TLCA 1SVIA 2HXSA 3T06B 5KNBA 1FTSA 1RVDA 4DEXA 2EFGA 2WICA 1VPLA 3CONA 1US8A 3GMTA 4GOXA 1YZUA 1PLKA 2H16A 4MGZR 3P4YA 3WRXC 1IM2A 2F9MA 4LK2A 1KKLA 1ZAKA 3FHTA 3DMNA 5EXTA 1SXJC 2FGJA 4HAZA 3PFIA 1ETUA 4ILEA 4M22A 2OM2A 2C5LA 2V8OA 4PPQA 2VHUA 2QPTA 2ZYUX 4DT1B 1IXSB 2V55B 3CRRA 2RGDA 4JLOA 2QQ0A 1TU3A 2ZJZA 4QM7A 1O87A 3KQLA 1NVXQ 3ZVRA 5DISB 4QBHA 3KKPA 1PV4A 2PCJA 3P20A 2P67A 4B3BA 2K5UA 2KSQA 2ZE8A 3VX3A 2CDNA 3H0KA 3NH9A 1Z2AA 4W5WA 3SI7A 5L8VA 2VF8A 3QXHA 2ZM5A 1UBGA 2XTMA 2YZ2A 4M53A 5LDDC 4V0OA 3A1SA 3JZAA 2D7CA 3ZZTA 3BC1A 1Z6TA 1IHUA 3O8BA 1RJ9A 1GOTA 4CDGA 2GRJA 1XP8A 1UKYA 2VL7A 4MA4A 1AGPA 5KHOC 3TIFA 1T3LA 3AV0B 4FW9A 2OAP1 1RPZA 3ZGXA 3WMFA 3GLIA 1HTWA 1KO4A 5FUYA 4MUBA 1Z0KA 5F2EA 2ZRNA 2MMGA 1KSGA 3LDAA 4IXMA 2ORIA 4FWIB 3EZ2A 1XU4A 4WIAA 1WXQA 3CR8A 5KSOA 2QMHA 3SE0A 5FTJA 2W00A 2V54A 4US2R 1TNDA 4D4MA 4ACAA 2PZEA 4B3XA 4CGZA 4RCYA 5DGXA 1E0KA 4DSTA 2O8DB 3BAFA 1MRSA 1XBTA 2HUPA 1NN3A 1Z6YA 2XGJA 1KI7A 4DCUA 1EWRA 2LCFA 2W2VA 5L3QB 3QKSA 5TB5A 4BQSA 4NYMQ 4Q4HA 4ZDIA 2L0XA 1Z47A 4RY2A 3TJZA 4O25A 2AHOA 2QBYB 3SNHA 2ZI7A 2RGGA 2IS4A 4A0FA 3LV8A 4TWZA 4OI1A 2GZAA 4P4SA 4TLBA 1JI0A 2ZEJA 1O3YA 3SYLA 3THYB 1LF0A 4GBMA 1WF3A 3ZH9B 5JCZA 3ZVLA 4AYXA 2FFBA 2O0KA 1C1YA 5K8TA 4BFUA 3TGPA 2ORVA 2KI5A 1L4UA 1M8PA 3A37A 5J4KA 5FL7A 2OBLA 4WBSA 3KJEA 4RD1A 2WBLC 4BRUA 4DB2A 3TSOA 3SJCA 4GOJA 2RAPA 3LQRA 1JAHA 1MABB 4UXJA 2FEMA 5DO9A 3C14C 1OXVA 3B8HA 5FI0B 5DN6D 1DAIA 3B1YA 4A6XA 1YZTA 1E0AA 3RNLA 1IJEA 2XOKA 2GNOA 2ZI4A 3KKQA 3MJRA 2PLRA 3AF3A 4TMKA 1BH2A 4X8HA 4AURA 1Z07A 1NMYA 1XJ0A 1XTQA 2GEVA 2QNRA 5KTYA 4QBIA 2MSCB 3K1JA 4V0MA 3R9WA 3T61A 4KVAA 1KO8A 3X1DA 3IPYA 2O8FA 4ABYA 2XZPA 3FVQA 4OI0A 2GK6A 1UEJA 4L15A 2QM8A 3TQFA 3ASYA 2D7DA 4CIDA 1IY0A 4Q1DA 2GCOA 1KNXA 4LHYA 5KNDA 4H1VA 1CR2A 4XJXA 3HPRA 1Z0IA 1A1VA 3KZ1E 4M2LA 4TN1A 1KY2A 3W5IA 4UNQA 4MQBA 1CXZA 1SXJA 1E0JA 1XMIA 2QSYA 2VHCA 5BN5A 4YDHB 4DUGA 1BIFA 3QSYA 4URXR 1NBMA 2VSOA 3CWZA 1R8SA 1AKYA 4DCTA 1TF5A 1QHSA 3RC3A 4M8NE 5J4YA 5F9FA 4TL8A 2I3BA 1FP6A 2QMEA 4HAVA 4US0R 2ZXUA 2BBWA 4TMXA 2IEZA 1W4RA 5HE9A 2FWRA 4L9WA 1ZRHA 3PUXA 5JWHA 3SYKA 2J0UB 3SJBA 3FMPB 2AX4A 3IEUA 4LBZA 4M1YA 5KPJA 2NO7A 2VSFA 1OH5A 3VNUA 5G3ZA 4MRSA 1N0VC 1EGAA 2AKAB 1LW7A 1GG2A 4RFSA 5SZKB 1OKKA 2NGRA 1LS6A 5L3QA 1QHIA 2HLDA 4KLZA 1DTSA 3W9YA 1FUUA 4Q9JA 5G40A 4DRZA 3TR0A 1Z2CA 3AM1A 3CO5A 1NMZA 1FX0B 3MJHA 4FMCB 2VO1A 4HZUB 2JATA 4EQ6B 2B8TA 2IXFA 5GADl 4EJSC 5CYPA 2N46A 4CEIA 3THYA 2GAOA 1J8MF 4LRWA 4P31A 3ZQ6A 3OIWA 1XTIA 4MGYR 1HQCA 3EW9A 2FFHA 1MO5A 3FWYA 4UNRA 3KJGA 5DI3A 1R0YA 2IXEA 1A2BA 3X1WA 4AI6A 1EK0A 4R7ZA 5FOXA 2FSFA 4X8LA 1TQ2A 1E9DA 2DWPA 3BOSA 2JLZA 4WXPA 4W5HA 1VG0B 1TQ6A 1ZP6A 2QRZA 1E9CA 1E96A 2GCOB 2WWFA 2ZJYA 4UNSA 2RKOA 4EPRA 3GLGE 4MGIR 2F55A 4MRPA 1E69A 2X1VA 2XZOA 5KO2A 1OXTA 1OIWA 1RKBA 5CDFE 2FSHA 4OYHA 1E6CA 2PT5A 1NG1A 2A7QA 2YINC 1JJ7A 3H84A 5L3SB 3IQWA 3QVUA 3K0SA 2WSSD 3R7WA 5AWFC 1FUKA 3VMFA 2RGAA 4JMPA 3MUFA 2Q9CA 1R5NA 1KI6A 4KBFA 1N5IA 4PPFA 2C9YA 2EWWA 2VA8A 2IWHA 4C2UA 2NZ8A 2J0UA 3RSLA 2D4HA 3QKRA 4WW0A 2BEJA 2IYXA 1G3UA 4LI0A 3UKDA 4M1MA 1OFIA 1W47A 4TQAA 1G20E 4AD8A 2WZQA 3Q5EA 4C0QC 1YHNA 1DAMA 4BZQA 2R8RA 2IYLD 5C2JB 5HTKA 3TK1A 3KB2A 4AKGA 4MYUA 3I61A 1DBSA 1XWIA 1YR6A 4ZI2A 5CDFA 2BC9A 3GJXC 1PUJA 1CIPA 1Z0DA 3DKVA 4OL0A 4RSGA 5GJBA 1XCGB 3CM0A 4U5XA 1CRQA 2ZUCA 1ANKA 4WZAE 4DLVA 2IHBA 2JLXA 2WWHA 3ECCA 1YR9A 2XOKD 2VEDA 2W6ID 3HU2A 1GSIA 2ZS8A 3A6PC 4R71A 1N5KA 4XTRA 4OK5A 3R8FA 2ZUDA 2REOA 2QMOA 1X8LA 2WKRA 4JT4A 2FN4A 1ZU5A 3OIVA 1OYWA 4PZLA 4QRHA 2QBYA 2X19A 4WXRA 1QRAA 5J4HA 3CRQA 3U44A 4AG5A 2RCNA 4C7OA 1ZCBA 1LV7A 1FQKA 5F3WB 4DZZA 2QE7A 2W6IA 5FUVA 4B6FA 4LJ8A 3UANA 4JLMA 2CVHA 1JXMA 2OCAA 2H1LA 3WNBA 4FINA 4TQUS 4JVSB 5C4MA 1RRPA 4PC6A 2ZRKA 1P6XA 1YZNA 2O8FB 4ZKEA 3VKHA 3CH5A 4A0HA 2HCJB 2WV9A 1KZ7B 3ONWA 3C15C 3AKYA 1E79A 3SOPA 1OH6A 3LX8A 1EFRA 4URUR 1C4OA 4YMWA 2SHKA 2QAGA 3IQXA 4Q5IA 1II0A 1UKEA 1G7TA 1P9WA 2QY9A 3V00A 1E9BA 3SEAA 2FNAA 1W46A 4OQXA 1KJWA 1G8FA 1AN0A 3LY5A 4BLOA 1F60A 4NMMA 4YMVA 2F43A 1SXJE 3REGA 4FMCF 4DBLC 2GJAA 4YDSA 2BCJQ 1E2GA 1G41A 2DB3A 4DWJA 3AEZA 1N6NA 3BB3A 1DARA 1JQLB 1X8KA 1Q22A 3QPUA 4PPGA 4ASUD 4AWXA 2Q6TA 1NIPA 4PZZA 2NZJA 4R98A 1XD9A 4RFSB 2OFOA 4JSYA 5HE8A 4FI3C 5BN3A 1I4TD 2RH5A 4F4CA 3K09C 1TX4B 4II7A 4DIDA 3VU9A 4LJ7A 4C0LA 1KOFA 2CHGA 2R6FA 1JB1A 1EWQA 3PENA 5FPSA 1YU9A 2A30A 4F4IA 4AY2A 5FUWA 1N6IA 4BGDA 2CLCX 4DDTA 1EESA 1SGWA 4BPBA 3LW8A 1M34E 3IBGA 1G5TA 3QF7A 5FBLB 2ZTSA 1Z0JA 3EZ7A 4TSFA 4G5GA 4HB4A 1E9FA 2YVUA 2XB2A 4DLRA 2ZSFA 3C5HA 1F2UA 4MKIA 2HJVA 2ZRDA 3NDPA 4HUTA 4FWTA 1QVRA 5JFGA 4TZ6A 4HDOB 2LWIA 2AFHE 1U94A 4QNMA 1T5LA 4NCIA 3QG5A 1OXXK 2E1RA 1D6JA 2W83A 5G41A 4A2QA 4EFLA 1E9RA 2ZRFA 1PLLA 1XB2A 2OT3B 3L8YA 1EFRD 3Q5DA 5FTKA 2Z43A 3W6OA 1XEWY 1E2JA 4DSUA 4LC0A 5BW8A 2DR3A 1P7CA 1OKKD 1VDZA 3VR5A 2YYZA 4A4DA 1QBKC 3OE7A 4F7WA 1S9HA 3AF0A 3KJIA 3QXSA 2O0HA 2ERXA 5JSZB 4CEIB 2B92A 5GVSA 2CL7X 1XTRA 3TNFA 2QI9C 4BFXA 2QE7D 3SN6A 3FKQA 2RGEA 5LB2A 3CRW1 5M04A 3AVTA 1Z83A 3KXKA 1OT3A 1IONA 4KSCA 2LKCA 1TL7C 4O0MA 4PHGA 1XD2B 3TLXA 4JL8A 1WQ1R 3NHBA 2YOHA
chains in the Genus database with same CATH superfamily
3NEYA 4HDAA 1ZM3A 2JIMA 5D3MB 4UUNA 5ALXA 5KIAA 2MSNA 3H11A 5F2NA 3SSNA 4QRDA 2HB6A 3NBAA 1QNLA 1VYUA 1TK3A 1QQ5A 2C84A 4QJ5A 5JDCC 5BOVA 3EC1A 2ZBUA 1BMFD 3QVMA 4IEFB 3WL5A 3PUZA 4BU0A 3G2HA 2J6HA 1AZLA 2AC4A 4AAYA 4FBGA 4XQCA 1GG8A 1RAIA 1VBNA 2PKYX 2YJTD 5HDQA 1DIHA 3W3AA 3K35A 3KZVA 3V33A 2RGNC 3F7TA 3Q4GA 4HGOA 4P3PA 1P2TA 1P6QA 2I7XA 1O94D 2VHTA 3QP9A 2PVCA 3D4LA 4LY6A 2Q21A 1S7GA 1WD7A 1WNFA 2C04A 4WUVA 5HM6A 5JI2E 2B36A 1VZ3A 5FFMA 1JAYA 1U3FA 1EFVB 2GYYA 4ALNA 5JDIC 5KQLA 3FBTA 2Y27A 2XNJA 2CFOA 5JMTA 1GYRA 4IJ6A 3ORSA 5AHXA 3UJ6A 3IUSA 4B8WA 1A50B 4C1BA 2IY9A 2FFRA 4HFJA 2XNHA 4PQRA 1XP5A 2C2KA 1E20A 3O82A 3WNVA 1A4RA 3BD8A 3AKDA 3Q2KA 4DR5B 1UF9A 3LPDA 2NSHA 1EB8A 2DTEA 3I8XA 1MGPA 3KOUA 3LP5A 1W96A 1WZCA 4JEIA 2E4YA 3NKLA 3BRCA 1J5EB 4BMCA 5KSZA 1UXJA 2FPXA 4YP5A 1DO0A 2MCFA 1CT9A 2BGGA 2JDID 5LN1A 4D3DA 4IW3B 4F1KA 5CCBA 4F9EA 3CJTA 1ZN8A 3HO6A 4IQ0A 1A8HA 3AERA 2CHEA 1N9ZA 4ZCLA 4QJ3A 4L5JA 1AO3A 3G2JA 4R7GA 1UAYA 2ZT6A 1G7RA 3RAPR 3WZ2A 1U28C 2H51A 4BMYA 4IYJA 1W52X 2CHUA 1W9MA 5I7SA 3G82C 2V6JA 1LLCA 1NFRA 1NIJA 1L5HA 2YC4C 3EEQA 4HX5A 4LKRA 1J8YF 4F5YA 3S8EA 5JALA 3OCYA 3GP8A 2H5JA 2OV1A 1GPH1 1B16A 1Q3KA 1QPZA 5CP8A 3PIRA 4J0KA 4FNOA 3C8UA 2G7ZA 1IPHA 5TC4A 1EWQA 3BE6A 1MW8X 1E4YA 1QG2A 3FZEA 1L7EA 4R8MA 3MWDB 1UXOA 2VNJA 1M2NA 3LDUA 4PC3A 4K46A 4LNHA 3U7GA 4U39A 4MRNA 1JJAA 1CQXA 1O95A 3ZIDA 2OCBA 3OUZA 3WBFA 2VDVE 2M6RA 4HFMA 1OFHA 2O07A 1VKRA 1YZYA 2QROA 4PLTA 2PVPA 2IODA 3AHEA 2C2ZA 1CEEA 1WE2A 3LFTA 1U9IA 3QLVC 4P32A 2R6ZA 5CDTA 4YXFA 1H65A 2IX9A 3USCS 2V96A 2ZRBA 1GDHA 9ABPA 1RZRA 2D8MA 3HFJA 1B42A 3PEYA 2AD1A 2C8JA 3NOOA 4JKIA 2ANBA 3S28A 1RQPA 2ECOA 3GQVA 2HA2A 1H85A 2B94A 2I4TA 4DRXB 3AKCA 5IZ4A 1DGQA 1T36A 4IVQA 4RTMA 2F90A 2BVNA 1NM5A 3LBIA 1G5PA 2OKCA 2P9TA 4F5DA 1FNMA 2SECE 1OC2A 2XXJA 3IA2A 3EG5A 1ZY2A 4MS4A 4OJTA 1CUEA 4P4GA 221PA 2XMGA 4Y9RA 5JAHA 3HBLA 1N2GA 2Z1NA 4P35A 1BVHA 4G8JA 4NKRA 3HR7A 4TX1A 4KAXA 1T4BA 1M9NA 4RTOA 4KNYA 2CCGA 3LMKA 2BFBB 1BMQA 3P52A 1EFTA 5TS2A 2WJWA 1K8RA 3OBBA 3C4QA 2RGRA 3MLAA 2EARA 4PNZA 2YXLA 1CDDA 3GGPA 4IIBA 1D5WA 3LUCA 4GI1A 1ISFA 1J2EA 4MAFA 4FJ1A 2EYUA 2PXCA 4Q7JB 1M67A 3IBFA 3LKDA 4K3VA 4U4AA 5ECWA 4LF5B 5FA8A 4UUQA 3IAAA 5FWNA 1VL6A 3ZE1B 1UKVY 4Q18A 4Q00A 1LGYA 3M6AA 3WSWA 3GVIA 2FZGA 3KOMA 3ICEA 4ZCMA 1E2BA 4MS3B 4CPDA 1FVOA 2QD2A 3NNDA 2DFLA 2Q29A 5BV0A 5KWEA 3JRWA 1T3HA 1JR2A 1NJ1A 1P2FA 3QLVA 5E3IA 4Z4CA 2I3ZA 5GZ3A 1QBGA 2DWQA 4LNAA 5D6NA 3ZWCA 1E2HA 2PTGA 2XA2A 5JAOA 4DARA 3YASA 3LLMA 3R3XA 5FO0A 2YXDA 4E5NA 1A5BB 3GVXA 3K20A 1WSBA 4I9FA 3L6EA 1MRZA 1KFBB 1QYDA 5DHTA 1GEGA 3B6MA 3OFSA 3ONEA 4ND7A 2WVAA 4U9HS 3C3JA 2FW7A 4YV2A 2EZ9A 1KEKA 5I6DA 1KRXA 2AX3A 4S1PA 1X1AA 4QQKA 3UPDA 1GZDA 1Z4OA 2YCLA 3G1TA 3GJTA 3DE0X 2WKQA 3AP1A 4KIGA 1E2LA 2X23A 4N0MA 4ME6A 1NBWB 4WFKA 2YNMC 3RSGA 3T7RA 3WLHA 5HVNA 1QP0A 4ZQBA 4BEBA 1RKUA 3B2EA 1DC7A 3PTAA 1E8DA 3QNMA 1UBEA 5IZCA 1MPXA 4AULA 4YRTA 4K8OA 2DFVA 3K8ZA 3H5IA 1L4EA 2R44A 3QKWA 4X45A 1ZD5A 1DKLA 2HADA 2BY4A 4LJYA 3GXBA 3PHCA 2RH8A 3TB6A 5JJKA 1IVYA 1WSWA 3QI2A 4GPEA 4IS2A 1Z13A 5EGNA 2Y8EA 3B36A 2V7PA 4MIYA 1U2PA 3L8ZA 1OLOA 4HX2A 5JJBA 1VE6A 1K5PA 4HGPA 3RYHB 5BNIA 2IEYA 2RHWA 2BKXA 4X97A 3ZLUA 1P61B 3HDQA 2VPPA 1EXVA 2JARA 1ZA2A 4E32A 1JDPA 1FUYB 1N2IA 2FHPA 3OZFA 3BS4A 5IDYA 2Z6QA 4GPIB 2QXTA 5JQGB 1U0RA 4BKOA 1HKUA 2H2FA 5JE8A 1OIVA 3LYLA 4HUQA 1VMKA 1Z22A 1D2EA 4NAVA 4B35A 2W70A 5D6OA 4U2BA 1IXKA 4KX5A 3JD4A 4LMPA 1L4FA 1SG6A 1Y8QA 4UPVA 4KKXB 3ZI0A 2FMXA 1KYYA 3SNKA 2UZ3A 4ZHQF 1P4JA 1UJ5A 2PG3A 1RADA 3ILHA 3PD7A 4YQFA 1EVQA 2Q4RA 2PJZA 4Y7DA 1DDIA 5FPKA 1SY7A 3BM5A 5LD2B 1YRQA 2YJ6A 4LJAA 3IYLW 3VJRA 4TTJA 1EX6A 4ZVMA 2YWRA 2Q0SA 4U7JA 2R0QC 5AFSA 1YGPA 3BCRA 1JG2A 1K9VF 1B3RA 4QGAA 3ESAA 3ZLVA 3GLHB 2VF2A 2REQB 2P9CA 3UAOA 3H9BA 1H2AS 1TF7A 2WU0A 2KQUA 4ZYLA 1KMIY 1MMFB 1YCDA 3OWXA 3V8RA 5EXEA 3W7BA 1QIKA 1W2WB 3TG2A 2I1VB 2QGFA 1FYVA 2ORWA 3M8KA 5KSYA 2BHTA 4FR0A 3SVLA 1MU0A 4YC7A 3GYBA 1TAHA 3KM0A 3ERCA 3E9QA 1E6UA 3N75A 1TC2A 3LCJA 1UBHS 5C18A 3AP3A 4YDQA 5CNMA 2D7DA 4EVSA 2G17A 3B5EA 4LRXA 1UT6A 2F17A 5F76A 3S2EA 1A76A 5EHGA 4RM3A 2R8ZA 2CNOA 4XUEA 5EKUA 2VVTA 2WB4A 4GKVA 1Q57A 4YUWA 2IYPA 3F6EX 1JIJA 1V2GA 4LF6B 3L0ZA 4B84A 5LOVB 2CV1A 5CDUA 2CV0A 4NECA 3FF4A 2VN8A 5LQAA 3GLFA 2CVPA 2UKDA 1OFVA 4L2IA 2WIFA 3O1LA 3MWDA 3BILA 4Z5XA 3MCUA 2CXSA 2N42A 4ASUA 1MQSA 3GA7A 2Q6IA 3AJAA 2XQVA 3W8RA 1GCOA 4N6NA 2QQGA 4ICIA 2XXAA 3GEHA 5F7XA 1QLWA 4YPVA 2BI7A 3WIDA 5BSKA 5ALNA 2QVBA 1KI6B 2WG1A 3KP1A 5EEHA 3QVWA 3W6NA 4DXAA 1SC9A 4BCCA 2Z30A 1CDEA 1CZHA 2WZCA 4H1HA 2BSQA 4DLWA 3A6KA 2TMYA 3MM4A 3L8MA 4Z4HA 1DWQA 2APJA 3KSZO 1CU1A 1SRQA 2Q1YA 3K2QA 1DXQA 2O8DA 2UUPA 3QUBA 2IK8A 3WGMA 4P8RA 2YWHA 4A82A 1GITA 2GCPA 4PYMA 4NV0A 1C9JA 8OHMA 2JFFA 1BE6A 1ZD3A 3UXYA 4MRVA 1CLEA 1NAHA 2WPDD 2GM5A 1FSFA 2WWYA 1TZMA 2FZLA 3SC6A 1RE0A 1T6NA 4QAJA 1W75A 2ZGVA 4OGGA 5CCXA 1E1LA 4AJEA 1Y63A 1C8KA 2EBFX 2Q4TA 3DOFA 1KEEB 1HC7A 2GWRA 3NHAA 2VSYA 4EJSA 3LSTA 5JASA 5JS7A 5IAGA 5AW8A 4JD5A 3VR5H 4PPNA 3W2IA 4RIEA 3VO1A 3EPKA 1Z7YA 4ZEWA 4YQEA 5EE1A 5F9MA 3WLMA 1T0IA 2RIRA 3EGIA 4C5AA 1L9XA 5E7IA 3R9XB 5ALOA 4NIMA 3KEQA 4CEJB 3IHLA 3ZE8A 1V8PA 2J7PA 2B7CA 3RT9A 4D74A 2C5EA 2SCUB 4MNTA 5ESDA 1HEIA 4GM4A 5AH0A 4BWGA 3U31A 4NF2A 3U1BA 2QV7A 1XXHA 2IF2A 1V5FA 2O7RA 2QLTA 2WUVA 1IY8A 2YJNA 3B48A 1VP3A 3JQ7B 4RQBA 4TKUB 6Q21A 3B70A 3REFA 1A96A 4JN6B 2CLSA 3PUIA 4HQ6A 3SOZA 3V1KA 4B82A 5B64A 2JRCA 1I51A 1EUDA 3PJFA 1Y8CA 1PJRA 1SBQA 2A5GA 2FWMX 3EYAA 4YK7A 2I76A 1TD9A 4KUHA 4LE0A 3NHPA 7ABPA 2OP0A 4ZVRA 1VA5A 3UC9A 2BBTA 2J9FA 5IP5A 1Z9BA 2B98A 5HCIA 3LC2O 4IV5A 5AKZA 3N7UA 3OZEA 3OPVA 2E48A 1K2VN 1ICEA 2VDWA 1LBTA 2H9AA 4AKTA 2JFOA 4RYDA 4X5OA 4CV2A 1KYVA 2DHEA 2PIAA 1XTVA 1Q0PA 1TYBE 2O2CA 2YMLA 3IEPA 4RU1A 3TLAA 1R9NA 2FRXA 2QRJA 5CT5A 4ESEA 2I99A 4AF8A 1HE1C 3LYUA 4ZDJA 3IAHA 3VTKA 3AUXA 3FSGA 3VV2A 2IYWA 4HMPA 1FDIA 1DKOA 1QANA 1U81A 2VDNB 2QB5A 3OTGA 3JYLA 4MWGA 1ZSVA 4NH4A 3W6UA 3FFXA 5BSHA 3WQHA 3O8CA 3L1VA 2FPGB 2ZRMA 4Y1RA 3ACCA 1JEQB 3SIXA 3BGSA 2QTNA 3D8NA 3GAFA 5IBRA 3NWEA 4M54A 1FY2A 3L4BA 3VISA 4BLPA 1XEXA 4WA7A 3K8YA 3DL7A 1DX9A 1GZUA 1VBMA 2B1JA 3C3XA 3L18A 3V1NA 1UOOA 2YQZA 5A5EA 4ESVA 1FOEB 2BFFB 3P71T 2NU6A 4ZODA 1FJ2A 4RLFA 4PINA 3TSAA 1Z35A 1K2WA 2GJSA 2J5XA 4LYYA 4QNNA 3AR9A 2LR0A 3MAGA 5IC5A 1PBNA 4JC4A 1ZJWA 5ALVA 2ZYWX 5JPIA 3EIQA 4HAIA 1UBJS 3A04A 4FCWA 5DASA 2X2EA 1PVOA 4CF5A 2XECA 1X0VA 2YWXA 2QUBA 4IHJA 4JJKA 3FD8A 5T4HA 3QVTA 5IKPA 5K0TA 4L5IA 1UZAA 3FRHA 3GPIA 1N25A 1YQTA 5J23A 1W5EA 2GHQA 3TQSA 4X00A 5FEMA 2LCQA 2FZ4A 4CKBB 2HIGA 2ZE5A 4EZEA 3AI7A 3WA6A 1D2MA 2B6NA 2CHFA 4DCMA 4YY3B 3P19A 5JNLA 2YV3A 3CE9A 3QVGA 2IZ1A 3NJ8A 1JU3A 2OGZA 4FE3A 4IPTA 4BV3A 1P62B 5A4FS 2WSMA 4HUQB 4IUBS 2F4VB 4HWTA 2O3TA 4E12A 2WTNA 2F8LA 1CYDA 4C88A 1OB5A 2DU8A 2RKBA 3H1TA 2QRPA 5MHTA 2RD2A 2CL0X 5CA1F 5C52B 1QDLB 2WWTA 3CXUA 4EMBA 1XZHA 3OHMA 4DWOA 3Q6NA 4ZCQA 1IUOA 1HE4A 1S96A 2I91A 4JC5A 3VH1A 1UANA 4EKDA 2J9GA 5DNVA 3TL6A 2D0OB 3N07A 2Y99A 4ZHQB 1TEVA 2C82A 2H17A 2N1MA 2CEKA 2YJ4A 2GD0A 4EHIA 1NV8A 3EXAA 3I58A 1JEJA 1YWGO 1JLKA 2Q3MA 1R66A 2JD0A 4MLZA 5DPMA 3ZY5A 3HJTA 3FMGA 4GE0A 3F3MA 4MVJP 1NAIA 4K88A 4CMCA 1NW7A 2R00C 3KJHA 2F8TA 3CGWA 4OFXA 2ICAA 5JOQA 2I8LA 4MQLA 4XCQA 3QYPA 4O1HA 1JA1A 2C92A 2OLEA 1Q0HA 4PYIA 4CDRA 3TI9A 3C74A 4MYHA 3SJZA 2ZAGA 3JVIA 2XTNA 1NF8A 4IFIA 4EH1A 4G4IA 4CCAA 3H75A 2OA0A 4NYJR 4ZOAA 4PIMA 3ASZA 2QW0X 1ORVA 3C6KA 4JGIA 1NGSA 2B2XA 5I4KA 1H3EA 5LFAA 2WW8A 1SIUA 4D3XA 4WOKA 2RJ3A 1SOWA 4B5KA 1CQJA 3E18A 4PO9A 2W11A 4Y1EA 1HORA 2GO7A 4EB0A 1AKWA 4KXUA 5EJ9A 4D43A 4MLCA 4WCVA 3NBXX 5HUHA 5AI0A 1OZFA 4F9GA 2IY7A 3G8BA 3G1WA 2YW9A 3VJLA 1F0NA 2EJVA 3CUKA 3GDOA 4G5SA 5H4HA 5H80A 5KUTA 1KWKA 5E1OA 4X65B 1MKYA 2BP7A 1P2UA 3OQJA 2Q4OA 3OEWA 4V1CB 2GJKA 2ZIXA 2UYQA 3CLSD 2C61A 1Y1KE 2H1HA 1NBME 1SOMA 2PR2A 2ZWPA 4P3KA 5DSZA 5TX7A 3EG9A 3LPNA 1XDUA 2QE6A 3D6NB 2WAYA 3LQYA 3ICPA 4ZCIA 2CJPA 2H7YA 3B89A 3TD9A 1N0WA 2IZ0A 4RJTA 2HRBA 3CNNA 5JSFA 2Z83A 3D54D 4WCFC 5TS3A 2HIMA 3FNHA 3RWOA 2EFHB 4MQFA 4U02A 4EQ6A 3VOBA 2QN8A 1HFKA 3E9YA 2ZJ3A 3OCZA 4JR2A 4DT1A 3UOWA 1WBBA 2YHIB 3AK4A 1V8BA 1IXYA 2QSJA 2NVUB 4Z4EA 4DQLA 4AJJA 3HXTA 1PT8A 1II8B 3OZAA 5AVOA 1T6XA 1P75A 1EGMB 2G70A 3WJ1A 3FY4A 3G6WA 4DUGD 1ZU4A 2XYQA 1DFIA 2QD5A 2EQ5A 4HEA6 3AHGA 3ZWKA 3M0EA 1KYQA 1NP6A 2R97A 2X15A 4BKPA 2PT6A 1FLNA 1IEVA 5F12A 3TVDA 2YWJA 5SZHB 3O0DA 3W7VA 3G0BA 2HRRA 3R3HA 3VV3A 5DH9A 3E48A 3EDYA 3HB0A 3KQHA 2VJQA 2IYEA 3VUFA 2WT4A 1NVMB 1N0UA 1KR5A 4BVHA 1EK6A 4C30A 1NXTA 1TAUA 2Q5IA 5IFKA 2HSEA 1U3UA 4MI1A 4UE2A 1MNQA 1I0ZA 4MUKA 5A5GA 5JZVA 4DCGA 4DF3A 4MI9A 2J5BA 2COUA 3KNZA 3NDRA 5KCMA 3BJIC 5TPWB 4K0RA 9ATCA 1V8OA 4U3JB 5CK5A 4F4HA 1CIVA 4WZ6A 1UM8A 4AJ1A 4ZYUA 4HCJA 5CCEA 2M1XA 4FDVA 5JCJA 4BB0A 1S7CA 1RYZA 2P9HA 3IKVA 4M88A 1DKMA 4IXDA 5I8PA 5CGQB 4PAQA 1GNQA 2PRZA 2WD8A 3E58A 3FPAA 4F2GA 1TGYA 4GEKA 3TEFA 2R6CA 4G2NA 2ZJ4A 4ISBA 5SY6A 3ZD8A 3O2NA 2H07A 2QVLA 4Z7OB 1LJUA 1MJHA 2WAAA 4LY3A 4CR8A 3C45A 2HOQA 2ODWA 1BU8A 3B7PA 4YAUA 4UQOA 1MOPA 1RJ9B 4V2IA 3O91A 3HA5A 5B36A 5A9SB 3DPSA 1ZMRA 5FOTA 1B74A 1GKYA 1K7YA 3GJ8A 3N8HA 1YFZA 1XQYA 3OOSA 3TO5A 5C1OA 2EV9A 4MRAA 5CX4A 3AZQA 1KVRA 3PRYA 3QX8A 3QUQA 2X7XA 3IO5A 3HJNA 4IH4A 4MA0A 1T0JB 1D2NA 3HJAA 3D7SA 4O5OA 4OBWA 4UE6A 2HA7A 3UT0A 4C4ZA 4WNAA 4INZA 4ZIRB 1TO1E 4MX8A 2XJ9A 5LPNA 1RWKA 3O3CA 3BCHA 4OKSA 1KYIA 4L8FA 1KP2A 2BFDA 1ZGGA 4KVZA 5KOIA 3PIDA 2CLLB 2VPWA 5B7NA 2Q4EA 4OQMA 1U1EA 3T12A 5AK0A 4K81B 4JQZA 2XVYA 4N3GA 2Z98A 2ZU0C 5HXAA 1V5WA 1IBSA 4E2FA 3DO6A 3DT9A 1UXHA 2X76A 3C6YA 3VR2D 3VA7A 1GPBA 2QV0A 5TGDA 2IDMA 4O8ZA 4GMGA 1KYTA 3E22A 4D8UA 4EZIA 2GFQA 3UICA 2K4MA 3MGKA 2JLQA 2FOIA 1IPEA 2VUHB 4PRLA 4HH0A 5L4SA 5LD2C 3ZCSA 2X1HA 1JHZA 1XAJA 4PZ9A 5B3KA 2BFCB 4W7HA 4CKBA 3CUEF 2JGAA 2WFLB 5MN4A 1SQ5A 4YP7A 1H0RA 3UAZA 3HBFA 1ACJA 4ARZA 4UM9B 5B6JA 5AW4A 2DQYA 5GIPE 1SVOA 1AV6A 3R6DA 3WV4A 1XYGA 2HXYA 3JAKA 4UBKA 5KYYB 2ZYIA 2MYUA 4DG9A 2OUKA 1A9SA 1M2FA 1G2PA 5F33A 5P21A 1NUPA 1K68A 3CIOA 1UP6A 2RHLA 3DMPA 1SKAA 3DO8A 3EDRA 3PQ8A 1YRAA 4DLSA 2J45A 2O2SA 3OICA 3KWJA 2V9PA 3LZ6A 1RAHA 1X92A 2QR3A 1QZTA 3B2QA 4UEKA 2DHRA 4ZT6A 3UMRA 4EKEA 1EZZA 1LF5A 2EW1A 3OP4A 3AC0A 4JJAA 1NYQA 1J1ZA 3O9MA 5A1JA 5AYVA 2FPSA 2LKDA 4Q4LA 4PU0A 3RAGA 1DCTA 1GUDA 2RARA 1UP4A 4CT0A 4BQFA 4ZYYA 1O97C 3LGAA 3GLHE 3GWZA 3I05A 4O0LA 2XB4A 4DLKA 3ZS8A 1MN6A 3GT7A 3D4NA 3KVYA 3DEHA 1L6RA 4RS3A 5FPYA 1ZBQA 2J31A 2CVFA 3DDWA 4L75A 3GLTA 2I55A 1HFEL 3W4KA 1G21A 1QTQA 2WYIA 1GQRA 3QKIA 2XMBA 4MDHA 1CUUA 1FFYA 1ZM2A 4S2UA 1PW5A 4XM1A 3ZEAA 2HK7A 4MYDA 1OWOA 2JCVA 2V8BA 2X8BA 4Q4JA 1K5HA 1CR1A 1GLVA 5EHNA 1KJ9A 2P5SA 1DIGA 3AVOA 3H19A 1S2OA 1NLYA 2BFEB 1V4BA 1EFDN 3LPAA 4OHWA 4TZKA 2SICE 4PWZA 5EWJA 3ML1A 2RC6A 3CW2A 1KEVA 3GGDA 4G23A 5F1YA 3R9XA 4C3OB 2BRUC 4MB0A 2IA5A 4LXXA 1RACA 2H1CA 2H7VA 1B41A 5FTWA 3IKJA 4O4HF 1EVEA 3KE8A 4ODIA 1V5IA 2LTAA 2R6GA 3WMEA 1Z36A 4PFQA 3PF9A 5IBCA 5K4GA 5AHWA 4MDFA 1I5OA 2NU9B 1PT7A 2EJWA 1RAAA 2HY7A 2QSZA 3T3DA 3ZY3A 4KBGA 4NULA 4Y2SA 5AJTA 4UD6A 3D43A 3VU8A 5KC8A 1NYTA 4AF6A 5IAAA 1EUCB 5T67A 3TUZC 1JFTA 1E2EA 3WE7A 4XUCA 2GB4A 2HEGA 2M1ZA 2W6NA 1T9HA 3AV3A 4KRXA 5K4HA 4HPXB 3RU3A 3U3KA 3JAMA 3EF0A 3X1ZA 4PYLA 5IAEA 4CM8B 2HPVA 1E89A 2Q45A 5IXYA 2QJRA 2P7IA 3CEMA 1NRJB 1N2ZA 2ZIXB 1QK4A 1YJ8A 2BE7A 1XLVA 2GA9A 5JWRA 3BXXA 2A33A 2ATXA 1GQ2A 1YBAA 3N8DA 3QKTA 4H35A 4RC9A 5H9WA 4AUMA 4DV1B 1NMXA 4H15A 4MW0A 4NJOA 2QS9A 2FR8C 4UCXA 4Q19A 3KE9A 2AE2A 4M0DA 3BKXA 3I1YA 1KZHA 4ZOLF 1BJKA 1WEKA 4D8XA 2WUEA 2EFEB 1Y89A 3HNOA 3EODA 3IOCA 4PR0A 3HACA 2JLYA 1NVVQ 4ND8A 2A0KA 2FVYA 4DLZA 1C1DA 4R69A 5AK4A 1PFVA 3IV6A 4OGKA 3R0ZA 2QJTA 3KB1A 2FU5C 5D3KA 4X6UA 4CMEC 1AGXA 3OQIA 3Q7RA 3ZDAA 4BB6A 2PXAA 3VOSA 2V65A 3W5UA 1SURA 1PBTA 2R1VB 3RYFA 4FMDB 2O3RA 2D5BA 2CZQA 2YFYA 3VKWA 4W82A 1E1KA 4U7WA 4IWNA 4TQ9A 4LF7B 4ARBA 1K3TA 1QFMA 3HVIA 2VT6A 2QRGA 3A3OA 3H1AA 4FD3A 1M0WA 4IDPA 2VHXA 4J2HA 5CAEB 2TECE 5A7FA 3FPFA 4D92A 4F38A 1LQUA 1OYYA 1NW8A 3CV3A 2G1JA 2FCRA 4GGOA 5FNVB 5SZJA 3RS4A 2KM1A 1DBRA 5DHFA 2AOVA 3ESBA 3LLCA 4RY8A 4D8WA 3WWDA 5AKEA 1OQAA 2GN6A 3OOJA 3VSBA 3W9UA 5CFLA 2GLTA 1OC4A 2PD6A 1G3MA 1RW4A 5EJGA 2X0FA 1NRWA 1TJ5A 3VU9B 3ZKWB 4EKYA 1Z5VA 2VJYA 3F7MA 5IN4A 3AEKB 1RQXA 4QOJA 4F0JA 2HSDA 4C7OB 1W19A 3OZVA 1XQVA 2ZSDA 2R7LA 2XGOA 4L95C 3PBKA 2VZLA 2NO1A 3BZUA 3GFVA 1U0EA 1NBOA 3S6JA 1KPHA 2O0LA 16PKA 2IHVA 1IN8A 1WMSA 1XLTC 2FWJA 2JLSA 3M6IA 4ID9A 4UVDA 5AVKA 1DQPA 1XZQA 4KU4A 3EZ6A 4WZZA 5DLQC 5J43A 1CZOA 4CMEA 1Q1BA 1L5YA 2XB8A 1PEKE 2JI4A 4HK4A 3VGJA 3UMFA 1EIWA 4A16A 5AT1A 4MUNA 2J08A 4RMGA 5KAPA 3TSZA 5LBTA 3AYXB 4G5FA 4KFSA 4Q9IA 1P4SA 1JN0A 4NMLA 3UJHA 1C29B 5T3YA 3OZXA 2O7VA 5IDQA 1DEKA 4MVYA 2QORA 3FCEA 1EJ2A 1RE1A 1GL6A 3HDJA 1K8QA 4GPTA 4RD2A 1VBKA 4C29A 4CI0B 3QFRA 4D9IA 4Z6KA 2AMFA 2FEWB 3LRTA 3FDIA 5EWMB 1VLMA 2XKKA 2CLIB 1FLAA 3ISJA 1QWOA 3VOAA 4HHEA 1JFRA 2XQKA 3QK7A 4YT2A 3ANXA 4XLLA 3QVGB 4URVR 2GZDA 3ZDBA 1E5XA 2DWUA 3CRZA 4YAJA 4C0KA 4CJXA 2EFYA 2CNWD 5IASA 1QC5A 3BWEA 2IHTA 3RRYA 4EI8A 2BTOA 5K0LA 3CZ5A 3I72A 4BC1A 4U2DA 4EMUA 5B58C 1E3SA 4D79A 1A9TA 4EHKA 2Q5QA 5JANA 3NATA 2GF2A 1H69A 2ZFUA 4JLWA 1JV2B 1MXFA 1ZOOA 2W37A 4U2EA 4NDZA 4Y8VA 3TRKA 3MG9A 4U6SA 2I6TA 4WJZA 1Q0TA 3LDGA 2ZVPX 4P4LA 3BG5A 3UGKA 1DC8A 4L27A 4X7BA 2ENWA 4EDHA 1REQB 3P97A 2PH1A 3FROA 1SMKA 5EYPA 1BFUA 1N7JA 2WJIA 2OCPA 2FSGA 2WIJA 4KAAA 4BLRA 1CJMA 1FMLA 3OIGA 1ZINA 2AFIE 1HPLA 5KVSA 4PX5A 4X9XA 1O57A 2YJZA 4OLFA 1LPMA 1U8ZA 1VDMA 4TS1A 4J7CA 4IIFA 1QYWA 3I53A 4Q47A 4GT1A 4YACA 3KWLA 3FPSA 3I01M 2QG6A 3SFVA 3T9AA 3F3YA 3UO8B 4DIMA 4QATA 5HWSA 1NVGA 3RARA 3PCTA 3DTNA 4F4JA 1YC2A 1PCXA 3HKCB 2HA4A 4OQYA 4FCVA 4CMBA 2ZYSA 1STOA 2RGWA 1JGTA 2ZR0A 3OFND 3JV7A 5CLHA 4EGSA 3U26A 4BO0A 3B5JA 3DZIA 3FPGA 3MCZA 2VHVA 1E3DA 4JUIA 2XDYA 1FMTA 3VAAA 2PWPA 1X15A 1P9RA 3E8MA 2P62A 2FPUA 3K0AB 4ER3A 4XWKA 5KKNB 1M0EA 4EYOA 2OESA 3FWNA 5EE3A 4M9XA 5HZKA 3MGGA 1QH0A 1LK5A 2A9KA 1GZSA 2LP4Y 1XWFA 5KU1A 1TADA 5DI9A 2WU4A 3TBFA 1QKIA 3WHIA 5HOEA 2AKEA 2R8PA 3PEFA 3M6VA 4DNPA 4EFKA 2QJWA 5KX5F 2ODPA 4OYRA 1T5SA 3UB4A 4C87A 3H83A 4ND3A 4IVNA 1DOZA 2WNIA 2YOGA 4ENWA 2ZXEA 5A6VA 3DEAA 1O0CA 4TSRA 4EPYA 1AZSC 5FNVF 3HUUA 2OQVA 5LWQA 3OY2A 3R5JA 3ZJUA 1HK7A 3PQCA 2XWPA 2FPRA 3JARB 2Z8XA 4OM7A 1GFZA 4UUBA 1JQ3A 1G9SA 3GLUA 4NEGA 4YRPA 3RM3A 5BP7A 4Q9HA 1X9GA 3ZZ0A 1KIFA 4MCAA 2EZTA 4C4SA 1IM8A 3EPJA 2WHYA 1JU9A 1RTKA 3Q3JB 2O5RA 4PLHA 5JNSA 3O84A 3R44A 3WYEA 3CW9A 1DEAA 5KNCA 3RC8A 4GC9A 4C3UA 3KHTA 5ECYA 4G63A 4C4PA 3PXDA 4HQKA 2DZDA 1QZ3A 4GBJA 4GS5A 4FYPA 2CUZA 3SZOA 3U3OA 3SS8A 1N4AA 1SB9A 4MYCA 2P5TB 3NCHA 1DWPA 2B0JA 3OY7A 4IBOA 1GLNA 2BV3A 3ZS9A 3HUFA 3KTFA 2V7GA 3GYGA 5IM4A 3FCAA 5DLEA 1TO2E 1EXWA 3C1OA 2NUBA 2ZATA 1CR4A 1J2RA 2PZAA 2GK7A 2QR5A 4ZYZA 4UDOA 3B1VA 2A0FA 2D3WA 4A0GA 3UTDA 5I3ZA 5L95A 1Q19A 2ZJ1A 3OJLA 4Q02A 4OHPA 1QIEA 4ER5A 5JXJA 2FQXA 4HBZA 4M9ZA 2QRVA 4WFJA 1U8AA 1S2NA 4P5DA 3H2YA 1EU1A 5TVKA 4MJLA 2VNKA 2F43B 4GEGA 1ONNA 2OAEA 3BA1A 1V4VA 3BX1A 3L6DA 1U1FA 1AIPA 3WIUA 1ZMTA 3KJXA 4XWYA 2VZ8A 1I3NA 1LTHR 2EKBA 3NP7A 4WXMA 3M2TA 4TTSA 4DA4A 4KYUA 1AOXA 3L1IA 5FTLA 2RAUA 4EPTA 3M6MD 2QAJA 4HNVA 1UADA 4LSGA 4E13A 2I3AA 1WDMA 1W0KD 2P4QA 1PX2A 2V6MA 3GZNB 4FCTA 4NFSA 4C21A 5EJ7A 4FMDF 3CJRA 3NYQA 1Y6FA 3NHFA 1CUAA 3BORA 3RYTC 4IKPA 1AZWA 1KAQA 1IWPB 3TNYA 1HE3A 2ZRCA 4NP6A 3WC4A 4D9CA 2PUGA 3M6WA 1CF9A 5TGZA 4PANA 3NOVA 4JOQA 2ZYDA 4EHHA 1XRQA 3B9QA 4XPZA 4AMGA 2XBMA 5AW9A 2EFJA 2XODA 3CY6A 3I2GA 1PK8A 4HLUC 5EHIA 5EIFA 4BLVA 4CLEA 3BBLA 1QKJA 2ZJBA 2GGSA 4YMIA 3QMVA 3CF0A 4QLAA 2PL3A 4X0EA 3D3EA 4HG2A 3D1JA 5FBQB 1OLUB 2WD7B 3CPHA 2IPNA 5ABPA 1MP0A 3DVRX 1LS1A 2RGCA 4BNDB 4BECA 5ALUA 3CBGA 1ZD9A 2W4QA 3DMDA 5IH7A 1BOFA 5BR8B 3RUIA 3I34X 3MTDA 4LZZA 1Q17A 1ZXXA 4NMHA 1YJ5A 4YGXB 3L5OA 1QFJA 3U13A 2YNMD 5ECDA 1DJPA 2PJRA 4HAYA 3ESXA 4WA8A 2YS6A 5E4FA 3HL4A 2Z0MA 1W5BA 2IDKA 4G1MB 4TYPA 2GJ9A 4B0OA 1NJSA 4Z86A 2E5FA 2ZBRA 3L0CA 3JPWA 4E4RA 3PQ5A 4I8IA 4YIKA 4FW8A 3DFUA 3GG2A 3U4IA 3SYMA 2Y1FA 4QXQA 3T0IA 2XBLA 2XUJA 5HQJA 3SBOA 4RJLA 1QQBA 2IELA 5ALSA 2PPLA 1VSQA 5IVHA 4KQ2A 1DIBA 3GPDG 4QPDA 1U0NA 3EXG1 1W0JD 3B6EA 3F5DA 3QG1A 4LXIA 1YVUA 4RDCA 5E6UA 2A67A 3GJ0A 4ZANA 1ULTA 3WK9A 4ALKA 3THOA 4C78A 1FQJA 3MTBA 5HUQA 1XPRA 5EJ8A 1NNSA 3GI1A 3RYIB 3TM5A 3KBBA 1RCFA 1IFXA 4LE2A 5EIHA 4Q4JB 2XCTB 3H1PA 2QPOA 3F96A 3KZOA 3U7RA 4UZEA 3D7NA 5AI9A 2JFVA 1RFGE 2DY0A 3SM3A 2FPIA 1J99A 5K0BA 2OQRA 4EPVA 5EWJB 4R2KA 1W2GA 1PR3A 3ZE7A 1MO2A 4BNVA 5I7FA 3DDCA 1D2GA 2FI1A 1RRKA 5M5BA 4Q66C 2VWQA 3P9IA 3UHFA 3H8VA 3JY6A 3ZLBA 2IHZA 4FCCA 5K3SA 3T7TA 4C0SA 4PZUA 1QR6A 4I3FA 2Z2ZA 3U4DA 4F85A 3ZV4A 3F3KA 4DMGA 3MVEA 3JXEA 5FUXA 5F64A 1T3ZA 3GFFA 1YA8A 3GHHA 2CNWA 3WRWA 1PHPA 1LDNA 2JBWA 4EX6A 1NWCA 2UUOA 3TZHA 3WKCA 3RUFA 2IZ6A 2Q8PA 3EPRA 2N1BA 2WPDA 3AEXA 2NSLA 3OIUA 1EP2B 3EW7A 4MW9A 2XT6A 4MR7A 3BGVA 3GLSA 1PAUA 4EABA 1T4MA 1RRFA 3MS2A 1N3LA 2ERYA 3W0LB 2YHUA 3K0CA 4BVEA 3RG2A 1A7KA 3DTVD 1R5OA 5L53A 5MN6A 5BV8A 3KKNA 1OXBB 3E9CA 1VP9A 2NO0A 1MAUA 3OPNA 1JPVA 4RKQA 4WOPA 4ARCA 4HZIA 1RI5A 1TEXA 1J9GA 4A1FA 3D2BA 4QZVA 2JLWA 1IN1A 3H2SA 3UJAA 3HE3A 3UMGA 1PIWA 4JUAA 4HVLA 3WK5A 4RZUA 4JDPA 4WBNA 3OQOA 1O77A 1Y3FE 4G8CA 1H8HD 2ZB4A 1GL3A 2BEUB 1K0UA 5CJPA 1UPTA 4BVGA 4QXOA 1C7JA 3DF7A 3BSSA 4AZ0A 3IKTA 4GRAA 3AI1A 3HMQA 1ONBA 3D5EA 3L77A 3P9SA 4CT4B 3SDZA 1PGQA 1FFBA 1S89A 4HFNA 1SUAA 3OT4A 4RMIA 5CT4A 1F5NA 1G19A 4K1LA 1HI9A 2DKOA 4Q1CA 5DTEA 1IG3A 2WJPA 4FQ7A 1B15A 4AMYA 1DUIA 1M8FA 2E9SA 2FFQA 2XCIA 3RRNA 3ZQUA 3RANA 5AXBA 1KZGB 1UZLA 3UPTA 2WI8A 2R751 4G41A 1XZKA 1XVVA 1ECBA 1EG2A 3L0DA 4IQGA 4Q39A 1NFFA 4AJIA 3D7KA 4DBVO 4Q7QA 5CA0F 5DB4A 2XUKA 2QENA <