4XVUA

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
301
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSLADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 103
structure length 301
sequence length 349
chains with identical sequence B, G, H
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xvuA00
1S1MA 3CLVA 5KPJA 1OXTA 3L82B 4FWIB 2AK2A 2FSHA 1XEXB 4HB2A 2GCNA 3ZD6A 4HLCA 1UKVY 3AVXA 2YWFA 1QHYA 4Q1FA 4DB2A 1YZNA 1ZYUA 1N5LA 3L0OA 1XFAA 1R0XA 3L0IB 5FL3A 2BVNA 2FN4A 2X2EA 5CIWA 2NO6A 1P3JA 1TEVA 3UK6A 2OUKA 2ZR0A 1IONA 2DPXA 3UWKA 5CLQA 4YMTA 1NVVQ 1PJRA 3TE6A 1P2TA 3CH5A 4QXAA 1F48A 5DNYB 1AS3A 2D62A 3Q72A 2VF8A 4HI0E 2FSGA 5GADl 2MSDB 1OW3B 2QE7D 3RABA 4BZXA 4TSFD 1U9IC 2AFHE 1NG9A 5KPDA 3GPLA 3TK1A 2C77A 2KI5A 4QGHA 1DO2A 4TZ0A 4QHTA 3E2IA 5EE5B 3BXZA 3DO6A 3RS0A 3TUZC 1B0UA 3RS2A 1SXJD 2GWHA 3BC1A 5GJVC 4HLUC 4JBWA 1AZSC 1IHUA 4NCIA 2G3YA 3GCGA 2WSSD 4S35A 3PJRA 1XRJA 3M1IA 1NRJB 3RRZA 5DI3A 4TYWA 3EZ7A 1OIWA 1ODFA 4MYTA 4NPHA 2OESA 3DL0A 2ZRLA 5FPYA 4TQAA 4D6PA 3ICEA 4JT2A 1Z0IA 4Q4HA 2PBRA 2PH1A 2Q3HA 1XJ0A 2GXUA 1P9NA 1JJ7A 1P60A 1TL7C 2QP4A 3WRXC 4IDOA 1U0JA 3CZQA 4L9SA 4WZBE 1FZQA 2QMOA 1DVRA 2ZRIA 1F5NA 3N2EA 1E2EA 2IWHA 1KSFX 4DEXA 4DUGA 1RRCA 3IIKA 3FMIA 5L3QA 3A6PC 1VG0B 3CZPA 4EIWA 4DLWA 2OFWA 3GP8A 1R7RA 1IN6A 1TUEA 1II0A 2R6FA 1KI6B 1IN4A 2B7BA 2D06A 3D6TB 4A36A 5AWFC 1HV8A 1SVSA 2QENA 5TV2A 2QTFA 4B43A 4B3GA 3QBTA 1N2CE 3Q3JB 1U8YA 4MGIR 1UEIA 4YMUA 5J4YA 2J87A 2GK7A 2BWJA 2J7PA 3EG5A 1AQYA 2WJHA 3AGPA 3DZDA 3MFYA 2QTVB 1NIPA 4TMWA 1IJEA 2VYFA 1Z07A 2OLKA 3X1ZA 2G88A 5AJYA 3FVQA 1E2JA 2VP2A 3H84A 4HDOB 3U44B 4M9XA 1GKUB 1SXJB 2IL1A 2J5XA 2CL7X 1A2KC 4FINA 4NYJQ 4Q4LA 1OLOA 4WXPA 4C7OB 4HAXA 2MSEB 2QNRA 2PCJA 2XJ4A 1R5BA 1VCOA 3A8TA 4LJ8A 4PQRA 3AGQA 4DRZA 1G5TA 1G6OA 1SQ5A 2IYUA 4DCNA 1G18A 4DDUA 1T91A 2RGCA 5L8VA 1G3MA 2ZI4A 3O8RA 5GVSA 1XCGB 2ZSFA 4KFTA 3B8HA 4E03A 5EUMA 1TF7A 4PHHA 4JIMA 2WICA 3FHCB 2IYXA 2WJJA 3WXMA 3BD9A 3GEHA 2GXSA 2ATXA 2QGNA 2EVWX 2FZLA 3AF3A 4RCZA 4V0ME 4ZKDA 2Z83A 2OFOA 5KOYA 4B3CA 2Q9CA 1XZQA 3HU3A 1IY0A 3LBIA 3WMFA 1CF4A 1IN5A 2JASA 1ZM2A 4B34A 5JJLA 1U81A 2D2EA 3SI7A 4KBGA 1P9WA 2J0UA 1F2UB 4RCYA 4F4CA 3BWDD 4D80A 1EFHA 4DUGD 3B1ZA 3CBQA 2GESA 4R71A 4RY2A 2JA1A 2XSZA 5FR2A 1T3SA 1ZUHA 1OFHA 4CEJA 1OXVA 2VP0A 3U4QB 1KMHB 1ZAKA 2GILA 2O0HA 3KXIA 4CEIB 5JJIA 4YONB 5HKKD 1EFRD 3QKRB 2EFHB 4HB4A 4V03A 2QA5A 3SYLA 3ADDA 5DI3B 5P21A 3PR1A 3GLIB 3SQXA 3OE7D 2J0UB 2WKQA 4HDQB 3I5XA 1ZBDA 4Q1BA 8OHMA 2ZJZA 5HZKA 1KI1A 5HZHA 3PIRA 3RSLA 1GM5A 2ZSDA 4Q7MB 2C99A 3FPAA 4JLKA 3VQTA 4DDVA 3FMPB 2ZI7A 5CK5A 2BM1A 2PL3A 1W5TA 2CNWA 3QKSB 2PX3A 1SVKA 3W8NA 4TSFA 1XZPA 2QE7A 4I1UA 3ZZTA 2ZJYA 3H2YA 1FQJA 4RKEA 1QVRA 1NBMD 2YVUA 2RGAA 2A7QA 2W0SA 2GEDA 1COWA 3B1VA 4M1YA 3THYA 4I1VA 2FV8A 2YHSA 4LDJA 4FMCB 4Q1CA 1AIPA 3OF5A 4UNQA 1NN5A 3UMSA 1JEEA 1G8PA 2ZRCA 1NVWQ 3K09A 2C04A 2W2TA 2JIZD 2CMKA 2P65A 2JLYA 3DM5A 2IXEA 4MUAA 2ZUCA 4JKIA 1QHNA 1VYUA 1KTVA 2VHJA 2Q0HA 4MUBA 3W8RA 4D0GA 3PVSA 4NYIR 4OBEA 4FWTA 1OKKD 3OIVA 4MGZR 3HJNA 2P6UA 1PVOA 4AKHA 1LB1B 2IUTA 5HE8A 4DXAA 3KZ1E 1XTSA 1KAGA 3SNHA 4B74A 2REXB 1UBCA 2CLSA 4G3XA 4HAYA 1ZM7A 3VMFA 3WP0A 4FCVA 2EQBA 2QP9X 1ZC3A 4TTRA 4WAUA 3C4JA 1MKYA 4LOAA 4B71A 2JJ2D 5ELXA 4XIGS 1EFRA 4Q5IA 3LXXA 3TLXA 1UPTA 1ZM4A 5FBVB 2RGXA 4DLZA 1FUKA 2XNDA 4KFRA 4GP7A 4GDFA 3O8DA 1VG8A 4ZDJA 1IN7A 2BOVA 4DDTA 4MKFA 5SZKB 2VHUA 4U00A 1W46A 3QY0A 1Y3AA 4JLNA 2QPTA 2F3RA 3HR7A 2BMEA 5FBRB 5J4HA 5L3VA 4B3DA 5FPKA 2P5TB 4IOJA 4II7A 1D2EA 2IS1A 2Q9AA 4S2EA 4UNPA 3AKCA 3BGWA 3IHWA 5AR1A 3T1QA 5FOUA 3WMGA 5JLJA 2ONJA 1WDTA 2NO0A 2JATA 4WZ6A 4ZO4A 4MDFA 5JFGA 2O8FB 2ZJ2A 4U7DA 4HLDA 2EYUA 3PV0A 4A2PA 1XTQA 4RFSA 4FMCF 5B2ZA 2QM8A 4M0LA 1IY1A 3GEEA 2R6DA 1ZD8A 4OHVA 4WW0A 4URVR 2F55A 1Z0KA 1T5LA 2KE5A 3IQWA 4KI0A 4LZZA 3IO5A 3RS3A 3L8ZA 1P62B 5JS8A 2GXAA 3LFUA 4O25A 1E1RA 1NL3A 3SBDA 4LHVA 2R44A 2YNMA 1TX4B 1G4AE 1Z29A 1TU3A 3AVVA 2BM0A 4L15A 3U4QA 3QEOA 2ORWA 4QBIA 1KK0A 5CJPA 2W2XA 1M7BA 3NBYC 2VA8A 3C5CA 3KJEA 5SZJA 4KSCA 4EJSA 4LHXA 4MA4A 1CBUA 1BS1A 1JBKA 1ZUIA 1ZIPA 3P4XA 2DWPA 5EP4A 2ODWA 4G5RA 1E0AA 4ABYA 3P27A 1W2HA 4W5HA 1I4TD 1P9RA 4M1SA 3RYTC 1OPXA 2W6IA 3EZ2A 4D25A 1TPZA 5HCNA 2WAYA 4IVQA 4PO9A 2SHKA 3LDAA 3LV8A 4LJYA 3A1VA 1E99A 3KQNA 2WJIA 1Z0AA 5KHOC 2XNDD 1SXJE 3X2SA 1T0HB 4PR0A 2ZUBA 4C0QC 3NWJA 1OYYA 1AS2A 3SE0A 1R0ZA 2ZETA 1YHNA 3TGPA 2V7QD 3K0FB 2HCJB 1OHHD 2W00A 5JZVA 2C03A 4NP6A 3F0TA 1FP6A 3BK7A 1CJMA 1IXSB 1D5CA 1GIAA 5EE1A 1Z6AA 5LD2C 3AM1A 1E0KA 3B85A 2PCLA 5DI9A 3SJCA 2NTYC 3QKSA 2AHOA 3ZS9A 3C16C 1NN0A 3ADBA 2ZI6A 2IWRA 4H1UA 3QF7A 3AVPA 1OKKA 1UBEA 3FHTA 2O8CA 3OEHD 1DARA 1VIYA 3IPXA 3U3KA 1Z8FA 4AYXA 2FPLA 3WBKA 3RWOA 5BN4A 1JNYA 4M1TA 5B30A 5FUWA 4N0DA 1K5GA 1YRAA 3U60B 1FMJA 1U2RA 2OO7A 5LDDC 5TXGA 2FFHA 1H8EA 5TB5A 2F3TA 4LX0A 2O8EB 1II9A 5KDDA 5J5CA 1N25A 4I1SA 1RPZA 2A5FA 2ZRDA 1D2NA 1DTSA 3OHMA 3U3RA 4OI0A 4BWYA 1M2OB 1GNQA 4ZDWA 4YQFA 1COWD 3NBXX 4TMTA 1NBMA 2QMHA 2V54A 2ZJOA 1P75A 4PC6A 2NZJA 2OCPA 1G7SA 4MGKR 2EU8A 1LVGA 4EUNA 4R9UC 5JRJA 3RWMB 2P67A 3VHLB 2PZFA 2D74A 3GJXC 2VH5R 1BIFA 2CHVA 2P5SA 3AV0B 4LC1A 3AVUA 3W6PA 1XMJA 3U3JA 1YZGA 3RRYA 2J46A 4BLSA 2P0EA 4JBXA 3R8CA 4LSGA 4W5JA 5CM8B 5EP3A 3EPKA 2K5UA 4TL6A 4JVSB 4GL2A 1PV4A 4DT1A 1KO4A 1RW4A 1XJCA 3F5FA 1BMFA 2VSXA 4P4SB 2I1QA 4LYAA 3B82A 4MKIA 4NHOA 4TLAA 3U7FB 5LB4A 3B6EA 4N3NA 2OCBA 1KSGA 3OAAD 4PSKA 4C0LA 1LY1A 4LK2A 5IT5A 2LKCA 2XSZD 3W3AA 4US2R 1U0HC 3OIUA 1P2SA 4TLCA 2ZRBA 1QBKC 3REFA 2WIAA 4RJLA 2FZ4A 3MG9A 4B35A 2VQSA 4B6FA 2ZS9A 1NKTA 2OT3B 4NCKA 3T34A 2HYDA 3UANA 3EIHA 3GJ0A 3PEWA 4W9MC 2Z4RA 1E9SA 4UNSA 1MO6A 4PZZA 3LD9A 1EXMA 2A5DA 2WVJA 1HH4A 4EJSB 1N6RA 3BAFA 3QE0A 3LBNA 4QC2A 1JXOA 4LHWA 3MWJA 4GI7A 2YJTD 1BOFA 5DHFA 3VR5A 1P73A 4JL8A 4J0QA 2AR7A 1EFTA 3VNUA 4JYCA 3KFXA 4BZPA 4N1AA 3M4YA 5FOXA 3HP1A 2CBZA 2GCPA 2XXAA 4BFSA 3GLIE 4O2LA 3K9LA 1ZD1A 4EJSC 1KZ7B 1LV7A 3GLGE 1FNNA 4XWKA 1W4AA 2H16A 3I4LA 4WIAA 2J41A 1G16A 3SFVA 1T8UA 2D2FA 4IDHA 4JL6A 4H9GA 4JT4A 2ZU6A 4YDSA 2QQEA 3R9IA 3RAPR 5IHPA 1E69A 3HU1A 4LCBA 5C18A 4B6EA 2HYIC 3ZIAA 5JHHB 1Z6XA 1UKYA 2ZM5A 3AVYA 1NIJA 5A5GA 2L0XA 2Z6VA 4GPTA 1PZNA 1DG1G 1NNEA 1SVMA 3GFOA 4DBLC 5BQ5A 2G1JA 2QPAA 3QXHA 4LHYA 1DAEA 4JLVA 4HB3A 5JCZA 1BYIA 2YOGA 4DLSA 1VIAA 5K8TA 4LV5B 3CRQA 4TMZA 3GFTA 5FUVA 4M9QA 5KNBA 5SZIA 1X8LA 1W0JA 3ND8A 1XD2B 3REGA 1CULC 4LJ9A 4D2IA 2HLDD 1JEDA 4W7SA 2ZIAA 3AKDA 1FOEB 4MYUA 4OK5A 4A4DA 3NDBB 2KB0A 2YZ2A 2IK8A 1Z6GA 3SYKA 4PQFA 5EE0A 2ZRJA 2C5LA 2QAGA 2VP4A 1ZW6A 4C3ZA 2A5GA 2QY9A 1W5SA 1Z08A 2FFAA 1NF3A 4K8OA 4F4JA 3KQKA 2BDTA 4A9AA 1EFCA 1HA3A 4WZAE 2OBNA 2IYZA 3F8TA 1GRNA 1A82A 3Q7QA 2O8EA 4OQFA 4Q4JB 4Q9KA 4M9SA 2NPFA 3B13B 4M1OA 5DYIA 3TSZA 2V6JA 3VR1A 3WYGA 2CLCX 1DELA 4PTLA 3AF0A 4KSBA 1XPRA 3B7GA 2KWIA 5TY0A 4WXRA 4DKXA 4CEHA 3IIJA 2MMGA 2H92A 4IEIA 4Z1MA 1FNMA 1R6BX 1ZM9A 4DSNA 5LD2B 2O8DB 5FBWB 1Z3IX 3KUDA 2Q3MA 4GZLA 2VSFA 1TUIA 1KK3A 1QG2A 1M7HA 2WWGA 2OCYC 2YV5A 2QPOA 4KFUA 4LV8B 4RD6A 1KK2A 4OI4A 3WNBA 2IXGA 1JQJC 1S96A 4URUR 1V43A 1T5IA 2ORIA 3SC3A 4FD2A 3AEZA 3TVDA 4CIDA 1AN0A 5DN6D 2ODBA 3CH4B 3FMOB 5DSZA 4KYUA 4DSOA 3TW4A 1ESMA 3KKNA 2FPMA 1XXHE 1T8TA 2ZANA 1GUAA 3L2OB 4CRWB 5JBQA 4YXWD 3R8FA 4G5SA 1LS1A 1G291 1OH8A 1GP2A 3WNCA 2F43B 1EESA 4QBGB 2J1LA 3V00A 4EQ6B 3SQWA 2D7DA 3PUVA 4R7ZA 4OJKA 1QRAA 5J40A 1RRFA 1ZJ6A 3P26A 4P3YA 4EKDA 1X6VA 2NQ2C 1W7AA 4QL3A 4NBSA 2B8WA 4URXR 1OFIA 2WOJA 1MABA 3MAAC 4YXWA 4AYTA 5JSZB 3T61A 4HB0A 5EE3A 4H1VA 2BV3A 3AVWA 1G6HA 1ZNXA 1KOFA 4KFSA 3EPHA 4G01B 3CX8A 5L3SB 2XZOA 4QNRA 1SZPA 1N6IA 4IXMA 3RS7A 1VHLA 4ERNA 4KVAA 1E9FA 3AVOA 1N6KA 1GL7A 2JJ1A 1A7JA 1D9XA 2O8BB 5GJBA 1DAHA 3LXRA 1MO3A 5EZ5A 2ODEA 1MABB 2XNSA 5G41A 2QM7A 2N46A 4ACAA 1KJWA 4TTQA 4PC7A 3UG7A 3SDZA 2RCNA 3AP2A 1H8HD 1G8GA 2PX0A 2QTHA 2G0TA 1JPJA 5JRZA 2EFDB 1W36C 2BMFA 3CWZA 1KZGB 2XAUA 2MMCA 2ZTSA 1T0JB 5TDHA 4IHQA 2CE7A 2PT5A 821PA 2A2ZA 1X8JA 2JAQA 2QORA 1NVXQ 4ZV4A 4UNNA 3TIFA 1OH5A 5EXTA 1ANKA 4NCNA 4Q4JA 4UXIA 3CRW1 5CB8A 3LW7A 1XTKA 4JJZA 5E7JA 4G1UC 2ZPTX 5M04A 4Q7LA 3EWSA 2ZJBA 1KI2A 3I92A 1R8SA 4ESHA 5FPSA 1BKDR 4PZLA 1M7GA 4B3FX 5JWRA 3MLEA 2WV9A 3QIAA 4Q9HA 4EPRA 3KTAB 2A30A 2XEXA 3G82C 4FMDB 2F6RA 1Z0DA 1KNXA 3F3YA 1OH6A 4NL4H 2ZQ5A 2W6ID 3H1TA 3Q9LA 1CP2A 2ZAMA 5DE3A 2VIIA 2G6BA 4X8MA 4YC7A 2BMDA 2CVFA 2TMKA 1KYIA 1KSJA 2QAJA 1D2MA 4GP6A 1RRPA 4P0TA 4C30A 4B73A 2FSFA 3RS4A 4EPVA 1UAAA 2QN6A 4RFSB 4B75A 1EWRA 1E9AA 1XTIA 2JDIA 4LHZA 4XVUA 2BBTA 2I3BA 2ZRGA 1ZVQA 3AB3A 4O3MA 4PPFA 4O2RA 3VAAA 2PJRA 1Z0JA 4GBMA 5KTYA 2QBYA 3KX2A 4P31A 1DEKA 1C9KA 1E79D 1KHTA 2HDNB 3KXLA 4YMVA 2BJWA 1QG4A 4NYIQ 3LNCA 3UXMA 2Y8EA 2C78A 1YZKA 4I81A 5EE9A 2XZLA 3U44A 4TN1A 2Z5FA 5JI3E 1YR7A 2CL6X 1Z2CA 3G0HA 1X3SA 4XD7A 221PA 1W36D 4KODA 3M0EA 1XEWX 4X8OA 2QT1A 2Z43A 1JQLB 2CCGA 2V55B 1TAGA 2JLVA 3ICQB 3EAQA 2RGBA 3EARA 4TYNA 2PMDA 5F9HA 4QBHA 1R5NA 3RVBA 2W6JD 1Z22A 1DAGA 4A0GA 2QP3A 4X8LA 4QKQA 1XMSA 2OV2A 4DLTA 1E2DA 2GBLC 5D3QA 3RANA 5C2JB 4G5QA 1C4OA 2R6GA 3D31A 1KDOA 4PX9A 3E70C 5E3HA 1EX6A 2DY1A 3OFND 5J4LA 2J0SA 1TU4A 4ITRC 5BN5A 4PC2A 1RFLA 3CR7A 3NHBA 5JECA 1LF5A 2FDCA 1AKEA 1E9CA 4DLRA 1E2NA 1GG2A 3A1SA 3W3ZB 4DDWA 421PA 2JJ2A 1XJQA 5EZ6B 1SKYB 4D4JA 4A15A 4D4LA 2WJYA 1F2UA 5HCIA 2WPDD 3HYRA 3LAWA 2GJ8A 5EJEA 3K9NA 1QHGA 1CJUC 1EGAA 4I4LA 1XBTA 4RZ2A 2RGNA 2QSYA 2FG5A 3QKTA 4GRAA 3GLGA 3GJ4A 5JWHA 1Q3HA 1N0UA 1ZM3A 2KBEA 1XTRA 5EXPA 5ANRB 3PUZA 3ZVMA 1FX0B 1GRQA 4A92A 3DVLA 4NH0A 6Q21A 5FPTA 5CM9C 2RHMA 2ZYUX 4BZQA 4URZR 2ZSBA 1DO0A 1Q1EA 1ZU4A 2O0KA 3BORA 4Q4HB 3LW8A 4BRWA 3I62A 1CRPA 2ONKA 2HCBA 4DLVA 4R98A 1CIPA 3EIQA 1M34E 3RLFA 1JXMA 2YINC 3A58B 3UIEA 3WMEA 1KI3A 4A82A 3ZVNA 3EA5A 4NTZA 4L16A 2OCAA 2VF7A 3CF0A 4Q1DA 3O8CA 2VHQA 2V9PA 1M74A 5F2EA 4Q66C 4EPWA 1E94E 4WA7A 4B3BA 4E09A 1BH2A 2GF0A 2GHIA 2ODNA 1AM4D 2WMNB 2OFXA 3L0PA 4RVCA 2GJAA 1VECA 1OIXA 1F3OA 1GWNA 1UDXA 1YVDA 4U02A 2RGNC 2QT0A 2Q3FA 1XMIA 1PLKA 4LBZA 5BW8A 1OHHA 2ECKA 4DVGA 2PLFA 2DFKB 3OE7A 4JLBA 4IDQA 3KDSE 4XD7D 3CRVA 3K70B 4B2LA 3KQHA 3ZZUA 2QI9C 3TAHA 1S9HA 2GJ9A 2GEUA 2AD1A 2ZR7A 4A1FA 1IOZA 4CYMA 2ANBA 2JEOA 3FYHA 1TF5A 1F6BA 1FPMA 1LFDB 5CYOA 4JLOA 3T12A 1ZIOA 2UZ3A 3RNLA 4QGGA 2BHRA 3TR5A 2IYVA 1ELOA 2FPKA 2UZIR 3CPJB 4PC1A 2GETA 3ASYA 1AK2A 2ZYWX 4LBVA 2F9MA 2R6CA 4KBFA 4ZDKA 1D6JA 1RRGA 1GAJA 1E4VA 4M22A 5GJCA 3R7WA 1X1RA 2QZ4A 3DOEA 3IILA 4OYHA 3WYFA 2HLDA 4G0NA 4BRUA 4WBSA 1G5RA 4PAMA 5HTKA 1KI9A 4M53A 1E6CA 4FMDF 3LLMA 5C46F 2ASEA 2CCKA 2OG2A 4OJQA 4C0HA 3C41J 1U94A 3LQRA 4RD3A 2X8AA 2G77B 3A4MA 4GMDA 3ZVRA 3EZ9A 1Q1BA 1W49A 1KDPA 1G41A 4Q1AA 4RD1A 3BH0A 3MMPA 1S1CA 4RD2A 2D4HA 5B58C 3QVVA 1UF9A 3FHOA 4NE2A 1CR1A 1W4BA 1KDTA 1QHSA 2DWQA 1LTQA 1N6LA 3I3SR 4KYIB 1VG9B 4NZYA 5H68A 3U3MA 2EFGA 4LV6A 3U61B 1J90A 1NLYA 1J7KA 1ZRHA 4ILEA 4N0EA 4AYWA 4UNRA 3NHAA 4ZPXA 1US8B 4JS0A 2FF7A 1LF0A 2ZE7A 4EPYA 2P3SA 1KKLA 2WBLC 4HEJA 1HQYE 2ZJ8A 1E1QD 3O8BA 3B78A 3QKRA 3NEYA 4HLQB 4HAVA 2REBA 3C14C 2FWRA 1KO1A 1F2TA 5E4FA 3KJIA 2Q9BA 3THXA 3QF4B 5JWOA 2FOLA 4EFLA 2BBOA 3AQ4A 3HPRA 2AD5A 3TSOA 4B33A 1E0JA 2JGNA 4TYPA 4LYFA 3CF6R 3SU8A 2ZU0C 2MSCB 2NO7A 1GITA 4GNKA 1RYFA 1YQTA 3I5YA 1ZINA 1XPUA 1L2TA 5JSZA 4NDZA 3AF2A 4Y0AA 3EXAA 4MKHA 3CNOA 4MRSA 3ADKA 4EFMA 3VNVA 4L4UA 1G7TA 3NIBA 5G40A 1K5DA 4R2IA 3THYB 4M1WA 5FBQB 1OB5A 2IC5A 2XXAB 2AXPA 4GOJA 1CJVC 1XPOA 3DDCA 4CF7A 3LLUA 1G3UA 2A3RA 1L8QA 1YR8A 1CKEA 3UMFA 3SZRA 1RKBA 2OILA 3X1YA 1S3SA 2H5EA 3I73A 1N5JA 4B2PA 4IRUB 1XEFA 2QQ0A 1P7CA 2A5YB 3N70A 4BGDA 1BMFD 4LBYA 1KSHA 3SEAA 2DB3A 4D4KA 3K0CA 4L5BA 4OK3A 1OT3A 1XD2A 2OEPA 2X77A 3K0EA 3V4RA 2ZE8A 4BFUA 3EPJA 3HDTA 5J47A 2JLZA 4XSHA 3DHWC 1DG3A 5FTMA 1G3IA 4Q9JA 1KI8A 2DFNA 4IOMA 4CGZA 1IXRC 1OJLA 1NMYA 4MRVA 3ZH9B 1DS6A 1W48A 3NH9A 4CZ2A 1CEEA 3T35A 2GJKA 1Z6YA 4DJTA 3MJRA 5C4MA 2CE2X 1GL6A 1MO4A 1SXJC 3GQBA 4HDCA 5G53C 1QF9A 4TYQA 4ZIRB 2JIZA 3K0SA 4AY2A 3BB1A 3FFBA 3WYAA 1G9XA 4KLZA 3WNDA 1W2GA 1VPLA 1Z28A 5AJVB 3C15C 3RS5A 4Y0VA 3ZQ6A 4BUJA 4Z8YA 1O87A 4OHXA 3NEJA 4JVMA 1KI6A 2CJWB 3A37A 4V02A 3LQQA 4PANA 2G9NA 4FMBB 4BFVA 3QG5A 3QXCA 5DYGA 1WE2A 3CPHA 2CNWD 1RJ9B 3B1WA 3DPUA 3MWLA 4Q18A 1JB1A 3D8BA 1KI7A 1NKSA 2GCOA 2RGDA 4HUQA 3C7KA 2EYQA 3PQCA 4TMVA 5IF9A 1KMQA 1SGWA 1CTQA 1ZD9A 3TNFA 3V9PA 2F1RA 5KSZA 2AKAB 2WJGA 1Q3TA 4HZUA 4IDPA 3TQFA 4RD0A 3FOZA 1WA5A 3FE2A 3JVVA 5EP1A 3ZLJA 3FGNA 1ONBA 4LJ4A 1G5PA 4EAQA 1WB9A 2XOKD 4TMXA 1JR3E 3ASZA 2B92A 4NCJA 1MH1A 1SHKA 3TJZA 2CXXA 4IVRA 3OIYA 3THOA 4V0OA 3O47A 721PA 3X1WA 1TF2A 1AZTA 5C4GB 1NLFA 2Q21A 3WP1B 1KKMA 4EFNA 1GFIA 2NGRA 3WHKA 3W34A 4BFTA 4F7WA 3I8XA 2IS2A 2IYYA 4Q9IA 3MWKA 3DKVA 3Q8XB 4AI6A 1U0LA 3H0KA 3QG1A 3S1AA 1FUUA 3IKJA 2H18A 2E1RA 1CU1A 1KNQA 2OSBA 3ECCA 4TL7A 1X86B 3TW8B 4M8NE 1X1SA 3LBHA 4TL8A 1YJ5A 2RMKA 2YWGA 4A6PA 2O0JA 3TAUA 4EPTA 2BBWA 3JZAA 4RZXA 5AUOB 2ZI5A 1ZUNB 2YWHA 1XEWY 4JLMA 5B57C 1CLUA 4QFMA 1CRQA 4DIDA 2IHBA 3ZIAD 4AD8A 3EPLA 4CEIA 1ESNA 3CPEA 5HR5A 5F98A 1KDRA 4JZKA 3EWAA 3ND9A 4GMXA 1N6PA 1G8FA 1U98A 2R62A 3CM0A 4HYYA 3NVAA 5IK2D 2ZREA 1RZ3A 4GT1A 3BH6A 3X1XA 3T5DA 3E1SA 4UQOA 4KJZA 1ZU5A 5CITA 1HE8B 4TTPA 5KSYA 1E9RA 1E1RD 1E2MA 1NBME 3IUYA 3GLIA 3OEED 1JR3D 3I1FA 4A6XA 4XTCS 3GLFB 3T1TA 1S8FA 1KAOA 4NONA 3VU9A 1S0UA 1T4GA 4ZDIA 2R65A 3VTKA 4ZIRA 2ZRNA 4E22A 4Q03A 3UMRA 5FUXA 2ZYTX 1F60A 1YZLA 4FCWA 3CX6A 3EZ6A 2ZRMA 5JMTA 1KO5A 4XVRA 3VR3A 1K6MA 2X1VA 3TH5A 5J4VA 1OYWA 2H1LA 2HUPA 4HZIA 3U7EB 5FUYA 4ZCMA 2WZQA 2I4IA 3K0FA 1S9DA 2RH5A 4JLAA 5B64A 4LPSA 3ZDQA 1UKEA 4LPKA 3RSOA 3LRPA 1YRBA 3DZ8A 1IM2A 2HXYA 2OZEA 3B1YA 4TQ9A 3P1JA 1TQDA 1FP7A 4B2IA 5EQTA 1S4QA 3LVRE 4P32A 4IFBA 2WMOB 1Q57A 2WWFA 4OK6A 1VYVA 1ZNWA 2CLDX 2RAPA 3RC3A 1VCMA 4DSTA 2JLUA 3FWYA 1HQCA 1GKIA 2R2AA 4XTRA 3ZQJA 1SXJA 2D3WA 2WWXA 3WHLA 3MCAA 3SHFA 1E98A 2NOAA 1SVOA 1R2QA 4B76A 3IEUA 1E9BA 4GSYA 1G17A 1UADA 1VKJA 2I1VB 4AWXA 5KYKA 2A78A 4E5UA 2J3EA 3H4MA 2NZ8A 2C95A 3B2EA 1FMLA 2IX3A 3T06B 2E87A 1A2BA 1RE0A 1AJEA 4KXFB 1DE0A 3QJYA 1N6HA 4DT1B 2ZE6A 2PEZA 1IAQA 3ZJYA 5A0FA 2P6NA 4DHEA 3VR2A 1FTSA 2AFIE 2IYWA 5H1YA 1GDDA 4BFWA 2CK3D 5AUPB 3GLHA 4HAWA 2X19A 3WY9A 1H8ED 1AQUA 2WOOA 3VX4A 4ARZA 3WBJA 3RRMA 3RRNA 2YWEA 2F1IA 1E0SA 1AS0A 2Z0MA 3R7WB 2OAQ1 1Q1ZA 4M9ZA 1L4YA 2QBYB 2IYQA 2IF0A 3U3OA 3BE4A 3N2IA 2WTUA 3THWB 2DBYA 3BRWD 4OQNA 4PPNA 4X8HA 4XOIA 1W0KA 4A8JB 1HT2E 5JEDA 1LNZA 3BIFA 4F38A 4W5WA 3L0SA 4LRWA 5KSOA 1WBBA 3QI2A 4A0HA 2NG1A 1DAKA 4BLTA 1NMXA 5AJXA 5D3MA 2BCGY 4AC9A 2VL7A 4HATA 2XZPA 1HTWA 4PXAA 4B3XA 1SVIA 2R9VA 2IBMA 3B1XA 4C0KA 5CDFE 1OE0A 2W2VA 4B47A 3ETLA 2XB2A 5HKKA 1R5OA 3QXJA 4YMWA 5C1BA 1NN3A 5G3ZA 1AGRA 1LS6A 4CT4B 3CF2A 2GZHA 2EFEB 1HUQA 3OZXA 2FEMA 5FTLA 4P33A 2WAXA 4AG6A 1GZSA 3HR8A 5J4KA 3EIEA 3GLGB 1DADA 2CL0X 3OFNA 2BEJA 5EUQB 4JKYA 3R9WA 3IIMA 1H65A 1YU9A 2FSIA 2V8OA 4M2LA 3V4FA 4Q9LA 2PEYA 3A1TA 4LY6A 3CW2A 5DIFA 1KGDA 2V4ZA 3LY5A 4TL9A 1VCIA 1CR2A 1OV4A 3FKQA 3TKLA 1CXZA 1Z5ZA 4JJKA 2R8RA 2XTNA 5DH9A 3BERA 4QJ5A 3CR8A 5L3QB 3DOFA 1XF9A 1XMVA 4RKFA 2H17A 1HYQA 3IDQA 2OE2A 4Z8XA 1E1QA 4A0RA 2GF9A 2VTKA 4BLRA 1JR6A 4K46A 4QHSA 4F91B 4JVLA 4G5GA 1SKQA 5E7MA 1JI0A 3EW9A 3N5CA 5BYJA 2BJVA 3W90A 3OEEA 2WJVA 1DOAA 1E2FA 4K81B 5E95A 2ZXUA 4I99A 4MRRA 4URWR 4PPGA 4QJ4A 1U8ZA 3K9GA 1FQKA 3QVUA 2QMUA 1EWQA 5EP2A 1IY2A 1QHHA 2WIBA 4AG5A 1S2MA 2OHFA 3NXSA 1VG1A 3I32A 3UPUA 4OI2A 3EC1A 1QHXA 2WHXA 4TWZA 4LBWA 3BFXA 4IDNA 3MJHA 2J7PD 1IQPA 2AK3A 1NI3A 3DMDA 5GJWC 3C5HA 1ZMXA 1Y63A 3GJ5A 4ZCIA 2WKRA 2P6RA 2RGEA 3SYNA 2QSZA 1OSNA 3HYTA 3NG1A 1KO8A 2ZS7A 2ZJAA 4LYHA 4MRPA 2GXQA 1QZXA 2AX4A 2EWWA 521PA 2ZI9A 1SVWA 3A4LA 3HWSA 4Q00A 4GOKA 5K8IA 3PCRB 2BIFA 1JECA 2O8FA 2WWHA 3FDIA 3TRFA 4KAXA 2W0MA 2IF2A 4MGYR 1JPNA 2GEVA 5DLQC 4MYCA 2ZUDA 2G1KA 5CIQA 4RD4A 4AKGA 3CRMA 3QPUA 4GOXA 4C2TA 4MH0R 4PAOA 3NKVA 1J70A 2AN9A 3PENA 2VRWA 2HT1A 3K1JA 5JJKA 5DO9A 4PO1A 3MWYW 1VDZA 1GSIA 1Z06A 3KUCA 3UATA 2PZGA 1XCMA 4HZUB 4BEJA 1W47A 4CEJB 4IJMA 3ZZ0A 4D0NA 4V0NA 2WM9B 1RVDA 3A1WA 2H8KA 3NTUA 3SBEA 4XWAA 2IYLD 4YMSA 1XXHA 4Q4AA 4WOPA 4UXJA 5FOVA 2J45A 1Z6TA 4XWOA 3LX8A 2GJSA 1HURA 1J8MF 3QUSA 1V5WA 4V0MA 2P2LA 4I1OA 3BFKA 1U8AA 4NYMQ 2GBLA 1OXUA 3Q5EA 3QXXA 5FL7D 5FTKA 4OI1A 1SKYE 1JJVA 3ZGXA 2IS4A 1VTKA 2HEIA 1FFHA 2CVHA 3U5ZB 3P32A 2VSOA 5FPHA 4IOKA 1NN1A 2NPIA 1OFUX 2ZR9A 3CX7A 4XJXA 3AUXA 2BKUA 3MUFA 3SN6A 3SFZA 3KKQA 4TZ6A 1CJKC 2H7VA 2XTZA 2FMXA 1JAHA 1II8B 2GA8A 2RHDA 1N3BA 3CNLA 3QSYA 4JSYA 3L8YA 2QRNA 1DPFA 2IYTA 4OQMA 3IPYA 4OQLA 1P72A 3FKSD 3PG5A 3U7GA 2ZSAA 2O8BA 4MKGA 1OB2A 4KLNA 2QRZA 1MO5A 2GTPA 4JLDA 4RSGA 5AUQA 3SS8A 1RIFA 1I2DA 1NG1A 4V0KA 2JLXA 1GRRA 1CJTC 3K53A 3EZFA 3UKDA 1S3GA 4PHGA 5BWMA 3GJ7A 1X8KA 1TQ2A 4ESVA 4P4UA 1TQ6A 4LWZA 4QBFA 1NVUQ 2OBLA 2X2FA 1W1WA 1XD8A 1FX0A 1Q12A 1Q20A 1KIMA 3FB4A 2DFTA 1P61B 3TVTA 4Q21A 4U5XA 5FI1B 1Z2AA 3W6NA 4A2QA 3UG6A 2EW1A 1IJFA 2ZYVX 3IBGA 1XP8A 5CLLA 1VMAA 1ZP6A 3G5UA 1L4UA 3LA6A 4DEYA 1EFUA 1XCPA 5FOSA 3W5JA 1NP6A 4C0SA 3GJ3A 3B9PA 4JSTA 4LUCA 5CJ2A 3PFIA 1PLLA 2F1JA 4IFEA 2HF9A 3KKPA 5AK0A 3SR0A 4DZZA 1O3YA 4Q7JB 2WSMA 3AP3A 4UKDA 3PUXA 1R0WA 4GZMA 3R20A 3BBPA 1I4DD 2F1HA 2GZDA 4UJ5A 1BO6A 2E9SA 4ASUD 1HY3A 2AKYA 2C9CA 1E79A 4OKSA 2VPPA 4KU4A 5IRCD 2IT1A 4KV9A 1HE1C 2YC4C 4IEEA 2ERYA 1MR3F 4KITB 1ZCAA 4KHZA 2V1XA 2QMEA 2VP9A 2HJGA 5AJWA 2PMKA 3T15A 2R6AA 3IGFA 2C9YA 1CR0A 3A36A 2DFLA 1IBRA 2CEAA 2OM2A 1G7RA 1XEXA 2FE4A 4DC9A 1RC8A 3EC2A 1Q44A 1JAIA 3GJ6A 1NJFA 3VX3A 5DISB 4BFYA 3VR4A 5LPNA 3PXGA 2CJWA 3P4YA 4D81A 1Q0UA 1G1MA 2EFCB 2XGJA 1MRSA 4G5OA 3BJIC 3ADCA 4B32A 4OHWA 1TQ4A 1KMHA 1US8A 4JLJA 5CK4A 2ZVQX 4MDEA 1NMZA 3A1UA 2VP5A 4DWJA 2QGZA 4IOLA 1XXHB 4Q4AB 4TT3A 4HUTA 2HF8A 2F43A 3TBKA 1II8A 3L43A 5FTJA 3GLFE 1AGPA 1G20E 2KBFA 4FIDA 4F4IA 3BH7A 2IXFA 4YDHB 4TYYA 5GVRA 3LH5A 3EX7C 4IKEA 3GLHB 4Q1EA 1J99A 3GMTA 2ZS8A 2C9OA 3K9HA 3CRRA 1WF3A 4Q01A 2ZROA 5DGXA 1UFQA 4KO8A 3JVUA 3C8UA 2IYSA 1G19A 4Z54A 4TLDA 3D7MA 4BFZA 1G64A 4FI3C 4MRNA 5FTNA 4IW3B 5JHGB 3U2QA 2WSSA 2ZRFA 1NJGA 621PA 2EWVA 1E9DA 3IBYA 2PJZA 1R8QA 5TVKA 1XWIA 1WBDA 4NYMR 1G8YA 1KJYA 3PEYA 4RFVA 4M21A 2GAOA 4BLQA 1WP9A 2J0VA 2LKDA 2WWYA 4D4MA 1N5KA 2BBSA 1YZQA 1F2TB 2PZEA 3PUWA 5JEEA 2W58A 5L3RA 3W5IA 2AWNA 5FH9A 2FA9A 2FFQA 2DHRA 2AWOA 2JJ1D 4QOSA 1ZNYA 4NU0A 5HPYB 5G3YA 4NCHA 1MOZA 3QPVA 1J8YF 2VO1A 2XJ9A 3NDPA 3I72A 4PSVA 3IHLA 4YLGA 4PC3A 3KFVA 1N5IA 3TUIC 3RDPA 2FFBA 3NC1C 1T6NA 4PPQA 2O8CB 2ZRPA 1E2IA 1Q21A 1YZTA 5JCPA 2OLJA 4MITA 2FH5B 3VU9B 2GK6A 3AKYA 1E96A 1XTJA 1QHIA 3QNUA 2FNAA 3DM9B 1CR4A 1KY2A 1YKSA 2G0NA 3FKSA 4A2WA 4B48A 4C0JA 1DAIA 1AKYA 1QVAA 4DCVA 3PITA 1C1YA 2NO9A 1VCNA 2B21A 4QNMA 2NIPA 3M6AA 5KDLA 4LGMA 4Q47A 2VHTA 1N6OA 2FJUA 4IXNA 4QGFA 3X1DA 5BXQC 1MT0A 4CEHB 2GNOA 3B9QA 3AVTA 3P20A 2H57A 5FFMA 1MRNA 4ON9A 1E4YA 1TMKA 3MGCA 5KUTA 2C2HA 2FU5C 2WPDA 3SJBA 2IUSA 2ZAOA 4DLUA 3SJZA 2CHGA 2D7CA 2QEQA 1UJ2A 4ZCLA 2QU8A 3TR0A 3U6BA 3MRSA 1E32A 1U90A 3QXSA 1B23P 5FL7A 2KJQA 3CUEF 4MQBA 1KY3A 1G3QA 1UM8A 4ACBA 3KB2A 5LB2A 1D8TA 4DIEA 4QM6A 1GKYA 1OXSC 3QBVA 2N42A 3VFDA 4PHFA 2J0QA 2HXSA 4TLBA 3CNNA 2NO1A 5A4JA 3OEHA 3KXKA 1L7VC 4Z1MD 4BECA 2A5JA 1WRBA 3VKHA 4C2UA 1KJZA 5KU1A 1RYHA 2FX3A 2LWIA 1DAMA 4Q19A 5HE9A 4UXHA 4XH9B 4LJAA 4QRHA 4BE7B 2BEKA 3CWQA 4O0MA 1UBFA 1FL9A 2GZAA 2V6IA 3A4NA 4C0BA 4OHYA 2AXNA 2O52A 5D3MB 2V7QA 1VHTA 3ZVLA 1UDWA 1EK0A 2QUZA 4EDHA 1NY5A 1OIVA 1KI4A 3TSWA 1NSTA 1XD9A 4IVPA 3LX5A 3Q85A 2RB4A 3UWOA 3W9YA 4CT5A 3EA0A 2BMJA 4A8JA 2CHQA 2B7CA 121PA 1T3HA 3D3QA 3CIOA 4TT3D 4CDGA 4OL0A 3K8YA 3BOSA 3U7HB 1WCV1 3MD0A 3BB3A 4NMMA 4QJ3A 3LVQE 2C96A 2F9LA 4PHTA 5FI0B 3THXB 2DYKA 4LI0A 3PEUA 1DBSA 4QG7A 4ARZB 2UVQA 4JMPA 1TNDA 2A9KA 5BN3A 2YKGA 1TTTA 3TUJC 1XU4A 3T1OA 5JS7A 3QOFA 1IXZA 2YOHA 4FN5A 1GNPA 2XTMA 2WKPA 3S1AB 2LCFA 2J59A 3OIWA 4Z51A 3VKGA 1KO7A 2PT7A 4HLUA 5FBLB 1E9EA 1E2LA 4P4TA 4FW9A 4PQYA 4BEBA 2Z4SA 4DLYA 2DWOA 1WQ1R 1SVLA 1M8PA 4V0LA 3VHXA 4ASUA 2ZRKA 4DCUA 2AL7A 3K0AA 3Q7PA 3B5JA 1A4RA 4M1MA 3PUYA 4HAZA 1WMSA 2IS6A 4M4SA 4EPXA 1ZC4A 5FR1A 5EXSA 1E3MA 1IN8A 3BB4A 3OESA 3KQLA 1OFTA 4TMKA 4AURA 1M6NA 5KSPA 3QKUA 4DCTA 3KTAA 5UKDA 3AP1A 1D9ZA 4PAQA 2HJVA 4NYJR 2VP6A 4ZI3A 1G3RA 3KL4A 3VR6A 2QAGC 4B44A 1XB2A 4LYJA 2ZRHA 3FTQA 3GLFA 3K0AB 3FFAA 3NBZC 4US0R 2IW3A 4LJ6A 2JLWA 2DR3A 4DSUA 1H8HA 1W4RA 2UKDA 4MYHA 4F93B 3TQCA 2ZE5A 4JLPA 4QM7A 1E2PA 5IDVA 2F7SA 1GTVA 1P2UA 1R4AA 4PZYA 2FEOA 4D26A 3K70D 3GJ8A 4DB4A 1NLZA 2JLQA 1YR9A 1YE8A 1GNRA 1T9HA 3Q5DA 2CDNA 3QPWA 3RC8A 3WRYC 2GDJA 2RKOA 3H86A 3HPQA 1BYUA 4BPBA 4OQXA 3DEFA 2XB4A 1QHHB 4US1R 1Z63A 2V3CC 1I4LD 2XX3A 3DKPA 4HSEA 1OXXK 1RJ9A 4XSGA 3TMKA 2GVDC 2ANCA 3T1VA 5F9FA 1LW7A 4AKIA 2FGJA 3AUYA 4BLOA 2FGKA 2ZRAA 1W4CA 3K09C 4NKRA 1QDEA 2XITA 1G4UR 2ERXA 1NSFA 3IO3A 4LJ7A 4LJ5A 3RHFA 1NY6A 3E5HA 2QG6A 4ZKEA 3GEIA 2BKEA 1JALA 1OF1A 2IA5A 1CS4C 2HT6A 5H8WA 2IEZA 3CKLA 1EX7A 1E2KA 4FCTA 2CK3A 3GLHE 1W44A 2VHCA 4A0FA 1ZCBA 3U6KA 1HT1E 1U9IA 5DN6A 1Q1QA 1A1VA 4KVGA 3VKWA 2BCJQ 1N6NA 3LO5A 4DCSA 1W36B 4JBYA 1UEJA 1XNJA 1E2GA 3IEVA 2W83A 4POAA 2YYZA 4AK9A 2ZI3A 3GD7A 3CB4A 4EQ6A 5L3SA 5KO2A 2IHYA 2W6JA 4Q7KA 2OXRA 3QF4A 5JI2E 2ATVA 4ZI2A 1NVVR 2HV8A 2Q6TA 2REOA 3BFVA 4DLXA 1ETUA 2WWWA 3SOPA 4F92B 1SHZA 3W6OA 1FTNA 2ZJ5A 2IYRA 1Q22A 3QENA 2VBCA 1WXQA 4FXPA 2YC2C 2JLSA 1N0WA 4C9BA 1EG7A 1P5ZB 1YR6A 5CDFA 4C4PA 4BLPA 2CCJA 3ZYCA 4PSAA 1E2HA 2G83A 4Q48A 3J81k 1G21E 4TLEA 3THWA 3KQUA 5LBIA 2DCUA 4JL5A 1U99A 4TQUS 2GRJA 3ONWA 3B60A 3KJHA 4KCGA 5TMPA 1GOTA 5BYKA 1R0YA 3T5GA 3AF1A 3LWNA 4URYR 5FOTA 1G8HA 5E7IA 3ZS8A 1VYTA 4A8JC 2JDID 2JJ8A 4D0LB 4JVNA 2OBMA 3GFPA 1W0JD 4L8GA 1KK1A 3K70C 4WVFA 4OHZA 1N0VC 1GL9B 1M1YE 3AH8A 3KKOA 2IUUA 3FMFA 4PO8A 1TADA 3AVQA 2O5VA 2OXCA 2RGGA 4XVQA 4BQSA 3AF4A 3JZMA 1YZUA 3QQ5A 2JCSA 3PEVA 5TARA 1FW6A 2KSQA 4LC0A 4PFSA 4D82A 3KB1A 1JR3A 5FOWA 4C0AC 1K8RA 4BFXA 2VEDA 2IEYA 4Q02A 3ZD7A 1J2JA 3HU2A 3I8SA 1A5TA 2BC9A 4UJ3A 1E2QA 3R9XA 5IK2A 2J7KA 5EXXA 1P6XA 4AIIA 1R10A 1G7CA 1MV5A 2ZVPX 3BS4A 2O8DA 4RZ3A 3K0CC 4CVNA 1PLJA 2NMVA 3NH6A 2GKSA 2VLIA 5KNCA 2JLRA 2QAGB 2QL6A 1UKZA 1XX6A 1Z0FA 1Z47A 1P2VA 2C8VA 4BASA 3SHWA 1OH7A 1UBGA 4JYBA 2QROA 4RZUA 5F3WB 4M1KA 5SZHB 2GCOB 5CB6A 1HEIA 4QGAA 1PUIA 3KKMA 1Z83A 5CYPA 3CO5A 2PLRA 2ZEJA 4P4SA 4R2HA 4E07A 5KDOA 2GVZC 2ZITA 4AKEA 2GAAA 3MSXA 1AA9A 5KNDA 4L9WA 5AUNB 1ZNZA 1GILA 2V1UA 2WWIA 1TEXA 3DMNA 3CONA 4C7OA 1XDBA 2N1BA 5DHAA 4HUQB 4HAUA 2B8TA 5AJZA 3QEJA 5K8UA 2ZSEA 1I2MA 1PUJA 3IQXA 3AKEA 2YOFA 1GVNB 4QHYA 2J9RA 3OAAA 5K8LA 3NBFA 4GFDA 2C98A 3KJGA 3I61A 2OAP1 2B6HA 2XOKA 1DAFA 2ORVA 3SJAA 3EASA 1SULA 4CW7A 1P4SA 5H70A 1T3LA 3NC0C 1W0KD
chains in the Genus database with same CATH superfamily
3ONNA 2QN3A 3KDPA 1TW2A 4FWIB 2AK2A 3PK0A 2C7VA 5DSTA 3ZD6A 4HLCA 1C4WA 1C30A 1UKVY 1YI0A 4PLFA 5HQ3A 1A4XA 5JH7A 2VQFB 3GRCA 4DB2A 4L5AA 2D13A 1H9AA 4NBWA 4A0QA 3L0OA 4WNAB 1XYYA 3L0IB 5FL3A 1RWPA 1Y3FE 2PR2A 2GQ0A 4G8CA 5CIWA 5TPWA 3UK6A 3L7DA 2IV7A 2FOXA 1IONA 2VPZA 4EI7A 3T1HB 4CJXA 5FHQA 3UWKA 5TNXA 4QEKA 4K7JA 4YMLA 1KR2A 3DUWA 1P2TA 3RYHA 3ZHQA 3WIVA 1GTSA 5KTRA 4P0PB 1T10A 2JGDA 3BMNB 3U3XA 4MW2A 4BVBA 1PR4A 2FSGA 1BA3A 5KOJB 3RHZA 3OOSA 2DSNA 3SK0A 1XELA 4RVHA 3WGTA 5FI3A 4UBMA 3PNQA 1NG9A 3GPLA 3I0MA 3TK1A 1NQUA 2KI5A 2PSEA 2C92A 4QHTA 4DJ5X 2DUMA 2ZXEA 5EE5B 5F4ZA 3OJLA 4Z3OA 2NADA 2V7TA 2GS9A 1ULSA 1XVLA 2AEEA 2EP8A 5LLDA 2Y71A 3G5TA 1B0UA 1D4FA 3ER8A 1JBQA 2B8EA 1KBZA 3FIJA 4LN1A 1AZSC 5EKXA 1OBFO 3RYHB 4NCIA 3I1IA 3WRVA 3FWZA 5FUBA 4S35A 3M1IA 4AT1A 3G7UA 3JALA 2PVCA 1UWCA 3D4NA 4QM7A 4TYWA 5JATA 1OIWA 4JUFA 1FP4B 2OESA 3KR0A 2FMFA 3IHTA 3SWWA 3ICEA 2QTCA 4UU7A 2NLOA 2PBRA 3A6KA 3EIXA 2Q3HA 2V6BA 1F8GA 2IYAA 2QP4A 3P2YA 3UJDA 4L9SA 4WZBE 4PCVA 1FZQA 2QMOA 2XWSA 4I08A 1PD0A 1OGJA 1E2EA 4DUGA 1RRCA 3WLEA 5DGCA 3F7MA 3IIKA 4ZVSA 4I9UA 5F7XA 4Y2TA 2FP3A 2C3UA 1SEVA 5FAKA 4OQZA 3A6PC 4BCDA 4DLWA 1GFZA 4Q37A 2P7HA 1II0A 3TOSA 1IN4A 2B7BA 1IUNA 3D6TB 3GWGA 5DDIP 4I50F 4A36A 1SVSA 2QY6A 2QENA 4B43A 2QTFA 3UCEA 5K45A 1GV0A 3DV2A 1GLVA 3G0CA 1UJBA 5FBZA 1U8YA 5U1PA 2X1LA 4MGIR 4N54A 1FYDA 1A1SA 4WBNA 1UEIA 1TAHA 4WK6A 5G4KB 1JKJB 4BRSA 1RQRA 3QVGB 3Q8KA 5JG7A 3HI6A 1JAZA 1FXWA 1FYWA 4PCLA 1K3TA 3EG5A 3AY3A 5CTJA 3DZDA 4MYDA 4LK3A 3IAUA 3ASUA 3D4PA 1UQTA 3RREA 4AJNA 4ZI7F 3CVUA 4GXNA 4CKEA 3KVRA 4KMOA 4PLWA 1NIPA 4DIMA 2BFPA 5KC8A 4YAWA 4ZYVA 1VPWA 3X1ZA 4TQGA 2GZ3A 3JD3A 1ORWA 1OILA 4JA0A 1YK1A 1CFJA 3GCDA 4HDOB 4JNCA 1N7IA 1FJXA 3MYYA 5ALXA 4HTFB 1PT6A 2XVYA 4R6WA 2IL1A 3COSA 4I9HA 2CL7X 4WXPA 2JI4A 2JH8A 4HAXA 4C7OB 1XUOA 2Z6AA 4FM9A 1LA2A 1B0AA 1IEQA 1U5AA 2OORA 1FNSA 1HDYA 1NPDA 1RKUA 2CMHA 2ORYA 1FYEA 1SQ5A 5I8ZA 4AO7A 5ADUS 5CFOA 1JWLA 4DDUA 4RZQA 1SU7A 2VPWA 2ET6A 2RGCA 1AKTA 3RFUA 1KH3A 3ZGNA 4JELA 4X84A 5KREA 1RWQA 4MCAA 4B82A 2C84A 3RBVA 3WL8A 1KAMA 1SA0A 3ZXSA 4KQGA 5CNIA 1VP3A 3OZBA 3IQZA 2ZBUA 2WJJA 3VAZA 3WXMA 4UZFA 3BD9A 4KW7A 5EQJB 1IK4A 3RASA 2ATXA 2QGNA 2EVWX 2FFJA 2FZLA 4RCZA 2GBIA 2F59A 2XADA 1KZHA 4CF6A 3Q7RA 3P2KA 4BVJA 2Q49A 5KOYA 2JFUA 3DXXA 4MW7A 4NDNE 3NHJA 1Z5VA 1MX3A 1IY0A 3T6KA 3BMNA 2E49A 1ZM2A 3C6BA 2PX2A 1K08A 1U81A 5K20A 2OCDA 1ZN7A 1GKKA 2K2QB 1IUPA 4JP8A 5TR9A 4RCYA 2BUBA 4TYMA 4F71A 3BWDD 4D80A 1Z36A 1EFHA 3OE4A 2BONA 3B1ZA 3CBQA 1I2BA 3DYBA 4HUJA 3JQAD 4NRDA 5EWLB 3WIBA 2CFSA 4TKZA 3THRA 1Q7EA 5JD3A 3F3MA 2XSZA 1E4OA 1NT4A 1RQ2A 1T3SA 1Y6RA 3CEPB 4J0DA 4CF4A 5IC4A 5LR6A 1POXA 1AV7A 1Q0HA 2O0HA 3G7NA 2YIMA 4MLPA 3SOZA 1A5SB 4OX9B 2OP1A 3QKRB 3SYMA 1CNFA 2EFHB 1K06A 4TTTS 1U6IA 2QA5A 3NRCA 3ADDA 5E6SB 3OPNA 2G40A 1Q14A 4CV2A 3OE7D 2WFLB 1T4BA 2FPSA 2P5YA 3CNBA 1CY4A 3JYPA 1ZBDA 1DJQA 2OHGA 5HZKA 3I5XA 1CJCA 1GM5A 5JU6A 3CUVA 4RK7A 4WCFA 4JLKA 4AN4A 5EYPA 4ARSA 4DDVA 3QX8A 4NATA 3R1IA 3ZU5A 1ZMRA 3EIUA 3ZE1B 1WO8A 2H9AA 3W8NA 3FGOA 2QE7A 2J09A 3BX1A 1UAYA 3KJFA 3LY7A 4FLFA 1FQJA 3EE6A 4FQ7A 1NBMD 4XEHA 2W0SA 2FPRA 4CV1A 1ZK1A 2P30A 3AJRA 4I1VA 3KOXA 2FV8A 2YHSA 4KVZA 5KYVA 4FMCB 3UJ9A 5AIBA 2BFNA 3BL6A 3L49A 4JBNA 4BY9E 4G2TA 3AHFA 1BX0A 2ZRCA 5AJUA 1MB9A 3EVAA 5HF5A 1Z4JA 1KMNA 2G9UA 2P9FA 1DWOA 2J3DA 4MUAA 2ZUCA 1YZHA 3OE1A 3OZEA 4CDMA 4JKIA 3PFCA 1QHNA 3D8RA 4MVJG 2QN7A 3A9CA 1U7WA 4NK4A 1IB6A 2VHJA 5K4AA 2QTBA 3PVSA 3SXJA 1YMUA 4MB0A 2WDPA 4FWTA 2FUCA 3TNYA 3HV0A 2NQTA 3BJMA 4HVLA 1W9HA 4MGZR 3T5CA 4PBRA 4UOQA 4AM8A 2AZDA 4PE5B 1MGPA 4R05A 4OAQA 1BN7A 5HE8A 3IQHX 4DXAA 3LK6A 1WBJB 1KAGA 2X1MA 1I5OA 3FAKA 3GRPA 1UBCA 2CLSA 3LHKA 2PK3A 1NWCA 3ID6C 4HAYA 5KTNA 3RNOA 3ZI0A 2Q4BA 3OM9A 3WP0A 2EQBA 3WLTA 4DIBA 5JR3A 4HDMB 3EPPA 1N5MA 4I36A 4CODB 2JCXA 4JZYA 3HSKA 4LXUA 4E7OA 4XUEA 4V2UA 3ELDA 4LDPA 2IP4A 3BXFA 3OLWA 3DCIA 1ZJJA 3C1TA 4WASA 4D9MA 3SLGA 2CFCA 5EIWA 5D85A 1TFRA 3REQA 3TLXA 2PU7A 2P2CA 1UPTA 1ZM4A 3GZ4A 4N5LA 5FBVB 3U26A 1TYBE 2VT7A 1YA4A 1PI3A 4GHWA 1JI3A 3RFCA 1VG8A 5EJ5A 1KPIA 1R64A 2WZDA 3LUHA 3F5SA 3OQIA 4MKFA 3U3DA 5JSKA 5IBCA 3EUFA 1RR6A 3A70A 2C2YA 1W46A 4N4AA 3QY0A 4CTJA 3HR7A 2BMEA 5J4HA 5L3VA 1Q1NA 3IKVA 3NUQA 1EZZA 1TLFA 5FPKA 5E7QA 1KDVA 4II7A 4JR1A 4QOFA 3MF4A 4S2EA 1NAIA 3C5WP 4K6KA 3VR3D 1A98A 2ADMA 4OUDB 3W06A 4B8YA 4KWHA 1LWOA 3SZ3A 3TZ6A 5TQJA 2G04A 2EYUA 4GBED 1U63A 5B2ZA 4FMCF 1Z75A 2ZDQA 4YRIA 5IPFA 4M0LA 3ESDA 2O5RA 4OHVA 5SY4A 4ZYUA 2F55A 3O4GA 5C1OA 3BXEA 4EO7A 3NOVA 1IH8A 2VYND 2X5NA 4LDRA 4MEBA 5AKLA 3UXYA 2WTEA 4Z4EA 3VZBA 1J1IA 2AEJA 3E5MA 3IVAA 2XQJA 3WB1A 2RONA 1E1RA 2ACWA 2ZTLA 1FXSA 2XDAA 1YZYA 4IQ0A 4LHVA 1G4AE 3NX4A 1RMTA 3TCKA 1FNCA 3N3BC 4L15A 2QW0X 3WI7A 1VA5A 1OU0A 4REMA 3A9WA 4QUIA 2M6KA 1F8XA 5CJPA 3TZBA 3AETA 3EQ8A 3BXGA 3TBHA 5C53B 3D6AA 1M2VB 2VA8A 3CCBA 3FZYA 3NBYC 1RXVA 3KQVA 4KSCA 1M6HA 1ULHA 4EJSA 4IFTA 1GGJA 1LH0A 3A2MA 1E9VA 3SHVA 1AK1A 1BS1A 5ILGA 1SU6A 2XWBF 3G2KA 1FFXB 4ERXA 4HNQA 2VBGA 1J06A 3NHSA 3MS2A 4P34A 2NU8B 5I6DA 3TBFA 1R8JA 4RDCA 3ZGVA 4RKWA 4BWVA 2BGNA 3GYBA 2B8JA 4ZCPA 2XMSA 3P27A 3S70A 5E3IA 1PQWA 3M8KA 2QN8A 3B7PA 3IQGX 1N9GA 3EZ2A 3NRBA 4ZFNA 1WKCA 3C8HA 1J5PA 3GGDA 1S7CA 3L46A 1T5OA 3NRJA 5BVGA 5FT9A 1M1UA 1SD1A 3LV8A 1E99A 2JKYA 4KOEC 4IZOA 3HY6A 2LR0A 5L6LB 1JIKA 2J67A 2A58A 4HGYA 2X0DA 4NEHB 1GDHA 2BFDA 3BIOA 3BM5A 2ZUBA 4RJ2A 1AS2A 1N32B 1RTKA 5JAMA 1IBCA 2V7QD 2B82A 3GBVA 3ZBUA 5MN4A 5A2GA 1VLLA 2Z08A 1OHHD 5HKLA 2C03A 2JIMA 3PT5A 4MQFA 1WHTA 1CJMA 2YN2A 1D5CA 1PZMA 1RQGA 2FW8A 3CZ9A 2J85A 3EG9B 3GZNB 3AM1A 3KPWA 1QO0D 4W82A 1IPHA 1Y4AE 3SJCA 3LIIA 3V1LA 3C16C 2NZVG 1HTBA 4PQEA 1ECFA 1HGXA 3QF7A 2X9LA 2Y0PA 3FHTA 3OEHD 2WZBA 3IPXA 4XW2A 1NXWA 1FUEA 2OB2A 3EPRA 3WBKA 5CD1A 1NQXA 2Y1OA 4Q3AA 4AZ0B 2HMAA 1YOVA 3AFGA 3LUJA 1YRAA 4N0DA 3KE8A 4W99A 3VKVA 2OO7A 1IBMB 5ESDA 1WHTB 1MB0A 1YH3A 3AILA 2XI4A 5AKYA 3GVPA 2F3TA 4BB5A 3GP3A 3MD9A 1AXGA 1HE5A 4HWGA 1TOAA 4EJMA 3C7AA 2NXNA 2ONYA 1RPZA 2A5FA 3TDMA 4D8WA 2E4YA 3U3RA 2W8ZA 3WLLA 4OI0A 3TRJA 4ZDWA 4KKVA 1COWD 1JE0A 2P9GA 1VL1A 2W2KB 2Z8YM 3QLJA 4TMTA 1MDFA 3R3YA 2V54A 1R0BA 4ZVLA 3KQMA 3UH0A 2W90A 3DNPA 1KOJA 4MGKR 1L5SA 1NLMA 4OKIA 1HRKA 1OI4A 1SPBS 2XE7A 3GRAA 4RTSA 2I4LA 4R9UC 5JRJA 1JQKA 3RWMB 4UDXX 1X80A 3OZDA 1VPTA 2PZFA 2YJ3A 4N8EA 4UDOA 3U7IA 2BYTA 4HOYA 2P5SA 1TJPB 3AV0B 3IFSA 4LC1A 5DLYA 1XMJA 2WHPB 2CXOA 3Q8WA 3S27A 3EAFA 2P0EA 3BT7A 1F8YA 1FDVA 3E15A 4PLYA 1OWPA 2GEKA 4LYGA 5EP3A 2CHEA 4I1IA 3MTGA 4EGCB 1B7GO 4GL2A 1RW4A 2QI9F 3F5FA 3G8AA 6GPBA 4TLAA 3GDWA 5I9IA 3VHQA 5LWHA 3P7MA 1H2XA 1Y82A 1Z7WA 4H16A 1BMDA 3F6RA 3YASA 1T43A 4N3NA 4UARA 1T5TA 3OAAD 1KSGA 3OQMA 5KB3A 1BE6A 4C0LA 4LK2A 2X7JA 3RUCA 2HIMA 3KYBA 4MKXA 4NCXA 5LFAA 1QRSA 1U0HC 4IO1A 2HD4A 1P2SA 2B98A 4GRDA 4WECA 3REFA 4YRPA 3K16A 5CPFA 3FOBA 1PNOA 2FZ4A 2LZ0A 5F2NA 3MG9A 1YFJA 3AL2A 2HJHA 3JATB 1CQPA 3SYTA 4CGYA 1EVQA 2H3HA 3T34A 3T9CA 3IUJA 3EIHA 4GMFA 4LOJA 4D6YA 2BR3A 4G24A 4W9MC 4JFRA 4MK4A 3RYIA 5D00A 4XUDA 1C1HA 2Q8PA 1MO6A 1T6BY 4LJSA 3LD9A 2HRCA 1O94D 2A5DA 3SX2A 4RIHA 1HH4A 3SVLA 3QH4A 1N6RA 4A73A 1N2CB 1Z5GA 4MINA 3NT2A 2V0CA 4INOA 2YJTD 2ZG6A 3ZH2A 1CUEA 5DTIA 1MORA 4V3CA 4Z9XA 4AWAA 2JA2A 5KVSA 2VYCA 3IURA 4JYCA 1YJCA 2W6MA 1WDWB 4JUIA 2VRCA 3GW8A 1X15A 3O94A 4FE4A 3FSRA 4XWYA 4PYNA 4YJFA 5A9TA 5LZ2A 1JIUA 5FOXA 2XXAA 1JDSA 2CLIB 4LGYA 3KUXA 4XQEA 3LQFA 1SCJA 5EZYF 4BFSA 2F9FA 4O2LA 3VGJA 1XSEA 4HL6A 2AXQA 4GOLD 1H3EA 1A7UA 2ILTA 3CSUA 4RCVA 2JGLA 2DP4E 3I4LA 1Y9DA 1JMVA 3IBFA 4GSKA 4X7MA 4WIAA 3DXYA 4B17A 3FWKA 2RH4A 1J2EA 2XD4A 1JSCA 4JITA 4K3VA 4JT4A 2GUWA 3RC7A 4JL6A 4MP8A 3SFVA 3W2IA 2O2IA 4P80A 1NFFA 5KNBD 1GYRA 1ZA1A 1OT5A 1SU8A 1NHGA 4R8RA 2ZAGA 1QLJA 4Z4GA 2LNDA 4ZCRA 2AOUA 1Z6XA 2NVWA 4EHFA 1BKSB 4H3SA 4EG6A 3AVYA 2QRLA 1M1NA 2L0XA 3E1KA 2O2GA 2OY0A 4L3OA 1CY2A 4RBNA 5BQ5A 3TI7A 4I6JA 1DFIA 3DDWA 3QXHA 1OYVA 4HB3A 3CVVA 1S2OA 2YOGA 4OLJA 1GD1O 1NW6A 4LV5B 4MJXA 2PBFA 4TMZA 2WM2A 2ZB3A 5FUVA 4BN0A 1TJ5A 5SZIA 4GPZA 1X8LA 1YUNA 4G67A 4DJFC 3TZQA 4YCCA 5I7VA 4LJ9A 1JEDA 1PSWA 1S2GA 2EEZA 2ZIAA 3NHLA 1DKOA 2FWBA 1KMCA 3P2OA 2C8KA 1Z6GA 2HA7A 2IK8A 3SYKA 2ZRJA 2C5LA 3LLCA 2V3CC 1ST3A 4U9HS 2W8BB 4KRYA 4F4JA 1Z08A 4E2YA 2GFQA 2BDTA 2H7YA 1QQBA 3NJ4A 4A9AA 1Q2UA 2BGKA 4JEUA 4NMWA 4WZAE 1PYOA 1X2EA 3MM4A 5HIIA 3H5IA 4PS0A 2DLCX 1VPDA 1W6UA 3I5AA 4RL4A 2O8EA 4OQ4A 3A9SA 1IY9A 1Y81A 1ZN8A 2WKSA 4OA8A 4YRCA 5DOVA 5KNDH 2XCQA 4P3XA 3VPCA 3IDZA 3OJXA 5CCDA 3NALA 3DPSA 2V6JA 1BCRB 2QTTA 3C3JA 1I30A 2CLCX 3H6KA 3P0RA 3ZI7A 5JNWA 4WSOA 1ZCZA 2OQIA 1SAYA 1XL1A 1AKRA 1RZUA 1JG7A 1SM4A 2HMVA 3H9UA 3D2BA 3NJ8A 4FJ0A 4WXRA 5CX1A 5DNVA 4HWRA 4IEIA 2E85A 3U7QB 3ZWKA 1KH2A 1R74A 2CLHB 2O8DB 5DRTA 3PRHA 1Z3IX 5FBWB 4Y2VA 4FYPA 5FFFA 3ROMA 3HVJA 2Q3MA 1ZNQO 4M76B 3RV4A 3OQVA 3TQQA 4B8WA 2YYYA 3AM4A 4M38A 3GLQA 2WFZA 1T8RA 1A8UA 1LLFA 3GROA 1AOXA 4RTQA 3PVCA 4IG4A 3EQ6A 2OYCA 4NXMB 2AXEA 1KK2A 3T7CA 2XQGA 4A10A 3WLFA 4M46A 2N9UA 2P78A 3CXRA 1T5IA 2ORIA 2FSVC 4GM1A 4U7TB 5EHIA 4Q15A 4Z6KA 4N0PA 1Z2DA 3BQ9A 3TVDA 2HSWA 4CIDA 3QEBZ 5HIAA 1YWGO 2ODBA 4DSOA 3U1BA 4PLTA 5LZ9A 1LBHA 3IOEA 3EXHA 1BZYA 3WNVA 4CMHA 5JBQA 3W5UA 1MX9A 4YXWD 4LNUA 3V9AA 3WNCA 1EESA 3AYXB 4E88A 1AE1A 2J1LA 1MC4A 4FNMA 4EQ6B 2IPMA 1LDGA 1I0ZA 3SR4A 5L95A 2I9PA 2O6LA 3T4EA 2HB6A 1Q92A 5J40A 3A10A 1RRFA 2VDRB 1EE9A 1SUBA 3P26A 3WV4A 3KC2A 1DDIA 1FDWA 2GGSA 4RL6A 2BF4A 1EWYA 3SC6A 1WZ2A 4FT4A 3GUUA 2UYYA 1NBEA 3R7DA 4D43A 1LFAA 5FBQB 1MJGA 5JSZB 3K3PA 4COOA 2ZW9A 1P19A 5DCYA 1HDCA 1KYYA 4LOIA 5EE3A 5CA1A 1OAOA 2XTAA 3BGVA 4KFSA 4MLZA 3O84A 3OZTA 3CX4A 4G01B 2OCXA 2FZWA 3S28A 4I4TA 1MEOA 3M9WA 1DDGA 3OP4A 4ND5A 1N6IA 4R7TA 1XQ9A 3UW1A 1AXRA 1T13A 4TV9B 5ER6A 2EL7A 3PPVA 5BUCA 2XBUA 1S8OA 4L0MA 2FSVA 5JVDB 4FHZA 1N6KA 1GL7A 4BNNA 1A7JA 2O8BB 2RAFA 4OXQA 1DC3A 5IAEA 1IPEA 4L0QA 3LXRA 1MO3A 2GMWA 1UC5B 3A1CA 2ODEA 4IZIA 5EZ5A 4U9IS 5G41A 3DZGA 4YGXB 2WF8A 4B3HA 2O1XA 3QX3A 2YZKA 3MJSA 4PC7A 1JSLA 3I39X 4YJHB 1RLTA 1WZUA 3E3AA 1QE0A 2FYTA 3FNGA 3NCTA 1G8GA 4YJ2F 5E6SA 4RKYA 5IKEA 2G0TA 5JRZA 1IBSA 1VI5A 2Z09A 10MHA 2EFDB 1D4AA 5DTQA 2EHDA 5CNKA 4J7CA 4RPHA 4TV9A 1FK8A 1IN1A 4MP6A 4E31A 2CE7A 5DWQA 5IAGA 4DRXB 5AI8A 4YPVA 2AC2A 3DAOA 3AKZA 1L5OA 1REQA 1TJNA 2CBGA 2GO7A 5C34B 2HMSA 4ZV4A 2Q5CA 3PPXA 3TIFA 1Z16A 2EQAA 5LP6F 1YJAA 3MPUA 3TX2A 3BWVA 3KIPA 4NCNA 4Y9DA 4JWKA 4UXIA 5CB8A 3LW7A 3W1WA 4WFQA 4DR2B 4JJZA 1P17A 2YXPX 2ZPTX 3OTOB 4CLDA 1AG9A 2ZJBA 1P29A 3EWSA 3DOCA 3I92A 4JJ4A 1R18A 4DNXA 1HSOA 2CD7A 3VYUB 4ESHA 2NUPB 4EW1A 1BKDR 2X1HA 2VPYA 4B3FX 4CUZA 1FLVA 2WV9A 3KTAB 1NF9A 1A71A 5EFOA 2A30A 2XEXA 1NQ5A 3CRNA 4R41A 4CG0A 4PNZA 5JTTA 1XL0A 1KNXA 3DV9A 1P1FA 1O5TA 1OH6A 4NVRA 4NL4H 5E2BA 2E37A 5HHTA 2ROQA 4FUQA 3Q9LA 1C4XA 4A1OA 5DE3A 1P7WA 1XAGA 4JQSA 5AVRA 1DU4A 2G6BA 4X8MA 4YC7A 1QXSA 2PRSA 3B6JA 3CO0S 3NHMA 4N3AA 4MQ4A 5FD8A 4BQOA 3FUCA 4EP1A 3U7RA 3CS3A 4PLPA 4B73A 1JQDA 1RRPA 4P0TA 2IIBA 3OMWA 4UZEA 2CF6A 1Z74A 4WLNA 3TLGB 3VYSB 3CW8X 5CVEA 4EPVA 1UAAA 4PLGA 4RFSB 2JDIA 3R4VA 4Y3UA 2BBTA 2I3BA 3UJBA 1ZVQA 9ATCA 4RS4A 5EA2A 1SXPA 2VTDA 3CTMA 1CQJA 3IQEA 2I3DA 4JMLA 4UHJA 1Z0JA 3OI7A 4KVFA 3PL1A 3V6MA 2OYRA 3IXLA 4E70A 1ETHA 5KTYA 3KX2A 2EBHX 4CM9D 1DEKA 2FVYA 1KHTA 5FP0A 3P52A 1QTRA 1VSTA 2HDNB 5BWNA 4RYDA 2WD7A 5I3ZA 1PZEA 3JAKB 2RI0A 3LNCA 4LRXA 3MRXA 2Y8EA 5AI9A 4DUPA 2G1AA 2V0NA 3HCAA 2BHNA 5ALPA 3PEYA 3QEKA 3BTUA 5KI6A 4FNOA 5EE9A 3GJZA 4DTCA 1F2VA 2Z5FA 4MR8A 2J4DA 4I6GA 4K6MA 3UK7A 4XD7A 1ILWA 3EEBA 4AZTA 4KODA 1QIDA 3M0EA 2YIJA 4BKUA 3O31A 5IWCA 1W36D 3I6QA 4X85A 1Y1QA 1M76A 1ZXBA 3GA5A 1WPRA 3U49A 3EAQA 5CEJA 4R1QA 4YPOA 3UMYA 3RVBA 4RW0A 1MC1A 4ENQA 2QP3A 3PUKA 4YV7A 2VK2A 2OV2A 4ZZ1A 3NETA 2DTEA 3T99A 5C2JB 2RDMA 3K32A 1XLWA 4PX9A 1KDOA 4V0RA 4ZICA 3B6KA 5I9BA 4EZIA 3KLNA 2DF8A 3DEZA 3RJMA 4U2CA 3VO8A 5BN5A 5I7RA 4N3GA 4MI6A 4EABA 2I0FA 2FDCA 2F62A 4RVUA 1ABFA 1E9CA 1JZQA 1U2DA 1QB7A 2XIQA 3HUDA 5DGTA 1GG2A 1JB9A 3VSCA 4EY6A 2A4KA 1B8UA 2BHLA 2OCKA 5E1BA 4ZK2A 4DDWA 3GEGA 2A9FA 1XJQA 2A1UA 1O95C 2WHRA 3F47A 5EZ6B 4E2FA 4A15A 3OX3A 2I2WA 3TIIA 2Q28A 5KOJA 1J9EA 2EJUA 2YUTA 2C20A 4J03A 1Z62A 1WJGA 1TM3E 1ISHA 2FWMX 3OT5A 3WS7A 1QE3A 1WG8A 2XMCA 3LAWA 5EJIA 3DE0X 3TX6A 1PCXA 1EGAA 4P0QB 3Q1KA 3WB2A 4I4LA 2IHUA 1RSZA 4O4LA 3SZUA 3W8DA 4TTVA 1X1EA 2QSYA 1XMQB 4CIYA 1GLNA 4GRAA 4Y6LA 4JV5B 4GEKA 4NK5A 4AUMA 5JWHA 1UKCA 1VJRA 5ALNA 4B2YA 3EWIA 3I2IA 5EXPA 5I4BA 1MIOA 4OJTA 3SY8A 5ANRB 2PSHA 5DHQA 4A92A 1T5BA 3DVLA 3PCXA 4NH0A 2FY8A 3QPAA 5DTEA 2BKLA 1H9CA 4YHHB 5B3AA 3CEHA 1ZU4A 4Q4HB 1XEAA 4RQUA 3P97A 2AMFA 4R5MA 2BI8A 4PFQA 3K1YA 4TT8A 1B0PA 1IRXA 3ULKA 2F1OA 1CSEE 1EQAA 3EIQA 1GQYA 3RLFA 4AJPA 5JCOA 2YINC 3WMEA 3UIEA 3V3KA 4MW5A 2B2CA 4UEJA 3EA5A 4R0MA 3H97A 4ZT5A 4Q1DA 2VF7A 5HJ5A 2VHQA 5F2EA 1M74A 1W1IA 4Q66C 2D8AA 3CGWA 1M2HA 4RMHA 4ML3A 2GKOA 1UMCA 1NNUA 4U7GA 1YO6A 4K9PA 1JHQA 4LMPA 1BH2A 2GF0A 2ODNA 1Z39A 1GPUA 3NNNA 5KTTA 4KWCA 5FPPA 3LUAA 1R8XA 1MOPA 5H9VA 3RHTA 1KC1A 4DYDA 4BXOA 4AJ9A 4IGAA 1F3OA 4U02A 1KYXA 4ZMRA 4D4HA 1YI8A 4X6YA 2VHVA 4J07A 3TLBA 2DECA 4ED9A 1G0OA 4ENUA 4M6WB 2FPGA 4ARAA 1OHHA 3V1MA 1SD5A 4HQLA 4HYQA 4ES6A 2PLFA 2VWGA 3OE7A 4FD3A 2XB6A 1N2HA 3SM3A 4BVFA 4AQYB 2AC4A 3RVMA 2HL6A 2QI9C 1L5QA 4G0OA 4RSHA 5DV9A 2MINA 1S9HA 3TAHA 3OQIB 4RNDB 4A1FA 5A9RA 4MWOA 3H5TA 3GA0A 1Y4SA 4AROA 4ZEXA 2VRBA 1TF5A 3K9CA 2A5LA 1F6BA 3TVYA 1AHPA 5CYOA 3WGHA 3WQSB 3LVFO 4M88A 1FEZA 2QN1A 4MKRA 1YB4A 3ZNOA 1ZIOA 3IOMA 4IHJA 1H2HA 4DMLA 2K2WA 3WGVA 2IYVA 2JVKA 4QNNA 1AO0A 2GETA 3OX1A 3KPYA 1AK2A 1FU4A 2ZYWX 3LT1A 3ZU2A 4LBVA 1XZAA 3TEJA 1GCIA 3PQ8A 3UT0A 2OXFA 3LF2A 1GAJA 1OXBB 3DTVB 3MT7A 2SCUB 5GJCA 1PWXA 2QZ4A 4OYHA 3U56A 3B1KA 1P45A 4X65B 4I2NA 4RHXA 4BRUA 4NZZA 5JNUA 4WHMA 1WZIA 2Q4TA 4OHCA 5HTKA 4AJEA 5B3JC 1SUDA 2IUFA 1E6CA 2JGKA 4M53A 2OG2A 4OJQA 3C41J 2Q6IA 1TUBB 2YNMC 3A4MA 3RM3A 2RG7A 2O7VA 2Z8YA 3GFQA 1Q1BA 1W49A 1DC7A 3HWX1 4TXNA 4DE5A 1G41A 3F90A 4Q1AA 5I4CA 1HLGA 4DABA 4E12A 2X4DA 3GUYA 1S1CA 3MMPA 2OVFA 4MUGA 4WADA 2D4HA 5MF6A 4TKLA 2DT8A 3TDNA 2WUDA 3QVVA 4K9SA 4AULA 4G4SO 1PR9A 1UF9A 1ACJA 1XYGA 3FHOA 3KYCB 1QFXA 2D00A 1KDTA 2VJMA 3OCYA 1FFWA 1N6LA 3GNQA 3GO4A 3ZV5A 5L4SA 2P68A 3U3MA 1OOEA 5KJ1A 5F7ZA 5TQ2A 1EKXA 4CLOB 1HTTA 1A4IA 2PZKA 3ZK9A 3CLRC 4LRTB 1C8KA 3ETGA 4IIVA 4V24A 2J9YB 1D2GA 2H1CA 3IDFA 1U80A 2ZJ8A 4QBTA 5CRIA 3QKRA 3O4RA 3PDWA 4UOEA 5A4FS 1TZKA 4EB8A 4R1TA 4YJKA 3CLTD 4NCAA 4CU5A 2FR1A 2OV8A 1KO1A 3D6UA 3P0FA 4LNHA 1ZGHA 2H6EA 1K86A 5E4FA 2Q9BA 3HKDA 4B3TB 5B1EA 2HSEA 4B33A 3TSOA 4F2GA 4OGGA 1E5QA 2DUNA 3W78A 3TZHA 3WAKA 2ZAIA 3WLHA 4LYFA 2MSCB 3RR2A 1ICIA 1GITA 1LTKA 4BS9A 3RBAA 1ZINA 2YMLA 4P7FA 5JSZA 2VNKA 4XQ9A 3N2KA 1NTRA 4FC7A 5FXMA 3AZPA 3A9VA 3PPWA 3RVLA 3ETEA 1G7TA 3OPYB 1G1AA 3N8DA 3QJGA 3BYZA 2W9XA 3RK4A 2DKNA 3TW8A 2WSYB 3THYB 1D1PA 3LVBA 1RYBA 2GAIA 1FXUA 1HDOA 3FUVA 3MAGA 4RAQA 2AXPA 1JNXX 4GOJA 1M34A 2XXAB 3NVKI 2VDVE 1EWVA 1M8KA 4EW2A 4BQFA 1ADJA 2GK3A 1G3UA 3GOQA 2IZZA 1L8QA 5A3SA 4LYYA 1CKEA 3NIWA 5B55A 1EPUA 1JIIA 5ICMA 1R15A 2OOSA 1N5JA 3I73A 5IM4A 1XEFA 2D5LA 5C3UA 1T3TA 1YI1A 5CB4F 1BMFD 4MS4A 1KSHA 3SEAA 1V9LA 3URMA 4D4KA 3K0CA 4F4FA 1A7KA 1OT3A 1W29A 2X77A 2MINB 2AG8A 4WLOA 3RRBA 1H3FA 3HP4A 3EQ2A 3QHAA 1IB0A 3IJPA 4PNPA 5IEBA 5FOQA 3EPJA 4Z0TA 3VPGA 3ABSB 3S55A 3GK3A 2NSDA 1U3VA 1ZG3A 2AEFA 5K8VA 5K9ZA 4BV8A 4MUIA 4QFBA 4IOMA 1PU2A 3OUZA 2R6JA 1I2AA 2QAIA 3L06A 4MRVA 1WVMA 4B3SB 3IP8A 1W48A 3WQHA 1ZS9A 1T1JA 4DJTA 5BT8A 2V59A 3MJRA 5C4MA 2CE2X 1U6JA 2UUPA 3G9QA 2MTBA 3SFTA 2XCIA 4BL5A 4DQKA 5CG2A 1BRTA 2QWXA 2QRHA 2Z3WA 1UMKA 4AY2A 3BB1A 3B8EA 4ZQBA 3FFBA 1XJ5A 4I5DA 4NMHA 1SOMA 4Y1GA 1LPMA 1O58A 4M0FA 4Y0VA 3ORHA 1U3DA 5BOSA 4M7WA 4E2WA 4MV1A 1O87A 2SKEA 3FRJA 4IILA 4OHXA 3T0FA 3EVBA 3Q7EA 2CJWB 2F1KA 3WKCA 2H0AA 3NP9A 2C4VA 2G9QA 4YRJA 2GT1A 1X80B 3QVWA 4PHCA 3QG5A 1N2IA 5DYGA 4ZCSA 1WE2A 2PDAA 2CLLB 3K6KA 3DPUA 4ZGBA 4KNWA 2Y77A 1VL6A 3DULA 2DUUA 1LI7A 3D8BA 3FOWA 4FJ2A 3X1KA 4DG5A 1NKSA 5IF9A 5HM6A 2EYQA 4TMVA 4NBNA 5DN9A 5TGTA 3TNFA 4KLRA 1NGSA 3C5VA 4KQ1A 2WJGA 2ID7A 4DAOA 4HZUA 2ETXA 4RD0A 3NEAA 1HWYA 5EP1A 4GLOA 1JXQA 3W1EA 4EAQA 4G1VA 1WCXA 3BXOA 1WB9A 4TMXA 4WLEA 1JFTA 1OZHA 3HFJA 1JR3E 3FYUA 4HQRA 3WMWA 3WTBA 1L8XA 3ZDEA 4ZOAA 4W5RA 1DXYA 2E5FA 3CA8A 1NJ5A 3ZY5A 1ZVMA 4LMAA 4NQRA 2OHIA 3X1WA 5GONA 3IP7A 2J9FA 1RI4A 3IVGA 1XJWA 3WP1B 5LA6B 2B9EA 3FLMA 2XOXA 2JFGA 4RIEA 5AIAA 3WHKA 2PV0A 2H06A 3R5KA 3MS4A 2AFVA 3I8XA 5F51A 4ZVNA 2QLLA 4YT4A 3FCAA 1QJ4A 1ZHOA 3CX3A 2O4UX 1CZHA 1E58A 1U11A 3OFKA 2V8BA 3HXPA 2HMWA 2JGDB 2Z04A 1A97A 5EXEA 3T95A 4UFNA 1ID1A 8LDHA 1PQUA 5FWYA 3TW8B 4OREX 3INTA 2AQHA 3LBHA 3TTTA 3GG9A 2I91A 3U09A 3HDHA 4GO1A 5CH3A 2I71A 4YHBA 4ID9A 2BBWA 3JZAA 2ZI5A 1SUAA 1ZUNB 5K3FA 2YWHA 4WKPA 4FDUA 1QQ5A 1ESCA 3B20A 3KR2A 1CRQA 3IR7A 3DE6X 1J9GA 3STWA 3EPLA 2RC5A 2A9PA 4CEIA 2A7XA 4GNRA 3AHHA 4Z0NA 1GU0A 4GMXA 4IDBA 1G8FA 3WK6A 1NQWA 1YRLA 3CM0A 1A7AA 5GWXA 3UHPA 2W43A 3EIWA 3IE2A 4JBGA 4MVJA 1F1JA 3BH6A 1CQIB 3I1YA 4O63O 3UC9A 1UK7A 1MOQA 1E62A 1WHSA 3OU7A 3QLEA 4BVAA 3IUPA 1B15A 2O5EA 4C1BA 5LYJF 3B3FA 1SBCA 3KVNA 4JUDX 4DANA 3GLIA 2O2EA 1JR3D 3LIPA 2PL1A 5ALFA 3VV2A 1FDUA 4TKUA 3GGPA 2C2ZA 2PUEA 4H7EA 1KARA 1S8FA 1KAOA 4NONA 2JFNA 3OKCA 1G60A 4ZDIA 5BSUA 1LDYA 3HB7A 1EJBA 2ZRNA 5F1KA 4Q03A 2JRCA 3HL4A 5AO9A 4FI3F 3UMRA 3VR5D 3TL6A 3HXTA 2COEA 3BMOB 3QVSA 4N82A 2OFPA 3DKIA 3EZ6A 3IMFA 2ZRMA 4UEOA 4V0QA 3F5QA 4I3GA 1FFSA 4JODA 2IVZA 3I12A 5EHZA 1F12A 1E77A 2OOKA 3HUTA 4ND6A 1P91A 4RETA 2DTDA 1O0SA 3DEAA 5AQ1A 4HZIA 5FUYA 2QMQA 1JTFA 2WZQA 3GP5A 3K0FA 1S9DA 1TGVA 2RH5A 1IWPB 5DEOA 1TKAA 3ZDQA 4RDIA 2XF8A 1H6CA 2O3TA 4K0KB 3G3EA 3ZPXA 5D5HA 2JJMA 2DUJA 2COUA 3MXOA 2HK7A 4R3UC 3OF3A 1O94C 2B20A 5C5IA 3DZ8A <