4XVUA

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
301
Chain Sequence
b'TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSLADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 103
structure length 301
sequence length 349
chains with identical sequence B, G, H
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xvuA00
4BUJA 4RCYA 2CL0X 2X1VA 1X3SA 1G8FA 2JLUA 2CLDX 3RRZA 1XPUA 5E7JA 2C04A 1YVDA 2Y8EA 3M1IA 1II0A 3REFA 3RS0A 1FQKA 3R9IA 4DLXA 4Q9HA 3QKSB 2DFLA 2V55B 4MYHA 1JBKA 1G5PA 3S1AB 3W90A 3G82C 4JLBA 2PBRA 4PPQA 2OXCA 2QPAA 3NHBA 5CJ2A 1U0JA 4UNQA 2XEXA 4W7SA 4M9XA 5JSZA 2EYQA 4PPGA 3SEAA 3DPUA 4PR0A 1FP6A 2J0UA 1MABA 1S9DA 2GF0A 3UWOA 1OSNA 1QHSA 2ZR0A 4UXJA 2EQBA 3KJIA 1ZUIA 3ZZ0A 2P67A 3GEIA 2GXUA 4F93B 1EFRD 3L43A 2GRJA 4LSGA 1WE2A 4HLCA 5CDFE 3U3OA 2CHGA 4QNMA 4RD3A 1ZCBA 1IHUA 3EWAA 3BH6A 3SYNA 2DB3A 2XZLA 1OV4A 3R9XA 2YC4C 3AVOA 4O2LA 3ADDA 4AKHA 2CE7A 2NO6A 4Q1FA 1QBKC 1KDRA 4O0MA 1E9RA 4GT1A 5DE3A 4ZKEA 5JCZA 1DE0A 4K46A 3RSLA 3RC3A 2GZAA 2I4IA 4Q4JA 4DLSA 1YR9A 2IYYA 3WRXC 2VP0A 4XD7A 5DI9A 2FPMA 4Q4AB 4P3YA 4MDEA 4GP6A 1XTJA 5IK2D 2I1QA 2ZJ5A 3AUYA 3QSYA 3V4FA 3K53A 1AS2A 1BOFA 1G6HA 2V6JA 4O3MA 1OIVA 1VIAA 2ZAOA 1OIWA 1TTTA 3KKNA 3KXLA 2P5TB 5FI0B 4JT4A 1WA5A 2RAPA 2ZRAA 1XMVA 1ZRHA 2K5UA 3HPRA 5B2ZA 3K09A 4B74A 2IXGA 2A5GA 2GILA 2VP2A 1E2EA 5CDFA 5DH9A 1U8AA 2IHYA 3IQWA 2GEDA 4OHYA 5L3QA 5JWHA 2UZ3A 1KI8A 3TBKA 1Z06A 3E1SA 5FL7A 3FMFA 2IYQA 2A5DA 2W0SA 4FMBB 1LTQA 2JGNA 2OE2A 1MO3A 4GI7A 4AURA 1S3SA 4V0LA 4OQXA 4M1MA 2ZSAA 1E9AA 1OE0A 4G5QA 4DT1A 2OZEA 1E4YA 3THWB 4NYJR 4G01B 3EG5A 2JAQA 3OZXA 4QHSA 1RVDA 3PEUA 4NE2A 1D2MA 1P2TA 2WJGA 1E1QA 2ZITA 3UG7A 4AKIA 1FPMA 5G53C 5DLQC 5B30A 5FUWA 4F7WA 2ZRIA 3B1WA 4URVR 4GBMA 4DBLC 2ZS8A 1G5TA 1LS1A 1I4TD 1II8B 1ZMXA 2OT3B 4Q5IA 4TMVA 4IOKA 2XTMA 3MD0A 5AJYA 2QPTA 5JHGB 2EVWX 3FWYA 3V4RA 4Q47A 1ZIOA 4O25A 1G291 1VCNA 4TL6A 2BBSA 3M4YA 2F6RA 4QBIA 4P4SA 3N5CA 4PHFA 4NCIA 2E1RA 2C77A 4KSBA 3TUIC 4RD1A 1QF9A 4DLRA 1GSIA 1N6LA 2WAYA 4JLMA 3U7EB 2F1IA 2ZRKA 1NNEA 1W7AA 4ZKDA 2F7SA 2R44A 1GKYA 2AKAB 4QBHA 5CM8B 1DAMA 1AIPA 4LBWA 4DLVA 3TIFA 3AGPA 1EXMA 2FWRA 5FOVA 2XJ4A 2RGBA 2VHTA 621PA 1DBSA 2GA8A 2VHUA 1QHXA 1VYUA 4A92A 2GXSA 2ZJBA 5K8LA 4DIDA 1KTVA 1IY1A 1XMJA 3CRQA 1E2NA 4KCGA 5EE0A 4XTRA 1OT3A 3BS4A 4KVAA 2R2AA 4K81B 5GVSA 1KHTA 3TGPA 3UMFA 2O8DB 4DB2A 3PUZA 3QVVA 4QC2A 4B3FX 4FCWA 1U9IC 1FMJA 2GHIA 1PUJA 3JZMA 3TSWA 4BE7B 1KI7A 4Q9IA 3LDAA 4CDGA 1JPJA 2ZREA 4ESHA 1E0JA 3X2SA 1DAKA 1TF7A 2VSOA 1U8ZA 3EW9A 2B6HA 1GVNB 2CCKA 4FW9A 1CJTC 2VSFA 2BDTA 5KNBA 1U0HC 1Q22A 3UXMA 1NVVR 2J41A 4UQOA 1D2NA 1P2UA 4FMCF 3TUJC 3P32A 1QHHA 2B21A 5JBQA 4JSTA 1KSJA 2R9VA 3ZVLA 2R6FA 2BMJA 3H4MA 2A2ZA 1N6NA 2W00A 3O47A 2HEIA 3LRPA 2XTZA 5L3SB 4GZLA 2G77B 3OE7A 1NI3A 3QG5A 4JSYA 2OEPA 4LGMA 4U00A 2XOKA 3RYTC 4BZXA 3WHKA 2XXAB 1YZNA 1CXZA 5AK0A 2E87A 1XWIA 1GOTA 2IXEA 3KZ1E 3RRNA 2OILA 5C1BA 1QHIA 4JLOA 3FKSA 2RHMA 4PO1A 1UEJA 4Q03A 5BYJA 3QI2A 3QBTA 5IT5A 1X1RA 4Q02A 5C46F 4OHZA 4KHZA 4CEIA 3A37A 5DO9A 3NTUA 4U02A 5TB5A 5EP1A 1TL7C 4OYHA 1TX4B 5DSZA 3T06B 3FDIA 1M7GA 1Z0FA 1BMFA 4PC1A 2ZYWX 1HQYE 4C0QC 4ZCIA 1L4YA 1E2MA 4A15A 4CEHA 3IBGA 2WWYA 4XJXA 3EC1A 4C0LA 1WB9A 3VFDA 2C03A 3C5CA 4TLDA 1G3MA 3I72A 4Q4HA 1SKYE 1Z29A 4J0QA 1B23P 3PITA 4DLYA 2PJZA 4V0NA 4JBXA 4V02A 4Q7JB 3L2OB 4KLNA 1UM8A 1HV8A 3DZDA 3C15C 3UK6A 3VR4A 3ZQ6A 1CU1A 2G1JA 3AP3A 3OEHD 4FINA 1G8PA 2G3YA 3IGFA 3K9LA 1SULA 1DAEA 2FZLA 4RKEA 1I2MA 1M8PA 4DUGD 1G17A 2YZ2A 4CEJB 1VHLA 2VH5R 4CZ2A 2P6UA 1Z63A 2V7QA 2O8FA 3H2YA 1Z28A 4D4MA 5F9FA 1W44A 2QI9C 4RKFA 3ADCA 3X1XA 3K09C 4L4UA 5KTYA 4TYWA 1I4DD 1GNRA 2PX3A 3MWYW 1ZC4A 4KFTA 3NVAA 5AUNB 4NCKA 3VHXA 1T3SA 4LI0A 4EQ6B 1XTQA 2GZDA 2BCGY 2OHFA 1SXJD 2P0EA 2IC5A 2NO9A 4BQSA 2ZYTX 2A7QA 8OHMA 4PC3A 3CRW1 3D8BA 4M8NE 4XWOA 4EPVA 1ZM4A 2Z4SA 1QHYA 1MKYA 1J99A 2HYDA 1TU4A 4TTRA 4WBSA 1XF9A 1P9NA 4QGFA 1P9WA 2DWQA 4GOXA 4DDUA 3A36A 3GLIE 4IRUB 3I1FA 4HB2A 3W3ZB 2NO7A 3VU9B 4E09A 2J59A 4LPSA 2FDCA 5FBWB 4RZXA 4V0OA 1WRBA 1QHNA 1F5NA 5JFGA 4WA7A 821PA 4MGKR 3BORA 5JWRA 1TQ6A 3QF4A 4KBFA 2AR7A 2P3SA 5EZ5A 4TWZA 1WCV1 4OJKA 3VR6A 2JLYA 2X2FA 3LFUA 4Q00A 3AEZA 1N5IA 4HDCA 4M1SA 3KJGA 3GP8A 4XOIA 1AZSC 2REBA 3B60A 5IF9A 3BB4A 3KTAB 3W6PA 2QRZA 4TZ0A 2VPPA 4TL7A 5JHHB 1XJQA 2IUUA 2C99A 1V43A 4U7DA 4DJTA 1H65A 1R8QA 4WZ6A 1G20E 5FUXA 3A58B 1OH5A 3QKRB 2RH5A 2R65A 4IOJA 3CNLA 3K0SA 4C9BA 5EXSA 3TE6A 1F2TB 2BJVA 1AS3A 3GLIA 2JJ2A 4C3ZA 1ANKA 2LCFA 1J2JA 3ZZUA 2VP9A 3A1WA 2YWEA 4FD2A 4C2UA 2QE7D 3UANA 1R5NA 2AFHE 1W0JA 3IHLA 1P7CA 3SOPA 1IN4A 3A8TA 2GK6A 1CIPA 3NDBB 4E03A 1T8TA 2PLRA 2X19A 2ZVQX 3QXSA 5HZHA 2HYIC 2QMEA 3F5FA 3PEVA 2H8KA 1NG9A 1F2UA 1GL9B 3THOA 3HPQA 1D8TA 1KK0A 3MFYA 1XTIA 4OI1A 3T61A 4ACBA 2OCBA 2ZS7A 1BS1A 4Z8XA 1KK3A 5BQ5A 2ODWA 3QKSA 5H1YA 2WWGA 1BYUA 3S1AA 4KO8A 1RFLA 3K0FB 2QG6A 3A4MA 3AB3A 3ETLA 1SVKA 1KI4A 4W5JA 4A2WA 1XNJA 3QPVA 2ZRLA 3DMDA 2ZUDA 3CPJB 3NWJA 4BECA 1Z6TA 1IQPA 2QU8A 2OCAA 1QG2A 4V0MA 5TDHA 2FF7A 3OEEA 1KJWA 3AV0B 4BEBA 2C98A 1E0KA 5E7MA 3BFKA 2WJHA 1S96A 4L5BA 4LV5B 4PX9A 5JS8A 1FTSA 1ZM2A 3AVWA 3W5IA 3L8YA 4N3NA 1G1MA 2RKOA 1QVAA 2ONJA 1LFDB 4DLUA 2BJWA 3MGCA 3SNHA 3SYKA 3QQ5A 5JZVA 1A2BA 1CR1A 2QBYB 4I99A 4ZDJA 2W6JA 5JRZA 3R9WA 3IEVA 1CJMA 3KX2A 1DELA 2QM8A 1HURA 2V1XA 3JZAA 1TEVA 3CONA 5EP2A 2MSEB 4HB3A 1OF1A 2AL7A 2AFIE 1EX6A 3X1WA 4IVRA 4KFSA 1DO0A 1P6XA 1W0KA 3HU1A 4PTLA 3MJRA 2QQEA 2YOFA 4MYTA 2CL7X 1OXVA 3OESA 1GIAA 4LBYA 1X8KA 3WP1B 1ESNA 1GDDA 2MMGA 3TW8B 3F3YA 4KYIB 2AK2A 1Z0DA 1TNDA 4ARZA 1Q0UA 2H7VA 3B9PA 1UBCA 1E94E 2H1LA 2QAGB 2V6IA 2QROA 3GJ0A 2PX0A 2WWHA 2XJ9A 2ZJ2A 2NIPA 3BD9A 5HCIA 1W1WA 4XD7D 2VLIA 1BYIA 5TVKA 3ZVNA 2V54A 5TV2A 1LNZA 3U7GA 2BIFA 1YRAA 3W8RA 1H8ED 2KBFA 4MUBA 5CM9C 5A5GA 1YR8A 4ZDIA 1XDBA 3B5JA 3PEYA 2PL3A 1ZP6A 5J4KA 3AH8A 2IYVA 2FJUA 4TLCA 2JDIA 4DZZA 1UEIA 1VYTA 2ZI3A 1N3BA 4HLDA 1BIFA 1YU9A 2OFXA 4MYUA 1GRQA 1UF9A 2XSZA 1RRCA 3WMEA 4KODA 1H8HA 1W2GA 4BFZA 2CVHA 2PEZA 2ZEJA 4IFBA 4FMCB 1II8A 5FL7D 3Q85A 4WZAE 2B8WA 3VKGA 1R7RA 3SI7A 1F3OA 1NMZA 2VA8A 2AXPA 3PUWA 4M4SA 3OAAD 2R6CA 5J5CA 5AUPB 2YKGA 4TMKA 4Y0VA 2CLCX 2YNMA 2WSSA 4LY6A 4PC2A 4ZI2A 3AP2A 1WQ1R 1AGPA 3GEHA 3B82A 1W36C 4TYNA 2GVZC 5AJZA 2JCSA 1R0YA 4ERNA 2YWGA 4NZYA 3EASA 5E3HA 1QG4A 1E1QD 2N46A 1DG1G 2AWNA 2JLRA 3ADKA 4QOSA 1VECA 1T3LA 2QN6A 5GJVC 3PG5A 1VKJA 3KXKA 1TAGA 3FPAA 1N5LA 2QMUA 3QIAA 2IXFA 2REOA 3Q5DA 4PAMA 4OK6A 5F9HA 4V03A 1HTWA 1VG9B 5G40A 1W48A 1IONA 1XEXA 1TQ2A 2GK7A 2VHJA 3I32A 3OIVA 4Q4LA 5IDVA 2E9SA 4R71A 2FOLA 1NBME 3FE2A 2O8BB 4BLQA 5JRJA 4B33A 2GJ8A 2IYZA 5JEDA 1G18A 2XNDA 1N6PA 3EZ6A 3X1DA 5F2EA 3WNBA 3N2EA 4OQNA 1U81A 3K70C 2O8DA 4B3GA 2XZPA 2RGAA 2J5XA 2W6IA 2JIZA 3AVTA 2DWOA 3J81k 2Z5FA 1S0UA 1W49A 2Q9CA 1OFIA 2JLQA 1KKMA 3CPEA 3CW2A 3EXAA 5HTKA 4E07A 1JI0A 4A6XA 1TU3A 3IPXA 4LBZA 4TN1A 1KI1A 1GITA 1WMSA 4LHVA 1DS6A 2C9OA 1S1MA 5JECA 3VR2A 1XU4A 4K8OA 4M1WA 4WW0A 3GLGB 2BEJA 2ZE8A 2BHRA 3IIKA 1GP2A 5EXXA 5D3MA 4BFWA 3SBDA 4JBWA 3U4QA 4PO9A 2OCPA 5KYKA 4DSTA 4XH9B 1N0WA 1E2JA 4LJ8A 4IKEA 1NBMA 2GAAA 3R8CA 2QP3A 1G8YA 5L3SA 4QM6A 2ZSBA 4KFRA 4CT4B 2PT5A 3U6BA 1WF3A 3A1VA 2WJJA 4TYPA 4DIEA 2XXAA 4PXAA 5JI3E 4Q7MB 3T12A 1RJ9A 1EFHA 1T3HA 4TL9A 4BRUA 4HZUA 4EAQA 3UMSA 3MCAA 4OKSA 2ORVA 3LLMA 3ZD6A 3LVQE 1MRNA 1KAOA 4LYAA 3UWKA 1IY0A 2WPDA 4EPWA 2Q6TA 1U90A 3CR7A 5EE9A 4PZZA 3CRRA 3ZD7A 2QQ0A 4IOMA 5B58C 1E9CA 2HT1A 3AVYA 3OE7D 1TADA 3B2EA 2D74A 4HAZA 4Z1MA 2XOKD 4MGIR 4ZDWA 5CK5A 3AM1A 1CKEA 1E2DA 4IOLA 4KYUA 1JEEA 3SC3A 1AN0A 1LW7A 2VHCA 4B71A 1SVOA 1P60A 1Q21A 2GJ9A 1KO5A 1MOZA 3FKSD 4LZZA 3ONWA 1P2VA 3WXMA 2EU8A 1ZD9A 4QJ3A 1DG3A 3DOFA 4F4CA 3SS8A 4II7A 4KITB 5KSOA 4X8LA 3KDSE 2QENA 4NCHA 3SU8A 1BMFD 3EZFA 1G3RA 3THYB 4LYJA 2W0MA 3ZH9B 4TYQA 3FMPB 2KSQA 4E5UA 5B57C 2NGRA 1PLKA 3TMKA 2ZE5A 2EYUA 1JB1A 1EFCA 4FIDA 4JBYA 4B2PA 1NF3A 1Z0AA 2BM0A 1OB2A 1OHHA 4I1SA 4D4JA 4FWTA 1UKZA 721PA 4JLAA 1L7VC 1Q1ZA 2LKDA 3QXCA 3GQBA 4OI0A 2FX3A 2QSYA 1RYHA 4L15A 2CDNA 1HA3A 2HLDA 4QBFA 1KI3A 5KNCA 5CLQA 2CL6X 3BXZA 2ZS9A 2ZXUA 4Q9LA 1R6BX 4LHZA 2JLWA 2QL6A 2GVDC 5EP3A 4ESVA 1JPNA 2VTKA 3GJ6A 3I8XA 2C5LA 4FMDB 2JEOA 3Q7PA 4JT2A 3BWDD 1FFHA 3VHLB 3VU9A 2QTHA 2ANBA 2ZQ5A 4G3XA 1CEEA 1AQYA 1HT2E 3RS4A 1XTRA 2YV5A 3F0TA 4IVQA 4WAUA 4JLDA 2D62A 4B34A 5BN4A 3MLEA 2FSFA 1M6NA 3AF4A 2QGZA 1S8FA 2KWIA 1I2DA 1Y63A 5FUYA 5GJWC 2CNWA 4BGDA 1NG1A 2ZPTX 1U2RA 3C14C 4GRAA 5JS7A 1RRFA 5HPYB 3ICQB 4PQFA 3TR0A 5A4JA 1OKKD 3Q5EA 1W36D 1XD8A 1G21E 4US0R 2EW1A 1S1CA 1G16A 3W9YA 4MRVA 1JQJC 4M21A 3WYFA 1T9HA 4P32A 4YONB 1ELOA 2ORWA 2FU5C 2RHDA 3TQCA 4LJ9A 4RZ2A 5KO2A 1UPTA 3R7WB 3WHLA 4LX0A 4Q1EA 4DSNA 1ZM3A 2PEYA 3CNNA 4ZIRB 1JR3E 5DNYB 1N6IA 3DMNA 4I1UA 4BLOA 4A2QA 3PJRA 2BBWA 2BKUA 2QA5A 2BCJQ 1SQ5A 1VG1A 2IYXA 1DOAA 4A2PA 3LW7A 1R5BA 3OF5A 5FTKA 3VKHA 2Z43A 2ZI6A 3L0OA 2HT6A 4HAVA 5HE8A 2GCOA 1K5DA 4OJQA 1UBGA 3TRFA 4BRWA 2F55A 2V9PA 2Z6VA 4Q01A 2V4ZA 2QORA 5FOSA 3K70D 1XB2A 4A0FA 2RGEA 4R2IA 4IVPA 4WVFA 2VEDA 2IT1A 3K0FA 3EIQA 3SR0A 4NDZA 3NC1C 5K8IA 4BFTA 4HEJA 4JLPA 2BWJA 1EWRA 2WKQA 3B13B 2JJ2D 2Q21A 5L3RA 4LJYA 5EZ6B 1R2QA 2ONKA 4OQFA 1EG7A 2VBCA 4G5RA 1AA9A 3ZZTA 5L3VA 2ZRHA 1MT0A 4IDPA 3C8UA 1UDWA 2ZJ8A 3ND8A 4QL3A 4MRPA 1O3YA 1EGAA 2WJIA 3BH0A 3IEUA 4MKFA 5KDLA 4DVGA 3WMFA 3HYTA 2QT1A 2JLSA 3PCRB 2QGNA 1KJYA 1XRJA 1E2IA 4LJ4A 1CTQA 2SHKA 3Q72A 1NKSA 1SXJB 5SZKB 3UMRA 4KJZA 4OK3A 2IYRA 1OH7A 2CHQA 2IUSA 3CX7A 4DHEA 1G41A 4B6FA 1C1YA 3EC2A 4JL8A 1WBDA 4B75A 4LOAA 3CO5A 2FFHA 1E96A 1QRAA 2HJVA 3T1VA 3VMFA 4YXWA 3OEED 2ZR9A 4Q1CA 4ASUA 3HDTA 4HAUA 2CJWB 2AKYA 3SJBA 4C0KA 1YR6A 3LBNA 3FOZA 2ZRFA 1UKVY 4L16A 1HT1E 3AF0A 4MRSA 3TAHA 1NL3A 1WP9A 2GBLA 3EIEA 4PHHA 1DADA 2OBLA 1DEKA 4TQ9A 4LV8B 3RDPA 2ZJOA 3KL4A 5CB8A 1AGRA 4LCBA 4A0GA 1GWNA 2NG1A 3I73A 2QAGA 3JVUA 4C7OB 1DAFA 5FPTA 3FB4A 3DHWC 3IPYA 3RABA 2VP6A 4JKYA 4TTQA 4P33A 1AM4D 4Q18A 4G5GA 5BN5A 4YDHB 3CF6R 2HDNB 4JKIA 5DN6A 3LD9A 3CRVA 2CK3A 4HZIA 3R20A 4B3XA 5C2JB 1P73A 1OXSC 2FFBA 1ZNWA 2PMDA 3QEOA 1LB1B 4M0LA 5E4FA 4KSCA 1GKIA 1OIXA 2VO1A 1B0UA 1W0KD 2ZUBA 1P61B 2ATVA 4URWR 4A8JB 3U7FB 1SZPA 2GNOA 2ZRNA 3PEWA 4PSAA 3K9NA 5FH9A 3PQCA 3X1ZA 4LPKA 5CJPA 1GRNA 1BH2A 4OK5A 1T0HB 2ZE6A 3W3AA 2ZSDA 5FTMA 1Q1BA 3PV0A 4JS0A 3T1OA 3TJZA 5E7IA 3WBKA 4ZCLA 3GJ5A 1NIPA 1JECA 2ERYA 2W2XA 2DFKB 2WZQA 3HU3A 4OBEA 3KUDA 4M2LA 5FBQB 4LBVA 3U3JA 3W34A 3KQLA 4XVUA 1OXXK 1U94A 1S2MA 3FFBA 1FP7A 3C41J 4D2IA 2D2FA 3CF2A 4CRWB 3B6EA 3BIFA 4HLUA 1X1SA 1Q1QA 3B8HA 2IS6A 521PA 4PAOA 3CWQA 4DDWA 3K1JA 2BOVA 5FOTA 2JDID 3NKVA 4H1UA 2J7PA 3U44B 4QBGB 4POAA 1N5JA 2BMEA 4NPHA 5TARA 4NYIQ 3TK1A 3UG6A 3Q3JB 4US2R 1XCGB 3LQQA 4X8HA 1H8HD 1Z08A 1Z2CA 4PAQA 4GOKA 1EFRA 1UADA 1RPZA 1AQUA 3QENA 4TTPA 3GLGE 4M1KA 4XSGA 1E1RA 4F38A 1FQJA 4IHQA 2XTNA 3IHWA 5JMTA 1VG8A 3BE4A 5KSYA 2WBLC 4PZLA 2MSCB 4HI0E 2WSSD 4PC6A 5DI3A 3T34A 1OXTA 3I3SR 1CULC 4ZI3A 1RRPA 1KGDA 2GCNA 4GSYA 3U3RA 2C2HA 4M1OA 3R8FA 2OFWA 2AK3A 2WWIA 3QOFA 4PO8A 5JSZB 1KK2A 1Z47A 1RRGA 5IK2A 3BK7A 2DWPA 1KJZA 3HR8A 1MABB 4YMTA 2X2EA 1E79D 2NPFA 2IEYA 4IFEA 1X6VA 1XEFA 3FKQA 3RVBA 5LPNA 1M2OB 5SZJA 3OIUA 2FEOA 3OFND 1EFTA 2EFDB 2F43A 5J4YA 4GMXA 4LHYA 4D25A 2ZSFA 4TL8A 4XIGS 1XPRA 1TMKA 3RANA 2D2EA 4D0NA 3T35A 3QPUA 4LK2A 4RFSB 3RRYA 2GXAA 4B6EA 4AD8A 1XXHB 2BMFA 2GXQA 1R10A 4A4DA 3AKEA 2G88A 2H5EA 1ZINA 4M53A 2XNDD 2EWWA 5M04A 4F4JA 3UPUA 3MMPA 2YVUA 5FPYA 3TKLA 4Q4JB 4QNRA 3KJHA 3O8BA 2FPKA 3DM5A 2KE5A 1AKYA 4TMTA 3AVXA 2C78A 1KO4A 2QMOA 2JIZD 5J4VA 3EIHA 1OFHA 2ZRPA 4DCUA 3WNCA 4PANA 5UKDA 3TR5A 5KDDA 1GRRA 1KNXA 5AUOB 4OQMA 4RCZA 3QF7A 4C0AC 1Z6GA 3UKDA 3CH5A 3LH5A 3GFPA 4P31A 2IS4A 3MG9A 5DGXA 4IXMA 3T1TA 1T0JB 2H16A 2WOOA 4N0DA 3CF0A 3HP1A 4AI6A 4NH0A 4G1UC 1QDEA 1XD2A 2J0VA 4KLZA 3MJHA 1NLZA 3NIBA 2QTFA 4FWIB 1A5TA 3H86A 3GJ4A 5GVRA 2VF8A 3N2IA 2QUZA 5EUQB 4DT1B 3L0PA 4A6PA 2ZANA 1XP8A 2WKRA 2AX4A 3CR8A 1L8QA 1ZD8A 2RGGA 2W83A 2F9LA 1YHNA 2IHBA 2FFAA 2IUTA 3NHAA 4KI0A 4B32A 4C0JA 3SBEA 3ZS8A 2JJ1A 3FHCB 2AD5A 1Z83A 3NH6A 3B85A 2A5FA 4M1YA 3HWSA 2O0HA 3CWZA 4MA4A 5LBIA 2WICA 3RS2A 3KKMA 5AJWA 3K0AB 4UJ5A 2G9NA 3ZGXA 2B7CA 4HB0A 1P75A 1ZNZA 4NU0A 4TT3D 2H92A 4LJ7A 2WPDD 1E0AA 221PA 4FMDF 2ATXA 4EIWA 4GOJA 1Z22A 3K9HA 4JJZA 1G7CA 2GBLC 1FMLA 4DCNA 1SVMA 1OYYA 4WXPA 1YZQA 2X8AA 2A30A 3NG1A 1GUAA 1JAIA 1Y3AA 4P4SB 1GAJA 5FPSA 1KSGA 1E0SA 3BBPA 3W6NA 2QAGC 3ND9A 2FA9A 4NKRA 4UNSA 1LS6A 2ZROA 2YWFA 2A5JA 1ZNYA 2A9KA 4MKGA 1Z8FA 1TUIA 5FUVA 4B47A 3GJ7A 2GF9A 2QNRA 4PPNA 4RD6A 3LBIA 1G8GA 3I61A 3MRSA 4US1R 1DVRA 1D2EA 3IUYA 4Q4AA 5JCPA 3U6KA 3WP0A 3DEFA 3AVQA 5K8UA 2BMDA 2Q3FA 3I92A 1NVXQ 3KB2A 4JVLA 1AZTA 1E2QA 2PMKA 1Q57A 1Z0IA 2UZIR 2VP4A 1E2GA 4A82A 1T6NA 4JL6A 4V0KA 1OHHD 3WNDA 1MV5A 3C4JA 3GJ8A 2O5VA 4DEYA 3RWMB 3N70A 3EPHA 1D6JA 3E2IA 1PLJA 3U60B 4LJ6A 3KQHA 1P4SA 4EPXA 3QXXA 2ZJYA 2HLDD 1JR6A 1KY2A 2J46A 1W4AA 3KXIA 3X1YA 2JLXA 3G0HA 1NY6A 2ZYUX 1G7RA 2DR3A 4IW3B 4DCTA 1GZSA 3EA5A 3REGA 2QY9A 1T4GA 1HH4A 5KDOA 1PV4A 4RY2A 2ZM5A 4HLUC 5SZIA 4UNPA 3ZIAA 3P1JA 3ZVRA 5SZHB 3THWA 2WJVA 4CT5A 3GLFB 1SHZA 2PCLA 3VR3A 1AS0A 1KK1A 4OQLA 3O8DA 1XTSA 2ZYVX 3K0CA 4P0TA 4R2HA 3R7WA 421PA 2FZ4A 4AC9A 4CIDA 2HF9A 2VL7A 5HR5A 1QHHB 4ILEA 2XB4A 4Q7KA 2EWVA 2YHSA 4EKDA 4MRNA 5F3WB 3LX8A 1ZU4A 3QPWA 3RS3A 1N25A 2Z4RA 3AVUA 1RYFA 3QBVA 3K9GA 1T91A 1CRQA 1BO6A 3D6TB 3GJXC 3NH9A 1S4QA 4JJKA 4I4LA 1PJRA 3PR1A 1SXJE 3CM0A 4UKDA 1G5RA 4HDQB 5HKKA 3QUSA 4M9QA 4Q66C 3KUCA 1KO7A 3SQXA 3RRMA 4S35A 4NP6A 4XSHA 2OV2A 1LF5A 4GMDA 1AJEA 1NN5A 4MITA 4TMXA 4X8OA 4F91B 1TF2A 4DUGA 5L8VA 2F1HA 1ZC3A 2IW3A 5EP4A 4M22A 3TLXA 1YKSA 1IXSB 1X8JA 2IYWA 1P3JA 3ZVMA 4GDFA 1TQDA 4JIMA 4B43A 2J87A 1U99A 4CEHB 3CUEF 1RE0A 2OAP1 4QKQA 1CR4A 1ESMA 3SDZA 4UNNA 4Q4HB 1GTVA 1KZ7B 2FSHA 4AKGA 2C9YA 1P5ZB 2GCPA 2J45A 3B78A 2PJRA 1DPFA 2CEAA 2UKDA 3L82B 2ZI5A 1G3QA 2IL1A 5IRCD 4EJSB 1F48A 1G6OA 4Z54A 1CBUA 4EPYA 2PLFA 3CX8A 5AJVB 1OW3B 1ZYUA 2OXRA 4ON9A 1VDZA 1GFIA 2FV8A 1DTSA 1UKYA 2QRNA 3FGNA 3NDPA 4TT3A 1NLYA 2ZRDA 3MAAC 2JATA 1NSFA 2F1RA 2OUKA 5AWFC 1XFAA 1IXRC 2WWXA 3EA0A 4DRZA 5JLJA 3WRYC 2YOGA 2R6DA 5LB4A 2F9MA 4C0BA 5LD2C 4LDJA 4EFLA 4BLPA 1HEIA 2CJWA 3ZDQA 1WBBA 2W2VA 1CR0A 2WMOB 2J7KA 2PT7A 1W4CA 1ZD1A 2G0TA 3C5HA 3KKPA 3AF1A 1OB5A 4MGYR 1AKEA 1WDTA 3WMGA 3DZ8A 3TSOA 5JEEA 3ASYA 4C0SA 3EX7C 4RD4A 1FOEB 1G9XA 2FFQA 1P9RA 2ZU0C 5KUTA 1W36B 5FOWA 3T1QA 2WTUA 4DLTA 2FGJA 3I62A 4HYYA 2IYUA 4LC1A 4XWAA 5HCNA 4URYR 5DYGA 2MSDB 3U3KA 5HZKA 3NXSA 3FFAA 4Q1AA 4NL4H 2QPOA 1ETUA 3CH4B 5EUMA 1II9A 1IN8A 5F98A 4ASUD 2HCBA 4E22A 4TSFA 1JEDA 1E98A 3AUXA 5DHAA 2DCUA 1E2PA 4I1VA 3VNVA 1L2TA 3GFTA 5EQTA 4B73A 3QF4B 1Z5ZA 4A8JA 4BASA 5CLLA 5CIWA 4ZPXA 2CE2X 3I4LA 2VHQA 3BERA 1XEWY 5KSZA 3LLUA 1VIYA 2IS1A 4BFXA 1G3IA 1ZCAA 1Z6AA 2QM7A 3GEEA 5BN3A 4L9WA 1W47A 3ASZA 2RGCA 3KQNA 4B2LA 4OI4A 3RS5A 3THXB 1K8RA 2ODBA 1SKQA 4JLJA 1RZ3A 1HE8B 2A78A 3B1VA 4JYBA 4NYMQ 1KSFX 4CF7A 1FZQA 1NJGA 1NLFA 1RIFA 1Z0KA 3SFZA 3VTKA 4TYYA 4D81A 1Z0JA 2OLKA 3FVQA 2NO0A 1IJEA 2ZRGA 4A0HA 5DN6D 2CK3D 2XGJA 1E99A 4XWKA 4Q9JA 1W2HA 3LXXA 3V9PA 2PH1A 3M0EA 1GILA 1YJ5A 1XCPA 2CXXA 4KXFB 5TMPA 5KHOC 2WWWA 4D26A 3AGQA 4Q21A 1N0UA 1NN1A 2LWIA 3O8CA 3ZJYA 3PXGA 3KB1A 4HAYA 1P72A 4CEJA 2KBEA 3AF3A 3CBQA 1N0VC 1Q1EA 2BEKA 2G1KA 1F2UB 1I4LD 5BYKA 2W58A 5B64A 1XXHE 2FEMA 3L0SA 2AWOA 1CJKC 5DYIA 2B92A 1JAHA 4FCTA 4LYHA 2Q3HA 4KFUA 4QJ5A 5GJCA 2IS2A 1L4UA 1LVGA 4EDHA 5FPHA 4TZ6A 1Q44A 3QKTA 4EQ6A 2FH5B 1A2KC 1NMXA 2R8RA 2HF8A 2NTYC 4Z51A 2P6NA 3GCGA 1FX0B 3HU2A 1KI2A 1MRSA 3FTQA 1G19A 1NY5A 2J7PD 4RVCA 3IILA 1HYQA 3B7GA 1KMQA 1A1VA 4DKXA 3TQFA 1XJCA 4GPTA 4ABYA 4BZPA 4ACAA 4DCSA 2O8EB 2V7QD 3CPHA 4BZQA 3K0CC 1FL9A 1YZUA 2O8CB 1ZNXA 1DARA 3LX5A 2O0JA 1E1RD 4A36A 1IN6A 1U0LA 3CRMA 1V5WA 1YZKA 4RFSA 3I5XA 2AXNA 3H1TA 3DDCA 1XXHA 3LBHA 2HJGA 2GESA 2ZRBA 3EWSA 2WAXA 5EXTA 4GL2A 2RMKA 1W4RA 2IF2A 2ZVPX 4JMPA 3I5YA 3LXRA 2CCJA 1F60A 1HY3A 2ZETA 3BRWD 2CVFA 3SHWA 4D0GA 1XMIA 2CBZA 2WM9B 5J47A 2PZGA 4KBGA 1E6CA 2IYLD 5BXQC 3H0KA 1XEWX 2ASEA 1IOZA 4XVRA 3KTAA 1FNMA 2D7DA 1H8EA 1CP2A 3A1TA 3GPLA 1E69A 3NBXX 3PUVA 4G5OA 2N1BA 2IYTA 4PZYA 3FMOB 4TQAA 5FBRB 3IO5A 4KU4A 4QGGA 3MWJA 3QKRA 5FTJA 2NQ2C 5IHPA 1J8MF 2W2TA 3QXJA 5FR2A 2V1UA 1SVSA 3A1SA 3LAWA 3T15A 1F2TA 4YDSA 3SJCA 4IJMA 4ARZB 4DDVA 1E4VA 2XITA 1SHKA 1HE1C 2DY1A 1TF5A 2XB2A 2ZI4A 4WOPA 1XD9A 2B7BA 4CVNA 4H1VA 1ZBDA 1IJFA 3AKCA 1CR2A 2IYSA 2WIBA 1SXJC 3OAAA 1Z2AA 4HATA 4M9ZA 5CYPA 1CF4A 1EX7A 1G7SA 1IN5A 1GKUB 3KFXA 4B2IA 4QG7A 5CB6A 2ZE7A 2FNAA 3CKLA 1LV7A 3QJYA 3IQXA 1COWA 2OM2A 3LVRE 5DISB 4OHWA 4RJLA 1YZLA 1Q12A 4F92B 4IDQA 4QGHA 4Z8YA 3K0AA 2VSXA 1G7TA 1W5SA 5AUQA 5ELXA 1PVOA 1GNQA 1Z6YA 4HDOB 3RNLA 1W0JD 1ONBA 5JJLA 1KYIA 4KAXA 3ICEA 4D82A 2ZJAA 1OFUX 2I3BA 1KOFA 1JR3A 3CZQA 2XZOA 1Q3TA 1IY2A 4NYJQ 2RGNC 1KO1A 4XTCS 1PZNA 4LYFA 1R0WA 5ANRB 4B3DA 1E9SA 2JJ1D 1ZJ6A 4MDFA 3H84A 4MGZR 3U7HB 5FPKA 3SZRA 3TVDA 5P21A 1EESA 1S9HA 1W4BA 4EPRA 2QBYA 3LWNA 1N6KA 1VHTA 3NBFA 2RGXA 1NN3A 3QE0A 4PQYA 2Q9BA 5TY0A 4D0LB 2RB4A 3GLFE 1DAIA 4HUQB 3HYRA 2EFGA 1NRJB 1UDXA 1KY3A 1G64A 3MSXA 4EFMA 4ZO4A 4A8JC 4QM7A 1Z07A 1NVWQ 1VYVA 4BWYA 3KQUA 1XEXB 1SGWA 4NONA 2DHRA 4C4PA 3C16C 2FE4A 1E9DA 4BLTA 4C2TA 3DL0A 3GD7A 3RHFA 4OHVA 1TQ4A 2YINC 4B44A 4MYCA 4LV6A 1Z6XA 2RGDA 3VKWA 4A0RA 1SVIA 2WVJA 4P4TA 3IIJA 4DC9A 2EFEB 3ZS9A 1X86B 1KMHB 2YWHA 1KKLA 4BLSA 3ADBA 2YJTD 4RD0A 1W46A 3VX3A 2W6JD 3L8ZA 3T5GA 5H8WA 1IAQA 2EFHB 4UXIA 3LO5A 2BC9A 2BVNA 1R0XA 5JJKA 4N0EA 3U3MA 4B48A 3HJNA 5JJIA 1KI6B 3GLFA 4MQBA 1D9ZA 4YMWA 4B76A 5FOUA 1ODFA 2XNSA 2ERXA 6Q21A 1UAAA 4NCNA 5FOXA 4MH0R 5FTNA 2OSBA 2GEVA 4JLKA 2FN4A 3P4XA 5D3MB 3FYHA 5FFMA 3EPLA 2IF0A 2Z0MA 1C9KA 4AG6A 5J4LA 1SVWA 3U4QB 3A1UA 2YYZA 4NYIR 1M74A 1Q3HA 4JL5A 4NTZA 1UBEA 1OPXA 1TEXA 2GWHA 4GP7A 1R4AA 1KI9A 2DYKA 2N42A 3LNCA 2JASA 3SE0A 3O8RA 1RJ9B 1DO2A 4HZUB 2AHOA 1N6RA 3GJ3A 3FHOA 3KJEA 3ZIAD 2G0NA 4BFYA 2HV8A 2C96A 2P65A 2ZU6A 4G5SA 1E9BA 4IEEA 2L0XA 3PUYA 2D06A 1XJ0A 2A3RA 1NIJA 4CW7A 4YMSA 1NVVQ 2GZHA 4M9SA 2CHVA 3ECCA 3GLHB 4HAXA 2WOJA 4R7ZA 2JLVA 4URXR 2FSGA 4DSOA 2GJKA 2AN9A 2V8OA 3P4YA 1VCIA 3BB3A 2XSZD 1US8B 1Z3IX 4Q48A 3AKDA 1JALA 5EJEA 4FI3C 1ZUNB 4Q1DA 4AKEA 2GKSA 4JYCA 2XX3A 1OH6A 3RSOA 4AYWA 2J3EA 5HKKD 2ZI9A 4RZ3A 4D80A 4EJSA 1ZW6A 3U5ZB 4PC7A 3VNUA 4JZKA 4R9UC 2BKEA 1U8YA 2WSMA 4LHXA 2KB0A 1RW4A 2QTVB 1M7BA 4I1OA 4RZUA 5FL3A 4W9MC 2O8BA 3QNUA 3AKYA 2R62A 4BEJA 2OCYC 4QFMA 5EXPA 4LJAA 1J70A 1NP6A 1QVRA 4BFSA 1VTKA 4EFNA 3IO3A 1XZQA 3TH5A 1IXZA 1MO4A 3LA6A 2PZEA 1XZPA 2J0UB 2IX3A 4LUCA 4TLEA 4M1TA 3FHTA 4AG5A 3LW8A 3QG1A 2F3TA 4PPFA 4LHWA 2R6GA 2RCNA 2Z83A 1YRBA 1K5GA 2WMNB 3W8NA 2C95A 3ZQJA 4CYMA 1JJ7A 1HUQA 2D3WA 2X77A 4G0NA 4TQUS 5FI1B 3HR7A 3CX6A 1R8SA 3P20A 4HAWA 1JXMA 1NMYA 2CMKA 2OFOA 4B35A 4QJ4A 2WV9A 3GLGA 3A4NA 1P62B 5EE1A 1OKKA 5CYOA 2G83A 1E9EA 1KZGB 1NKTA 1XTKA 1MH1A 4FN5A 4MKIA 2OBNA 2DBYA 4TLAA 4YMUA 5GJBA 1CJUC 1T5LA 5J4HA 4GZMA 4D6PA 5LDDC 3TUZC 4YLGA 2ZR7A 2W6ID 5E95A 1J90A 1WXQA 1JJVA 2H17A 3FMIA 1IN7A 2CCGA 3U2QA 3SN6A 2G6BA 1UJ2A 2IBMA 2Q3MA 1J7KA 1KNQA 1A7JA 2A5YB 4HLQB 4DLWA 1GNPA 1GL6A 4L8GA 1E2LA 4DEXA 2BBTA 2OLJA 3I8SA 4XVQA 4ZDKA 2QT0A 1LF0A 4JVMA 1D5CA 3TW4A 5L3QB 3SHFA 4LWZA 4MKHA 4DXAA 3P26A 1A4RA 2V3CC 4TLBA 1VMAA 3A6PC 3QXHA 4IDNA 2QZ4A 3THXA 2Q0HA 4W5WA 3WBJA 4HSEA 2MMCA 3KKQA 2TMKA 3WYAA 3RC8A 1XX6A 1KDTA 1NBMD 3D3QA 3VR5A 1XPOA 1ZM7A 4PQRA 5EE5B 2ZSEA 4IXNA 3DOEA 2OBMA 2XAUA 3BGWA 4TSFD 5H70A 1M7HA 2HXYA 2ODEA 1KDPA 2O0KA 1DAGA 5JI2E 2OO7A 4V0ME 2ODNA 4ZCMA 4TMWA 4L9SA 1N6OA 1CJVC 2BBOA 2FGKA 4UXHA 3A4LA 4PHTA 3PFIA 4AYTA 3G5UA 2ZUCA 4RSGA 1XMSA 2WIAA 2JA1A 5AR1A 4EPTA 1LY1A 3TAUA 2ZIAA 3DO6A 3THYA 5KOYA 1SVLA 1UFQA 4B3BA 4AY2A 2GCOB 3PIRA 1F6BA 5JWOA 2BM1A 5CITA 4CGZA 3EZ7A 2LKCA 2F3RA 3AQ4A 2YOHA 4OL0A 4H9GA 5FBLB 4PHGA 4Z1MD 2VF7A 4WIAA 2AD1A 4A9AA 1ZM9A 4DWJA 3WYGA 1NVUQ 2GEUA 2J9RA 2IWRA 1EWQA 4U5XA 1EK0A 3K8YA 4OI2A 4NCJA 2GDJA 2REXB 3P27A 4QHYA 1FX0A 2ZAMA 1KDOA 4JVNA 3SJAA 3VR1A 4IDHA 2BV3A 3Q7QA 4PFSA 2WKPA 2QP4A 3AF2A 3UIEA 4DDTA 5BWMA 1N6HA 1VPLA 5KSPA 4QGAA 1W5TA 2NMVA 5C4GB 4PSKA 3DM9B 2OG2A 2ANCA 3EPJA 1G3UA 4UNRA 4HB4A 3CIOA 4NMMA 5DHFA 2O8EA 2Q9AA 3OHMA 4D4KA 2O8CA 1QZXA 1PUIA 3BJIC 4P4UA 4Q7LA 1ZUHA 1MO5A 2ECKA 3E70C 2OAQ1 4X8MA 2QSZA 3DKVA 1NN0A 4AK9A 5TXGA 2PZFA 2QMHA 1AK2A 2ORIA 3WY9A 3VX4A 1K6MA 1RKBA 2P5SA 3NBYC 3CLVA 3JVVA 3OIYA 2ZI7A 3K0EA 1E3MA 3B9QA 2IEZA 3MWLA 3BAFA 4GFDA 1VG0B 2O52A 1N5KA 4URZR 5C4MA 5FTLA 3RS7A 5BW8A 4KV9A 4A1FA 1CLUA 1E2FA 3PVSA 4BLRA 4C0HA 4AWXA 3SFVA 3UATA 3VAAA 3B1YA 4F4IA 3SQWA 1R0ZA 4OHXA 5GADl 3B1ZA 5G3YA 4PSVA 3KFVA 4W5HA 5CIQA 4HUTA 4EUNA 1E32A 1JQLB 1KAGA 2P6RA 4ZIRA 2GJAA 1OH8A 3EARA 4KVGA 4EJSC 2C9CA 2CNWD 2NZJA 4LC0A 2VYFA 4IDOA 1G4UR 1FUKA 4D4LA 1M1YE 2FSIA 2VIIA 4JLVA 4YC7A 3QVUA 4UJ3A 1D9XA 3OEHA 3T5DA 1OJLA 2HXSA 4QHTA 3RLFA 4AIIA 4CEIB 1GG2A 5G41A 1TPZA 1YQTA 1JXOA 5EE3A 1OLOA 1P2SA 1KIMA 5G3ZA 2ZRCA 1GL7A 3QY0A 1KO8A 1HQCA 3IBYA 2NO1A 2B8TA 2UVQA 121PA 4MRRA 4Q9KA 3RAPR 3GFOA 3BC1A 2D4HA 3PUXA 1M34E 2EFCB 1UBFA 4BPBA 3ZLJA 3ZYCA 3LV8A 3F8TA 1O87A 4ITRC 2D7CA 3NEJA 2ZJZA 2KJQA 4MUAA 2FG5A 1YR7A 1MO6A 3C7KA 5HE9A 1ZVQA 4IEIA 4NBSA 4LRWA 1COWD 1SXJA 1XCMA 3Q8XB 4NHOA 3OIWA 1GM5A 3BH7A 3D31A 1BKDR 3TSZA 5FBVB 4JVSB 1E9FA 1NSTA 1S3GA 3IKJA 1ZU5A 1FNNA 3BB1A 2HUPA 4RD2A 2J0SA 2WHXA 2CLSA 5AJXA 1E79A 3L0IB 3V00A 2O8FB 3BOSA 3OFNA 4YQFA 2F1JA 4N1AA 4HUQA 3TNFA 3DVLA 5A0FA 3TVTA 2I1VB 2JLZA 1ZAKA 1ZIPA 2DFTA 4WXRA 3CNOA 2QEQA 1J8YF 4Q19A 2GAOA 3PENA 5KU1A 1T8UA 1FW6A 2OESA 4S2EA 1R5OA 3Q9LA 4TMZA 1JR3D 4JLNA 2DFNA 1FUUA 1OFTA 1X8LA 2QP9X 4R98A 4B3CA 2VP5A 2FMXA 3AP1A 3EZ9A 5DI3B 1SKYB 1IM2A 3KKOA 2IWHA 2ZRMA 2WWFA 5D3QA 3MWKA 1PLLA 3NEYA 1YZGA 4BFVA 2RGNA 3DKPA 2GTPA 3RWOA 4FXPA 2J0QA 2C8VA 1KMHA 2GETA 3W6OA 2GJSA 1OXUA 4ZV4A 4AYXA 1RC8A 4C7OA 3LY5A 2ZRJA 3CZPA 4WZBE 1E2KA 5CK4A 4NYMR 3VQTA 4Y0AA 1UKEA 5KPJA 1T5IA 1YZTA 4QXAA 2IK8A 3BFVA 2F43B 1QHGA 4GNKA 3KQKA 4RFVA 1KI6A 3EPKA 4YXWD 2NOAA 1KSHA 4DLZA 4I81A 3GLHE 2H18A 3SYLA 1Q20A 2KI5A 2VRWA 3M6AA 3MUFA 1OYWA 4YMVA 3W5JA 5DIFA 2H57A 3EZ2A 2IA5A 2ZTSA 3LQRA 3CB4A 2QE7A 3NBZC 3QEJA 5FR1A 4DSUA 5KPDA 4LJ5A 1IBRA 3AVPA 1CS4C 2J1LA 2QAJA 5C18A 1VCOA 2VQSA 3E5HA 1YE8A 3D7MA 4Q1BA 1G8HA 2HCJB 1N2CE 4URUR 1G4AE 2YC2C 5KNDA 1A82A 1JNYA 2NPIA 3EAQA 1TUEA 1C4OA 3NC0C 2WJYA 1CRPA 4QRHA 3QKUA 4FCVA 2PCJA 3B1XA 3K70B 2NZ8A 2DPXA 2JJ8A 5LB2A 1FTNA 1EFUA 1U9IA 1VCMA 3IDQA 5H68A 5LD2B 4DB4A 1NJFA 1MR3F 4DCVA 3GLIB 1XD2B 2R6AA 3SJZA 3BFXA 3GMTA 1XBTA 4BFUA 3GLHA 4C30A 2P2LA 1U98A 3U61B 1DAHA 4O2RA 3AVVA 3U44A 2FPLA 5K8TA 1E2HA 3IIMA 1US8A 5J40A
chains in the Genus database with same CATH superfamily
3R7BA 4RCYA 3IUBA 2X1VA 2H2IA 2W42A 1QRSA 3FWNA 1ENOA 5BSWA 2PKWA 3JQAB 1XPUA 2AZ4A 2HX1A 1DQRA 1KGSA 5KQGA 1B76A 1UMKA 3D8HA 5I4KA 5JAOA 5LVAA 2OZPA 2VWPA 4AS3A 2NU8B 3REFA 4QARA 4AO8A 1FQKA 4AW9A 3JQBC 4DLXA 1O95C 2C82A 3QKSB 3JTMA 4KO4S 3EJWA 1NMQA 4ZOLA 1A2QA 1L5HB 3TPCA 4R7GA 1ZK3A 1CLEA 3KOMA 4W8GA 3PDIA 1DC6A 5CJ2A 3QMPA 3X1MA 4KX3A 1U0JA 3GJTA 2OHXA 5YASA 5ADUS 3D6NB 4J2TA 4RTRA 1EA5A 1ZK4A 2QN8A 3EFOA 1MG5A 1GFZA 2PKQO 3DEKA 5IJ0A 1L5LA 3I9V1 1AHPA 3SEAA 2GH1A 4PR0A 1FP6A 2FQ1A 2GCGA 2GF0A 3A2LA 3G5TA 4ZVMA 5T4BA 1Y1TA 3ELUA 2EQBA 2SNIE 3D8TA 1ZUIA 3KJIA 4PZEA 2P67A 4HQRA 2Y93A 2P68A 3HVHA 4IDDA 1GR0A 2AFHB 2YW9A 3AOGA 1XDZA 3JQFA 1WE2A 3L43A 5F64A 3U3OA 4B3JA 3BXFA 5C5IA 3G5MA 3CLSD 4RD3A 1YS1X 3RTAA 2CFOA 1VCHA 1HLPA 3BH6A 3KPWA 3BGDA 4LGVA 3SYNA 3WKDA 1B6TA 4RQTA 4JASB 4O2LA 2ZTMA 3UBTA 1ENPA 1YS2X 2R48A 4IMIB 1U2PA 3LWDA 4MV7A 2NO6A 1MJ5A 3NVDA 4Q1FA 5E6UB 2G4VA 5IJZA 1KDRA 2IBTA 1NQ5A 1E9RA 2V7TA 1AHIA 1EZ4A 5DE3A 5JCZA 3HQ4O 2FWIA 4MW5A 3I9KA 2ZWMA 1OLUB 3T6KA 2E85A 5LLTA 1U4SA 2I4IA 1YR9A 3RS9A 4KZPA 4NZPA 1F06A 3ZCQA 2ZJ5A 4J2OA 1GLGA 2VWGA 1AS2A 2ZLBA 1VE1A 1R6UA 4Y9DA 4GLBA 3RSZA 3ZV4A 4ZI7A 3FW1A 5I6DA 4JFAA 4QGSA 5BPFA 1RQ2A 5B2ZA 4O4LA 3NHKA 1XMVA 2BGUA 4LG1A 4UVGA 2O19A 2C59A 3WGQA 2ZB3A 5L6MB 5CFNA 3K09A 2HU2A 3E0XA 1EP1B 2BFWA 2XUOA 3OQ1A 1E2EA 4HDRB 5CDFA 4K9DA 4ZC1A 2IHYA 3KSMA 1PK8A 3WGGA 1Q0ZA 2A57A 4P8RA 4OHYA 5A06A 5L3QA 1YJBA 5G1OA 4ND7A 5EJ2A 5JWHA 1UMDB 1QFSA 3IJEB 4XQCA 3KUUA 3UB3A 1GQSA 1UUFA 4F12A 1CUBA 4KGDA 3NXKA 3VDMA 1C7JA 1XVLA 4GI7A 1LTQA 2OE2A 4B40A 3DGFC 3HV0A 5J58A 1E9AA 4G5QA 1E4YA 4G01B 2BH2A 3FNEA 3OICA 4MX8A 3OZXA 3JQ9A 4QHSA 4C6SA 3EQ7A 3FR7A 2G4CA 2NN3C 1VXOA 1D2MA 4L27A 4MJLA 4Q9DA 5EHGA 2XUHA 3KOYA 3B7PA 1PNVA 3GCZA 3OLQA 3HRKA 2I6SA 4P5DA 2HSJA 5CVVA 3SF8A 4AY5A 1H2HA 1I3LA 2ZITA 4MV3A 1D7AA 3V1KA 4EGQA 1FPMA 2ZXFA 4JI7B 2FSSA 3M1AA 4L08A 3LCRA 5FUWA 2ZRIA 3EZLA 1LLCA 3QYAA 2H06A 2YWBA 4ZK2A 3MINB 3PC2A 2JGFA 3P71T 4TROA 3OLXA 4JP2A 3H0EA 3WWZA 2RHTA 1LVUA 4IOKA 5KTMA 2XMZA 1BVUA 2O2GA 2P1RA 1WW2A 2HRZA 3FWYA 3IVGA 1P18A 4Q47A 4X1KA 5LIPA 4XB6B 1QP0A 2PKCA 1G291 2VBIA 4QAJA 2DPGA 1JLMA 2BBSA 4XZ3A 5E6SB 1F38A 1R4MA 1RXEA 1RDFA 1YQ9A 3GEGA 4QBIA 4TZTA 4P4SA 5LQKA 4UCFA 4NU5A 3QV2A 2WT4A 3L02A 4KSBA 5JANA 1QF9A 1EDZA 3M6VA 1GSIA 1N6LA 3RH0A 3PUKA 4WSOA 2P35A 2E0IA 3HBNA 3VZSA 2CXNA 4KB5A 4MKRA 5KYWA 4O2BF 2O6LA 1MA3A 2R44A 3VZRA 3S1SA 1THTA 3B3QA 2RHCA 2AKAB 4M8KA 2I6QA 2QD3A 4QBHA 1P31A 1OMOA 3BJEA 4IIUA 2Q99A 4XKJA 4X61A 4TM7A 4YJ3B 5E1MA 5EVCA 3EY9A 3WFZA 2W2MA 1YDHA 3O9ZA 5AM2A 1DIAA 621PA 1DBSA 1QO0A 4FOPA 4WZAB 2IH2A 3E18A 1Z6QA 3LC0A 5A04A 3OTWA 4BBJA 1RWOA 3GDGA 1QHXA 1VYUA 4GYKA 3L3BA 3OLWA 4NCXA 5AKXA 1KTVA 3USCS 1LX6A 1U8EA 2YIMA 3TRKA 3PPIA 4PG5A 5CTJA 4KCGA 1BS2A 5EI5A 1SU6A 3DV2A 2DQZA 1EE1A 4A0SA 1C9NA 1GZ5A 1NJ2A 4KVAA 4EKGA 1TEHA 3OQOA 2Y2VA 3VBEA 3SZLA 4PNEA 3TGPA 2P78A 2R1TA 3QVVA 3WGYA 1ONSA 3P2KA 4B3FX 1YB6A 1CQIB 4CLRA 1FYEA 3BXEA 3GROA 4X9XA 5HDQA 4O2BA 2GHIA 3TX6A 5KOJB 1PJZA 4NG4A 5AJTA 4BE7B 1KI7A 2B4YA 4DV7B 3FDZA 3LDAA 1WJGA 1YJCA 2OO5A 4YGXB 3UJHA 3VGJA 4BO1A 4BNGA 3L7OA 3A6ZA 2FETA 4BAGA 3U3XA 1TF7A 1NUSA 2FQWA 1Z0ZA 2BI4A 2WYHA 3B1FA 3P45A 2B6HA 4RDCA 3LXMA 5KJEA 1FDVA 4EL5A 2VSFA 4ZVPA 3GGGA 1X1AA 4OSPA 2WU3A 4KE7A 2Z8YM 1ZI6A 1D2NA 1SIUA 4KMSA 3ZXSA 2RGYA 3P32A 4OHMA 4BKPA 4JSTA 1RKXA 1SQFA 4FOTA 8AT1A 4LYYA 2BMJA 1S5PA 2BF7A 2EJTA 3AEQB 3F9IA 3G7NA 3R23A 1E6MA 2YJ4A 4IMRA 4X60A 1X1CA 2HEIA 3L4EA 2XTZA 3LRPA 3A1NA 4GZLA 4KWEA 4GXQA 5FWXB 1SRQA 4WK0B 1NI3A 3C8DA 5JQWA 2HK9A 1NDHA 3MWEB 3HFJA 3TCXB 3RYTC 1LC3A 3RGGA 2O7QA 1GUBA 4GR9A 3WHKA 3CVUA 2SKCA 2ASVA 2DJIA 2FN7A 2JFPA 3JZFA 2QS9A 1CXZA 3OWOA 1SG6A 2OGSA 3KZ1E 4FGUA 4YS6A 1EGVB 3ZGNA 4CPDA 4XD2A 3WKBA 4JLOA 3AESA 3VYSB 3KSUA 3BL8A 2RHMA 5CG1A 1TECE 1CDOA 4CM7A 2YN4A 3QBTA 2YWDA 2W2KB 3K0KA 2BZGA 2O3RA 2XGMA 3DBLA 4KHZA 4Q02A 1NONA 3SXUA 4CEIA 4HJRA 3RTGA 3PE3A 1SJ9A 5DO9A 2HAEA 4U02A 4ZOQI 1QF6A 7MHTA 5EP1A 1ZVVA 4V3BA 2BTQA 2NZ2A 1M2HA 4XX0B 1P33A 1M7GA 3FDIA 3FI0A 4H2DA 1IHXA 1P74A 1Q95A 3MC1A 3OZUA 3JQFC 4I55B 4YJHB 1HQYE 3ZU2A 4P0QB 3EXG1 4P7KA 1VKOA 4A15A 2ZG6A 3IBGA 2WWYA 1BXRB 2XCSB 1YA8A 1UXKA 3HM9A 5DVZA 3KBOA 2HJRA 2A9VA 1K7SN 2XCTB 1QPZA 1S7CA 2BI8A 3PITA 3PRJA 2PJZA 2BKAA 5ALQA 2ECFA 2OHOA 3T3MB 2CC2A 3EMDA 1Q0TA 1UM8A 4KO2S 3DZDA 3EWNA 4HNRA 2HQ1A 1OVMA 3UTCA 1HYBA 3PKIA 3SYTA 5J2TB 4OXKA 4UUQA 1UM9A 1JKXA 4DMMA 2VSQA 2G3YA 2WFLB 2I33A 4IHKA 2FWNA 1EFPB 2YXBA 3BXOA 2FZLA 3ET4A 2X4IA 4RKEA 2A33A 3T94A 1I2MA 3MFQA 3VPCA 1G17A 3AI3A 2CLIB 3QTLA 1ACLA 1P39A 3IX7A 5IWCA 1GEGA 1VHLA 3P9NA 4XGQA 3R3WA 2V7QA 1Y4SA 2O8FA 1Z28A 4NMLA 3OJOA 5F9FA 1PR3A 2JI4A 3TLGA 3D5EA 2O3SA 3VKFA 2XVZA 4DWVA 3GNTA 4PLVA 3X1XA 4PZ9A 3K09C 3FZEA 2MCFA 5LL6P 3U7QB 5JMWA 4TYWA 2TSYB 1GNRA 4J16C 2FQYA 1ZC4A 1V7ZA 4RESA 3RG8A 5JYEA 2GS9A 3ZTTA 4NXMB 2WU1A 3CW8X 4RTJA 3ILSA 3CT4A 3PX2A 3JWPA 1GPWB 1TQ8A 5DP1A 1T3SA 2QTTA 4EIWA 4CTMA 4MQFB 1XTQA 3PC8A 1AOXA 4MB2A 3TFWA 5JNTA 3GQBB 1Y4DE 3Q3HA 1K8YB 4DR5B 1SXJD 5AKKA 1XDGA 1Y81A 1Q7RA 4BX3A 2NO9A 2ZYTX 2B0JA 2LPMA 1A5ZA 2OM6A 4IF4A 4OBXA 4B0OA 2O57A 3S29A 4CN9A 5AVRA 2ZIXB 5I9SA 4FOSA 1A1VA 3ET5A 3FNRA 3QFSA 5I7AA 4EELA 1TU4A 4TTRA 5J5VA 1XF9A 4G9BA 3SKXA 4QGFA 2BKXA 4OQPA 3C48A 4HLNA 3IR5A 4TSKA 5TGZA 2X42A 3FOCA 3GLIE 1RJFA 2W4MA 4I4CA 4IRUB 3I1FA 4G0OA 4ZO7A 3VU9B 2QRKA 1L5MA 5FFNA 2IV7A 2FDCA 4RZXA 4EUSA 2PXHA 4V0OA 4AU1A 1X9IA 1XAIA 4ZYVA 821PA 1TIKA 1WEHA 3QF4A 2YBEA 5BN4B 3I28A 5B2EA 1VC2A 2AR7A 3VV2A 3I9FA 4G2NA 1EUDB 1ISSA 2JLYA 1WCV1 4OJKA 2CV1A 2X2FA 3IB6A 1A9ZA 3RTDA 4M1SA 2P2NA 3Q9SA 3IUMA 4Q1VA 3VUEA 4D9EA 3CRNA 1QZUA 4QBTA 5IF9A 2PMCA 2Q3BA 2WC1A 5LZ5A 3PGMA 3W6PA 4ZAVA 2DETA 4HQOA 1N5MA 3VZDA 1ZVMA 4TL7A 2FOXA 3TZHA 3CEMA 5JHHB 5CURA 2BFBB 5JAMA 3W2IA 4MR8B 1WWKA 2PRSA 3QJGA 3WL8A 1ZRNA 1G20E 3CEHA 4A27A 4OJNA 1CG6A 2I9PA 2YHBA 3RU3A 3TJRA 2RH5A 3G8DA 1H2FA 3IUQA 1NW5A 5EPEA 4C4AA 3JALB 2C9BA 3LSTA 3O75A 3V33A 3TE6A 1F2TB 3IAAA 1AS3A 1SZDA 3FWZA 1ANKA 2LCFA 2EW2A 2PFGA 2EBHX 2MYTA 1ULUA 2VJYA 2XMQA 3RTBA 3UHAA 4FD2A 3F5MA 3A6DA 3IHLA 3NP7A 1GZ6A 5EJ8A 1AO0A 4LFCB 5A03A 3C7TA 1X0XA 3RO7A 5HZHA 1T8TA 3ND7A 3QXSA 4NBTA 1CUEA 1G5QA 2XQKA 3F5FA 2ZWVA 3IDFA 4O3FA 3UA3A 4F4DA 1YZYA 2CN1A 2XYGA 1NG9A 5SY6A 4MIEA 1CVLA 1D6MA 3S55A 4TTVA 3MFYA 1XTIA 2BSAA 4WECA 4KH1A 5I3CA 2VOEA 1LD3A 5BQ5A 4BU1A 5LR6A 4JYZA 3IAS6 2HL6A 1T6YA 2ZIGA 2WWGA 4LXQA 3QIVA 4O08A 3S1AA 1OOEA 1RFLA 5ALHA 9MHTA 5JXHA 1SVKA 1F4PA 4CMBA 3R3UA 4P7FA 5EJIA 4A2WA 1RKQA 3NYRA 4D9KA 4AX8A 5K6RA 2O2JA 2XE8A 5KJCA 1PGNA 4M0CA 1IAVA 3SMVA 5LJIA 1X7DA 2OO5C 2I6FA 2QU8A 1GPBA 2KLHA 3DA8A 4LE1A 3DNMA 1Z39A 2FF7A 2QZ9A 3OEEA 3Q40A 1KJWA 3CVXA 3AV0B 4RKRA 3EDQA 1UP7A 1FVOA 3EVGA 4BEBA 2Q3LA 3WLKX 3WYDA 5JPCA 5A0TA 5E7MA 4ALIA 3DP9A 2AMVA 3BFKA 5IC4A 5J1SB 1M3SA 3UAXA 4A16A 1K2WA 4KPGA 4IIJB 1ZM2A 4BCDA 1QQBA 3L8YA 1DX9A 1G1MA 2ZKIA 5TC4A 2WSBA 1CYEA 3NT2A 2FUEA 2W2LA 2OO3A 2MDTA 2VDWA 3H2GA 4E5YA 3JY6A 2NSJA 3QQ5A 1W5BA 2C88A 2Q46A 3U0BA 2PUDA 1NI4A 2PUVA 1CR1A 1NXVA 4G0ZA 4ZDJA 4WKPA 3IJ5A 3HSSA 8ADHA 3KX2A 3UXHA 1VJ0A 1P0PA 1MBZA 2QM8A 4GEKA 1JHRA 2QN2A 2DF8A 3O4FA 1PEDA 1GEEA 1O94A 3K6RA 3NT5A 2I2XB 2V1XA 3JZAA 2DPHA 5AJUA 3GUZA 1M83A 3FTNA 1P0CA 4MW9A 4RMNA 2XGSA 3FGZA 4P98A 4CLOA 3HTXA 1RNLA 1JHDA 2QM3A 4Y2JA 3X1WA 2ZJ6A 3RFVA 1L4FA 5BORA 5CFMA 2QY6A 4CKZA 3C3JA 3HU1A 3DL7A 2QQEA 4MYTA 3ZNPA 4LF8B 1OXVA 1GYRA 1QIFA 4Y2YA 2AR0A 4BNLA 1CY4A 1I7QB 1UJ6A 1RAIA 1ESNA 5B1HA 4OX9B 1VXRA 4Z9FA 1WB5A 3GRAA 1V6CA 2HDOA 4DCCA 1KAQA 3BSFA 2XECA 3H16A 1L8AA 1A8UA 3V7WA 1M1UA 4PXYA 2H7VA 1UBCA 4M0FA 3AFMA 1SBYA 2HEGA 3KIPA 4DXHA 1K06A 5F9MA 4HVCA 2QD5A 4X7RA 1SBZA 1W1UA 4L22A 5DTRA 3LF1A 4YYZA 3LWBA 3C4VA 4TX1A 1G0NA 2V54A 5JW6A 5HM8A 3PQ3A 5SYMA 2B25A 3U7GA 4RNDB 2BISA 4GVPA 2VBGA 2RSLA 2R00C 3N1UA 4LZOA 3MSCA 1P9LA 1UDCA 3CLTC 1YR8A 2E4UA 1W88B 1CFJA 4M55A 1L7DA 2FVYA 3KYIB 2PL3A 1ZP6A 3AH8A 2HDHA 1DUIA 3EGIA 4TLCA 3DL4A 5EC8A 2ZI3A 3ND8A 1N3BA 1RRCA 1BIFA 5FBVB 1GRQA 1T43A 2BGMA 2JFQA 3OQIB 3KVNA 3M2PA 1QH8B 2ODPA 4FBMA 3O92A 1ATIA 3UGTA 1Q16A 2ZSJA 3MXOA 1NUPA 3Q85A 2B8WA 1LBQA 3ZLTA 4OP2A 2W70A 2C3YA 3NVMB 3M6MD 3VNQA 2V97A 1NMZA 4DCMA 1BA2A 1XLWA 3Q9UA 3UV3A 1KZ6A 3K0HA 1WAMA 1XLUA 3OAAD 3T99A 1D8AA 2R6CA 4N40A 4ZGBA 2B1JA 3BYZA 1EE2A 1EDBA 3MB8A 5AUPB 2CLCX 5C5DA 3T3OA 2YNMA 4LY6A 4ZI2A 1M1NA 1EVIA 1WQ1R 1AGPA 3LCJA 4OD0A 4DV4B 3DJYA 2GLTA 2O2DA 2QM0A 3IP6A 3OWXA 4O4IA 3QU9A 2GVZC 1ECGA 1R0YA 2TYSB 3LHFA 2YWGA 4FSXA 1GHTA 4FJ1A 1LZLA 1QFZA 4C03A 4ZVKA 1F6WA 4TTTS 3RC9A 4BVKA 3ADKA 1IU9A 5FFFA 2ZCJA 2FTKE 2V96A 1YF3A 3DS8A 2V0GA 2QZSA 3HXLA 4YO8A 4BUZA 4M9CA 4RMHA 2W9XA 1V5IA 4DSAA 1COZA 1N1DA 3QIAA 2REOA 2P9GA 3QUTA 5D01A 4EMBA 1U5CA 5F9HA 1HNXB 2Q5JA 1CF9A 1RAFA 5JASA 1SIWA 1SFRA 2V6GA 3GNQA 3JVDA 3ETEA 2B3TA 4MULA 4Q4LA 6ADHA 1JLKA 1IEVA 1W2WB 4QOGA 3FE2A 3JR7A 3HYSA 1OA1A 2GJ8A 4FBLA 2ZYAA 1G18A 1N6PA 3X1DA 3Q3GE 2X6RA 5CDYA 2JH3A 1BGXT 3PRKE 3A11A 2CNNA 5K0CA 3MT8A 3LDHA 2O8DA 4RZSA 2QIOA 2XZPA 4K2HA 2J5XA 4NBWA 4DMKA 1XP5A 2JBAB 3SX4A 2Z5FA 2FMHA 2MSWA 3FOBA 4S1TA 4Y2PA 3VJMA 5ITZA 1KERA 5DBIA 5JSQA 3GN2A 1W49A 1PU2A 4UM7A 2PZLA 3CPEA 1Q91A 3RUPA 1I7LA 2XI4A 1BU5A 3WL5A 5MFPA 2UVPA 3IPXA 4TN1A 4JBHA 1KI1A 1SCIA 1WMSA 3PFGA 4B4KA 5JXIA 1DS6A 4KNWA 5AI6A 1MC5A 2QMZA 3L9WA 4CQMD 1XU4A 4K8OA 4UARA 2GM5A 1WY7A 2JW5A 1KIFA 3QH4A 4EECA 3GLGB 2H1OA 2O4UX 5D3MA 1UZAA 2GDZA 2O2CA 1WPRA 1YBVA 5KTKA 1Q7CA 4DSTA 1QG6A 1BCRA 4ZQBA 1E2JA 3VI4B 4C21A 1NBMA 2Z8XA 3R8CA 1IDN1 3UYKA 1X7ZB 5LLDA 2W6ZA 1UBMS 2QW0X 2RBKA 4AN4A 5JI3E 4CKBB 2H52A 1EQAA 4TL9A 4HZUA 4S1NA 4EAQA 3UMSA 1JYEA 3U7IA 2X6TA 2B5VA 2DUMA 5EHNA 3QM1A 1NDUA 5EG5A 1NR7A 4PG8A 1RI5A 2IEBA 4RH3A 2OYRA 5LKAA 3FOAA 3N7UA 3S2EA 2YY5A 3PHJA 3UWKA 1GTSA 4W9NA 1V11B 5M34A 1U90A 1ZGBA 3T5TA 1J2TA 5AHRA 1E18A 3EQ6A 3FBTA 3T38A 3CRRA 1D0IA 4Q82A 2XDQA 4Y9SA 1G55A 2IPXA 4JR0A 3HYCA 3OWHA 5IANA 1PEKE 4U8GA 3HDQA 3O1LA 2WZBA 5DU2A 3LC1O 3OE7D 1Y1PA 1M6HA 4Y30A 2DGDA 4HAZA 2XOKD 4AN0A 1E2DA 5HS6A 1UEXC 1JEEA 5IYZB 2AKEA 2OL4A 5BYJA 4B6JA 4BC0A 4BO9A 2VHCA 1SVOA 5JBIA 3M2TA 1MOZA 3FKSD 1UZUA 3WXMA 1G9SA 2EU8A 1ZD9A 4QBKA 4QJ3A 2EATA 2WG2A 3NYQA 1WXWA 4MW0A 3GRVA 3N5KA 1EM6A 3SS8A 2VTVA 3I4CA 2D5IA 4KITB 1C3OA 3A0UA 2W2NA 2OGWA 1L9KA 1Y1QA 2HTFA 2I4RA 3FUTA 2XRZA 3THYB 3OLVA 1B8OA 5JAQA 3ZLVA 1YMQA 3FMPB 3IELA 4LDQA 5CLHA 1F14A 1YDMA 4FI3F 2V3VA 2R79A 2ET6A 2Y0EA 1JDBB 4IIEA 5CT4A 5FWDA 1JQ3A 4FIDA 3DCIA 4Q34A 4CMKA 4EHNA 4B2PA 4OFZA 2XTAA 2BM0A 1OB2A 1OHHA 3TEMA 4I1SA 4GP9A 2NSDA 2B1GA 3MTDA 721PA 1Q1ZA 3M9XA 2BMAA 1MV8A 2W4IA 2YJ3A 2BE7A 5AQEA 5DSTA 5JR3A 4FR2A 3OE1A 1P0FA 2X4LA 4I1RA 1HE4A 3BTUA 1DKLA 4AP6A 2CL6X 3P0HA 1A4UA 4D4HA 2ALJA 2ZS9A 4Y2QA 3H1PA 4Q9LA 4DTIA 4LHZA 2D5AA 2EBFX 2GVDC 2BW0A 2IZ1A 1JPNA 4EYKA 3WLTA 1UINA 2C5LA 2IPLA 4RADA 2CJYA 2M98A 4LOHA 2D1RA 3HVJA 1C2YA 1LRLA 1Z5VA 3Q7PA 1H5NA 1A7AA 3KOOA 2VN8A 3VHLB 1JKFA 5H9WA 3CKMA 2IFTA 4D79A 1GCOA 2JI9A 4Q6WA 1CEEA 1TJPB 1TEZA 1HT2E 3H5RA 1W9MA 3D7KA 4QUBA 2L19A 1SUAA 3K30A 5HYVA 1VGQA 4JI3B 1GZHB 1XZEA 4JJEA 4KR2A 1RMTA 3PFNA 4B34A 4EYQA 2FSFA 3A3OA 4JC0A 3GW8A 5E9QA 3TO5A 4MOWA 1Y7HA 4KN6A 4BGDA 4R4JA 3BTVA 5GAJA 3BSYA 1H22A 3TM4A 4PGGA 5JS7A 1RRFA 2VRNA 4INAA 2XV1A 3TR0A 5AW4A 1WP4A 1OKKD 1R6TA 2OBXA 3Q5EA 4MUNA 4Z4QA 1W36D 2EP5A 2YNMC 3DF7A 1XD8A 4CIVA 4HG2A 4MARA 1W4ZA 3WYEA 3IKLA 1QV9A 3D4NA 3EZNA 3OC6A 1IUKA 3PPWA 1J39A 2UDPA 4L1KA 5FV7A 5K99A 4NCAA 1ELOA 4ZYTA 5F7OA 4YQYA 5C1DA 4ZRDA 4GLOA 3JQGA 2RHDA 3LMKA 3TQCA 5KVCA 1UPTA 2EQAA 1AU9A 3OZCA 4RK1A 4GYJA 2LVBA 3WHLA 3QPCA 4DSNA 1YFZA 3CLUD 4EGCB 1EIZA 2CMHA 2QXTA 3LZ6A 3RVJA 1PEAA 4ML3A 4QWWA 3PSAA 3DMNA 3VR6D 1KJ8A 4A2QA 3PJRA 4FGSA 2NO5A 1PX0A 2RI1A 1VG1A 3GC6A 4NOLA 3VKHA 1UWCA 3FY4A 1EK5A 3U9SA 2ZJ0A 2X9QA 4IO0A 1HBJA 1P4RA 2CV0A 4S3MA 2GCOA 1UBGA 4Z4IA 1LQ2A 3VR5D 1M6YA 3LIIA 1ESZA 2QUAA 3S8YA 2VUTA 3CVJA 3L9XA 4A0FA 1DBQA 4R2IA 3RG2A 1SHLA 3LHDA 3KELA 4IVPA 3ZCRA 3K0FA 1RLOA 3EIQA 4NDZA 1PD1A 4OOFA 1T4MA 2RH9B 1K3TA 3ETDA 4EY7A 2YASA 4EB8A 3TDMA 2XD9A 3E2PA 2WKQA 3B13B 3RBZA 2GASA 4KAJA 4I3HA 3I2GA 2JJ2D 3HSKA 1NYLA 3H5AA 5L3RA 1XMOB 5EZ6B 4B45A 4ARIA 2ONKA 3RPEA 4PZ0A 1J5XA 3SSMA 4BPRA 4MS1A 2VBCA 3P5BA 4EBFA 1KS9A 3VSBA 1MT0A 1WXIA 4MR9B 3LY9A 3SIXA 2QAIA 2NXCA 1EBFA 2WJIA 3IEUA 4PG6A 4W6ZA 1ZJZA 3F3KA 3D8SA 4H16A 2SHKA 1GUZA 5AVWA 3TSAA 3S8EA 4CCYB 3MCVA 1X1BA 1A8PA 2BMVA 2VSNA 3IXQA 1N4DA 1TT7A 4OMDA 2IYRA 4WLFA 4F71A 3ZI7A 4X6LA 3T9DA 1OH7A 3EXFA 3ABOB 4R31A 5IKEA 1J07A 1WNFA 1G41A 4KYTA 4MTLA 4B6FA 2QV0A 2ARKA 4JL8A 2IZZA 2MT9A 2WP0A 1WBDA 4B75A 1U0BB 1I3OA 4LOAA 4O4HF 4FYIA 1V5FA 3MJEA 3OCXA 4ND8B 5C3UA 5KBYA 2OBBA 3KKLA 1WTCA 1M2KA 2HJVA 4J3NA 3VMFA 4MP8A 2QRUA 4F21A 2ZR9A 3SX2A 1T0UA 1DBPA 1V2HE 4W4TA 3IUSA 3UJAA 3O31A 3UMJA 4EHDA 2AKYA 3LG2A 2G9QA 1JI3A 3LBNA 2ZRFA 3MTJA 1O97D 1PFYA 1RFGE 4W9NC 4QA9A 2HCRA 4MRSA 5IDWA 5KEIA 2XUQA 3TAHA 1EAYA 1WP9A 4JB2A 5LYJA 3G23A 1U7DA 1UXJA 3HRHA 1HOTA 1T3GA 3UB4A 4TQ9A 5GP1A 2EFJA 3FPGA 3TW8A 2PR7A 2ZJOA 2IP1A 3TKYA 3FZNA 3FPEA 2MSNA 3ZDCA 4HPXB 4HL6A 5B12A 5GJCA 3M4XA 5C53B 4X97A 3ILVA 2QAGA 1TK3A 3CG4A 5L7YA 2J09A 5FPTA 3A9RA 1O95D 1KL7A 1KYQA 4WASA 4EO7A 2MR6A 3KU1A 5GOZA 1J24A 3ICCA 1H6AA 1SA0A 4Q18A 4LKRA 5BN5A 1QONA 3CF6R 1A4XA 3O2NA 3HVUA 4JBLA 5T3UA 1XKTA 2M32A 2YWRA 5DN6A 3LD9A 3CRVA 2CK3A 4B3XA 4M38A 1X3LA 1RBMA 3QEOA 2HPVA 1LB1B 1LCIA 2ZWAA 2GO7A 1BEEA 2CB9A 1W75A 5A02A 1GKIA 1OIXA 4XPIB 1AG9A 4NBNA 3V7NA 1W0KD 4JROA 1LTKA 1ZEJA 5JYBA 3BKXA 3K9BA 3BIOA 1XNHA 2H1SA 2ZRNA 2Y3IA 5DTEA 5LOVF 2VHEA 2FPWA 2OPBA 1EGHA 3DTNA 5KHAA 3VTFA 3LCCA 3GBPA 4LPKA 3E3OA 3FETA 5AVVA 4DNPA 2X1HA 2ZE6A 1DIGA 3W3AA 2ZSDA 1MP0A 4JS0A 2QYHA 1EP3B 5TSDA 4BVAA 5E7IA 4Y2XA 2PZ8A 5IFLA 1O5TA 5ICFA 3TSCA 1OLXB 4DM3A 2DFKB 2WVHA 2WZQA 4LYGA 4YRAA 5DWQA 1JIJA 1UC5B 4POOA 3HZZA 4M2LA 3C6XA 3D5QA 3TTYA 2GFQA 2V7EA 3KQLA 3ICVA 3GMIA 3D4BA 1OXXK 2HHJA 1U94A 3TTTA 4BDSA 1LX7A 3DBRB 3Q10A 2EKPA 3T7EA 3A2KA 2YN0A 1B8UA 5SYAA 2D2FA 1Y3CE 1QKJA 3CF2A 4IDBA 4KRGA 4D2IA 3B6EA 2HLHA 2OLEA 2IEIA 2ZYRA 1QZ3A 3QVKA 3BIFA 4G0MA 5EHIA 1GA1A 4W5QA 1TU0A 5PGMA 521PA 3K96A 1RD4A 3UMCA 1HLGA 4PAOA 4DDWA 1AUVA 4ZYZA 3NKVA 4IRXA 3BXXA 2J9ZB 3U44B 1H3FA 1M2NA 2DUUA 4FR0A 4XR9A 2H8GA 1IK6A 2QVXX 1ZN8A 3S5UA 3TK1A 1PR6A 6NULA 4HFRA 5HKAA 1XCGB 2RARA 1MORA 2X3FA 3LQQA 1H8HD 1RQGA 1UPFA 1V41E 1XRNA 1SD1A 3DR5A 3GJYA 1EFRA 1UADA 4GOKA 1T8WA 4RGYA 5DCWA 5ICGA 2A4MA 1IBKB 2H51A 3AC0A 3QENA 4HPWA 4OXXA 4OU4A 3SDBA 5BR4A 4OM7A 1RTTA 1PI3A 1KAEA 4M1KA 2OQIA 1E1RA 4DLBA 4EI2A 4F38A 3KG2A 4IHQA 3M5PA 5EFOA 3WGHA 1ISJA 2QUBA 1VG8A 2QYSA 3J7TA 4PZLA 1B6SA 4CNBA 2MSCB 2J9FA 4N7MA 1UPAA 1LU9A 2X3YA 4IUYA 4ZOLB 1V26A 4PC6A 4U39A 3T34A 1KE2A 5BPHA 5KNDH 2Q5CA 3DZJA 4GI2A 3G59A 1RXVA 2WB4A 4GSYA 3U3RA 2BYTA 2C2HA 4M1OA 3D4IA 5REQA 4G5XA 3OKFA 5HM6A 3EFOB 1KJ9A 1DRUA 1IJBA 1TMOA 3HBFA 1JU3A 1M2EA 3DCNA 3NR2A 1FQOA 3E22B 4K6OA 1V9LA 4G8CA 1E79D 5JVDB 2IEYA 1OZFA 1X6VA 1RZRA 1PQPA 5BRJA 1JZTA 2HB6A 2QNIA 3W1WA 4QDUA 1Z4OA 2H1VA 1DSSG 1QH9A 2EFDB 2YV4A 3GI1A 4PS0A 3RF6A 2R7LA 3IPLA 3BRCA 4GGPA 2ZSFA 2OD7A 4H08A 1OTHA 5DBFA 3P0EA 5GPBA 3H7IA 4CV3A 5K8CA 3AONB 3SK0A 4L4YA 3QPUA 1RADA 5L40A 1YB2A 4I1YA 4RFSB 3MIIA 3RRYA 3UB2A 1G4HA 3BF7A 4Q37A 2ZB8A 3RSFA 2GTIA 5F7XA 1R10A 4A4DA 2H5EA 2G04A 4L5CA 4HX9A 5M04A 4G4SO 1XZKA 3SKYA 3ONEA 3T9BA 1R6VA 1ISMA 4OJMX 3LSYA 2DOKA 3OE5A 4FE3A 4KL8S 1FTYA 3IP7A 1CDEA 2C5AA 5BUCA 3AKZA 3AVXA 3FF4A 2JIZD 2L18A 1X9GA 3NWOA 1VIMA 2WJAA 3EIHA 4ZI7B 2PL1A 2XCUA 1OFHA 1MJGM 1Z4KA 2Q3DA 3FJOA 3N2NA 4PANA 5GZ1A 3L7NA 1QC5A 3HHEA 5DBHX 1HF3A 4O4LB 5J63A 4OQMA 4JI1B 3O73A 3E15A 4E5VA 5CX1A 3UKDA 1EUQA 3LH5A 4KLCA 3LA8A 3AZOA 3CSUA 1RPJA 1UMCB 3T1TA 1T6BY 1T0JB 5C1PA 3L6UA 5GTDA 2QD2A 2QYOA 2WOOA 4KE6A 3CF0A 4MI6A 1VLJA 3VR2D 3HP1A 4A8HA 4AI6A 2KHZA 3HCPA 1YRLA 3K2QA 3MHPA 4YAGA 5K0JA 1SC3A 2A6PA 2IE0A 4FGZA 5ENVA 4HO1X 4NFHA 5T3YA 4ETIA 4FWIB 4GKKB 1VLLA 2GGSA 3EIUA 3H86A 5A7FA 2C54A 4PFKA 4WLUA 2JLCA 4I8DA 1I14A 4QOIA 3CZAA 3S0JA 2C0CA 5AVTA 4A6PA 3CR8A 1SU7A 2EX0A 2Q4OA 1D2CA 2F9LA 4KI0A 4L3OA 1WL8A 1P0MA 4NG5A 5LZ2A 3RRXA 1P44A 3GF4A 1Z83A 3B85A 1HRDA 3QVMA 4OX9Y 1OYOA 1Y7IA 3N6XA 2O0HA 2UZAA 3CWZA 2WT8A 2WICA 4N5HX 2ID7A 2QTMA 3BGVA 3ICOA 3K0AB 2X5JO 1KDYA 3ZGXA 1KE1A 1A04A 1G20A 3BHMA 4DZRA 1HWYA 5AK3A 3DTVB 3OFJA 1TK2A 221PA 1E7QA 1KOJA 3V1LA 4ARVA 2ATXA 1KEKA 3BGSA 4BQEA 1FSPA 3L92A 3FSJX 3B48A 4LCEA 1DMRA 5AHOA 5BV8A 3FSRA 4JJZA 4KXXA 4DJDC 1RBQA 3GMSA 3L6BA 1Q2XA 1TVKA 4E32A 1SVMA 1RR6A 3G8YA 4PHCA 3V8EA 1VE5A 5DX8A 1BXZA 5GIPE 5DPMA 1TA9A 1W76A 1EP2B 1R4MB 2R4QA 4I19A 1GUAA 3MTQA 4MRMA 1Y3AA 4P4SB 5ECYA 4MMZB 1L4HA 4JLSA 3R6WA 1JDVA 1SWWA 4IJ6A 2QAGC 5IKPA 3AOEA 1R0LA 2HV9A 4MDYA 1PJBA 2FA9A 2F64A 1ZNYA 5EIEA 1TUIA 3L8DA 1G9TA 1NBOA 2JI8A 4KO3S 1A3CA 2A1TS 3E3MA 5KYWB 1GY8A 4N01A 4HYEA 4PPNA 1RZUA 2I6UA 2XCRB 3UJDA 1DAPA 5EJ5A 2FW1A 4LTNA 3IUYA 4M9UA 4CCSA 3HYLA 3PNOA 4J3FA 3DEFA 4RYDA 2EX4A 3WIBA 2FI1A 2O2XA 4WN9B 3HUTA 4YRGA 3KB2A 3AY7A 1UQUA 1Q57A 2UZIR 1RHRA 5BSFA 3JQ7B 3KJXA 4XJTA 1C7IA 4TKMA 2R96A 3EGOA 5C4IA 1JH9A 1E9VA 1GR1A 1IPFA 1MV5A 1DKQA 3GJ8A 1WIWA 2O5VA 3NNSA 4OMUA 3T4XA 1UBJS 1T34A 3N70A 1QYDA 4B7AA 4F4HA 3EPHA 3TBFA 5JH7F 1JAYA 1UPBA 3E2IA 4WLEA 3U60B 4LJ6A 3CH6A 4TPKA 3KQHA 4ID3A 3JQCA 2ZJYA 3HMQA 4J0JA 4NEQA 5JFOA 4MPDA 2R1TB 1W4AA 4X44A 4CLRB 4IUBS 2IKQA 2ZYUX 2B9VA 1GZSA 3EA5A 3HABA 2QY9A 1I13A 3FDZB 1ZWLA 2AJLI 5SZIA 1SUBA 4MJ3A 4GVXA 4UNPA 4C2BA 5SZHB 4CT5A 5IMBA 3M3DA 4F96A 2PHZA 2Z2IA 4K5QA 4BO3A 1XMXA 1ODJA 3TTXA 5JXJA 4OQLA 3I9LA 4LVOA 1RWWA 3V4OA 3WLHA 5GIOE 1MFZA 3O8DA 4P0TA 3DBHA 1S8NA 4GE0A 5H3HA 4CIDA 2X5OA 2XCLA 3PQ8A 4TZKA 4YCCA 1R3UA 2TMDA 5A2GA 2JFGA 1JWAB