4XVUA

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
301
Chain Sequence
b'TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSLADLTGSIPGIDEALSFMEVMKHIKRQEQGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
molecule tags Hydrolase/transport protein
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
total genus 103
structure length 301
sequence length 349
chains with identical sequence B, G, H
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xvuA00
1UM8A 5DHAA 3SFZA 1Z29A 1ZUHA 2D62A 4CGZA 2PZEA 2G1JA 5JWHA 1FZQA 3ADDA 1E2EA 2WPDD 1N5IA 1JNYA 1CJMA 4ZI3A 1CJVC 2QGNA 3PCRB 3SFVA 4DCSA 5A4JA 4F4JA 3WHKA 1A5TA 4M0LA 1UADA 2QQ0A 3CF2A 3QF7A 4TMKA 4CF7A 1UKZA 4PR0A 3H84A 2K5UA 1CJUC 2AXPA 5KHOC 3AVYA 4LYHA 3W9YA 2AK3A 4LCBA 4UJ3A 5J4YA 3IHLA 4Q4HB 1CF4A 4U7DA 2W6JD 4MYTA 4CRWB 1P6XA 1KDOA 2CCGA 2OZEA 3Q3JB 4OHXA 3GLIA 3RANA 3VU9B 1OFTA 4JSTA 2WAYA 2PBRA 5H70A 1XU4A 1GOTA 4AURA 4TWZA 2XNSA 2ZJ8A 1QHGA 2ZRPA 1XCMA 3LVQE 4DSTA 2JJ1D 1TF7A 5DSZA 5F98A 3U61B 3B1XA 2GEUA 5FPHA 3Q7QA 5P21A 2W83A 2P5TB 4DLXA 1WBDA 2ZRGA 4BLSA 2Z43A 4MRPA 4TYWA 2QMHA 1SHKA 4G5OA 1J2JA 4ZKEA 4B3FX 1OHHA 4DRZA 1ESNA 2QT0A 1UKEA 5CITA 5K8TA 3GEIA 2R6GA 4A2QA 8OHMA 3K70D 2ZS7A 3HP1A 1H8HA 4QOSA 2QAGA 2VTKA 4YDHB 2D3WA 3REFA 3U44B 2AN9A 2QTHA 3TQCA 4DEXA 3RRZA 2GVZC 1X8KA 4P4SB 4EPYA 1UBGA 1AZSC 4LJYA 1DVRA 2OG2A 3W3ZB 4LJ6A 2R6FA 4I1OA 5JWOA 2O8DB 4Q48A 3RS0A 4TL9A 3AF1A 1JAIA 4RD6A 2F7SA 4IDNA 4JJZA 4QFMA 1IM2A 4QGHA 5G40A 5A0FA 5FUYA 5TB5A 1Q12A 1UBCA 4DUGA 5JSZA 1G3MA 2ZJYA 2RGAA 2VEDA 1S96A 1EFCA 2QRZA 3DL0A 3UMSA 1G9XA 5CK5A 3CR8A 3CWZA 3KKPA 3N5CA 3D6TB 3DM9B 4HAYA 1YRAA 2Z4RA 4HSEA 1OB2A 3UK6A 5JMTA 5AWFC 3KUCA 5GVSA 4NHOA 4TL7A 4YC7A 5TV2A 1S1MA 2ZJBA 2N42A 3QIAA 4M1SA 5DIFA 4F7WA 4JBYA 5DLQC 3LO5A 2AD1A 1I4DD 2G88A 4M1KA 3ZZ0A 5B57C 5BXQC 1E99A 1SVLA 4GFDA 2BBSA 3FE2A 4MKHA 4TYQA 5CJ2A 1NKSA 2EU8A 2GEVA 5J47A 4WAUA 2J0SA 4KBFA 1W46A 5FOVA 3ZVMA 3B8HA 3CM0A 1E2LA 1P5ZB 5DYGA 1NLZA 2XJ4A 2W2TA 4O0MA 2AK2A 2KBFA 2RCNA 3OIWA 1JR3A 3KZ1E 3SS8A 3RS4A 4XVUA 5K8LA 4JLJA 4EPTA 1YRBA 2QI9C 3PIRA 3A1TA 1QVAA 2VSFA 2MSEB 5EXTA 3GFTA 2YWGA 3MUFA 4JIMA 3FVQA 1AK2A 1M34E 2DWQA 3PITA 1W4RA 2IEYA 3NEYA 5CLQA 4OYHA 2W6JA 4IOKA 2IYVA 4FCTA 1EFHA 4I4LA 4LK2A 3AF0A 1G291 4AD8A 3GP8A 5CYPA 2J0UB 4QJ4A 1ZW6A 1JALA 1ZMXA 4WZAE 2CJWB 1RYHA 1VYTA 2A9KA 3D3QA 2QBYB 1DADA 4HLQB 4QM7A 2JEOA 1W44A 2ZSAA 4TMTA 1JEEA 4Q9JA 5JJKA 3QF4A 2QEQA 1RKBA 2ZETA 1G4UR 4ESVA 4R98A 4JVLA 3H2YA 1ZM7A 5DO9A 1RPZA 2Q9CA 4UNQA 3IO5A 4TL8A 1XTIA 2SHKA 5L3SA 1QHHA 1KDTA 3SOPA 3AQ4A 1TL7C 5EZ6B 3ADCA 4FMDF 4AKEA 1P2TA 2HXSA 2WBLC 2IW3A 5FR1A 2KBEA 1NBME 1RRGA 4CIDA 2DB3A 2WKPA 4BLOA 1II9A 2ZE5A 3GD7A 1AA9A 3ZD6A 1II8B 4JS0A 4TTPA 3ZYCA 1R8SA 3UMRA 3T1QA 5KPJA 4HEJA 4NCJA 3DO6A 3NVAA 4I99A 2HXYA 4RZXA 1TU4A 4PO9A 4BWYA 5GVRA 5B58C 3SYLA 4RFSB 3MWJA 1DAHA 2IYWA 3GCGA 3K0AB 1UAAA 5G53C 4URVR 1WBBA 3Q7PA 3H1TA 3LW7A 5CDFE 3ADBA 1S4QA 5AUNB 2WZQA 2B21A 3T06B 1GL6A 3P4XA 2BBWA 1RJ9A 2LKDA 3FPAA 3PUWA 4XWAA 4CEHB 3JVVA 2QG6A 1T3HA 4LPKA 4LDJA 1OE0A 4HB3A 1TF2A 4UNRA 1Z6XA 4YMVA 5DISB 3I73A 1E0SA 1VCMA 4PAQA 4LGMA 4DHEA 1Z63A 1SQ5A 2H18A 3K9NA 1KSGA 3VKGA 3IBGA 2JAQA 3QBVA 3HYRA 3CRRA 1IXZA 2VA8A 2I1QA 3TRFA 1X6VA 4Q00A 5C18A 3EWAA 3KFVA 3JVUA 3ZZTA 3RRMA 3SU8A 2P67A 4LYFA 1T3SA 3BFKA 1XTKA 5FOTA 3AUYA 1W2GA 2CL6X 1VCNA 2J59A 3PQCA 4M21A 2BIFA 3CO5A 2A2ZA 4MKGA 2QMUA 2GAOA 1G18A 4NYJQ 1FMJA 3OFNA 3BJIC 1AN0A 3GJ4A 1XRJA 3VHLB 3DHWC 5J5CA 2BVNA 3OEHA 1SVMA 4LJ7A 1CXZA 1CRPA 2UZ3A 4QXAA 1E9AA 2ZROA 4CEHA 1L4YA 5UKDA 2G0TA 1VKJA 1GRRA 1R5OA 4IXNA 5GJVC 1HH4A 2PCLA 5HCNA 3A4MA 1P62B 4NCIA 2EFGA 4EQ6B 2J0QA 1BMFD 3RC8A 1X1RA 2FZ4A 5F9HA 2RAPA 5KNCA 4Q47A 1KMHB 4PO1A 4NYMR 4GOXA 1U94A 3O8DA 3IUYA 1E0JA 2Q21A 4JT4A 3W6NA 4Q9KA 3NC0C 4WOPA 1JECA 4XOIA 3TSWA 4CW7A 4FMBB 4MGYR 1E9DA 3CF0A 4CYMA 2AHOA 2QTFA 3NBXX 4PQYA 1CRQA 3AF3A 4EJSA 3O47A 2O5VA 2FFQA 2GJ8A 3EIHA 3MFYA 4KHZA 2ANCA 1SXJA 1AGPA 3MGCA 3FMIA 1E9EA 1E2QA 4HZIA 2J7PA 2DFKB 3GLGE 1G19A 2IXEA 1IXRC 5EE3A 2BM0A 2XOKD 5HE8A 3WY9A 3T35A 2WJGA 3H4MA 2XNDA 2FNAA 1NIPA 2W0MA 1Z5ZA 4KVAA 1HT1E 3AEZA 3ZIAA 4K8OA 4V0OA 3WYAA 2V7QD 4WBSA 2WWFA 3QENA 4PPNA 3U7FB 4Q5IA 3TSOA 1XXHB 4C0BA 1DAFA 4G1UC 1ZIPA 1D2NA 2QAGC 2DYKA 2PX3A 2ZVPX 1F60A 2OCBA 2B8TA 4YMUA 3W8RA 5LDDC 4BEBA 1N5LA 1NVVR 4BGDA 5JFGA 1TTTA 2IC5A 1A2KC 1NBMA 1V5WA 5FR2A 2KE5A 2KI5A 2AL7A 4EQ6A 2FWRA 3CLVA 2D74A 2ZRMA 3QPUA 2ODWA 2HT1A 2OCPA 4D82A 5E7JA 1N6NA 4BFSA 4MYCA 2ZI3A 1PV4A 1EFRD 4ITRC 4Q4JB 2LWIA 2NIPA 4HUTA 2ERXA 1PVOA 3DDCA 1DAGA 1KJZA 4FIDA 5H8WA 1E9FA 1YZKA 1S2MA 1DAIA 3CF6R 4TL6A 3FHTA 2OLJA 2ZVQX 3TW8B 1I2MA 1T6NA 4TZ6A 3CWQA 1F48A 2ODBA 4LHWA 1NSFA 2F43A 1EFUA 4MDFA 3CONA 3VNVA 1YZQA 4ASUA 4AG5A 2P6RA 1KJWA 5BYKA 3KKNA 4PANA 4ZDWA 2F9LA 1KDPA 3LBNA 4KU4A 4W5JA 3T61A 3MAAC 4KSBA 5FTLA 2Z6VA 3NBZC 4F91B 2RGXA 1IN5A 1EFRA 2FN4A 3NDBB 3ASZA 1GILA 4RFVA 5D3MA 1LNZA 1M74A 4C0LA 1KK3A 4JKYA 5SZJA 1AGRA 2J1LA 3A58B 1W7AA 4HDCA 4RKEA 2CJWA 3CB4A 4DCUA 5JCPA 1KKMA 2RGEA 4I1VA 3TUIC 2XXAB 1VG8A 1TEVA 2UKDA 1WA5A 4G5QA 4J0QA 2DWOA 3HR8A 3CNLA 2NMVA 1PUJA 2ZM5A 5KSOA 4LPSA 4C3ZA 3HR7A 3S1AA 3OF5A 1DAEA 3SN6A 5C4MA 2Z83A 4FINA 4ZKDA 2ZI6A 5DHFA 1Z07A 3GEHA 1XJ0A 3VFDA 5JEEA 3EZ2A 4BLQA 3KQUA 4P33A 4D6PA 4DLTA 1UEJA 1YZTA 3UWKA 3VKWA 3C4JA 3KB2A 4DBLC 3L0IB 2FH5B 4YONB 4A1FA 1P61B 1II8A 5HR5A 3WMFA 4CVNA 3THYA 3TIFA 3RVBA 2QL6A 2JJ2D 4AI6A 4NL4H 3U3MA 5HE9A 4IOJA 1TQ4A 3D7MA 4OK6A 1P3JA 5FBWB 4AWXA 4ILEA 4LV5B 3T1TA 2CEAA 2V3CC 4C30A 2O8BB 5TDHA 3QG1A 3NIBA 1SZPA 4UQOA 4XSGA 2C5LA 4A8JA 1N3BA 4JL6A 1P72A 1LW7A 2HYDA 2Z5FA 4ZPXA 1E1QD 1WDTA 3LY5A 4EIWA 4X8MA 5LB2A 1QHSA 1WB9A 3LDAA 3MRSA 2CVHA 2OXRA 4PFSA 4QJ5A 4PC7A 3T5DA 1GNQA 1G7RA 2CHVA 2ERYA 4PPFA 2ZR9A 1YR9A 2PCJA 3WBKA 5FBQB 2IHBA 3GFPA 2WPDA 1OFIA 1E4VA 3C8UA 1KI8A 4X8OA 4LBWA 4TMWA 4QJ3A 1G5RA 4IDQA 2GXQA 2RGNA 2ZANA 5SZIA 3VR5A 1SKYB 3QEOA 4QBFA 2IYRA 1ZUNB 2IYUA 4DCVA 4IOLA 4LBVA 4B73A 5KDOA 1XNJA 1UPTA 1I2DA 3W6PA 3AM1A 1ZVQA 4TT3A 3CIOA 3RSLA 4EFMA 2BMDA 4M1MA 1GP2A 1W36B 4NTZA 3HPRA 5BN3A 1IN4A 1ZIOA 5JRZA 3UG7A 2Q0HA 5JI3E 3TE6A 2VP5A 4R9UC 5DYIA 1NRJB 3Q8XB 4OI2A 1KK1A 4DJTA 4FCVA 3CX6A 5KYKA 1X8LA 1Z06A 3OHMA 4Q7JB 1NY6A 5ELXA 5CM9C 4QC2A 2XB4A 1KKLA 2P65A 2KWIA 3QOFA 4NH0A 4P4UA 2ODEA 2OV2A 1J90A 4KXFB 2IXFA 5AUQA 1KZGB 3ZS8A 2V55B 1N2CE 2XTMA 1COWA 5KPDA 4PHHA 2O0KA 2EW1A 1EK0A 4UNPA 5AUOB 1HT2E 4GRAA 2L0XA 3UATA 2VPPA 3F3YA 2A5GA 2BMFA 1CBUA 3OESA 2R6CA 2NPIA 3PVSA 4HB2A 1IXSB 3A37A 3WNCA 2MMCA 4US0R 1KNQA 2EFEB 2PMKA 4NP6A 5FUVA 1JR3D 4Q4AB 3C16C 2O8DA 4Y0VA 3LXXA 3RRYA 2AKAB 4JJKA 3TSZA 3NWJA 2GRJA 3KJIA 1AQYA 3K1JA 1NN0A 1I4TD 1DS6A 5L3SB 1GM5A 3SHWA 2IK8A 3MD0A 4EFNA 2JDID 2A7QA 4HDOB 2GJAA 1XCPA 2Y8EA 5TARA 4C9BA 2JA1A 3WNDA 1Q22A 4TLDA 1NY5A 1QG4A 3KXIA 2IYZA 3MSXA 1LF5A 3I1FA 4XWOA 5IRCD 2FEMA 1E6CA 3K0CA 2ZI5A 3RAPR 2Z4SA 4LC1A 4BZQA 4US1R 3X1ZA 1QVRA 3THOA 1N5KA 2OFOA 1U8AA 2IXGA 4Q1FA 4PPQA 3PENA 2F1JA 1FUUA 1CR0A 4L9SA 3IILA 5KTYA 5FUXA 4A36A 2J41A 2OLKA 5B2ZA 1Z0AA 1OH6A 1HE1C 1U98A 2IYYA 3DVLA 3I8XA 3LD9A 4IRUB 5HTKA 2VHTA 2YC4C 4PC1A 3X1XA 1AS0A 3EZ7A 3V4FA 3K0FA 4OQMA 1Q1EA 1SVWA 1KO1A 2A78A 1E9RA 4Q02A 1D5CA 2GCOA 3IPYA 2OBMA 3WRYC 5L8VA 4JLKA 1G7SA 3FTQA 2Q9BA 4Q4JA 2A3RA 2ZJZA 1P2UA 1Z22A 2GF9A 2QGZA 4IEEA 5KSZA 4Q18A 4Q9IA 2O8EA 2KB0A 1AIPA 3HPQA 3GQBA 2GK7A 2DFTA 2ODNA 2JLVA 2F55A 4G5GA 1NVXQ 1SVIA 4Q7LA 2GCNA 2AWOA 2X1VA 1D2EA 2QRNA 4DB2A 3U7EB 5BN5A 1AKEA 4N1AA 4D0LB 1GTVA 4IOMA 4RFSA 3VHXA 3TKLA 2IS2A 4B6EA 1BH2A 4RD3A 1SXJD 5B30A 5A5GA 1XTRA 2YWFA 1QHYA 4NDZA 4XD7A 4ZV4A 1MT0A 1COWD 2CVFA 2QZ4A 3U3KA 2XSZA 2BC9A 4X8LA 2IHYA 2JJ1A 3QXCA 3U5ZB 2QMEA 1NNEA 1JBKA 4QBHA 2VIIA 2ZRJA 1JJ7A 4XWKA 2CE7A 4BFTA 1HURA 4RCZA 4LHZA 3D31A 4HZUB 1IY2A 2HCBA 3TW4A 2ZPTX 3AGQA 1FMLA 1NVWQ 2QM8A 3EPLA 2GAAA 2UVQA 3GLFB 1E2HA 1KI2A 3B1ZA 1GNRA 4DUGD 3TVTA 2RB4A 4LWZA 4OHVA 2WJIA 4ARZA 4QRHA 2RH5A 4P3YA 4Q4AA 1G21E 4ESHA 1ZM3A 2CMKA 4A8JB 2VF7A 4BPBA 4KLNA 3GFOA 4NYIQ 3RNLA 3C7KA 4BLTA 4JLNA 1GRNA 1OIXA 2FU5C 2P3SA 1ODFA 3W34A 1W0JD 2CBZA 3HWSA 3OFND 5FOUA 3R9IA 3VX3A 5LPNA 5ANRB 2VYFA 4V0LA 1C9KA 2DFNA 4FMCB 2NPFA 4MRVA 2ZI4A 3U4QA 4OK5A 2Q3HA 3X1WA 1KO7A 2J3EA 3EIQA 4AG6A 1D9XA 4PZZA 3QBTA 5CDFA 4S35A 3SBEA 1HTWA 1QHHB 4JBWA 4TLAA 1CIPA 3UPUA 4MRNA 5E4FA 2ZQ5A 1HUQA 3NC1C 4JKIA 2KJQA 1JPJA 4S2EA 3TGPA 1ZD8A 2V8OA 3LX5A 821PA 1N6OA 2XXAA 4L16A 3A1WA 2R8RA 4QKQA 3A1SA 3SEAA 3ZVRA 5J4VA 4A6PA 1CR2A 1E0AA 3F8TA 4HDQB 1E0KA 3P32A 1VDZA 4V0ME 1QRAA 4ACBA 4D4KA 1ZJ6A 1Q3HA 3S1AB 1FQKA 2ZSBA 3CZPA 3L0OA 4QBIA 1N6KA 2ZE7A 4JYBA 5BWMA 5FBVB 3E1SA 2V6JA 3K0CC 1ETUA 3B9PA 3NXSA 4GBMA 4TQAA 3ONWA 1UJ2A 4CT5A 2YKGA 2VHUA 2HEIA 2Q9AA 3KQKA 1C1YA 1P9NA 1P2SA 3BXZA 4LHYA 3IEVA 4HAVA 4LBYA 1KY2A 1ANKA 3KQHA 1N6HA 1N5JA 2NZ8A 2IS6A 1F3OA 4KFUA 3CNNA 2CL7X 3L8YA 1M1YE 2XGJA 2MSCB 2OSBA 2J87A 3EC1A 3FB4A 1VIYA 3G0HA 3I4LA 2PH1A 1MABA 1UKVY 1E4YA 2B7BA 4QGGA 2D2FA 4PHTA 2GNOA 2LCFA 3B2EA 3THWA 4K81B 4XJXA 4BZXA 2CDNA 4B34A 3RC3A 1NSTA 3AP3A 1OPXA 3HU3A 3I5YA 2YZ2A 1IJFA 1F2UB 4RZ3A 3VR3A 1NL3A 2YVUA 1UBFA 1KO4A 1Z2AA 1WRBA 2ZITA 1RRFA 2GJ9A 5CJPA 2EVWX 5D3MB 2CCKA 4ZDJA 1TQ2A 3ZGXA 1N0WA 2XZOA 2O8EB 2XB2A 4B74A 3QKUA 2XZLA 1AKYA 3IHWA 4FMDB 3SC3A 3OEED 1OB5A 4O25A 2N1BA 3W6OA 2BEKA 3UG6A 3CUEF 3KFXA 4ABYA 1W4BA 1OYYA 1TUIA 4GMDA 3SI7A 4DIDA 4AYWA 1YKSA 1GKUB 3IO3A 3MWLA 2NO0A 4NBSA 3B1WA 1PLKA 6Q21A 1OXVA 2WWIA 2QM7A 4DCNA 2PJRA 1OFUX 1ZM4A 4TSFD 4NZYA 2PLRA 2IUTA 3K9GA 4HUQB 1KMQA 2ZRKA 2ORVA 5BYJA 2BMJA 4TQUS 2G9NA 1OH7A 4A4DA 1XEWY 1XZQA 3BE4A 5KNDA 3QEJA 5JJIA 2YC2C 4B32A 1R0XA 4Z8XA 2MSDB 2IA5A 3EW9A 2NG1A 3SBDA 4QHSA 5EXPA 2E87A 3TBKA 1T3LA 2HJGA 1JPNA 1KTVA 1FL9A 2X19A 3RABA 1S9HA 1G8YA 2JATA 5IT5A 5CIQA 4A15A 2R65A 1XF9A 1NVUQ 4WXRA 4A82A 4WVFA 2QAJA 2VQSA 3K9LA 5BQ5A 3U6KA 2EWVA 2Q3MA 5TY0A 2BHRA 2ZRDA 4E09A 5C4GB 2F1HA 1VG0B 2H17A 3GLHE 4M4SA 3SDZA 2C9YA 2V6IA 1IOZA 1GFIA 2XNDD 4HLDA 3RS5A 2BJWA 3CR7A 3KXKA 2J45A 3U3JA 5J4KA 4Q7KA 1DPFA 1DAKA 3IQWA 1E2GA 2ZRHA 1QBKC 2F3TA 3GJXC 4D25A 1CJTC 1G6HA 2A5JA 2ZRBA 3AVOA 1LV7A 1LS1A 2RGCA 5TVKA 1TQ6A 4MKFA 2REXB 1E2FA 2C8VA 1FPMA 1SXJE 1A82A 3PV0A 1FX0B 1GITA 1VG9B 3PUZA 4WIAA 1EWRA 4KSCA 1EX7A 4TSFA 1RRPA 3K0EA 2PZGA 3QY0A 4B35A 1IONA 2GILA 5DN6D 4OI1A 3PFIA 1KI3A 1SVKA 5JLJA 4BUJA 2OBLA 2WJJA 4LV6A 4MUAA 4JBXA 3HU2A 2CHGA 4IXMA 2B92A 3I8SA 4NCHA 2FF7A 1M7HA 4OQNA 4YLGA 4BFUA 2YYZA 1YQTA 4B33A 4NONA 2HYIC 1BOFA 2VP4A 3CRW1 2QMOA 3IIKA 1E79D 2GJKA 3HDTA 3ZQJA 4V0NA 4PSAA 3OE7A 4Q9LA 4C2UA 1T0JB 4EJSB 1M7GA 2A5YB 1SKYE 2DBYA 4EKDA 5K8UA 4UXJA 3ND8A 3FDIA 3K70B 1Z6YA 2FSHA 1T91A 4JLOA 3T15A 5L3QA 3AVQA 3PEWA 4OQFA 3EAQA 4QGFA 3FMOB 4W5HA 2A30A 2JLUA 3QSYA 1AQUA 2QAGB 3Q85A 5H68A 1HEIA 5C1BA 1G41A 3RS7A 5B64A 2GXSA 4Z1MA 4TLEA 3SE0A 4QHYA 4EPWA 4FW9A 1UFQA 4PHFA 2H7VA 4DDTA 1DTSA 4YMSA 2QP9X 1XEXA 3JZMA 1NJFA 2FE4A 1XTQA 3D8BA 3K8YA 3F5FA 3TQFA 1OF1A 2WWWA 4OBEA 1E32A 4KVGA 1G3RA 1Q1QA 4YQFA 2F6RA 4IVRA 3T34A 1OFHA 2ASEA 2H92A 1CTQA 4U02A 4DVGA 2IWHA 2ATXA 3VQTA 1CULC 2BM1A 3AKEA 5IHPA 3BB3A 3MMPA 4OL0A 4LZZA 4XVQA 2W00A 2VSXA 3AH8A 1II0A 1ONBA 1SVOA 1U81A 5G3YA 2GVDC 2QPAA 4Q1AA 1L7VC 1QF9A 2AFHE 3QXHA 4Q4HA 5FTKA 4B75A 4B47A 1WCV1 1KMHA 1XEXB 4DT1B 2PT5A 3EPKA 3G5UA 4UKDA 3KJEA 4I81A 5JS8A 1RIFA 1MH1A 2QE7D 2HLDA 3DKVA 5FTJA 2RMKA 1KI7A 3AUXA 4YDSA 2PEYA 2IS4A 1QHNA 1DE0A 2ATVA 4Q7MB 3EZFA 5FPKA 2FFBA 4B43A 1EWQA 3OE7D 1XMIA 4W9MC 1YZLA 5DI3A 1E79A 1Q0UA 5HKKA 1XD2A 3B13B 4A0FA 1KY3A 1KHTA 1FP6A 1RJ9B 1CS4C 2H5EA 4LJ9A 4TMZA 1GKYA 4W7SA 2KSQA 1Z0IA 2WVJA 5AJZA 3THXB 4JLMA 1Q3TA 2D4HA 1JJVA 1G17A 2BCJQ 3OIUA 5EP4A 4POAA 3ZQ6A 4QM6A 1CEEA 2CHQA 4Z51A 1V43A 2ZS9A 1R2QA 4JT2A 5JEDA 1R0WA 1W4CA 2J9RA 1NLFA 5FL7A 3TMKA 2C95A 1JQLB 4EFLA 2PLFA 1E2KA 4AKIA 3P20A 1U0LA 4LY6A 4KAXA 1KIMA 2OM2A 1XXHA 4TN1A 3PR1A 1CR4A 4MQBA 1QG2A 3U6BA 4L8GA 1MR3F 4B2PA 4B76A 3ZLJA 4PSKA 4B3GA 2RGNC 5IK2A 2DY1A 2R62A 2VP6A 3CKLA 3TUJC 3W90A 4M2LA 2DWPA 1Z0DA 4OHWA 1DG1G 2VP2A 3AP1A 2R44A 4R7ZA 4WW0A 4HLCA 1ZRHA 3KKQA 1HQCA 3AB3A 1OIWA 4ZCLA 4A0HA 4DSOA 4CT4B 4QNMA 5FOXA 5JBQA 3R7WA 3CX7A 1WXQA 4Q19A 1E69A 1HY3A 4DLWA 1NN1A 4RVCA 4F38A 1DOAA 4Q1BA 4FXPA 3C5CA 2CLDX 5JWRA 2C77A 4OQXA 4Q66C 2R6DA 1VCOA 3KL4A 4EPVA 1KJYA 1YZUA 5CYOA 421PA 4UXHA 3VR6A 3VMFA 1L8QA 2H16A 3SYKA 1LTQA 3B1VA 2CLCX 2PEZA 2ANBA 3R9XA 4AKHA 1TPZA 2ZJ2A 2ZREA 3A36A 4F4IA 1Z8FA 2AKYA 1YE8A 3SYNA 5JS7A 3CZQA 2QP4A 2PMDA 1KK2A 1U90A 2G77B 2XOKA 4LJAA 2WAXA 4RCYA 1E1QA 3B7GA 3KDSE 5JSZB 1Z0KA 4H1VA 2CCJA 1MABB 3EA0A 3BRWD 3CPEA 2FV8A 1W48A 5GJCA 3GJ7A 1EG7A 2ZTSA 3BH0A 1D9ZA 3EPHA 3KJGA 3M4YA 3SZRA 3LFUA 3QG5A 1XEFA 2R6AA 2X2EA 3ZVNA 1T4GA 3SJCA 3ZS9A 3BS4A 4DZZA 3AVPA 2W58A 5EP2A 2NO9A 2GDJA 1TAGA 1R10A 1S8FA 5CIWA 3T1VA 4URXR 1RE0A 1OH8A 1X3SA 1WP9A 3U44A 3MCAA 5CB6A 2OFWA 2H1LA 1ZU4A 4BLPA 2XTNA 1SXJB 2OUKA 1E98A 4OK3A 3NKVA 3C15C 4BASA 4RD4A 4B3BA 1A1VA 2ZAOA 3FFAA 4ASUD 1OT3A 1OYWA 1Q20A 1IQPA 1U0JA 4GMXA 3EARA 4QL3A 1U9IC 2F3RA 5DH9A 1WQ1R 3WBJA 3R9WA 2F9MA 3GLHA 2C9CA 3LLMA 4FWIB 2ZJOA 5FBLB 5FTMA 3SJBA 1RRCA 1FW6A 1QZXA 4GT1A 1Q57A 3CH4B 1M6NA 1H65A 1UKYA 2NGRA 4Q4LA 1G8GA 1XEWX 2XZPA 5F9FA 1W47A 3L2OB 4M9ZA 2DFLA 3EIEA 3DOFA 5J4LA 4Z8YA 2IBMA 1LS6A 3O8CA 4R2HA 2PJZA 2IWRA 1XMJA 2QA5A 2WWXA 5EQTA 4EPXA 4U00A 1U2RA 2VP0A 3DM5A 2ONKA 4QNRA 5L3RA 2X8AA 1KI4A 4HAZA 1VMAA 4MGZR 3AVWA 2B6HA 3OAAA 4D0GA 4XIGS 3CRVA 3FHOA 2FDCA 5EUMA 1FNNA 3ZIAD 4E5UA 1PZNA 3CX8A 1XX6A 2ZS8A 2WWYA 5IK2D 1KSHA 4US2R 1Z28A 3C14C 3EZ6A 4DDUA 1EESA 1GL7A 3WXMA 4CZ2A 3RLFA 1US8A 4G5RA 5L3QB 2XX3A 5C2JB 2GA8A 3V9PA 2HF8A 4M9QA 2CE2X 4BLRA 3KX2A 2QSZA 4P4TA 4V0KA 5CB8A 5AJVB 2FX3A 1ZM2A 1E9BA 5FUWA 3TLXA 4P32A 2EFHB 4C0AC 3P1JA 3AVVA 2O8FB 4LSGA 1MRSA 1ZNZA 3K0FB 5DE3A 5AJYA 2GZAA 4BEJA 4OKSA 4U5XA 3EASA 1E1RD 1HQYE 4Z1MD 4Q1DA 3I61A 4BFXA 4ZCMA 1H8ED 1DO2A 2JIZD 4BRWA 1KAOA 2EYQA 4C2TA 3P26A 2FZLA 4HUQA 3QKTA 1EGAA 3MWKA 4FD2A 4GOJA 1OXXK 1XB2A 1NF3A 1AM4D 4XTCS 4EJSC 2FOLA 4LX0A 2GBLA 1VCIA 1WF3A 2P5SA 3KB1A 3RDPA 4DC9A 1E96A 1NKTA 1P2VA 4NYIR 4QGAA 5JCZA 1YVDA 2C99A 4KV9A 2GXAA 3TNFA 3U3OA 1ZC4A 4PSVA 3QKSA 3QVUA 2Q3FA 1GNPA 2GCPA 2J7KA 4JLVA 3ZVLA 2ORWA 1IAQA 4TYNA 1NJGA 1SVSA 2ZE8A 4GSYA 4C0KA 5LD2B 3LLUA 4CEIB 1LVGA 4F93B 4JLDA 1W1WA 1G7TA 3T1OA 2CNWA 5FTNA 2FSIA 2D7DA 1GVNB 3QXXA 1YU9A 3WMEA 3ND9A 2I3BA 5F2EA 3K09C 2ZUDA 1NMZA 4V0MA 2IL1A 1P75A 2VHJA 2YHSA 1QHXA 3BB4A 2P2LA 3K0SA 1L2TA 3EZ9A 3A4NA 1U9IA 1ZD1A 621PA 3NH9A 3OEHD 4KYIB 1XTJA 3CPJB 2FGJA 3GJ6A 2JJ8A 1E2DA 3V00A 4JMPA 4ACAA 2JGNA 1GKIA 1Z0FA 4TQ9A 3GLFA 3P4YA 1KAGA 1FQJA 4X8HA 1VG1A 1K5DA 1N6PA 1JQJC 2HV8A 3N2IA 1ZCAA 1EFTA 1W0KA 2NZJA 3J81k 1RYFA 1T9HA 4MH0R 3U4QB 2GWHA 4TTQA 3QI2A 3VTKA 4GL2A 4NYMQ 3DMNA 2CK3A 1GSIA 3G82C 4QHTA 5M04A 4CEIA 4IW3B 2HCJB 1LFDB 3O8RA 2G0NA 4NKRA 1VECA 3PEYA 3LVRE 3THXA 2FPKA 4Q1CA 4K46A 3KXLA 3X1YA 4DDVA 2ZUBA 2QE7A 5BW8A 4PAMA 4KYUA 2VLIA 4AKGA 1BS1A 4D26A 2EWWA 1LF0A 3IQXA 2N46A 1MRNA 5FPTA 2BKUA 2CK3D 2EQBA 2WM9B 3LV8A 4FMCF 4NYJR 4WZBE 4OHYA 1MO4A 3Q5EA 4HLUA 3EX7C 2WTUA 1OJLA 1NLYA 3IIMA 1NVVQ 5JRJA 3BK7A 1R8QA 3PXGA 3IIJA 2OCAA 2WWGA 1JR3E 4P0TA 2REBA 3NHAA 1VYUA 1Y3AA 2JLSA 5FFMA 4Z54A 3VU9A 4B6FA 4IVQA 1ZBDA 2YOGA 2FA9A 1LB1B 3Q5DA 4RY2A 1HYQA 4WXPA 5EXSA 5IDVA 2B8WA 5KDLA 4B3DA 3QXSA 4JL5A 4A0RA 4DLYA 4MDEA 1G64A 1UDWA 3BD9A 2ZRFA 4LJ4A 4URUR 3SR0A 2WJYA 3ZZUA 5J4HA 1BYUA 1NBMD 3ECCA 3CRMA 2RGBA 3A1VA 3EWSA 2V1XA 2I4IA 1UF9A 5L3VA 4LRWA 1XD9A 4C7OA 3X2SA 1XBTA 3WP1B 3GJ0A 3TUZC 1XTSA 5LB4A 5F3WB 1IY1A 3GLGB 2BEJA 1R6BX 1U99A 1WE2A 4GP6A 2ZI9A 4IDPA 4L9WA 1G6OA 1UBEA 2GF0A 1S3SA 1J7KA 1MV5A 1TADA 3LBIA 4A8JC 4BE7B 3B78A 3DPUA 4GP7A 3EC2A 3EG5A 2IF2A 3DKPA 4ZIRB 2W6ID 4O2RA 3P27A 1Q44A 4F4CA 4HZUA 3R8CA 4A2PA 4N0EA 1RC8A 3QXJA 4Q01A 4LHXA 3ICEA 2IYTA 1ZNXA 3LA6A 3LBHA 3B82A 4RZUA 3I62A 1CJKC 1W36C 4KFTA 3VKHA 1TMKA 3Q72A 3B6EA 3I32A 4OHZA 3B60A 4C4PA 4TT3D 5JHHB 1DG3A 2B7CA 5DGXA 3QJYA 3B85A 4RD2A 1F2UA 3PUYA 2YOFA 2G6BA 3FKSA 4FI3C 2W2XA 2W6IA 5DI9A 1XD8A 2ZXUA 4IKEA 3M1IA 4FCWA 1JB1A 4G0NA 3IBYA 1F2TA 2OEPA 1N0UA 3GLGA 1ZAKA 1K6MA 1G5PA 4TYPA 4L15A 1JAHA 2X77A 3PG5A 2IYXA 4R71A 2J46A 2NTYC 1CKEA 1Z83A 2F1RA 4ZIRA 3WYGA 2AXNA 2IYLD 2A5DA 4D2IA 2R2AA 4D4MA 4G3XA 3NBFA 3QPVA 3QKRB 4B3XA 1D2MA 2V9PA 3ZJYA 2C98A 4IFBA 3GLIE 3L8ZA 1YZGA 3GLHB 2AFIE 1O3YA 2BWJA 1OLOA 3NG1A 3PUXA 1A4RA 4ARZB 2RHMA 5CM8B 5SZKB 4G01B 2O8BA 2JLWA 3VNUA 1OKKD 4JYCA 2YJTD 2OAQ1 2O8FA 2YOHA 2IX3A 3V4RA 1JI0A 3KKOA 2NQ2C 5HCIA 3IPXA 2ZEJA 3OIYA 4M1WA 3RYTC 3TVDA 2GXUA 2GZHA 3CBQA 4GNKA 2DR3A 1VYVA 3LWNA 1F2TB 2GCOB 3K9HA 3PJRA 4Q9HA 4WZ6A 2VL7A 3IGFA 1OXTA 3AVUA 1YR6A 1J99A 1Z08A 3BIFA 4PC2A 1IBRA 4Q21A 4HB4A 4IFEA 2WWHA 2XITA 4H9GA 5C46F 1E9SA 1T5LA 1OV4A 4DSNA 3BAFA 4BFVA 4M22A 2GKSA 3E5HA 2WICA 2OAP1 4RZ2A 1GRQA 4XD7D 1RVDA 1W0JA 2GEDA 2FSFA 3NTUA 2FJUA 3RWOA 3W5IA 4A92A 2ZRLA 2C78A 1GIAA 1J8MF 3BWDD 1Z47A 4LOAA 1MO3A 3LH5A 4AYTA 721PA 4JVNA 3BORA 3RHFA 4ZCIA 1Z0JA 4PZYA 2FG5A 1ZCBA 3LXRA 3LRPA 1KK0A 1G16A 4HAUA 4GZMA 4E07A 5FL7D 1YJ5A 1FUKA 1E2PA 4B2IA 3DEFA 3M6AA 4M9XA 3HJNA 3IEUA 1Q21A 3T5GA 1I4LD 3IDQA 1M7BA 4D4LA 1MOZA 2DHRA 3BBPA 3MJHA 3KJHA 3TJZA 1CU1A 4JVSB 1R0ZA 2OXCA 4FWTA 2YWEA 4G5SA 4XH9B 4ON9A 3LW8A 2OO7A 3FHCB 4PC6A 4C7OB 1QDEA 2IYQA 4MYHA 2VO1A 4ERNA 5FOWA 2GK6A 4JL8A 3UKDA 2YWHA 3RS2A 4IHQA 1G3UA 1ELOA 2ZR0A 121PA 3ICQB 1FP7A 2TMKA 2V1UA 3AKCA 1E2IA 1GUAA 3L43A 1AZTA 1IY0A 1MO6A 1X8JA 1P73A 3E70C 4Y0AA 3CRQA 1TNDA 1T8TA 4BECA 1R5BA 3TR5A 3I3SR 1NG1A 4C0HA 1TQDA 2JLQA 4URZR 4PZLA 5D3QA 3UXMA 3C41J 3L0SA 1E2JA 5KO2A 3QUSA 3NDPA 5AUPB 5LD2C 3FYHA 3DOEA 2XEXA 1W0KD 3KQNA 2JDIA 3ASYA 3AF4A 3LX8A 4DLRA 2ZSEA 4UJ5A 5H1YA 3W3AA 5HKKD 1KZ7B 4AY2A 1ZM9A 2YV5A 3A4LA 3NEJA 3GEEA 1VHTA 1VHLA 1FTSA 2XAUA 1JR6A 2QROA 4O2LA 2ZR7A 1SHZA 1DAMA 4DLUA 2NOAA 2FPLA 4RSGA 2IS1A 3AKYA 3GMTA 1D8TA 5IF9A 2Q6TA 3GJ3A 3PEUA 2HLDD 4OJKA 4N0DA 1KDRA 1GDDA 4I1UA 5JJLA 2UZIR 1H8EA 2JIZA 2QBYA 3FFBA 1NIJA 2FFAA 3BB1A 4OQLA 3SNHA 3SQWA 2D06A 4WA7A 1UEIA 3OZXA 2G83A 5KOYA 1N6IA 3BFXA 1E9CA 3DZDA 3FMFA 1EXMA 2C04A 3VR4A 4MA4A 3CH5A 4KFRA 4W5WA 5AJXA 1JXOA 3A1UA 2C96A 5DI3B 2Z0MA 5EP1A 1DBSA 2ZSFA 3AF2A 1NN5A 3SQXA 1P7CA 1MKYA 1KO8A 1XPOA 4P4SA 2XTZA 3AVXA 2ZIAA 4LYAA 2QORA 2WSMA 2O8CB 4M1TA 4GPTA 4DKXA 4KITB 5EUQB 2JLYA 2C9OA 2OE2A 2ONJA 1BMFA 2YINC 3ADKA 2OT3B 4A9AA 4UNNA 3U60B 2P6UA 2G1KA 5E7IA 5CK4A 3WMGA 3THWB 1TEXA 2HDNB 2WIBA 2ZAMA 3U7HB 3I92A 3NBYC 4FN5A 3U7GA 1S9DA 1IN8A 3I72A 4HATA 3TR0A 1Q1ZA 3GLFE 3BH6A 2ZU6A 5FI0B 4AC9A 4NCKA 4D0NA 5EZ5A 3FOZA 4H1UA 4NMMA 1U8ZA 5EXXA 4JLAA 1C4OA 4UNSA 521PA 1G5TA 2V7QA 4GI7A 3SJZA 4HAWA 2H8KA 3BFVA 2ZRCA 4ZI2A 1FX0A 2IT1A 3AVTA 3K53A 2MMGA 4C0QC 1M8PA 1TF5A 4LHVA 3LAWA 2GETA 1S3GA 4DCTA 3KTAA 4TLBA 4OI0A 5EE0A 1KO5A 1RW4A 3LNCA 3BOSA 1DARA 2DCUA 4Q03A 4NU0A 4V02A 5CLLA 5FL3A 2GZDA 2E9SA 2ZYTX 4TLCA 2BV3A 4DLSA 3WHLA 2BOVA 1YZNA 3VR2A 1OH5A 3BC1A 1ZC3A 2QENA 4ZDKA 3KQLA 2G3YA 4BQSA 5FBRB 2WSSA 2WKRA 4M1OA 1OSNA 4KLZA 4URWR 1HV8A 3IKJA 1NP6A 1YR7A 1KI6A 2CNWD 3QF4B 2JLZA 1J8YF 1Q1BA 4KBGA 1JXMA 1GZSA 2FMXA 3MWYW 2O8CA 1GAJA 3M0EA 1NI3A 1XXHE 2JLRA 2WMOB 1BYIA 1TX4B 5HPYB 4PX9A 5FOSA 1PJRA 1S0UA 1K5GA 5KU1A 4MKIA 3U3RA 5KDDA 2C2HA 3BH7A 1XFAA 4B44A 2VSOA 4DDWA 1VIAA 1Z2CA 1HE8B 1U0HC 2YNMA 3KTAB 1W5SA 1XCGB 3R8FA 2QN6A 2F43B 4MUBA 1W36D 2AD5A 2WHXA 1RFLA 1N25A 4P31A 4IVPA 4YXWA 3TAHA 1XD2B 2A5FA 3QKSB 4E22A 1YR8A 4EPRA 3UANA 1G3QA 2H57A 2AWNA 1IN7A 4HAXA 1E1RA 5FH9A 1ZD9A 1P4SA 2AX4A 4M1YA 1O87A 3BGWA 3R7WB 1RZ3A 1E2MA 2HUPA 2ZSDA 1W49A 2QTVB 4Q1EA 2HJVA 2JJ2A 3I5XA 4MGKR 5GJWC 2FGKA 2OCYC 3QVVA 1M2OB 3K09A 2HT6A 1ZNYA 2O0JA 1ZUIA 5AJWA 4BFZA 4XVRA 3T12A 1AS2A 1T8UA 4IJMA 1L4UA 4LJ5A 1EX6A 4PPGA 3AV0B 1R7RA 2IEZA 2BJVA 4RD0A 2WJHA 3B5JA 4PTLA 2J5XA 4B2LA 1IN6A 1B23P 3NH6A 3UMFA 1CP2A 3N2EA 2WSSD 4BFYA 1CR1A 3JZAA 1P60A 5JI2E 4URYR 4GZLA 4B3CA 1A2BA 3TH5A 3MG9A 4BFWA 4XTRA 4AYXA 4ZDIA 4PC3A 1R4AA 1X1SA 4DEYA 4PQRA 2ZE6A 4V03A 2VBCA 5J40A 1OKKA 5KSYA 1XPRA 5K8IA 3QE0A 3RRNA 5E95A 4RJLA 3GJ5A 2BKEA 4D81A 4ZO4A 4LI0A 4LC0A 5SZHB 5E3HA 1BIFA 1G8HA 4JZKA 5G3ZA 3UIEA 1N6LA 4TMVA 2EFCB 2IF0A 2P6NA 2ZU0C 3FMPB 4AIIA 2GESA 2BBOA 4CDGA 1B0UA 3AGPA 2WOJA 3HYTA 4KJZA 4DLZA 4RD1A 4YXWD 4DB4A 4O3MA 2VF8A 1ZNWA 1KI6B 3WRXC 3RS3A 4QG7A 1OXUA 3DMDA 3GJ8A 5FI1B 3CPHA 5EE5B 4HLUC 2ORIA 1NMYA 4IDHA 4R2IA 3ETLA 3TAUA 3UWOA 1SXJC 3TK1A 2X2FA 1G4AE 1OHHD 1A7JA 2ECKA 4OJQA 3K0AA 3FWYA 3SJAA 2ZJAA 2DPXA 1G8FA 2CL0X 2JCSA 4KCGA 1FTNA 3LQRA 1TUEA 2NO7A 4MRSA 1E3MA 3WYFA 1J70A 3KUDA 2ZRAA 2OILA 1T0HB 2OFXA 1XMSA 2PZFA 2RGDA 2VHCA 1G1MA 3MLEA 1Z6AA 2RHDA 2J0VA 3DZ8A 4LV8B 4MGIR 4RKFA 5AR1A 2XJ9A 1Z6GA 2FEOA 2PX0A 2CLSA 2WMNB 4IDOA 5E7MA 1N0VC 3A6PC 1FNMA 4BZPA 1XJQA 2RKOA 3PUVA 2P0EA 4DT1A 1ZYUA 1HA3A 1SKQA 1W5TA 2O0HA 5EE9A 5LBIA 1P9RA 1JEDA 1Z6TA 2QP3A 4MYUA 5BN4A 1GL9B 1ZINA 3X1DA 3WNBA 4GDFA 1H8HD 1DEKA 1UDXA 4M9SA 2J0UA 3Q9LA 2BBTA 3KKMA 4B71A 1X86B 5AK0A 2FPMA 1PLJA 2QPOA 1K8RA 1E2NA 1SGWA 2QT1A 1XPUA 2ZYWX 1WMSA 3HU1A 4A2WA 2J7PD 1ZP6A 1G7CA 4LYJA 2QQEA 1ZU5A 2QSYA 1VTKA 3L82B 2W0SA 3FGNA 4TTRA 2C03A 4OI4A 3F0TA 5JHGB 2EFDB 2NO6A 5KSPA 5TXGA 4NPHA 4I1SA 1PLLA 4DXAA 2BMEA 2D7CA 1KYIA 5KNBA 4LBZA 3VAAA 2LKCA 3K70C 1KGDA 3W5JA 3NHBA 4PAOA 3MJRA 1KI1A 2QNRA 3SHFA 2QPTA 1G20E 3W8NA 1SULA 4DSUA 4CEJB 3FKSD 3QPWA 5DN6A 3GPLA 4JLPA 2ZYUX 4IEIA 2V4ZA 4YMTA 2OHFA 1YHNA 3WP0A 1OIVA 4A0GA 5EJEA 2XSZD 1Z3IX 3QNUA 4C0SA 3E2IA 1XP8A 5FPYA 2EYUA 2FSGA 4D4JA 4QBGB 5JECA 3ZD7A 4KO8A 4E03A 3VX4A 3O8BA 2GHIA 2VH5R 2ZYVX 3R20A 2WKQA 4JVMA 1G3IA 2VRWA 3PEVA 4D80A 3QKRA 2IYSA 3QQ5A 4KFSA 5HZKA 1XJCA 1KSJA 1R5NA 1MO5A 1S1CA 1XWIA 1P9WA 4KODA 1N6RA 3EPJA 3AKDA 3RSOA 2BCGY 4A6XA 1KSFX 2VHQA 3EXAA 2IUUA 3CW2A 3REGA 3OIVA 5EP3A 4PO8A 3U2QA 4MRRA 4N3NA 4NE2A 3H86A 2BDTA 2V54A 1FFHA 2PL3A 4HYYA 4LUCA 3OAAD 2AR7A 4HI0E 2D2EA 1PUIA 1TU3A 2WJVA 2RGGA 3B9QA 4UXIA 4M53A 5GJBA 2E1RA 2ZRIA 2GTPA 1VPLA 4CEJA 3ZH9B 1GWNA 2GBLC 1AS3A 2QU8A 5EE1A 3FKQA 3C5HA 1NG9A 4B48A 3ZDQA 1OW3B 4KI0A 1DO0A 4PHGA 3A8TA 3RWMB 1F5NA 1IHUA 3EA5A 3VR1A 4GOKA 1G8PA 3AP2A 5HZHA 4MITA 1OXSC 1KOFA 1XMVA 2I1VB 2OESA 1BO6A 4DWJA 1U8YA 4EUNA 1NN3A 5G41A 4AK9A 2W2VA 1Y63A 3L0PA 1BKDR 1FOEB 4M8NE 4YMWA 5DNYB 5KUTA 1LY1A 1CLUA 1US8B 4XSHA 2O52A 2QY9A 4EAQA 4JLBA 4HB0A 5JZVA 1IJEA 1KNXA 4DIEA 4NCNA 4L4UA 2R9VA 1T5IA 1D6JA 4PQFA 1E94E 3THYB 2ZJ5A 4DLVA 2OBNA 3OEEA 1ESMA 3BERA 1AJEA 3LQQA 3B1YA 5FPSA 2VP9A 2PT7A 2WV9A 4F92B 2JLXA 4TZ0A 4II7A 2GJSA 5TMPA 2ZRNA 1GG2A 3H0KA 4TYYA 3GLIB 1W2HA 221PA 2F1IA 2JASA 4JSYA 2HF9A 4LJ8A 4PXAA 1R0YA 1DELA 3CNOA 5GADl 1XDBA 1KI9A 4L5BA 1F6BA 2NO1A 2CXXA 2FFHA 2REOA 2IUSA 2ZUCA 2WOOA 2QUZA 2ZI7A 1NMXA 1W4AA 1XZPA 2WIAA 3N70A 4C0JA 4BRUA 4EDHA 4TMXA 1QHIA
chains in the Genus database with same CATH superfamily
4W4TA 4LY9A 3HMQA 1JJFA 1DRKA 1MNQA 1WW2A 2ZSUA 5JWHA 3ADDA 4LDPA 2GKOA 1E2EA 3B8EA 1N5IA 2WAMA 2WM3A 1XQXA 3QOYA 2ZCVA 3ROFA 4ER5A 3LIPA 4ZI3A 1DDGA 1CJVC 3PCRB 4DCSA 3NHUA 5IAOA 2HNBA 2R48A 2QN9A 4L95C 4BNLA 1FZTA 4J90A 2NXJA 3CF2A 3QF7A 4TMKA 5DLEA 5TQ2A 3WBFA 2JJMA 5MHTA 4PR0A 1YC2A 1HRDA 1Z2PX 2BGNA 3H84A 4M0CA 2YDYA 4KLRA 1SC3A 3AJRA 4WTOA 5ENZA 4D43A 3W9YA 2NYRA 4LDAA 3WR5A 4LCBA 4RCVA 4YBRA 4BVGA 4RXUA 5AIBA 1C29B 3RVOA 2GEJA 1Y5LA 2CDRA 2Q5HA 2O9JA 3L1UA 5F2OA 3IHLA 1QMGA 3N0TA 2TS1A 3OQ1A 3UJ8A 2WJ6A 2V0GA 1JKJA 3K4PA 3KKZA 4OHXA 4UAJA 3RANA 3AI7A 3VU9B 1PR6A 2WAYA 4XDYA 5HM8A 1M6WA 4NLLA 1GOTA 4TWZA 3QVTA 2YYYA 1DEOA 4B3MB 2VNKA 1XCMA 2WWVD 3VOAA 5KJ6A 1M8FA 5COBA 2QDKA 4JLWA 3NOOA 2N1MA 3WAJA 3W4IA 3CHYA 3B1XA 1L6IA 3QTBA 4MI6A 3Q7QA 5BRJA 5HMMA 2DY0A 2HADA 2YJ5A 3RBZA 4BLSA 3T9FA 2Z43A 4MRPA 2NM0A 4CLXA 3WK9A 2OGUA 5JPDA 2XMCA 2J3KA 1J2JA 4TXHA 4ZKEA 3D8NA 3W05A 4DRZA 3B48A 5BSRA 2QT0A 4I7EA 1UKEA 5K8TA 4DV0B 2C94A 10MHA 3GEIA 3PPVA 1PTKA 2FQWA 2R1TB 3I8OA 4A2QA 2ILVA 2R7AA 2ZS7A 4TUYF 4AJHA 4D8XA 7YASA 1RPZA 3HP1A 3A14A 3L7BA 4ZMBA 3LT0A 3UUFA 2V7EA 4ZEMA 4WKBA 1KDYA 3U44B 4YDHB 3REFA 2A0XA 3LPLA 2ZT5A 3FR7A 1KWGA 1PGJA 2P3QA 1NHGA 4QYTA 4RMJA 1V7QA 4BE4A 2WYIA 3DYIA 4I4NA 2XIQA 3IULA 1PEYA 1RKQA 3EF3A 3W3ZB 2R6FA 5KWJA 3CKKA 1JFVA 1LH0A 2A0UA 5L4NA 5HBGA 1ZBQA 1U7HA 1KYXA 1V3QE 1VJ0A 2E4ZA 2G36A 1BH6A 3A32A 4M9UA 4XDZA 1C7IA 1LVUA 1I3OA 1QFZA 5TX7A 5C1OA 5BV1A 1GFWA 3NU1A 2AI2A 3W5UA 1UBCA 4WV3A 4KO3S 2B1IA 1H94A 1G3MA 1PR4A 4G09A 1VLQA 4G8DA 3ZI0A 1FFEA 3BD8A 5K8VA 3OQHA 2DTXA 1HG0A 1S96A 3Q9NA 4NNOA 3NETA 3JAMA 3C3BA 1P1IA 1WHSA 3D4NA 3HCRA 5M29A 3L8MA 3WLIA 3OICA 1YS9A 4R31A 2FMKA 2Z4RA 1P0CA 4HSEA 1OB2A 2ZQYA 4UVEA 4UCQA 4KQKA 3DFKA 3M9XA 4F4HA 3EDRA 3VR6D 3KUCA 5GVSA 1V6SA 3N3BC 4W1PA 3Q2IA 3SVLA 5IDXA 5EL0A 3OM1A 4MINA 3DFZA 1B3BA 4Y2JA 5HVNA 4F7WA 1CHNA 3LO5A 3GVIA 4M1KA 5JG7A 3CW8X 1E99A 4F4FA 1SVLA 2PU7A 5AVKA 4P86A 4V1CA 4J03A 3GVPA 3SX4A 1NAHA 5KNLA 2EU8A 1XK7A 4WAUA 2J0SA 2XBUA 1XDDA 4JUFA 1TZBA 4MWSA 1C3JA 4NH4A 4WN9B 5DBIA 3TN7A 3ZVMA 4EABA 2NZVG 1I7QB 2C84A 1P5ZB 4ZT7A 2XJ4A 1OMOA 2HB6A 1ZOOA 3IEPA 1BVUA 1JR3A 2HMWA 2Q2VA 1WB5A 3GGOA 5D85A 5CLGA 1GQSA 1O6CA 1CQWA 4X00A 2G08A 3UXYA 2GNPA 3PIRA 3G17A 3WB2A 5IZ4A 4D96A 4I5EA 5ILQA 1TM2A 1N2GA 3D8SA 1X77A 3UHPA 5KNCH 1DO8A 2CUZA 2C42A 1CZNA 2VSFA 1PJBA 2X0IA 4JGIA 1HKUA 2C4TA 1UXJA 1Z4PX 2IEYA 2YV2A 3KLNA 5CLQA 4FVTA 1OR8A 2VYQA 1AUPA 1UK6A 3PF9A 4LK2A 4MO2A 3PXEA 2XNJA 1PQYA 4AS1A 3Q3IA 4MB6A 2EJTA 3LUPA 3QWAA 5LQKA 1PCXA 2DHEA 3PFBA 3D3QA 4ISCA 4ABTA 1X1EA 3D7NA 1DADA 2QBYB 1YUMA 4QXOA 1NXSA 2JEOA 3EHEA 4QM7A 2ZSAA 4PYRA 3UO8B 3LF1A 3U09A 4K1LA 3IMCA 3NJ8A 2Q8PA 1K27A 3GEMA 4Q9JA 5JJKA 3REQA 2JH9A 3HVIA 2FYTA 4G0YA 5AP9A 4R9VA 4GG1A 4XB2A 4ESVA 4R98A 5D6NA 2OFPA 3JX9A 5GGYA 3H2YA 3GRUA 4ZQGA 2W6ZA 1VRCA 3M49A 2OG1A 4UNQA 4XPIB 1XTIA 3A2MA 3G2OA 4JXJA 5DNDA 1B26A 2VJYA 2VHEA 4YAUA 1FDVA 3ROZA 2XDWA 2QRLA 3COSA 4YT8A 2C5SA 2G8LA 4H08A 1VZ3A 3KVYA 1CHDA 2JVIA 1ISGA 3FNQA 1ZSYA 4FMDF 4ITUA 4UAVA 5U1PA 3TTUA 4AKEA 1EXDA 3K2EA 3KNZA 2KBEA 1RRGA 2OBBA 2PT9A 3MINB 4BLOA 4GOLD 1D1SA 4HMQA 1II9A 3OJCA 2IZ5A 4M9CA 3GD7A 3GLVA 1MN6A 2VBIA 3OMLA 3D5EA 3UMRA 1MOPA 3E3AA 1AKQA 1NNUA 2CJXA 1SHTX 2Q99A 4I99A 4RZXA 1TU4A 4PO9A 1FTQA 3PIDA 3AUTA 2IBTA 5B58C 2GQ0A 3MWJA 3FYUA 3NFRA 1DAHA 3ZY5A 4B9EA 3M5WA 3CUKA 5G53C 1WSWA 3JSXA 4YJKA 1S4QA 1BXGB 1I32A 4XDHA 4QZVA 2YFQA 4C22A 4MMZB 1LWNA 5MGNA 3T06B 5G0UA 2C7GA 1NV9A 1C2TA 2RAVA 4NDAA 4WASA 5IWCA 5BWLA 2BBWA 4H35A 1BVHA 3FPAA 1OUMA 1WABA 1SRQA 1Z34A 1VSVA 1B43A 3NTVA 3V80A 4E14A 4PX2A 5HOQA 2CF5A 1OE0A 3H05A 2QZSA 3C3WA 1TQ8A 2Q1SA 5K01A 3VNUA 2YWXA 4UNRA 1Z6XA 2H1WA 2ZIWB 4G0PA 2O54A 3I73A 1T0PA 1YD7A 5BUZA 5C1DA 4XXHA 3VA7A 2BTQB 5F7OA 3VKGA 1VMKA 2RARA 3IBGA 3F3MA 4DIFA 3ANSA 5IP5A 3CRRA 5DTRA 2GERA 4EGQA 2I1QA 3EZNA 1IEXA 1RHKA 1X6VA 1T3ZA 3EWAA 2P91A 5ICSA 1NRXA 2WUGA 4QFDA 3S2FA 3WMRA 3EGWA 3PGKA 3ZZTA 5CP8A 4LYFA 4B85A 3JQFA 1T6ZA 1VA4A 1T43A 2GPYA 3GEDA 1SUFA 5IBPA 5FOTA 1U7ZA 4BQRA 4CETA 4ESOA 2ID4A 1U31A 1VCNA 4M21A 2BIFA 3CO5A 2A2ZA 3O26A 4F56A 2QMUA 4NYJQ 1KJIA 1PJZA 3A05A 3MQFA 4AWAA 1I6LA 2GJ4A 1GZ7A 3OFNA 4I9UA 5B55A 1Q6YA 4KAJA 4DV6B 1PNOA 3GJ4A 3V1UA 4HQOA 2IYAA 3VHLB 3DHWC 3N2YA 2XGMA 4P5PA 1CXZA 2UZ3A 1Q50A 1U8FO 2RHBA 3C6QA 3PL1A 5TMBA 3A6KA 4CEHA 4IXNA 1R5OA 3EFOB 3KEGA 4WDRA 4Y7CA 5GJVC 3OJEA 5EC8A 3CCCA 3QUQA 4MKXA 4RHXA 3R6LA 2G40A 5CXUA 3QWIA 2EIXA 3IUMA 1T9GR 2QKYA 3OE4A 2FZ4A 4FBLA 4HAIA 3NBUA 4B35A 5F9HA 1ESZA 1GA4A 5DBOA 4K86A 5G4KB 3ZV3A 4PO1A 4EGAA 2IY8A 3DP9A 1U94A 1OT5A 4IUBS 1LSUA 1RWMA 4FHFA 4JT4A 3USES 5G4LA 4Q16A 3NC0C 3TSWA 1JECA 2QUAA 4DARA 1JHMA 1MDBA 4JD5A 3L46A 4EI9A 5B3KA 2VAVA 3R6DA 3AESB 1E9DA 4MVCA 3S40A 3LMKA 4KR6A 4G9BA 4LWQA 1EP9A 2AHOA 3NBXX 1YBFA 4QO7A 3B3FA 3V2IA 4EG1A 3O47A 3UH1A 2I9PA 3EIHA 4MW2A 3H1FA 2ANCA 2ERCA 1H2XA 4R1MA 4OP2A 5LMCA 1QO0D 4F4DA 2OKGA 1C1XA 5EJFA 1X0XA 2J7PA 2X86A 3ENQA 2Z3ZA 2A7XA 3NRBA 5GONA 5HCUA 5IDWA 1XNGA 3GLGE 1IXRC 1SCQA 2BM0A 5LP6C 5HKAA 1JJAA 4S3MA 5I3ZA 5FWXA 3H4MA 3FWZA 1NIPA 2W0MA 4IXWA 1Z5ZA 4JSRA 1QTQA 1NJ6A 3H9QA 1I10A 1BHJA 4O5AA 4PSDA 3OFVA 4AY3A 1QIHA 4D5GA 3K9CA 4V0OA 2BTOA 5T3UA 3O1HB 3QTLA 3TZEA 3WYAA 5IJWA 2WWFA 4TX1A 1YDMA 2D1TA 1CQXA 2JFWA 2Q8NA 4QUHA 2NUBA 2IEIA 3HLTA 5HRUA 1UPUA 4C0BA 1XXHB 3HVRA 1DAFA 2HTEA 3EIUA 2QAGC 3U7FB 5HUHA 3KOWA 3UW1A 4RA6A 1T10A 2OCBA 2GCIA 3AFOA 1CUIA 1MEEA 3JCZA 3W8RA 1BFUA 2IV3A 2WJWA 2DVMA 5LDDC 1VA5A 1A2KC 4XVHA 4MVJP 4IUYA 4YR7A 1V8PA 2BGLA 2PBFA 1GQ2A 2HIHA 1PGPA 1K5HA 2IODA 1ONNA 3VR6H 2FWRA 2D74A 3TMYA 3ZWPA 1J20A 1Y6GA 4GH5A 5LM3A 3ONVA 4L9AA 1MXHA 1J9GA 1I6KA 4KQEA 1NMEA 3RBAA 3WB0A 3D3WA 4BFSA 2ZI3A 3EGDA 3H6GA 4ITRC 5LP1A 1MHTA 3CSDA 2ERXA 2Z57A 4PGAA 4QGSA 4YI5A 2B5VA 1KJZA 4FIDA 3QWHA 1JSZA 3QEKA 4AJEA 2UYYA 3CF6R 3DFUA 1GCUA 2P35A 3IODA 1QO0A 1SU7A 4ZXPA 3CWQA 3SICE 3QP9A 2EL7A 2ODBA 4D98A 2NVWA 1EFUA 1CZOA 3BHNA 4C08A 4MDFA 1D8AA 5FJIA 1FUIA 2C7BA 2GBPA 3ZV6A 1ND6A 4ASUA 4UHHA 1PBNA 1XRLA 5EQJB 4AG5A 3CLSD 3I53A 3F6SA 1NQUA 1AGYA 2F1OA 4W1QA 1VXRA 3AZPA 3E22B 1RFGE 4KMMA 4P5EA 4ZDWA 4DV5B 2FP4B 4TN5A 4KU4A 3MAAC 5FWXB 1NI4B 4B7UA 4HC4A 3FTCA 5YASA 1TAQA 2RGXA 1IN5A 3DQQA 1EFRA 2FN4A 4RPKA 3ASZA 3EDQA 1GYPA 4YJ2B 4MCIA 3QPCA 5DNUA 5IT0A 4D6XA 4JKYA 3CRZA 4I6EA 2J1LA 1W7AA 4FM9A 2JGRA 4NJOA 2CJWA 3WDMA 2I2XB 4XQ0A 4C5CA 1YE5A 1XVUA 4I1VA 2C0CA 3OZDA 4HADA 1TEVA 4TKUA 1U9CA 5HS6A 1AXGA 2CBXA 2TSYB 2M6SA 1GPNA 2XWPA 3AU9A 5IXJA 4CV2A 4MICA 1CEXA 5KSOA 4C3ZA 4HRYA 3S1AA 4AULA 1IZ9A 3AW9A 2DQ4A 3WBBA 2MDTA 1DAEA 3SN6A 2PL1A 4V0SA 1J33A 4AJNA 4F6CA 4MUHA 1W9HA 3GEHA 1F4PA 1CETA 3CNHA 4NE9A 3THRA 3ROMA 4BLVA 4BLQA 1ZHFA 1TGVA 2Z1MA 4P33A 4D6PA 1CUYA 3OZCA 4E5KA 1H85A 1UEJA 1VBKA 3QWFA 3UWKA 1OX5A 2VDKB 2XCUA 3KB2A 4MCHA 4Z53A 2GH1A 3L0IB 1Q91A 1VIDA 2FZCA 2MOKA 5IXYA 2JIRA 5KINB 2VG8A 3MPUA 5IWAB 3R9XB 5LP6B 1PT5A 5HR5A 3NVDA 1AX9A 1AKUA 2VDMB 1H9CA 3DGEC 3JARB 2IDMA 2JI6A 2QNBA 1DZIA 3BMCA 3TIFA 4LMBA 2B83A 3OT1A 2E89A 1EDDA 2Z08A 5ER6A 3FG9A 4IOJA 5HE9A 2UAGA 3GNSA 3BMOA 3D7MA 4MVXA 1JB9A 4OK6A 2Z58A 5JAIA 4MQ6A 4FGSA 3T1TA 1S2GA 1ZN8A 1GAQA 3SSNA 3W2TA 1R37A 5TDHA 4EMUA 3GPDG 1D7AA 2HAEA 1N2OA 1JKXA 2C0PA 2C5LA 1IEWA 1XZFA 3P4UA 4ZICA 4G0VA 2R7KA 4PX5A 2E4XA 2HYDA 4L0DA 1WDTA 1Q7CA 3V55A 3GFBA 4MVJI 3VR2D 1WKVA 1QHSA 4JEIA 5CM2Z 3MRSA 3RVJA 3R1IA 3AG6A 2CVHA 3DJFA 1RYMA 4D9KA 1QZ3A 4EHAA 1ST2A 2GF2A 3KU4A 4HTFA 2ERYA 2JGJA 1IBLB 1ZN2A 4QDTA 1DFGA 1A50B 1C7FA 1CT9A 1EVJA 5DIZA 1FUYB 3N2GB 3REQB 1OBOA 3L1JA 1F12A 3ABSB 3O2QB 2H0AA 3WBKA 1S6YA 1X9IA 4OYRA 1L5HA 1GN8A 3PGXA 2RJNA 3DDUA 2RONA 3K4HA 4B3TB 3FYTA 5SZIA 3LTEA 5IASA 1W59A 2C7QA 1CPYA 3HI4A 5EIAA 4BMZA 4YIHA 4MI1A 5E6RB 4YRNA 4JBHA 3MOIA 1LEHA 1Y3HA 2XZDA 4YCSA 5L6LB 3D1LA 1C1DA 1MHPA 5EHNA 4ZI7F 3WRYA 1QRUA 2QW1A 5ALKA 3MD9A 2XQVA 1XHLA 1IN4A 3TLMA 1FU7A 3QBEA 3O84A 2XKAA 2YVAA 2OP1A 2VP5A 3IJ5A 4N9QA 3RARA 3Q8XB 2QMYA 4MQUA 4DDKA 5HNKA 4R1OA 4DJJA 4E70A 4L5CA 4LYYA 1X8LA 1Z06A 2XYVA 2JBAA 2YN4A 4W5NA 4Q7JB 2YIJA 4PR3A 3KQTA 1GTZA 1OX4A 3R6WA 1A9QA 5CM9C 2XB4A 4HQ0A 3VUFA 3HVUA 3MIIA 2W9XA 2AQ8A 3KQQA 3FNBA 4P4UA 4X7BA 1J90A 2IE0A 4KXFB 3R75A 4GR9A 4CN8A 1I8TA 3SQMA 4RACA 3I30X 4GGMX 2FMFA 4FT4A 5K0ZA 3H8SA 2P2SA 3BQMB 2O0KA 2CJFA 3NOQA 1T9BA 2DC1A 3IXQA 4NATA 4UNPA 1HT2E 1KAMA 4BV8A 2ROQA 3E9ZA 3CT6A 3D6NB 4I0WB 3F3YA 2A5GA 2BMFA 1CBUA 1JDBB 2GTHA 2R6CA 2Y0DA 3M81A 4MAFA 4MOWA 3PVSA 4KXXA 4HB2A 1IXSB 4O2BF 4RNDB 4AN0A 2ILTA 5INTA 5IM4F 3EA4A 2VK8A 1KE1A 4QU0A 2EFEB 3L4JA 3AB7A 5FUVA 3TL6A 1DZ3A 3L6RA 2NUTB 3NWPA 4TTAA 3C16C 4GQAA 1HDOA 1PFQA 1XV5A 4F6LA 1C8VB 5IAKA 5K3CA 3KJIA 4HWRA 3KQWA 3OURA 3T5PA 1PDVA 2RAFA 3QVKA 1JHPA 1I4TD 5KKAA 3E27A 3UWPA 3SHWA 5EPEA 2IK8A 4EFNA 4XQGA 4TROA 1BJTA 1C0KA 3I3OA 4HDOB 1A98A 2OVFA 3TRDA 2RSLA 3H9UA 2JA1A 3WNDA 1EINA 1Q22A 3E8MA 3ZOZA 1QG4A 1RWVA 2DUWA 1T1GA 2FVYA 1SOWA 2IYZA 4RIIA 1RC1A 5DCYA 3MSXA 3WWZA 5ITZA 3RSHA 3O2JA 1M2EA 4XWOA 1I7SB 5IRCD 1E6CA 1MVLA 3UN1A 3NORA 5MN6A 4LC1A 2ZJ4A 3BIXA 3KOUA 4TKZA 2O0LA 3AEYA 1P44A 1QVRA 1N5KA 3COWA 5K5EA 2IOYA 1U8AA 2ZIXB 3AEUB 4JQYA 4OEHA 1N2JA 2B25A 2H4YA 4ITVA 3FRJA 4A1OA 1FMFA 1ISPA 4L9SA 4OGFA 5KTYA 3AW8A 3J81A 1FJGB 2PANA 4KGXA 2J41A 1C9DB 4BNDB 4EEXA 1OH6A 2IYYA 4UBOA 3I8XA 1QAMA 3ESRA 3MLAA 4PC1A 4PYMA 3TINA 2CNLA 1HETA 1VE1A 3K0FA 4D5EA 3Q12A 3T3DA 2A78A 4PEVA 1UXIA 2PX6A 2XHEA 3IPYA 4IQ8A 1U8TA 5KAMA 3C5WP 1TEHA 4G23A 4G0WA 5MDHA 2I8AA 2X13A 3SVTA 3L84A 4Q4JA 1ZVJA 3IAS1 5JARA 5GIPE 4YA6A 1W93A 3HUTA 1KY4A 2CFCA 1YL5A 1T1SA 3MERA 2KB0A 1XHEA 1ZIYA 3GQBA 3HPQA 4ENVA 2X6TA 1SVIA 4OGWA 5DX8A 3KHKA 1EQ2A 5J4YA 4Q7LA 1VL0A 4PS0A 1CIVA 3NM5A 1M6EX 1D2EA 2DKFA 2FPIB 1ESEA 1I51A 1IUOA 2OQ2A 2QRNA 5JXJA 1E3TA 1L7RA 3ZJTA 3VHXA 2WQ7A 2R00A 2BKAA 5AM1A 4MW9A 4F9GA 5CB4F 2XZTA 1XTRA 1Y33E 4ZN6A 4NDZA 4ZV4A 2V9CA 4MYRA 3DEIA 3CMMA 5TLSA 1KH1A 4XLZA 3NAQA 5ALIA 4A10A 1F8YA 4I2NA 5ITZB 1BN6A 5TJHA 4D9GA 1ZZEA 1TTHA 7ADHA 1UWCA 4QBHA 2LE0A 4EKYA 2QR2A 2VIIA 1OGJA 2RHWA 3FD8A 2FX2A 4PLHA 4LTDA 4CLHA 4BFTA 3ED1A 3EN0A 3I39X 4JEMA 4BJ6A 3D31A 2NUPB 2YXBA 1Z4JA 3DCJA 3I4FA 3LA8A 1ZJ4A 4RABA 1QG0A 2ZPTX 1FMLA 2WE8A 1EI9A 3AGQA 5KMGB 2GAAA 2UVQA 3GWZA 4Y2HA 3BMOB 4YJGB 3CE6A 5JOQA 4DUGD 3TVTA 1XN1A 4UM5A 5HIKA 2QD2A 2B5OA 2RB4A 3GYBA 4LWZA 4LZJA 4NSNA 4QRHA 2PGOA 2RHGB 4MUFA 1G21E 2EJVA 1BE8A 2JFHA 4IJ5A 1IEVA 4MB0A 2VF7A 1A4IA 4KLNA 4B6JA 3QJGA 3Q7RA 1MUUA 2O0MA 3C7KA 2FW0A 3O83A 4UTOA 3RNLA 3F5MA 4ALJA 1GRNA 3PNPA 1OIXA 2FU5C 3DQZA 3LZ6A 1OI7A 4NEHB 2YZNA 2CBZA 3T7TA 3WLQA 5LPNA 4DR1B 4FSHA 4V0LA 3P71T 3W5DA 3EXEB 3TAXA 4B09A 4ALMA 4UUOA 3HKBB 3MQ4A 3G0DA 4V1CB 5H5JA 5HKOA 1A95A 3OWHA 3B5IA 1Z8DA 2Q3HA 1SG9A 3ETGA 3EIQA 3AERA 4AG6A 4QPDA 3LOPA 2Q0XA 5CDFA 1Y4DE 3HKEA 4P58A 1HTWA 3VRHA 4CFSA 1L6RA 4JP5A 1HLDA 1HUQA 1PHPA 2GPBA 5C51B 4HS4A 4FLMA 4GKJB 4U7PB 1ZW1A 3RRXA 3X2FA 2O2ZA 4HWOA 1U3WA 2HX1A 4L16A 5BNIA 2R8RA 5JATA 3QU2A 5U9CA 2OXTA 1GGVA 3UCFA 4A6PA 1Y1LA 2VBGA 4JB8A 4K05A 3MS4A 4XQ9A 3V1NA 3FPJA 1C14A 1JR6A 1RQLA 1AQNA 3SXPA 2F3QA 3ASUA 3KQMA 4V3CA 4D4KA 2NU8A 4KJXA 3P96A 3DNPA 3RJTA 4TVOA 3S1AB 3ZLBA 1MORA 3CZPA 1V4NA 5CYGA 2ZSIA 1Q3KA 1KP3A 3E1SA 2OB1A 1E4EB 2V6JA 2JFOA 3K0CC 4X5OA 3NXSA 3INGA 2F00A 4W8OA 1WCIB 3I6BA 1WMBA 5CCEA 1NU8A 2VJCA 4JITA 1IUKA 1UJ2A 4NE7A 4RJJA 3ND7A 2GASA 3N9IA 3WI7A 1O6FA 3UMCA 2CHUA 1AZLA 1A2OA 2FPSA 2ZDQA 1P2SA 4RSHA 4BN4A 4X66B 1YDWA 4LHYA 4OFBA 3O8LA 4DNQA 4HAVA 2AJLI 4KH0A 4RTNA 1N6HA 1HFEL 2NZ8A 3V7NA 3LRXA 2IS6A 2Q2WA 1F3OA 1ZY2A 4IQ4A 1N1DA 4DBVO 2GN9A 1BJKA 4CLRA 3PHIA 3CUSA 1KTIA 2OSBA 5DXFA 3I4LA 2K7ZA 4RZHA 1MABA 1JHVA 1UKVY 1W5BA 4K40A 1UMCB 2ZJ7A 1CVLA 3H17A 3NHSA 4C7MA 3THXB 3KT3A 1FQWA 2E5FA 2LCFA 5CH8A 4LJRA 2Q6LA 4XJXA 2BPOA 4BZXA 5JNTA 4B34A 1GA1A 2X0KA 3MM4A 1TK2A 3AP3A 1XROA 3EPRA 4LXTA 4DA4A 1IJFA 1LDEA 5A4IS 4WOJA 2G9VA 4HF7A 4NQRA 1NL3A 1UZNA 4RTPA 1UBFA 4CQMA 3OM8A 1Z2AA 1UODA 1WRBA 3CGGA 2ZITA 1D2CA 5FBHA 1GTSA 2J3MA 2DWCA 2EVWX 3GMIA 4KN6A 4MVJA 1I33A 4KBYA 2A92A 5LOVA 3H11A 3ISJA 2HA4A 3HDGA 1T26A 3QKUA 3ZTYA 1QH9A 2R7LA 1JFRA 1XQ9A 3IHWA 4HEA1 1OLSA 2BSAA 2V96A 2TRSB 4QBTA 2IV2X 1EP3B 2N1BA 3SC3A 2BEKA 1VZ2A 3CUEF 3KFXA 4FHDA 2PMEA 3V1MA 4CUZA 1W4BA 1OYYA 3IP1A 4FKBA 2FWMX 4FONA 4DIDA 1UAYA 3IO3A 2NO0A 4NBSA 3UOGA 4FFRA 6Q21A 2VBFA 1OXVA 4X6UA 2WWIA 4H3SA 1WEHA 1AOXA 4DCNA 1DJQA 3DBIA 5BSGA 2O05A 1OFUX 1UOEA 1ZM4A 2JFXA 4NZYA 4BO0A 1R9GA 3K9GA 4HUQB 1KMQA 2HN9A 2PYIA 2CUNA 3JALA 2C2WA 5EERA 1AUVA 4MEJA 1J5EB 4L57A 4TQUS 1WXIA 4Z4CA 2QZJA 4YRIA 1IXYA 4BKMA 1B8PA 3QEJA 4W7IA 5JJIA 4L0QA 4E5YA 2JZOA 2Q5JA 4N0QA 3UVEA 1R0XA 4QQFA 4M7RA 3CN7A 1Z5NA 3ZWNA 2IIVA 2CD7A 1Y9AA 4I8IA 4NU8X 4FFDA 1T0BA 4HBZA 5EJ6A 1IPEA 3SBDA 4QHSA 5EXPA 2X9LA 3TQHA 1XCBA 4C6TA 1GJRA 3AR8A 3OLCX 4MUNA 3TBKA 1JPNA 5EWJB 3K2BA 5FB3A 2X19A 2YW9A 4Y3UA 5F7XA 3V4VB 5LSAA 1G55A 1ICEA 2YICA 3GLRA 4K9KA 3COYA 2HBZA 5IH7A 4M1EA 3JD0A 3JATA 2NYVA 3U9SA 2FXIA 1LX6A 3OJFA 2R65A 2PG3A 1DCKA 1TA9A 4MUEA 2OY0A 2AMYA 4CCWA 1DG9A 1S3IA 1NVUQ 1UC9A 2AZTA 4WXRA 4PCUA 3A9UA 3C1OA 3ACBA 2NSDA 2VQSA 1J0CA 1VJRA 1NNLA 4Q1VA 4JBLA 3B6MA 3OO1A 4G2TA 5BQ5A 5KPDA 3U6KA 2ZRDA 4HY3A 3VV2A 5LMNB 1WXEA 1P5JA 1VG0B 2H17A 3M5PA 4Y2YA 4ZVVA 3T4EA 4AW9A 3JYPA 3AXSA 2J6HA 5AW2A 4LXQA 4HLDA 2JIDA 3C7DB 3RS5A 4G63A 3ZNOA 4EUHA 5LYJF 5KTOA 2J45A 2Y0PA 3HUFA 3I2FA 3JR3A 2BLNA 3GEBA 5ECDA 1C0PA 3QSGA 1FX1A 2V7BA 4FZJA 4Q7KA 1ZK2A 1E2GA 4KRGA 2ZRHA 2F3TA 2Y3IA 1XF1A 2C1ZA 4HNRA 4D25A 3QM1A 1LK7A 3Q4GA 5I5GA 1LV7A 1LS1A 1PR1A 1LJ8A 1U04A 5D7NA 2X0RA 2AJBA 2REXB 1E2FA 4DQUA 1YVRA 1SXJE 4WBXC 3HH8A 3BN3A 4LFCB 1UZUA 3PUZA 2XCLA 3EPPA 1W4LA 4X3PA 5AK4A 4EHHA 4KSCA 3M4NA 5CBPB 4BO5A 4TSFA 3C6KA 4W6ZA 1RRPA 3QY0A 5BORA 1DU4A 5LKRA 3ABZA 2GILA 1GPMA 1KI3A 1KYYA 4KR3A 1SCUA 5L7YA 1Z2NX 2OBLA 2QQGA 2OHOA 4LV6A 2R2GA 4LEIA 3I8SA 1KYVA 4Y2XA 1O97D 3C48A 5AVWA 4XQCA 2YYZA 3PT5A 4NONA 2HYIC 2CXRA 1UMDB 1BOFA 1DBPA 2Q6OA 3DV0B 3QYAA 2C07A 3SLKA 3FRHA 3HDTA 3ZQJA 4V0NA 1ORTA 3OE7A 4Q9LA 3FYUB 4LMRA 4RQBA 3KHTA 1DX9A 1M7GA 2R5FA 1SKYE 3IB6A 4IKOA 1Z73A 4L6AA 1AC5A 3FDIA 4TV9A 4WJLA 2SICE 5A5DA 1GKLA 1T91A 3N75A 3T15A 3PEWA 2GM9A 1R3DA 3AVQA 4OQFA 4L0MA 4W5HA 3FMOB 1XZJA 3OU6A 3STTA 4GZ5A 2YY6A 3O93A 2ZYHA 4G4IA 3Q85A 2CJPA 1A7KA 2H3EA 2XV1A 5F3DA 3BMXA 2FP3A 2AFVA 3QFTA 2YIVX 3CRNA 4IWNA 4YAJA 4B31A 4EATA 3HG7A 3HWWA 4OHBA 1B74A 5JY1A 4Z1MA 2VSYA 4GOMD 1TZJA 3RCBA 4EGFA 3B20A 2GN1A 4FW9A 5EIFA 1E3LA 5AW6A 4ND7A 1TCVA 4I66A 1DTSA 3ZGYA 4K3VA 3WSVA 1XEXA 3ANXA 1N0HA 2Z2JA 5IT9A 4F1WA 5EMHA 3D8BA 2QN3A 5GV8A 3D6HA 2XQIA 2M1ZA 1ZCFA 2C4HA 3F5FA 3QVWA 3W1VA 5A3JA 3OQOA 2SKDA 1IM8A 1G3RA 2DJIA 1Q1QA 3T34A 2V4MA 5B1IA 3G5AA 2ASEA 3QEAZ 2H92A 1CTQA 1P81A 1BKSB 3BK2A 4JOCA 4BQNA 5JS2A 2ATXA 1FPQA 1M2KA 2BM1A 3KT0A 2HGZA 3C3XA 5HX7A 1TCAA 5IHPA 4OL0A 1FCJA 1JG3A 2VNSA 2GM5A 2W00A 3HFSA 1BXRA 1II0A 1PV1A 1SVOA 1YDGA 4MR7A 2GVDC 3GELA 4QYMA 5U4XA 3CVYA 4PZPA 5LVAA 3H1GA 3QXHA 4NBKA 3H75A 2ZULA 3TW6A 4CM1A 3A2KA 1E4OA 2ZPUA 1GUDA 2DHQA 1SUSA 1TO2E 2D5IA 4PWYA 2I34A 1TVCA 5D5PA 2C88A 2D5LA 3KJEA 3G2HA 3IX7A 5BQPA 2FY8A 4HVCA 1CB7A 1GXSA 4C4YA 3T7CA 5F23A 1BX0A 3N8HA 4PWZA 2B6NA 1YFLA 3UFBA 2TMDA 4LQDA 1T1JA 4K6CA 5CD9A 3R5SA 1XLUA 4YLEA 1HG1A 3T41A 5JDCA 3VU3A 2ACEA 3FPLA 3L7YA 3TZCA 4B43A 5CU7A 4N0PA 1GQOA 2WTBA 3FZYA 1XMIA 3OE7D 1YZLA 4MV9A 5HKKA 3QE2A 1XD2A 4NEQA 4A0FA 5HFAA 1NF9A 3ESQA 1KHTA 3JY6A 3C0KA 1CS4C 2H5EA 1H23A 4TMZA 4W7SA 3VC3A 3CH7A 2Q5IA 4GVPA 3ZHOA 2KSQA 3IUBA 2OHXA 2G82A 5AJZA 3RQIA 2VDWA 1NSYA 1ZK0A 5EKSA 5AVSA 4ZO6A 4G89A 1V6CA 2CGEA 3CLRC 1YRWA 2QVCA 1G17A 5A9TA 3ZQ6A 4QM6A 3F4LA 3N2KA 2CD9A 3CIFA 3DAFA 5JEDA 1R2QA 2I9KA 3T3IA 3NZEA 4HH1A 1Q16A 4J0KA 3HGQA 3TMKA 1JQLB 2PYZA 4DMFA 4EFLA 4DV3B 2EXXA 1E2KA 3NVMB 4M7PA 4YN3A 1ZWKA 4HX2A 4MVJG 4ZRDA 2HO4A 2HPAA 4TN1A 3PR1A 1CR4A 2I29A 4LWPA 1TVMA 2YCBA 2PZJA 1C7ZA 1RJDA 1KF0A 3GPCA 1O95C 2OORC 3ZLJA 3QX7A 3I6ZA 3K30A 3AM3A 1X7ZB 2ZIGA 5IK2A 1WUIS 2R62A 4LIPD 5CEFA 5ITSA 3RODA 3TG2A 3W90A 3LY7A 1GO2A 4IO1A 5ALNA 2I6GA 3C6XA 3TCNA 1DG1G 2GD6A 5JAZA 4HSGA 5DTJA 2R44A 4R7ZA 4QOEA 4OHPA 4LYEA 3RVMA 2B8JA 1IM5A 1X13A 2B9EA 4J7AA 1ZRHA 4CPDA 3EZGA 3EK2A 4ZCLA 4A0HA 4DSOA 4CT4B 4QNMA 3IUSA 2YYAA 1U3DA 3P0HA 1WXQA 1SB9A 4HEHA 5CDTA 1BHSA 3TZBA 2NP6A 5KYXA 2I3ZA 4PICA 4F38A 1YS4A 2J67A 1H1LA 2HRBA 3D4BA 3FUTA 2X5XA 2C77A 4PAGA 3BMCB 3JR7A 2QW8A 3E8XA 5ALYA 3LXMA 4H6XA 3VSDA 1JNXX 4E1VA 5K0LA 5A3QA 2UUAB 3KIPA 4OXQA 3KUUA 1XZHA 2CLCX 2FOIA 2E82A 2ANBA 2AFHB 2NX2A 2GN6A 1EUCA 2XA2A 2YWDA 3JATB 4G26A 4WJZA 4ZARA 2EAUA 4BV2A 1JQAA 1MF7A 3GD5A 2R8XA 4QARA 4BNIA 2A86A 4MUYA 3TPZA 2PMDA 3CF4G 5H16A 3TKAA 2G77B 3JASB 2FQQA 3L1KA 1UJBA 3B7GA 3JVIA 4BB0A 4P3XA 5COAA 3TLGA 5JSZB 1WMFA 3IURA 4PHCA 1K5PA 1RHMA 2V7GA 3M83A 4H1VA 4U5QA 2R8ZA 2NZYA 3U1TA 3EA0A 1CCWA 3PC8C 2VQ6A 3F96A 3G2MA 3IAEA 4LJKA 5KIAA 2FV8A 1NUSA 5E6UB 2EV9A 1W48A 4CMJA 3NBKA 5JH7A 4JI2B 5DJ5A 2IKSA 3I83A 4CF6A 3EE6A 2KW5A 4RLFA 4H3KB 4QDZA 1BC5A 1CVIA 3QG5A 1RQ7A 2R6AA 3GHYA 4UVIA 3VGJA 3GROA 4GP9A 2GZRA 3WGKA 5IG2A 3SJCA 3ZS9A 3BS4A 3G1TA 4DZZA 2W58A 1EM8A 4L08A 3IBTA 4LRTB 3MTDA 2NO9A 1TAGA 3ONEA 5CIWA 4MGEA 1P8JA 3T1VA 5HJEA 2YV3A 1DJNA 4YUVA 2A6PA 1X3SA 1WP9A 4PFJA 5EWLB 1AMNA 3MCAA 4NS4A 4NV0A 1UBOS 4FYWA 2IBSA 2H1LA 4MMXB 4NPCA 3WAGA 4PCAA 4BC1A 5AW4A 5HWSA 5IEJA 2D1QA 3ITEA 3SPXA 3GNTA 4M0EA 1Z18A 1L4GA 4DREA 3VNAA 1SXJB 3VYUB 2JD1A 5DNVA 3ANMA 2PNJA 4OK3A 3HNPA 4DN6A 9GPBA 2D8AA 3F67A 3C15C 1FE8A 2OGZA 3UK7A 2PPVA 1BN7A 1P7ZA 1NUUA 3P2MA 4DVJA 3SJ7A 5LJLA 1QMPA 2E1PA 4GMXA 4AG3A 2W90A 1M5UA 1NBEA 1K86A 5JZBA 1U9IC 4ZQFA 4Q82A 2DKNA 3R9WA 3GXBA 2OWDA 4QELA 2IY7A 3IB3A 2JCGA 3LLMA 2QS9A 2IRWA 3CFYA 3NKFA 1T5SA 5FTMA 2RIRA 3OWXA 2DHDA 4GT1A