4XWYA

Crystal structure of human sepiapterin reductase in complex with an n-acetylserotinin analogue
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reduction of Neuropathic and Inflammatory Pain through Inhibition of the Tetrahydrobiopterin Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xwyA00
1JKJA 1P1RA 2FMUA 3WYBA 1GD1O 3S2EA 4K6FA 4GMGA 1ZK2A 4NH4A 3S2IA 3OQ1A 1EEHA 2H63A 3OIDA 4PFJA 5JAZA 3WB9A 1GY8A 5K6AC 4MVJA 3ONFA 3PFFA 1PL6A 3I1JA 1ZXBA 1DIAA 3OEWA 4Q3BA 5I7EA 1MFZA 1PWXA 8LDHA 1L7DA 3ZWAA 3NTOA 2VHWA 2VZ8A 1CWUA 3DBHB 3U4DA 2BRUA 4IDDA 2FR0A 3QWIA 3HSKA 4NBRA 1XCBA 4JK3A 4YAJA 4NPCA 4HY3A 1G1AA 1YQGA 4MP8A 4DYDA 4UVEA 1QG6A 3K92A 3P5SA 3VPGA 4E30A 3GQVA 3CPSA 4CL3A 2J5KA 1DHTA 2Q2WA 1I3LA 4L76A 3WIEA 3SEFA 1B2LA 4YAGA 1H94A 4QFCA 5G4KA 2BMAA 1ZK1A 4WUVA 5CDYA 5DCUA 5KVSA 4CLRA 5JO9A 3WQSB 4KUGA 4U7WA 1PZEA 5CDGA 2Y1DA 1PWZA 3RUAA 3L4SO 4XX0A 4NNJA 2H5LA 4KMSA 3WMWA 4EDFA 4CMGA 4GVLA 4CQMB 1PGQA 3DBLA 3TF5A 1M76A 1X1EA 4XYGA 2NNLD 3RFXA 1U3WA 4W99A 4BMNA 2ET6A 1Q7CA 3H3JA 4U8GA 1AGNA 2I6TA 4ZQHA 2O3RA 4DWVA 5LCXA 1GQ2A 1X7DA 2EEZA 3HFGA 5ICMA 1E0DA 1AN9A 4FJ1A 4CLOB 5TSDA 1YDWA 3UAGA 3IC5A 2O50A 5BQFA 2ZCUA 4QT0A 4N5MA 3ULKA 3RQSA 5IF3A 4UUMA 3WLFA 3TFQA 3OECA 4R68A 3WICA 3U4HA 2YV2A 1I2ZA 3H9GA 2HK8A 2AEMA 2CMDA 2FHSA 5IN4A 1PJBA 3I52A 4OM8A 2C7GA 3FWZA 4E3ZA 4P4LA 2AMFA 3LT0A 2Q46A 4ZQBA 3S8MA 3AOGA 1KETA 5COBA 3VHRA 1NYTA 4E5KA 3T7CA 4WJZA 2GN4A 1HETA 2JAPA 2R2GA 1E1KA 1ADGA 3FHLA 3DZBA 1S6YA 4DRYA 2I5PO 2DBQA 4OOFA 3M1AA 4W9NA 5A9SA 4GX5A 1YWGO 3HNPA 1NWHA 3Q1LA 3GVCA 4P38A 2OORA 1N1EA 3PJGA 4PVDA 2IYOA 3PP8A 1YXMA 1DC5A 4TRNA 1VLLA 2C2XA 5KJ1A 2I99A 3QA9A 1ML3A 2AEJA 4ZICA 4UULA 4UUPA 1E3LA 4ESOA 2B35A 2ZJ1A 3WYCA 2DPHA 5EN4A 3C85A 4J43A 4DC0A 3QIVA 3H3FA 1QLJA 1U3TA 2PTGA 5C7LO 2X0RA 2IZ0A 1ZMTA 1W6UA 3WGGA 1JAYA 1UAYA 1NVGA 3RIHA 3EZLA 4NBVA 4INAA 2BELA 2EHDA 1KVRA 2Q50A 2EKQA 4J49A 2EKPA 2ILTA 4CLRB 4QECA 3H5AA 5CEFA 1DC4A 4TZKA 1BXZA 2C2YA 4E2ZA 4E5MA 4MVJP 3I4CA 3PLNA 2Q49A 1XIVA 1KS9A 3DHYA 3AOEA 2CDBA 3DAGA 3PXXA 4LW8A 4OAQA 1GUYA 2BFAA 4WASA 4BO6A 4B7CA 4F46A 2GNAA 4CMEA 1EMDA 1LC3A 3GFBA 1XDWA 2O2YA 2OFPA 5JS6A 3OM9A 2G1UA 2P68A 3IP3A 3HQ4O 4W82A 1L1FA 3FNEA 7MDHA 1ZZEA 3UXYA 2D3TA 2GRAA 4KTVE 4XWYA 3VKUA 1KEUA 2YHIA 3EW7A 4BOYA 4CMKA 1HDXA 2SCUA 2J5QA 5CPFA 2A35A 4PCVA 1LLQA 3JQ7A 1LSUA 4EJ0A 3OIGA 2DM6A 1YOVA 2B5VA 4RLHA 1UP4A 1B0AA 4PZDA 2G76A 4Z0HO 5IN5A 4AFNA 4G5HA 5JAIA 4YB8A 3H9EO 1GTMA 4IDEA 4OL9A 2R00A 4CM4A 4N54A 1AHHA 2CF5A 3H5RA 4R4JA 1E6WA 3KEOA 5ITVA 6ADHA 4FFOA 4HUJA 1U28A 2EG9A 2YV3A 4L74A 5BSFA 1QMGA 1M6HA 1WVGA 1I0ZA 1X1TA 1YL6A 2LDBA 3TL3A 4B3IA 2WYWA 2X4GA 3D1LA 1U3UA 4BKOA 4MJLA 3JQ7B 1NFQA 1SNYA 3JYNA 3PGJA 4BNFA 4IGFA 2HJRA 3DZGA 3WFJA 3ZHXA 3D4PA 3WGZA 4B79A 2C07A 1NHGA 3OFSA 4UVHA 4XKJA 1F14A 2H9IA 2QRKA 1EUCA 1YO6A 4FJ2A 1FXSA 4AJ2A 4J90A 3VDQA 4Q3DA 4J9VA 1VKOA 3I5MA 4CM4B 1MGOA 4NU5A 4I5EA 4B3JA 5DN9A 4UUOA 1WMBA 1U7HA 3ZWCA 2PZKA 3EVTA 3PK0A 3IUSA 4CM1A 1DO8A 4BGIA 2BGLA 4WKGA 2C7VA 1EFLA 2EKLA 3ONDA 3RAJA 3AI3A 4YJDA 2GN6A 3DZFA 3C7DB 1EE9A 1I10A 2JHGA 2IXBA 1UXGA 4WCDA 1WZEA 4NDNE 3BHIA 4CR6A 1Y1PA 3C1OA 1EQ2A 4CV2A 5DOVA 1EDZA 2EGGA 3JD1A 3GMSA 3NV9A 3KHUA 2AQIA 3LT4A 1YJQA 1SO8A 2DQ4A 4W7HA 1B3RA 4U0JA 3ZNNA 4IDCA 3RJ5A 1LI4A 2HK7A 2DKNA 2HAEA 4Y6RA 2B69A 3L4BA 3V1UA 4YT8A 3BAZA 4NFYA 2AQ8A 4E2XA 5A06A 3L6OO 2CFCA 1V3TA 3RUIA 4OSPA 3E9MA 5FFFA 4A5OA 1P1KA 5G2OA 3TZKA 4C4OA 3JQDA 5DF1A 3L07A 2ZTMA 1P33A 3I9KA 4NJMA 3F47A 3GA0A 5THKA 4B8ZA 1B26A 3IMFA 5TIIA 3OH8A 2HMUA 2P9GA 1E1LA 2PV7A 2FZEA 3I23A 5HS6A 5FWNA 4B4WA 3JCZA 3WYEA 1BDMA 3AFMA 4IIVA 3VH2A 3T4EA 4C7KA 4I1IA 2VTDA 1EUZA 3RFTA 4CMEC 3GVHA 4N18A 1EUDA 2YYYA 2HUNA 5IJZA 2ZYGA 2JCVA 4B8WA 2YV1A 1LDMA 3JYQA 4HNHA 1NVTA 1GCUA 3DBHA 3BTVA 3G1UA 4YAKA 1X0XA 3E9NA 1LRKA 5ENVA 1UH5A 5TC4A 3G79A 4A27A 4DVJA 1ENPA 2X58A 2GERA 1M66A 4UVGA 3D0OA 4E4YA 4R1TA 1NPYA 5A3JA 3KB6A 4J1SA 3RKUA 3PWZA 3W8EA 4PZCA 3LYLA 5DT9A 1KVSA 4Z9YA 5C3MA 4IDBA 4ND2A 1SB8A 4ZJUA 1XQ6A 3AUUA 4NQZA 5BSEA 2JCXA 4Q39A 4RCVA 2CVQA 1GQYA 2X0IA 1RKXA 2VN8A 1WDKA 1N2SA 1EQUA 1QORA 1GDHA 4O1MA 2CUKA 1LNQA 3BZUA 2V7PA 3JQCA 1YVEI 2X5OA 4NK5A 4WCFB 3ZCXA 1LLUA 5IZ4A 2ZIZA 1HXHA 4XCVA 2UV8A 4U6SA 1LDEA 2YW9A 5DCWA 4XEHA 3GEGA 4FFPA 3PDUA 1E7WA 1Q7BA 2AE2A 1V8BA 2P2SA 2D59A 1JLLA 3TOZA 2VCYA 2QG4A 4ZHSA 5TJ9A 4BNNA 4EEZA 2FR8A 1IUKA 5JCXA 1HDOA 3A28A 3KYCA 3M6IA 3PGXA 4M87A 1WAMA 2J5RA 1GYRA 4QTZA 3KLPX 2DTEA 4CM9A 3ICCA 1OZAA 4QX6A 4AG3A 2VWPA 3NJ4A 5BNIA 4OQYA 4QQRA 4GVXA 5KWEA 1FDTA 7ADHA 4YACA 3FPCA 1X7GA 3KTDA 4W4TA 1D1TA 2FOIA 4M54A 1C1DA 3W4IA 3A4VA 2CY0A 1R4NA 1D1SA 3GUCA 4WECA 3ZU2A 5JFOA 1R37A 4A2CA 1YB4A 1E3WA 2C82A 2X0NA 1BTOA 2O3UA 4OIMA 4R51A 3DXFA 4JJIA 4OKNA 3GZNB 1WPQA 4DPLA 3QVSA 3DZIA 5L4LA 1ZKMA 1NNUA 2PH5A 4FGSA 5HBRA 4J7CA 1LSOA 1O89A 4ID9A 1HSZA 3CZMA 3WWZA 3K5PA 5AYVA 1GZ3A 2RH8A 1KEPA 4NHEA 1H2BA 3WNVA 1U8FO 1WW8A 3NEPX 1OMOA 2QRLA 4FD3A 1YBMA 4XB1A 4Z9XA 1A5ZA 1P1FA 4ZQEA 4AL4A 3KYCB 3TWOA 3ITKA 3LZ6A 1N7GA 3X2FA 4CLXA 3WBBA 2FRDA 2D2IA 1PGOA 1BSVA 3C1AA 4TRJA 3ZZNA 3ABIA 1P31A 3PZBA 4E33A 2PNFA 1ZSVA 3AWDA 2ZTVA 2WMDA 1E7RA 1K0UA 2XOXA 4P22A 5U9CA 2HU2A 1R6DA 1I24A 3CINA 4MVJD 5JY6A 5CP8A 2Y1FA 2EP7A 4FS3A 4RVDA 1Z75A 1CF2O 5EQFA 2NV6A 3H2ZA 1N1GA 1PS0A 5DCYA 1HZZA 2E49A 1P9LA 4IDGA 3RROA 2E37A 4XYBA 2VQ3A 3WIDA 5KJ6A 1V3UA 1VE9A 3VAZA 4CQMA 3ROKA 4XIJA 3EYWA 4OXNA 4BKUA 4DPKA 1I3NA 1SBYA 5A9SB 1E3SA 2I76A 2JD2A 3JQFA 3BHJA 4R9SA 5F21A 4O5OA 1GPDG 3WDSA 1ONPA 3DO5A 3WSWA 1PJSA 3E5MA 3H9QA 3SX2A 4DIFA 1ZIDA 2X8LA 1K6XA 1LDGA 4CMBA 4ZN6A 5KJFA 5KJCA 3TDKA 4NG5A 1DHRA 4J2HA 4JP3A 4PG4A 4CM6A 1QYWA 2NTNA 2DBRA 3M2PA 3PPIA 1O94A 5A04A 4DXHA 4RJTA 1HDRA 5A03A 3GRKA 1NR7A 2HMSA 3ON5A 4CMAA 1U5CA 1PGJA 4J91A 1JAXA 5IDWA 3AM5A 2FPIA 5A4DA 1B8VA 1Y8QA 1YBVA 5F3RA 1B15A 1LSSA 4LMRA 3AI1A 4IQGA 1GYQA 1Y9EA 4YCAA 2ZB8A 2LDXA 4LMPA 3PHGA 4B4UA 3S55A 4ZD6A 3MWDB 2NQ8A 3R0IA 4HXYA 1MC5A 4RDHA 2Y1OA 1UJMA 4J1NA 1SOVA 5ITWA 2EW8A 3UICA 3GEDA 2PA3A 3DBRB 4YA6A 5GMOA 3WTCA 1NQ5A 4LISA 4FDAA 3A14A 3EMKA 3RCBA 1E5QA 4RF5A 3HN7A 2I3AA 4XGIA 1DIBA 4LK3A 5KIAA 1E1NA 1DDOA 1X14A 1UUFA 3WR5A 5JAMA 3WQQA 1NXQA 3DR3A 3ZWVA 4DREA 2BF7A 3NAQA 4TVBA 2PLAA 5JPIA 1YE3A 4XYLA 4WLOA 1EVYA 3TQHA 5K0ZA 4ND1A 3GUYA 2NSDA 3KETA 4PRLA 2VHYA 5TQVA 4YAEA 2HSDA 1UR5A 2FP4A 3GAZA 4GBJA 5ENDA 4AJHA 2DBZA 4D43A 1D3AA 3VZSA 3RWBA 1E77A 4M55A 2VTEA 2VHVA 4DMMA 3G1TA 4YT4A 1YONA 1PR3A 2EXXA 1GU7A 1S7CA 3WGTA 3AUAA 1AXGA 3JQEA 3LC2O 4FQ8A 1R4NB 4LRSB 3JQBA 3VPHA 3WGQA 3HE3A 1BWSA 4YR9A 5KVVA 1JVBA 3IP1A 3NTRA 5A5EA 3LC1O 2NADA 4YWJA 3ONEA 4ZU3A 2HMTA 1B16A 3QV1A 4Y67A 5HS4A 1V3VA 3RC9A 2IZZA 1C0KA 3VDRA 3DL2A 2W4QA 4L9RA 4RQUA 1DEHA 2JCYA 2EWMA 2O48X 2W98A 2GD1O 4A26A 2QHXA 3BMQB 1Y8RA 1VKNA 4MKZA 1CJCA 1ENYA 1YB5A 2HJSA 3OP4A 5B4UA 3DTYA 5JY1A 5I9LA 4K9DA 1WXDA 3ENNA 4E6PA 1ISGA 1AXEA 1KC1A 4MO2A 4Z0PA 4R3NA 3WX0A 5L4SA 3O26A 3ADPA 1JKIA 1LLCA 1A7AA 3FTNA 3GAFA 1LUAA 4K28A 3AU8A 4KQXA 1QSGA 2PK3A 2PD3A 1C1DB 4DBZA 4IBOA 3WLEA 2WM3A 2HRBA 3H8VA 3R6DA 4NK4A 3ZW8A 4DQUA 1DAPA 2R6JA 4OO3A 4RORA 1V6AA 3OJ0A 3QJ5A 2PGJA 2VYND 3OJOA 3KYDB 3TPCA 1IOLA 1E7YA 1A4IA 5GY7A 1ZNQO 4TRRA 5L95A 4BNYA 3MOIA 1IY8A 4DIBA 3F5QA 1XELA 4U6QA 2FWMX 3LSYA 3QVOA 1DC6A 2VRCA 3EC7A 3OETA 3PFWO 4ITUA 3ANNA 3ORFA 5H81A 3MJTA 2UVDA 1FDUA 3DDNA 1Z7EA 3ZH2A 5GZ3A 2F1KA 8ADHA 3WGIA 3K6JA 3PIIA 4Q3EA 2JFHA 3VPSA 1HL3A 3S2FA 5ICSA 1LU9A 2NUAA 4K1LA 4MOWA 5IZCC 3FSRA 1V9LA 4GMFA 1U3VA 1HDGO 1T26A 3FRJA 1UXJA 2WJPA 3NYWA 2B83A 4NMHA 1EVZA 2DAPA 1UDBA 3INRA 4BL5A 1PU2A 2PY6A 2XXJA 4MVJG 4QUKA 1SEVA 4OJNA 3D5QA 3DMTA 1UDCA 1NFRA 1QP8A 1P3DA 5IDQA 2X6TA 1ISFA 1E5LA 1K6JA 1N7HA 4W9NC 1M75A 2BH9A 4H3VA 4IIUA 2Q1UA 1PJ2A 1E1MA 2X5KO 3B1JA 4J2OA 2O3SA 4MP3A 3QP9A 1GV0A 2E48A 1BRMA 2PKRA 5T8KC 3PJFA 5L51A 3VZPA 3BTUA 1KC3A 2AEFA 3QVXA 3QSGA 2J3KA 2RH4A 1ISHA 2VUUA 3TFOA 2QW8A 4DQXA 2UDPA 3ETDA 4UEJA 1ADFA 1Z82A 3RUEA 3WWYA 4BQPA 4Q3CA 4YT2A 3JQBC 4DLBA 1A9YA 3RU9A 5L4NA 5IDYA 3ZWMA 1NTOA 5F1KA 2RCYA 3E6AA 4NIMA 1OC2A 4ROSA 4I08A 3RASA 3BMOA 2VOEA 3HDJA 1ZXLA 3PZRA 4CQLB 3JQ9C 1NWCA 3GEMA 1B14A 1T2DA 2J3HA 4RDIA 1NASA 2OBYA 4ND5A 1Y8RB 5TS3A 4CM7A 5JDIA 3D64A 1Y5RA 4BHTA 1Z73A 3DB2A 2ZATA 5JBIA 1UAGA 4JLWA 2W2KA 3N7UA 4BNHA 3P7MA 2P5UA 4JN6B 1CERA 1Q0HA 4BGVA 3DQPA 2GN9A 4OKIA 1DRUA 3ANMA 5JMWA 3DONA 3BYZA 5COAA 2ZQZA 5KKCA 5LDGA 1PJLA 1G6KA 1K5HA 2NLOA 4XDZA 3JYLA 3VOSA 1OAAA 4HFMA 1SC6A 2DT5A 1HDZA 3E9QA 3F5SA 5JDCC 4WEQA 5EPOA 2O3QA 1P1JA 2WDZA 3W4KA 5IG2A 4LSWA 4O0LA 2I65A 4IS2A 3IKVA 5DNAA 2I3GA 1N9GA 2O4UX 4YDRA 2V6FA 3T4XA 4O6VA 3W4JA 4BO8A 4EITA 1MLDA 3ZU5A 3Q11A 1H6AA 1T1RA 1PR9A 3AI2A 1PJQA 2C59A 1GAEO 2UYYA 2Y0EA 1HEUA 3FR8A 4R9RA 1B3BA 1PJ3A 1O0SA 2BFOA 1F8GA 3GPIA 4JBGA 1KOLA 4CMHA 2YQ5A 5JAQA 4BNJA 5KNLA 1P74A 3C7AA 4GH5A 4IS3A 3DHNA 3LT2A 4J4TA 3GGPA 4DGSA 3V8BA 1LBEA 1FDSA 1T24A 3KXDA 3EGOA 2EF1A 1DLJA 3UCEA 1N9GB 4ALKA 4DQVA 1HTBA 6LDHA 3LVFO 3CUKA 4QSMA 5TF4A 1H2HA 3D4NA 2HDHA 2BGKA 3BHMA 1U2DA 4J9UE 3Q9UA 2NTJA 3H2SA 2A4KA 4FIZA 4MIYA 5L45A 3CMMA 3U3XA 2EGHA 3G49A 1U5AA 4BKPA 5JDIC 2B36A 4AJEA 3WGHA 1DSSG 4YYZA 3NDJA 1U4OA 1K6IA 1TA4A 2FSSA 4QO7A 2NQTA 2AQKA 2W90A 4FFMA 2H6EA 4PLZA 4ALIA 5THQA 2AHRA 5L40A 2G0TA 3ZNOA 4EBFA 4EJMA 1EBFA 4MIEA 5JCJA 2FPGA 3DAPA 4D44A 1ZK3A 4UVDA 3DOJA 2XF8A 4OXYA 3EHEA 3UHAA 3ZV4A 5BNTA 4JP2A 3BMNB 4MP6A 2GUGA 1A27A 1E7MA 4BV8A 1XSEA 1Y9AA 5L3ZA 3HUDA 1GR0A 2W2LA 2VZ9A 1BXGB 3Q2IA 4YVFA 3ZHBA 3ZWOA 4F3YA 4J16A 5JDCA 4TKLA 3ETEA 4BNVA 4GKBA 2Z5LA 1KY5A 1ZMOA 4YJHA 4FOSA 2VNSA 4I5GA 4JJGA 1HRDA 1HSOA 4TZTA 5G4LA 3PQEA 4CM8A 4E5NA 4R1UA 1PS9A 5TLSA 1TB4A 4GWGA 1RM3A 2VRBA 4ZQGA 1EE2A 1KERA 1PIWA 4GLOA 4BNZA 4Z6KA 3GNQA 4R54A 3PLRA 2QYSA 2EERA 4ALMA 5EL0A 3V1YA 1B7GO 3NX4A 2AE1A 1QYXA 1ENOA 4R5MA 3RC7A 4Y8VA 4IZHA 4MKRA 3FNFA 3QWHA 5AXDA 3S1LA 5TX7A 4RVGA 1B8PA 3UGKA 3R1IA 1T2CA 1T4BA 4BGEA 2BFPA 3G0OA 2B4RO 5TRTA 1UXKA 3INGA 1H93A 4CM8B 3VVBA 2O23A 3NDRA 1PQPA 1O5IA 4WEOA 1QLHA 2VT2A 1PQUA 2EW2A 5F1OA 2E82A 1BDBA 2HQ1A 2X1HA 3SJ7A 4Z3DA 1XWFA 4URFA 4BNTA 3RSHA 2P5YA 4IINA 2ZYAA 3EY4A 1MP0A 3FNGA 4KQWA 4XR9A 2AW5A 1HT0A 3GN2A 5AOVA 2IRWA 3D3WB 4NI5A 2X23A 2P91A 3E82A 4PG5A 1T1SA 3ASVA 1OBFO 1SZJG 3H7AA 4WLVA 2PZMA 3JD4A 3ENKA 3OIFA 1PQWA 3NUGA 5B4VA 4S1VA 4MDHA 4E5PA 1W4ZA 1WLYA 5IFLA 1DRVA 3DMTC 5DP2A 3VTFA 1C0LA 4LRTB 4DC1A 1ZSYA 2NACA 3GFGA 3NT5A 5H83A 4OH1A 1RM4A 1YQDA 1QXSA 4G2NA 3H65A 4I9NA 3VH3A 3W8FA 3JQ9A 1K89A 3JYPA 4XQEA 2UAGA 3DC2A 1MX3A 4MPDA 3H4VA 3IKTA 1RYDA 1IPFA 1WZIA 3GNTA 2WTBA 1E3EA 1LX6A 1Q2XA 1YRLA 3JQAA 2B0JA 2DFDA 3QW2A 1PJ4A 1HYGA 2DFVA 2IEBA 2O3JA 3F4LA 3GDFA 3HFSA 3I9MA 2QIOA 4BVAA 3F1LA 1QV6A 5GZ6A 2EP5A 1K3TA 3B70A 2OL4A 3MJCA 5A5FA 3L9WA 1VJTA 3RC2A 4LSMA 3C7CB 1W73A 1YJ8A 3PQFA 2X9VA 2Y1EA 5T8KA 3ZU3A 4A0SA 1NAHA 3VPXA 5DP1A 1Q7GA 3L6DA 3P2OA 2GR9A 3DMYA 3GK3A 2JKVA 1IL0A 4HFJA 1HYEA 4AJ4A 4YPOA 1TXGA 2RHRA 3JQAD 1X0VA 1BMDA 1RM0A 1Q0LA 4BO3A 1XKQA 2DTXA 3INTA 4CM3A 4DMLA 1HDCA 1ZFNA 4JIGA 3TN7A 4AJJA 3CKYA 2A9FA 3WGOA 1XQ1A 4IDFA 3KLMX 4TQGA 2NVWA 2ZTUA 3RBZA 5K9ZA 1BG6A 3QHAA 2Y0DA 2H1SA 3NDIA 3ZV3A 1J4AA 3GLQA 3HDYA 4R5HA 3AUSA 3O8QA 3BIOA 4GI2A 5ES3A 1QRRA 1KEWA 4GKVA 4BIIA 2JD0A 4MINA 3B1FA 4HADA 4DPMA 1JTVA 3H9UA 4FSHA 3GG2A 1I33A 2XAAA 4WE3A 2OP1A 4P8RA 1OOEA 5EIOA 1ZK4A 4RGBA 1A71A 1BGVA 1KVUA 1P77A 4RF4A 5TT0A 1DIHA 3L0DA 4N5NA 1UP7A 1PX0A 1LJ8A 1BXGA 3PTZA 1NBOA 1T4DA 2O4CA 3CZRA 3QVTA 3ZWBA 3MTGA 1MV8A 1LQTA 1ZJZA 1GFSA 1MG5A 2R00C 3B6ZA 3VPFA 5CDSA 2JFFA 5DBFA 1HKUA 4CUJA 2NWQA 3DZHA 2GZ1A 4OQZA 3JTMA 3D7LA 5TT1A 1X15A 3GF4A 2FSVA 4RZIA 1KVTA 2ZB4A 3MOGA 3CE6A 3NRCA 1A4UA 1J6UA 1ZEMA 5IAAA 2V6MA 5G0VA 5BT9A 1GUZA 4JBHA 3DBRA 2OXIA 4E2WA 3FN4A 3GVXA 3OQ6A 4J0FA 4KOAA 1WWKA 4II3A 3OMLA 1ONNA 2J3IA 2QQ5A 4L0QA 1VI2A 1E3JA 1T2EA 1HE4A 2D5CA 3OQBA 2J6IA 1XGKA 2TMGA 2VOJA 4FJ0A 4XRRA 3FBGA 1BHSA 1X13A 2QYTA 1GCOA 3QQPA 2NU9A 5T64A 3UH1A 1PSDA 4TMFA 4OHUA 3IUPA 3T7EA 5CEEA 4IUYA 5KOIA 4KUHA 3KSZO 4GX1A 3A9WA 2RHCA 3KVOA 1K2WA 1P1HA 5COQA 4E2YA 4F6CA 3KYBA 3LLVA 3N74A 2CSUA 3ADOA 4D7AA 1E7SA 2F00A 3PRJA 4EUFA 4G65A 4MKXA 3LLSA 4ZQFA 1SPXA 3ASUA 5G4KB 2ZJ0A 3QWFA 3KSUA 4UVIA 5G0WA 1H6BA 1JW9B 3K31A 1TT5B 2VWHA 4HX5A 4OSOA 3JV7A 1HLPA 1VJ1A 2C0CA 2JHFA 5C7IO 4J1QA 4GGPA 3PVZA 1R0LA 1U1IA 1ZBQA 3SC4A 3KV3O 5JW6A 2CDCA 1I30A 4HFNA 2Q2VA 2EJVA 1YL5A 2DU8A 2X9NA 4GX2A 4F6LA 5I9MA 3PWSA 4WLUA 1MXHA 5G0TA 4YAIA 4MVJE 2YQ4A 3QLJA 4BNKA 4PLHA 2WD8A 3RBVA 3DZKA 3JD3A 4YJHB 1XEAA 2VHXA 1CIVA 3E5RA 3LT1A 4BNGA 4R3WA 2NVBA 4D41A 1SEPA 2WE7A 5CDUA 3TOXA 3PYMA 4PLTA 4KDFA 3RJ9A 4XYMA 4YTEA 2CVOA 4ILKA 4LCEA 4WOKA 3IIEA 4CQLA 3K96A 4RVFA 4XA8A 2GN8A 1NVMB 4BNIA 1UDAA 2Y66A 2B5WA 4Q3AA 3RU7A 2B4TO 1EVIA 2Y68A 1OI7A 3RKRA 1QYDA 2P9CA 4JBIA 3JQFC 1T2FA 5I8WA 4MVJF 1V0JA 4KUEA 4XIYA 3WSVA 1KIFA 4R69A 1ORRA 3E1KA 4FFLA 3OBBA 2C20A 2VYNA 4BNWA 1CEQA 3QWAA 2QX7A 4BB5A 4BGUA 1H0KA 1EK6A 3QRWA 4CMIA 1ZCJA 4ND4A 2E6UX 3GG9A 4A7PA 4R1NA 2JD1A 1E7QA 4AICA 1ISJA 4JQCA 4L4RA 1ZW1A 2YZ7A 3ZHZA 4IJUA 2YFHA 3DHEA 4MVJM 1VSVA 5ILOA 3PWKA 1P0FA 3OA2A 4FW8A 4PLYA 2I66A 1VSUA 4I9HA 2HKIA 1NM5A 1XLTA 3HDQA 4EW6A 4HBGA 4JJFA 1I32A 1N8KA 4RVSA 1NQTA 4D0SA 1Z6ZA 2ZB3A 3E8XA 1Z7BA 2Q4EA 5U4QA 5DDIP 4RZHA 4YJGB 2NVUB 4RPHA 3ZWYA 1J49A 3ROMA 4AJKA 3OICA 2GZ2A 2IODA 4DIOA 2A94A 5JE8A 1P0CA 3FTPA 3PYXA 1Y7TA 1DIGA 3DOOA 4IJVA 2JAHA 2DC1A 3RFVA 2FN7A 4XB2A 3RUDA 3F1KA 1O9BA 2IEDA 3CIFA 3ZWXA 4YXFA 4WGGA 3C3XA 3D3EA 1KBZA 1CETA 4NU6A 1YKFA 1TI7A 3I9JA 3BMOB 4DTIA 3UUWA 1XYGA 4ALJA 1YGYA 3W1VA 4II2A 4Z3KA 4MIOA 3L77A 2ZKLA 2ZTLA 4YT5A 4ONEA 5I8ZA 1J0XO 4KWHA 2NVUA 4YJGA 1PGPA 3C24A 4QXMA 3IS3A 2VNAA 1LQUA 1NHWA 2JFGA 2RAFA 2VT3A 1KYQA 1VL8A 3JQGB 4PVCA 1PZFA 1C0PA 1GZ4A 4XQCA 1LRJA 2C5AA 4CQMD 3MJEA 3VTZA 3PHIA 1OC4A 4AJOA 2PGLA 5I7FA 4KTTE 5EESA 1P44A 5BR7A 2OO5A 2XPCA 1DPGA 3TRIA 4TROA 3JYOA 2HCTA 3ZW9A 4BO4A 5CAEA 4BS9A 1RYEA 1FMCA 3WNQA 3IL2A 5CHEA 3ZHYA 2J3JA 2C5EA 2X22A 1JWBB 1YS4A 4Y6SA 4L4SA 1W0CA 1Z45A 3GMDA 1IB6A 2BFMA 1BW9B 1QV7A 3ICPA 4WLFA 3U9LA 1XG5A 4CPDA 1YL7A 2YHUA 4GSKA 1MUUA 1LC0A 4JXKA 2YUTA 4WPGA 5BNFA 3GPDG 1I2BA 1D4FA 1YBAA 4LN1A 4PN3A 3H5NA 1I5RA 3EAGA 3W6UA 4BUCA 4PG7A 3MWEB 1M67A 3GZNA 3ZV6A 3RBXA 1LTHR 1JWAB 2OMEA 5CG2A 3DFUA 3WMXA 4BV9A 2ZYDA 4D3SA 2DLDA 4XQ9A 1KY4A 3HZZA 2B4QA 1MG0A 2ZQYA 3B20A 5I9NA 5KJEA 5IXYA 2GGSA 4HFRA 3S2GA 1DFGA 4Z9FA 2YDYA 1ENZA 3VZRA 1EDOA 1GL3A 5FYDA 5AXBA 3RUCA 2D0IA 4MVJI 1NAIA 1IZ0A 4Y6PA 2ZCVA 1F8FA 2YDXA 3JQ6A 3C8MA 4CR8A 2PZJA 3TNLA 5FEUA 5L53A 2Q1WA 4PG8A 4H15A 4ZRMA 2E4AA 2DVMA 1UP6A 2EJWA 4E0BA 5LDHA 4D46A 5B4TA 1DC3A 3HN2A 2TMDA 1C1XA 3QY9A 1F12A 3F46A 3DZJA 3HB5X 5FF9A 1G0OA 3UN1A 3ZN2A 3WBFA 4R01A 3I4FA 3GDOA 4EGFA 3RUFA 1KVQA 4Q9NA 2HK9A 1DFIA 5MGBA 2HRZA 4XR4A 2O7QA 3KO8A 3O9ZA 2FPPA 3ITDA 2VRCD 3NTQA 4XJTA 2Q4BA 4AJPA 5KKAA 1DJQA 1TT7A 2CNBA 2P4HX 5JC1A 4LGVA 4BKRA 1ARZA 1IHXA 4RQTA 4CUZA 1D8AA 3K30A 4PGFA 3SLGA 1DFHA 1N92A 1O95A 5EMHA 3AK4A 2VUTA 1C0IA 4DYVA 3JQAB 5JCJD 2BKAA 4FFRA 3ZGYA 4AJLA 1LSJA 3L4BC 3F4BA 4DL9A 1YOVB 3KM0A 2V6BA 1A7KA 1ZJYA 5HTOA 1DIRA 1RJWA 2BHLA 2OBNA 4IGEA 1SMKA 1XU9A 5DZSA 4XD2A 1RWBA 2EV9A 2NTVA 4G81A 4WNIA 1XU7A 3DEYX 4KP7A 3ZDFA 3ZWNA 4IJKA 1ULSA 2FR1A 2GDZA 2IXAA 2PKQO 3F3SA 4GWKA 3VZQA 4BO7A 2WD7B 3JQ8A 4IJWA 1GYPA 5JMPA 5L7TA 3UCFA 4PLWA 4IMPA 2PR2A 1H5QA 3E18A 2C29D 5FI3A 3H9JA 2D4AA 3EUWA 3U4IA 4D45A 4DLLA 4QFDA 3LF2A 4UEKA 1U8XX 3TZCA 4CM9D 4WK6A 3TZ6A 1IYZA 3NGXA 1XR3A 1NQAO 2WD7A 3JQ8B 4Y98A 1LDBA 1HE2A 4OXKA 2QRJA 3GZ4A 2CDAA 4M1QA 1PZGA 4NBTA 3GHYA 3EK2A 1FJHA 1NQOA 4B3HA 3TJRA 3SC6A 2PH3A 4EUEA 5JYEA 3P2YA 4TSKA 3FPLA 4FFNA 3WGYA 3VVCA 2GO1A 1I36A 3OJFA 4CV0A 2RIRA 5T67A 2B37A 3WQRA 3GRPA 4RLSA 3TSCA 5EINA 1LDYA 3UCXA 1QYCA 1DOHA 2W2KB 2OZPA 2VZ0A 2NU8A 4J7XA 3ROPA 3D4OA 4NZ9A 1MB4A 3K9QO 3LQFA 2JJYA 4MVJH 4ALNA 1QKIA 5DBGA 3FWNA 4CLHA 1YH3A 5C37A 4FC6A 1PTJA 4CJXA 1AE1A 1M2WA 3BTOA 3U62A 5CG1A 4U5QA 1DLIA 4B4VA 1JQBA 2CF6A 4YQZA 4CR7A 4IQ8A 1T25A 3WS7A 3NT4A 4EZBA 1I8TA 2Q3EA 1IPEA 3DBVO 2X0JA 4RF2A 4P4NA 2VUSA 5AXAA 2J8ZA 2Z1MA 2Y0CA 5A1TA 4OGWA 1CYDA 1Q0QA 1ONOA 2W8ZA 3VC7A 1G0NA 3IJRA 2RBEA 2BLLA 4FOOA 1O6ZA 1U2GA 4LCJA 4WLNA 4AVYA 4XZ3A 1ADCA 3CH6A 4EEXA 3WOHA 4EUHA 5JO0A 3FF4A 3MEQA 2NU6A 3JSAA 4S3MA 1EVJA 4RVHA 1PL7A 3AJRA 1Y81A 2YHIB 5HWSA 4J7UA 1AUPA 3DOCA 4I5DA 3RD5A 3O38A 4OOEA 5A05A 3N58A 4XGNA 3RC1A 3VKVA 4NBWA 4OMUA 2CZCA 4F45A 4GSLA 3QE3A 4YRDA 1VC2A 4E21A 3TZQA 2O7SA 4BMVA 2VWGA 1E6EA 4X54A 3EVNA 3C1TA 4FGWA 1WNTA 3JD0A 1NR1A 4J4BA 3V5NA 3AUTA 3QVWA 1LXCA 4TWRA 3GVPA 5J23A 5IXSA 1TT5A 4GGOA 3SXPA 2P9EA 4HV4A 2GF2A 2EIHA 3K2EA 3E03A 2BGMA 4PLCA 4R1SA 4PG6A 3IJPA 4O59O 2AG8A 2AA3A 5AVOA 2YJZA 1EZ4A 1F17A 4ZRNA 3BMCA 1TEHA 1LLDA 2IDZA 1JU9A 3MJ4A 4XQGA 5ILGA 1MC4A 5HRUA 1GEEA 2IYPA 3AY7A 2Y93A 4BO2A 3X2EA 4J0EA 3ANLA 2ZB7A 4BKQA 5JNLA 5G0SA 3RUHA 3WJ7A 3LK7A 1EK5A 4N7RA 3BXXA 2POQX 1QR6A 5A9TA 2OOSA 4RPLA 3ROQA 3MTJA 4IM7A 2Q1SA 1VJ0A 2X7HA 3AM4A 2GSDA 3MJVA 4GLLA 4B4OA 1D7OA 4JNKA 3AOEC 2WYUA 1H6DA 2Z95A 5CFZA 4FPXA 3TZHA 4IMRA 4WLEA 2DBVO 4IZIA 3V1TC 2G82A 1VL0A 4GAEA 4XYEA 1HE5A 4H7PA 3IDSA 1TVEA 2FY8A 2GASA 5I7SA 1U4SA 4AJIA 2Q99A 1WP4A 4RO0A 1O8CA 1C3VA 3WXBA 1F0YA 2X5JO 3FD8A 1FDVA 2PKQP 4DBVO 3IAHA 4CMCA 4JCOA 4CLEA 1PEDA 4J4HA 4BO0A 1PJTA 4BMSA 1U9JA 3GR6A 3ZV5A 4CUKA 5MDHA 3KRTA 1PS8A 3Q0EA 3SLKA 3HB4X 5DBIA 3P19A 5L9AA 5CDTA 3AM3A 4PZEA 4IQ0A 3PQDA 1HLDA 2BD0A 3M2TA 4LVCA 3LU1A 3DFZA 3ZU4A 3K73O 4CODB 2QZ9A 1WMAA 2CVZA 2D8AA 1IZ9A 5T5QA 4BO1A 5F1PA 4YRBA 3OF2A 9LDTA 4A10A 5HA5A 3I83A 1IHYA 1ADBA 3ETGA 1BXKA 1R16A 2WWRA 2D5AA 5AXCA 3COSA 3GY0A 2Q45A 1M6WA 3I6IA 2ZK7A 5KTKA 5TNXA 1CQJA 2O3TA 5B1YA 2DTDA 1EBUA 3TL2A 1V35A 4B7UA 3OSUA 5JLAA 3STHA 5B37A 1P1IA 4JGBA 1I3MA 4BNLA 1BVRA 4WCFC 3WJAA 5C5IA 4H16A 3G3EA 3BTSA 1J5PA 3OHSX 4DA9A 3U49A 3L9XA 3K2BA 3HJAA 3G17A 3A1NA 1LA2A 3ST7A 3KSDO 3HADA 5HM8A 5TGDA 3WFIA 3PHLA 1BVUA 4W6ZA 1DJNA 4L73A 2NM0A 4E13A 3NGLA 2Y1GA 5JSFA 1XA0A 1U7TA 3KBOA 5GZ1A 4J1TA 4I8XA 1UXIA 4IXTA 4R41A 4UUNA 3PJDA 2Y67A 1F06A 3SBOA 3GHHA 4WNCA 1PGNA 1R12A 5H82A 2PWZA 4NFHA 4PRKA 2UUPA 4RPKA 4WOJA 4N5LA 4CMJA 1ZH8A 2WEKA 1W8DA 3UF0A 5IDXA 2AQHA 1N5DA 3F6YA 3GGOA 1ZUD1 4D3DA 2OP0A 3OJEA 3KUXA 3EZYA 4FC7A 4UAGA 3WTBA 4C7JA 3FR7A 3UKOA 3UFXA 2G17A 3Q9NA 4J3FA 3PHJA 3V2UA 1GPJA 4J6FA 1UZLA 3AY6A 1H9BA 4JX8A 4CLDA 4YRAA 1VRWA 2GPTA 2I9PA 3I9OA 5T57A 1UZNA 1E3IA 3BMNA 3NKLA 3EDMA 4L4XA 4L8VA 1X7HA 3IOYA 1Q1NA 3RI3A 2P4QA 3GDGA 1C1XB 2Y05A 4KDEA 3W8DA 4BNUA 2IE0A 4CV1A 5ER9A 5L7YA 1R0KA 5F5LA 3U09A 1NPDA 4IY1A 1E3WB 1I2CA 4K6CA 3AFNA 2BI7A 4PLGA 4PIVA 4EYEA 4D42A 3I9LA 3CMCO 5KVCA 3SVTA 1LRLA 5CEJA 4UREA 5EQDA 2W2LD 3V2GA 3V2HA 2Z1NA 1I3KA 2AG5A 4QEDA 4PLFA 5BSHA 3HHPA 1ZEJA 1H6CA 1DBVO 1R66A 1BW9A 1DAOA 4HKTA 4YJFB 3SJUA 3PDJA 1HF3A 1GEGA 1FDWA 3LC7O 5IZCA 5EERA 4I9UA 1ID1A 4XJSA 4FR5A 5JXWA 3RVDA 1YDEA 4JROA 4GPD1 2HLPA 1WDLA 3Q2KA 4OYRA 3UVEA 2VYVA 3MJSA 4L75A 4FCCA 4TKMA 2Y99A 1FK8A 3UOGA 3AY3A 2IZ1A 4A03A 1P45A 3GC6A 3IQDB 2DPGA 5KCZA 5ER6A 2YY7A 4XDYA 1ZO8A 2PZLA 3GNSA 2V65A 1CRWG 3KOUA 3ZNPA 3B1KA 5C7OO 2WSBA 4HNGA 3I9NA 4P4GA 3OEYA 3ZI0A 2G5CA 4TVOA 4IDAA 1Y6JA 1GADO 4CV3A 4D0RA 3GT0A 3OJLA 1PL8A 3ZWWA 4BO5A 3O03A 1OFGA 1ISMA 2HMVA 2I67A 1NPTO 3FBTA 2CD9A 3VH4A 1H9AA 5L7WA 3I6QA 3GN1A 3R3JA 1VPDA 3NT2A 2YFQA 2OUIA 1IE3A 1PJCA 3FNHA 1L7EA 3AU9A 4IXWA 4RPJA 1ULUA 5JYDA 1HE3A 1R15A 5DULA 4RL6A 5DOZA 4YJFA 3PYLA 4BO9A 4Z0TA 3GOHA 5K6AA 2PGDA 2GZ3A 3KZVA 4RV9A 4XGKA 3CXRA 4CL8A 1ISIA 1JA9A 4R16A 1KEVA 1GQQA 3KEQA 4K26A 4QO8A 4BNXA 1DRWA 4D79A 4KZPA 4HWKA 4B7XA 3D5TA 3E48A 4E31A 5A3VA 1MFPA 5ADHA 4NJOA 4PLVA 1XHLA 1MA0A 4NJMB 5G0UA 3PHHA 2X86A 4ZVVA 1YQXA 4NR0A 1E6UA 3D3WA 2Y1CA 4GL4A 4DLAA 3NJ8A 3PEFA 1PZHA 4M86A 4UEOA 4HP8A 2WE8A 3U5TA 1A9ZA 1E92A 3L6EA 5U1PA 4FB5A 4M89A 2GYYA 4I5FA 1FF9A 5FI5A 1LEHA 4CMIB 1MXFA 3WG9A 4FBGA 2QZZA 1JN0A 2BI8A 4D3FA 3VH1A 4CM5A 3CSDA 5TJHA 1HYHA 4ZGWA 3PJEA 1SCUA 5F5NA 3PIDA 3ZNQA 3PI7A 1AHIA 3BMCB 3O8QB 2HMWA 3BA1A 1VL6A 1CQIA 2O2SA 3M1LA 4GQAA 1R4MB 2HO5A 3UW3A 5EJ2A 1GV1A 1WDMA 1GUFA 1ZSNA 3GVIA 1B8UA 3F9IA 1SAYA 1TLTA 2GLXA 1DB3A 1LDNA 2GCGA 2VWQA 4U0KA 3CEAA 4CLOA 4ND3A 3ZWPA 1Y5MA 4DUPA 3O4RA 4LVUA 3JD2A 3K8ZA 2VYVD 1UZMA 3QWBA 2DUWA 4WCFA 4A73A 4AJ1A 5B12A 1ZVMA 3H6KA 2V6GA 4NFSA 2PFGA 5BSGA 2PD4A 1HWYA 4ZA2A 3A06A 4W7IA 4M49A 4GX0A 5JC8A 2WYVA 3W6ZA 4EJ6A 2PD6A 1VM6A 1JDJA 3LDHA 3R3SA 2NU7A 4NBUA 4BQRA 3GH3A 1UXHA 3DAFA 3HG7A 4RPGA 1EFKA 1QYVA 4E5YA 1RM5A 4Y9DA 4ALLA 3I3OA 4FN4A 4XRGA 3HDHA 1NX6A 1CDOA 3BMQA 3JQGA 1I01A 2JL1A 2UUOA 2VHZA 3FCOA 4KWIA 9LDBA 4O63O 2D1YA 1YB1A 2FZWA 4YBZA 1JKFA 4RF3A 4Q3NA 1IULA 4EI2A 3OA0A 2X9GA 3DWFA 1R0SA 1Z74A 5CPBA 1JVSA 1Y8QB 4M8SA 2C54A 1C14A 2Q2QA 3HWRA 3Q3CA 1HDYA 5T6BA 2A92A 5A9RA 4BNMA 4E12A 1NP3A 1R4MA 2Q1TA 4PLPA 3AW9A 4TRMA 5I7VA 4AJNA 4E32A 3GGGA 1RPNA 5AQ1A 3U4CA 1DXYA 1GZ6A 3LF1A 2DUUA 3KYDA 1SOWA 2AXQA 5A02A 3MZ0A 3U0BA 2OHXA 4RVUA 1HZJA 1T2AA 3Q6IA 3FI9A 4IPTA 1A72A 4YEDA 4BB6A 1SB9A 3DBLB 3CTMA 4YQYA 1NFFA 5LC1A 3DTTA 2OGUA 2XXBA 3MCVA 1ZK0A 5KVQA
chains in the Genus database with same CATH superfamily
2C7PA 1Z3IX 2WIBA 2XRMA 1GD1O 4K6FA 4UCQA 1ZK2A 1PHPA 1LBQA 4BMXA 1Q1ZA 1VLZA 1Q0UA 4ND8B 2H63A 4PFJA 3S2IA 4BE4A 5JAZA 3WB9A 1KJQA 2B30A 5K3FA 4Z9AA 1IIRA 4LYHA 1CY7A 2GAAA 2UZIR 1ZXBA 3MTAA 2FSIA 3DZDA 4OMFG 4Q3BA 5EJFA 2Z6VA 3HUTA 4HLQB 1X7YB 3E05A 2V98A 3ZWAA 1GIAA 1JIQA 1Y1QA 4YXWA 3ZGNA 3DLIA 4QKQA 3PC8A 2V8BA 4DEXA 2ZJ4A 3I39X 5JYCA 3NORA 3D8BA 5K3FB 5BWLA 4JK3A 1CU1A 4YAJA 1M33A 1U6IA 3RU3A 4F5WA 1KSJA 2I7VA 1G1AA 1GCAA 2VP9A 4TL7A 4WHMA 3P52A 3VGJA 4YK7A 4MP8A 3WHPA 4UVEA 4EY5A 2M6RA 4I19A 3HVKA 1QG6A 3IKMB 4KQGA 3EEIA 3KG2A 4B6OA 2C2KA 2DR3A 1EPUA 3ZZ1A 3NHKA 1MZVA 1PEYA 3D6MA 3HNRA 4IFIA 1JEYA 2Q2WA 4EA6A 4X1IA 2WG2A 2VBGA 1PNTA 4QFCA 5G4KA 3B85A 2BSQA 4XCQA 7ABPA 2I4MA 2KB0A 1A8IA 2XB8A 3QNMA 2AG6A 5BV8A 3LO8A 2G5TA 2SICE 4J7AA 1PYOA 3IOEA 3RSGA 5H5JA 4L51A 1FMFA 2VXCA 2VJCA 1EZZA 2Y1DA 4OY3A 3AR4A 3SY8A 5HPYB 1ZGCA 5I3ZA 5F9HA 1MCZA 2OO5C 2Z30A 1W93A 3WIBA 3WYNA 2H5LA 4J07A 4NU0A 3WMWA 3DOEA 2YC2C 4EDFA 4YX9A 2KQUA 2JB9A 3CVWA 3IMKA 3CVXA 4EX7A 1CY1A 4TWBA 2XQJA 1Z13A 3ZJ5A 3VA7A 2FEWB 3D5EA 2NNLD 1T35A 4X9XA 4TOIA 3TUIC 1Q7CA 2W5UA 3L06A 2I6TA 4B3DA 3C45A 2P9BA 3CUWA 5C4IA 5DYGA 2OCPA 2MWMA 3RW9A 5LCXA 1GQ2A 4QA9A 1WMSA 2EEZA 4CLOB 1AN9A 4G0ZA 3WRYC 1PWYE 2I1WA 2Q29A 3IPRA 3DMDA 2ZZNA 4L4ZA 2PIDA 2QI9C 5FUBA 4UEWA 1RCTE 1KYTA 5BQFA 1PV2A 1PK7A 2PU7A 1TEVA 4QT0A 1IB0A 2ADOA 3OJWA 1G8YA 3RQSA 1JQAA 4UUMA 3RC3A 2B3TA 3K20A 4M9SA 1LPMA 4OVKA 3T54A 4NPAA 4FR2A 3TFQA 1E2LA 3T3OA 4FP9A 4LXHA 3WICA 2IH4A 2F1HA 4OHMA 2ONZA 2YN4A 1I2ZA 4YHBA 2HT6A 4NYMR 3L1KA 4OB8A 5SICE 3ZS8A 5J2UF 2CMDA 1NRIA 3ZLJA 1J9ZA 3EQ7A 3K9WA 4Z8YA 3PCTA 3I52A 2VYFA 3FWZA 4OQLA 4YCSA 4ES6A 1NJ2A 4E3ZA 4P4LA 5K51A 3PNMA 5JZSA 4ZQBA 1OQAA 3AOGA 3S8MA 1VMAA 3KPUA 1NV8A 2OQIA 2LR0A 1DKRA 1W0JD 2GN4A 1ADGA 3FAKA 4L72A 3PDIB 4G1UC 5DRTA 4RKEA 5KAMA 4EG1A 4B3GA 2VSFA 2WKRA 2GK6A 3G2HA 1Z8HA 4FDMA 4MMYB 4MVWA 4E09A 4HS4A 3MD9A 4JZKA 1JF8A 3GVCA 3M6AA 3SR3A 3EVZA 2HU8A 3F7OA 3K05A 1PDWA 4PVDA 3EBLA 3PP8A 4AXBA 1YXMA 3C3YA 2WJJA 3I34X 1Y6FA 2HTFA 4JD5A 4QELA 4C7VA 4ZICA 5B1EA 1ML3A 3ZXYA 4UUPA 4Q7EA 3TQTA 1QQBA 3NETA 2VHQA 3JAWB 3WYCA 2RJNA 2DPHA 2N9UA 3CLUC 4C0JA 2WWIA 1FX0B 4O8CA 4RJKA 5BURA 2ZUVA 3B12A 2C4TA 2BMWA 3BFKA 3IUNA 1U3TA 3GA5A 1C8BA 4L4UA 4FI3C 3PVSA 2X0RA 2H1CA 3Q3GE 3AEQB 2P9QA 4UM9D 2FCRA 1Z8NA 1NY6A 3WGGA 1NVGA 3RIHA 4BEVA 1Y42X 1TYCA 3NHYA 2P8JA 4EGCB 4BXOA 1QOZA 2BELA 3AR9A 2EHDA 1PK9A 2WWVD 2ZRBA 1ORDA 2C92A 3CFYA 4AURA 1UC9A 3O91A 2ZXEA 2EKPA 4HYYA 3Q10A 3W8RA 3T7SA 1V7QA 3FPFA 4FDTA 4CLRB 1EIZA 3QNWA 1BA2A 1SBNE 2CNDA 1XLTC 4E5MA 1NT4A 4MWZA 5A5DA 1R5BA 1X1CA 2D74A 3HEAA 2JKYA 4CIDA 4MVYA 1MJFA 2OGWA 5HX7A 4OAQA 1T1JA 2VZEA 4CNQA 1J20A 1ZCAA 3QBDA 4LRUA 1ACLA 2O06A 2QG9A 3ORSA 1B74A 4MV1A 1J0CA 4U63A 3VC2A 1YE5A 1KKMA 2XWQA 2GNAA 4LZNA 3WGJA 1NVVR 3DE5X 3T52A 3SJCA 4IFTA 4C7BA 3GFBA 4EY7A 2O2YA 2XJ9A 5JXGA 5DBOA 4W82A 4C1NA 1L1FA 3MJHA 3BK1A 4IX9A 3E2MA 2PWBA 2EYQA 2IHUA 1UJ5A 3GNLA 4FNGA 2ZYTX 4XWYA 5DGTA 1DTSA 5HTKA 3VKUA 3GZJA 4TMZA 5BO5A 3V1LA 5JECA 4U7TB 3KFVA 4Z1MD 3VUEA 3Q8MA 2BN4A 3O2JA 3R7AA 3JQ7A 1LSUA 4EJ0A 1TPYA 1BH2A 2IU4A 1JHDA 2HO4A 4RLHA 2O2DA 3C5EA 3MINA 3I9V6 1E9BA 1UJ4A 3GUHA 4RZQA 5DXJA 2C1XA 3T7IA 3KP1A 4GNKA 16PKA 1JKJB 1XRLA 2F62A 4DILA 4URUR 4ZPJA 2CXHA 2QORA 5NULA 3UV3A 5K8LA 3N8GA 3BWCA 6Q21A 4MW0A 3CTPA 4J2TA 1H2YA 1L4GA 1U0GA 2W0SA 3G88A 3CH4B 2NZ8A 5IP5A 1L8XA 5EE3A 3TTYA 1AHHA 2CF5A 1NJ8A 2GETA 4QGBA 2EBFX 3KEOA 1BJTA 4EB0A 5IJWA 2Z2IA 4HUJA 5JG7A 3IUQA 5CFOA 3M8KA 2PN1A 2Z2ZA 1B8NA 1M6HA 1WVGA 4PPFA 1YL6A 4CXMA 3SBEA 3SNHA 1TF2A 1UJNA 1Q1GA 2RONA 3D1LA 1U3UA 5KYWA 1QKJA 1N0VC 4MJLA 1AKUA 3C41J 1F1JA 2RHDA 3JQ7B 3JYNA 4ZGBA 3D6JA 3LWNA 2IH5A 3HJFA 2QU8A 3ZHXA 3TD9A 3MERA 1CR2A 2XTZA 1TIBA 3D4PA 1DE0A 1E5TA 3OZXA 5AO9A 3P9RA 5EYPA 4B09A 3KEFA 2C7RA 2G1PA 3MTEA 5T41A 5A5GA 3OFSA 4RCZA 1RWKA 4P5DA 5M04A 1TJPB 1KBOA 1WPRA 2IEIA 3HN6A 1FXSA 4LHSA 4AJ2A 4KSCA 3VDQA 4J9VA 1L7NA 3C3JA 3PWTA 2PL5A 4O08A 2VHUA 5FH9A 2ASVA 2AD1A 5ELXA 4RZ2A 4C76A 3WKDA 2HA0A 4IIBA 4JLVA 3SM9A 4Q82A 2QV7A 1QLWA 3JAKB 3U4MA 5JAOA 3ZWCA 2FN3A 3PEEA 5EE5B 4CV2A 1P29A 4D92A 2QXTA 5IS2A 4G5XA 4CM1A 2JGLA 2OAEA 1DO8A 1RAGA 3DE7X 1H9CA 4WKGA 2C7VA 4MS1A 3FKJA 1X39A 1IHOA 3DMFA 4KRGA 2IQ5A 1VP9A 2LPMA 5EIHA 1KJ8A 1UOQA 2YZ2A 4H7DA 3PENA 3GMTA 2DHRA 1EE9A 1IXKA 1C4OA 1UXGA 1NOJA 5D84A 3FTCA 5I5GA 2OK7A 3OZIA 5K0BA 4NDNE 3BHIA 1QGZA 5CT8A 2FTKE 4RSGA 1LKZA 4R2HA 2A3RA 2EP8A 3C1OA 4GR4A 4X95A 3RIEA 3MT0A 3PGKA 2X5NA 1OXBB 2EGGA 2IYVA 1O6FA 4B80A 3NV9A 5BR1A 3KHUA 1BCSB 1PYGA 1NM5C 2GBLA 1PBNA 1RWXA 3OBIA 3U39A 2MSNA 3H8SA 3L6CA 2IYQA 2RB5A 4NONA 3IBCA 2GNOA 5F3DA 2K5UA 3TPZA 1W0JA 2QLNA 4QRHA 4A8TA 3CO5A 1DAIA 1QDLB 5DBHX 5SY6A 1OU4A 1ZH4A 2I4TA 1PG5A 4KR3A 2VS1A 4YT8A 4ZZ1A 3BAZA 4E2XA 3M4YA 3M6MD 1D4AA 2CB9A 4P33A 4OSPA 7YASA 5K2MA 4TWIA 1N6NA 3HSYA 3K5WA 5G2OA 5JCZA 3JQDA 1Y0BA 5DI3A 5HUQA 3KQPA 1P33A 3E3MA 1M74A 2KI5A 3RK0A 2DH5A 2D5BA 3MTBA 5LNK6 1UBEA 2PL9A 1B26A 3WK7A 3IE1A 1J00A 3IMFA 2CDNA 3HFRA 1E1DA 2JLYA 1F4PA 1A2KC 2P9GA 2CB0A 1RZ3A 4G9GA 4BJHB 5FL7D 3SM3A 3H86A 1RKVA 1ZU5A 4JVOA 3JZFA 4QULA 1CZOA 1LY1A 3TQCA 5H3CA 4P58A 2GA9A 3AFMA 3VH2A 3ZVLA 3KVRA 4CBVA 1CQJB 4I1IA 4QM7A 4R1QA 4D99A 2ZUBA 2ZUFA 1QIJA 1RRFA 5TMBA 2IUYA 2IYYA 1VE7A 1K98A 1NVUQ 2CUNA 3C98A 1SC3A 3GVHA 4JL5A 4YUVA 1U65A 2PX2A 4DG8A 3F6BX 5HUHA 4B8WA 4DADA 2IYWA 3T5CA 1YS7A 1XQXA 3IEIA 1GA1A 1GCUA 3OU7A 3BTVA 3G1UA 4RA9A 4EPYA 2YZNA 1KMHA 1FQJA 1TO2E 4DXAA 1TCCA 2CL5A 1EKXA 2RI0A 2B8NA 2XA1A 1OH7A 3V3TA 4A27A 1NVVQ 2I0FA 2X58A 4NAVA 4HH3C 1K92A 1M66A 1Y98A 3WI7A 5HYVA 2DQZA 3G7SA 3D0OA 4YFVA 3C3PA 2R5NA 3CB4A 2H2IA 3FUVA 5HBGA 4G84A 3B6IA 5ALWA 3IQEA 4JJZA 1L7PA 3PWZA 5EZ6B 3W8EA 4D9EA 2Q5EA 2F9FA 1BE1A 3LYLA 3B9RA 4Z9YA 4ND2A 1SN7A 3G13A 3MRTA 4F9EA 1GPKA 4BBPA 1QZUA 1RAIA 2HADA 2G77B 2JCXA 3GO4A 2PBZA 4RCVA 1I94B 1GQYA 3EGVA 3K1ZA 2VN8A 3IHTA 1J8QA 2AOWA 4RJ2A 1T9GR 1W2WB 3I9V1 3QLTA 1GDHA 1I4WA 1U8AA 2CUKA 3AB8A 2IPXA 1YIDA 3G2MA 3OOHA 3ECCA 2WJ6A 3TTTA 3NJRA 4UUAA 4G8CA 1ZI9A 4A6PA 5JH7F 5JI2E 3F73A 3OURA 4JEHA 3UUGA 2QAJA 3RRMA 1QHNA 4BZPA 1OYVA 2JJ1D 1W44A 3DOFA 4ABYA 2I2FA 3MQ4A 1E7WA 4JSRA 5HP4A 1Q7BA 3HLYA 1SUBA 5AHKA 1VA5A 2BT4A 2P2SA 3DVRX 4LE1A 5LIRA 3IEMA 3VX3A 2QG4A 2ZAGA 4F4DA 5CW2A 4B3XA 1PT7A 2FR8A 1DAMA 4I8IA 5JCXA 1HDOA 4G0YA 4MNTA 4WW0A 4KQHA 2ZR9A 3M6IA 4FGKA 2GLTA 2G9QA 3A6LA 1W2HA 4L8LA 4R31A 1WAMA 2Q4OA 3NXKA 4KPGA 1BWQA 2VT7A 1R0XA 4QTZA 3A0RB 5AHXA 4ARBA 4C0BA 4YUAA 5FJJA 1WUIS 1FP4B 1ECJA 1QTIA 1SKYB 1YA8A 4YUYA 3QJGA 3AVQA 4RD2A 2EFEB 4LVNA 2CFIA 3ZE2B 1STOA 1V2HE 5HEKA 3WK9A 1VIYA 5BNIA 3K9GA 1NKSA 4MV8A 2HA5A 5CX1B 2R1UA 2VNHA 4KKXB 1EM8B 4MWBA 1BJRE 4DM4A 1BS2A 2AD5A 4YP7A 4AKTA 4LG1A 2BM9A 4R7ZA 3ZV7A 1R4NA 1D1SA 4W5HA 1CSEE 3ZU2A 5JFOA 4WVLA 1RI4A 4A0GA 3EZ7A 4A2CA 4DIUA 1E3WA 2C82A 1XD2B 1C3JA 1BTOA 5DW3A 5P8WA 4JBYA 5BN4A 1V39A 4R51A 4V0ME 3W2EA 2XHEA 1PR1A 1WF3A 2REBA 2VL7A 3RU2A 4YMLA 3HVHA 3GZNB 5LA6B 3E8SA 4DPLA 1U6KA 3DZIA 5L4LA 2G1KA 4TKUB 1NE7A 3HUFA 1YE8A 3DFMA 3HRIA 5AIBA 2XQIA 2ZWPA 5H4GA 1LSOA 1O89A 2R6DA 4RXMA 4ID9A 3IDZA 4RABA 3KL4A 4YP1A 5AYVA 4D4MA 1H2AS 3G0BA 1F38A 4NHEA 3Q72A 1FIUA 4QDJA 1JECA 2EQ5A 4MPRA 1VHJA 4JP8A 1XRPA 1H2BA 2VDLB 2R87A 3WNVA 1XEWY 2XUPA 4KN5A 3NEPX 1V7ZA 5EZ5A 3OX3A 3EODA 1LBSA 6AT1A 2YV4A 4Q19A 1UM9B 2CNWA 5ESWA 5DKFA 3KYCB 4X60A 3Q8WA 3J7AC 3M0EA 2YYZA 2ABWA 3EVGA 1OKKD 3PDWA 3X2FA 3UMMA 2BH2A 2J0EA 3SS7X 4KLNA 1NNLA 4MDEA 4TRJA 1W2GA 1UMKA 1ULBA 4MV6A 2OG2A 5F5XA 4OQEA 5HZMA 5TEVA 3AEYA 1K0UA 3BM5A 1RQGA 4JDUA 4P22A 4FYYA 3EPRA 3FG9A 3HXTA 2HU2A 5JVDB 2W11A 4JI3B 3JALA 1I24A 3CINA 3WYGA 3KYJB 1VMKA 2AUMA 3OLVA 2F1IA 1MO3A 4JB0A 2EP7A 4M7WA 2FPRA 1ZLXA 1F0KA 1BEUB 1QFJA 4JKYA 1Z75A 2CLFB 2QUAA 5KAPA 4B32A 1N1GA 5DCYA 1CW2B 1HZZA 2WHPB 4QRDA 4QHYA 2G0NA 1ABEA 2FN4A 3EGDA 4K6MA 3WGLA 1PR5A 4H60A 2C97A 3T95A 2QTTA 3TI9A 2KBEA 2XBLA 4YPVA 1YVDA 4EPRA 4LS3A 1LI7A 5JARA 1M8FA 1KDTA 2PQ2A 2QMUA 2ZRFA 3KBBA 4OXNA 1I3NA 1Z6YA 4TS4A 3I2JA 4EMUA 5CGZA 1RWOA 1TIPA 5A9SB 1XD2A 1C4KA 1KQOA 4R9SA 1KJNA 1P39A 5AM2A 4O5OA 3A25A 1ONPA 3DO5A 3WSWA 4Z53A 4GOND 4DIFA 2WJVA 2X8LA 5I9TA 2K87A 5KJFA 1TYBE 4EFNA 5DWVA 1OX4A 1TMYA 4R2MA 1DHRA 4RTRA 3DT6A 1ODFA 1S2IA 3PVCA 3GFSA 3GLGE 3M2PA 3LQYA 1C4XA 2IYZA 4RJTA 3C3EA 2YY6A 1SVUA 3ASYA 1DG3A 4GPAA 4CKWA 5KDDA 1NR7A 1MB2A 3ON5A 4CMAA 2XQVA 3GJRA 1PGJA 4INPA 4ETNA 1CF9A 1OFTA 1M34A 1BVHA 3CJTA 1X2EA 2B1IA 2CMHA 3P0IA 4HB2A 1IM8A 4XUEA 2BMEA 1IEVA 3S6JA 3AV0B 2RB4A 3T61A 1ACMA 3EBPA 4NYJQ 2EL7A 4DV4B 1B15A 1KH3A 4LZJA 4MKHA 4UNNA 1LFDB 2P9JA 4K1XA 1KO4A 4LMRA 1VMDA 3AR6A 4OLHA 4JSTA 4Q9HA 4YRQA 5CTAA 2C0QA 2I87A 3GFOA 1UINA 5CIQA 1GSIA 4YWHA 2O5EA 1RACA 4CHGA 2JAWA 4ZD6A 1GQFA 4GMXA 1C1HA 2P75A 2VO1A 1S7GA 1SBTA 4RDHA 3VR4D 1R4ZA 1ESCA 3HR7A 1UJMA 2CXQA 1SOVA 3KXLA 2AOXA 4XWKA 5EHXA 4HDMA 4S0ZA 1Z15A 1J7KA 4UAVA 1JSRA 3STWA 3WTCA 3WZ2A 1AA6A 3ND5A 4FDAA 3HN7A 1GAWA 1KSHA 2YN0A 5JZOA 1MDBA 3V80A 5JOQA 1E1NA 2GHIA 1T5LA 1DAHA 1P3JA 1FS6A 1YU6A 5KIAA 3QE2A 4P81A 3WR5A 3D6HA 3LC0A 5JAMA 3KWFA 8MHTA 3DR3A 1AGRA 1QAMA 4R1LA 2ST1A 5LNK1 3L84A 3U26A 1Q2UA 2VSYA 4TQUS 4HRYA 4A3SA 4XYLA 4WLOA 1EVYA 3KJHA 4LMAA 5K0ZA 3IDQA 2NSDA 3KETA 3ESYA 3I5XA 2YX1A 1OHHD 4PRLA 1V8DA 5TQVA 3QX7A 3FGPA 3IB6A 1N6OA 1UR5A 1LF0A 4YAEA 4M1TA 3FSGA 3UM9A 1G6Q1 3QA3E 3D0RA 4PONA 1T4CA 4WZBA 1HDEA 2QM3A 4M55A 4NF2A 3REQB 3IAXA 3U2QA 2HMAA 4OU5A 3DKIA 4UC0A 2EXXA 2PR7A 3AUAA 3W5BA 2HH9A 3EMVA 1MAAA 2HBQA 2R97A 3LC2O 4FQ8A 3JQBA 1CHDA 5AK3A 3HE3A 3ND9A 3VPHA 4B85A 3ZE1B 4EVIA 1JQJC 3TDNA 1JRLA 4KR6A 4QTYA 5A5EA 4HZUB 3AR8A 4YWJA 3FJ1A 3ONEA 4ZU3A 1FSGA 2ZEJA 5HMMA 4KPYA 4L3VA 4Y67A 5HS4A 2PMBA 4ZCMA 2ZAYA 4MQUA 1PT9A 1U6JA 2C58A 4FVTA 1DEHA 2O48X 2EWMA 2IYFA 1GILA 3QKRB 3TNFA 3ZCSA 5A2GA 1OB5A 5LXTF 1QF6A 3MRXA 2CJWA 3COJA 3TLBA 1YS6A 3W9BA 2XNDA 3BMQB 3LWDA 2X0DA 2XQGA 4KQKA 1YB5A 3MLBA 5TQ2B 3EW9A 3OZDA 2J4DA 3UA4A 1T4CB 5JY1A 3V8QA 3VYTB 5A5VA 1EFRD 2RAPA 3T41A 3IQHX 4Z4GA 3ENNA 4E6PA 3KLOA 1AXEA 2R25B 3D2BA 4C88A 1K7SN 4JX9A 5L4SA 5EPUA 3GJSA 1MABB 4BE7B 1E59A 1B00A 1LLCA 3IR6A 3FTNA 3T94A 2F2TA 3Q8KA 4N8EA 1RC8A 1L4KA 3DNPA 4C4SA 3AQ4A 3LXMA 2PD3A 2XUHA 4Y9RA 3SSMA 2A67A 4B9EA 3H8VA 1N5RA 2SNIE 3LVRE 5AKLA 3A1VA 4JQYA 5CGQB 2QRVA 4ED9A 4LV5B 1ULHA 1Z4JA 2XUAA 1GG9A 3LCRA 3AX6A 3KYDB 2EJTA 5JQGF 3P4UA 2FPOA 1A4IA 1UT8A 1ZNQO 3EWNA 4PPYA 3RSSA 4BNYA 1U8YA 1N33B 1QGAA 4DDKA 3F5QA 1Z8DA 3ZXSA 2FPMA 3QFFA 5AICA 2YNMA 3FVWA 3QVOA 1AKEA 3AI7A 2ODPA 2W6ID 3PFWO 4IIHA 2PPLA 3WBKA 1I7QB 1I1QB 3MJTA 4BMCA 2UVDA 4P83A 1Z7EA 3D8HA 2AI3A 3QPUA 2VDMB 5GZ3A 5KYKA 5MN4A 3WGIA 3K6JA 1T8TA 3C0KA 1M5RA 1UWVA 1C41A 3VPSA 3S2FA 4YO7A 2NUAA 3TTWA 5IZCC 1DS6A 1ZOSA 4BZWA 1V9LA 3KAQA 4RV5A 5TEWA 5JEDA 4BU0A 1C7FA 1CG6A 2GM9A 2H4HA 2XNCA 4N6NA 4BASA 1UXJA 1XTZA 1AZTA 2B83A 4E5DA 3SQOA 1KDYA 1QE3A 1FMJA 2VYCA 5AKIA 2R6FA 2K6GA 3INRA 3PQCA 5HJ7A 1QFYA 3EIOA 1E4YA 3W78A 2VNKA 1EDDA 4K46A 1L4EA 5LLTA 3D5QA 4HWOA 4M76B 2PYZA 1C9NA 2ZBVA 1GN9A 1HNXB 5EY5B 1QCZA 3KCQA 2IUUA 5F9MA 4U7FA 4H6XA 1M75A 2BH9A 2Q1UA 4DV5B 5JNWA 1PJ2A 3A1EA 4ARAA 1E1MA 3B1JA 1A9PA 1E4VA 4IIDA 4YCDA 5EP2A 2O3SA 3CU5A 1RABA 3JATA 3V8MA 2E48A 4DSOA 4FIDA 5F78A 1BRMA 2PKRA 3ZY4A 4OV6B 1A82A 2I7CA 3PJFA 5L51A 4KREA 3GLTA 1N2JA 3QU4A 3TBKA 4Z2YA 3RGWS 2J3KA 1ISHA 1YS2X 4XWOA 1HTWA 3AJDA 2F3RA 1Q16A 2VUUA 2QW8A 1NYQA 3GIDA 2UDPA 4TMTA 2ZRCA 1S2LA 4N01A 4K9KA 3WWYA 3BK2A 2G4VA 3O2NA 3OOEA 4PGGA 4Q3CA 3TGWA 4DIEA 3QI2A 4DLBA 1TAQA 5D3MA 5BN5A 2WKQA 3NI2A 3RU9A 5IDYA 3W9YA 3L02A 4X8OA 2ZQ5A 1NTOA 4Q1EA 3EZ9A 5CJPA 3BILA 3UPUA 4NIMA 3IP9A 1OC2A 2I33A 3SBXA 3TIGA 3W79A 2PZBA 2WDPA 5B2FA 1IU9A 2Z83A 2XUJA 4I1YA 2GESA 1MQ9A 3HWWA 1Z0JA 1A7JA 4UDNA 4NDZA 1NWCA 1B14A 1T2DA 3KZOA 1NASA 2OBYA 2QVBA 4ZVQA 3PRKE 2AKEA 2D1RA 5H9VA 3BJMA 5TR9A 3ENWA 3MIIA 1Y5RA 3CEJA 1Z73A 1NDUA 2ZATA 4BHTA 1YD7A 3LUCA 5SYNA 1JFFA 1UAGA 1CUYA 4NESA 5EFZA 4LJKA 3O9MA 3A6PC 2VPQA 4RNDB 2CBXA 3OZFA 4HT3B 1BMTA 3I8XA 2VJMA 1DCKA 2ZBGA 1JQ5A 1JV2B 3HXLA 3DLBA 2O57A 2ZSEA 3KWJA 4OKIA 4BGDA 4I4IA 3THYA 1KYXA 5DK6A 3ZHOA 1UOEA 2JVJA 1PJLA 1U1CA 3OCWA 4XDZA 1QHYA 4GZLA 4C43A 2ATCA 2GX6A 1DOZA 1S4QA 1SC6A 3QEBZ 1HDZA 2RGNA 3F5SA 3O1IC 5JDCC 1U0NA 2J3MA 5EPOA 2SECE 3OM8A 5ELMA 3IODA 3D1JA 3W4KA 1O4WA 4LSWA 4C7XA 4O0LA 2X2EA 5JEEA 3I6MA 3BAFA 3IKVA 2I3GA 4LJSA 3T4XA 3UTCA 4R2JA 4KAAA 3IAS1 3ZU5A 3Q11A 1CUSA 1Y9JA 2Z2JA 3U44A 5AVVA 1T3TA 1H6AA 4O4JF 2OHGA 1PJQA 2DX7A 5CA0A 1Q0SA 2C59A 1GAEO 1RXUA 1ODSA 2LCFA 2YNMD 3PXCX 3IKLA 4I55F 3WKCA 1NG9A 4LY6A 2ZCJA 4OGGA 1Z63A 2Q6KA 2BFOA 3GPIA 2I1LA 4PZAA 1KOLA 2YQ5A 1DIOB 4YCNA 1E2PA 1AZSC 1P74A 3C7AA 3KR9A 3ZGLA 1LFAA 1ULAA 4DGSA 3MBOA 4YRIA 3IVRA 2RC6A 2MJLA 1XVTA 1HUQA 1LBEA 2C4HA 5DN6D 2XT0A 1T24A 2X1VA 3EGOA 3K0HA 4LBZA 3DTVD 1SCKA 5J58A 3H2HA 2ZPTX 1QIEA 5GJCA 2HX1A 5C8YF 2H3HA 5K4AA 1HLFA 1ZIOA 3CNBA 5FOUA 1H2HA 3LY9A 3BHMA 3Q5EA 5DEOA 1Z6PA 4IKPA 2NTJA 3PX3A 4ECAA 5KQSA 1OWNA 4MIYA 1UDXA 3CMMA 1KZ1A 3QPBA 3CSUA 4ZVNA 5LR6A 4BKPA 4ZALA 1V16B 3KTAA 1N77A 3HB9A 1EFRA 4N1AA 2JGDB 4AJEA 1EEXB 2UUCB 1AH2A 1I4DD 2H2WA 3WGHA 2G4LA 1RJEA 3NDJA 4QO7A 3GCGA 3SHVA 4DDUA 4GG1A 2NQTA 2AQKA 4FFMA 4AROA 2FKNA 5THQA 2AHRA 2J59A 3AT1A 4PYOA 3SF0A 5L40A 4JZYA 1A04A 1TTPB 4FUQA 3TM4A 1E8DA 3UJCA 4M1MA 4TM7A 4EBFA 4CT4B 4M0DA 3TTVA 2XWSA 4ANFA 1K0FA 4OPMA 2YWDA 3SIXA 3EY9A 1BCRB 2E4VA 1K66A 2WA2A 3QLVC 4FKBA 4JOCA 5ALMA 3UG6A 5I48A 3UHAA 5BNTA 2HA3A 4B48A 2PL3A 3QBEA 2PZ8A 3EBOA 5HIKA 1W1IA 4RY9A 1L4HA 2GUGA 1CP2A 1YRWA 2YNMC 4F4JA 1G291 4QARA 1DEAA 1XZDA 3SHQA 4CF6A 4NMWA 3F90A 4NZNA 3ABSB 3DM5A 1GG5A 2FI1A 2XDYA 4GKBA 3U31A 1S01A 2Z5LA 3BVPA 3U80A 4MMXB 3LCVB 4M8IA 4JJGA 2VNSA 4O33A 4X1OA 2ZGVA 4RTLA 1URPA 4P7GA 1J70A 4GMDA 3GYGA 3NH6A 1FNCA 1PYDA 4GWGA 1JQEA 1RM3A 1U9CA 4RYLA 1SVKA 2YTZA 2ZFUA 1T6BY 2IUEA 3A36A 1BOOA 3MINB 3PE3A 4LHEA 4ZIRA 3T1YB 5IKXA 2QRGA 1ZL2A 1XHEA 5G41A 2AG0A 4CCYA 4LWQA 4RNCA 2ANCA 1L5WA 2QYSA 5HKKD 5HOQA 4JI4B 2IS6A 2EERA 1G6OA 3T1TA 4G36A 4MV0A 5TMEA 2IGTA 3B2NA 2NO0A 2PWAA 3OTQA 1SY7A 2IYAA 2PH1A 1L6IA 2DECA 1B7GO 1U99A 3HS3A 2AE1A 1HFKA 3HI6A 1ZRHA 4RK6A 3NCTA 2WWXA 5BPHA 1SA0B 4IICA 3SQXA 4GOMD 5FBHA 2JGKA 1XRRA 4NE2A 4BBZA 4KCGA 4KFUA 1T4BA 4MS4B 1T0JB 3NM5A 2CL0X 1VPLA 4IIEA 5B3JA 5TRTA 1QO9A 3A11A 2X13A 3VVBA 4GL2A 3DLHA 1C2YA 2VP0A 2XBMA 3UKJA 1PQUA 2OZLA 5A62A 5F1OA 3T4UA 2HQ1A 3B6MA 4ZYVA 4FN5A 3EXHC 4JELA 4NCXA 4RM2A 1KJZA 1OPRA 1XZJA 1IJBA 2BP7A 2P5YA 2ZYAA 3EY4A 3H1AA 4KQWA 4HB4A 3U5ZB 5AH0A 1SR8A 3B1YA 1FCJA 4XR9A 3VM6A 4AWXA 4BAUA 1HT0A 5AOVA 2GHQA 4RKQA 2G25A 5LLDA 1V6SA 4WCVA 1CPYA 4PG5A 3ASVA 3I5UA 5ALSA 1Z22A 1SZJG 3M9XA 4ZK2A 3ROGA 3JD4A 3ENKA 3E9RA 5AMXA 1EVQA 4BV3A 5T4HA 2JLQA 3H18A 4X85A 1ZZGA 2IKSA 4DGQA 4Q05A 4KH1A 3CRNA 3WLOA 4HGPA 5DP2A 1F7VA 4Q6BA 3W06A 4Z4EA 3BFVA 3VTFA 3B38A 3RFCA 2YZGA 3R0ZA 2D1TA 3RSZA 1P8JA 3WOVA 4AY4A 1HT3A 1HE1C 1G2IA 4AZSA 2NACA 3NT5A 4CIVA 3A1TA 4DC1A 2QN7A 1FYWA 3PXEA 4I9NA 3QEMA 3H65A 4LY0A 3A2LA 4BX3A 4W5RA 2HHHB 3JQ9A 3GEHA 3OC0A 1K89A 4MUMA 4XQEA 2O8CA 3W0LB 4DB2A 2OHOA 2V9ZA 2FWIA 3H4VA 1A76A 3P0EA 3TIVA 1YQ9A 1L2TA 4ZJYA 1LX6A 3UWOA 4BY9E 3KKEA 4QHSA 2QGNA 4AMVA 1MF7A 1P5ZB 4PSCA 1PNQA 4AMUA 1WM1A 2RG1A 1XCPA 3WWEA 3I9MA 3GDFA 1QGUA 2IEBA 3I4LA 5KTSA 2QIOA 4Q00A 5ADUS 3F1LA 3OE5A 2EP5A 4WBSA 3S8YA 2Q6IA 3HVUA 2ZI5A 2YMPA 1L9KA 3C43A 2D2FA 5EWMA 3BJZA 3BFPA 1XRNA 1N4DA 1NBWB 1NAHA 5AJWA 3G89A 4C6TB 3DJFA 2MR5A 3FI0A 1T4MA 2HBYA 1W4LA 2KMLA 3BE6A 2CL6X 2JKVA 4HLUC 1IL0A 4IDHA 4K6KA 1I7LA 1I4OA 1KDVA 3VR1A 2RHRA 3J81A 1NQXA 4B3SB 2ZBEA 1Q0LA 4M1OA 4TUYB 4CGZA 1XKQA 3VU8A 3WHIA 3U40A 3FYSA 2DTXA 2NXNA 4I50B 4G1MB 2C61A 4MQFB 1QRUA 1BNCA 2NQ2C 5E7QA 2NZYA 3LUAA 5HDQA 1UK8A 5IK2A 3ZDZB 4FZJA 1EVLA 1LK5A 1NUHA 1SQFA 4DA7A 1G4UR 1BX1A 1LVUA 1EE1A 4DWWA 3OO0A 5DMHA 1F8XA 2AOTB 1XJCA 3NDIA 5HF8A 1J4AA 3GLQA 3OOSA 1N32B 3O8QA 4MJ7A 4ZANA 3O95A 3RDPA 3SEQA 2DXIA 4LF4B 3O1JC 4ISCA 4Z4HA 3RQIA 1XTVA 4ZV7A 3ZTTA 4S04A 4LF6B 1N9KA 2IGBA 3B1FA 2B9VA 2Y2VA 4HADA 4FSHA 4WBNF 2XAAA 1FP2A 2OP1A 4UOEA 2B3DA 4RH0A 4BFWA 2LXNA 4BAGA 3QHPA 1A71A 3QX8A 1LPNA 3GRRA 1GNTA 1FYFA 4HZGA 3L0DA 3UWPA 3MWYW 4WVFA 2NP7A 4S1WA 5A7FA 5K3BA 3KKOA 3HXQA 5JNSA 1NBOA 3D0KA 3N0RA 3C3MA 1KFBB 2GBPA 4HRVA 1IZZA 1MV8A 3B6ZA 3BK7A 1MG5A 4MH0R 4DV2B 2MINA 1ECLA 2C3OA 4LBVA 4KR0A 4P3OA 1XEWX 2IPMA 1JJIA 3DZHA 2XCLA 4ZMRA 5K0TA 4DSUA 4JMLA 3RS5A 3SZLA 4PGAA 1E89A 4PFSA 2HJGA 1PN3A 2PBFA 1O7JA 3SC3A 3BIXA 1ULZA 2QM0A 3WLIA 3M3PA 2FSVA 5JD3A 4BP3A 1GGKA 1FSSA 4ZP1A 4JYMA 1MJNA 1ZW6A 1IXYA 4JODA 4JYAB 3NRCA 1RLMA 3D81A 3EC2A 1J6UA 2VC2B 3P0RA 3LBAA 2H0QA 5BT9A 1JI0A 2Q3DA 4Z8XA 1GUZA 1ZH0A 2OZVA 2ZYSA 5GJBA 3UA3A 3DBRA 4E2WA 3WSTA 3DVQX 4ZMSA 4ZDIA 1LS1A 3FN4A 4MSUA 3OQ6A 1DC8A 4EZEA 1WWKA 1W36D 1B0ZA 2XMSA 3OMLA 2QUKA 2SHKA 3P9XA 1BQ4A 1VI2A 2VH2A 4R8LA 4XEUA 4D9IA 1E3JA 2ZANA 2NAFA 1GTJ1 4FX5A 3G2OA 1H66A 2IHYA 4PZZA 4F97A 3U4GA 4G0OA 4G5YA 2J6IA 1H1LA 1TFUA 2VOJA 2N46A 3LPNA 3CUTA 3FBGA 2HW8A 1X13A 2LUOA 1GCOA 1SH7A 4FZVA 1LZLA 3LHKA 4DBLC 1TUEA 2PZGA 1PSDA 1ICEA 3ILHA 1PFYA 1TCBA 1UBGA 2CLCX 3QK7A 1RKQA 4TMFA 1IEQA 5EJAA 2C3UA 2Q3CA 1RQ2A 1QAOA 2IBTA 1TZBA 3IEUA 3EWSA 3KHTA 4P82A 4PO8A 3A9WA 3EQ9A 4GOOD 2OFWA 1A9QA 1K2WA 2X2PA 5COQA 1S8FA 3PNOA 1CYEA 2WF6A 3NATA 3GUVA 2IP1A 3KYBA 3LLVA 4GYKA 1AOXA 2YVLA 4UNPA 1Q11A 1UJBA 5JJLA 4D7AA 3SQWA 4W1QA 4QFMA 4QFBA 1XRSB 4R1MA 1E7SA 1TGVA 4DT1B 4EUFA 2B1JA 3GLFB 1RFLA 1RW4A 4B2LA 1G20B 2EWWA 4LWPA 3D3KA 4Y2YA 4EG6A 2XJ4A 2Q2NA 2MT9A 1IVNA 3K70C 3KSUA 3KOXA 4DYHA 1WLSA 3OQOA 1DKUA 3RFFA 2C2ZA 3GP5A 1VJ1A 3HMKA 2C0CA 1L7QA 5CW1A 4GGPA 2ZSBA 3GJQA 1KQNA 3TNYA 2XKJE 4CCWA 4NV3A 4F1JA 1OW3B 5CFNA 4L4YA 3M1IA 1O94D 5IKOA 5KREA 1WOYA 1YL5A 1Y1LA 3OT5A 5E6SA 5HKLA 1A1SA 2X9NA 3AF5A 3U3ZA 5BMVF 3JY6A 5IK2D 5ALZA 3UFXB 2EDAA 3FIJA 4M38A 3PWSA 4GU5A 2BFCB 3O93A 4MS4A 2OK8A 5H3HA 3H5IA 5DH9A 1X1RA 1ML4A 1UC8A 2YQ4A 2ZJ3A 2RHGB 3IP6A 4I6EA 5GJVC 4BNKA 1HG1A 1CB7A 1QGYA 4HDRA 3FROA 1KI8A 5K0NA 4QREA 2EJUA 4GKKB 2YIDA 3RYHB 1XXHB 3ENZA 3UANA 1SEPA 4DCOA 2D2XA 3A27A 2WE7A 4ZHQA 4KGXA 1M1NA 4EBBA 4I55A 2O5CA 5CXQA 2BGGA 3TOXA 4BFXA 3RIXA 4EF5A 4HEA6 4GE3A 4PBRA 4PLTA 2M6KA 3RJ9A 5BVHA 1QQ6A 2YJ5A 4C2AA 3J80A 2DY1A 2CVOA 3TKYA 1QQ7A 2AFVA 4KE7A 3UMBA 4CQLA 1DEKA 5L6LB 4XA8A 2GN8A 1NVMB 2RC5A 4GZMA 4AC9A 1UDAA 2Y66A 3NO4A 4Q3AA 1V11A 2E4ZA 3BWXA 5LBUA 2DQYA 1E2NA 2AL7A 1NG1A 1OI7A 1RHJA 1F2DA 3X1MA 1QB7A 1QH1A 2WUVA 5FBZA 4HPWA 2ZXFA 3U3OA 4DR1B 2FK8A 4JBIA 2BY4A 4X44A 2JLZA 3ZCPA 4ZAXA 1PZMA 5CM2Z 1DL5A 1TDJA 2HD4A 3E1KA 4FFLA 1Q7EA 1E9CA 4BNWA 2OSVA 3QWAA 4OYLA 2WUDA 2ZWIA 3NW9A 5IASA 3A1SA 1H0KA 3ZHRA 2JASA 3HA2A 4CMIA 5JQGB 4P32A 1XV5A 2HFKA 2X9LA 1W85A 1CQIB 3HCBA 4HX2A 3GEPA 4JQCA 2VXYA 3TK1A 4TV9F 1SKYE 1UL1X 3KJIA 1P17A 2YWEA 1P0FA 2H9YA 2CMGA 4I9HA 1VSUA 1YJBA 2FP4B 4LA4A 4PLYA 1OYWA 1NM5A 4EW6A 4QOHA 4RVSA 4R0MA 3B36A 5BQXA 4D0SA 2HSJA 3EWAA 4QPNA 2ZB3A 3DEZA 2DPXA 4NH0A 3QV2A 5DDIP 1IWBB 4G1BA 4RZHA 4YJGB 2NVUB 1ZAKA 4RPHA 3ZWYA 3F3KA 3NGMA 1XA3A 4QG3A 2QYHA 2R5WA 3UMGA 1KI9A 1NBMD 2GZ2A 4ZI2A 2A94A 4DR6B 1P0CA 1AB6A 3QVMA 1V26A 2Q2OA 3KYIB 2W22A 1DKNA 4BFCA 2F55A 3K0KA 2ZJZA 3TG8A 2IJGX 3MFQA 1ESNA 1GRQA 4XB2A 1XFAA 2R8OA 3BJRA 4EKNB 1XXHE 2X7XA