4XWYA

Crystal structure of human sepiapterin reductase in complex with an n-acetylserotinin analogue
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reduction of Neuropathic and Inflammatory Pain through Inhibition of the Tetrahydrobiopterin Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xwyA00
4HUJA 4IJUA 1LDYA 5IZCA 1JAYA 1PJ2A 3S2GA 3C7AA 2ZQZA 4IQGA 1EVZA 1U2GA 3F1LA 1A9YA 1WXDA 1GQQA 4NHEA 1B14A 3ZWWA 1WWKA 3O38A 3PHGA 3AOEA 4NI5A 3O4RA 4A0SA 1NHWA 1H2BA 2J3JA 2RAFA 1AUPA 3WXBA 5CDTA 2Q1WA 2R2GA 3PK0A 4ZU3A 4B4VA 1I33A 1V3VA 1T4DA 5EQDA 1M6HA 1ZO8A 3GR6A 3G17A 2P4HX 2NU8A 2XPCA 3F1KA 3ZGYA 4RDIA 4MP8A 4WECA 3BZUA 3DHNA 5JC1A 1X0XA 1QRRA 5FWNA 1PR3A 1DRUA 1DIGA 4WCFA 5AXDA 4CMBA 1YL5A 3B20A 2EKLA 3PQDA 1ONNA 1PTJA 1U5AA 5EL0A 3ZWAA 3PWSA 3ITKA 3FI9A 5KIAA 2NQ8A 4B4UA 2UV8A 4ALMA 3GUCA 1H9AA 1WVGA 1H6CA 4R1TA 5T6BA 4IMPA 3DHEA 1I2BA 1LTHR 1ZK3A 2ZTVA 3DDNA 3TL3A 4CM9A 4MVJP 1NNUA 2OP1A 1Q1NA 4WPGA 4K26A 2W8ZA 1DC3A 1N92A 3ZV6A 1NXQA 4NNJA 2J8ZA 4NFSA 3RKRA 4ALIA 4IDGA 4NIMA 1AHHA 1N1EA 2EEZA 4BNZA 4U5QA 3H2ZA 4XYEA 2CDAA 3JQ7A 3BMNA 1GV0A 2CDCA 1KIFA 5CG2A 1DEHA 4J0FA 1EBFA 3A06A 4Y9DA 1HWYA 2FZWA 3VH2A 3ROKA 2X9VA 3C7CB 2CFCA 4P22A 3V1UA 3WGIA 3RUCA 1GFSA 1SAYA 2JAPA 3EUWA 3LT2A 4FGSA 1NP3A 4M1QA 2X0RA 3ZWNA 2DTXA 2V6GA 3NT5A 4RPKA 3TOXA 4E13A 1T1SA 3JQAD 4ILKA 4ZQGA 1U3UA 5EN4A 1RWBA 1B8VA 3R1IA 3WGOA 3B1FA 1EQUA 4PRKA 4U0JA 3AM4A 4YAGA 2ZYGA 3BHIA 1RPNA 2X5KO 1H6AA 4XQEA 1LSOA 4BNXA 1HYEA 4N5MA 1I5RA 4KMSA 1M76A 1XEAA 1YGYA 1DC4A 4O1MA 5BNIA 4PVCA 4XGIA 3DB2A 1VSUA 4N18A 4OKIA 4LISA 3WBFA 4Q3AA 4NU6A 3OEYA 3STHA 1GYRA 1DOHA 2DT5A 3UCFA 1UP7A 3TF5A 4GPD1 1EQ2A 2X23A 1QLHA 1ZZEA 3VDQA 4WOKA 2WD8A 2IODA 2RHCA 4BVAA 1ZSYA 3ZHBA 3HNPA 4Z0TA 3NTOA 4R16A 2GR9A 3D7LA 4F45A 1R4MA 4F6LA 3CKYA 4ND4A 2GYYA 5GZ6A 4U6QA 4BGIA 1U2DA 4NBWA 1XKQA 1GEEA 2JL1A 1EK6A 5HBRA 1E77A 3PZBA 5BNFA 3AI1A 4B7CA 5A5EA 5TT0A 4ID9A 4M8SA 4D0SA 3X2EA 3GDOA 3GNQA 3EW7A 2Y68A 3ADPA 4G5HA 3ST7A 5JNLA 4QT0A 3EDMA 3GN1A 2C82A 4UEOA 3K92A 3NX4A 4FSHA 5JDIC 4D44A 1HLDA 5AXCA 1NFRA 4QTZA 3DTTA 1HSOA 4RQTA 3VH3A 5C7IO 1BXGB 2GZ2A 4FFMA 3GNSA 1LDMA 3N74A 2Z1MA 5FYDA 1GYQA 3QW2A 3F9IA 3F4BA 4FQ8A 4D45A 2PV7A 3ZU4A 4XCVA 4CV3A 3GUYA 1B0AA 3CXRA 3H5NA 2VWQA 3FWNA 3RUFA 4U7WA 1Y5RA 3F5QA 2XXJA 5JYDA 5A06A 1ZMTA 2FWMX 1JAXA 1PX0A 3PJGA 4O5OA 4PZEA 4RL6A 2Q2QA 3NTQA 3PJFA 4ZN6A 1H6BA 1EMDA 1SCUA 1PL8A 3IKTA 1I0ZA 3RU9A 1NM5A 5JY6A 2AE1A 2AQHA 1PWXA 4YT4A 5JAMA 4QXMA 4G81A 3RU7A 1PZGA 4ESOA 4CM4B 2FZEA 2Q3EA 4F3YA 4I08A 1B3BA 1YKFA 2VUTA 5F5NA 4L4RA 1HF3A 1QP8A 1QORA 4CM7A 1P31A 1BDBA 3EK2A 2VHWA 4WLFA 4I5GA 4HFMA 3GA0A 4XWYA 4B7XA 1GADO 3DBLA 1U4SA 1K6IA 3UXYA 4NU5A 4KP7A 3PLNA 3H2SA 3ZH2A 1MB4A 4E6PA 3B1KA 1PGJA 1A9ZA 1I8TA 1OC4A 2EGGA 5JE8A 1Q0QA 1OC2A 3DMYA 3JQ7B 5BR7A 5CAEA 3ICPA 4KUHA 2OMEA 5KWEA 2VTEA 3L9XA 5MDHA 3PEFA 4RF5A 3FTNA 1QMGA 4JN6B 4FIZA 4CUKA 1YB1A 1KY5A 4Y6RA 2BGKA 3W8EA 1YRLA 3RSHA 1IPEA 1EVJA 1DSSG 3IC5A 5BSHA 4XJSA 2VHYA 4KQWA 1HL3A 5DP1A 1PL7A 5KTKA 3WX0A 8LDHA 1Y9AA 1AE1A 2D4AA 1MGOA 2C7GA 4NBUA 2EW2A 4TSKA 4WGGA 4ONEA 3OIGA 3HSKA 4ROSA 1U7HA 2Y1CA 1DIRA 1M75A 3GNTA 2YV2A 3H9JA 3T4XA 4AJ4A 4CLEA 5CEJA 1XDWA 1V35A 4GVLA 3V1YA 2I99A 3FBTA 4ZQFA 3PFWO 3GG9A 3S55A 5K6AA 1LLQA 2PNFA 1ISJA 1NVTA 4IDCA 4LVUA 3R3JA 5G0TA 2DKNA 3ROPA 1WLYA 2O3RA 4BNJA 1AN9A 1V8BA 1YL6A 4OKNA 5CHEA 5COBA 2VT2A 4LGVA 3VPXA 4YJDA 4GL4A 4EW6A 3CEAA 4LVCA 4EEZA 4R3NA 1LDNA 4PG6A 1SMKA 1K2WA 1H94A 3E18A 3ANLA 4H15A 4XEHA 4YACA 1JW9B 3OQ1A 2EW8A 5L4LA 2ZB4A 4BKOA 1R37A 2A35A 1SOVA 2X58A 4UVGA 5ICSA 3G3EA 3ITDA 2QX7A 4E0BA 2SCUA 2YHUA 2CVOA 4R1NA 5TNXA 1PJ4A 3A4VA 3SLKA 4BNFA 1I3MA 2HDHA 2NVUA 3GPDG 3AM3A 2X9NA 1GZ6A 1GR0A 2FPGA 3H8VA 2AXQA 3QJ5A 1ADBA 2Q4BA 3TZHA 2A9FA 4OH1A 2ZQYA 4EYEA 5JFOA 3KYDB 3QHAA 4DQVA 4IDAA 1LU9A 2Y1DA 4ZJUA 1QXSA 3DZBA 1Z82A 2YFHA 4EZBA 3E6AA 3VH1A 1E6UA 1I2ZA 4PLGA 4RGBA 1VL8A 2AQIA 2VHXA 3MTJA 4QECA 4CLXA 4ALLA 2GUGA 2HK7A 1R0LA 1HRDA 1DDOA 2VN8A 4CQLA 1DB3A 2O4UX 4IS2A 4J1NA 3GVCA 1MXFA 1ML3A 4YTEA 2OO5A 3LT0A 1HSZA 3MTGA 5IAAA 1VC2A 5U4QA 2ZJ1A 1N1GA 1RYDA 3JQFC 3VZPA 3TZCA 1GUFA 3FNGA 1TA4A 1F12A 1B16A 4YAIA 1UUFA 3L4SO 2O2YA 1VLLA 3D5QA 3EVTA 2EF1A 3FSRA 4W7HA 2NACA 4J1QA 4O59O 4CM6A 3DZKA 3KLPX 3ZN2A 3NV9A 5F5LA 4A7PA 1CQJA 1PQPA 5FEUA 3S8MA 1B2LA 5DOVA 4NK4A 2Q50A 1A71A 3DR3A 4JNKA 3WDSA 4PFJA 3FD8A 3HADA 3KRTA 2YV3A 2EP7A 1DPGA 2VNSA 4MKZA 2CZCA 3T4EA 1D1TA 5IXYA 4WK6A 3CUKA 4J6FA 4WKGA 1GDHA 4WCFB 2GDZA 4HFJA 3WLEA 1E5QA 1IUKA 3ZWBA 4BOYA 4E2YA 4ZQBA 2C5AA 4O63O 3KV3O 1UXJA 4PZCA 1H2HA 3WG9A 3D1LA 3FHLA 3MCVA 3IDSA 3N58A 1XWFA 1FDTA 4AG3A 3B6ZA 3WB9A 1A27A 2NNLD 1T26A 2VZ8A 5JMWA 5ILOA 5G2OA 3ZW8A 1A7KA 4ND5A 4UUPA 2E82A 4GLLA 2YHIA 3WNQA 5CEEA 2RCYA 5KJEA 3TZKA 1HDZA 3CIFA 3R6DA 4IJKA 4CMIA 3MJSA 1W8DA 4FC6A 2AMFA 3OH8A 4WLEA 3IL2A 4YWJA 3ENKA 3JQ9A 3VDRA 1T2DA 2Y1FA 1U8XX 4KDEA 1YQGA 3SJ7A 3UOGA 1HE2A 2A92A 1NQTA 1Y7TA 1DFGA 2Q2WA 1LDGA 4GWGA 1GU7A 3ICCA 5JPIA 2YDYA 2GSDA 4OXYA 3TOZA 3LC7O 3UW3A 3W1VA 2HMSA 3P7MA 4HWKA 2EP5A 3WIDA 4FFPA 3FRJA 3H5AA 2WEKA 3HDHA 1JN0A 1C0KA 4GQAA 2HJSA 3AU9A 3FN4A 1Y8RA 1SBYA 1E3LA 1OMOA 5TT1A 1O8CA 3OFSA 3ZWYA 3RC7A 2C5EA 4UVDA 3LDHA 4YAJA 2F1KA 4OIMA 2B0JA 3UFXA 3AUSA 3LC1O 3OF2A 3OQ6A 4NR0A 4XYBA 4RQUA 2XOXA 4HV4A 4BS9A 4J91A 4GMGA 2VQ3A 1BG6A 4JCOA 2NTNA 4NH4A 1H93A 4D46A 2I5PO 1EZ4A 1U3TA 4LW8A 3ZHYA 4YRAA 1WDLA 3WICA 4BGUA 3ONFA 3BMCB 1Y8RB 1GUYA 1RM5A 3HG7A 1PL6A 4KUEA 2E49A 2Q99A 1F8FA 3PQEA 4HNHA 1ZK4A 1YBAA 3PDUA 4AVYA 2D0IA 4F6CA 2IXAA 2PTGA 4XIJA 1Q7GA 3JQAB 5T5QA 1V9LA 4BHTA 3WFIA 3VPGA 3CPSA 3UCEA 2Y93A 3GVHA 1FXSA 4Y6SA 3U5TA 3UHAA 3QVTA 1HZZA 4R69A 3WSVA 1E7QA 5H83A 4I1IA 5A9SB 1BVUA 5CFZA 1PJ3A 2ZJ0A 3C1TA 4RLHA 1DXYA 1PS8A 4EUHA 4EJMA 4NBVA 3DL2A 2DBQA 1M2WA 1D8AA 2V7PA 4MKRA 2CD9A 3D3WA 5IZCC 3KTDA 2HK9A 1O5IA 5EIOA 3IKVA 1DLIA 4FW8A 4R9SA 3VTFA 4B79A 4YQYA 4BKRA 2YFQA 4L75A 2W2LA 4DQUA 5DCUA 1G0NA 3AOGA 2PD4A 2YQ4A 2E4AA 3MJVA 4GWKA 1XU9A 4J4BA 4KZPA 5L7YA 1ZK1A 2H9IA 4A03A 1ADCA 1OBFO 1VM6A 2Y1GA 1YBMA 4NK5A 3OA0A 4C4OA 1EEHA 3I6QA 4R5MA 1P1KA 1WDMA 4DUPA 2FP4A 5A3VA 1TVEA 3M1AA 3MJCA 4YBZA 3F4LA 2Z95A 3WJ7A 1RJWA 1HE5A 4D3DA 1NVGA 2NQTA 4FN4A 3EMKA 1CQIA 3O03A 1EVIA 2E6UX 3W8FA 4EEXA 1I32A 1GL3A 4JJGA 2AG8A 2VWPA 1R0SA 2C07A 4BO5A 2W2KA 5T64A 3WQRA 4DC0A 4II3A 3I1JA 5CDUA 2CY0A 2DPHA 3ENNA 1YB5A 1BWSA 3AFMA 7ADHA 4GX2A 3I83A 3FR7A 1GZ3A 3JQGA 4YCAA 5JO9A 1VPDA 3E8XA 1QSGA 4J90A 3DOCA 2ZYDA 3VAZA 3ONEA 3K31A 2AW5A 4B4OA 5KJFA 4Z9YA 4RVUA 1FDWA 4XZ3A 3RC9A 2Z1NA 2HO5A 3GHYA 3KYBA 1I36A 2G17A 3GEGA 3K73O 2HMWA 3H6KA 4NBTA 4BV8A 2RHRA 2X5OA 4E5KA 1M6WA 1Z73A 1RYEA 3DHYA 4W82A 2IE0A 2R00C 3ROQA 3KYCA 1IY8A 3PJDA 1XGKA 4MVJA 4E5PA 4MDHA 5LDGA 3WTCA 1HKUA 4NPCA 4R9RA 4L8VA 4TROA 4EGFA 5I7EA 3BTSA 4XR9A 3AM5A 4R4JA 3G79A 1M67A 3Q2KA 2B4QA 2V65A 5A9SA 3PXXA 4W99A 4AJPA 1ISFA 1ZSVA 3BTUA 3L77A 1LDBA 2HRBA 1R0KA 3JD2A 1BHSA 3DFZA 2FSSA 3QIVA 4HXYA 4YJFA 1PJCA 4OXNA 1PJTA 1T2EA 4BQRA 5BQFA 1MP0A 1U9JA 1SO8A 4B4WA 2D5CA 1L7EA 2EIHA 1PZFA 2AA3A 5TJ9A 2PGDA 4BUCA 5KVCA 4DL9A 1PR9A 1MXHA 4WLVA 1QG6A 2XXBA 3CZMA 3FTPA 2ZKLA 4KQXA 1BSVA 1NFFA 1ZCJA 3BHJA 4NJMA 3W4JA 4E2ZA 1R16A 3WGQA 4G2NA 4DLBA 1KOLA 3PGJA 1EBUA 2X6TA 3H65A 4OGWA 4CQLB 4JJFA 5HA5A 5AVOA 5IDQA 4XDYA 4I5EA 1C0IA 3OHSX 1Q0HA 1ULUA 2QYTA 4RJTA 1Z75A 2GD1O 3WOHA 3CTMA 4GBJA 5BSEA 1JQBA 3IJPA 3JQDA 4K6CA 1BRMA 3RJ5A 2NTVA 2E37A 4MP6A 2ZYAA 1LUAA 1BW9A 1Y5MA 1RM4A 2B83A 4JLWA 1B3RA 3GVPA 4PLVA 1PZHA 4A73A 2NVUB 4J7XA 3VZSA 1YL7A 4I5FA 2PFGA 3RVDA 1UDAA 2JHFA 3RCBA 4XR4A 1LA2A 1MC4A 3AWDA 1FDUA 2VTDA 4B3JA 3RD5A 1EUCA 1XG5A 4J43A 5KJCA 1DIHA 5L7TA 3PRJA 2EKPA 4DYDA 2EERA 3DOJA 5G0VA 4A2CA 5HRUA 4N54A 3TPCA 1NVMB 5TSDA 4PCVA 1E1NA 1E3WA 3GMDA 2QHXA 2WE8A 2PWZA 1LC0A 1KBZA 3DZFA 3PTZA 4PLCA 1I3NA 1TT5B 1KEUA 4CMKA 3SBOA 3I23A 1XSEA 1SEVA 4W9NC 4DIOA 1JVSA 1ONOA 5TRTA 4GH5A 1P1FA 4R5HA 4E3ZA 1E92A 3H9GA 2UYYA 5CPFA 2WWRA 1H9BA 4FJ0A 1CIVA 2NLOA 2HK8A 3HE3A 3OIFA 1QYWA 4J49A 1D3AA 4WNCA 3WJAA 4MVJG 1V3UA 4EDFA 3DFUA 5U1PA 3FPCA 5ITWA 3DBHB 1HT0A 1NBOA 2DPGA 5TX7A 3RC1A 4YAKA 4BO2A 5L95A 4WCFC 4YA6A 4CQMA 3AY7A 2BFMA 5EESA 2BFOA 2Y0CA 3OJLA 1GD1O 3ZI0A 4Q9NA 3WGGA 3OECA 3HN2A 2NM0A 3E1KA 5DZSA 1DIBA 4BNVA 2DAPA 3QVWA 1BW9B 4TZKA 2BKAA 4IJWA 4QFCA 1D7OA 1Z7EA 4E31A 3MEQA 2VOJA 2P9GA 3CMCO 4IZHA 1EUZA 4IMRA 3RAJA 2FRDA 4UVHA 3M2PA 5JAZA 1DC6A 4ITUA 2HUNA 1KVSA 2P9EA 1LBEA 3I9OA 1GV1A 4TWRA 1KC3A 4IGFA 1IPFA 2FY8A 2IEBA 4BO8A 5JSFA 3CINA 4CUJA 1HDXA 4I9UA 1K0UA 3BMNB 3L0DA 1ZXLA 3P2YA 2P5YA 4IUYA 3VHRA 1DBVO 2ZCVA 3OMLA 2QZ9A 2W2KB 1Y81A 4D0RA 5EINA 3O8QB 4Q39A 4X54A 4XJTA 1E7SA 3VVCA 3RJ9A 4MVJH 2Y05A 4YT2A 3H9UA 2ZTUA 4BNWA 3S2IA 5I7VA 1K5HA 2YZ7A 3NUGA 2BI7A 1UP4A 1DAOA 3E5RA 4XGKA 5H81A 1J6UA 2I67A 3OSUA 3T7CA 3UH1A 4GX1A 3RUIA 4AL4A 1ADGA 3IMFA 4DQXA 4KOAA 1P0CA 1XYGA 2O3QA 1GQ2A 5DCYA 3GQVA 2WYWA 1DJQA 1RM0A 4ZQHA 5GY7A 1E1MA 2G5CA 2ZB3A 3TFQA 2X5JO 4PG7A 4CV1A 4BL5A 4J1TA 4ZHSA 3DBRA 4PLFA 3KEOA 5JDIA 1MA0A 2P68A 4XRRA 3PIDA 4CLOB 1HDCA 1GY8A 1VE9A 4CLHA 3OA2A 4OSOA 2B36A 4RZHA 5ER6A 1E7WA 2EXXA 4K28A 3RFVA 1CJCA 1E3SA 1MG0A 5F1PA 3H3FA 4GI2A 4DIBA 3D3EA 3PI7A 4BQPA 3C1OA 2GN4A 1BXZA 3F5SA 2CVZA 3PHJA 4YT8A 1IB6A 3JYOA 3DTYA 3ZNQA 4UUMA 1JKJA 4TMFA 3CZRA 2O3SA 4ZGWA 1IL0A 2O3TA 4L73A 3H7AA 1G6KA 1BVRA 2Q45A 2WD7B 2CF5A 1GQYA 4H3VA 3DC2A 1LNQA 3D5TA 1C1XA 4MIYA 5HS4A 5AOVA 1Q2XA 1T2AA 3DOOA 5HWSA 1W6UA 1NFQA 3E48A 5IDWA 2YQ5A 4XQGA 5L51A 5A05A 1X7HA 4PLWA 1YJQA 3WS7A 2DQ4A 1R4NB 5JCJA 2AQKA 2QZZA 1XCBA 4U0KA 1ENYA 2VOEA 3BMOB 3JV7A 1JLLA 3AU8A 2PLAA 3B70A 5COAA 1VJ1A 1CEQA 2UUOA 3AFNA 3NDRA 1U7TA 1YDEA 2GZ3A 1W0CA 3PJEA 3WTBA 1NYTA 4OMUA 2DTEA 3CSDA 1IYZA 3OICA 1Z45A 3K5PA 4CV2A 3LZ6A 3M2TA 1KVRA 3Q6IA 4JQCA 5BT9A 2BMAA 4QO7A 4Z3DA 4FFOA 1Q7CA 3D4NA 2Y99A 4PGFA 3PQFA 1ISGA 2WMDA 3X2FA 1UP6A 2GLXA 4CODB 3WMXA 5LC1A 4DBZA 4EUEA 4R1UA 5A03A 2GF2A 3HZZA 5T67A 4CV0A 4CR6A 4DIFA 3ZU2A 3ZWXA 2IRWA 4WJZA 5JS6A 3ZWOA 2Q49A 3Q11A 1UAGA 2FR1A 4FC7A 2BHLA 4OOEA 4RVHA 4DRYA 3SLGA 4BNYA 4RZIA 3KYCB 4KUGA 4W7IA 1XLTA 3IP3A 3PYLA 2NU7A 1SZJG 2UAGA 4RF3A 2BGMA 1LEHA 4FBGA 4IY1A 1SNYA 5I7SA 1N9GB 1YE3A 3GGGA 3PP8A 5EJ2A 4W9NA 2AEJA 2P91A 1Y6JA 3G1UA 3QQPA 5K6AC 1O89A 1ULSA 3LSYA 3B1JA 4EBFA 2BD0A 3AI2A 5JW6A 3U3XA 2ILTA 4QUKA 1LJ8A 1HYGA 4GGOA 2X0JA 4UULA 4YPOA 1GTMA 2BF7A 2GNAA 1BXKA 3S2EA 2O3JA 4FPXA 1LSSA 1E7RA 1IHYA 4CM8A 3QY9A 1R66A 1IOLA 3L9WA 4GSKA 4IIVA 5KKCA 1A7AA 4XQ9A 1EE2A 2ZATA 1D4FA 2NWQA 3I9KA 5JO0A 1PSDA 1PGQA 5IG2A 4BO6A 4ZD6A 5JDCC 2HMTA 3DAGA 3PIIA 2B35A 3UKOA 3V5NA 3D0OA 1Q0LA 3IQDB 1ARZA 4PLTA 2PZJA 4HX5A 4RVGA 4K9DA 4C7KA 1XELA 2X8LA 3HN7A 3NAQA 4O0LA 1F14A 4OHUA 3ZW9A 4CLRA 3DQPA 1I30A 2JKVA 2FOIA 2PD6A 3LQFA 3WQSB 2OOSA 2OBYA 5F3RA 1XR3A 3KSDO 3UICA 2B5VA 4J9VA 4ZQEA 2GN6A 2QRKA 1YB4A 2A94A 2VUUA 5T8KA 4GKVA 4DGSA 3NJ8A 2ZB8A 3KZVA 2H63A 3F46A 1OAAA 5EERA 1G0OA 1NAIA 9LDTA 4DXHA 1ZNQO 4RDHA 4Z9XA 1C3VA 4KWHA 1LDEA 1JDJA 4GX5A 3RWBA 3H3JA 3DAPA 4CQMB 2FR0A 2P9CA 1NR1A 3C3XA 4R41A 2V6FA 1DFIA 3KXDA 1U5CA 1UH5A 3QWHA 1Z7BA 2C54A 2Y1EA 4N5LA 5AXAA 3DZGA 1HZJA 4L9RA 3U0BA 3H4VA 3DZJA 1ZEJA 4CMEC 4QX6A 2Z5LA 4Y6PA 1LRLA 4Q3CA 4TZTA 3WGTA 5HS6A 3E82A 1X14A 4IQ0A 5CP8A 1QKIA 5BNTA 4RVSA 3HDQA 3I6IA 4MPDA 2X86A 4UUOA 4TKMA 2DBRA 1YQXA 4OJNA 1T25A 4JBIA 4E21A 3RKUA 5L53A 3JYLA 6LDHA 1YVEI 3H9QA 2UVDA 4JIGA 4TRMA 3GZNB 4IS3A 1Y8QA 4P4GA 3P19A 2JJYA 3FCOA 1ORRA 2QRJA 3ULKA 4PVDA 4IGEA 2D5AA 2VRBA 1KEVA 3OP4A 4OAQA 1WAMA 5ENVA 4J7UA 2P4QA 1HEUA 1PEDA 3JYPA 5B4TA 2OUIA 2G0TA 3JQGB 3CH6A 1CERA 1H5QA 3LF1A 4RPJA 3ETEA 5DULA 1GAEO 2OP0A 3NGXA 1E0DA 2PZKA 1T2CA 2DU8A 2VYND 3EYWA 3RI3A 4HNGA 1LRJA 1T4BA 3Q0EA 4ZA2A 4XRGA 3U4HA 2BI8A 1SPXA 3K96A 1E3IA 1PGNA 1GPJA 2NTJA 2X22A 3JQFA 1SB9A 1OOEA 1XU7A 4RPHA 3A1NA 4BO3A 4IINA 3MWEB 5F1OA 2PH5A 3C7DB 2GN9A 3INTA 4Z6KA 5TIIA 2NVWA 3KSUA 4LN1A 1VJ0A 4CM1A 3OEWA 1F8GA 3OJEA 1TB4A 2ZB7A 5TS3A 5LDHA 5ENDA 2I6TA 4OQZA 4R68A 1W4ZA 4J7CA 2DUWA 2I65A 1X1TA 3UN1A 2OXIA 3MJTA 1NASA 4FS3A 1UXKA 3DBVO 4PIVA 4AJ1A 2YW9A 1X7DA 3I5MA 2OZPA 4I9NA 2C59A 5ITVA 5MGBA 2WM3A 5KJ1A 3RFXA 2NV6A 4J4TA 4OO3A 4CM9D 3RFTA 1VL6A 2OORA 5B12A 1CRWG 4A5OA 4P4LA 3PHLA 3NDJA 5DNAA 2HLPA 3ZWPA 4BNNA 5KKAA 3RUDA 2R00A 3VPFA 1A5ZA 1ZFNA 2Q1SA 2IYPA 5IN5A 3UAGA 3KO8A 4DLLA 4ALJA 1HLPA 3W8DA 1P45A 3PPIA 5JDCA 4GLOA 4QFDA 2BELA 4J2HA 3ZU5A 2DBVO 1NHGA 3HFGA 3FNFA 1TEHA 3VC7A 3JD0A 1MUUA 1PQUA 2FHSA 4FFLA 3COSA 1X0VA 1HDYA 3AY3A 5DOZA 4D7AA 3FNEA 4BNLA 1X1EA 1YWGO 3ZU3A 1XIVA 2LDBA 1T24A 3BMOA 1CYDA 4OOFA 2ZK7A 3KB6A 2WE7A 4WLUA 3QVSA 4EJ0A 5C5IA 2JD1A 4GSLA 3JQBA 2FPPA 3PWKA 3JQ6A 3V2HA 3E5MA 4E2WA 5L4NA 3GT0A 3SEFA 4D79A 3TDKA 2OHXA 1A72A 2I66A 4UAGA 5TJHA 3U49A 5IFLA 2G76A 1Z6ZA 2CUKA 4GVXA 4AJHA 2Y1OA 4E4YA 5KOIA 3WYBA 2HJRA 3QSGA 4GAEA 4A26A 1FDSA 5C3MA 1HDGO 4YRBA 4E5MA 2O23A 5TF4A 4DBVO 5B4VA 1C14A 4M89A 4D41A 1VJTA 3RIHA 1PU2A 3JYQA 4CLRB 4PG5A 2GGSA 3GMSA 3KUXA 2VRCD 4BNTA 3KETA 4CUZA 4CLOA 2I9PA 1V6AA 2AE2A 3GFBA 1UAYA 3EY4A 1NR7A 2LDXA 2BFPA 2AHRA 2HMVA 2VYNA 3TN7A 4MVJE 2XF8A 1EDZA 3A14A 1P0FA 2ET6A 1HXHA 4RO0A 3PYMA 5JAIA 1P1IA 3SVTA 2EJVA 3IIEA 4L74A 5AQ1A 1C0PA 2QRLA 5JXWA 3ETDA 2O7QA 3GG2A 4CL3A 4CQMD 2IXBA 1NWHA 2G82A 3WBBA 4TRNA 3ADOA 5KVVA 1KS9A 2DC1A 2JFGA 4CM5A 3WYCA 1AXEA 2Q46A 3WNVA 4ZRMA 2WTBA 4M87A 4DTIA 3DO5A 2JCYA 3JCZA 1HDOA 3KLMX 3NEPX 4N7RA 5J23A 3C8MA 5U9CA 2BGLA 5EQFA 3W6UA 5HM8A 1H0KA 4PLZA 2NU9A 1B26A 2H1SA 5ADHA 1PGOA 5F1KA 4XYLA 1O94A 2O4CA 1ONPA 1PIWA 2NU6A 2PGLA 2VRCA 4H7PA 4UREA 5I9LA 4LMPA 1DAPA 5DBFA 3WWYA 4CLDA 5GMOA 2YHIB 5JMPA 3U9LA 1N2SA 1B8PA 2VYVD 1ZEMA 2VNAA 3AJRA 3FWZA 3WFJA 5DBIA 4D43A 2AEMA 4DMLA 4BO9A 3HQ4O 2RH8A 1W73A 1MX3A 2FMUA 5I9MA 1EVYA 5A9TA 1BGVA 1UDCA 3O8QA 4LSMA 1TLTA 2EV9A 4G65A 4JK3A 3RQSA 4A27A 3KEQA 4MVJD 4Q3DA 5EMHA 4OSPA 3GK3A 5BSGA 3Q3CA 4OXKA 2IEDA 5CPBA 3W6ZA 4U6SA 4I8XA 1UZLA 5CDGA 4E30A 3MZ0A 3ZDFA 4LCEA 1L1FA 5F21A 3INRA 1H6DA 1O95A 1SB8A 5K0ZA 2WD7A 5I7FA 5EPOA 1WP4A 4DLAA 1A4IA 2IZ1A 3ZHXA 2W90A 4HADA 4I5DA 2JFHA 5LCXA 2A4KA 2X9GA 2V6BA 5DN9A 3JQBC 4Z9FA 1F17A 4MVJM 2DLDA 4RV9A 3VTZA 1RM3A 3VH4A 4ALKA 3GAZA 2NUAA 3GGPA 1EFLA 4AJLA 4FDAA 4YJFB 3I4CA 2WDZA 3MJ4A 5DBGA 2FSVA 2ZTMA 3L4BC 3OQBA 5DCWA 2D59A 5FF9A 4E12A 5FI5A 1I10A 2VWHA 3L6DA 3W4IA 4B8WA 4E2XA 4DC1A 3VVBA 1ZK2A 1NPTO 3UCXA 4YVFA 3KYDA 2WSBA 3HB4X 2VUSA 2RH4A 9LDBA 5KCZA 4M54A 4CMCA 1YOVB 2J5QA 2IDZA 5TGDA 3VZQA 1ZBQA 3UVEA 5H82A 4O6VA 1KVQA 5DF1A 4E33A 1P74A 4ZVVA 4RF4A 1DRVA 3UUWA 1MV8A 1F06A 3E9NA 3MOIA 4AJOA 3GY0A 2Y67A 1KY4A 3K2BA 4CMAA 4CMEA 1E6EA 1PJQA 2EG9A 5K9ZA 5L9AA 4IDFA 1DHRA 4L4XA 1MC5A 1LLDA 1XA0A 3GPIA 1JTVA 1X15A 1FJHA 1UR5A 5FFFA 3LT4A 1B7GO 4K1LA 4YEDA 2WYUA 4BB6A 3AI3A 3PHHA 4TRJA 1VKNA 2POQX 1KYQA 5HTOA 2YJZA 1MFPA 2JCXA 1HDRA 4FFNA 5GZ1A 4RLSA 1DO8A 4AICA 3TNLA 3MJEA 1Z74A 1SEPA 1GUZA 2OL4A 3BMCA 3FNHA 4U8GA 3GRPA 4IDDA 2IZ0A 1U4OA 4BNHA 2AQ8A 2FR8A 4DVJA 1AHIA 5IDXA 2HQ1A 1ENOA 1KEWA 5A4DA 4GKBA 4BIIA 5CG1A 2C2YA 2JHGA 1K6JA 2Q1UA 4LK3A 5L7WA 4NJMB 4OL9A 1C1XB 1P1RA 3QWBA 1NTOA 4AJ2A 3K30A 5IJZA 4EUFA 4CL8A 2O48X 5KNLA 2G1UA 4AJJA 3RUAA 5JCXA 3PHIA 1E6WA 3NGLA 1YJ8A 1LI4A 3NKLA 4LMRA 5A1TA 4BKQA 2QYSA 1K89A 8ADHA 4WE3A 2VHVA 3LLSA 4GGPA 3GGOA 3BTOA 4Z3KA 1JU9A 1KC1A 3D64A 4FCCA 4CM4A 1SOWA 1ZK0A 3BYZA 3CMMA 4RPLA 3SC6A 3RBZA 4R3WA 4KTVE 3IUPA 3OM9A 5B37A 1C1DA 2JAHA 2P5UA 2QIOA 3EC7A 3QLJA 2BLLA 5THKA 2B37A 2NSDA 4XX0A 3QWFA 3DBRB 4P38A 2PA3A 4CR8A 2Q2VA 4YYZA 3NTRA 3C24A 4BO1A 3NDIA 5C7LO 3IJRA 4ZRNA 1YBVA 3AY6A 1ZKMA 2VZ9A 4PZDA 5IN4A 4RORA 3VZRA 3W4KA 1U1IA 1ZIDA 4YB8A 4WOJA 4Z0HO 3ZNNA 3JQ9C 4Q3EA 4RF2A 1BXGA 1D1SA 5L40A 1DC5A 3BXXA 3I3OA 1CDOA 3LVFO 4NZ9A 1J0XO 3VPSA 4M55A 4NJOA 2P2SA 2PR2A 5KVSA 4NFHA 4HP8A 4BKUA 1VI2A 4RPGA 4MVJF 1J4AA 2Y0DA 1P9LA 2GASA 4PG8A 3WIEA 4R54A 3R0IA 1VL0A 3EZLA 5DP2A 4BB5A 4BNMA 1EDOA 1PJBA 2QQ5A 3AK4A 4XDZA 1N8KA 5IZ4A 2W4QA 4B8ZA 1PS9A 2OBNA 1U8FO 3OJFA 3PYXA 4ZICA 3GH3A 1CETA 3ORFA 4MJLA 2I76A 3Q9NA 4BMNA 2NADA 3QP9A 4IM7A 1P3DA 4QO8A 1U3WA 5FI3A 2HCTA 1GEGA 2W2LD 2IZZA 3F3SA 3LK7A 3MWDB 1EFKA 4FJ1A 3BMQA 3SJUA 2PKQP 4I9HA 5ES3A 1R15A 1DRWA 1KETA 5JYEA 3G1TA 3QWAA 1DJNA 2D1YA 5JBIA 2DBZA 3OIDA 5G0UA 1XQ1A 3SC4A 1N5DA 3WMWA 5G0SA 3VOSA 4CMJA 3ZNOA 4E5NA 3RROA 3E9MA 1K3TA 4JXKA 3ROMA 5B1YA 4XYMA 1YO6A 4FR5A 1OI7A 3JQ8A 1X7GA 1GCOA 1EK5A 2YDXA 3LF2A 4KWIA 3K6JA 3OBBA 4CR7A 2O3UA 3KHUA 4PLPA 3BHMA 4YJHA 4PLYA 1C1DB 3JD3A 1O0SA 1QV6A 3P2OA 6ADHA 4S1VA 4II2A 4J0EA 4B7UA 4MO2A 4XYGA 5A04A 4WUVA 3A9WA 4TKLA 2WJPA 1MFZA 4N5NA 1YOVA 4NQZA 4FB5A 1AXGA 4Q3NA 3TZ6A 2GO1A 3GC6A 1UXIA 3DWFA 4GMFA 3IP1A 1E3EA 4KTTE 1NQ5A 4QEDA 5G4KB 3HHPA 3LYLA 5I8WA 3Q2IA 2X0IA 3WSWA 4R51A 2H5LA 4P4NA 2GN8A 1HE3A 1I2CA 2TMGA 5L4SA 4WCDA 2PKRA 3JD4A 4OYRA 1ADFA 3GHHA 3GF4A 1XQ6A 4IQ8A 4J4HA 1JVBA 3K9QO 3V2GA 4LRTB 3RUEA 3RBVA 1QYXA 1QYCA 1IULA 1J49A 2VZ0A 4MVJI 4OQYA 3OETA 4PN3A 4XKJA 4MIEA 3M1LA 1DLJA 4YAEA 4UVIA 3F6YA 3WLFA 3BMQB 1ENPA 2NVBA 4FJ2A 3GZ4A 4CM8B 2GCGA 1C0LA 2V6MA 1R4NA 1WZEA 1HE4A 3KBOA 3RUHA 3VPHA 1LSUA 3I9LA 4YR9A 4TVBA 2DFDA 1BTOA 2GRAA 2J3IA 4R1SA 4Z0PA 4Q3BA 3GEMA 1N7GA 3DBHA 4ND2A 1NQOA 1ZSNA 3VKVA 5TC4A 1QR6A 1ID1A 3GEDA 4R01A 2CMDA 1EUDA 4J2OA 3G49A 2DM6A 1GPDG 4Y67A 4AJNA 1I24A 2DVMA 4XIYA 4DPMA 5L45A 2QW8A 3DONA 3PGXA 2UUPA 2XAAA 3WGYA 5A9RA 3DZHA 4IJVA 3UGKA 1QYDA 1HTBA 4BO7A 3RBXA 3P5SA 4XQCA 4RVFA 3ANMA 3O26A 3HJAA 1KEPA 4H16A 3ON5A 4FOSA 4M86A 5AXBA 1WMBA 5I8ZA 3DEYX 2J5RA 2UDPA 5COQA 2JFFA 4D42A 2AG5A 3JQ8B 3PWZA 4DREA 4J3FA 2PH3A 1YXMA 1P1JA 2D3TA 4WEQA 2DTDA 2YV1A 4MIOA 1QYVA 1MLDA 2C7VA 4BGEA 1P33A 5JLAA 3A28A 3U62A 1NWCA 4UVEA 4BNIA 1UZMA 1KERA 3LU1A 1LQTA 1WMAA 2PZLA 4RVDA 3D3WB 4ND3A 4E5YA 2C20A 4BGVA 3ZCXA 3F47A 3VKUA 4BMSA 2I3AA 1E1LA 4B3IA 2HRZA 1NPDA 3JYNA 1PQWA 1UDBA 2Y66A 1YS4A 3HDYA 2QG4A 1YH3A 4RCVA 1HYHA 1B15A 5C7OO 4HBGA 2PY6A 3FF4A 3D4PA 2X1HA 3JQAA 4INAA 3V2UA 5CEFA 1ZXBA 2X0NA 2TMDA 4EI2A 4C7JA 4HKTA 1UXGA 2OFPA 1O6ZA 3E9QA 4LCJA 1GZ4A 1E1KA 1JA9A 2D2IA 3EAGA 3K2EA 5GZ3A 1S7CA 3I9NA 1UZNA 4NFYA 1PJLA 2PD3A 3WWZA 2CSUA 3DMTA 1DFHA 2CF6A 1VRWA 4YXFA 3I9MA 4CPDA 4LRSB 1U28A 1JKIA 3TJRA 4AJEA 4B3HA 3GRKA 1CWUA 2Q4EA 2AEFA 1ZJYA 4DPLA 4BO0A 4DA9A 5B4UA 1ZVMA 4MP3A 3L6EA 3U4DA 4E32A 3TFOA 3BIOA 3I4FA 3SXPA 3PZRA 2HAEA 3WGHA 4CMIB 5JC8A 3TWOA 1PS0A 1Y9EA 2B4TO 3HWRA 3QV1A 3RASA 2EJWA 3KM0A 4BMVA 3S1LA 4IZIA 3QVXA 4P8RA 3ZHZA 1TI7A 3O9ZA 1O9BA 1TT5A 2ZTLA 3WR5A 2X7HA 2X4GA 3E03A 4L0QA 3FR8A 3OJOA 1WPQA 3HB5X 2PZMA 4DMMA 4W6ZA 1LQUA 4WLNA 2JCVA 4XB2A 4QSMA 2DFVA 1V3TA 2Q1TA 3DAFA 3EHEA 1N9GA 5ILGA 3ASVA 1YDWA 3NT2A 1NAHA 5A5FA 3C1AA 4WNIA 1ISMA 4YRDA 1FMCA 3D4OA 3ASUA 2GPTA 3I52A 3JD1A 1ISHA 1TXGA 2J5KA 3BTVA 4EJ6A 3FPLA 5KVQA 2EWMA 1T2FA 2GERA 3C85A 2OGUA 4TVOA 1QLJA 4BO4A 1WDKA 1IZ0A 3GVIA 4BNKA 1X13A 1M66A 3ONDA 1KVTA 2C2XA 1Y1PA 3QVOA 5DT9A 2VHZA 3IUSA 1P44A 5G4LA 4IPTA 2YUTA 4D3FA 2GZ1A 2B5WA 1B8UA 4JX8A 3KVOA 5G0WA 3GOHA 3CE6A 2CNBA 4M49A 4BNUA 3EGOA 4L4SA 1ZH8A 1ZW1A 1I3KA 5IXSA 2VT3A 5JAQA 5AYVA 4CMGA 2ZIZA 3SX2A 4HFRA 1LXCA 1T1RA 2YYYA 3H5RA 1DIAA 4Y8VA 3BAZA 3L6OO 3GDFA 1S6YA 1WW8A 1XHLA 1R12A 2E48A 3WGZA 4EITA 2F00A 4W4TA 3PVZA 1E7MA 3BA1A 1E5LA 4LSWA 1SC6A 2DUUA 3HDJA 4YQZA 4CM3A 3ZNPA 3K8ZA 3IOYA 1PZEA 1JWBB 1N7HA 4IDEA 2C29D 5JCJD 2FN7A 5G4KA 3TRIA 3TQHA 1OZAA 3L4BA 1LC3A 4L76A 3WQQA 3DMTC 2J3KA 1P77A 2FPIA 2O7SA 3GZNA 3KSZO 4NMHA 2EKQA 1BMDA 1YONA 1FF9A 5ER9A 1VKOA 3GAFA 3GFGA 3I9JA 1F0YA 4TQGA 3OJ0A 2VCYA 4ALNA 5ICMA 1DHTA 3ZWMA 1PGPA 3ZV3A 4JJIA 1IHXA 5TQVA 3HUDA 2H6EA 3PLRA 3T7EA 3TSCA 2PKQO 3PDJA 4AFNA 1ZUD1 4MOWA 3GDGA 1OFGA 4URFA 4JP2A 1JWAB 3JTMA 3LC2O 4AJIA 4BKPA 4F46A 4J9UE 3ABIA 4UEJA 4YJGA 1QV7A 1KVUA 2IYOA 2HMUA 4HY3A 3RC2A 1R6DA 5IF3A 1ZMOA 1UJMA 3V1TC 4Y98A 2Y0EA 4JGBA 3JSAA 3IAHA 1LSJA 3QE3A 4JBGA 1LLCA 1IE3A 2C0CA 4IXTA 3V8BA 1ISIA 2B69A 2VYVA 3ZWCA 2VWGA 4DPKA 1NPYA 3TZQA 3PFFA 2BH9A 2HKIA 3LT1A 3MOGA 1GYPA 4UEKA 2RIRA 2R6JA 3AOEC 2BRUA 1IZ9A 3FBGA 4PRLA 4NDNE 3KOUA 4YJGB 3N7UA 4S3MA 5TLSA 1Q7BA 4KDFA 3DXFA 1PWZA 1E7YA 4XGNA 1MG5A 3ANNA 4JBHA 3DBLB 4MKXA 4DWVA 5JY1A 1FK8A 4J16A 4XD2A 1RKXA 3G0OA 2JD2A 1EE9A 1A4UA 4WASA 5THQA 3AUUA 3NJ4A 2HU2A 3Q9UA 4K6FA 3JQCA 3ZV4A 1G1AA 1J5PA 1Y8QB 1JKFA 4GX0A 1YQDA 3QWIA 3INGA 1UXHA 4XB1A 4PLHA 3UF0A 4TRRA 4JP3A 4MINA 1LRKA 1E3WB 4BNGA 4WEOA 2RBEA 1BDMA 2PK3A 3WYEA 4WLOA 3H9EO 4HFNA 2PGJA 3QRWA 3QA9A 2O50A 1HETA 4OM8A 1TT7A 3ETGA 1NX6A 4FD3A 4J1SA 5BSFA 3IS3A 3ZZNA 5CDYA 3L07A 3TL2A 1P1HA 2EGHA 4QQRA 5T57A 4YDRA 1GCUA 3EZYA 3ZV5A 5CDSA 4ND1A 3GN2A 4AJKA 5C37A 3NYWA 1ENZA 1LX6A 1ZJZA 4UUNA 2WYVA 3U09A 4FOOA 3AUAA 2ZCUA 2YY7A 3S2FA 1K6XA 4PG4A 2J6IA 1LLUA 3AUTA 3NT4A 3U4CA 3EVNA 5A3JA 1VSVA 1PJSA 1U3VA 4IIUA 4IBOA 4DYVA 3GVXA 5IDYA 2CDBA 3Q1LA 1V0JA 4A10A 3NRCA 1FDVA 2EHDA 3GLQA 3HFSA 4D3SA 2HSDA 2O2SA 5KJ6A 2BFAA 2J3HA 4JROA 4IXWA 4BV9A 5L3ZA 1R4MB 2W98A 1WNTA 1CF2O 1NQAO 2I3GA 3LLVA 3DZIA 4NBRA 1L7DA 1I3LA 4NG5A 3AW9A 2B4RO 5DDIP 7MDHA 1E3JA 3U4IA 4CMHA 4FGWA 3JQEA 3ZWVA 5I9NA 1I01A 3R3SA 4IDBA 4XA8A 1WZIA 1AGNA 4FFRA 5T8KC 2JD0A 5A02A 3M6IA 4CJXA 4YT5A 4YJHB 2CVQA 2D8AA
chains in the Genus database with same CATH superfamily
1EFVB 4D9IA 4EY3A 1B41A 1QHYA 1C3EA 4I6EA 4FKBA 2Z2IA 2ZQ5A 4MW5A 3MBOA 4B3MB 5ESWA 3S2GA 4P86A 3CXUA 5LD2C 5E6SA 3RKSA 3QE9Y 2PWBA 5IBCA 1TVKA 3H42B 2HNBA 3H9CA 4UCFA 4D3XA 4KQ2A 2FSGA 3VJRA 1E2BA 1GQQA 1T5OA 1QIDA 5JLJA 2VUHB 3OWXA 3AOEA 5J40A 1BD4A 2BL4A 4Q03A 4GEKA 3A6JA 2J3JA 3WXBA 4HPXB 4JI0B 2R2GA 4LNUB 4ZU3A 1D6JA 2C95A 2AN5A 4LXUA 1W0KA 5EQDA 1RWWA 5ED0A 2HQOA 4QSHA 3BQNB 3I2HA 2GT1A 3ISTA 4XDHA 3MMPA 4D9CA 2NU8A 3ZUPA 4M0CA 4BN5A 3ZGYA 1MENA 1XTBA 5JNWA 3R6LA 2PNJA 1U9YA 3T3NA 4X7PA 2NYRA 1W25A 3PQDA 3FROA 3WV4A 1EFRD 5C4GB 3LBIA 1N3IA 2JFOA 2VJYA 4OH7A 1ZLYA 5EL0A 3COWA 2YASA 5GM2A 3ANXA 1CFZA 4ZXFA 3FI9A 2PL1A 2PS1A 1V4BA 2C2GA 3QYPA 4B4UA 5JHGB 5DK6A 4WA7A 3RAFC 3PT9A 4XWOA 1H9AA 4BLQA 5ANRB 1H6CA 1A0OA 4PV7A 1U3GA 2WWYA 4D0GA 2ZTVA 1OI3A 2K4MA 1N8SA 1UC4B 3OWHA 4D8YA 5ADWA 4BXOB 4W63A 3U4GA 4DQLA 2QRVA 1WP9A 1XZNA 3PFHA 4K26A 3NHAA 4MS4B 5CGQB 3U0VA 3ZV6A 2FXVA 1X2BA 1FC0A 3RB8A 2OYSA 4IDGA 4NIMA 2E21A 2EEZA 1EJ2A 4N12A 5SZJA 3ZE1B 2OT3B 4U5QA 3DEAA 3AESB 4RKEA 3H2ZA 4EB8A 1L7MA 2CDAA 2BTQB 2AOWA 1Y3BE 3BMNA 2HM7A 1IUNA 5B6IA 2XF2A 3V7FA 3L8GA 4ZOLA 3HJTA 1OXXK 2HGZA 2CFCA 5I48A 3QYJA 4KR3A 4B74A 1W0JD 1VKJA 1W1UA 2O0HA 2PRIA 2Q07A 2RGUA 1U9CA 2BRUC 4H59A 5CW1A 1B8NA 4WCVA 1GFSA 1AMUA 2QRMA 2NZUG 3TEMA 4OMDA 5FV7A 5GONF 3ZJ5A 2NZ8A 1ILEA 1JHYA 2IJGX 2PX2A 3OM1A 3M4JA 2PX3A 3NT5A 1T0HB 4RPKA 3TOXA 4EO7A 4NF2A 3JQAD 1T2VA 1EM8B 1U3UA 1DUSA 4ZVSA 2ID8A 3WGOA 3FFXA 1EQUA 2XUQA 3LLCA 4OGGA 5EGSA 2ZYGA 4DLKA 2OHIA 1RPNA 4PGHA 3CR7A 1O5OA 3FNBA 2G4LA 3VNUA 2ZXFA 4IHQA 1I5RA 1SM4A 1SCUB 2E0IA 1XEAA 3BMXA 3L1JA 3NVAA 1J0DA 1DC4A 4KL8S 2OE2A 4XTCS 1BVHA 4I3GA 2Y0PA 3PGA1 1IAQA 4LISA 1CUEA 1P7ZA 2RC5A 1J8QA 4KXNA 5C4MA 2L82A 1GFZA 4QJBA 3UCFA 3ZY4A 2RGWA 3HBNA 3E9RA 4DCPA 3GEIA 4GPD1 5EJGA 3IPYA 5J4KA 3U3RA 4M4SA 1QLHA 4JLNA 3C5VA 1JH9A 3LUPA 4K9LA 5K3FA 4E15A 1QS0B 3LQ2A 4G4SO 4IVPA 2I7TA 2IYNA 4PHHA 2G08A 4QJ5A 6REQB 2WD8A 1JXMA 2IODA 4R40A 1ZSYA 1PJAA 2NO7A 3LPMA 3UXEA 3GBPA 2PQ2A 4A0QA 1R4MA 1BJRE 3S8EA 5KU1A 3N28A 4RD1A 5KAMA 2AGVA 1I4TD 2W00A 3MIIA 4U6QA 3EXHC 1U2DA 4NBWA 1UQUA 2HQRA 3F6BX 1OX6A 1RWXA 2O1XA 1KZGB 1EK6A 1E77A 2R5NA 5BNFA 1KFEB 5TT0A 4C7VA 2WHXA 2CXRA 1NE2A 2L69A 3QLUC 3HXOA 3X2EA 1DJMA 3A1VA 3JARB 221PA 3UJ9A 3SYRA 4GI5A 3T9AA 3TM5A 2Y68A 3ST7A 1Y7PA 5BURA 3PNYA 3PF9A 8MHTA 4ECAA 1SQ0A 3EDMA 4DJ5X 1TF5A 2AOTA 2ZVPX 3KWLA 5EQTA 1WXEA 4ED9A 3NX4A 3FHOA 5LWQA 1S2NA 1WU8A 5GJWC 1LH0A 5LLDA 5AXCA 2FA9A 4RQTA 2QUKA 5MFPA 1BXGB 1V5GA 2GZ2A 3O94A 1L9XA 1G2IA 1MJ5A 1I1OA 2X8WA 4LV5B 3PQCA 4WH0A 2VLIA 1CJBA 3I2GA 4ISBA 4ZEWA 2W2XA 3F4BA 5CA1A 4D45A 5HIIA 3W34A 4DF3A 4IZ6A 4YRRA 2RHHA 2DH5A 4WOBA 5EXPA 4FKZA 3J81A 1Y5RA 3IUBA 5A4MS 1A8PA 2C4KA 1CRZA 5JYDA 1NL3A 3RU2A 1DAHA 1JAXA 1KMNA 3H2JA 3MT8A 3NTQA 1B73A 4L2IA 4WN9A 4ZN6A 1J20A 1WCIA 1THZA 4W5RA 2EFEB 4OQ4A 1EMDA 5L6MB 4M2LA 4ESEA 3E3OA 4TUYF 5JY6A 2AE1A 3STTA 1XZIA 1JB1A 2AQHA 4YT4A 2JVJA 5INTA 5JAMA 1FP2A 2C4TA 1CQZA 3AIMA 4K5QA 4LDAA 4HNSA 4IDHA 2JGDB 1PZGA 4ESOA 3VRHA 5B2ZA 3TXXA 1RYFA 1KS2A 3PL1A 3IOCA 1T1EA 1VL1A 3EXG2 4HZIA 4MICA 4HN2A 1TJ4A 1IBLB 5F5NA 2NTEA 3QEMB 1MJFA 4Y0AA 1SQ6A 1EZZA 1QORA 1Y9JA 2ICAA 2R11A 4GR4A 1P31A 4QL3A 4NV3A 5EIWA 4CM7A 3EK2A 2FXIA 1BYIA 1QH0A 5IVKA 1KMHA 2JEOA 4F93B 1L5MA 1VRCA 3ZGZA 1JNXX 4Y2QA 3SLRA 1AHPA 1K6IA 3KOZA 4NU5A 2A30A 4CGYA 5CT4A 4REQA 3R7DA 2ZZKA 2HHAA 4KP7A 3UJDA 3ZH2A 1MB4A 1GSOA 4G5FA 1RSZA 3QU7A 1OC2A 2CHGA 1WO8A 5CAEA 2HDNB 3UO8B 1CY8A 4ZI3A 3R7WB 3L4KA 2VK4A 3ICPA 3C7TA 4KUHA 3RVJA 3ZDXB 4RZSA 2WQ7A 2FPLA 3ZDAA 2RD2A 1O6BA 3PEFA 4RF5A 1A8QA 4PHCA 3VPCA 2R7MA 3QXGA 4F12A 4O02B 4HC4A 4CGZA 5A7GA 4WGFA 4X00A 1KY5A 1NT2A 5AVKA 1M8JA 1D07A 1WKBA 3MT9A 3W8EA 1YRLA 2J59A 3RSHA 5IANA 4HGRA 1QVVA 3K8OE 3B82A 1K7EB 2BM8A 3CNNA 2IXEA 3E9EA 3QKRA 4XJSA 1SU6A 4MR7B 1FYXA 4N0PA 2C2MA 5DP1A 1AKUA 1PL7A 5KTKA 5LQMA 2EWWA 2HNKA 4LOIA 3WX0A 3L8DA 1Y9AA 4FGKA 2VJBA 3LUKA 3HL0A 2C7GA 1XTVA 2EW2A 1WABA 3N8DA 4WGGA 4HQKA 1R64A 2RHLA 5EP2A 3AVQA 4CR6A 1NUSA 1U7HA 1ORTA 4HDQB 3T4XA 4CLEA 5HKAA 5TS2A 3TS1A 2X9QA 1V35A 3U7IA 2KYRA 4PYNA 4FIDA 4E09A 5FBLB 3TUJC 2JGLA 3GG9A 2IL1A 4GMKA 2G6TA 2PNFA 3K72B 1NVTA 2VT7A 4LVUA 2WUDA 4LZOA 4RSMA 4KK4A 1J2YA 3ENVA 4TWIA 4Y2SA 1O95C 1IY2A 2OV2A 2O3RA 4TV8F 4BNJA 5ICCA 1MIOB 1T1IA 4FQ5A 4JEMA 1YL6A 2BKEA 2YWDA 4OKNA 3NGMA 4NDZA 1JV2B 3PUVA 5COBA 3WGKA 3EZ2A 4DR3B 2AD1A 4EW6A 3M9WA 3CEAA 1QUFA 3P9SA 4JEUA 4PG6A 4UE6A 1K2WA 3H86A 5B1HA 3E18A 3CGWA 4ARUA 1Z4MA 4DCNA 2IX3A 3NHFA 4EHFA 4YACA 2I34A 3Q8XB 4OXXA 2EW8A 6AT1A 2ZB4A 3DO8A 1Z4IA 4EELA 1W5AA 3BD9A 1KQGA 1KIMA 3C3WA 2H2DA 2JC3A 1YASA 5CA0A 1FQKA 1RQ2A 3OZRA 3MUOA 4R1NA 3A4VA 4ZV7A 3SF8B 3SLKA 4AO6A 4WXEA 3WNCA 2DLCX 1G7RA 1Y34E 1ZOLA 5DGXA 3FKQA 1GR0A 4P84A 3KKEA 4LHXA 3P9NA 1B43A 4MVWA 3QJ5A 1ADBA 1FXWF 4B4KA 2SECE 5ADVA 2QTHA 3T9BA 4B7ZA 3PTAA 4Y9UA 2VP5A 5ALSA 2JCBA 2I33A 4H18A 4HAWA 5JFOA 2H92A 1IY1A 1LX7A 1TA0A 1Z5NA 1YRQA 4HAVA 2O2XA 1Z82A 1MR3F 2WV9A 3CG4A 2IYLD 1N2EA 3E6AA 3VH1A 4R0MA 2C7QA 2AQIA 4PYKA 2VHXA 4EY7A 4IIDA 2O8FA 2VN8A 3FFBA 3PNVA 1DDOA 2RAUA 5ESXA 1DB3A 4ETWA 1IXKA 1MXFA 2G63A 1JEDA 4PN7A 4JLVA 1QQ6A 1R0WA 2RKBA 3MTGA 5IAAA 2AF3C 1UQRA 2ZJ1A 3AP1A 4G4IA 1JRLA 5DYWA 2FZLA 2XUFA 4A8TA 3LY9A 5KVAA 4QEZA 1Q0PA 3UWOA 1JA1A 5HKKA 4YAIA 2ON6A 3O3CA 4JZYA 3THXB 3FZQA 2VDRB 3D5QA 5EJ8A 2G5TA 3FKSD 3S5JA 2NACA 2QZ4A 4J1QA 2OBBA 1OVGA 3EXHB 1C8KA 1XXHB 3GEBA 3CVOA 4IIYA 4URUR 6REQA 1RAAA 1K92A 4D4LA 1PQPA 1OGJA 1K7SN 4M88A 2WIAA 1ZH0A 4I5IA 4C7MA 3W1WA 1Z28A 1GXSA 1UKAA 1C3OA 4ISCA 4FI3C 3TXYA 2PQ0A 3FD8A 3HADA 1Z2NX 1Z07A 4D8XA 4C2TA 4R98A 2J6BA 1NMXA 5LU9A 4TS4A 5M5BA 4EW2A 2QN7A 5KC9A 4GHWA 4LRXA 4R9NA 2B2XA 4WK6A 4CG2A 1R6XA 1JIXA 1N2CE 1RVDA 1URPA 4J6FA 4K6MA 2GDZA 1SHJA 1XKXA 4L15A 1JDUA 1CRLA 1M2EA 1NXVA 3FLMA 4AY3A 2O5CA 5ELLA 2ZDGA 2II6A 2QQGA 5J2UA 1NN3A 2A0UA 3KV3O 3U1TA 3COPA 1H2HA 2VT6A 1UINA 2GRJA 3C3YA 3WG9A 1FDIA 2WF9A 4N48A 3NWBA 3A0UA 1S1CA 4IR7A 1YBHA 3B6ZA 4Z0NA 4CQJA 1SPBS 2IVZA 3IP5A 1T26A 3C3BA 3IPLA 1P2TA 4RBNA 5G2OA 2FUNB 4C0KA 1A7KA 4UUPA 3UJBA 3T0FA 1Z6QA 2RCYA 4GMXA 1XI2A 2PFSA 3EQ7A 1HDZA 1HTWA 3TZKA 4JR0A 4IJKA 4CMIA 5CNMA 2E4WA 1U0GA 3P4XA 2CFSA 3PDWA 3OH8A 2ZIXA 2WIBA 3IL2A 4BQFA 3STYA 3DKKA 3H8SA 3ENKA 2ZYIA 3KJHA 4Z7OB 2H29A 1U8XX 3D8SA 1YQGA 3UOGA 1HE2A 2A92A 2X0KA 5KYYA 1Z62A 3HJCA 3N75A 1Y89A 1Z7GA 3OPQA 4OXYA 4NZMA 3LC7O 2FQWA 3AFGA 4L02A 2HMSA 3P7MA 1N5IA 1V7CA 1U1FA 4GXNA 4D9JA 1EM8A 4GQAA 1C0KA 1OWLA 2XCTB 2HJSA 2P0YA 3AU9A 1CT9A 3E7XA 4DZRA 2CLDX 1SBYA 4HUQB 1IZ7A 1VB5A 3OFSA 1E4OA 5JJKA 2D0OB 5LYYA 3QOYA 4UVDA 3TJZA 4D9FA 4DIEA 3LDHA 1JHQA 1COZA 2IZ7A 5JWHA 2H1FA 1KGSA 2JFQA 5DGCA 3RT7A 3PFNA 1DWQA 2B0JA 2IXGA 3TVTA 3PNPA 3OF2A 1M2OB 4OBBA 2J0UB 4XYBA 4P7GA 5K0LA 1DE0A 4U7TB 2WPDD 2XOXA 4OHWA 3VV3A 1A1VA 4MA5A 2IIBA 3EDOA 4UHKA 1UODA 1MF7A 2VQ3A 4UU1A 1HG1A 4UAJA 4G1VA 3TEJA 2NTNA 3W7VA 5BVHA 2P8JA 1M33A 1FSSA 1H93A 3H2HA 4IW3B 3UWSA 4JJEA 1W2WB 4D46A 2I6XA 4GI3A 1U3TA 2XNSA 5ALGA 4ERNA 3CTPA 1WDLA 1T9GR 3ONFA 3VKGA 2CZGA 4IIEA 4EMSA 1HT3A 5LQRA 1GUYA 1EQAA 3KDPA 4M0PA 4XWKA 2QN8A 1W5SA 3ETLA 4KBYA 3M5WA 3OZCA 5CNJA 1GKIA 1U8UA 2E49A 1ECPA 3PL5A 4MTCA 3PDUA 3RVNA 2MR6A 1FXUA 4Z8XA 3GH1A 4L3OA 4AVYA 2O7RA 1CJSA 3CUEF 2IXAA 4UOQA 3SIPA 1JAZA 1JH8A 3KPWA 5T5QA 1N57A 2B1QA 5ALQA 1YAJA 2FPIB 1XZ8A 4QTUB 1OLXB 2PUHA 5CU7A 5GP1A 3WFIA 8AT1A 2YV5A 1GPWB 2F6RA 4N8EA 3QVTA 1HZZA 3A6EA 1N2BA 1L5KA 5KSPA 4EF5A 4LYGA 1RCUA 4I1IA 4N3AA 1OA0A 2Z3VA 2Q5QA 2VNIA 2ECOA 1ETUA 4IKEA 3VR6A 4EUHA 1YZYA 5ALPA 2IK8A 5FLKA 2R7AA 2LKCA 1GT6A 1GPYA 2V7PA 3LLMA 4MKRA 3RV4A 3D3WA 5A6SA 4UNIA 1Y3AA 5C80A 5ITZB 3OZBA 4QPCA 3TR5A 5LP6F 3IT1A 2SBTA 3CEMA 2CLFB 4JUDX 3DJFA 4FW8A 3Q72A 4YQYA 4C2BA 2JDID 4C3VA 5AW0A 5DYGA 1YC5A 3PE6A 3NIGB 2W2LA 5C8YA 3SD7A 5C46F 2H2IA 5F2EA 1G0NA 1RCFA 2YVAA 4B9EA 4QARA 1L5HB 3BGOS 5L7YA 5SY6A 5JSQA 4M8IA 2F8LA 1U3DA 2V7QD 1VLHA 3VSAA 1G20E 1VM6A 4QDXA 2JGFA 4TXJA 1EEHA 3I6QA 1CJVC 1P1KA 5HQTA 2FP4A 2X2PA 5K8UA 2V55B 1J8VA 2A1UA 4KH0A 3TX6A 3IVMA 4YBZA 2XNDA 4JA2A 1EX6A 1PKXA 4HSEA 4I4IA 2NUAB 1YI8A 3STWA 2QKYA 4TKUB 2C4UA 3IIJA 3EMKA 2HF2A 1EVIA 4WZBA 3U4QB 3K53A 3ILXA 4LZNA 2UVPB 4W8GA 3R8XA 1F4LA 1QFZA 4EPWA 4TYQA 1XRJA 2EATA 1XJ0A 3FZYA 1EINA 2X8AA 1O0BA 1D2RA 4GKJB 4LE0A 1AF4A 2XMPA 3WQRA 1ODJA 3H17A 4DC0A 2Z5GA 3HUFA 4G9EA 3N7TA 4PIPA 5HRCA 2W2OA 1YB5A 1NIPA 3AFMA 4GX2A 5ERYA 3UQYS 4KR2A 3JQGA 1Q21A 2QDKA 1Q22A 1VA5A 3OZFA 1KDOA 2B8EA 4J90A 4OQFA 4CKBA 2CV1A 2VG8A 5KPJA 3ROGA 1I1NA 5G41A 3IP7A 4Z9YA 5BVGA 1FDWA 4V1CA 2G77B 2Q28A 3I34X 2QN9A 3ETJA 3PQ6A 1TA9A 4QXPA 2HO5A 2XYQA 3KYBA 1I36A 2G17A 3GEGA 5FBRB 2HMWA 4I99A 4O4LB 1T0BA 3L6CA 1QHHA 4NBTA 1QAOA 2G07A 4MMZB 4E51A 4JKIA 4ZJPA 1M6WA 2BCJQ 1Z0DA 1O94C 1VHLA 5EA2A 5KYWA 2WLSA 2M9MA 3ED1A 4KN5A 1EA5A 1KYXA 4B2LA 1T9KA 3PJDA 4D8UA 5FPSA 1VBNA 1MW8X 2EL9A 2JGRA 3WTCA 1M8KA 4AULA 1K08A 2F3UA 4BFSA 1G9XA 2NUPA 1N0WA 4JI2B 3LBHA 4I4NA 2AW3A 4KGZA 2GKSA 1EG7A 3D3JA 1IRXA 1VI6A 5T41A 4W99A 1E0AA 1P2GA 4ARBA 1EHIA 1A2OA 3EEBA 2RDMA 2W8BB 2BMJA 3WL6A 1ZQ1A 4BUJA 1L3CA 1CUWA 1KK2A 1R0KA 1BHSA 4KIJA 4YJFA 1PJCA 5JANA 1T2EA 1T4CA 3HR8A 4BQRA 4F97A 4YX9A 1GXSB 1SHTX 4L27A 4L28A 2O9JA 1YS6A 2QX8A 3DLHA 3EMVA 2H7CA 2B9VA 4QRDA 4ZAYA 3SYTA 1S4QA 3H83A 2EIHA 4E11A 4G1UC 1X8JA 5E3HA 4E5VA 2HF7A 1PZFA 4ZEOA 4G89A 3GEHA 5DU2A 3OMWA 1JHPA 1OZHA 2O20A 4BUCA 3IBTA 5KVCA 1BOOA 1YDMA 2JFNA 4QDOA 3QOFA 4ZZ2A 2HXYA 3QIAA 3ASYA 5C8XA 1RNLA 2DQZA 1NFFA 1T43A 2CJWA 3CZQA 4NJMA 4A92A 3DVLA 3ELBA 4B3XA 1YZVA 4G2NA 4IHJF 3A9SA 1EBUA 2X6TA 3LUAA 3TZLA 4X41A 5HA5A 2O8DA 3T35A 1KDTA 3TOVA 3OHSX 4YR9A 2J6CA 3QPBA 1RXUA 1ZC4A 4RJTA 1BD3A 5BSEA 4NY1A 5FBHA 5JU6A 3IJPA 3PA6A 3JQDA 3EQ6A 2IKQA 3A2LA 3E53A 3TRDA 1O9HA 1JHDA 3SZOA 1Y5MA 1RM4A 2OPBA 3N8GA 4EG1A 1AMNA 2XGJA 1YJ5A 4IXDA 4DMHA 2NPOA 1G17A 1OIVA 4K6OA 4Q6WA 4ZZ0A 2YXPX 3TZEA 3GVPA 5ERXA 4PLVA 1SCAA 5ALKA 1PZHA 1XDDA 2L2QA 4J7XA 4MW0A 1D9XA 3VZSA 3ICEA 1YL7A 2QSZA 4RZ3A 3W5AA 3KAKA 3RCBA 4BLUA 1LA2A 3DZDA 5ESRA 4JJAA 5ALEA 1FDUA 1W4CA 2VTDA 2J0UA 1EUCA 3OCYA 4JLBA 3F5DA 5LOVB 4EG3A 1U11A 3NBKA 1A9OA 2G9QA 3TVYA 2HCRA 2H5JA 1FFHA 1A8SA 3CNOA 3QTLA 4RPCA 3TQIA 5EJ9A 3DOJA 3A70A 1SURA 2FOXA 3Q5DA 1C8BA 1QCCA 3B85A 3QNUA 4INZA 5AM0A 2I03A 3FYTA 1RZVA 5BSUA 3ZVKA 3CVUA 2GBLC 4B33A 2WE8A 2PWZA 3PPYA 5P21A 5JAPA 3DZFA 3QUTA 2BGGA 1KEUA 3SSAA 5CYGA 1YQQA 4LYYA 3EBLA 4ZGBA 4G8JA 3GP3A 2DHQA 4C4AA 1RJ9A 2AG6A 2IP1A 4E3ZA 1E92A 2CSXA 3EASA 4TS3A 1GG9A 1KZ4A 1H9BA 2GAJA 4IRMA 4UTNA 4RMGA 3DAHA 2HK8A 4UBIA 4UDXX 3DFMA 3FWYA 1T2UA 2VO1A 4WNCA 5CUQA 4ZWNA 4MVJG 2DMRA 3A4MA 3MIZA 1V3UA 3BXFA 4XVQA 2RIPA 3DNFA 2OSBA 2VFAA 3FYCA 4LVOA 4UUQA 1VLZA 4IRUB 3TUZC 2QN3A 3FVWA 3H2IA 3NVMB 2OCPA 5DB4A 3JATB 1NBOA 5BW5A 5HQ3B 2BVNA 4JBXA 3RC1A 2VF2A 3AT1A 4AX4A 1WPXA 1N2JA 2X14A 3KG2A 2NT3A 3LFHA 1UJBA 5EESA 3FOCA 1UWLA 3IVXA 1GD1O 1YIOA 4Q9NA 4IXMA 4QG3A 1O6CA 2GWRA 3VOAA 1G8AA 2I55A 1UBCA 4WXPA 2G8LA 1Y42X 2UXCB 3E1KA 5DZSA 3EA0A 1ZX1A 2D3WA 1BW9B 4X9XA 4FNOA 2GMWA 4KR7A 2XWQA 4IJWA 1V6CA 4AZWA 2CL5A 5CLJA 5JZOA 1KI8A 1K7FB 3PFIA 1A5SB 4CDMA 3O93A 4N3BA 4C1NA 3CX7A 3WJ1A 2FRDA 4F60A 3MA0A 2ABWA 4E1AA 3SS9X 1TJ3A 3H7IA 2HADA 2P9EA 3LRTA 4V0RA 4AF7A 3DOEA 3IVRA 4QJIA 2CLMB 3WP1B 5AVYA 4BO8A 5JSFA 2XYRA 3FPFA 3G2NA 4PSVA 5AW4A 5JNTA 4LA4A 2F1HA 1K0UA 3RRBA 3D7KA 2EBFX 5DN6D 4UU8A 1Y4ZA 2BM9A 4ZCRA 3L8EA 2QU7A 3O8QB 1XYYA 4D81A 3WMRA 1CRQA 4R8RA 5HGJA 4MVJH 2Y05A 3KTOA 4X8LA 1U1CA 4KFUA 2UUBB 3KHKA 1BROA 4XWWA 1OLUB 2MSNA 1OFTA 2P30A 1KO5A 1E5TA 1T6YA 1O97D 1UDRA 2JATA 3NUGA 3S2IA 3VC3A 4EI7A 4JL5A 2BI7A 1UP4A 3E5RA 1IJEA 3AR8A 3IEVA 1G42A 2BFBB 2IIPA 3P4YA 3DCJA 2YMPA 2IOFK 2YXDA 3R3VA 5FD8A 4AL4A 2R8EA 2A9KA 2A1IA 5LMZA 3D3KA 1GQ2A 5DCYA 2DG2A 1C30B 1F4PA 2WYWA 3GQVA 4G84A 1E8MA 2G5CA 2WHQA 3G5LA 4BFTA 3S27A 1MO6A 2XCRB 1FFYA 3AHCA 3FSGD 3VO8A 2FUEA 2CXHA 3DBRA 4PLFA 1XEWY 3BREA 5JDIA 1MA0A 3DP9A 3EY9A 5IK2A 4XRRA 4CLOB 4LJ4A 3UJHA 4LKOA 1HDCA 3WADA 1VE9A 4NDAA 1OB2A 1D04A 3GW8A 2F90A 4ZMRA 3KZNA 3HM2A 5C8YB 3W1EA 1CR4A 2QTFA 1OXKB 3ESCA 2AR0A 1VYTA 3GP5A 4DIBA 2G7MC 2G9ZA 2EWVA 4M7OA 4G5GA 5SYMA 4BQPA 3D7MA 1EA7A 1OHHA 3F5SA 2CVZA 1DZ3A 1TO1E 4LWPA 1V2GA 3DTYA 3ZNQA 1Z0KA 4OP3A 2IPXA 2RGBA 4H0FA 4TMFA 1L7OA 1XTKA 4BTVA 1PFKA 3QFRA 1FNBA 1LBQA 1UCFA 4DJAA 5JZMA 2WD7B 5BN4A 5FUMA 1IWPB 2QWXA 2VJKA 4M36A 3O2JA 3DC2A 1LNQA 1NM5C 5AOVA 4OQMA 1JXOA 1P19A 3ZQ4A 4NPHA 3D6FA 3B48A 5FQNA 1PNQA 2HD4A 2VQDA 2HLDA 4AIRA 1HOXA 1T2AA 2VXCA 2B6HA 2JIRA 4GS5A 1LY1A 4K6HA 4P3NA 4YRLA 3I05A 5AD1A 1NFQA 1MOPA 2XRFA 2VSXA 4F3KA 4XQGA 2ZIFA 2X1LA 3UWDA 4QBTA 4G0WA 1YJQA 2BSAA 3IXQA 3LGAA 4LE2A 5LYJA 2QZZA 1ENYA 1XFDA 3OFND 3ZGOA 1JLLA 1FIUA 1WX1A 1T91A 3ABZA 4CDRA 1XFAA 1VJ1A 3CCBA 1NKVA 1N6LA 4C6SA 1EU1A 1GA4A 3OM0A 3O7MA 4P7BA 1U7TA 4O4JF 1KK3A 5AKLA 4HDNB 5C1DA 1W0CA 1PTKA 3CZAA 4OMUA 1L5YA 3UGTA 4C7OA 1ONBA 2G6BA 4BMXA 4MJ3A 2DTEA 3GCXA 4FHEA 2MCFA 4DSTA 5G40A 3EX7C 5CCDA 3WY9A 1P2DA 3M2TA 2FP4B 1ZMRA 4MS1A 1VG0B 2ZRPA 2PRKA 1JG6A 2J4CA 4F4IA 5IWCA 5AKYA 4Q4LA 2C96A 2PSSA 2AOVA 2WMDA 4X0EA 4Y2PA 1YBFA 3X2FA 1V95A 1TIBA 4C22A 2OO7A 3CO0S 3WMXA 4AIIA 3W2GA 4DBZA 3WXMA 3FDXA 4EUEA 3LKZA 5A03A 5TARA 3W2EA 3P8ZA 4I0WB 1OYOA 3EG9A 4PHGA 4QLOA 1VKRA 5BSRA 2OQIA 2HV8A 4GUDA 4KWTA 4Y1GA 4ZT6A 1FFAA 3N3AC 5EJIA 4BNYA 1M54A 2PHZA 2XA1A 4RZIA 4S2UA 4FBMA 3KYCB 2XZPA 2J0VA 4W7IA 3OEEA 2Q7XA 5HXAA 1XLTA 1DAIA 2HK6A 3HYCA 1SZJG 4E46A 1EG2A 4KIGA 5HOEA 3K0CA 4KO2S 1ZN9A 4RE5A 2CE7A 4FBGA 4ND6A 3S2YA 5D1NA 1N9GB 3FAKA 1A9PA 2IUYA 3PP8A 4UU0A 4YJ2B 5EJ2A 2AFRA 2J07A 2Q5JA 3WA7A 3QQPA 1XHEA 2NP7A 1TAGA 4ZI5A 2Y4OA 2ENUA 3HN6A 4RHUA 2YZ2A 3QBTA 4FYVA 3PU6A 5CT5A 3C8ZA 3VUEA 4AAYA 4P4SB 2FGKA 3RTAA 3A1FA 3I32A 5JW6A 1SZPA 1U2TA 2CXOA 2X0JA 4UULA 4YPOA 1XTRA 3CKLA 1SWVA 2QLJA 3DQQA 4QREA 3ZUGA 2O3JA 2XGSA 4L0MA 1QK5A 1Y5IA 4LGMA 3KJEA 3QY9A 4RKQA 4CM8A 5HJ7A 5EEHA 4KQIA 5ALYA 3TIFA 2REXB 3NETA 3KR9A 4MLZA 3MTIA 5C9ZA 3M8KA 3RVBA 5JNVA 5KKCA 4PTYA 4PBSA 2DHDA 1C50A 1EE2A 2E7ZA 5DNCA 3F78A 1MNAA 1JA0A 5E7IA 4FP9A 4RMJA 2WUFA 3DAGA 3BOSA 2P7HA 1RHQA 3AI7A 1G20A 1JEYA 4MI3A 3HCFA 4H1UA 2W2QA 3TRFA 3DEZA 1TVCA 1BEEA 4J0QA 3PB3A 2WUVA 2ZW9A 1ARZA 3N0TA 4YDQA 3B13B 2OC9A 4K9DA 1MRSA 1NY6A 1A9TA 1F14A 3ZW9A 1QIGA 3RHFA 4CLRA 5DHRA 3DQPA 1G3UA 3IV9A 2PVPA 4M9SA 2CNOA 4ACBA 4AN1A 2O5EA 2FI1A 3ZLUA 3IV6A 1KBOA 1N6HA 3JZIA 3UICA 4OK3A 2ZRLA 3CLKA 2JNWA 3G8CA 4J9VA 1YQUA 4PCAA 4GPZA 4ZT5A 4AC9A 1X86B 3WNZA 5T8KA 3WVNA 3GGSA 5CDHA 3X1JA 1D4ZA 3F49S 1OUMA 4F2PA 4WBNB 5F77A 1SHKA 3NJ8A 3RTGA 3KZVA 3F46A 1DQZA 2E5FA 3CZPA 1RAFA 5EYPA 1CDEA 1ODTC 3SFTA 2BBTA 2AVDA 5AW9A 4ZCQA 4ZFNA 4G0XA 4RDHA 1ICIA 2I71A 3BE8A 2BMWA 3H3JA 1KJNA 1J23A 4HATA 1SN7A 3PPXA 1P8JA 4R6WA 1VTKA 5MHTA 4R41A 2V6FA 1CSEE 3KXDA 4KQ6A 1W59A 3WSTA 3EPLA 1Z7BA 4WJLA 1C9MA 2V7WA 4JLAA 3QLEA 2IIVA 4GXTA 2D00A 2A6PA 3NPMA 1TUBB 1M2KA 3B1WA 4D6PA 4Q3CA 4TZTA 2JLBA 2YICA 3TI7A 3VYRB 2RJ3A 3NDPA 4S24A 5HS6A 4RNCA 1X14A 4CL2A 2QTZA 2BEKA 3UAWA 4M1EA 4RVSA 3J7AC 4YFYA 3UATA 3EOZA 2V5UA 4Y0NA 2DBRA 4Y6OA 3KX2A 3PE4A 5FPHA 4D74A 2WVHA 2V03A 4LCBA 4JBIA 4XPIA 1MV5A 3GLRA 4CTKA 3CVVA 3A9UA 4GSYA 1AUVA 3DLPX 4JOSA 1FMTA 2IYZA 3UJAA 4ENUA 1RLUA 3DOHA 4P3YA 4HRVA 4MYTA 1C7FA 4RTOA 1AV6A 2IXTA 2IDJA 4Q12A 3A1EA 3A1UA 3KQVA 4JYZA 2D5AA 1KEVA 2J33A 3Q7SA 3WLJA 1KRWA 1PEDA 4OF4A 3JYPA 1A9RA 3UMSA 4WZAE 2IPAB 3LHFA 1K6MA 2X13A 2G0TA 4K6GA 4EQ6A 3JQGB 5HMLA 1CZHA 5JCZA 5ECDA 4RPJA 1MEEA 4D0LB 3DZCA 1EFTA 4P5EA 5DULA 2OV8A 1N2XA 2PZKA 1T2CA 2VYND 3EYWA 2N0SA 3HYLA 1T4BA 4K46A 1AKQA 1L5OA 2BZ0A 5G1NA 1K75A 3U4HA 4WI1A 4UNRA 2BI8A 4ETIA 3K96A 4XWAA 4MPJA 1PGNA 2FFJA 5LBUA 1PV2A 4QBGB 4CIWA 4Z86A 4DA0A 3JQFA 1J09A 1SB9A 4GO1A 3RFCA 3A1NA 1SCIA 3IMKA 3LNCA 5LA6A 3FDIA 3Q1KA 3D31A 4BO3A 4IINA 1DWOA 3MWEB 5F1OA 3INTA 1RKBA 4LX8A 1RJDA 3OJXA 5JSZA 3ZVMA 3CYFA 1V5WA 3K35A 1K4KA 1CXZA 3VNBA 3ZZ1A 3C3DA 1A5AB 1BA3A 1M2JA 2R47A 3K9HA 4UNSA 3GLHB 2YYSA 2K7ZA 2OQVA 5ENDA 4OQZA 3ZG6A 4B47A 4J7CA 4KFCA 1CNMA 1ML4A 1Z13A 2EFGA 5A2QA 3TSZA 3ESBA 1S3SA 2BGIA 4N6NA 3MJTA 3DMPA 4W9MC 1FVFA 3M6XA 4G56A 2IH5A 4N41A 1Y1SA 3DBVO 2YW9A 2Q1XA 1AU9A 1UXOA 3DM5A 1JHXA 2C3PA 2QD1A 3DOIA 3O9MA 4G26A 5ITVA 5EUQB 1RW4A 4WESB 3ND5A 3RFXA 2NV6A 3LUFA 2VJLA 2R44A 5EG5A 3CX6A 2PANA 2QJWA 2YMLA 2HF8A 4U2CA 1SXPA 3P0IA 2OECA 2WKQA 3ANSA 1Y82A 2J31A 2A78A 3OY7A 2QPTA 2R00A 3KKLA 1A5ZA 3QVLA 1ZFNA 3VPFA 2H9YA 3H1EA 4QQKA 3UAGA 1D09A 3A6GA 2QXUA 2BHTA 1HLPA 2G83A 2FZKA 3CZ4A 5JDCA 1Q11A 4LJ8A 5KNDA 3BXEA 5LUBA 2EJUA 3O8NA 3X2SA 4A2WA 5K45A 2W6ID 2DBVO 1KJIA 1NHGA 2OCXA 3WZMA 3FNFA 2ZSDA 4UTOA 2F1RA 2OXTA 2NTYC 1M7HA 4K9MA 4DTCA 1PQUA 4NAUA 2LP4Y 1E2MA 2ADFA 3AZPA 3IAAA 1X1EA 2BTOA 5E8RA 4UPDA 4EW1A 2H08A 2FQYA 1H69A 1XIVA 2QJRA 2NSYA 1CUGA 1GITA 2OMKA 2ST1A 2VAWA 2V98A 2J3MA 3CV3A 1VBFA 2ZK7A 1Q44A 3V7UA 2AC7A 1N2OA 2MIIA 4PU0A 4TYWA 4GSLA 1YVDA 2OFOA 1Q7EA 5BUZA 4BFYA 4Y2GA 3V33A 1GRQA 4F71A 3E5MA 4H7IA 4J75A 5HG0A 3UMBA 3SS8A 5L4NA 1S1MA 4RK1A 4QUIA 3E4DA 4TXNA 3K1AB 4HWTA 4MI6A 4DG9A 4D79A 3TDKA 3U44A 2BBSA 3CUUA 3ZZTA 5EJ6A 1WKVA 1Z39A 4G8BA 4DCJA 1GLVA 4YUYA 2IGBA 1EFCA 2G76A 3KT0A 3V42A 3GMIA 1P7CA 2XIJA 4AJHA 2RH5A 4E4YA 4P34A 3SBEA 1BKSB 2HJRA 1G3IA 2B78A 3SDBA 2EX4A 3MSXA 4BCCA 5C3MA 4WZAA 5EIEA 3T15A 4GI7A 3SF0A 4RJLA 3MVEA 4DA6A 4E5MA 1YVRA 1IBRA 2QTAA 1G6Q1 1XRMA 1Z8NA 5LOVF 1VJTA 2JVIA 1PU2A 3OOEA 3TTYA 2X40A 3D6VA 2VRCD 4JLMA 4KXMA 5SY9A 4BNTA 4CETA 4MV5A 4Z49A 4I46A 1RWNA 1V6AA 2AE2A 1TKBA 3GLKA 4NQRA 1JDVA 1UAYA 2MYTA 2M1ZA 4KQ9A 4P54A 1QX4A 3TN7A 2CXPA 1TF2A 1BS2A 4MVJE 4R7ZA 5C34B 2XF8A 3E70C 1EDZA 2ZUCA 4BLWA 3WHPA 5AJYA 1XAGA 5H3HA 4LZAA 4AN0A 3OUZA 3VO1A 3CUYA 3I61A 1LWNA 3RSQA 3NWEA 1JB9A 1T5DX 1WB6A 1C0PA 2R7NA 4DA7A 3QE0A 2QRLA 4ZEVA 2QT1A 3C8DA 3DEJA 1BWRA 3KTAA 3L2OB 3B9RA 4JC4A 4LOAA 2KX7A 1IUPA 3CPHA 1VYHA 4X7BA 4Q34A 1XTQA 2QVZX 1Y4DE 1CUIA 4C30A 4CHTA 4GM1A 3K0HA 4DC9A 1JS1X 2UYCA 3DNPA 3IFSA 4Q9IA 4CM5A 4AG5A 3QPUA 2Y1XA 4BBJA 1BEZA 1QGDA 3F7MA 2XQVA 2NSLA 3LHSA 4Y6QA 4ZRMA 2HA2A 3WWDA 3DO5A 3H84A 1I1QB 3JCZA 3M5DA 5JYCA 1P4AA 4F9EA 5J23A 5BWOA 1JBQA 1II9A 3W6UA 4PXAA 4QDUA 2I4MA 4PLZA 5SZHB 1XD2A 5AK0A 4WL0A 3OVMA 4JDPA 1UFRA 3URMA 1X7ZA 2A14A 1ZRMA 3BGVA 3I72A 3ZCTA 3LBNA 4KMOA 3M6MD 2H48A 1YRWA 1AT1A 4DMGA 3I53A 1RPTA 1YKGA 5DBFA 1O6GA 3PICA 1Z5VA 2GNOA 1N2SA 5I9SA 1UBGA 2C7BA 5FTNA 5HDBB 5AOBA 3ZXXA 4B6EA 2EQAA 3WFJA 1WMDA 2H11A 3EIUA 1I9CA 3SC2A 3ZH9B 4BO9A 4KX5A 3MYYA 3ONVA 4B6QA 1W73A 1EVYA 3IE0A 5HMMA 3O8QA 4I2NA 1PFGA 2B21A 2WNIA 2YY5A 2Z4RA 1KE1A 2D4HA 2NOAA 1E6CA 4MVJD 5EMHA 1UPTA 3K05A 4AP6A 4E3WA 4N3GA 1DO0A 3SX0A 3F2IA 4EY5A 5CPBA 1KHTA 4COOA 3EPKA 1XJ5A 5BSTA 3D8TA 4XOIA 3L0OA 5A3SA 3W6ZA 3IE1A 3LWDA 4I8XA 1OH6A 1QRSA 4C4TA 2NSHA 5FADA 2CLCX 5CDGA 5FRDA 4E30A 1NP6A 3ESXA 3AIIA 4DSAA 3ZDFA 1WB4A 1L8AA 2O8CB 2XT9A 1IN6A 3TCNA 1ODCA 2BGJA 1XZFA 4RYDA 1R10A 1H6DA 1O95A 4F85A 5K0ZA 3LG2A 2RGCA 2J9YB 2H9AA 1T8TA 5I7FA 3G2QA 3I3SR 1R8JA 2D6FA 2ZE8A 1JHUA 5EGNA 4PYMA 1N9ZA 2KM1A 5IK2D 2B30A 2W90A 3CNEA 1GTJ1 2ZANA 3ZK7A 3IT3A 5E6RA 1I6WA 1R00A 2QNIA 4EW3A 1XO1A 2X9GA 2V6BA 4E6EA 4DEVA 3NOXA 3AG5A 3C2QA 4N5DA 3ZLBA 4CKWA 2ZBDA 3VH4A 2HXGA 3HRHA 4UDYX 4YMUA 1IWOA 2I3DA 1Y37A 1KMMA 3GGPA 4FDAA