4XX0A

Coa bound to pig gtp-specific succinyl-coa synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
303
structure length
303
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structure of GTP-specific succinyl-CoA synthetase in complex with CoA.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 113
structure length 303
sequence length 303
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xx0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xx0A01
1D8AA 3L4BA 2I5PO 3F6YA 1B8VA 1O95A 1VL0A 1X7DA 3GAZA 3PRJA 3VDRA 1FMCA 2ZKLA 5AOVA 4DC1A 5DCWA 1AGNA 4R4JA 3VH3A 4NR0A 4YT4A 4NZ9A 3RWBA 2H63A 4LCJA 4JNKA 1I2BA 4GPD1 3LT4A 3FR7A 1E3SA 4PLYA 4WKGA 4BNUA 3QW2A 3MJCA 5IDXA 3JTMA 3ROKA 4XR4A 3HQ4O 4E5NA 1PZFA 3AK4A 4H16A 1E7MA 2D4AA 4N5MA 2X0JA 1SMKA 1B2LA 3D1LA 1BTOA 3BMNB 1WZIA 4O6VA 4PZDA 3V2UA 3MOIA 3RC7A 5KJCA 1ONNA 3RFXA 4CMIA 5C7OO 3KV3O 1D4FA 2HO5A 2C0CA 3I4CA 4JJFA 4FFNA 5JFOA 4MJLA 2FHSA 3ONFA 3U09A 4TRRA 4BNIA 3WNVA 3H6KA 1G0NA 1YRLA 3PZBA 3LF1A 3NGXA 4GKBA 1DB3A 3RJ9A 3DEYX 4L75A 2X58A 2I65A 2ZTLA 4Z6KA 1PJ4A 2GF2A 1A7AA 3PHGA 4CLXA 4GQAA 4R5HA 4WOJA 1JKJA 1LSOA 2WD7B 3IMFA 3TZQA 1N5DA 2V6BA 1ISGA 1T4BA 2RCYA 4UEOA 4XDZA 3TF5A 1N7GA 4CQMB 1WW8A 4R54A 3UFXB 4YTEA 3ZWWA 4WEOA 1HE4A 4CM7A 1GV0A 3S2GA 3E18A 1YKFA 3RU7A 2ZQYA 2P68A 4M54A 5I9NA 1H6DA 2JHGA 4J0FA 3RU9A 1A9ZA 4RPLA 2JCYA 3E5MA 1QV7A 1W4ZA 2BH9A 4A26A 3GPDG 2A9FA 3H65A 3ZNNA 1JWAB 2NWQA 1E6EA 3LU1A 5JPIA 2WJPA 3Q3CA 2FSSA 1X0VA 5F1KA 2GN4A 4W6ZA 1P77A 1ZSNA 2NVWA 1OBFO 1T4DA 3DMTC 1GV1A 1MXHA 1UP4A 3MTGA 3OF2A 4ND2A 3L77A 2EF1A 3INRA 1GPDG 3RAJA 1UXJA 1F06A 4XB2A 2ZB3A 3I9JA 4MP3A 3I1JA 2Y67A 1JW9B 1R0LA 1VL6A 2ZJ0A 3RKUA 3ZNQA 5T57A 5G2OA 1K89A 3SC4A 3D4OA 3GDGA 3QWIA 3L4SO 3PFFA 3A28A 4XB1A 1DRUA 1NPDA 2B5WA 2VRCA 4CM8B 2AQIA 2FN7A 4L73A 4HXYA 4FQ8A 4L4SA 3HB5X 1QKIA 3GFGA 1Q7CA 2AMFA 3E82A 4PFJA 4QFCA 6LDHA 4R3WA 4DPLA 1IHYA 5KJ6A 2BD0A 1Q2XA 1EVJA 1T1SA 3FI9A 3MJVA 4BVAA 1HYGA 4UVHA 2FSVA 1NBOA 4I9UA 1OZAA 1LDGA 3ASUA 3CTMA 2GSDA 2YHIA 3C1TA 4IJWA 5A9SA 5DNAA 4JBHA 2ET6A 1Y9EA 4PRLA 4XD2A 1QLHA 1U3TA 3CXRA 5B37A 2OP0A 4PG4A 3ONDA 4AJJA 3BTOA 2DBVO 4MP6A 1CIVA 4IMPA 1I8TA 3RCBA 1X1TA 3AFNA 3CMMA 3LQFA 1HT0A 4PLCA 2DBQA 3AM4A 1J4AA 1U5CA 1Z6ZA 3V2GA 2PKQP 3ENNA 1WDLA 2R2GA 3NT4A 1ISJA 1YWGO 3D4PA 5A9TA 4ESOA 4RLSA 3AOEA 5BNFA 3FN4A 2B4RO 3GHHA 3PQEA 1GQQA 1N92A 4JXKA 4OXYA 5JXWA 4UVDA 4CM5A 3VAZA 4WLOA 4CLOB 1A72A 3QE3A 3R0IA 4HP8A 5KKCA 5DZSA 1RM3A 2O4CA 2YFQA 1R66A 4JJGA 1E7WA 2C7GA 4XEHA 1JN0A 1DC4A 1NXQA 1C1XA 1DIAA 3G0OA 4BMNA 5ES3A 3JQGB 2BI7A 2NU9A 1HDXA 4J7CA 1GL3A 5AXCA 5CEFA 3H4VA 3VDQA 3L07A 3E8XA 4BNKA 4A2CA 3PVZA 1E3EA 4WNIA 3PWKA 5CPFA 2IEBA 1K3TA 2D0IA 1FXSA 2YYYA 1UZMA 4IDAA 4OM8A 3GR6A 4CR6A 5AYVA 1TB4A 1PIWA 3SX2A 4PZCA 1PJ2A 3SLGA 4WCDA 1ONPA 4FFLA 1SB9A 2J3IA 1ZJZA 4RPGA 4WCFA 4WECA 3COSA 2O4UX 3IIEA 4RVSA 3I9MA 1QMGA 4IBOA 3I23A 2NADA 3MWDB 3KSZO 4D45A 2JFGA 4HNGA 4KDEA 4YJGA 2CDBA 3I6QA 3MCVA 5JAMA 4YXFA 3MWEB 1P1JA 5HRUA 1AN9A 5I7VA 1QR6A 4IZIA 4RORA 3KLPX 4RCVA 4CL8A 2VZ9A 3NTRA 3OMLA 5T8KA 2BF7A 2O7QA 2XXJA 3WTBA 2PY6A 2P4QA 5JW6A 3FSRA 1JA9A 5BSHA 2CF6A 1O89A 4QEDA 4RL6A 3S2IA 4B4WA 1YBAA 3VPHA 3PYMA 3C1OA 1LRKA 3GDOA 4RPKA 3RC9A 1E1MA 2JFFA 1GFSA 2Q2WA 1UZNA 3F4BA 5AVOA 4NBUA 5TT1A 2W2KA 4B8WA 3R1IA 4TQGA 4GVLA 1I3MA 1SAYA 2H5LA 2I67A 3LC7O 2J3KA 1JWBB 4GX5A 2O3RA 5DP1A 5EQFA 1BGVA 1R0SA 2FPPA 2H9IA 3JQ9A 1PL7A 3Q0EA 4U0KA 1B3RA 1H6CA 3JQAA 5B1YA 2PKQO 3A4VA 2UAGA 4WLUA 4WPGA 1VPDA 4INAA 5ER6A 4XYBA 3G3EA 4OSOA 1ZFNA 2A92A 3O4RA 1IHXA 4NK5A 4P4GA 2VWPA 2FR1A 3CIFA 1I3KA 3JQ6A 4ZICA 3ULKA 1MGOA 2BFAA 4FFOA 1L7DA 4W99A 2PH3A 1O5IA 4FFMA 3FRJA 1TI7A 2PNFA 3UKOA 2VT2A 4FBGA 1ZK1A 3M2PA 2RBEA 5U4QA 4PLFA 4A0SA 1Y5RA 5KKAA 3E9QA 4ZQHA 1QORA 1VJ1A 3GGGA 4PLWA 4GH5A 4WLVA 5F3RA 3JQFC 4P22A 3RUHA 3RBZA 3FNHA 1UJMA 3E1KA 2JAHA 4OHUA 5IDYA 1B3BA 2AEMA 3NDRA 3RROA 3UCEA 3ZU4A 4DVJA 4MIOA 3VC7A 3M1AA 3O03A 1AXEA 1ONOA 4H7PA 2UUPA 3OH8A 3ZW9A 5BSGA 4N5NA 2O3SA 4OKNA 4CUJA 2OHXA 3B1KA 4O5OA 1CQIA 5TC4A 4E21A 1SPXA 3K6JA 4BNYA 4BQRA 1DC3A 4Z0HO 4MKXA 2XF8A 4DMLA 1T25A 1P1KA 1X1EA 2X0IA 2DVMA 1ISIA 3ROPA 1C1DB 5BQFA 4R9RA 1EFKA 3L0DA 2J8ZA 1QV6A 1VLLA 1SNYA 2C2YA 1Y5MA 5G4KB 5TX7A 3KYBA 3WLEA 3OJLA 4EI2A 2G0TA 5CDUA 2Q1TA 4CMEC 1DRWA 5JY6A 1J49A 2NNLD 3WBFA 2F00A 4XX0B 4TKMA 4BO5A 1K6IA 3L9WA 4IJKA 4XGKA 2ZQZA 4RQTA 3JQ7A 3ZWYA 3TFQA 4CV1A 1EUZA 2GN8A 3JD4A 4FSHA 4FS3A 5CEEA 4FIZA 4YACA 2VZ8A 3AM5A 3I52A 3KYCB 3FPLA 3STHA 4NH4A 1RJWA 5JY1A 3GVHA 1HLPA 1CQJB 3FWNA 4IS3A 4GSKA 1JU9A 3QA9A 4KMSA 1T2EA 3D3WA 1E1NA 1S7CA 3PHHA 3RUCA 4CM3A 1SBYA 1NR7A 5L4LA 4HUJA 4XRGA 1YDEA 5L51A 5HTOA 4CMAA 2PA3A 4OAQA 4R51A 2ZYGA 3PXXA 4EZBA 2PWZA 2EP7A 2VTEA 1FDUA 2F1KA 4H15A 1D1SA 1RKXA 1LQTA 3WIDA 3ZWCA 1R0KA 2X5JO 1XDWA 3EDMA 3JD3A 3OA0A 2P91A 2RH8A 3D3EA 2GDZA 2NU8A 3I83A 2X9VA 1NX6A 3GC6A 2BLLA 2BFPA 4MIEA 1NQAO 1ULSA 4ROSA 4YRDA 1E77A 5JO9A 1XU7A 3DZKA 3SJUA 5HM8A 1KEWA 3UHAA 3EK2A 2C82A 1V35A 4CR7A 1B26A 2Y66A 1HE3A 5IF3A 3TQHA 4IY1A 3GEDA 1N9GB 1UAYA 3IKTA 3A06A 1SCUB 3RQSA 4EUEA 4XQGA 2NU6A 4JLWA 1YXMA 3C7DB 3DOOA 4YA6A 1V6AA 3RD5A 4AVYA 3ZNOA 1ZJYA 4Q3BA 1P1FA 2NSDA 4KQWA 5CDYA 2C07A 4OOFA 1KERA 5G0UA 5K9ZA 3WOHA 4BHTA 3ZWXA 2Q1WA 4BNNA 2FP4B 4J90A 1XU9A 4MVJA 1P9LA 1LC0A 3BTSA 4JBIA 3F46A 5KVSA 1ZO8A 3AFMA 4BQPA 4J0EA 1U3WA 2G82A 3JQ8B 5JYEA 3UVEA 3DZGA 1NR1A 3LT1A 4PLTA 2WE7A 3EC7A 3G79A 2OOSA 1PZGA 3ADOA 2Y1CA 1NQOA 1TEHA 3D5TA 1Y8QB 2VHVA 2V6MA 4S1VA 4BKUA 3WGIA 3TN7A 2EWMA 1GCOA 3DONA 1XQ1A 5J23A 1T2AA 1D7OA 1WP4A 2O23A 3FWZA 1WNTA 3JYQA 1NAHA 2QW8A 1YQXA 1BXGA 3W4IA 4P4NA 2IRWA 3GG2A 1YBVA 2CZCA 3D64A 5TLSA 2EEZA 1C3VA 4NU5A 4GL4A 2HCTA 4EEZA 2D59A 4YPOA 3LYLA 4L4XA 2WM3A 3AUUA 4NJMB 4J3FA 3IDSA 4A73A 4UUOA 3OETA 5JDCA 3P2YA 3WGZA 4QXMA 2NM0A 1YOVA 1NQTA 3KBOA 3AY6A 3LF2A 4HBGA 1QSGA 1HEUA 3OIGA 2IE0A 3JQBC 4UUMA 2HMTA 4RF3A 4ZHSA 2EW8A 2FPGB 3PJEA 3ON5A 3PIDA 2EW2A 5IXYA 2FPIB 1PJCA 5L40A 3WYBA 4L4RA 1TXGA 2GO1A 4YEDA 5ENDA 2PZJA 4WNCA 1M66A 4J7XA 2CVZA 4XDYA 3DQPA 1EFLA 2X22A 4JP3A 5EINA 2G17A 1R16A 2EG9A 4I5DA 1NAIA 4IPTA 1U1IA 1C14A 4M8SA 1DEHA 2PK3A 1ISHA 2NV6A 2VWGA 2E6UX 3GGOA 3QRWA 5L95A 5GZ1A 2Q49A 4O0LA 1H2HA 1T2CA 4NK4A 4E2WA 4JQCA 2OMEA 2R6JA 4J9UE 4HFJA 1V0JA 3EUWA 3JD0A 4Z9YA 3VH1A 1P74A 5I8WA 5A4DA 4K6CA 1HYEA 4NU6A 1F14A 3ZW8A 5AXDA 3IUSA 2B4TO 3NV9A 5FF9A 4OMUA 3B1JA 1CWUA 3NJ8A 2X23A 2P5YA 4JX8A 4WGGA 1YJ8A 1QYDA 1U7TA 5DDIP 3N74A 1MFPA 4OXKA 4EITA 3SLKA 1PGOA 3K2BA 2W2LA 3GN2A 1UZLA 1I0ZA 4CV0A 3AOGA 2WEKA 4WEQA 3F9IA 4PLZA 1UAGA 3GNTA 1A27A 2ZTVA 2DFDA 4K26A 5IXSA 4DGSA 9LDBA 3JQEA 2OBYA 1BRMA 1DFHA 5T64A 4BO2A 5FEUA 3SBOA 1DRVA 1IPFA 3BZUA 1BVUA 5EESA 1HZZA 2ZB7A 2JD1A 2WD7A 3WJAA 2WYUA 1U2GA 3FTPA 1W8DA 2B37A 2B0JA 4HADA 3UFXA 4QO7A 3MZ0A 1MA0A 4P4LA 2ILTA 1ENOA 4O63O 1GR0A 3TWOA 1DAPA 1ZH8A 1XHLA 3R3SA 3BIOA 4XYEA 4W4TA 1XLTA 4CM6A 2ZTMA 4U8GA 4WE3A 3WSVA 4F3YA 4ALIA 1LXCA 3F47A 4BIIA 2PD3A 4BNMA 2GLXA 3IOYA 3KO8A 4FGSA 4IM7A 5G4LA 5JNLA 2PFGA 5L53A 5G0VA 3ETEA 1ZMOA 4YJDA 1IOLA 3OBBA 3QWHA 3PTZA 4A5OA 3TOXA 4B4UA 3KOUA 5CP8A 5L9AA 1DC5A 3GEGA 3H9EO 3ZN2A 2BHLA 5KVCA 3WYCA 4DQXA 1R4NB 4W9NA 1EEHA 5LC1A 4KWHA 4DA9A 3VHRA 1NTOA 1ISFA 1XR3A 2POQX 2WSBA 3LT2A 1EVYA 3O9ZA 5DOZA 1HZJA 3ITKA 1TT5B 1Q0LA 4TVBA 1HTBA 3H5RA 3NYWA 2RHRA 3GRKA 2I6TA 2V7PA 3AU9A 4CM8A 3OP4A 3AY7A 1C0IA 5COQA 1EVZA 1V3VA 2PKRA 3W8DA 4AL4A 1WXDA 4E13A 1X7GA 4HKTA 4URFA 1S6YA 1VL8A 5BT9A 1IE3A 2W98A 3MJEA 1PR9A 1HF3A 3DOCA 3K30A 5FYDA 1Q7GA 4ILKA 3RUDA 3PHJA 3QP9A 2O3JA 2Y1GA 5TNXA 3NJ4A 1EQUA 3DTYA 1M76A 4LMPA 4DLLA 5L7YA 3EMKA 4IGFA 3DBVO 3JCZA 1N8KA 3AOEC 1GADO 4MOWA 1E7RA 2XPCA 5LDGA 3E48A 4RVGA 1KS9A 1RM5A 2OUIA 1LU9A 3DZBA 3KXDA 1HDYA 2Y99A 2FZEA 1I32A 2EGHA 3C7AA 3BMOB 2Q1UA 5IN5A 4AJOA 4EYEA 1P1RA 1SC6A 1YVEI 4MVJF 5JE8A 1PJQA 1LQUA 1BMDA 1HRDA 3LZ6A 1XYGA 3MJTA 2BELA 4N7RA 4OQYA 1BDMA 4R3NA 4AJ4A 1TLTA 5K6AA 2AHRA 2ZATA 3QVTA 1O6ZA 4KTVE 2CDCA 1A4IA 3MTJA 5EN4A 2JCXA 4FC7A 2AE2A 1LTHR 4D41A 1F8FA 3MEQA 3VVBA 1YL7A 5ICSA 2CUKA 2P5UA 2E82A 2NVUA 1A4UA 3WMXA 5IZCA 2OL4A 1Z82A 4CLOA 1JTVA 5KWEA 4B7UA 2GPTA 4D3DA 5JBIA 4WCFC 1EMDA 2ZTUA 1ZKMA 3PZRA 1LJ8A 4MDHA 3S1LA 5KVVA 2B4QA 2ZB8A 4KDFA 5AXAA 2NTJA 3AUAA 3OIDA 2VNAA 3I3OA 1PSDA 1D3AA 4FFRA 2GR9A 1XG5A 3ZWOA 5B4TA 4OH1A 1LEHA 4CV2A 1GQYA 2GCGA 4D0RA 3GK3A 4J16A 1OI7A 3KSDO 2Q2VA 4LSMA 1DO8A 1HKUA 2EIHA 4CM1A 4U0JA 5ADHA 1JKIA 4R41A 1AHHA 1Z45A 3WMWA 4E5KA 3KRTA 3BHMA 1GAEO 3FD8A 3I6IA 3CZRA 3WX0A 1JQBA 1AHIA 1YH3A 4M87A 3RC1A 1UXKA 4LK3A 5CAEB 3MWDA 3DXFA 1ENPA 1IPEA 1QYCA 4KUGA 5KTKA 1P1IA 3MWEA 1CJCA 3FF4A 1DIHA 3JQ9C 4E2YA 3ANNA 3K2EA 2DFVA 2EP5A 3OQ6A 5A3VA 4QFDA 2UDPA 3RSHA 4ZVVA 3WWZA 2UVDA 4ND3A 2E49A 4LW8A 1DLIA 4LCEA 3UOGA 4CLDA 2Y68A 3ZDFA 2X6TA 4BMVA 2CF5A 3DL2A 3ZZNA 1OC2A 3GF4A 1B8PA 3JD2A 3KSUA 3G17A 4L8VA 2WE8A 3T7EA 5L7WA 3I4FA 3WICA 3IQDB 3QVWA 1AXGA 3ZWAA 1SO8A 4GGPA 4W82A 2EGGA 1L1FA 3KETA 4R69A 2GZ3A 3MJSA 2VNSA 3TZ6A 1P0CA 3TL3A 4LRSB 3SXPA 4LRTB 2VWQA 5TGDA 3E9MA 3R3JA 4Y67A 3WBBA 4DL9A 4ZU3A 4NFYA 4CMBA 2P4HX 4DBVO 1N2SA 2D1YA 3G49A 3RIHA 1VSUA 1ZEJA 4PN3A 4X54A 2G5CA 4QX6A 2QQ5A 4EBFA 1PR3A 3O8QB 3NX4A 2ZB4A 3KYDB 1YE3A 2VRBA 4M89A 3KZVA 4Q3AA 3GVCA 3QLJA 3V1TC 3HE3A 3GVXA 1DIBA 1X14A 4XWYA 3PQDA 4FC6A 4JCOA 4G2NA 3E5RA 1GY8A 1V3TA 1UDCA 5ICMA 4B7CA 3WSWA 8ADHA 1H9AA 1NHGA 4AJEA 1UP6A 3VKVA 4S3MA 3DHYA 1HDOA 5F1OA 5CFZA 1JLLB 1GYQA 1I3NA 3FNFA 5DULA 4IQ8A 5JC8A 4YAEA 3PWSA 3VPSA 2GNAA 1G1AA 3EYWA 3VH4A 5GZ6A 3PLRA 4WUVA 4WK6A 3WGGA 4ND4A 3ABIA 4LVUA 1HDGO 1QYWA 5G4KA 1U8FO 1EBUA 3GY0A 5GY7A 3I9KA 1PS9A 4FFPA 5B4UA 2HK8A 3WNQA 3ZHYA 4BNLA 2JJYA 1R4MB 4XX0A 1IB6A 1J6UA 1U7HA 3U0BA 4AJLA 3GPIA 3ITDA 4GX1A 3H9QA 4ZGWA 1N1GA 4YCAA 3LK7A 4D42A 1GUZA 1PS0A 5C37A 4BNVA 2O3UA 3KYCA 4FR5A 3LC1O 5JLAA 1FF9A 1CQJA 1Y9AA 1ZNQO 3N58A 2Q4BA 3E6AA 3RVDA 4XYGA 1NASA 1P45A 2SCUB 4I8XA 4ZRMA 2QRKA 2C5EA 3GZNB 3QSGA 2UYYA 4XQ9A 3TRIA 4BO9A 4GGOA 4QT0A 3P19A 3PGJA 2H6EA 2QYTA 1U3VA 4NBVA 1PU2A 2C20A 2Q99A 1JVSA 5I7EA 4IMRA 2ZCUA 2R00A 2VCYA 4BNJA 3NTQA 3FHLA 4R16A 4XIYA 3W8EA 4E0BA 1WMAA 3S2EA 2HAEA 3U4DA 1B14A 2Y05A 3ETDA 4BGEA 3HZZA 4D46A 4NIMA 2Q46A 1WDMA 1F12A 4MINA 3INGA 1IY8A 5ILGA 2QX7A 4U5QA 3B1FA 2X4GA 1GEGA 1BW9B 2VHWA 1GU7A 2X0RA 1QYVA 1AUPA 1T26A 4ALMA 3GG9A 3RBXA 3TDKA 1DJNA 3JQAD 4BO7A 4TKLA 4R1NA 3VPXA 1N9GA 1RM4A 5TIIA 4AJ1A 1SCUA 1EUDB 3F1KA 2FZWA 4UREA 3Q9NA 1QYXA 2DBRA 2QRLA 2ZIZA 3IC5A 1E7QA 3ANLA 4MVJG 5TSDA 3HDJA 1ZXLA 4J91A 4KTTE 4GWKA 3HSKA 3DAFA 3ZV3A 1NFFA 4ALJA 3DOJA 1HDCA 3F5SA 2NUAB 1EUCB 3EY4A 1T2DA 5U9CA 2Y0DA 3OQBA 4DXHA 4CM4B 2FP4A 4E12A 1DBVO 3HN2A 3OEYA 1M67A 1R15A 2VYNA 3PLNA 4J4BA 4PCVA 4Z9FA 3BMQB 1VJTA 2WD8A 3B6ZA 5A04A 4JP2A 4UULA 1LA2A 1YB4A 5L4NA 4WOKA 4D7AA 1BDBA 3JQ8A 4LISA 4ALLA 3M2TA 2FWMX 4BV9A 4E32A 4D3SA 2A35A 3QVOA 3RFTA 2B69A 3F3SA 1Y8QA 3GDFA 4BS9A 2OFPA 2RAFA 2X7HA 5FI3A 1DOHA 5FWNA 1CYDA 1KVRA 4BMSA 2NU9B 1PZEA 3H5AA 3ZU2A 4A10A 2Z1NA 2DBZA 2XOXA 3RI3A 5A9RA 1A5ZA 1KVSA 4NBWA 5G0WA 3WS7A 2PTGA 4UVEA 4AJKA 3ZV5A 3H9UA 4XYLA 4D3FA 3PJGA 1JVBA 1KEUA 2GZ1A 2BFOA 2H1SA 4ZJUA 5ER9A 3ZU5A 4ZQGA 4NJMA 5L3ZA 3KHUA 1H6BA 5F5NA 2CD9A 1NWHA 1LBEA 1NVGA 2QYSA 4E30A 6ADHA 1O94A 2AG8A 4I5GA 1I10A 2CDAA 2EXXA 3WQSB 4FW8A 4UUNA 2HJSA 4GLOA 4NG5A 2YW9A 4NJOA 5B4VA 1FDWA 3DHEA 1RYDA 1SEVA 1E7SA 1Y8RB 4A03A 1A9YA 1G0OA 1NQ5A 2FPGA 1OOEA 4WLFA 4BKRA 1QG6A 2J3HA 2X5KO 4U6QA 1EE9A 1PS8A 3ADPA 4TROA 4HFNA 1WAMA 1B0AA 3DTTA 1HETA 4J2HA 5EERA 3IAHA 3DR3A 2VUUA 3WGQA 3RUFA 2Y0CA 3PGXA 3S55A 4L76A 1PL6A 4PVDA 4ZQBA 1VKNA 3C3XA 2CY0A 3HDYA 3DMYA 2JL1A 2W2KB 3ROQA 3TFOA 4Y9DA 5TS3A 4FJ2A 4OO3A 3TZHA 3V8BA 1RYEA 4YT5A 4FJ0A 4F6LA 5IFLA 3EAGA 4Q39A 1JKFA 3VZQA 3EZLA 4GI2A 4J1NA 1X13A 1R12A 1FJHA 2Y1FA 4BKQA 2E48A 4D43A 4IXTA 1NFRA 2V6FA 4OGWA 2AEFA 4B8ZA 4J2OA 1DHTA 1R37A 1HSZA 4IDEA 4ND5A 1KY5A 3EVTA 4R68A 9LDTA 1LLDA 1E3WB 1YONA 4NQZA 4M55A 2VUSA 4OXNA 1C0LA 2WMDA 3GNQA 2PH5A 4DC0A 4YT8A 1ADFA 3GLQA 3ZWVA 1PQWA 5IJZA 4GMFA 3GGPA 2G1UA 4RDIA 2B5VA 2B36A 5KVQA 4ND1A 4MVJD 4RDHA 4AJIA 4FPXA 5AQ1A 3DZIA 1ADBA 3VZPA 2OZPA 4IDBA 1HLDA 4AJHA 5L4SA 3ICPA 4PIVA 3GA0A 2OGUA 4FGWA 4DMMA 1ZIDA 4DLAA 2BI8A 2P2SA 2YDXA 4II2A 4B4VA 3DBRB 5KIAA 2P9CA 4GVXA 5CPBA 1PGNA 1ARZA 3GOHA 1ZSVA 4L9RA 4N18A 3UAGA 3IL2A 1PJBA 4QSMA 4G65A 3RASA 4LGVA 3CKYA 3BMCA 4XGNA 4DPMA 5ITVA 4CMCA 5CG1A 2HMUA 4IJVA 1EDZA 2X1HA 4OOEA 4W9NC 2J3JA 5KOIA 4MKZA 4E4YA 4JGBA 4BNTA 1DAOA 3D4NA 2I99A 2VTDA 4IDDA 1GZ4A 1M6WA 3IUPA 4PG6A 5I8ZA 4XCVA 3HB4X 5I9LA 4DYVA 1ZVMA 1KEVA 3L4BC 4YVFA 1IZ9A 3JQ7B 2QHXA 3JYNA 1PJ3A 3K5PA 4K6FA 3GVPA 4DIOA 4P38A 3I5MA 1MG5A 4JN6B 1HWYA 1GUYA 3NRCA 2PD4A 4Q9NA 4FB5A 4I5FA 3BAZA 3L9XA 2NU7B 2YQ5A 3BTVA 4MVJH 1O9BA 4M1QA 3WQRA 5IDQA 3PPIA 5ILOA 4BNXA 1R4NA 2XXBA 3ROMA 3R6DA 3ICCA 1Z73A 1Q0HA 2GRAA 4FN4A 1ZK2A 1U4OA 3NGLA 3HFSA 3OJFA 5JYDA 1HE2A 4DBZA 1TT5A 3EHEA 4LVCA 3H5NA 3DBHB 1O8CA 4RZHA 2Y1DA 1Y1PA 5MGBA 1E92A 4YT2A 3HNPA 1ADGA 4N54A 4B3HA 4TWRA 5TQVA 5JCJA 5JSFA 3PK0A 4NMHA 1YQGA 4NHEA 4DWVA 1EZ4A 3D0OA 3SC6A 4YYZA 3ZHZA 1YB5A 1E1KA 5THKA 3A1NA 4E33A 3KTDA 3NT5A 5K6AC 3UH1A 1NVMB 2PGDA 4II3A 4PLHA 2LDBA 1E0DA 5DF1A 4JROA 3AI1A 1H93A 4EGFA 3VZRA 3Q11A 4NFSA 3BMNA 4GWGA 3PIIA 4R1SA 2VZ0A 3OJ0A 4Y6SA 4BO0A 4J1QA 4YR9A 2Y0EA 3KVOA 3NDIA 3W4KA 8LDHA 3IS3A 2Z95A 1E3IA 5IZCC 4TSKA 2X86A 2VYVA 3OEWA 5I9MA 3FBGA 2YY7A 3VKUA 3BMOA 1Q7BA 1P44A 4XR9A 3H2SA 5TJ9A 3PYXA 4XJSA 1ZCJA 3QIVA 2BMAA 3N7UA 2HSDA 3MOGA 2YHUA 1U4SA 1IYZA 1NNUA 2IYOA 2X9NA 2GZ2A 2W2LD 4YRAA 3HADA 3TZKA 1DFIA 4TRNA 2NTNA 3U49A 5BNTA 5K0ZA 1JAXA 3OSUA 3DO5A 3O26A 3UN1A 1W6UA 4OYRA 3ZWPA 2Q4EA 5F21A 3DZJA 1MC4A 4CQMA 3M1LA 3NAQA 4FOSA 4NI5A 3WG9A 2DKNA 1WWKA 1Y7TA 3ZNPA 3WGTA 1ZK0A 3GMDA 1IULA 5HA5A 4CUZA 3Q2IA 2D5AA 4GX2A 4IDFA 2Z1MA 1J0XO 1I33A 2O2SA 4R9SA 2Q50A 1XELA 4PG8A 3CPSA 2DM6A 1YL5A 4QUKA 2PV7A 1FDSA 2TMDA 3H7AA 1R6DA 2RH4A 4NNJA 1P1HA 4UEKA 1LDBA 3DBLB 1K6JA 4BO3A 2WWRA 1HE5A 4UAGA 1M2WA 3OA2A 2D2IA 4OSPA 1WLYA 3INTA 5CDGA 1KVUA 2VOEA 3X2EA 4RZIA 2C54A 2HMWA 4J1TA 4YJFB 4OL9A 4EDFA 1C0PA 1U9JA 3P7MA 4Y6PA 5CAEA 2UV8A 3GQVA 5TRTA 5A06A 3RBVA 1B15A 1U28A 4OJNA 4CM9A 1I5RA 4XRRA 4AJ2A 3KEQA 1Y6JA 3WXBA 1JDJA 3GMSA 1E5LA 1GYPA 3UF0A 1SOVA 4JK3A 1LC3A 3IP3A 3WFIA 1PGPA 5EL0A 3D7LA 2FR8A 2HK9A 4DIBA 4MVJI 2ZJ1A 3BA1A 3CMCO 1RWBA 3RUIA 4RV9A 4YDRA 1BG6A 2HDHA 2QZ9A 1CDOA 1I01A 4DREA 1XCBA 1PEDA 2AQKA 2BKAA 4HV4A 4PLVA 2AW5A 5BSFA 1MG0A 2OXIA 3JQBA 1B7GO 3AI3A 1P31A 2YUTA 4KUHA 5I7SA 3W1VA 1XWFA 4K28A 1Q0QA 3PFWO 5KJEA 3ZWNA 4GX0A 3T4EA 1NWCA 7ADHA 1GUFA 4IIVA 3GHYA 3NDJA 3TPCA 3T7CA 3WYEA 4C7KA 4HWKA 2QIOA 1HYHA 5IDWA 2O3TA 5HBRA 2PR2A 1X15A 2W4QA 4R01A 2I3GA 4CQLB 2NQTA 2PZMA 4IZHA 4CUKA 1GYRA 2YZ7A 4YQZA 4BO8A 4GLLA 4PZEA 3BYZA 3HDQA 3PYLA 5C7LO 1ZEMA 3WQQA 3JYPA 3O8QA 3QVXA 4YQYA 4CL3A 2E4AA 3KYDA 3W6UA 3LT0A 1KYQA 3I9LA 4RVDA 3ZWBA 4DRYA 4QTZA 1VKOA 4TMFA 2Q3EA 2EKLA 4TZKA 1KIFA 4UVIA 3KLMX 4M86A 2V65A 3GH3A 4NFHA 1DC6A 4XA8A 1E7YA 2JD2A 1YDWA 2VOJA 4E2XA 2DT5A 5T5QA 3V1UA 3F5QA 5DCUA 4UEJA 4F45A 5G0SA 3VOSA 4KWIA 3UW3A 3G1UA 4IS2A 1KEPA 4K9DA 4U7WA 3P5SA 4J1SA 3TJRA 4CMKA 4C4OA 3OJOA 5EJ2A 3JQGA 3E9NA 1WZEA 2BGLA 3HUDA 3Q1LA 4CLRB 5EPOA 4HFMA 2AE1A 4IJUA 3WR5A 5AXBA 4AJPA 2J5QA 1JLLA 5JC1A 3QHAA 4RLHA 1PJSA 2GN6A 3H3JA 4J43A 2YFHA 4HNHA 5T8KC 5A02A 2VHXA 1Q1NA 3RJ5A 1DJQA 2HJRA 4CV3A 4BGVA 4CJXA 4Q3NA 4R5MA 4BO6A 4DPKA 5JAIA 2OBNA 1IUKA 1R4MA 1UXIA 2QZZA 1WVGA 1D1TA 2J6IA 4DQVA 1X0XA 3HFGA 4E3ZA 4WLNA 3Q6IA 1ZK4A 2CSUA 2R00C 3L6OO 1G6KA 4RO0A 1KC1A 4BO4A 5JDIA 5ITWA 4RVFA 5H81A 3U4IA 4RF2A 4HFRA 2QRJA 3WB9A 2AEJA 1EK6A 1CERA 3AUTA 3ZV6A 2HRZA 4KZPA 1M6HA 4DUPA 5JAQA 1DLJA 3EVNA 4GKVA 4B3IA 4J9VA 4IIUA 4BGUA 2DTDA 2OORA 1ML3A 1MP0A 2SCUA 2VRCD 3V2HA 5LCXA 4NBTA 3GEMA 4UUPA 4YJHB 2O48X 3BXXA 3GZNA 4CLEA 2ZK7A 2FMUA 4LN1A 3T4XA 5COAA 4E5MA 1LI4A 4D0SA 4BNFA 5H83A 2EKPA 5U1PA 3WFJA 1PWXA 5DN9A 4Z9XA 1H6AA 3U3XA 4ALNA 3W6ZA 1DDOA 4IINA 4BOYA 1EVIA 3NT2A 1BSVA 1LRJA 3KM0A 4QQRA 4AJNA 1H9BA 1GPJA 5DCYA 1UDBA 4I9HA 4B4OA 3NEPX 1PGQA 4GBJA 1UH5A 4BUCA 5KJFA 1JAYA 1ZW1A 1BW9A 4GMGA 5A5FA 4YRBA 3PEFA 2GERA 4TVOA 3GN1A 3AW9A 5MDHA 3IJRA 3PJFA 4FOOA 3S2FA 4CMIB 5TJHA 3WGOA 4BNZA 3QVSA 3E03A 4B79A 4PLPA 1EUDA 2IZZA 3ZI0A 1TA4A 3RC2A 2WYVA 4JIGA 2B83A 4ZD6A 3ZHXA 2DTEA 5DP2A 4YWJA 1K5HA 3DFZA 3QY9A 4I1IA 1YB1A 2IYPA 4D79A 2JAPA 2NUAA 1EUCA 3IJPA 5A1TA 3RKRA 2O2YA 1JKJB 4FDAA 4CM4A 1P0FA 1ZSYA 4Z3KA 3CINA 1LSUA 3OM9A 1FK8A 3OHSX 1KVTA 3PWZA 5EMHA 3BMQA 3CZMA 4ITUA 2IDZA 3W4JA 1ID1A 2NVUB 4AICA 4MVJP 2PGJA 4L74A 4AFNA 3VH2A 1C1DA 1GZ3A 1UUFA 2Z5LA 5TF4A 2OO5A 1ZZEA 3Q2KA 4JJIA 3PI7A 2HKIA 3ETGA 3DC2A 1UR5A 4J49A 1YO6A 1PTJA 4I5EA 2DC1A 3C85A 3PDUA 4TRMA 4OQZA 4WLEA 3TOZA 3I9OA 1NYTA 3KB6A 3OQ1A 5GMOA 4RPJA 4Z3DA 1B16A 1EDOA 3JYOA 3GRPA 2O7SA 3NKLA 4HY3A 2C59A 1LDMA 2X8LA 3HG7A 3NUGA 4FCCA 3A9WA 4KOAA 4UVGA 2RIRA 3U4CA 4RF5A 4Q3EA 4I9NA 1PX0A 4F6CA 3H8VA 1SZJG 5DT9A 2JKVA 2DAPA 3JQDA 2AXQA 1HL3A 1K0UA 3LVFO 3P2OA 1I24A 1VI2A 1VJ0A 2GGSA 1KVQA 4J4TA 5A5EA 2VN8A 2GD1O 4BO1A 3GUCA 1MV8A 2BGKA 1Z7BA 3DHNA 3EZYA 2EERA 1VSVA 1Z7EA 1K6XA 4MVJE 3C8MA 1XQ6A 4IQGA 5CG2A 1Y8RA 4NDNE 5JO0A 1P3DA 1NM5A 3AJRA 2D3TA 4G81A 4EJ6A 1EBFA 2JFHA 2WDZA 3DMTA 2CVQA 1FDTA 4IQ0A 4KUEA 2HK7A 3VZSA 3RFVA 5G0TA 1LLQA 3ZCXA 1W73A 4GSLA 2XAAA 5F5LA 5A05A 5JMPA 2GUGA 4YAJA 3LLVA 1KBZA 4BB6A 1E6UA 3HDHA 2P9GA 1GZ6A 4OKIA 1LSSA 2JCVA 3V5NA 1BVRA 3TNLA 2Y93A 5C5IA 5COBA 3M6IA 5KCZA 3FCOA 2FRDA 4ALKA 5CDTA 2YHIB 5A9SB 5GZ3A 2HQ1A 4MVJM 3PHIA 4J7UA 1DSSG 2HMSA 1MB4A 5DBIA 2E37A 3PJDA 2IZ1A 1GEEA 1XSEA 1N1EA 1LDNA 1NP3A 3DB2A 2V6GA 4BB5A 4J4HA 3GT0A 1Z74A 2DUUA 4JBGA 3GNSA 4FD3A 2LDXA 3JSAA 2Q2QA 1XA0A 3FBTA 2I66A 1NHWA 1E3WA 1PZHA 4HX5A 4PLGA 1NPYA 4KP7A 1VRWA 2DPHA 4EUFA 4PVCA 1GQ2A 5EIOA 3X2FA 3EW7A 3CH6A 4E31A 3ORFA 1DXYA 2X5OA 1LDEA 1BWSA 1VE9A 1XEAA 4G5HA 2JD0A 1EK5A 1P33A 2CMDA 3OFSA 5JDCC 2W90A 1T24A 4L0QA 4DYDA 2VYND 5HWSA 4LMRA 4Y98A 3I9NA 4IXWA 1C1XB 2EJWA 2YDYA 2D8AA 4BNWA 5HS6A 3DWFA 2DLDA 1KOLA 4EJMA 1WPQA 1LSJA 3AU8A 3DBRA 3HJAA 3ONEA 2FR0A 1MUUA 4QECA 1V3UA 3PHLA 5KNLA 3DFUA 1U8XX 1NVTA 1PQUA 1GD1O 2IEDA 3OJEA 3QWAA 5A03A 2Q45A 5IN4A 1DFGA 2DU8A 2ZCVA 3HN7A 1ZMTA 1KC3A 3ASVA 2WTBA 1HSOA 2TMGA 1LUAA 4IUYA 3CE6A 4MP8A 4BGIA 3ZWMA 3A14A 1OAAA 3S8MA 2PZKA 4WCFB 3K92A 2W8ZA 1GDHA 3QWBA 4RF4A 3V1YA 1U3UA 1WMBA 3L6DA 3QWFA 4CMJA 3ZV4A 2VUTA 2HUNA 4YJGB 1LDYA 1J5PA 1UDAA 1XGKA 3WGHA 2NLOA 3MJ4A 2CVOA 3LDHA 4RPHA 4CMGA 2UUOA 3LLSA 2X0NA 1NPTO 2IZ0A 2FPIA 1ENZA 4U6SA 2NU7A 3RUEA 4MIYA 3UUWA 1E3LA 1Y81A 4B3JA 5DBGA 4R1TA 1AE1A 4Z0PA 2QG4A 1CETA 3ZU3A 5I7FA 2X9GA 1E3JA 4Y6RA 4XZ3A 1U5AA 3UCXA 1VC2A 4Y8VA 3GFBA 1ZK3A 2JHFA 5BR7A 3ANMA 1KETA 4A7PA 1PWZA 4BKOA 5JAZA 3DBHA 4ONEA 1PGJA 2IODA 2DTXA 3AWDA 1V8BA 4EW6A 4QO8A 5L7TA 1T2FA 3VPGA 3HHPA 2HU2A 5A3JA 3AM3A 4AG3A 2FPPB 1H5QA 1ULUA 1YQDA 3BHJA 1I36A 1X7HA 2PZLA 4YAGA 4ZA2A 2BRUA 3WWYA 3JQAB 1ZUD1 3CUKA 1KY4A 2I9PA 4A27A 2J5RA 1TVEA 2I76A 2EHDA 2DPGA 1Z75A 1LRLA 2GN9A 1MC5A 2IXBA 3VTFA 1LLUA 3G1TA 2O3QA 1WDKA 2GASA 2YQ4A 2GYYA 1PJLA 3HWRA 3K31A 1UXHA 1A7KA 5F1PA 3BHIA 7MDHA 5T6BA 4ZN6A 4E6PA 3ZH2A 3AUSA 3UICA 1HDRA 4CODB 1O0SA 1W0CA 1E1LA 5C7IO 5DBFA 4CLHA 4Q3DA 4WASA 4MPDA 2NVBA 3TL2A 1OMOA 2C2XA 4ZQFA 1ENYA 4MO2A 1UP7A 2PGLA 2NACA 2FOIA 2G76A 4H3VA 3SVTA 2O50A 4LSWA 2FY8A 2NQ8A 3DDNA 2YJZA 1EQ2A 1UXGA 5IZ4A 2AQ8A 4WJZA 2CFCA 2AQHA 1YL6A 3CSDA 3UCFA 3DZFA 3JYLA 1CQIB 1RPNA 1MXFA 4XQCA 2Y1EA 3DZHA 1H2BA 1E6WA 1H94A 3UGKA 4PGFA 3W8FA 4W7IA 2ZYDA 3D5QA 1DIGA 5JMWA 2AG5A 4W7HA 3K8ZA 3JQFA 4CMHA 1K2WA 3U9LA 4DQUA 1GCUA 2VHYA 5EQDA 3WGYA 4DIFA 2EKQA 1ADCA 1N7HA 3IP1A 5CHEA 4TRJA 2OP1A 2Y1OA 2ZYAA 4OIMA 3C24A 4PG5A 3FTNA 2C29D 3LC2O 3DAGA 4YAIA 3DBLA 3WDSA 3WJ7A 5T67A 1NFQA 3TSCA 3O38A 3H9GA 1EE2A 1RM0A 4FJ1A 2C7VA 3H9JA 4RGBA 1IZ0A 2VQ3A 4Z0TA 2PLAA 1YBMA 4C7JA 4IDGA 1YGYA 3PDJA 4B7XA 1CRWG 3CEAA 3D3WB 1E5QA 4BNHA 4O1MA 2J5KA 3PP8A 4YJFA 4CMEA 3VVCA 2YV2A 4D44A 4I08A 1L7EA 1OFGA 2VT3A 4ZRNA 1ORRA 3VPFA 1OC4A 1CEQA 3C7CB 2BGMA 3JD1A 2NTVA 1MLDA 5FI5A 1PL8A 2VWHA 1BXZA 4E5PA 4RVUA 1IL0A 5FFFA 5B12A 3TZCA 5L45A 2Q1SA 1T1RA 4RVHA 1F8GA 2HLPA 3H2ZA 1QP8A 5TT0A 3FR8A 4YAKA 2NU8B 1MX3A 4J6FA 5ENVA 4CPDA 2A94A 5BNIA 3WLFA 3ZHBA 4GAEA 3K96A 2C5AA 5JCJD 1CF2O 3EGOA 2YV1A 3FNGA 4PRKA 3U62A 2P9EA 3QJ5A 1LX6A 1FDVA 4IGEA 4RQUA 3NTOA 3GVIA 4Q3CA 4F46A 2B35A 3QV1A 5LDHA 1SOWA 2NU6B 4PG7A 1YJQA 4BV8A 2CNBA 1I2CA 4EJ0A 3BTUA 3IKVA 3DAPA 4BKPA 1QXSA 4XYMA 2A4KA 3U4HA 4BNGA 2D5CA 2DQ4A 3ZGYA 4CQLA 1C0KA 3LSYA 2VYVD 5JCXA 3C1AA 3AY3A 3GUYA 3GZ4A 1BXKA 1I3LA 4CR8A 2AA3A 1A71A 4NPCA 3B70A 1QLJA 2I3AA 5IG2A 3ENKA 4R1UA 3FPCA 4DTIA 1PJTA 2PD6A 1LLCA 4ZQEA 5THQA 3QQPA 1ZBQA 4ID9A 1GTMA 3OECA 1BHSA 3H3FA 4CQMD 3AI2A 3KUXA 2EV9A 3K9QO 3B20A 1DPGA 1HXHA 4YB8A 4TZTA 1MFZA 4E2ZA 1BXGB 1SB8A 3JV7A 1LNQA 4IDCA 4CLRA 3GAFA 5JS6A 5JDIC 1PQPA 4P8RA 3WIEA 1XIVA 3BMCB 5IAAA 1F17A 3F4LA 1U2DA 2RHCA 3PQFA 4XGIA 3L6EA 5HS4A 3K73O 3SJ7A 4EUHA 1I30A 3VTZA 5DOVA 3Q9UA 4K1LA 1HDZA 2HMVA 4MKRA 4M49A 4XIJA 4EEXA 1YOVB 1M75A 2YV3A 4RJTA 1ISMA 4O59O 2BFMA 4XQEA 1VM6A 3OIFA 2WYWA 5C3MA 4E5YA 1TT7A 3OICA 2HRBA 3SEFA 3JQCA 5BSEA 4DLBA 2EJVA 4KQXA 4XJTA 1H0KA 5CDSA 2DUWA 1XKQA 1YS4A 3WTCA 3KEOA 1SEPA 5CEJA 3F1LA 3ST7A 5KJ1A 4YBZA 3UXYA 3U5TA 1DIRA 2IXAA 3FNEA 2VHZA 4XKJA 1DHRA 5H82A 4N5LA 1I2ZA 4NBRA 1ZXBA 4CM9D 3RUAA 1V9LA 1QRRA 1F0YA 4YJHA 4BL5A 1B8UA
chains in the Genus database with same CATH superfamily
2FA9A 4JGGA 5I3ZA 2E1RA 3NBXX 1B8VA 3RSZA 1CJUC 1I4TD 2GNOA 1GAQA 2O06A 1J2YA 3VDRA 2ZKLA 4OJMX 4F11A 3NGMA 1WB9A 3HZRA 5LU9A 2IUUA 3OKPA 4R4JA 3LUCA 4H59A 4NR0A 4NZ9A 4BX0A 1AGRA 1FP6A 3I73A 3NHYA 1KBQA 3FR7A 3VO8A 1YJBA 3KLBA 4QSHA 4MGZR 4V39A 4AM8A 2Q2OA 3DAYA 421PA 1BKSB 3R3ZA 4YYEA 1VPEA 3BL8A 3D02A 4XR4A 2O8CB 3KR9A 1R9GA 1XTKA 2V0NA 1E7MA 2QTGA 2XMBA 3BOSA 5SY6A 1Q0TA 1EUYA 4RDXA 4DSTA 3KIPA 4NYMQ 4C2UA 1B2LA 3D1LA 2QTMA 1RCUA 1XHFA 2DQSA 2R1VA 4DSAA 3K70C 2Z2XA 1G3IA 4H7FA 4I4TA 4MCIA 3V2UA 4ESVA 3KKNA 1JECA 5KJCA 3V8PA 4PQYA 4YMUA 2PAAA 5J4KA 1FS4A 3IVGA 3KV3O 3OZGA 3OZWA 2C42A 2HO5A 2PMCA 1VG1A 4IHJB 4XLTA 2G9QA 1G21E 4HDSA 2RB4A 4JJFA 2J3DA 2HQBA 3OT4A 3RHTA 3VNBA 3H84A 2I2BA 4YCJA 1YRLA 3TFWA 3NGXA 3NPMA 1WF6A 3CZCA 1Z0ZA 3QF4A 5BNZA 1YMQA 2D0OB 2PYIA 3A6KA 3K7EA 1DP4A 1G8GA 1ZGGA 2I65A 3WJ1A 2VYQA 4LFCB 5KTOA 1A7AA 4MA4A 1UFKA 3EPRA 4KRFA 4DMUB 3LHDA 5IC4A 1KMHB 1GT91 1JKJA 4FCTA 4M38A 3CSSA 1R5NA 1P61B 2HNAA 1GGKA 5FUYA 2ID9A 1U7WA 3LRXA 4ARCA 3AF0A 3HXKA 4NCXA 4ER7A 3TF5A 1N7GA 3OKAA 2C96A 2ECKA 3I62A 1Z6TA 3R5HA 4YTEA 3TSZA 1QZXA 3ZWWA 5IXJA 1DQZA 2JH3A 2WJGA 4HN4B 5AQEA 4POOA 4D8YA 1KH2A 2CL6X 5AVQA 2A88A 1YQ9A 3RU7A 4B46A 1U80A 1AKTA 2HLDD 5JS2A 5I9NA 3P20A 4CL2A 1PWHA 1NW5A 4HVAA 3TLBA 1SXJB 2WU1A 4A26A 4RX1A 3E5MA 2QSZA 4RKRA 3WZLA 3GPDG 4E5VA 1GG2A 2X4DA 3QYFA 4BVEA 4EL0A 3ZNNA 1JWAB 1CBUA 2PL5A 4UNRA 2YRFA 3KJNA 4LA4A 1XKXA 2WJPA 2O5EA 1X0VA 1X94A 2OILA 4W6ZA 1BCRB 1P77A 3LP5A 3DMTC 4Y2VA 1MF7A 2WAOA 3FJOA 3L77A 4LKRA 3RAJA 1UXJA 4IH9A 2EOAA 2GX6A 4PNEA 5CLJA 3TSOA 2P3SA 3I9JA 4KVAA 4MP3A 4TWAA 3I1JA 2QZ4A 4K6GA 1JW9B 2PS1A 3R4CA 4URUR 3WBJA 3NU1A 2NQ2C 1NYQA 3SC4A 5JCZA 4JEIA 2ZBDA 1QPZA 5GM1A 1UMDA 3GDGA 3STYA 4TRMA 2IEYA 5IK2A 4D57A 3PFFA 1T8PA 1SOAA 2AWOA 2LIPA 5HCNA 4XB1A 1DRUA 1NPDA 2B5WA 4CM8B 5F7JA 2AQIA 1PYDA 1G66A 1KY2A 4MRAA 4OCZA 1UBCA 1Y37A 2EIXA 4HDNA 4KZKA 5FI0B 1PK7A 3EMVA 1U3DA 4HXYA 4R8LA 4AG5A 1IXKA 5JYCA 3HB5X 4TSFA 3GFGA 1Q7CA 2VDJA 1OCEA 4DPLA 2DUNA 2V6JA 1RAAA 2L42A 3NEAA 2BD0A 4WA7A 1WTAA 3MJVA 4BVAA 2GA8A 2OV4A 4OI4A 5LJIA 5HF8A 3K15A 1NBOA 4I9UA 1OZAA 3WL7A 1STOA 2GSDA 3AKDA 4GKJB 3HWX1 1EM6A 1T6NA 5JSZA 2ET6A 3HSYA 3AB7A 1Y9EA 3A4IA 4XD2A 4A15A 3BILA 3JZAA 5B37A 4G09A 2FPMA 5INTA 1P4JA 4TOIA 4AJJA 1JU4A 1T6ZA 1CIVA 2CKDA 4IMPA 3RCBA 4EG8A 3HFJA 5C32A 3CMMA 3LQFA 1YZQA 5IARA 2PYZA 4PLCA 3A1DA 4DAOA 3IIMA 4TUYA 4K8OA 2VK1A 1Z6ZA 1Z08A 2J3LA 1Y6FA 5C1IA 4M0DA 1OFTA 1RQ2A 2OZKA 2G7MC 3THWB 1GDTA 1D2AA 3EXG2 1YWGO 3T7RA 2AX3A 5KNDH 1NT2A 1JEJA 5E4JA 1UEXC 3K4HA 4UHBA 5MN5A 3T9EA 4AYTA 4DFDA 3D4PA 3ZGXA 4ESOA 4G4GA 4RLSA 4QUDA 3A1UA 3AOEA 2Q5EA 2VPYA 3PQEA 1UJ5A 4NNPA 3CRZA 4UVDA 6AT1A 4JT4A 4FHCA 1FW8A 1Z37A 3DEHA 3I9FA 3KZKA 1A72A 4HP8A 1T5DX 4PWZA 4L27A 5BSKA 3T41A 1ITZA 3B82A 3EEOA 2ERCA 2QD5A 4UDOA 4JJGA 4DWWA 1E7WA 1M2FA 5CH8A 3FPKA 4L5CA 2ZQ5A 1DC4A 4DDTA 3U60B 1DIAA 3G0OA 2FYTA 2LD4A 2PVPA 5ES3A 4X65B 1L7BA 4COOA 2RHHA 4J7CA 3TQFA 4V1CB 5AW4A 4A36A 1Q22A 4REMA 2WHEA 4BQEA 4BNKA 3L92A 1WMEA 2PBFA 4KLCA 1TM3E 3UAVA 2F4VB 5C8YB 4FEEA 5DHRA 1CUUA 2IEBA 4H1UA 2Q07A 3O8OB 2JI4A 2XNJA 1HNNA 3EFOB 4YC7A 1RPTA 3ANTA 1QWSA 2A0KA 1PIWA 4N3GA 2Z5FA 5H1YA 2K4MA 4GEKA 4WCDA 4FFLA 4LY0A 1O5OA 1QS0A 1ZJZA 3X43A 3FTFA 4LRWA 2JIBA 5TDHA 4MVWA 3COSA 4QYSA 3H19A 1R0XA 1E2BA 3V4OA 3I23A 1Y3AA 3IEPA 4EELA 2ORIA 3FWHA 3QOYA 1VYVA 3I6QA 4X7BA 1ONSA 1ACLA 1Z4KA 4YXFA 3WLNA 5B53A 2Q2NA 1ZUNA 3E4CA 1SVMA 3BB3A 4OFWA 1VIAA 4PPYA 1AN9A 3THOA 1QR6A 4XCXA 4RORA 3UTCA 5I7VA 5TMPA 3U4QB 1EESA 2R8PA 4PYRA 2DKFA 2XBLA 2VZ9A 1DWOA 3OMLA 4HH4A 1QTNA 5C4GB 2CE2X 3WTBA 3KQNA 2VPWA 2WZCA 5JW6A 5B1HA 1KAQA 3PUXA 3ZHTA 2CF6A 1O89A 3CLRD 3DL7A 4PQGA 4QEDA 5AM0A 4JXXA 4CKEB 2XXAB 1YBAA 3VPHA 3LCRA 3O4HA 2G3YA 3GDOA 1E1RD 2JAWA 3FYTA 5IT0A 4BJ5A 1GFSA 5BW6B 3BM5A 2Q2WA 5C34B 2J0SA 5TT1A 1XTQA 2AYXA 1ILEA 2WY2D 3TX6A 4TQGA 1SAYA 3THYA 1DMSA 4QRDA 3CJTA 4EF6A 4P31A 2O3RA 4C5BA 5DP1A 1VZ2A 5CFNA 4N03A 4Q3LA 2H9IA 3JQ9A 5EKTA 3Q1KA 5GONA 3SIXA 1PL7A 1OLSA 1X80A 1NVEA 5TMDA 1B3RA 3JQAA 5FLKA 3BFPA 2J0UB 2IXGA 3A4VA 4WLUA 3UJ3X 1M2VB 4XYBA 3G3EA 1ZFNA 2W11A 3O4RA 4P4GA 4URZR 3STWA 4OUDB 1VSTA 4LK2A 1MT3A 1T9GS 3CX7A 3CIFA 3NCTA 3LBFA 3R09A 1PT5A 1CLUA 1XMJA 5DTEA 3ULKA 3BDIA 1MGOA 3LH5A 2ALJA 2EX0A 4FFOA 4MVYA 4FFMA 1O5IA 3CRW1 1GVHA 5J5CA 5ALIA 4EFMA 1OASA 2PNFA 2A0UA 3TZLA 4NTZA 4FBGA 1ZK1A 1FFGA 1XFDA 2HPAA 4FQ5A 3UWPA 1H0RA 1OGJA 4IG9A 1KI8A 2EARA 3M2PA 3QYJA 1M8FA 4BRZA 2PGOA 4WDRA 1LBQA 1J24A 1S2NA 1K86A 3H4IA 4ED9A 1QORA 1ZAKA 4TTIA 1MH9A 4GH5A 1VCOA 1W52X 2NZXA 1J33A 3JQFC 5F3RA 2ODBA 3FNHA 1UJMA 3IRUA 3UENA 1NG9A 2N3ZA 2EJCA 3EHDA 4OHUA 3E5NA 2IH5A 3T4PA 1S02A 2AEMA 2VEDA 4CEJA 1KDOA 4DVJA 1V1RB 4HDMA 1P17A 2BEWB 1G6Q1 3TQQA 4AO6A 1Q20A 4IVNA 1KOGA 3CKKA 3GJTA 3DDCA 3KDSE 2AOTA 3OH8A 4JLAA 2X0EA 4OKNA 3S8YA 1B2RA 1HGXA 4O5OA 1CQIA 2W2NA 1JYEA 5TC4A 1SPXA 3VU9A 3U7GA 4BNYA 4DMLA 4MKXA 2XF8A 4I50F 2PS0A 1KAHA 1D2MA 1P1KA 1Z4LA 4DLNA 4Z8XA 3L3BA 4EY8A 1P2UA 4CKWB 3AC0A 1VLLA 2W6OA 2Y0PA 1ORIA 2IYTA 1XZ8A 4EY7A 5KQMA 5K20A 2QRZA 4LOLA 2CFTA 2XTZA 3FVTA 2G0TA 3OZUA 1OZHA 2ZDGA 5LZ9A 3FDFA 4NQRA 1Q5PA 1M9NA 3T5DA 3AR7A 2AMVA 1NYLA 2F00A 4TKMA 3NHZA 4M98A 5G1OA 1RYMA 3WYGA 4BO5A 4IIFA 2OBBA 4XGKA 5K3AA 2QJWA 3WL5A 4EUSA 1E3MA 1GNSA 1E1QD 2K2WA 1FSFA 3S28A 4JQSA 4FIZA 4Y2QA 3ACBA 1G21B 5AICA 4DEXA 3O2SB 1F4PA 1KWKA 4CXMA 1BWQA 1ZOLA 3IXLA 5LP6F 5JY1A 4H6PA 3P0RA 4QOGA 1EFUA 5A6SA 4H17A 3WGLA 5LYJB 3VVLA 4TKVB 1MJHA 3PC8C 4KMSA 4Q4HB 1NE7A 1QO0D 5FL7D 1E1NA 5KYYB 5I9SA 2GK6A 3RUCA 3C7KA 3EGXA 4RZSA 2LCFA 1EXWA 4D9CA 5L4LA 1GXSA 3CF6R 4XRGA 2EYUA 2ZYHA 2GKGA 2GXSA 2PLWA 2VTVA 2Y1LA 5HFNA 4I5IA 3DLHA 4EG5A 2XHZA 4C4PA 2R1TA 4XLLA 3BXPA 4MV0A 2PWZA 4BVBA 2CNDA 2EP7A 2H17A 2VTEA 3FDIA 3RYFA 1FDUA 1CF9A 2F1KA 2P3QA 3LGAA 1D1SA 1WEKA 5A0FA 1KEEA 1UPFA 3EPKA 4TLDA 4WOBA 5HKBA 1U5BB 1XDWA 2CK3D 1M0EA 3O95A 1RAFA 4C20A 2GETA 3EPHA 4H27A 4PM4A 3F90A 4RYLA 3D3EA 3LKZA 5EP1A 4F8YA 4MLDA 3TRFA 3GC6A 3FKJA 2BFPA 4M9SA 3R9XB 4YRDA 1Q7TA 1E77A 3R0VA 5JO9A 3E8SA 3MT8A 4CYMA 3N0VA 4NX2A 4UQOA 5HM8A 2KSQA 4CR7A 3NALA 4OGLA 1B26A 4R9NA 1HE3A 1YQEA 3R4VA 1ZUIA 4IFIA 4LNUA 1YZUA 4D9JA 3VPBA 2UYHA 1CZOA 1N9GB 2NXJA 3U19A 4HEHA 2YMPA 3CLSD 1I2DA 5TPZD 1N6KA 3RQSA 1I1QB 2V7UA 2W5UA 1HORA 2LR0A 3D2AA 4MJ7A 1GILA 3EVZA 2G9NA 1UOEA 3DOOA 4AY4A 4AVYA 5TS2A 2NXCA 4GZMA 3HRHA 4KQWA 3O3OB 4ZAFA 4OOFA 2QMYA 5EQJB 3WOHA 1GPNA 3UA3A 1QDLB 3ZWXA 4F86A 1VG0B 1TDJA 3HYCA 4B73A 2ILVA 2VJAA 1XU9A 3V55A 4EIWA 1COWD 5KX5F 3Q8MA 2C4NA 2H1IA 4JBIA 4O4LA 5EWLB 1P4SA 3MLEA 3VYWA 1YACA 2X9LA 1YA4A 3AFMA 4FDMA 4G07A 3CVYA 4BVHA 4NVRA 2GARA 1U3WA 2JGAA 2G82A 2VJMA 3TI7A 4BMOB 2MINB 1RU3A 3SZGA 5D1HA 1G3RA 5DVZA 1II0A 4QTTB 4X6YA 1E6KA 1E8MA 1PZGA 4UDXX 1IM5A 3D5TA 3M3PA 5K0FA 2VJQA 4S1VA 4BKUA 5LOVF 4IW3B 2VDMB 3SZUA 4QODA 3TN7A 2EWMA 4P4TA 3UC5A 3DT8A 3DONA 3IBGA 3RAGA 1XQ1A 3S1AB 4CIWA 2FG5A 5AVKA 5KC8A 4NABA 3WV4A 2O23A 4NENA 2PRZA 2FVYA 3M5WA 4NYIQ 3QJGA 4WCVA 3JYQA 5CNIA 2ZDQA 5A7GA 2W6PA 4A0FA 1BXGA 3LCCA 4P4NA 4PSKA 1CRQA 4FR0A 2IRWA 3GJRA 3IXMA 1KO1A 4YGXB 4BATA 3GG2A 5FBZA 5IBPA 2CL5A 2EATA 3V4RA 4IIJB 2I3BA 4GL4A 4URYR 1GTRA 2D59A 2QI9C 3T3IA 5LUAA 2P6NA 3LLMA 2QUJA 3IDSA 4L16A 3FDZB 3KLNA 3OMXA 1FY2A 3OETA 1W5TA 2NZWA 4IYRA 5JDCA 2NM0A 5BVHA 1JPJA 3L8MA 4XFKA 4UHHA 3BH7A 5CVDA 4JI6B 3X1XA 4CIAA 2QJRA 1AKVA 2P75A 3OJCA 2Z0MA 2YYAA 4ZEOA 5KOYA 5KMGA 1YVUA 1O95C 1TMOA 3EODA 1RQPA 3OIGA 4LJ7A 1YZLA 2Q5IA 4UUMA 1L5RA 1NJ6A 3IDFA 5I4IA 2P0YA 4INZA 1PP4A 2HF2A 2WKPA 4L5YA 1K6EA 1KQFA 4LYEA 1DJLA 3PD7A 4UFNA 4X60A 5LB2A 5BWCA 2WP0A 3N87A 3G0HA 4EG3A 4MS1B 2KHZA 3ND5A 4AF7A 1HLGA 4MZDA 1H4VB 3V6LA 6YASA 1EFVA 4YEDA 3IVCA 5HDQA 5ENDA 4YFVA 3RSCA 3CPEA 3R5SA 4TTJA 4DLTA 1Z33A 1JFSA 4KWCA 3JWGA 1WW3A 2B1IA 3WFZA 2GO7A 4C4AA 5C52B 4XDYA 1S9DA 1EFLA 4IOMA 2JGDA 2G17A 3A6FA 4YRGA 4LJ4A 1R16A 1KE1A 3SYLA 2R84A 1BFKA 3TGWA 3SE0A 3GP3A 4IPTA 3K8YA 3VR5H 1U1IA 5AOAA 4CKXA 3FSEA 4ZDIA 1DEHA 5KNCD 1U0SY 2F9FA 3H17A 3O83A 3ZI4A 4RZUA 5GZ1A 2HWUA 3GCDA 4NK4A 3AVYA 5KCMA 5I4KA 1DE0A 1Q74A 1DTWA 2F1HA 1JE0A 1RHQA 5JYBA 3B2EA 4RS3A 3D1VA 2CLIB 5A4DA 3A1WA 3MBIA 3ZW8A 5AXDA 4QELA 5FF9A 2VZLA 5KQGA 4CG0A 1CWUA 1YGPA 3D6UA 3VAYA 5LMZA 4DV4B 1CEEA 1F1BA 2O7VA 2YH2A 4ND7A 2A9JA 2P5YA 3CSUA 4WGGA 5ICEA 4J75A 2DBYA 1YJ8A 5DDIP 3RRBA 2BBSA 3RBAA 3DUWA 2VG8A 1TTHA 3CUVA 1BROA 3MRXA 3SLKA 1PGOA 3IXQA 3STHA 1MVNA 2W2LA 4G1UC 3L0BA 4N0DA 2ZM5A 4QJBA 4F96A 5DU2A 1KBOA 5C81A 3G2MA 5MN4A 5H59A 2DFTA 3HI4A 2IL1A 4DGSA 4KIJA 5FOXA 5DK6A 2CLEB 1R27A 1BRMA 1DFHA 2MYTA 3DMGA 1RSZA 2AYZA 2ATIA 2CEKA 3GUVA 4I0WB 3D2LA 1RRKA 2JCSA 4Q05A 2Z8YM 3ROGA 3W5DA 4BVJA 1M5RA 3A2KA 1UINA 4TKUB 2PZFA 5JVDB 4G26A 1ZGBA 2WD7A 5JSHA 1YS6A 1E9SA 2BOVA 3U0VA 4G86A 2JGJA 4QATA 3AX6A 2B0JA 1WJGA 1WY7A 5E6UB 1CUFA 5JFGA 1QNLA 1QK3A 4ZYLA 1ZH0A 1K4KA 3MTBA 4LBZA 4RKYA 2Q7DA 3HPQA 4P82A 3RRFA 2G9ZA 5LVAA 2UYQA 3V1LA 5CFRA 1U3GA 3LKVA 3LLUA 5EWJB 4M7PA 3WGHA 4WJKB 3URMA 3RAFC 4M1TA 1V11A 4LYHA 4MRMB 4TQAA 1XHLA 3TWOA 5JXGA 4NPHA 2I4TA 2QN8A 3FNBA 2XRFA 4XYEA 4PNPA 1XLTA 2IDMA 4DSOA 5KSOA 3MBOA 3NAZA 4EG1A 1OZ0A 3HK2A 4BIIA 3D54D 3QX8A 3V32A 4G1VA 3IOYA 3CM0A 4TYMA 4Z9AA 4YMTA 5K0EA 1UEJA 1RI2A 4K9QA 1J7JA 4QNRA 2ZP1A 1QE0A 2PFGA 1I4DD 2UZ0A 3Q7QA 5L53A 1SU4A 2IA5A 3FB4A 5BWMA 3PTZA 4TMWA 5IH7A 4EAAA 1OWLA 3CA8A 1GIAA 3GEGA 3H9EO 3H9CA 3P2KA 4KKVA 2YXBA 4PR3A 3VYVA 5KVCA 2F6RA 4W9NA 1Y5NA 2O52A 4RBNA 1Y1KE 2GJKA 5BSWA 4CG1A 1ESEA 3DE0X 1U8AA 3FSGD 1QZ3A 2JLQA 1EAYA 4B32A 3O73A 1KY3A 4B6PA 3VMFA 4UJ3A 3STUA 1FYEA 4B43A 2V98A 1NVWQ 4A82A 1HTBA 2B82A 3H5RA 4WTOA 5FTLA 4X1KB 1G5FA 4QEKA 3AU9A 1ETUA 1YSCA 3KEFA 4JJKA 2AOUB 5CLHA 3OP4A 3AY7A 1C0IA 2G5TA 1PR0A 2WR8A 4ZV9A 5ICGA 3GGDA 1WXDA 3ISTA 2ZRMA 4Y2UA 5D3MA 2PSSA 5AKHA 2DPMA 2IEGA 1S6YA 3A1EA 2L17A 1NXWA 2RHLA 4EYOA 5BT9A 3ENWA 1QB8A 1M6VB 1O8BA 1PR9A 3VNAA 4CNBA 3THXA 4PU0A 3SMQA 4DCGA 4OJKA 3RYIB 1HFWA 2A0WA 2GJAA 3LYAA 3RUDA 2Y1GA 3ESRA 5TNXA 2MU1A 1P9NA 4EY4A 3HJNA 4TT3A 4JVLA 2BGUA 5BP7A 3M3DA 4LMPA 4IKPA 1D09A 3QEJA 3WL8A 1GA1A 4F2DA 2YFKA 2QENA 2VF4X 1CZNA 2LCQA 1TOAA 1E7RA 5TR9A 1X8XA 3E48A 4RVGA 3HBLA 4CZ2A 1VHTA 5FR2A 3ZGVA 2F64A 3RU2A 1EHCA 2AZTA 2IKQA 4ZIRB 4MQEA 3K8OE 2BP7A 2JIOA 1I32A 1VE7A 2EGHA 3HZHA 3N8IA 4NYIR 2IQIA 4ENQA 3BMOB 4BKMA 1IRIA 5KNBD 2NUBA 1BE8A 1XB2A 2W83A 1E9BA 1P1RA 2HLNA 5IEJA 1PJQA 1HRDA 3LZ6A 3DXXA 4N7RA 4OQYA 4V2UA 4UBNA 4DJJA 1F2TB 2UZIR 4ES6A 4KIWA 2I2DA 2AHRA 3ZDEA 2IPAB 4OD0A 3FAZA 2ZATA 5BN5B 3V2IA 3WB0A 3UWDA 2SKCA 1O6ZA 4KTVE 4OFBA 2J0EA 3P97A 1MV5A 1OREA 3Q6MA 4DAEA 3BL5A 1ODSA 4D2IA 4RIHA 3V8NA 4IKEA 3N39C 3Q3HA 4O5AA 4RFVA 1UBNA 4PO3X 1VIMA 1QZUA 2DHQA 2YIJA 1FJGB 5IZCA 1Z82A 3MMSA 3N86A 3OWOA 1I2AA 3BUSA 4IG4A 4CQJA 4EKNB 1JTVA 3K1YA 5IFKA 5KWEA 4LXGA 1WBBA 2PBRA 5AVZA 4EGCB 3DC7A 4TT8A 1X9IA 3A6GA 4WCFC 3TLAA 1P1CA 4F4IA 2HNBA 3IAUA 2WZQA 2HHCA 4GPTA 4BFYA 3A04A 5DTRA 4TTRA 2NTJA 3IQWA 4O4IB 4G85A 1U8YA 2FSFA 3BJEA 2JVKA 3QEOA 3QXSA 3HXOA 2GR9A 4U2DA 5B4TA 2XY4A 1YQUA 3LZCA 2BGRA 3QUQA 3QYPA 4HR7A 4N12A 3AJ8A 1KPIA 3GK3A 4DUGA 1EG7A 2H4WA 1ZHFA 2EIHA 3NOXA 1CUEA 1JIJA 4CM1A 1Z45A 3TSYA 3WMWA 1L5ZA 2E2WA 1VECA 3H13A 1RRFA 3I6IA 4N9QA 3WNZA 4BU1A 5EHZA 4E3WA 3CZRA 2AC2A 3WP1B 2YINC 4UMDA 1T9HA 2QVCA 2X0DA 4M87A 5FV4A 4U7GA 4UTVA 3MWDA 3DXFA 3SS7X 3G8BA 2BZSA 1KMQA 4YH1A 3RE1A 4U7DA 4XVCA 3PDIA 3RHFA 3ZJTA 5DX1A 1OLXA 1DEAA 4M8KA 3MWEA 5FBKA 5AUNB 1DIHA 3TW8B 3SC3A 1EH5A 3RSSA 4E2YA 2ZUUA 5B3LA 2FTKE 3S1SA 3II6X 4KXFB 3QPUA 5DHSA 3RSHA 4XSGA 3I9V1 4ZVVA 2O0MA 3KOMA 3WMGA 3WWZA 2OVFA 4F4HA 4DV6B 4XSHA 1EX1A 4OJQA 2AVDA 2HDOA 1DLIA 1DX6A 1X7YB 1WZUA 1YV9A 1OF1A 1SG0A 2H48A 5E0KB 1VE5A 4JOQA 1L4EA 1OZGA 4MR8A 1JZSA 3HA5A 1T36B 3KXKA 4BMVA 3EB9A 5L7WA 3T7EA 4I1PA 4PAGA 1V26A 2BFBB 4KR6A 1VGQA 2NP6A 1PT6A 3QVWA 4V24A 1AXGA 2XKBA 3H5LA 3KT0A 2XUQA 2PRKA 1BQEA 1H2AS 2DRIA 3HEMA 3LGSA 4YRQA 3KETA 5I48A 4ZVPA 5K0JA 1YR9A 2V7BA 5BVGA 3H7IA 4RY8A 5ALYA 3PB3A 3QG1A 3ETNA 2QL7A 3WI7A 4URVR 2YKGA 1P0CA 3GUUA 1U8CB 3IUNA 4W1QA 2G63A 4MUJA 2YW2A 3SXPA 1W36C 3DE1X 2W6JA 5IJAA 5TGDA 3UYLA 4BWYA 1VRVA 3E9MA 5DM70 4Y67A 3A9VA 4O3FA 3WBBA 4EB6A 2ZJZA 1EZ1A 1FNMA 1H2WA 4U2BA 3ZUPA 5BOSA 2PO7A 2DQKA 1YZGA 1AMNA 4IOKA 3DTVA 4NEGA 4JZYA 4YXWA 1WUHS 2BN4A 1UBOS 3JVEA 4DGQA 3TI9A 3SQLA 2G5CA 3BRWA 4BX8A 3WLLA 1J22A 2V7EA 4JKOA 5HZGA 1TF5A 1I7PA 4HDKB 2G40A 2H52A 2ZB4A 1YE3A 5EXPA 4DJFC 1M1UA 1MA3A 1MB9A 3FOFC 3KZVA 1P2DA 1BQ3A 2MYPA 2X8JA 4Q3AA 3GJ6A 4AN1A 3GVCA 2Q0HA 3UMMA 3M82A 5TY0A 3DD5A 3HE3A 3HJRA 4ZC1A 3V1TC 2YYSA 2G1JA 3IDAA 5G41A 3R0QA 4EZIA 1DIBA 1X14A 3DKKA 4EI9A 1E4OA 1QHGA 2VT7A 2R68A 3V8QA 5ES4B 3NUQA 5EJGA 8ADHA 4L6CA 2GS9A 4S0ZA 2W00A 4B7ZA 1QU2A 1PT8A 1OX6A 3EQ8A 3UHJA 5CFZA 1T6YA 2CEAA 1LK0A 3F9CA 2RGXA 4AZ0A 4QTYA 1JLLB 1I3NA 2UXBB 2OCBA 5DULA 1Z0UA 4A1OA 4UASA 1G1AA 3V4SA 4JBXA 2VYCA 3FXAA 5K2OA 1XMSA 5H3LA 3ABIA 4A0QA 1LPNA 2CWDA 1LJUA 1PR5A 1U8FO 2W2QA 3GY0A 1GLNA 3D2CA 5GY7A 2I7CA 2DP4E 3I9KA 4PS0A 5E4FA 3UWSA 2BFFB 1XTJA 1A5AB 3WNQA 4LZLA 4BNLA 2JJYA 4MK4A 5EE3A 1N2OA 3N0XA 4X1YA 4ZCPA 2KWIA 4MWTA 4KPYA 1LNSA 1W5AA 1Z4QA 2PUDA 4AJLA 3LUDA 5HTKA 3D3JA 5AJUA 3GPIA 2FDRA 4GI1A 3K6SB 4BX9A 1PO7A 3RVPA 1N1GA 2W70A 1GUZA 2YN2A 2GZAA 1Y4UA 1MT0A 4UU8A 4ZK2A 1KSFX 2OV3A 2BM8A 1K7SN 5C37A 2QQEA 1EXMA 2B61A 2J1LA 2Q4RA 3KYCA 5LFAA 4YHHB 1H1LA 3VMMA 1N9ZA 1VKHA 1Y9AA 2BMVA 2NO4A 3OC6A 4HRVA 3N58A 4ME6A 3RVDA 3VOAA 5BQ3A 2VUIB 5J4YA 5CYFA 3AWIA 5IAJA 1ESZA 4EYQA 5KTPA 1YHNA 5E0OA 2RC6A 3SIRA 4MTCA 4TV8F 5D7NA 5DT2A 8OHMA 4GGOA 3B3AA 4E08A 1B23P 2H7VA 3P19A 3ZN2A 2H6EA 1JH9A 4GDFA 4QBFA 4FD2A 4IQ4A 1UMBB 1PU2A 2C20A 4NBVA 3C4QA 1B8OA 2XNDA 3VV2A 3OLCX 4OAOA 4D56A 4EH1A 1RWVA 1L8OA 1WG8A 2OECA 3NBYC 3NTQA 4R16A 4XIYA 4BWFB 2VSYA 1KL7A 2P0AA 4E0BA 2P3LA 5DPMA 1IN5A 3Q3JB 1B14A 1KIMA 3U6BA 4Y1RB 3QKSB 1N2ZA 3HVHA 4O25A 4MKGA 1GARA 2B3TA 3B9BA 3MS7A 4MINA 2FPKA 1Z5GA 2XBUA 3W04A 3WHPA 3KUCA 1VSBA 3INGA 1IY8A 1TA9A 1M34E 3TPZA 2X2OA 1TIBA 2XWSA 3AR9A 3B1FA 4KFSA 4KFTA 1BW9B 2H00A 1GU7A 4JDPA 4LOAA 1GA6A 3HRKA 1AUPA 1T26A 4ZU6X 3G5TA 1QFXA 1W5SA 4MICA 1EUQA 3W5AA 3M9LA 1SCBA 4QOSA 5M04A 3BA6A 3PD1A 5H3CA 2JZOA 4OMCA 3SGLA 4NARA 1QGED 5JEDA 4X97A 5TIIA 3NUZA 3QUTA 2FQ1A 5IM4F 3G8YA 3IDOA 3P32A 1JVNA 1QF6A 2HQSA 2XSZD 3OWXA 3IAFA 3Q9NA 2GAOA 1DC7A 3RKSA 4BEVA 1QYXA 2DBRA 2QRLA 2G25A 2ZIZA 3ZLJA 1DBRA 1WHSB 1U90A 4H6VA 3ANLA 4MVJG 5EOVA 3TW0A 1VJ5A 2W93A 3QKIA 3TW8A 3HDJA 4NATA 4B2PA 5BUZA 1TLFA 5GADl 4KTTE 5ULLA 1V25A 2C1ZA 1HDCA 3DOJA 3MMNA 1UBRS 4HH0A 2C2KA 2AOWA 2ZI5A 4LJ9A 1E4EA 1T2DA 4MQ4A 2Y0DA 3T8YA 2GBIA 5T41A 2JNWA 2NUTB 1FUIA 4HI0E 3HN2A 4ZYYA 1R15A 3EGWA 3PLNA 2Q7XA 2WD8A 4M0FA 2OM6A 4K9KA 5KPDA 3LW8A 1H5NA 4D8VA 4D7AA 2ACKA 4FWIB 3R9KA 2AKEA 3KE9A 1DBSA 1WLSA 1CUVA 3AINA 3FMOB 4HLCA 3SQWA 1EXVA 2EX1A 2GBCA 3WHLA 4BS9A 4DMRA 3F74A 2OFPA 3HO1A 2RAFA 2F1JA 3L7NA 5D85A 5FWNA 1JSRA 5C5DA 1KVRA 2BMFA 2Q1YA 1T29A 4MRSA 2MSWA 1XDDA 5EGSA 2OBXA 5JWHA 3ZU2A 4G36A 3QEBZ 1OTXA 4HB3A 3B9RA 4LYGA 2XOXA 5ALXA 4JEUA 3RI3A 5A9RA 4NBWA 2ZJ6A 3TCKA 3WS7A 4X71A 1PEKE 2C57A 2Q9AA 2VDUE 4AJKA 3ZV5A 3H9UA 1RJDA 1L7RA 2A84A 2GZ1A 1TCVA 3HKCB 1GAXA 3W5BA 1JHMA 4XWAA 5CVCA 5F5NA 4JI5B 4C78A 5AHKA 1LBEA 2QYSA 3TDNA 2ACWA 2Z6QA 6ADHA 3GRCA 4EABA 1DX9A 4CHTA 4D6PA 5BV8A 1FLNA 4QG3A 6REQB 3EZ9A 3HR7A 1A77A 4FW8A 2YHBA 4A6EA 3OQNA 4LXHA 3QV2A 4DJ5X 4N47A 1L1RA 2BDEA 1RYDA 1E2MA 2A6PA 2XGMA 2PKXA 5CTJA 3C6KA 3UO8B 3IHLA 3BRCA 3JXEA 2CLLB 5I5GA 1F0NA 3ZXSA 1TTQB 2IELA 3QE0A 5IKOA 1UPBA 3AKEA 2REQA 4X1OA 2J3HA 1HT2E 4QGGA 2JASA 3H1TA 3S5UA 1M5TA 2F3UA 1PS8A 1C4WA 5FTWA 2EFEB 2OESA 4HCJA 4TROA 3GJ8A 1WAMA 1B0AA 3DMRA 1R1DA 2P30A 4CHGA 3HBMA 9ABPA 3NM4A 3D59A 3VHXB 5KYWB 3FVVA 3K9HA 2M1XA 3S55A 1Z28A 2HWYA 2IZ7A 4L76A 1INLA 4PVDA 3SS8A 4ZQBA 3NPAA 5BMVB 2FI1A 2PWPA 4PPGA 2JJ2D 1MOPA 2I55A 2JL1A 3NWJA 3OEHA 1MB3A 3W5VA 3RYCB 4HVCA 3V3TA 4FJ2A 1IATA 2XTJA 5J1SB 4FJ0A 4W8HA 4F6LA 3E70C 3EQ9A 4V2IA 2O07A 3EZLA 3EDCA 4AB1A 1ML4A 2OHOA 3VJRA 3F6RA 4ZP1A 3QF7A 3DCIA 1XXHA 1FJHA 5J4LA 4MGKR 4NBSA 3DOEA 1KJNA 1SN7A 2SNIE 3I6YA 3MWLA 3NRJA 4IXTA 3GCWA 4NFLA 3GLVA 1U1EA 3WAGA 2C8VA 4L95C 1NE2A 2AEFA 2ZDHA 2HV8A 3OM1A 4H35A 1KYXA 2C4MA 3K1AA 4J76A 1R37A 2HH9A 2RK6A 1HZZC 3IJEB 3FPJA 4PSDA 5DGCA 5F4BA 5J5AA 2QW1A 1Q21A 1XEXA 3CZPA 3SF8B 4F3KA 2VTKA 3HEAA 3W79A 5C18A 4YT8A 2Z2YA 1GM5A 2B7CA 1IN6A 1L6IA 3OPMA 1ADFA 4QULA 5ICFA 5ITSA 1Y7PA 4YJ2F 3ZWVA 5IJZA 4ZHQF 7AT1A 5EG5A 2B92A 1GR1A 3QLEA 2FPSA 4GMFA 5KWJA 2D1RA 2G1UA 5A5GA 4E88A 1CQWA 2ZJ7A 4RDHA 1TQ8A 2AG0A 2I2AA 2OXRA 2PZGA 1N4AA 1KRWA 2OZPA 1WO8A 3ID6C 4IDBA 2WUEA 4Q4DA 4RQBA 1J2RA 1HTTA 4DMMA 4DLAA 1GGHA 2ID4A 3LPLA 2BI8A 4UU0A 3T9DA 4B4VA 5CPBA 3UB3A 1CQXA 3IL2A 3JZMA 3O91A 4N18A 5KTYA 3B1ZA 1PJBA 4WZZA 4Y2HA 3RJZA 3EXAA 2A59A 3TOCA 2FPOA 2NNWB 3L79A 4HB4A 4U2EA 3F5DA 4WK2B 1ZA1A 2NX2A 4OOEA 3M7IA 3WXMA 2GHRA 5IPFA 4GQIA 4EY3A 4BNTA 1OWPA 2J45A 2VTDA 3UJNA 4RTOA 3IUPA 2AFIB 2JEZA 2PJUA 3K5HA 2HBZA 1DQYA 1R5JA 2E4UA 3PEEA 2QGNA 4G4SP 1WP9A 3PXEA 5I9LA 3P9QA 4LJRA 2XBMA 1ZVMA 3COZA 3NWOA 3QEMA 2GVDC 3CB2A 4YUWA 1FMFA 3MHPA 4JLVA 4WDQA 1IZ9A 1IH8A 5JZBA 1Z5ZA 4QDZA 4OHFA 1HWYA 3QIAA 1ZNWA 1Z29A 1ZOIA 4R8KA 2EX4A 4QRHA 4E11A 4FB5A 3MMXA 5LA6A 1J2TA 3K94A 4IP0A 3SR3A 1C8KA 4RESA 2CSXA 3UB4A 1YUBA 1OXTA 1VMAA 1OQAA 2CXRA 3BTVA 1BAPA 1O9BA 1Z2CA 4INJA 2YN4A 3PPIA 4MVJH 1SHZA 3OQHA 2C5HA 4OQFA 4BNXA 2ZIFA 4P7JA 1PW5A 3U2QA 1O0BA 4FN4A 3U1VA 1KJIA 4B0PA 4N6GA 2ZVQX 5JYDA 3OJFA 1ZN9A 2Z3ZA 3CVOA 2GQ0A 4KRYA 4DBZA 4O4HB 4M46A 5J2UF 4ZZ2A 4KXMA 3J81k 5FPPA 1V8DA 4DG8A 4QG7A 1O8CA 4FUTA 5JRJA 4H6WA 1T34A 3R8XA 3U3ZA 3M6FA 4JUDX 4ID3A 5FNVA 1E92A 4B44A 5ENZA 1E32A 3HNPA 1ADGA 2ZU6A 5F76A 3W77A 3EDQA 3JATB 3WHKA 4B3HA 5A4FS 3VR2D 2ZWVA 1E2LA 4QEZA 3EISA 1ZW6A 1OKKD 4ITRC 4YIKA 2WM9B 4DWVA 4KHPB 4Z2YA 3ZHZA 1YB5A 2ZETA 1C4OA 3F6SA 1LV7A 2IVFA 3NT5A 4JSTA 5BR1A 4M83A 4CIYA 1SXQA 4O2AF 4PLHA 5DF1A 4EGFA 3AI1A 1SK9A 3Q11A 2JC3A 3VZRA 5CX1B 3FCXA 3BMNA 1THZA 4HDRA 2A9QA 2DECA 2DYKA 1UMKA 3IILA 4R1SA 1YZYA 4BO0A 1M8JA 4Y6SA 3TO5A 4RV4A 1VBFA 3KJXA 3SC2A 3VPAA 1U0TA 3RSFA 3WIVA 3IS3A 4R0MA 4FNGA 2OO7A 2O2DA 1E3IA 2VA9A 2H11A 1DWUA 2HK6A 1QHEA 2IXFA 3RS7A 2DUMA 2VYVA 3OEWA 5I9MA 4QUHA 1JHQA 1VHQA 3OLZA 1QAMA 4OB6A 3VKUA 3U1BA 1Q7BA 1F60A 4KAJA 5IUNC 3QTTA 2P6UA 4QT4A 4BXOA 1TCCA 1W30A 3GEPA 2Q8QA 3PYXA 1ZCJA 2WFAA 4XJSA 2Z9CA 3QIVA 2Q4TA 5K8TA 2QSJA 1SVNA 3N7UA 3ZE6A 5C51B 3MOGA 1DRJA 5KBYA 3VO9A 3WKDA 3WYAA 1IYZA 1N6IA 4XJVA 2IP1A 2IYOA 2X9NA 3GL9A 4CKYA 4YRAA 3TZKA 1GGJA 4TLBA 2GEBA 2NTNA 1O6GA 1Z4IA 4TRNA 4YRZA 3EPJA 2A5GA 3OSUA 3O26A 1W6UA 5F21A 2NUPB 3R75A 2IYWA 5HJ7A 3TQTA 4MMXB 1FIUA 1MC4A 1VPLA 2OE2A 4UE6A 4HAWA 1D4ZA 5CTAA 3NAQA 1RVV1 4J16C 3HO6A 4EHAA 4OXXA 4NI5A 4PF1A 1U2TA 1U0EA 5CK4A 2FEMA 3WGTA 1M2EA 1Y1RA 3GMDA 1XZLA 1IEXA 4PTYA 3FCYA 2BR3A 4I9FA 4IDFA 1ZHHA 2UUBB 1GZSA 1Y9JA 1ZH6A 2Q50A 2RI0A 2ZYSA 1XELA 3L6CA 3EIXA 4R9SA 3U7EB 2FEAA 4UHDA 4MB6A 4RFLA 5JXJA 4QUKA 3BSSA 1M34B 3K09C 5A62A 2FF5A 2R8RA 1JHZA 4B3TB 1OH7A 3H7AA 3HB7A 3Q15C 2RH4A 2XUJA 1E59A