4XX0A

Coa bound to pig gtp-specific succinyl-coa synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
303
structure length
303
Chain Sequence
b'SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
molecule tags Ligase
source organism Sus scrofa
publication title Structure of GTP-specific succinyl-CoA synthetase in complex with CoA.
pubmed doi rcsb
total genus 113
structure length 303
sequence length 303
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xx0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xx0A01
4G2NA 3NUGA 3IP3A 1NVTA 3ZI0A 4DC1A 1FDTA 2EV9A 3GNSA 2EEZA 4Y98A 1P9LA 2Q1SA 4L0QA 2Q4EA 1LDMA 4ALMA 1UDAA 3ORFA 2JHFA 1GY8A 1JWAB 1PTJA 2RIRA 2IZ1A 1Z73A 2FPGA 2EW8A 4OGWA 4CV2A 2IODA 6LDHA 1UXJA 1JWBB 3U4IA 3KEQA 4RPGA 2J6IA 4NIMA 4U6QA 4CMJA 5BNIA 5G0TA 1P1FA 5L4NA 3WX0A 4R5HA 1YB4A 1NAIA 4YJFA 2VUSA 3NT2A 4QT0A 2A92A 2FP4A 3CEAA 3HB5X 3RI3A 1JKJB 4AG3A 3JD4A 5JW6A 5HTOA 3PQEA 2AE2A 2WYVA 1H9AA 1WPQA 3K6JA 4LRSB 4JJFA 2YQ5A 4J1TA 1YDWA 1SCUA 1O95A 4J2HA 1U3WA 1EUCA 4DLBA 3GHYA 4MP6A 1W0CA 3OICA 4G81A 3RBZA 3LLSA 4AJHA 1ZFNA 3ZNPA 4MKXA 5A5EA 5DDIP 2AQKA 2Y05A 1GR0A 1LA2A 3A1NA 3FR7A 2P68A 3KTDA 4DMLA 2AG8A 2OGUA 2O7QA 3MJEA 4PVDA 3WFIA 4AFNA 3IOYA 1KC1A 1JLLA 2RH8A 1T24A 3DMTC 3HQ4O 1PGJA 5AXCA 3ANMA 1PJQA 3PFFA 5ITWA 2YHIA 1SCUB 5DNAA 1SEPA 1H94A 1UXGA 4NG5A 1DHRA 4UEKA 3GUYA 3GPIA 3F9IA 2AEJA 3HDQA 4FC6A 2V6FA 2E82A 4M49A 4I5EA 5DOVA 1GZ3A 4CPDA 3CZMA 4XDZA 1HDYA 3GR6A 4NBVA 3ZGYA 3OFSA 4PRKA 3H7AA 1LEHA 3M6IA 2ZIZA 4WCDA 4IM7A 1VJ0A 3BMQA 3GGGA 3OQ1A 5IXSA 2H5LA 1KVRA 5C5IA 1Y8QA 2ZCUA 3D5TA 4UUPA 1RM5A 1Y9EA 2X9VA 3NX4A 4N7RA 4NK5A 3A28A 4FS3A 1ADGA 4JROA 2XOXA 3GEDA 3H9QA 2A9FA 4Y8VA 3RKRA 3BHJA 4YBZA 2JD1A 3AFNA 4Q3DA 2HDHA 4EJ6A 2IXBA 1AGNA 1DEHA 1I01A 4XCVA 3PPIA 1O94A 2X22A 1ZK1A 3LQFA 2VHXA 4GX5A 3DZJA 2Y93A 4ITUA 3PGJA 1RJWA 3RD5A 3UHAA 4A5OA 1DIAA 4BNFA 3COSA 4FBGA 1IPEA 2W2LA 2O23A 1PQUA 4IDEA 1HLDA 4JXKA 4I5DA 2QYTA 1DO8A 4FC7A 3HDHA 3WNQA 1MXHA 3GEMA 5L7WA 2PD4A 4YYZA 3GFBA 3WSVA 3U62A 2WEKA 4TQGA 1PZFA 2NU8B 3OP4A 3PVZA 1P77A 2V6BA 3MOIA 4Q3BA 4ZHSA 1PU2A 2EP7A 3E48A 2A35A 4BO1A 1Z74A 3PZRA 4KUEA 4TVOA 2PNFA 3JSAA 1OFGA 4KTVE 1T2DA 5KWEA 1YKFA 1BMDA 1ULUA 4XKJA 2W98A 2NU9A 4PG5A 4YAJA 2ZYDA 4XIYA 4JBHA 4QX6A 2GR9A 3AM3A 1I2ZA 1NFQA 2EW2A 3AY7A 1XR3A 3PHHA 1I33A 3PIDA 3AOGA 1QV7A 2C5EA 4HWKA 5EINA 5KJ1A 3WBBA 4XQGA 1NX6A 2EP5A 4FJ0A 3OQ6A 4DREA 3P7MA 3QVSA 2Y0DA 4HFMA 4ALNA 4K9DA 1Y5RA 4XB2A 3ABIA 3W8FA 1D3AA 3VZRA 3R3JA 2FR0A 1AN9A 2HMSA 4OHUA 4P4LA 1XEAA 3GT0A 2EKQA 3JQ6A 2NUAB 5BNFA 4HKTA 4BUCA 1JU9A 5IDYA 3H5AA 3EVTA 3M1AA 4GI2A 1DDOA 2D5AA 4LMRA 4NJMA 4E21A 4A7PA 5IXYA 3HG7A 1HETA 4BQRA 1GUFA 1U5AA 1EE9A 3JQGA 3N74A 4C7KA 3C24A 3AU8A 5IDXA 1ENYA 5FFFA 3NEPX 1IB6A 4N5MA 4BKQA 2ZJ0A 4TKMA 3C7AA 4BGIA 1EVZA 1YWGO 1KY5A 4XA8A 1BXGA 4DMMA 1UP7A 5G0VA 2C2XA 5MGBA 3QIVA 3TZ6A 3EGOA 5B4UA 1A4IA 3D3WA 4BNHA 3L77A 3TDKA 4AJPA 1I24A 2X6TA 1E7SA 3JQ7B 1TVEA 2D3TA 4ZA2A 5CFZA 4P4NA 2OO5A 1ZBQA 2O3TA 4GKBA 1E3WB 3BMOB 3AI2A 3INGA 2VQ3A 3OSUA 3VPXA 1PWZA 2EGHA 4AICA 4BKOA 1Z7EA 4OXNA 4GSLA 4YA6A 1Y1PA 3QVOA 3ETDA 4NI5A 1I3MA 1DBVO 2VHVA 3D3EA 1BXGB 3DZFA 3DMTA 4FGWA 1YGYA 1DRUA 3RC9A 3KETA 2W2KB 4C4OA 1E3EA 5ER9A 2OFPA 1DLJA 1I36A 2VUTA 2Y0EA 4M86A 3ZNQA 2Z1NA 3IJRA 1JKFA 2FMUA 4DVJA 2C29D 3KLMX 1G0NA 3TJRA 4XX0B 4D43A 4U5QA 2R6JA 4INAA 3DOOA 1E5QA 4FCCA 2C59A 4A10A 3DMYA 3WYBA 1D8AA 4GKVA 1C0IA 4IS3A 4O0LA 3RIHA 4WEOA 1K3TA 1UP4A 4U0KA 2OHXA 1R0SA 2JCVA 2NADA 3DAFA 1E7MA 4RDIA 2A4KA 1TXGA 1JVSA 3GN2A 3F1KA 1ZK4A 3JQAA 4MINA 5HM8A 1R66A 4DXHA 1QXSA 5TF4A 1V3UA 3RC2A 4MVJD 1E1LA 2PKQO 3HJAA 5ENVA 1LLCA 4XEHA 4Z0PA 4U0JA 4CM7A 2IZ0A 4CR7A 1KETA 5JAQA 3HZZA 2I99A 2TMDA 3OJOA 3ITDA 2X0RA 5L40A 5KNLA 1E3IA 2AXQA 4R1UA 3K9QO 4WOKA 1GL3A 2WWRA 3H8VA 4NBTA 4OSPA 3VDQA 3ZWYA 4KQXA 5TT1A 1PJTA 1XIVA 3S8MA 2WSBA 3CH6A 5DP2A 3WB9A 3IUSA 1J0XO 4LVUA 3RSHA 3QY9A 4OKNA 1GZ6A 1ULSA 4HFRA 4WLFA 4NBRA 3A4VA 3GMDA 1Q0QA 1EQ2A 3S2FA 3BAZA 4OXYA 2NQTA 5JAZA 2GN4A 3H2SA 2PLAA 2X8LA 4J0EA 1P3DA 4XYMA 3GQVA 4B79A 3ZNNA 4BB6A 5K0ZA 5B4VA 1H0KA 1KEWA 2HK9A 3H3JA 1KVTA 3B6ZA 4IGEA 2QG4A 2E6UX 4OOEA 4D3SA 3TZCA 1E5LA 5EESA 5CHEA 1HDGO 1QYWA 2IYOA 1R6DA 4EJMA 5GMOA 4XYLA 3PHIA 5T57A 2P91A 3TOZA 2BF7A 1RYDA 2V6MA 1R15A 3M2TA 1KY4A 4A26A 5CEJA 5JDIC 2GCGA 3WOHA 4CQMA 4M55A 4NFYA 4IIUA 3FBGA 1C1XA 3X2FA 2WE8A 4WNCA 1ZMOA 1RKXA 4BMNA 1DJNA 2CVQA 2GYYA 2QZ9A 3SXPA 2PZLA 4NJMB 3I52A 3CINA 2E49A 2RAFA 2FOIA 4L9RA 4E31A 2ZYGA 4FJ2A 4R1SA 3GUCA 4N54A 4AVYA 3JYLA 2X7HA 1ISGA 2CFCA 4MVJG 1RPNA 1XGKA 3ZU5A 3GF4A 2CDBA 2X86A 4B4WA 2Y68A 3EYWA 1A7KA 2VRBA 4WE3A 1DB3A 3D1LA 4DBZA 1HDRA 2G17A 5CEFA 2RHRA 3OJFA 3OBBA 1AE1A 1T2FA 4OXKA 5TNXA 3CKYA 3JQFA 3HADA 2IYPA 4YT8A 4R4JA 4IXWA 4EGFA 3DFZA 2VHWA 4ND5A 5FI5A 4AL4A 4D3DA 4E3ZA 8LDHA 3ZV5A 4DLAA 4B3IA 1N9GA 3CIFA 2UV8A 2AE1A 1GZ4A 3UF0A 3W6ZA 4FFPA 5KVSA 1E7QA 3TNLA 1YDEA 3KYCB 4O59O 3Q2KA 2R00C 1LDEA 3NV9A 3OIGA 3R0IA 4UVEA 4BNZA 1NFFA 4TVBA 2I6TA 4LVCA 4IUYA 1NR1A 4QFCA 4W6ZA 3OH8A 1SAYA 2BELA 2P4HX 4IJWA 2JCYA 5G0UA 4WNIA 3L9WA 2BFPA 1VPDA 5CDUA 4FFLA 4HBGA 4RLSA 1YS4A 4IINA 3EDMA 2QYSA 4FIZA 3TL2A 1EBUA 3TF5A 1E3SA 4Y6SA 1E1KA 1V35A 3D64A 3VPHA 2IDZA 5T67A 3L0DA 3KYCA 1MG0A 2VRCA 1BWSA 1DAPA 1A27A 1IHXA 1PZHA 2GN6A 2RH4A 1WZIA 4M87A 4DQXA 2C0CA 4PG6A 1GU7A 4AJKA 4HUJA 1X1EA 3WXBA 2ZTMA 4A73A 3DZKA 1U3UA 4R41A 1WP4A 3GVCA 2HK8A 2NSDA 4NNJA 1JVBA 3RFVA 4CMGA 1P1KA 2AG5A 1OOEA 4CLOB 3I9OA 4JP2A 3VDRA 4F46A 2ZB3A 3WQSB 2NWQA 3ONFA 5I7EA 2UVDA 5COAA 5EL0A 5F1OA 2NVUA 1D4FA 3AFMA 2GPTA 4P38A 2W8ZA 1DIGA 1QSGA 4R9RA 4YJHA 2GUGA 2VHZA 1SBYA 1ZSYA 4C7JA 1ZJZA 2HMTA 4H7PA 5LCXA 1A71A 2XXBA 3RAJA 4CM4B 4D0SA 2UUOA 1HE4A 4U7WA 5CAEB 3WS7A 2DT5A 3JTMA 4XWYA 1X7HA 1CF2O 5AQ1A 2BI8A 4EEZA 3VH2A 3GAZA 1O9BA 2IEBA 1OZAA 4YXFA 2RCYA 4BV9A 4R1NA 1IULA 4WEQA 2FR8A 5ILGA 3WIEA 1AXGA 4XYBA 4HNGA 2TMGA 3VH1A 1G1AA 4M54A 3DTYA 4RCVA 5G4LA 1GD1O 2VT3A 1IOLA 2ZYAA 1TA4A 3PGXA 2ZTLA 2C07A 1NQ5A 3W4KA 4B4OA 5JC1A 1P31A 1P1JA 4JN6B 5I9NA 1PJ2A 5FF9A 1NASA 4XIJA 4IDAA 2SCUB 2YFQA 4J4TA 3JV7A 4HNHA 4A03A 4ZRNA 3ROQA 1PL8A 2O3SA 5CP8A 1VI2A 3BTUA 3DBLA 3JD2A 5BSGA 1DFIA 2J3HA 5HS6A 3GNTA 2Q4BA 2B37A 5U4QA 4E4YA 3ZWOA 4QXMA 1MX3A 1ADBA 5DT9A 4CM8A 3L6DA 1F17A 2HU2A 3MJTA 3ZV3A 3PJGA 1EFLA 3RKUA 3TSCA 5ICMA 5HS4A 1M6HA 4Z3KA 1KVQA 2IEDA 3I1JA 1FDSA 1QKIA 4L74A 1P45A 3BTVA 2CDAA 4MDHA 4QQRA 1PR3A 2Y1GA 5KVVA 3I3OA 1MXFA 4MIYA 1ML3A 5ADHA 4BKRA 2NVUB 1DIHA 4J1QA 2EJWA 2YHUA 3S2EA 2O7SA 2FPIA 4E5KA 1JW9B 3E9QA 1ZO8A 2DPGA 2Q46A 3HUDA 5BSEA 5DCWA 3C3XA 3WIDA 5TX7A 5BSFA 3T4EA 2VZ0A 2O3UA 3OA0A 1CERA 2DTDA 4GGOA 3ETGA 4J2OA 1I10A 4WLNA 2ZTVA 3AUTA 1OI7A 3RC7A 4Q3EA 2JFGA 1TI7A 2QRJA 5B12A 4Z9FA 1P44A 1A72A 3D5QA 1B14A 1HTBA 3GVXA 1ISIA 1UH5A 5I9LA 4I08A 1JKIA 3UFXB 5ICSA 3Q2IA 3PQDA 2GRAA 1IZ9A 1GFSA 3E9NA 5U1PA 3VH3A 2QHXA 4KDEA 3UXYA 4L76A 4R5MA 1BXKA 5TSDA 4BKPA 4UUMA 1UXIA 3L6EA 3RUDA 2BFAA 3UCEA 4BO9A 1T4BA 4QO8A 2X5JO 4BNKA 4N18A 1SB9A 3QVWA 4Z9XA 2VNAA 5HA5A 3GDOA 4WCFA 2GZ2A 5A04A 4ZQEA 3JQEA 4UEJA 2O50A 1PGQA 1Q7CA 2FR1A 3E1KA 1PL6A 1SPXA 3I9LA 1ISFA 3MJVA 3SLKA 3LDHA 3MWEB 2OP1A 4CUJA 1M76A 2AQIA 2NTJA 4TRMA 1RYEA 4E32A 4OQYA 1K89A 1VE9A 3DHYA 4JQCA 4BKUA 3NAQA 2P9CA 3LSYA 4WASA 4LCEA 4R69A 5T5QA 1KEUA 2HMUA 4WK6A 3TQHA 2EKPA 2XPCA 3WGQA 4G5HA 2WYWA 3AOEA 4ID9A 1NQAO 2WJPA 2ZB8A 3GDFA 3F1LA 4ALLA 4IDFA 3LC2O 5TS3A 1NTOA 3DZBA 1CDOA 3QA9A 2PZMA 3HB4X 3PLNA 1I8TA 3D4PA 5A1TA 4TRRA 4GVLA 4UEOA 2X5KO 4IQ0A 4YJDA 1N5DA 1CQJA 3I9MA 4KUGA 4II2A 4PLCA 1ZJYA 4NH4A 1HYEA 1ENPA 2VWQA 1IPFA 4IMRA 4RF3A 1ENZA 3KYDA 2J5QA 1UDCA 5JMWA 3V5NA 2DFVA 3L4SO 3R1IA 1F06A 4FB5A 4RLHA 2FPGB 1K6JA 2RHCA 4ZD6A 4L8VA 3ZH2A 3WMWA 1VL0A 2X9GA 4PIVA 4XR4A 4FJ1A 4YQZA 2NNLD 4DA9A 2JAHA 3W8DA 3CUKA 1ZIDA 3DHEA 4W82A 1YXMA 1LQTA 5DBGA 1T2AA 1VKNA 3CE6A 4CR6A 4FFOA 1U2DA 4JBIA 2YV1A 4PLGA 4R9SA 5F1KA 3PRJA 3AI1A 3KLPX 3ZWPA 4A2CA 5EQDA 3QVTA 4GMFA 3KB6A 3E5RA 3JD0A 1IYZA 3WLEA 5G4KA 1FF9A 1VSUA 3L4BC 3DR3A 2C7VA 2ZB7A 3LK7A 3SC4A 3KOUA 1ADFA 4MVJP 5IN4A 1B16A 5GZ6A 4CMKA 1V3VA 6ADHA 5JS6A 5DP1A 1J49A 1YO6A 3QWIA 5I7FA 2CF6A 3RJ9A 1U2GA 4YRDA 5JY6A 3H4VA 1YB5A 1EVJA 3QV1A 2J8ZA 4JP3A 3V1TC 1ZXLA 5L53A 4CM1A 1ZSNA 5AOVA 3VTFA 1BSVA 2YHIB 5L45A 3NKLA 3JQ9A 4YAKA 3AM4A 1R0KA 5GY7A 2CVZA 2UUPA 1QR6A 2FPIB 1R4NB 3EHEA 5EMHA 4AJ4A 4DGSA 3GZNB 2EG9A 4BO3A 4CMCA 5GZ3A 1E0DA 1YL6A 5A4DA 4QEDA 3B20A 3C7DB 4YJGA 5C7IO 3DBLB 1E92A 1DXYA 1BXZA 4F6CA 4PLZA 3IAHA 1GEEA 1RM3A 1HE2A 4YJHB 4CMBA 1M2WA 5KKAA 1DSSG 3BTOA 2B4TO 2OP0A 4U6SA 3E03A 4XJTA 2YFHA 2Q1UA 4QO7A 1LUAA 3GEGA 4HFNA 2XAAA 3WGYA 4CLEA 5EJ2A 2BRUA 3K2BA 3GY0A 4CJXA 2CSUA 5JPIA 3D7LA 2P5UA 4ZRMA 1TB4A 4K28A 4UUNA 3JQFC 1WNTA 2HUNA 1BRMA 2W2LD 2FPPA 3G1UA 3PLRA 3WDSA 2DBZA 3D0OA 5B1YA 1YVEI 4W7IA 4XYEA 1LDNA 4JX8A 1O8CA 3H9GA 1C1DB 4Q9NA 1LSSA 1GQQA 4X54A 2OZPA 2O3QA 2B4QA 3H9EO 4ESOA 2DVMA 4YEDA 1LLDA 3B1KA 1ZKMA 4XGNA 1CEQA 1Y5MA 3BMCA 4KWIA 4XQEA 5C7LO 1I32A 1PR9A 4O63O 1PGNA 1QYCA 3OM9A 4J3FA 1DOHA 1LJ8A 3QWAA 3GG9A 1PIWA 3WG9A 4YJFB 4BIIA 3L6OO 3IP1A 3WGZA 5HWSA 3F47A 4KDFA 5TIIA 1IY8A 2X5OA 3PTZA 3TFQA 4AJJA 1LSOA 2YUTA 3MJSA 4E0BA 1C1DA 1YH3A 4HP8A 3VTZA 3ULKA 4R01A 4ALJA 4BO0A 1X14A 3ITKA 4LRTB 4YTEA 4GH5A 4JNKA 2ET6A 4IMPA 4ZQHA 5TQVA 4D42A 2FY8A 4ZICA 5KOIA 3FTPA 2CNBA 1EUZA 1KBZA 2P9EA 3PIIA 1JDJA 1NAHA 1DRVA 4RQUA 4HADA 4B4UA 3JD3A 3OJLA 1I2CA 4MIEA 3HDYA 3G17A 5BQFA 1V6AA 1PJCA 2HJRA 4MIOA 1KEPA 3RQSA 3ONDA 1KVSA 3NDRA 4XYGA 4Y67A 4XRGA 2YQ4A 4P4GA 3ZZNA 3GH3A 1LQUA 3GK3A 2C54A 2HQ1A 3DTTA 1HDOA 2PWZA 2VN8A 4QUKA 2Q1TA 3D3WB 3MJ4A 1V0JA 4JJGA 1XHLA 3I6QA 1R0LA 5U9CA 1R16A 5HRUA 3IIEA 1HDCA 4D3FA 1F12A 1KC3A 3QJ5A 1B8UA 4UVIA 4E6PA 1QP8A 3GNQA 3Q0EA 4NZ9A 5DBFA 4O5OA 2ZB4A 1VM6A 4PRLA 4CV0A 4DYDA 2UAGA 1TEHA 5JDCC 2B36A 3KYDB 5THQA 3VZPA 5T64A 4E2XA 5TLSA 4RF2A 3RROA 5H82A 2J3KA 3F4BA 5CDTA 3I9NA 2PD3A 2VWPA 1Q0LA 2VTEA 1O0SA 4J43A 4TZTA 3MWDB 4MKZA 4BNTA 4DTIA 2WE7A 4ALIA 4TKLA 1C0PA 5IG2A 4YT5A 4AJNA 4R68A 2NLOA 1AUPA 1NM5A 4BO6A 4EJ0A 1WMBA 1NR7A 2D2IA 4KWHA 1U4SA 3RBVA 5A03A 1NBOA 2FSSA 5B37A 3ZWAA 1F14A 1KIFA 1XQ1A 3AUSA 4J7XA 4CLXA 4J6FA 4WLUA 4BOYA 3RCBA 3QVXA 4JIGA 2NVBA 5JC8A 4BV8A 1B7GO 1XKQA 2Q2VA 4E5YA 4IDCA 5L4LA 2Z1MA 3ZV6A 2D4AA 5EERA 4EITA 3AM5A 1G0OA 1QMGA 3IL2A 3GDGA 2FP4B 1RM0A 5LDHA 2YV3A 3ASUA 2GN9A 1LDGA 2GD1O 2PK3A 5IDWA 4GMGA 3KO8A 3NT4A 4PLHA 1L1FA 4PG8A 4QFDA 3N7UA 1GADO 4B3HA 2JFHA 3IKTA 1H2HA 1ADCA 1XU7A 4PZEA 4UREA 4CLRA 1QYVA 3BYZA 3JQBC 3LC1O 2C5AA 4WLVA 3TRIA 4IQ8A 3JQAB 3VVBA 3FCOA 5EPOA 1T26A 2OXIA 3QSGA 4BNGA 2VWHA 3JYNA 2FPPB 1UDBA 3KSDO 2PTGA 5TT0A 4BS9A 1B15A 4A27A 4RVUA 4FQ8A 3ROPA 5A9RA 2ZQZA 4KP7A 1BW9B 4NFHA 1I3LA 2WD7A 4J4BA 4EDFA 4J9VA 1HSZA 1U1IA 2Q3EA 5DCUA 5JAMA 4FGSA 3ZV4A 1U3TA 2EGGA 1YBAA 5TRTA 4ALKA 3KUXA 3S1LA 3GVHA 4XDYA 2QW8A 4J0FA 1UAYA 4YAIA 4LN1A 4GGPA 1GPDG 1I30A 3AUUA 3DBHB 5DBIA 1MG5A 1E77A 3KYBA 1K6XA 3KSZO 4CM9A 9LDBA 1PS8A 2DTXA 1B8PA 4BNMA 4P8RA 3PHJA 1ZH8A 4D45A 4EBFA 2BGLA 3PHLA 1Y81A 4LSWA 1V8BA 2JCXA 1CQJB 4RJTA 1HE3A 2BKAA 2QRKA 3FNEA 3ZU2A 1T1RA 1XG5A 1SO8A 4FFRA 4NU5A 1YL7A 3KHUA 1CRWG 1YRLA 4ZN6A 3QE3A 4D46A 1O6ZA 1Y8QB 3RJ5A 4U8GA 1N7GA 2VYNA 1FDUA 1R37A 3ON5A 4OJNA 2PGLA 3JQ7A 4YCAA 3LC7O 1PZGA 5G2OA 2NUAA 2I67A 2P4QA 4Q3NA 4RVDA 2PKQP 1U9JA 2JKVA 3EZLA 1B2LA 1X7DA 1F8GA 2H63A 5KTKA 3F5SA 4O1MA 4W99A 5BNTA 2DKNA 5J23A 4D0RA 4N5NA 5KIAA 2PH5A 1W8DA 3Q6IA 1X13A 5CDSA 4HY3A 5A9TA 4J91A 1GPJA 3F4LA 4RZIA 5BSHA 3R3SA 3WGOA 2VWGA 1NYTA 3I9KA 4IZIA 4OM8A 4Q39A 1ORRA 4NBWA 3CMCO 1H93A 1VRWA 4BO8A 5JCJD 1ZEMA 3KEOA 4RVHA 4S3MA 2BHLA 5I8WA 3BIOA 3VHRA 4M8SA 3TL3A 4PLYA 1WDMA 3WNVA 4OSOA 2D59A 3QW2A 5MDHA 1V3TA 1IE3A 2GF2A 3GZ4A 4BVAA 3FNFA 1UUFA 1KERA 1DIBA 3MTJA 1X1TA 1HYHA 4GPD1 3G79A 3F5QA 4QSMA 3ST7A 3RASA 2I5PO 3HN7A 3A06A 4IIVA 1NVGA 2O2SA 3O38A 1C1XB 1FMCA 1LLUA 5L9AA 4BNJA 5EQFA 5JCJA 3OA2A 2YW9A 2GNAA 4YR9A 1R4MA 4RVGA 2VYVD 3ZN2A 2BFMA 1X0VA 1GYQA 3WGGA 4BNYA 1FXSA 4GLOA 4FOSA 3JYPA 3BXXA 3QQPA 4MKRA 5T8KC 4YRBA 3HWRA 4DQUA 2FHSA 1VC2A 1D1SA 1FK8A 2O4UX 4UAGA 1WDLA 3ZWMA 4ND3A 4LISA 4ZU3A 4Z3DA 3PHGA 3E8XA 1NWCA 2GZ1A 4CV3A 1X0XA 3LT4A 1XELA 3BZUA 4ZJUA 4XZ3A 4RL6A 3TZQA 2GN8A 1J5PA 2WDZA 3HFSA 4MP3A 1WAMA 2HKIA 1U5CA 1S6YA 5BT9A 5COBA 3RU7A 3DAPA 1Y6JA 1TT7A 2D8AA 2DPHA 3OJEA 5AVOA 1GEGA 1N92A 1H5QA 2VZ8A 3BMCB 1YB1A 2H9IA 2Q1WA 4H3VA 2HO5A 2I66A 1ZUD1 1UR5A 3JYOA 5A5FA 4K26A 4RQTA 3UAGA 3Q3CA 4XRRA 3L4BA 3LZ6A 5I9MA 4JJIA 4BNWA 1LXCA 4J90A 4OAQA 3MWEA 2X0NA 3R6DA 3WBFA 1SC6A 3IQDB 2HJSA 1ZSVA 3JCZA 3WLFA 3WWZA 1U7HA 4BO7A 2Z5LA 2VUUA 2W4QA 2Y1DA 3IJPA 5JFOA 3AI3A 1QYDA 4NHEA 3DL2A 3OIFA 1QV6A 2QX7A 2YY7A 1HRDA 4MVJM 4AJLA 2F1KA 3DZHA 3DZIA 3PJDA 4PCVA 1A5ZA 1LX6A 3OMLA 4DLLA 4YT4A 1YQDA 4JGBA 3V1YA 1EEHA 2BFOA 3NGLA 3LYLA 1C0LA 3U4CA 1B8VA 3V2GA 3ANNA 1GTMA 1E7RA 1GV1A 1B26A 1FJHA 2PA3A 3LF1A 3DEYX 1ZW1A 3Q9UA 3DO5A 2I3GA 4CMAA 3O9ZA 2DU8A 4GX1A 4L4RA 5DOZA 4OKIA 4DWVA 2CUKA 1UZMA 3HHPA 3ZNOA 5THKA 1BVUA 4DIBA 4E2YA 1QG6A 2EXXA 3O03A 3E5MA 1GCOA 1DC4A 3AWDA 1ZK2A 4TRNA 4OQZA 3SX2A 4JCOA 3K8ZA 1KS9A 1P1HA 1M66A 2X9NA 1EZ4A 1UZLA 5ILOA 1NQOA 2G5CA 3TZHA 1KEVA 3X2EA 3UGKA 1CWUA 3FBTA 3CTMA 3HNPA 2CD9A 4E30A 4PLTA 1ZXBA 3PWZA 4RPHA 1BVRA 4R51A 1I3KA 2CF5A 4HFJA 5CPFA 4IDGA 4YVFA 1Z82A 2AQ8A 3SJ7A 3DOJA 4OOFA 5DF1A 2HRBA 3U9LA 3ZHZA 2GZ3A 1XA0A 3VAZA 4B8ZA 4PGFA 5CDYA 2ZTUA 2DLDA 2PV7A 2H6EA 2ZKLA 2I9PA 5TJHA 2VOJA 1ZEJA 2Y0CA 3EK2A 5TJ9A 1ZCJA 2HMWA 1WMAA 5T6BA 2V65A 1WZEA 4H15A 4MP8A 1RM4A 3DB2A 3PEFA 4WPGA 1QORA 3RFXA 2JFFA 3D4OA 3PP8A 3V8BA 1LTHR 4OMUA 3EZYA 2Y1OA 3OECA 4XB1A 5I7VA 4CQLB 4PLWA 3GRKA 1LC3A 3BMQB 1I3NA 1WDKA 4WJZA 1ONOA 1VKOA 2AQHA 3DHNA 3GFGA 3VKUA 3PJEA 4DYVA 1EFKA 4BGEA 3QLJA 1IZ0A 3JQDA 3NRCA 4RPJA 2AA3A 2CDCA 4J9UE 2DBVO 2C2YA 4BHTA 3EAGA 2OOSA 3RUEA 3FPLA 3GMSA 1DC5A 1EVIA 1HZJA 4K6FA 5L51A 2DTEA 3ZCXA 1IHYA 4BNUA 3L9XA 3KVOA 3AU9A 1LRKA 2EERA 1P74A 3OEYA 3W4IA 1BG6A 1OBFO 2AEMA 4YDRA 2YDYA 1PS9A 2JJYA 3DONA 5H81A 4GBJA 4KUHA 3WGTA 3KM0A 2DBRA 4ILKA 4Y9DA 4DRYA 3PQFA 1IL0A 3VPGA 2DAPA 1Y8RA 3Q9NA 1LRJA 5KCZA 5L7TA 2HLPA 5FYDA 2I76A 4W7HA 3T7EA 3I4CA 1DRWA 4RZHA 2A94A 3Q1LA 5A9SA 1I2BA 4AJ2A 4PZDA 1U7TA 4RDHA 1B3RA 1DLIA 3BMNA 1BGVA 3WTBA 4ZQFA 3INTA 2EWMA 3ADOA 5ENDA 2QZZA 1H9BA 1TLTA 3F3SA 2YZ7A 3VOSA 2Q2QA 4DIOA 4MVJE 3FNGA 5LC1A 2BD0A 3RFTA 4FOOA 4DC0A 2X4GA 1I0ZA 2O3JA 5JMPA 1LDBA 2DC1A 1DFGA 1MA0A 4L4SA 4FW8A 1FDVA 4L4XA 1LRLA 3K96A 4H16A 3AUAA 4M89A 1QYXA 3ZU3A 1JLLB 1U28A 3VKVA 1ARZA 1V9LA 4EEXA 5C7OO 4LW8A 2J3JA 3U49A 5G4KB 4W9NC 4LMPA 4XGIA 3BHIA 1PS0A 1NNUA 2DBQA 2NACA 3DDNA 3ZWWA 1N1GA 3RUHA 1WWKA 1HLPA 3LT1A 1PJLA 4PG7A 1PJ3A 1R12A 3E18A 5G0WA 3WQQA 2FRDA 2C82A 4CMIA 1M75A 3QHAA 3WSWA 1DHTA 2CZCA 1ISMA 3GRPA 1R4MB 4XJSA 3SVTA 2OORA 1GUZA 4GSKA 4J16A 2GSDA 1N8KA 3TZKA 3ZHBA 4BNNA 4EUHA 1JTVA 1ZK0A 4I5FA 3OEWA 3GGPA 3OQBA 2JL1A 1NHGA 3HDJA 2NU6A 1MB4A 1NHWA 1W4ZA 3PDJA 3UOGA 4BL5A 4PVCA 1LSUA 3UFXA 4RVFA 4TROA 2CVOA 4FPXA 3C8MA 5LDGA 1DAOA 1ZMTA 2O4CA 4Z6KA 1GQYA 3NJ8A 4EW6A 1K5HA 5IFLA 4TSKA 5AXDA 1ISJA 1XWFA 3U5TA 1T2EA 3FN4A 3MEQA 2VTDA 2VT2A 3ZU4A 4EZBA 1A9YA 2AHRA 3D4NA 5IN5A 4E33A 1E3WA 2AMFA 2E37A 4NMHA 2FZEA 1E3JA 2Y1EA 3TWOA 3CXRA 1MUUA 2P9GA 3NDJA 1NWHA 5ITVA 4WCFC 3MCVA 1XYGA 4ZVVA 4NK4A 2D5CA 3S2GA 3F46A 1P33A 3G49A 3PWSA 4YAEA 1LLQA 5JNLA 5JYDA 1UAGA 1HT0A 4K6CA 3GN1A 3ANLA 3V2UA 4BNIA 5TC4A 3WJ7A 1N1EA 3FR8A 3KRTA 3ZWVA 1SB8A 2ZQYA 3HE3A 3SEFA 3NGXA 4I1IA 3ZHYA 3OHSX 1AHIA 4AJ1A 4E5MA 1N7HA 2VRCD 5TGDA 1EMDA 1CYDA 1NFRA 1U8FO 2DUWA 1LI4A 3EY4A 4GQAA 3STHA 2D0IA 2HCTA 2VYND 4J49A 5F1PA 4YT2A 1E7YA 4MVJI 2AW5A 5L95A 2B83A 3GVPA 3OJ0A 5DZSA 4CQMB 4R3WA 3WJAA 4NU6A 1Y9AA 3DFUA 1XSEA 1JAXA 3FF4A 4PLPA 2NU7A 4B7XA 2YJZA 3QWFA 4RV9A 4CM5A 1BDMA 3AW9A 4UULA 1A9ZA 3MOGA 1E1MA 2NVWA 4GWKA 1D1TA 4FN4A 1O89A 4E12A 2OBNA 1WW8A 2NU6B 1LDYA 4DUPA 5A02A 5CDGA 2I3AA 5L7YA 4D79A 2BH9A 3H5RA 4UVHA 1E6EA 1E6WA 1H6CA 3M1LA 1NVMB 2BMAA 3W6UA 5IZ4A 3ICCA 4B7CA 1G6KA 4P22A 2J3IA 2ZATA 1CIVA 3SC6A 4TRJA 3WTCA 3DZGA 2IE0A 1CJCA 3W1VA 3LVFO 1CQIA 3PDUA 4J1SA 5KVCA 3WYEA 1U4OA 2EHDA 3RVDA 1A7AA 1XLTA 1NPYA 2G76A 2VHYA 1EDOA 3RUCA 3DBHA 2C20A 5G0SA 4BO4A 3EVNA 1ID1A 5KJCA 5T8KA 5CG2A 3ONEA 5C3MA 3FNHA 3G3EA 1JKJA 2PH3A 3JYQA 5JYEA 4MJLA 4MPDA 3CSDA 2OMEA 3LLVA 3NTRA 1BDBA 3EW7A 5IF3A 4II3A 2NU9B 4J1NA 2H1SA 3TN7A 4BNVA 5JAIA 1Q0HA 3FPCA 5DCYA 2IXAA 1PGOA 3IC5A 3UW3A 3DXFA 1H6BA 1ONPA 3U4DA 1DPGA 4WCFB 5JSFA 5I7SA 3UCXA 3PI7A 3I23A 2GO1A 1C3VA 1KOLA 4DPMA 3RBXA 1AHHA 3OF2A 4W4TA 1E3LA 2PKRA 1LSJA 2VYVA 4FFMA 5F21A 1PJSA 1YJQA 3H65A 3P2YA 4YQYA 3BA1A 4MOWA 4GX0A 2JAPA 4BGVA 1OMOA 1UXHA 5ES3A 1PGPA 2IZZA 5FI3A 1MC5A 2PGJA 2WTBA 3WGIA 1ONNA 2X0IA 1T1SA 2DM6A 4Q3AA 4RORA 4OIMA 4PG4A 4EYEA 3MWDA 4L73A 1F8FA 2OBYA 4YWJA 1HKUA 2VOEA 2WD8A 2VNSA 4UUOA 1GYRA 2V7PA 4WKGA 2WMDA 2WYUA 1EUCB 1Q7GA 3TPCA 2B69A 7MDHA 1MFZA 1MLDA 4RO0A 2X23A 2PD6A 3DQPA 4IZHA 4D41A 3UN1A 3B1FA 4ZQBA 3PZBA 1YOVA 5K6AA 1VJTA 4PN3A 1T2CA 4E2WA 5CEEA 1E6UA 4ZQGA 2YV2A 1HWYA 1Y8RB 1SMKA 3VH4A 4CLRB 1NPDA 5AXBA 5F5NA 2I65A 2PR2A 3KSUA 1PQPA 5CG1A 2NTNA 1DIRA 5JO9A 2BGMA 3O8QA 4GL4A 4NFSA 4CQLA 4E5PA 2GASA 3H5NA 4CLDA 3INRA 3ROMA 1P1RA 4YB8A 2Y1CA 3ETEA 3L07A 4FR5A 1MFPA 1UZNA 3OIDA 4Y6PA 4EUFA 1IUKA 2UYYA 3GA0A 2HMVA 2Q49A 2QRLA 1EK6A 1EUDB 3BHMA 4I5GA 3I4FA 3HN2A 1ZK3A 2OUIA 1J6UA 1PEDA 3E82A 3K31A 3WGHA 1X15A 2XF8A 3FTNA 1Q7BA 1XU9A 5H83A 4Z9YA 5JLAA 3LF2A 3WYCA 4NDNE 2HK7A 3FSRA 1PWXA 4XGKA 3K73O 1I5RA 3C1OA 3WQRA 3UVEA 3GOHA 3HFGA 2PZKA 2ILTA 2O3RA 3AY6A 3EMKA 4BMSA 2J5KA 4R16A 5HBRA 3U09A 3C85A 4IJVA 1UJMA 3JQ8A 1H6DA 1EE2A 1OC4A 3ZDFA 4UVDA 3SBOA 4CM8B 2B5VA 5ER6A 3K30A 4WLOA 1UXKA 4F45A 4XQCA 1EQUA 3WWYA 4J7UA 4BNXA 5A9SB 5I8ZA 3RWBA 4GAEA 3V1UA 1P0CA 2W90A 3ZWBA 3ADPA 2X1HA 4HXYA 3IS3A 3QWBA 4IJUA 3CMMA 3U0BA 1TT5A 3SJUA 3VZSA 4BO2A 3JQBA 4IBOA 4DIFA 4WGGA 1NXQA 4R3NA 2Q2WA 3MZ0A 2HSDA 5KVQA 1YBVA 1JN0A 2NU8A 2YYYA 4J7CA 1JQBA 3GG2A 2J5RA 1JA9A 4CM6A 1M6WA 3CPSA 4PLVA 4CLOA 1A4UA 3B1JA 4Z0TA 1HDXA 3C1AA 1GDHA 3KXDA 2GDZA 3PYXA 4M1QA 1YQGA 2P2SA 3LT2A 1SEVA 2B35A 4NQZA 1DJQA 1P1IA 1LU9A 3LU1A 2Q45A 4RF4A 2E4AA 4KOAA 3LT0A 1DC6A 4CMIB 1SOWA 4MVJH 4CM4A 1PL7A 5K6AC 2YDXA 2JHGA 1KVUA 4ND1A 3I5MA 4IY1A 3AK4A 2EIHA 1BHSA 3P5SA 1K0UA 1OAAA 3Q11A 1OC2A 3A9WA 1CQIB 5A06A 1WLYA 3GHHA 2IRWA 3WFJA 1LC0A 1T4DA 1Z45A 4NR0A 4ROSA 1MC4A 3GZNA 3SLGA 1PX0A 4B4VA 4Z0HO 3JQCA 1W73A 5AXAA 2CY0A 4CR8A 3ASVA 3NDIA 1MV8A 3TOXA 3UH1A 2FZWA 4OL9A 1Z6ZA 4I9NA 1T25A 3DBRA 3JQ8B 3ZWCA 3P19A 3PYLA 4CV1A 4D7AA 5B4TA 2X0JA 4I9HA 1E7WA 3CZRA 4A0SA 1ZZEA 1YQXA 3W8EA 2BLLA 4IPTA 8ADHA 3K2EA 1Q2XA 1VL8A 2R00A 5JE8A 2DQ4A 3AY3A 5IJZA 3DC2A 1S7CA 2O2YA 3UKOA 3V2HA 1TT5B 5JBIA 2WD7B 5A3VA 3S55A 4PLFA 5C37A 1PJ4A 3DBRB 5F5LA 1CETA 1K2WA 5DN9A 5JCXA 5KJFA 4KMSA 4R1TA 4Q3CA 3ROKA 4GVXA 3GGOA 2X58A 4E2ZA 2V6GA 2R2GA 3NTOA 5KJEA 3DWFA 1VLLA 2FSVA 3NYWA 3S2IA 2Y66A 2OL4A 3ZW9A 4BGUA 5KKCA 3C7CB 1N9GB 4CQMD 3K92A 1HEUA 2UDPA 3ZHXA 4D44A 4B8WA 4BB5A 1PZEA 4CMEA 3UICA 1L7EA 5FEUA 3PXXA 5EIOA 1HYGA 3UCFA 5IZCA 1Y7TA 2DFDA 4B7UA 1XDWA 3H9UA 4I9UA 2NV6A 4OO3A 1XQ6A 3GPDG 4TZKA 1HDZA 4YPOA 2Y1FA 3U4HA 5F3RA 3WMXA 3WR5A 2VCYA 2Y99A 3DAGA 3H2ZA 2NQ8A 3PYMA 1GV0A 3IKVA 2XXJA 1NPTO 4AJIA 7ADHA 3KZVA 4LGVA 2BI7A 3I6IA 1P0FA 4G65A 4CMHA 2HRZA 2B0JA 1DC3A 1GUYA 3PK0A 4EUEA 2SCUA 2JD0A 3O8QB 3I83A 2EKLA 3T4XA 2NTVA 4E13A 3TFOA 1HE5A 1YJ8A 1BTOA 4HX5A 1SOVA 1QLJA 3M2PA 1UP6A 4PFJA 3VPSA 3IUPA 3RUAA 3ZW8A 4IQGA 2C7GA 3RUIA 3A14A 2FN7A 3ENNA 4RPLA 3U3XA 1EBFA 2EJVA 4MO2A 1EVYA 4RGBA 3W4JA 1L7DA 4GWGA 4GLLA 4FDAA 4IGFA 1HF3A 1ZNQO 3VZQA 3AOEC 1C0KA 2QQ5A 3GAFA 3ICPA 1K6IA 1GAEO 1VJ1A 5BR7A 1O5IA 1MP0A 1YONA 4R54A 5A3JA 4IS2A 2B5WA 3IMFA 3QWHA 1YL5A 5IDQA 5JY1A 3G1TA 5AYVA 1QRRA 5L4SA 2Y67A 4W9NA 4YJGB 5IAAA 4B3JA 1PSDA 4YRAA 5KJ6A 2PZJA 4WUVA 5L3ZA 1MGOA 1Z7BA 4WOJA 4J4HA 1NQTA 1WXDA 1VSVA 3JQAD 3BTSA 4CUKA 4DQVA 4NBUA 1W6UA 5JDCA 5JDIA 2LDBA 3UUWA 3NJ4A 4LK3A 1YOVB 4N5LA 5DULA 3PJFA 4MVJF 4XD2A 5COQA 3FWZA 3QRWA 1HL3A 1HZZA 2GLXA 2Z95A 3FI9A 2GERA 3O4RA 4QTZA 4DBVO 4E5NA 3HSKA 2PGDA 1E1NA 3MTGA 2AEFA 4CL3A 1BW9A 2JD2A 1YE3A 2Q99A 4UVGA 3F6YA 1FDWA 4MVJA 1GQ2A 1F0YA 4F3YA 4YACA 4RF5A 1PJBA 4URFA 1LNQA 4I8XA 4RVSA 3GVIA 1B3BA 4CLHA 1J4AA 4IXTA 4PZCA 3QP9A 2G0TA 4IDBA 1NP3A 1AXEA 4NPCA 4LCJA 2F00A 3H9JA 3C1TA 4XR9A 3RUFA 1DFHA 2P5YA 3DOCA 3PFWO 1C14A 3B70A 4L75A 4ZGWA 3FHLA 3EC7A 3KV3O 1HSOA 1EDZA 4FD3A 3GC6A 2FWMX 2O48X 3VC7A 2G1UA 3MJCA 1RWBA 4F6LA 1YBMA 4FFNA 3P2OA 4Y6RA 3E9MA 1XCBA 3T7CA 2EF1A 4JK3A 1HXHA 4YAGA 1LBEA 1R4NA 1H2BA 3H6KA 1N2SA 1QLHA 1ISHA 3NTQA 4RPKA 4BQPA 4FSHA 5JO0A 4OH1A 1M67A 4WECA 3FD8A 1SZJG 4JLWA 4XX0A 4GX2A 3WICA 2DUUA 4HV4A 3H3FA 4QECA 4BO5A 3JD1A 4BMVA 4BNLA 2CMDA 1B0AA 1WVGA 1D7OA 1JAYA 2ZCVA 2ZJ1A 2B4RO 5EN4A 1KYQA 1Q1NA 3N58A 2VZ9A 4ND2A 2D1YA 2NM0A 3NT5A 4TWRA 2Q50A 3ZWNA 5CPBA 3VPFA 1VL6A 3RC1A 3DBVO 3FRJA 1H6AA 4S1VA 3BMOA 2PFGA 2POQX 4CMEC 5FWNA 3FWNA 2LDXA 3PWKA 4AJOA 5GZ1A 3VVCA 5A05A 1GYPA 3BMNB 3E6AA 3IDSA 4TMFA 2PY6A 4IJKA 4CODB 4KTTE 4EI2A 3JQ9C 4K1LA 1ZVMA 2W2KA 4O6VA 4IDDA 5CAEA 4ONEA 1EUDA 1SNYA 1Z75A 9LDTA 2GGSA 1PQWA 1X7GA 2E48A 3OETA 4WLEA 5JXWA 2ZK7A 3RU9A 2WM3A 2G82A 4CUZA 2QIOA 3I9JA 2HAEA 1U8XX 1EK5A 3K5PA 4KQWA 4OYRA 3ZWXA 3EUWA 1U3VA 4DPKA 3O26A 3AJRA 1GCUA 5IZCC 2BGKA 2RBEA 2NU7B 4CM3A 5K9ZA 4AJEA 3GLQA 4DL9A 3ENKA 4KZPA 1ENOA 4LSMA 4NJOA 4DPLA 4CL8A 3JQGB 3G0OA 4XQ9A 3KBOA 4JBGA 4CM9D 4ND4A
chains in the Genus database with same CATH superfamily
3NUGA 4YJ3B 2HXYA 3NFRA 4L7QA 2OHOA 1ORDA 5MFZA 3D8SA 2EV9A 1HFKA 2WTMA 3BB3A 3MWGA 5KYVA 4Y98A 2QAGC 2ZT7A 4BAGA 2XWBF 4L0QA 2Q4EA 2HA6A 3VR5D 3GLFA 1P19A 2IPOA 4M76B 1BX3A 1GPNA 1FYWA 2JHFA 1Q3HA 1N0WA 4MR7A 4C5AA 1Z73A 4HRVA 4UM7A 2FPGA 4OGWA 4DR2B 2IODA 6LDHA 1NSFA 5E1BA 5KB3A 2I22A 1UXJA 4IZOA 4F3CA 2O1XA 3U4IA 1LTKA 1DKNA 3SDZA 4TV9F 4CMJA 5D5HA 3KKPA 3INYA 5G0TA 4E09A 3DV0B 2D5BA 2H51A 3VR3D 3F9RA 3WX0A 2GH1A 3L06A 3PQ3A 4R5HA 3T95A 3WE7A 3N2NA 4AKIA 4WESA 5J2UB 4OJQA 3PBKA 4OQDA 3NXSA 4Z1MD 4QT0A 1ZICA 3DAOA 4U6NA 2W2TA 2MYTA 3B3JA 4MQ5A 4MPTA 1BE6A 2G28A 2WF8A 3PCTA 3OTHA 1C7EA 1CP3A 1FVFA 2JLAA 2WHPA 2AGVA 5A6VA 1JHRA 2I4NA 5CT5A 4QDXA 1HMYA 1WPQA 2DECA 3EOAI 1ZUWA 1LX7A 3CQ9A 2C1XA 4JJFA 3LUBA 5LP6C 2PJZA 4KB5A 1WCIB 1V7CA 2B3DA 3PHCA 2PYDA 3HY6A 3BA6A 2O2JA 1QIDA 2HBYA 2R25B 3C6QA 2CXXA 1ULAA 4X1YA 3LUPA 1KHTA 1D09A 1UWVA 4ICIA 1ZFNA 3ZNPA 1K75A 5A5EA 3GZTB 1SRRA 2SBTA 2WJZB 2FXIA 3V48A 2Y1KA 4QBHA 1WUHS 5ERYA 1DTWA 4MWSA 4Z86A 5GOTA 2WW8A 2PH7A 2AG8A 1TCVA 2O7QA 5DX8A 2W0SA 1BVYF 4DMLA 3IV7A 3WFIA 4AFNA 2JGLA 3KOOA 1W76A 1XU4A 2EBHX 3PD1A 3Q3IA 4KIJA 3S8YA 2P77A 2H00A 2XEDA 3CNBA 4JD5A 3RSOA 2ZWVA 2IBTA 4WNAB 1ZH6A 2VXCA 3HJUA 4XSHA 4Y9SA 3HTXA 4LJAA 1XEWX 1UXGA 1CQWA 1HT3A 1C3OA 3NAGA 4NG5A 5DNAA 5IYZF 3L8CA 4R0NA 4UEKA 2GT1A 2PUWA 4FXPA 3GPIA 3MUEA 4V0OA 2VBGA 1PWHA 4LF9B 1RLOA 4HRYA 2V6FA 3JU3A 4NEGA 5FWYA 3DEZA 4NATA 1SY7A 1Y9JA 4IXDA 3CX8A 5L3SB 4FWBA 3CZMA 1VPLA 3Q8WA 2A5FA 2EDCA 2B9VA 2F59A 2J33A 3DNPA 2WKSA 5GM2A 1HDYA 4NBVA 2BH2A 5D86A 3GLGB 4HT3B 3H7AA 1A97A 2A8YA 4JKOA 1JLSA 4PYNA 4W5TA 2G4CA 2CL6X 3ESZA 3KUKA 5D3KA 4XDHA 3QTLA 3ROTA 4EVSA 5EZ5A 3W9UA 3B36A 2F2TA 2JIRA 4PHTA 5CCEA 2TS1A 4HH1A 4UUPA 1BKDR 2VFAA 2X9VA 3CVJA 2QQEA 4NK5A 4JLSA 5ALWA 5AM5A 4JROA 3SIWA 2Y2VA 4IRMA 4ZZ2A 4E5SA 3PXAA 1U6JA 2EX1A 2OQ2A 1WCXA 1OAOC 3DH0A 3TW0A 2MMCA 2P9HA 4ADSG 2FW1A 1YDGA 2JD1A 1OY1A 2Z3WA 3SKYA 4Q3DA 1JZQA 4XCVA 2CD7A 2R84A 1KKUA 1XCPA 5CB0A 3PPIA 5AHKA 2R6FA 2X22A 1BCRB 1ZK1A 2DPLA 4M1TA 2Q5CA 3DZJA 2Y93A 1PKEA 3P9PA 4XYBA 4XWOA 3IELA 5HF6A 4OXIA 3UK1A 3CIOA 5FPTA 3HM2A 5FLEX 3RD5A 3OZVA 3UHAA 4AY2A 1XTRA 4NMXB 2O23A 5H16A 4IDEA 5C53B 1QHGA 4JXKA 4QBTA 4FC7A 4MV7A 5C1DA 1J7KA 1M34B 1E9EA 1MXHA 1QTRA 1WPRA 2PUVA 2ZJ3A 3GFBA 3GEMA 4Q1FA 3T7IA 3FZYA 4YYZA 3RV4A 2H31A 2WAXA 1YDMA 4TQGA 3Q3JB 4MEJA 4KO2S 1PZFA 4BFXA 5EIXA 2QTRA 2ZAGA 4Q3BA 5KYWB 2A35A 4V0NA 1CUDA 4LJ9A 2O2DA 3HMQA 1Z74A 5AW9A 4AW9A 3EDQA 4AO7A 4C6RA 1TYZA 2RHLA 2FI1A 5KYYB 4GR4A 1JXAA 1T2DA 5FFNA 5KWEA 3FOAA 1II9A 3QE2A 5DTMA 1ZC3A 2W98A 2NU9A 1H2YA 4UDYX 6PFKA 2H3HA 3QF7A 3QU9A 2B7CA 1VBMA 2AR0A 1CY2A 3JALA 2ZYDA 5DFAA 2B6NA 5HF5A 4RHCA 5ALLA 3SFZA 3EGDA 2GR9A 2P9TA 2W6PA 1NN0A 1Q84A 2GNOA 3AM3A 3AY7A 3EXAA 1XR3A 1YI8A 3QMVA 5DIZA 3VYTB 2JLCA 5ED4A 3PHHA 1RPAA 1NY6A 5B3KA 1GPWB 2BCJQ 3TTYA 4BFTA 2BSXA 1VSBA 1Z5UA 1KA9H 4HWKA 5KJ1A 2AYXA 4H0FA 4XQGA 4M7WA 4S1TA 3N6VA 4D4IA 2VYFA 2B1IA 3GA5A 1YHNA 4AMBA 3EXIB 1WXQA 5FBLB 4HFMA 4ALNA 1AO0A 4QYMA 2Q5FA 1C9EA 3W8FA 1D3AA 2FHPA 2IP2A 2N1BA 1O94C 2XADA 3C3EA 4A8HA 3G7NA 5JEEA 2FN8A 3DWEX 3G0DA 3ISTA 3JQ6A 5EQJB 5BNFA 3AIKA 5TR9A 4DGQA 4LOIA 4MCHA 1KNXA 2WF9A 4HTFB 5BUCA 2D5AA 1C9YA 1WDTA 4LMRA 3ZIAA 4A7PA 5IXYA 4DSTA 1N0UA 1OREA 3HA3A 1RAHA 4NECA 3N74A 4CU2A 4YAWA 4C7KA 1PYOA 2AOWA 1NJ5A 2VK4A 3HP1A 2WF6A 1MT0A 2Z9CA 1M6EX 3NEPX 3WLOA 2C1EA 4D1YA 1HX7A 3U7QA 1F6WA 3C7AA 3PPWA 1C7IA 5E6SB 2OR3A 3IP5A 4QYIA 2ZYUX 3FFTA 3T9FA 3OM0A 3OZDA 1KMNA 1QRUA 4KXWA 1ZVVA 3EGOA 4FONA 1A4IA 1HNNA 4BNHA 3TDKA 4AJPA 4MRNA 1WU7A 1ACJA 4D8UA 2H1OA 1JG6A 2DETA 1U9ZA 3OHPA 2D3TA 4KI7A 5BSKA 3FDFA 2OO5A 3AJAA 3R8XA 4BQQA 3H6GA 2YS7A 3O47A 3WYDA 2OHHA 5ADVA 4MWGA 5JJ5A 4BKOA 2EGHA 4MZXA 1UWCA 3K0CC 5DEIA 1EWRA 1Z7EA 4GSLA 2GBLC 4RM3A 4Q7EA 3AETB 4RE6A 5K3SA 1K7EB 1Y1PA 3UTCA 4AM8A 5ALSA 1M7HA 3ETDA 3MVEA 1DBVO 2F48A 2A9VA 2HMAA 3B52X 3D3EA 3HH8A 3MTAA 2M6RA 3OZSA 5AM2A 1V8PA 4NICA 3GPLA 1EFRD 2G71A 4TLMB 4C4OA 3LQQA 2YNMA 4DV2B 3NBFA 1LBQA 5GV7A 2IA5A 1DLJA 1I36A 4I19A 1C30B 1QHNA 1P29A 2XQGA 3SZRA 2H1LA 2C2HA 2Z1NA 3IJRA 3TLBA 1S2LA 2WPDD 2QIPA 4R2LA 1U11A 3VC2A 4AMGA 5JNSA 3QFRA 2VXBA 2UUCB 2OV2A 4QKQA 3I8OA 5JANA 2C59A 4A10A 1EQAA 3OLYA 3IVGA 5HTKA 3C5VA 1FFCA 4P7FA 4TSFA 1FJXA 3WYBA 1T9AA 3PC8C 2JVKA 1VMEA 4Q7LA 5CCBA 5J43A 1P18A 3KQSA 4JOBA 4CKCA 4U0KA 3NETA 1D6NA 1UIRA 2YJ6A 3GX1A 3R44A 1SELA 1S7GA 2ZBUA 3P4XA 1Z68A 4HCJA 4CIWA 1IBCA 3B2QA 5B5SA 1WXWA 1OXSC 2OBXA 3H4MA 3W1EA 3GN2A 3QKTA 5LZ4A 1MEJA 1IN6A 3JQAA 1Y6QA 3N07A 2W70A 3DC7A 10MHA 1NUSA 4UCFA 1GQFA 4HAWA 1JEYA 5TF4A 2I8AA 5E4YA 3VMMA 2CNWA 4YIHA 2PKQO 4KXNA 5ENVA 3VZDA 1N0HA 4K9OA 3HCEA 4NOKA 1VMIA 2IS4A 2JFYA 2IHBA 4HZUA 1BS9A 3VR4D 1KGSA 5JAQA 1IMJA 2PEYA 5I9SA 5ITZB 2YBEA 2X0RA 1NVXQ 1GAWA 3DTNA 1ULHA 1BHQ1 3BWEA 2WWRA 3I73A 4JC8A 4R1UA 4G4SO 2WTAA 3H8VA 3VDQA 3EGXA 4D6YA 4LOLA 5BSTA 3MXOA 3EF1A 5TT1A 3V3TA 4EY4A 2XRZA 5E3IA 5DP2A 4AJ9A 2C7BA 3IUSA 1AB6A 1J0XO 3RSHA 3QY9A 3SE7A 3RG8A 2E5FA 3W5UA 3HP4A 1U2PA 1FPQA 3KUUA 1Y4AE 5EI5A 2R6ZA 3VKGA 1D07A 2AG6A 3A4VA 1R6XA 3JPYA 3BAZA 4JJZA 3EIXA 1XMQB 5AKZA 1SCQA 1LF0A 5EUQB 1P0PA 2X2EA 3E53A 4ITRC 1SVKA 4C6SA 2X8LA 3H3XA 1P3DA 3ONWA 1YE5A 3U3ZA 1VGVA 1Z4NA 2R11A 4KN9S 2PDAA 9ABPA 4L57A 4DJFC 3WLQA 3QUTA 3I9V1 2GK7A 2QK4A 3EGDB 1N2HA 3ORSA 4PFKA 3UJ8A 1M10A 1OIVA 3H97A 3OZ7A 5C46F 3L4EA 2VT6A 1KVTA 2RI1A 1IWBB 3LOUA 2PV0A 2QG4A 4OOEA 4XM1A 1BS1A 3CLSC 4ZEXA 4MUAA 1PUXA 4JELA 3C7TA 3EG9A 1RPJA 4XD7D 5D6NA 4RIEA 3T7AA 2D5LA 1G8GA 5GMOA 3THXB 3GLVA 3GU3A 1E0AA 5BWMA 5A5VA 2ETVA 2X77A 3ENZA 3M2TA 5CEJA 4D99A 5HR5A 3PRKE 4ZIRB 5IKPA 1RPZA 3FBGA 1C1XA 1IEQA 1CQXA 3W7VA 1TCUA 1L4LA 3CW9A 3F2IA 1PDWA 2FJUA 3PG5A 4GI3A 2LWIA 4OHCA 2RONA 3AVQA 4CTKA 5JALA 4Y1FA 1DJNA 2GYYA 5IJXA 4YAUA 2PZLA 1T9GR 3LVRE 4NJMB 5LL6P 4TKZA 1M1UA 3LCRA 3GLGA 1DCKA 4JZKA 4RE5A 1G6Q1 4XQ0A 2WI8A 3OPYA 4L2IA 4XW2A 3T5BA 2HGZA 5E8JA 2XZOA 3GUCA 4MWOA 1L4UA 4QWWA 2D4HA 2QEQA 4B75A 5DXAA 3RRFA 4JVOA 4MVJG 2QLLA 5JYBA 1IBKB 1XGKA 4D0GA 3ZU5A 3TM5A 3AKCA 4HQOA 5IU6A 3I0ZA 4B4WA 3EYWA 3USES 1YR9A 4FOLA 4NU0A 1A5SB 1FRQA 1QG2A 1SXQA 5KDLA 5TQ0A 1HDRA 2G17A 4DBZA 1IZZA 3BRWA 1MW8X 3FLEA 2DUNA 4WDRA 1LJLA 1N6NA 2CK3D 1MIHA 1GSAA 1NVAA 3HADA 2ACWA 2XTNA 1MT3A 4JI8B 1R4AA 1X7ZB 1Q3KA 3ZY4A 4R4JA 4IXWA 3IP8A 5CVTA 4OHOA 4D3DA 1OVMA 1U5BA 4O4JF 3TUZC 4WXEA 1WHSB 4XVCA 3SWWA 4FDTA 2BGGA 3BFKA 1J2JA 1FS6A 5H3HA 2AE1A 3U3JA 2JFPA 2I91A 2B8WA 2R1TA 2ZIAA 5EWLB 4BE7B 3OTIA 5GIPE 2V7VA 3R0XA 2WLTA 2NO6A 3KYCB 4Q7KA 4QGGA 2CLHB 4XVHA 2UKDA 5GJWC 4LXXA 3LXUX 3A9UA 3KKEA 4XASA 2I6TA 1HI9A 2P6PA 1YRBA 1REQA 2JCYA 3QFTA 1EKXA 1WXEA 4TL8A 5CB4F 1O95D 3SIPA 4ZMSA 1N7JA 4HBGA 2XMZA 5TB5A 3UG7A 1AM4D 3W5IA 3VR3A 1U8TA 4CWAA 2F55A 3AERA 5ALMA 3C5WP 1KFJB 1PG0A 1YRWA 1CIJA 5CK5A 3AV3A 3K15A 1N2CB 3TF5A 2EHJA 1C9KA 1V35A 2MSCB 2BV3A 3VPHA 3ZYCA 1GR1A 5CRIA 3RSFA 3A1DA 3KYCA 1DAPA 4KQ9A 1M2KA 4LC9A 4EGQA 2RH4A 3FPHA 2WHQA 4M87A 4X71A 1RNLA 2QDKA 1NULA 1GJRA 1K06A 3OKPA 3B7PA 3HGTA 2BW0A 2O1WA 1UF9A 3ND5A 4AJKA 5AW3A 4HMOA 1AURA 2JIBA 1OI2A 4CKYA 4R41A 1Z0ZA 2C2MA 5A1TA 4NNJA 2NAFA 1P1KA 1OOEA 3I9OA 4JP2A 4M0EA 3VDRA 4N3NA 4DA6A 3HJHA 3RVOA 3LY9A 4PQGA 4K9NA 2NWQA 1NBME 1VLHA 1HE1C 3EARA 4EMUA 1O6GA 2ORWA 2P5SA 3RTBA 2UVDA 3BREA 3DV2A 3AP3A 3QYJA 4C89A 5F1OA 3CT4A 3WB2A 3VU9B 4RSHA 4CETA 4GRAA 4IW3B 4CG1A 3HJGA 4JWTA 1US8B 1KTIA 1DJPA 1O96B 2ZITA 3OPMA 2AOVA 1ZDMA 1JDZA 1RBMA 4X1IA 4POOA 4CDMA 4JXZA 2A1TR 2C97A 2GLTA 2XXBA 1H69A 1POXA 4UATA 4D3YA 2UUOA 3WS7A 5CAEB 2RGXA 3ZKAA 1WKVA 1PFVA 3UJ9A 1K08A 1X7HA 3UPUA 3CC8A 3TNDA 5CLFA 2XHEA 2BR4A 2HPZA 3GEHA 1NDUA 1OZAA 2XB4A 2YJ3A 4DWOA 1EDBA 2RCYA 3LP5A 4RSMA 4LXYA 4DLTA 5BVGB 5IJWA 4R1NA 1BCSA 4Y7CA 4J0JA 3T7DA 1BYIA 1RI2A 1AXGA 2F3TA 2F3PA 4IWXA 5F35A 1A82A 3L0BA 2AK3A 2ZPAA 4JLDA 1LQ2A 2FVYA 2ZRIA 2RGRA 2FFRA 2QSYA 2VT3A 3KXKA 4JC5A 2PRYA 5FUWA 3PDWA 1TU4A 1V7QA 2ZYAA 3AR7A 4EMSA 1NQXA 3GYGA 3QG1A 1A5AB 5BOVA 1Q92A 3W4KA 4B4OA 3BM5A 1MV5A 3PEEA 1M72A 2ZR0A 1CU1A 3NV7A 1V43A 2VHQA 1PJ2A 4RNCA 1USIA 4V3BA 1NIPA 2Q5HA 5CIQA 3RREA 4PSVA 3TSYA 4E4RA 2Z08A 4A03A 4HNHA 2IV7A 6ABPA 3AERB 4BLQA 4XWWA 2ZIXA 3U56A 1XTZA 4ZJYA 1RXVA 3V8MA 1YQ9A 2B94A 2O3SA 3LCJA 1UKVY 1YR2A 3L3BA 2PZBA 2C95A 5JZSA 1NA5A 1XA3A 1YJXA 1DFIA 2D0PB 2VDNB 4FT2A 4NCHA 2J3HA 1I4EB 1L7MA 3JPWA 3GNTA 3MWYW 2OVFA 1JHVA 3ZWOA 1MX3A 4A23A 5JAOA 1WB9A 1WUKS 2CBZA 3A9SA 3TLYA 1BOOA 3FHTA 2HU2A 4AKTA 4B6SA 2QL6A 5ICMA 2FAXA 1NI4B 4ZVQA 4HZGA 3D0KA 4X1KB 4EB3A 3I1JA 4Z3KA 3WGNA 4C88A 2QX9A 2EZUA 3IT3A 3RR2A 3ESQA 4MDHA 1HMPA 3E2PA 1MPXA 3BRWD 4QQRA 1JDBB 2YUIA 1SVOA 4EG8A 4MIYA 1DKPA 1VDMA 1WBDA 4ZOLA 4J1QA 2YHUA 2AB0A 4LCBA 1SC1A 2C3PA 5J9FA 1JW9B 2XNSA 4BVKA 1ZM7A 5I9TA 5FOSA 1FFBA 2JFNA 1WPXA 1KMQA 1NDQA 1QE0A 2CFIA 2YV4A 3ID6C 4YN3A 2RHDA 2ZZKA 4EG7A 2IXGA 3WYGA 5TX7A 3FTCA 3T4EA 2O3UA 3OA0A 1PE0A 5IWCA 1ECCA 1G2OA 4WZAE 3A1WA 3G0BA 1SCBA 1EWYA 4BLOA 1U0NA 5HRAA 1U7XA 5B58C 3PXCX 1DARA 4RFSA 4YHBA 3ZS9A 4JENA 4NTZA 3FH0A 1WCWA 4EB0A 3GLRA 1OI7A 2F9MA 3O8OB 4BQNA 1ZX1A 5AJHA 2X0DA 1TI7A 3DDOA 1XL0A 4Z9FA 3CYFA 1T9GS 1B14A 4UTNA 2H2WA 1C9NA 5JD4A 3IILA 4X97A 3GVXA 1ISIA 2QMUA 1T91A 4BB0A 5I9LA 3N2GA 4LE2A 3UFXB 2B25A 4HVTA 3ZVLA 1X1AA 5ICSA 5T3UA 1XQWA 4JI7B 4AY5A 1P4RA 1CUSA 3KQOA 4ITVA 1XQ9A 4KDEA 2QI9C 1UK9A 3VH3A 4BVAA 5FJJA 3CUWA 3UWMA 4PBRA 1WU8A 3L6EA 4R8LA 3HCFA 4L0DA 1RXEA 1NKVA 2QNRA 1FVHA 4BEWA 2IVZA 1Y3FE 1X74A 4MEBA 2V59A 3TLKA 1KMMA 1NKTA 3IE2A 1AX9A 1SB9A 2JPDA 3FUVA 3G9XA 1RXYA 4N18A 4ZOAA 4PQFA 2ZRAA 4P33A 4TSRA 1KI2A 4A9AA 3RS7A 1NZDA 4MQ6A 1V8DA 1BXRB 5FBHA 4UEJA 1S01A 3PGLA 1AKUA 1GO2A 1PGQA 3G23A 2B99A 1C3EA 3ZCUA 5CFRA 1OYOA 2YVLA 3ENQA 1SULA 1S1CA 4JJ8A 3DF9A 2K4MA 3BWVA 5CA0A 4KQIA 4BKUA 1FX0B 1U2TA 1Z4QA 4WASA 3GMTA 5BO5A 5EKSA 1Z5VA 1MX9A 1XNRB 5BORA 4DSNA 4AF6A 1QX4A 2UUBB 4GL2A 2GPSA 4YCJA 3PTAA 2QMYA 1TYCA 4ZKDA 1P60A 5H02A 2ZPUA 3OESA 5KO2A 3WGQA 1LZKA 3PDIB 1H2RS 4OYHA 2WILA 3SMVA 2YRFA 2JGMA 1T3ZA 3N1UA 5ENZA 4QBGB 3JRXA 4ALLA 4KJZA 3OZCA 2IITA 1QZZA 4DABA 1TUEA 2OYRA 3QA9A 5CFMA 3IAAA 2PZMA 3C5CA 2JCGA 3NHZA 4B0PA 4TRRA 3ZVRA 1DO0A 1ZVKA 4BEBA 1MNQA 1CR1A 2DWOA 2H18A 4V0LA 1N5DA 3I9MA 5M7EA 2FMIA 3I53A 3KTAB 5AVRA 4XDGA 2RG7A 3I34X 4UXHA 1Y8AA 2M98A 4NPHA 5AKKA 3TXAA 3WGVA 5MGNA 3M83A 1AF7A 1GT6A 4LYDA 1VE7A 2C5SA 3OD1A 1UKCA 1JMYA 2DFVA 2F64A 1OFVA 2G0NA 2IGBA 3KCNA 5BSRA 4NABA 3TPZA 4C21A 2DSNA 1RS0A 2WAYA 3OX4A 2G5TA 3BSWA 4BCCA 3WMWA 2J87A 1QTNA 1TAHA 3Q9LA 5AM4A 4L8WB 2X9GA 3PFHA 4LVOA 2QT9A 2EW1A 5GM1A 5IC5A 2A1UA 5AVWA 4MRPA 2AI3A 3BORA 4TMKA 2NNLD 4C2UA 2ATEA 4HG2A 1NMZA 1V6SA 3C14C 3W8DA 1SVNA 4LV5B 1YXMA 4UM9D 4ZT7A 1OWNA 4QYIB 4NEQA 1L3CA 5IVIA 1X7WA 3COWA 1TC2A 2VYCA 1WHTA 2QDXA 1FRFS 2WKPA 3CRW1 3OLXA 3QNWA 3AI1A 3KLPX 1SUCA 3USZA 4A2CA 1ORHA 2CE2X 1IEXA 1QR2A 3L8FA 5TVGA 3P97A 1SH7A 4DA8A 1ODKA 2RSLA 3E5RA 3G2NA 3JD0A 2AZMA 1IYZA 1FF9A 3L4BC 4KIUA 4YLEA 1KORA 4CIYA 3T7JA 1XN4A 3L1VA 3NOVA 3KOUA 4NH0A 3OCVA 4XFDA 1RRVA 5EMJA 1CUWA 5GZ6A 4EJFA 2VF4X 6ADHA 4KQEA 5BQOA 1UMBA 4M83A 3GGDA 5I7FA 4L16A 1TO2E 3D54D 3G59A 4D3XA 5JY6A 3H4VA 1OWLA 1PWYE 3BRCA 1E3TA 2A67A 3HVJA 1YB5A 3MA0A 3NTVA 4ER7A 2HJVA 4JP3A 2FFQA 1ZXLA 2BP7A 3E7WA 4JSTA 5DWVA 5L53A 2NTEA 4HMPA 4BLTA 3RG2A 3VTFA 2YHIB 4AECA 3JRWA 3JQ9A 1QU2A 1R0KA 2VT7A 1NU6A 2CVZA 2CJYA 1EAMA 5EPEA 2FPIB 1M5RA 3EHEA 1IY1A 4FNGA 2H29A 3A0RB 2R86A 1MDBA 4WOPA 3JWJA 2R4QA 3U1VA 4QEDA 4B82A 1F4VA 1W4RA 1KJQA 3C7DB 2CHFA 5C7IO 3DBLB 1DXYA 1DMRA 2GEKA 2XZDA 1J8YF 4EVRA 1A50B 1GEEA 2IU4A 3BJIC 3PUHA 4HQ0A 3GJ8A 3PC3A 4MX8A 5F2EA 1TMKA 5DGHA 421PA 2CHEA 5LNK6 1MC1A 4DCNA 3FETA 3C3BA 2JBWA 4XJTA 1MQSA 2Q1UA 3BD6A 3P2EA 3TW4A 3LX6A 4QUAA 4IVQA 5H9VA 5DTIA 1S2MA 3V4FA 4RNDB 5HVNA 5EA2A 3OZIA 2CSUA 1ID8A 3QBJA 2BISA 4FCTA 1JHXA 1KAQA 3TECE 2PWBA 4Q9HA 2L0XA 1BRMA 2FPPA 5K3FB 1EZZA 4DLXA 3HJFA 1L4BA 4PTLA 3BQNB 3W3AA 4FZ5A 1OI3A 1U8CB 1OH8A 4WNYA 2AMVA 1LWNA 1G98A 4BE4A 4NOMA 4KXYA 1LNZA 2Z6VA 4JU8A 4PRYA 4YRCA 1GQQA 1Z28A 3DKKA 2O3QA 2G5PA 2B4QA 4LNUB 5FBQB 4AG6A 3O74A 1ZKMA 4XGNA 1ESEA 5JFGA 3L46A 4DXAA 1F1JA 1Z6TA 1JAZA 4AT1A 1QGUA 2FPWA 1U90A 1Y63A 4O63O 3OCZA 4TQAA 5DISB 2YINC 1PGNA 4V2UA 3X43A 4V03A 1LJ8A 1HORA 1T36B 1E2IA 2VHTA 1PIWA 1Y9DA 2HF8A 2ZSFA 3LYHA 3MLBA 3WG9A 4KDFA 3NR2A 2W2MA 3R0QA 5TIIA 3VC1A 3TFQA 3ZY3A 4DLYA 3OCJA 4FLEA 5FRDA 2X1MA 4EKGA 3MJSA 2I1VB 1KH2A 3M3PA 4HP8A 4B3XA 1P4HA 1COWD 4RJKA 1DEOA 3SBDA 1CT9A 3HA7A 5B1IA 2JFQA 3NTXA 4GH5A 1E64A 2ET6A 4D42A 3IVCA 5TQVA 3FOCA 4JVNA 3M82A 4JQOA 4ZICA 4JT4A 3FTPA 1EUZA 1JDPA 3LSTA 4D4LA 2I2XB 2I6FA 4ZI2A 5FA6A 1JDJA 1NAHA 5JR3A 5G41A 1EDDA 4B4UA 1XLWA 1XTKA 1J0AA 1I2CA 3RUPA 3KWMA 3K2QA 1O58A 3HDYA 3PHBE 1NJ8A 4TSFD 3OIVA 4F91B 1XMJA 1RP7A 3AIIA 4OBEA 2CXHA 3RQSA 4U2CA 3ONDA 2ONJA 4AQYB 1C9JA 3NDRA 5JCOA 2F62A 4LOJA 4PAGA 1EWKA 2YQ4A 2XMDA 1E2EA 1G7CA 3F8WA 3GH3A 1OCEA 4X00A 2CMKA 5FXMA 3AVVA 1AUVA 3MTIA 4GMHA 4JUFA 2YZKA 3H0EA 3SZGA 1E2MA 1YQTA 5JJLA 1Z2PX 3RIYA 1G6HA 3UYLA 2Q1TA 5ALNA 4R40A 4JJGA 5CX1B 5DK6A 4CCSA 1XDSA 2W6ZA 3S28A 5JS2A 3TQRA 4AI6A 2IZ6A 1Y8CA 2KHZA 5HRUA 4KPUB 2DMRA 3E9CA 1YA6A 2VP6A 3CF2A 3HRIA 2HC9A 4GZ5A 2P9BA 2IK8A 2FUEA 1RBYA 3K70C 1KC3A 3EWSA 1YVRA 4JLBA 4MKHA 3W8NA 2VPWA 4LUCA 1NGSA 4Q6WA 3RSSA 5K3FA 1GA6A 4DLPA 2UZ3A 1D6JA 4KWTA 2XCOA 3CUEF 4Y6OA 4C06A 1U3GA 4CV0A 3THYA 4DYDA 3HCDA 3ZDYB 5JDCC 2E4ZA 4LFCB 1E63A 1TK9A 3VZPA 1EBBA 3B85A 1E6MA 1HUQA 3F4BA 5CDTA 1SVIA 3I9NA 5IJ0B 2DLCX 1U0BB 3E8MA 2VWPA 4F5EA 5HKAA 1O0SA 4J43A 4IWYA 1ST2A 2MT9A 2BHNA 3NIGB 4DTIA 1Q50A 2H4XA 2OXTA 3VYRB 1DKQA 2NLOA 4QOSA 1RIIA 1NM5A 4WZBB 1YDHA 3F73A 3CONA 4KWHA 4OUDB 4UTZA 4HN9A 5DM0A 2F9FA 3M4JA 3RBVA 4PZ9A 3R5XA 3Q7TA 4S0ZA 4Y9TA 1KZYC 2FQQA 2M1ZA 4L8YA 4TGLA 3LK6A 4BMXA 5LMCA 2WJGA 1KIFA 4FXOA 3G5UA 2NZJA 4J6FA 2P6MA 4BOYA 1MW9X 3S81A 3QPAA 3U13A 3RADC 1A88A 2XTZA 2GYUA 4BV8A 1KZGB 2X8BA 1U8UA 1B7GO 3QBVA 4PYMA 4E5YA 4IDCA 3ZU6A 1RRFA 3K53A 2H2IA 1T2VA 5EZQA 4EO7A 4XUCA 5JQGF 3L7AA 5J59A 3W2TA 2HJWA 3V4OA 3RTAA 3IL2A 1RLIA 3K1AA 3GDGA 2FP4B 7REQB 5JHGB 1P39A 2LP4Y 1DIOB 2Y3IA 1EGHA 3AJEA 3MGGA 1O03A 4LHYA 1DRJA 3LDGA 1LDGA 2GD1O 2PK3A 5FOQA 4JI2B 4G84A 4HYTA 5KREA 5IM4F 2H92A 1TVCA 5B7GA 3SHTA 1TA9A 1LPOA 2R66A 1QVZA 2VK8A 1IJKA 2FMKA 4MARA 3IKTA 1VGQA 2UYHA 1ADCA 4CZ2A 1QH1B 1GTG1 4OB7A 4CLRA 4H7DA 4WLVA 4Y9RA 5IVHA 4CCAA 4U2FA 1BMTA 2E87A 3VVBA 5K0SA 1ZWLA 1MRZA 5EPOA 5SYAA 2OXIA 4PXYA 3UJDA 2Z6QA 2WU8A 2ZRHA 4OB6A 4OAPA 4QU8A 1UDBA 5FOUA 3ZGNA 1XTIA 5TT0A 2JI6A 5C4IA 4TKUA 4U5XA 3VSCA 3ROPA 3FXAA 1BW9B 4NFHA 1I3LA 1QUFA 2WD7A 4J4BA 1TJ3A 2OCLA 4GOJA 4EDFA 2QSZA 1U28C 3N2IA 1CNFA 4HGRA 1U1IA 2FEOA 4O25A 4PAQA 3NW9A 4Q1AA 2RCNA 4YUWA 2Y71A 3A11A 3P45A 2JLXA 5I6DA 1E2LA 2VCHA 3NC0C 5F5XA 5TRTA 3ML1A 2A2ZA 2GTHA 3X2SA 3OZFA 3QFFA 5AJWA 4C4SA 2R8YA 3S1LA 2OZLB 3R5HA 3NBUA 4GRDA 1KJZA 3MGCA 5C9ZA 1XLUA 4LN1A 2HHJA 3DBHB 1V2GA 4X84A 5KHAA 1HQKA 3S3TA 4ENWA 4Q37A 3KSZO 4LA4A 4LTMA 1RYZA 4D81A 1VXOA 3GRRA 5SICE 2NZ8A 1W5AA 2D00A 3AL2A 2ODTX 1RKVA 2BGLA 4QLAA 1TA0A 1JDVA 1ZPDA 2A5DA 4RZSA 4Y6GB 4D6XA 1FDRA 2BKAA 2QRKA 1M83A 1PD0A 3W04A 4KN8A 3F6CA 4KHPB 1XG5A 4NU5A 4RTNA 3H8SA 5DI3B 4D46A 4BUJA 3L4KA 1ZAYA 1BJTA 3RJ5A 5JAPA 4AX4A 1N7GA 2C9MA 2B9EA 2BKLA 5CGQB 3ANYB 3P52A 3KVYA 1PLLA 4OJMX 2V7XA 3L0SA 1BHJA 1PJAA 1PZGA 1ESMA 3IVAA 2FU5C 5AVYA 4OH7A 2NUAA 4RBNA 3E3AA 4UBNA 1QQBA 1S8NA 1KKLA 4EBBA 3ORQA 1NQUA 1DBRA 1F8GA 3LXRA 4H1TA 5IT0A 3F5SA 4KPGA 2W2VA 3QPVA 2BE7A 1P2BA 4OIFA 2PH5A 5H4HA 1Y6ZA 3VUEA 4B6QA 2J31A 4O2BB 4R1OA 5A9TA 3RO7A 2I4MA 1JL3A 2YNMC 2Z4RA 1P81A 5CDSA 2W6IA 3F4LA 4U9HS 4XLLA 1OWPA 2LR0A 3HA5A 4YRPA 3ZK9A 4LSZA 1K9SA 2PL5A 3I9KA 3LGSA 4MPPA 4H7FA 4Q39A 3FFWA 1YJBA 4N9QA 3N2KB 2DHEA 2OBFA 3KWFA 3NDBB 3DGFC 1TEZA 4D9EA 1H93A 3AUFA 4KGVA 4BO8A 3ZGXA 1VDZA 2JGDB 2HRCA 2ATIA 2O07A 3QSYA 3L0OA 2XH8A 4S3MA 5BPFA 3W6NA 4CF4A 2HLDA 1NLMA 5B6IA 1I7LA 4M8SA 1WOMA 4IXMA 4MJ3A 4IIJA 1KDOA 1JQEA 3WNVA 3PC4A 1T9KA 3C3KA 3SY8A 3UAOA 3OY2A 1PT6A 1YVPA 5TS2A 3NH6A 1R6UA 3R9IA 1IE3A 2NZUG 4QOHA 3KXLA 1COZA 5BW6B 1FW8A 5KSZA 1GQOA 1QJCA 4HWTA 5I7RA 2IYYA 5M34A 1YNOA 2R6HA 3FPSA 1WIWA 2ECQA 4I1VA 4IFEA 4GPD1 1P4SA 1ZHOA 3G79A 1G60A 1PRYA 1IOWA 3O8DA 3RASA 3UANA 3A06A 4IIVA 3AEUB 3W9SA 1UIMA 3R0VA 2O2SA 2WYOA 5K01A 1OTYA 1C1XB 3HGMA 1LLUA 2YZMA 5L9AA 4BNJA 3KD3A 4WT7A 1FU8A 3ETJA 3E1GA 3MT7A 3E23A 2FK7A 4LTDA 5EQFA 5JCJA 3SBXA 1D2GA 1R4MA 3CVWA 2VYVD 3ZN2A 1OTXA 1KI9A 2YBDA 4DDMA 1R8QA 4BNYA 4X8HA 3EE6A 3SD7A 2EVWX 3PQ6A 4F06A 5FH9A 4K9RA 3CWCA 3I5YA 2PUGA 1JDSA 2WWWA 3R5JA 2AFRA 4NS1A 3HWRA 1F48A 1S4QA 1D1SA 4DA0A 3VO9A 1OWOA 1DQNA 1RWVA 4LBZA 5DT2A 4UAGA 1DBSA 2WTEA 5IK2D 2CDRA 2OD7A 3E8XA 4CU5A 5FPHA 1IM5A 4M9ZA 3HR4A 4RDCA 4QPZA 4RHTA 2HQBA 5B1SA 1XELA 4BJ1A 2HQOA 1T5SA 4RL6A 1E4EA 1JH8A 2HWXA 2LGJA 3UPDA 1UEIA 3KAKA 3HFSA 5FNVB 4YXWA 1T3GA 3ICVA 4MP3A 2DUJA 3STTA 4UOQA 1IN1A 1UFOA 1G9SA 1U5CA 4KMRA 2SNIE 1S6YA 1Q1BA 3U3DA 3OCWA 4A15A 3OJEA 4F1KA 4F4JA 3HCRA 2R2AA 1C4XA 4HBZA 2V9CA 2ZJOA 2Q5LA 3HCNA 2PIDA 5H7XA 4KMMA 4DTCA 1H5QA 2CHGA 2A0KA 3D6FA 4LJ5A 2E5LB 1H4TA 2KLBA 1QIEA 4ZARA 4CFZA 2QJFA 4ER0A 2Q1WA 2KBFA 2VDJA 4TL7A 2HO5A 4G01B 1L5MA 2SICE 1V25A 4IHJA 4Q1EA 2AHOA 4K26A 3K09C 2VDWB 3Q3CA 3KTAA 4RQTA 3UAGA 2VJPA 4XRRA 5C81A 3L4BA 3LZ6A 3ZVNA 2XEXA 4PC6A 2QUBA 3Q87B 2RC5A 4Y0VA 3EFOA 3W06A 4JJEA 4XB6B 4J90A 2BGIA 1J90A 3BJZA 4BJ6A 2Z2KA 2WVJA 3NPAA 1SIUA 3IQDB 4C2TA 2J32A 4YLYA 1TRHA 1ZSVA 4U7PB 3JCZA 1W7AA 1ZM2A 3WWZA 3D8NA 1U7HA 3MUOA 4QASA 2WFLB 1OGJA 2C3MA 2Z9BA 3IJPA 1JECA 3VKWA 3C6KA 3ZZ1A 1QYDA 5F78A 3EIQA 3OIFA 3HPRA 1RBZA 2PT6A 1VHDA 2YY7A 2QTCA 3M4XA 1HRDA 5AOCA 4ZZ1A 3F0TA 1GRVA 2C8JA 2BKUA 2F1KA 3DZHA 3PJDA 4PCVA 2FWIA 3BXGA 3PX2A 1EXNA 3V1YA 4RTPA 1MORA 1CSEE 2J30A 3LYLA 2IZOA 3IPYA 3PIRA 1X9IA 5B1EA 5IABA 4B83A 1TW2A 3LPNA 2FX2A 3TNJA 3KJZA 2WT8A 2GFQA 4ZYTA 3NWEA 1B26A 5I4BA 3PLAE 2PA3A 1E1CB 3DEYX 1F8XA 1HLFA 3EGEA 1ZW1A 3F96A 2G8NA 1L1EA 3KR9A 1GPMA 1XV5A 1T8TA 4L4RA 4W8OA 1PT8A 5DOZA 3DP9A 1QRSA 1N8TA 1SIBE 1UZMA 1X3LA 2NZYA 4OHWA 2YJ5A 3HHPA 3EC1A 1M7BA 3LHDA 3ZNOA 3NO4A 5K8IA 2VA8A 2JK0A 1WF3A 3N8GA 1Z5OA 1QFYA 3O03A 4GOLD 1DC4A 4LWQA 4QXAA 3AR5A 4IV0A 1R0YA 1X9HA 1IHOA 4MAMA 4TRNA 4Y2HA 1E4EB 3ANXA 4UOEA 1NVWQ 1E0JA 2EEPA 2VUIB 3K8ZA 3QYAA 4YGXB 1L1QA 1KS9A 2WUGA 2AXPA 1N2ZA 1QQTA 2P1RA 4PR3A 5DN6A 3K1YA 4R9NA 3UM9A 1UZLA 1CQPA 1TVMA 3GFTA 3N70A 4UUQA 3A1EA 3EAFA 2COKA 2I87A 2VXYA 2ZYHA 1G8MA 2WAMA 3CVOA 3IO5A 3X2EA 4AY3A 2IEAA 3HM9A 4E30A 1AH2A 1VE3A 3I3SR 3PWZA 1M3SA 5EWJA 2ZR8A 3PF8A 3LWNA 4PHGA 4JJ7A 4UHDA 1N77A 1FFXA 1PNTA 4IDGA 5CPFA 4ZKEA 1OTHA 3SJ7A 4EUSA 3C41J 4KAAA 2PQMA 1KEZA 4DIKA 4YCCA 4OOFA 1CS0B 4G9BA 2WDPA 3M4YA 5EC8A 5FWDA 4U7DA 1EFDN 2C92A 1WQ3A 3NBMA 4B6FA 2VQFB 3SX4A 5DPMA 1QK4A 2DPXA 2XOEA 1FMJA 1ZEJA 2R1TB 3EK2A 2IU3A 1XTTA 3IOMA 4RWEA 4BNDA 1B1CA 2FFJA 3O21A 3DQQA 1WZUA 3SSAA 1ZRNA 5BUSA 3M0EA 2D7JA 3IPXA 1MAHA 3L5KA 4N0EA 1MVNA 5J4LA 1GG9A 3D4OA 3EQ8A 3PP8A 2P6NA 4UDNA 4GLFA 3V8BA 2Q3LA 1P72A 1CBUA 1W2HA 2CWWA 3ND7A 4MWEA 4X8LA 4YECA 4B46A 3PU6A 1EU1A 4G5YA 4L22A 5ICGA 5CM9C 4PLWA