4XX1G

Low resolution structure of lcat in complex with fab1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
210
structure length
210
Chain Sequence
SYELTQPPSVSVSPGQTASITCSGDKLGNKFTSWYQRKPGQSPVLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTAWVFGGGTKLEVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Fab1 light chain
total genus 36
structure length 210
sequence length 210
chains with identical sequence L, O
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1G02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1G01
1NCUA 2EICA 3BDYH 1XF5A 5FHAH 3HR5B 1RIHH 5I1HH 2X4TA 1WZ1L 3PP3K 3P3YA 4ORZC 3HAEH 3DSNA 4A2LA 4M6ML 4HKBB 1RZKC 1EEYB 5MI0B 3SDDA 2RBLA 2X4OB 4MA1C 3L3HA 5D7SL 5DRXB 3JTTB 1Q9LA 4C56A 2FJFB 3FO2A 4K2UH 4I13B 2K1MA 2VL4A 3I84A 4EI5A 2AI0L 3DO3A 2WIIA 4OLWL 4FG6D 5I0ZA 5JZ7D 2ICWI 5F7NC 1QKZH 1ZANH 3CK0H 4XPGL 2CRMA 3VD4A 2R2EB 3WXWH 4XMKL 1J11A 3TZVC 3HNVH 4Y8DC 2VTFA 1S7WB 2F54B 2Q7NA 4AT6A 4KJWD 3UEZA 2QQLL 2ORBH 3TZVB 3VGAC 3FKUS 2CDGA 3T2OA 1XZ0B 3DUUA 4MA7H 5C0EA 4HQQL 2H2PC 1TJIH 5A16A 5FUZL 1FNFA 4I3RH 1TCRB 4HGWB 3B9KA 1NBZA 4MCZB 3ARYA 5EBLB 43CAA 4W6WB 1BIIB 4PJFF 5IVZA 2QADD 5LXGH 3BP7B 1IEAB 2QQQA 3QZWG 3KPQA 4E41B 4EQ3A 2JELL 1YEIL 1JHTA 3PIQA 5A2KH 4FFYH 5EC1B 4EBQL 4CN4A 3UZVB 5C2BH 1VB9A 4LF3B 1KENL 2PCPB 3FQXA 3RDTD 5GS0C 4R7NA 1PKQE 2CUMA 2LAGB 2B4CC 2DQFB 3J7HA 4LPVA 3WN5C 2DQGH 2Y9RT 3OKKA 1X5XA 1UH2A 5KANG 2NZIA 2FEDD 5CMAA 4HQQH 1FL6B 4PJGA 4QGYA 2HKHL 1I8IA 2AW2A 3BAEH 5SX4H 5KZCB 5E8DL 2Z91A 2G2RA 1VPOH 4HS6B 5HHOD 5C3LD 4PREB 1K6QL 3OZ9L 1S5HB 2JCCE 3LB6C 2EDOA 4JR9L 2JB5H 1VKXB 5D1QA 5E2TL 1INDH 1AP2B 4NOFA 3FT3A 4LQ1A 4NCC2 3VWKC 3DHMA 3WFCL 1C5CL 2X05A 4CMHB 1SYSA 4RAUB 4FQIH 1QO3B 1YC7A 5C70A 1CYGA 3NN8A 3SDXB 3TBWB 1NMCB 5EU3B 1BX2B 4GQ9L 4NKQB 4AMKH 3QQ3B 3VXRB 5HVHC 3FO9A 4GG6B 4PD4J 4HCRH 4L9LB 2QL1A 1QG3A 4YBHA 1FO0H 1FJ1B 4PJ8D 5BS0A 5J11C 3LKNB 2OL3L 1S9YB 5KVDH 3LSOA 1LE5B 4JFEE 3CZFA 4PJXE 1T6VN 1R0AH 2NTFB 1S7TA 4R4FL 2VLRA 3HB3C 4V1DE 3O8XB 3IFPA 4F7CB 3LQZA 4TQEH 3VWJA 5K9JH 2X4PA 1MCPL 4OGXL 2VZ1A 5DDHA 3MLSL 3UTTD 1ZANL 4XPGH 3HE7B 5GZOC 4Z7NE 4JDZA 1TZHB 2HFEB 4YHKH 5BRZD 1MJ8L 3TJHC 1JNHB 1CR9H 1BMGA 3WUWA 1A7BA 1UWXK 4LASH 4KTEL 5C0FB 4GT7A 1IGFL 1ZHBB 5FYJE 3QPQC 3SDAC 1P4BL 1IC4L 5DI8A 5GGUB 2ADJB 2W9EH 3TBSB 3OQ3B 2UY7A 1G6RA 2GFBB 3QDJB 3WS3B 3DNKA 2NXZB 3CCHA 2NY6C 5IHZA 5T33H 1U8OB 3NCFB 4OCRL 2JB6B 5ID1A 3DIFB 1CXLA 1UADC 3LRGA 5FEBA 4HKZB 1A4JA 4JKPL 4GBXB 4NKOB 4Y5VC 1Z5LA 1NL0L 5E0QA 1S78D 3F8UB 4ZPTA 3O4LB 1MIMH 4PRHB 5BO1L 5T3XL 4Q74A 5F7KC 2BRQA 2FIRT 4MQ7B 4F7EB 3ILPA 1QZ1A 1INQA 5I75C 4M62L 3GJFH 2P5WA 4KKNA 3SBWA 4NWUH 4X7CC 3TBYA 3D0VA 3WFEL 4NRYA 2IC2A 5I16B 3KDMB 1T03H 2VDLH 3Q48A 4XAKE 5I18L 5LGHH 1H15A 4OD1H 5JTWA 3MV7B 4RGNB 5IHZB 4L9LA 2BSED 1CD0A 4RQQB 5EBWB 3GKWL 1FZMB 4LSTH 3O81A 5FM8A 3OJVC 1YEKL 4OFKA 1BZ9B 4OJFH 4YC2B 3GI9H 1WICA 4QHKI 3MYJB 5GJSH 4AEEA 2ZZUT 4R4ND 4CN1A 5DJYA 4ZS6D 4Z7WF 1SYVA 3IVKA 1QRND 2GW5A 3QIBA 4KK8C 1FGVH 1J0IA 4H1LA 4PJEE 4YNYB 5GS0D 3V6OA 2D3VA 1IGCL 4XMPL 3U1SH 2EO9A 1EHAA 2HFFA 3RNQA 1QSEA 1GC1C 3O4LD 2XQYG 2QSTA 2ZSWA 4X9HA 4ERSL 4B53A 5M7QA 3QQ9D 2FB4H 1DANU 4LCYA 4U0QB 2FX9H 3P4OB 4NSKB 4GAGL 3FO1A 4P4RB 5FGRA 4BH8B 4OCYL 2V7HA 3G6AA 4KQ3H 2V17H 5GGTH 43C9B 4ZFGL 3BGAA 4JY4B 1JGVH 4HK0A 2VWEE 1BM3H 3W82A 3FFDB 5TH2B 2J5LC 4KK5D 4KRPB 4HUVA 3ROLA 3FOMB 1CXIA 4MJ5B 3BKMH 4ZODA 5DURD 5IFAH 2VZSA 5KSVA 1A6VL 2VR4A 2I9TB 5FKAB 2A6KA 3MLRL 3KGRA 3QULB 1WC7B 3MMEA 4YHLL 1YEEH 4FQ1H 3QZWA 3VRIB 4MHHG 3TM6A 5EUOF 1WUNT 4P46C 2P5WB 4D9LH 2DLEA 4P2QE 3OMZA 4Z95L 1DLHB 2E7BA 3O3AA 2AXGB 4X80L 1EFXB 4LPUA 3RU8L 5DVMA 3TCLB 4PBVC 1MCQA 4NHUB 4KUCF 2VXQL 2NY4B 5HGAB 4YHNA 3HCVB 4PB0L 4O51B 3LPFA 4LNRB 4N8VA 2DI9A 2NZ9D 2AJ3B 2OP4L 5SWZE 3MFFA 1U8OA 4EUPA 4OLYH 4NO2B 5FIEA 5J13C 4PTUB 4NQDE 4LKXB 4U2ZA 4H0IA 4JFOB 4RBPK 2R9HD 5I15L 4UINL 3UJTH 3BP7A 1KBGH 4F15B 4KZEH 4EN3D 3V5DA 4LEXH 2MCPL 4WV1B 5CKGA 3R0MA 3ZTJG 1F6LL 2JIXB 4LRIA 4LCWA 4HUUA 1NGZA 3S35H 3TA3A 4G8GB 5EO0B 1MHHA 5JXED 5DD3L 1RIUH 2YRPA 2AQ2A 1WVZA 1NBYA 1MHEA 4JFYA 1SM3H 5DQJA 5IFHL 2RCSH 3O4OB 1RUMH 1T80A 1ODAA 1MF2H 4S1QH 3QIUB 3T0DA 4DN3H 3ZDZF 4PGJA 1HSAB 1U92A 5JOEA 2ARWA 5E2WL 5MEOA 4NSKA 4MNGE 4XVSH 5GS0L 2CDFA 3LZFL 3RWGA 2EECA 2DYPB 1A4KB 4Z76A 4M9PA 1INEH 1E4JA 3VXRA 1PJ9A 5JO5A 2IH3A 3RVVC 1G0XA 1VADB 3MGAA 3MV8A 5HGHA 5D71H 1YEJH 1NGQH 4JO4H 1C5DA 3DROA 3SDCA 5GXBB 3WLWC 3GSNH 1DEEA 1NGXA 4LLMA 2EXWC 4OIIL 4DOHB 5DJAB 1T2JA 3EOAA 1CICA 3TT1H 4M7LH 3MO1B 4HAFA 4Q6IB 1J5OH 1A6WH 3FMGL 1F00I 3KLAA 4YGAB 4P0DA 5FGBC 4PRID 2ICWA 4FQ1L 1KB9J 4FQXD 2NY0B 1FZMA 1ED3A 4QXTB 1ZGLB 1R5WA 1MVFA 4PJFB 2IFFH 3PWPD 5I1CH 2VZOA 5DJCB 3F7VA 3HI6H 4RMSA 5GGSB 3BISA 4JPVH 1IFHL 1SMOA 3QCVH 3MGOA 4W4OC 4AIZB 3LEXB 3V95A 1HE7A 1ONQB 4Y4HC 1JPGB 5LAXB 2JJSA 3JUYA 1LEKA 4XNQA 5JIIA 3T3PF 5J4MA 2JJSC 4NQEB 5HHNA 3HC0B 4Y4HA 3VFGH 2YPLD 2H8PB 4UILL 3SGDI 3BQUA 2D31A 1X5GA 1YNTA 1YNLH 5CJXA 1A02N 3PDDA 3BN3B 3UTZA 1KIQB 4N0UA 5HDBF 1HHGA 4HGMA 3PQYD 1T89C 1I9JH 3AS3A 1HI6B 2IBBA 3OPZL 3CVHB 3BP6B 3QUZD 4GS7C 1G6RH 3IDGA 1I1YB 5DFWH 1ZHKA 3VGFA 3ZT6A 2F54A 3JWNC 1EEZA 5MEOB 1MJJA 1OGAB 5C0DA 2R2EA 4XP1H 4U1JB 5DT1H 1UKSA 3SE4C 1UM4H 4LRNL 1T1ZA 3ARWA 3MACH 1RULL 4YX2L 2AJSH 3NPZB 3GMOA 1U3ZA 5DFVC 1F42A 2ZJSH 3UAJC 4D0CA 3SGKA 3VW3H 4CAGA 5JPMB 4UDTB 4AG4L 5LWYH 1E28A 2YKLL 1P5UA 4LSVH 1HQRB 3CNKA 1FCGA 4HS8H 5CJOH 3LOWA 3VGEA 1A7PH 4FQCL 3QRGH 5DLML 5J12B 3T65B 1S7QB 4X83A 1F4YH 4U1IA 3FONB 2O61B 1PDKA 2DQUH 4JKPH 2D0GA 1JK8B 2XY1A 1CG9A 2H3NB 3ZT5A 5CINL 1AGEA 3ZDYF 1KCSL 2B7DT 5KG9A 2FLRT 5JUEL 3AC0A 1JPGA 2YZ1A 3EKCA 4M6AA 4LQFL 4O5LH 5HYFA 2OJZH 4QWWC 3NIGE 5L2KB 4G7YL 3BRGC 4KK8D 3D3VA 1FIEA 2OSLA 4HV8A 5IM7A 5DJAA 5A2FA 2DQHL 5I73C 3CVIH 5KSBE 3QDMA 4DOHE 3PGCA 3SDAB 3QXUA 4MXVE 5ALBL 2VE6B 1B4JH 4NUJA 4JM4H 3L3DA 2X4SA 3S3PA 2NW2A 1NCWH 4ZUTB 2AV7B 3H7LA 5EO9A 2WBJD 4QXGH 1V5JA 4CMHC 4NC2B 1I3UA 4AEHH 3KJ6L 4JY4A 5F7FA 3WUWG 1HHHB 2VYRE 2IADA 3OTTA 3VH8G 3VFUB 1XIWB 4NO3A 1A9EB 3GSWB 3TN0B 3MV8B 4GRWE 1JUFA 4LSDA 4NZTH 5HGHB 3LEXA 4YDLB 3D85A 1DQJB 3LDBC 1AR1D 1RIVL 2NLJB 3V5KA 3C8KB 1LEIA 5EU6A 1NEZG 4NQEA 1R5IA 4Z0XB 4HT1H 1S5IH 2EIZA 3VGHA 1JWMA 1MWAB 1OCWL 1RHHB 4KK6D 2X7LA 5IB2A 3O11B 3IAGC 3WS6A 3LS5H 3I6GB 2DL9A 5F1IB 5LJYH 1P4LB 2CRIA 4KGLA 3NA9H 2PW1A 2CLVA 1S8DB 3ARFB 2NY2B 2GK2A 3I3BA 5HGGS 1A3LL 3D3VE 4KHTL 4ELMF 5B39B 2VQ1A 3T1FB 1IMHC 2C7UA 5BVPH 1A1NA 3GK8L 5CWSA 1M05A 2FGWL 3DXAA 3PGFL 3EOBA 3NGBB 4LKXA 1D5IL 5JMOC 3GMRB 3MRLA 4IJ3C 5I8EA 2FWOB 5ALBH 2FJFA 4C56B 1TENA 5ESQA 1IGMH 3P0VH 2APBA 4PJAA 3I6KB 4MS8D 2VXVH 3ARXA 4N1EA 3M17B 5I6XC 4JO3L 3GHBL 1I4FA 2IAMC 2C5DC 1UT9A 4NNYB 1NUFA 1TIUA 2G5BA 3HAEG 1RZKL 1U92B 3BYYA 3HC3H 5F3HB 3WN5B 4YAQB 1M1SA 4TRPH 5DO2C 1JZ8A 5I30L 2VN4A 5E5MA 1MAMH 4CMMA 1RI8A 3F12A 4MA3A 1NCCL 4NUGL 1KCSH 4TOYL 5IW1A 4M6NL 1N6VA 3BUYB 4OT1H 4HLZH 5IB5B 3ULUH 2R1XA 4WENB 1MCFA 1T7WA 3VXPA 3IFLL 4JFDA 2NY6B 5DD0L 1IGIL 5CBAB 4ZUUB 5E5UB 3P0YL 2HWZL 1DLFL 5FGSA 4EVNA 3VRIA 2VZUA 3OB0K 4FQCH 4MJID 5I1AB 4PRIB 1LD9B 1NEZA 2XFXB 3EO9L 5IKCB 2YKLH 3SGEH 3VG0H 1FYTB 4OZIF 3MOBH 4P57A 3NTCL 1OAXH 4G8IB 1MLCB 4L4VA 3UYOD 4OZ4A 2YD2A 3CFCL 2XXCB 4NM4H 5EH1A 2AJ3A 1YYLL 4AQ1B 1PKQB 2P8MA 2YUVA 1Z3GH 1UYWH 5HYQB 4JREB 4ZAKC 2VXUH 3WNOA 2BZDA 4KHXL 1EH9A 3U9UB 4RIRB 2EKJA 1T0MA 4QHUA 4YDIH 5GJTL 4ZDHB 4X98B 3AVEA 4IRSB 5EN2A 3CZFB 3H6JA 1NFDE 1TJGH 2CJUH 2FL5A 3GB7A 5B8CB 4DGIL 1WZMA 2PXYC 1QBLH 3JV4B 2EYTB 1EJ6A 4MAUH 4OLUH 3G6JF 4WW2F 3CSGA 5CJ8A 3MZTA 1N6UA 4BELD 4JRWA 4ODUB 4TYUA 5BZWB 4J7RA 1OAYH 1I9RL 1CLYL 5TH2A 3SJVD 3QO1B 3IB4A 4JFXA 2FJHB 4X7EC 4EUPG 2AEWA 1KLUA 1NCNA 1G9ML 3CU7A 5DYOA 1T7VA 1T5WA 2Y6SD 4DJMA 2CO7B 3KDMA 2DQHH 3MRDA 3DBXA 4PJ9C 2DM7A 5T1LA 3X12B 1T4KB 2VIRA 3VCLA 2D03H 1QR1B 4MA3B 5IW1B 5IB1B 3NIFF 1MH5A 2Z31D 4D94A 1OF2B 1NBVL 3MXVL 1BJ1J 1DP0A 3P30L 5CGYC 3UYRL 5TQ0L 2W0FA 1OTSC 2ZUQC 5DQ9A 5ANMB 1A22B 5MEQB 3HUJA 3QIWA 4GMTL 3QEQB 1KEMH 4X5LA 5E8PA 4KJQC 3OBAA 2V5YA 4ODVH 2UZXB 2GTZB 3RWIB 3T2PA 4XH2B 2A77H 5IR1A 1EJOH 4URTB 1HQ4A 4OCSH 5DD1H 2Y36L 5DEFB 4OCNC 4KMTL 1NFIA 1HKLL 2DQJH 3BYTA 2R4RH 2MWCA 5IMLB 2J88L 4YFLF 3QDJA 3WS3A 5CBAA 4Z7VF 2OR7A 5E6ID 5GGQH 1QNZL 4YXLH 1OAKH 2IGFH 2UZYB 4Y16D 4YBQC 1U8KA 3BP4A 3QDAA 5EB9A 4QRRD 5FUOL 1DEDA 3CSYA 4AT6B 4KTDL 5ESVA 4LDEB 1JWUA 3RWIA 2BVQA 5E1AA 3UZQA 2E9WA 4N90E 3MV7A 4PJCF 3WS6C 5D7JA 2AAVA 2J6EA 4O58L 1TQCB 2CKBH 1P84K 5FECB 2X9YA 3O6ML 2AK4A 4D3CH 5ID1B 1X7QB 1JGDB 4JZOA 1FYTE 5D7IB 2X9WA 1UJ3A 2VLRD 5D1XD 1U58A 4K7PL 3DGGB 3QEHA 1XGTB 1UM5H 1ZSDA 1FVCB 3UJIH 4MSWB 1SJHB 5EO9B 1KIRA 5F97E 3RIFK 4HWZB 1BVZA 4KZDL 2AXJA 4Y1AD 3S37H 4PLNC 4BZ2H 3REVB 2B0SH 2FHCA 2F58L 3GBML 2IMMA 3HR6A 1A6PA 1NCDH 1U91A 1N59B 3C08H 4JFFE 4PJ7E 1X44A 5F6HJ 5GGUA 4PBXA 5L2JA 2YD4A 4YEEA 4XBPB 3VXTA 1NFDB 2NX5D 3QDME 2X7LB 3H7BB 2VXSL 1R3IH 3NMEA 5HGBA 3LV3A 5GGRB 3T09A 3WIHL 1U8LB 3B3IB 3B6SA 2EEBA 5E8EB 2D9CA 2DBJA 5MEQA 5C07D 3V6FA 3EJJX 3U9UA 5DK0A 1BJ8A 5K9OA 4HG4K 3IFPB 3MREB 1OP3H 2AP2A 5IHLB 4TTDC 3BW9A 4P3CL 1DANT 1IGTB 1NC4B 2ADGB 5IT2H 3QQ3A 4MCZA 5EBLA 3H0TB 4JRXB 5AG8A 1FFPB 2EIBA 2NY1B 3RHWF 1F3DH 2C4XA 2C1PA 3CH1A 3LSOB 1K8DB 1CFQB 1KOAA 1I3RA 2R1WB 4OCXH 4XPAH 3P9MB 2J7LA 3FB8A 5SWZA 4JPWL 3MR9B 5D70H 1I7ZA 4NZJA 1QR4A 5EULV 4JVPA 4ZUSA 1MCSA 1BIIA 5IVZB 1DQDH 4X6CF 3WKMH 5JHLH 3FRPA 3C5SB 4L8BA 2J3SA 1Z6JT 1SJVA 4Y4FA 5K9QI 4L3AA 4UT7H 1IJ9A 4U6YB 3T2NH 3VWKA 3DXAE 3X3FL 4L4TB 2VLLB 4PGCA 5FYJU 1PLGL 5D96C 1L6XA 4ODHH 2APXA 4HZAA 4NDMB 1LO0L 1JJUA 2M1KA 3ULVC 1PZ5A 5C0AD 4CADA 2OTUB 3SY0A 1X6LA 3WMSA 1P2CB 3CX5J 2O26U 4Q2ZA 5BMFH 2XRAH 3MR9A 3SDDB 2BXYA 2CKBL 3ZKNC 4GRLA 4GXVL 4NQDB 4OF8A 1XF3B 4G8GD 2Q6WA 3LKRA 2A77L 2GY5A 3ZHKA 4H26A 1IGJB 4HFUL 1J1OH 4PRHE 3U4BL 3MJ7A 2DDQH 4V1DD 4IRJB 3HZYB 3GKWH 1G7IA 3GSVA 4U1LA 4KI5D 1AFVL 4Q9QH 3GSQB 1U95A 2IGFL 3O3DB 4OM1H 1XZ0A 1XCTB 3DUUB 3A6OA 4ZSOA 4CU7A 1E6JL 2A0LD 5I8CA 1WCBA 1OTUD 3VXMD 2A6IB 1FGNH 5IHUL 4LU5H 2I07A 5J9PA 3OXSA 3RVUC 2PF6A 3F7VB 1IKFL 4XBGB 3LIZH 5EPMB 5DQJB 3EDDA 3P77B 1WISA 5HGBB 1PEZA 2MHAA 1ZGLA 2HVKA 4MB4A 4FHBD 1T20A 1TPXB 5ALCL 1MIML 5F1NB 4XBPA 3NFPA 2OQJA 1YMHB 4X4XA 5KJRL 4KJYA 4XX1E 4IDJL 4QHMB 3RWDA 4YXHL 5DC4B 1CE6B 5BV7B 5CKAA 2UZIL 4GOSA 3QUKB 4P23B 4LSRL 3OKOB 4L3CB 3MLWH 1FZOA 5TQ0H 4X5WB 1JGUL 4K7PY 2XT1B 2ICEB 2G5BB 4LLQA 4EOWH 1ES0B 2KBGA 5D2LF 5ESAB 1XGTA 2L7JA 5ANME 5GRYA 1G7MA 4V1DB 4KTEH 2IAMB 3CXHJ 3OGCB 1BFVL 1RU9H 4O4YH 5ACLA 5DA4A 2HJFB 2NW2B 3TH4T 4AENB 3QFDA 2W9DH 1DQQA 1E4KC 4Z7OE 3QXVA 3H42H 2H9GA 1IBGH 3BZDA 5EPMA 2XWTB 3G5ZB 1SMAA 1VACA 2GI7A 3ARFA 4YO0A 3LRHA 1DUYA 1W72B 5BOPA 4PJ9D 2EDWA 1RV6X 2HA1A 1IL1A 4HJGA 1FGVL 4OUUB 1KXQE 3UTSD 4NHCH 3WXVH 3FQRA 2ESVE 1IEHA 3HB3D 4NFDA 1KB5L 1OP5K 5IMLA 2FO1A 1W8OA 5DD0H 1H5BB 3L5IA 1UEMA 4WU5B 3JWDL 2OXGA 1I3GL 5DEZA 5BJTA 2IH3B 3G6AB 3Q1SL 1RJZB 2VLMD 4M6NH 3SJVE 2I9LA 3CLEL 3L5XH 3DMMD 5HHMD 2Z93B 4CADB 2IJ0C 1RFDL 4NNPH 2HJKB 3SJVB 3MOBL 3P4NA 1TJHL 3ARZA 3B3IA 4PR5B 5FGBA 3IDUA 4G6ML 4X6CA 5IUSA 3MTRA 1J86A 3MROB 2YD5A 1KACB 4D0DA 1GSMA 1MPAH 3L3KB 4LARH 5L0QC 1KTLA 5DK0B 4IHOB 5F9DC 1R3JA 5JPNA 2AKRA 4U1MB 4G7VH 1KNOA 4OF5A 2LABA 3D9AH 2XACC 1FFOB 3PDOA 1D5IH 4E41D 3FFCD 2YD1A 4HKXA 2E6QA 1BQHG 3MRJA 4PGEA 1G7JA 1B6DA 4TVPD 1RURH 3EDJA 3GEWB 5KG9B 4N9OB 3V5DB 5F7DB 2VSDA 1D5MA 3ORJA 4JVWA 2XKNB 5JQHC 2R1YB 4X6DB 1IC4H 1CG9B 4WHYH 5KBNC 1ZHNA 1UJ3B 3MLXH 4ODWB 4OGAC 4QXUH 4I0CC 2XYCA 3BJ91 5CILH 1H3WM 2BDNL 1I1FA 1Q0XH 4P4RA 5HI3D 5JOFB 1WFUA 3MOAH 2ORBL 3H9SD 4QNPE 1LEKB 4OI8A 4PRHA 5H94A 4JFEB 3FQUB 3JV6A 3TYFB 3GK8H 5I1EL 2VAAB 2JLLA 3D5OF 2CRZA 2F53A 4LHUB 5BZDB 3FAWA 4KJPD 1Q72L 2FHFA 3TIEB 1GC1L 4NNPL 2E7MA 4YC2C 4BFIB 4JJ5A 3H3PL 4AYFA 1F45A 1JNNH 2DRUA 2YPVL 4EDXB 4IBLT 4OQTL 3TC9A 3QEGH 3TN0D 2BDNH 2PYFA 1I8KB 4Z78B 2BMKB 4WTZA 4WFGD 1JPTH 3SGJC 1BOGB 4RNRB 2YPKB 4I18A 3ARBA 1A64A 3LHPH 2YN5A 3I6LE 4AMKL 2I25N 1HKFA 4P4KD 3PWJA 4NCDA 2WBWB 1N4XL 1N8ZA 1U8MB 4P2QD 1G0DA 2AK4D 2HG5A 2MQ3A 1YUHB 3WHXB 1KCUH 4LEOA 2R0WH 3VWJB 3TP4A 4KK5C 4PB9L 3TIDA 3MLZH 4LCYB 3S9DB 4OV6F 4I1NB 4GRWH 2DIBA 3DGGA 3QEHB 5DHYA 5EOQL 1UA6L 4XNMA 5IVOA 4QHLA 1MVUA 2AEPL 5C8JB 2FO4B 4U1SB 1L4IA 1CE1L 3RWEB 1S7UA 2J5LB 1F4YL 1RU9L 4PGDB 4UV7H 3VD3A 5JORA 5J57B 2ICES 2Z0BA 3WLBA 1ZHNB 5C2BL 4K9EL 5E94B 2EDNA 4Z7QF 2BCKB 3IAQA 1HN1A 3C2SA 4PRPD 4HMEA 5DTFA 5L88H 3PF2A 2P48B 5DSCB 4C55A 3LVEA 4QF1A 5GQBA 1C08B 3VGBA 4TVPL 1J9CT 4P4KA 5C0BD 3NZ8B 3HMWL 3H8NA 3OL2A 4NQVB 1EVTC 2K9UA 3ARBD 5E95B 1G7HA 4APQA 2F53B 1AI1L 4LIQL 4GRLD 5E9DE 1I3VA 3L5WA 4Z7UE 2C1OB 3O2VH 4U33A 3LMJH 3OKKB 3FTGB 1A7QH 4Z77B 1GGBH 5C0BB 4P2OD 3C8KA 1A7RH 4QT5A 4GJTB 3L5JA 2IPTH 2VL5B 4K3EL 2OI9B 1Q9WA 5F44A 2EH8H 4ETYA 4U31A 4XMLH 3VFUA 5HYSB 2GSIB 5CP7B 3M8OH 1NBYB 2ADJA 4ZUWB 5FYJL 3DVGB 2R0ZL 3MLVL 1TNNA 5C0AB 4G8IA 3K2UL 3S88L 5BZWA 1BX2A 3WHXA 4HUUB 1JZ3A 3ARRA 3D18B 3VFMA 2WP3O 1UM6H 4S1RL 1A3RH 3GJFK 3VI4F 2ZCLL 1G6RL 5DC0A 5ISZD 4XCCL 2ZP0T 3BPNB 5D93B 4NQXB 4U1MA 3MBXL 2GEEA 4CVZB 5FYJD 4LCIH 5H2BB 3RWFA 4DKAA 4NC1E 4Z7QE 3OAZK 4Z78A 1ACYH 1KPRA 5C0DB 1B2WL 4NQCD 1JF1B 1MFEH 1NCAL 2Y25A 1DDHB 3QFDB 4F7TA 5KAQG 3N9GH 1NANH 3VXMB 1QSVA 4GS7B 5FK9B 3I75B 2Z4QB 1MCHA 1MI5D 3NCJL 5AUMB 4ZDHA 2DM2A 4AEIL 1FHGA 3F62A 4E9LA 2MKLC 5HGAA 3PWVB 3QCVL 3WJJC 5BS0B 5J89A 1AFVH 1XCQA 2VJXA 2HFFB 4NQCB 25C8H 2IBZX 1H8NA 1I4FB 3U4BH 5CJQH 1IM9A 4NRXB 3CFIC 4WNQA 2Q86B 3OX8A 4POYA 1L0QA 5I8KH 5GHWH 2BNUA 2NY0C 1QO3A 3MLYH 1TFHA 4DW2L 3FMGH 3THMH 1MFEL 4OCMC 3W9DA 4RDQG 3ZHDA 5ITBH 3X11A 1KPUA 1UM5L 1CLOL 4Z0XA 1CLZL 1C7TA 4QXTA 2Z8RA 3BRDA 1TXKA 3K3QA 5FF6A 1MLBA 1YNKL 1KT2B 4KROC 1RUQH 2KQNA 3V6ZB 4OLVL 4IRZH 4JRYB 1GPOH 4Z7WB 4LSUL 4ONFL 3ZO0A 3ZKSD 4RZCB 3MRHB 4NJAH 2EH7H 2L0DA 4YPGB 3C6LB 5I8KL 2Z31B 1NMBH 2ITDB 4WI7A 3QEQE 3T77B 5JPNB 5CUSL 2FYYA 2DBLH 4HUWB 1NBQA 3QHZH 2JIXD 1FVDB 3LCYA 2DLIA 4HX1A 4NUJB 3C6LC 1YUHA 2NXYC 4J1UB 4XVJH 1RUML 1U8NB 3FZUD 5EC2B 3BD5A 1ZA6B 4FQ2H 4K8RD 3PG2A 4JDVB 4Q6YA 5GRJL 2X5PA 4UMGA 4I8DA 5L2KE 5DJ2A 4Z7WA 1B0RA 1OTTC 1A1NB 3S88H 1GZPB 2Q3AA 3PE9A 4Z7UF 4EJ1C 3E6HA 3MBXH 3V7AE 1R5IB 2W92A 2HVJA 4GLRH 3O8XD 3DMMB 1KJMB 1FLRL 2WINB 1HYSD 1Q9OB 2NR6D 2ZCHH 3O11A 5IQ7H 3VXUB 1I7ZB 1Q8MA 4R26H 1A7RL 1NBVH 5FV2A 3OR7A 1T7XA 3SDCB 1N6QL 4HMDA 2XIDA 1ZS8B 2Y4SA 1UZ8B 1HQRA 3T3ME 1H3TA 3FN0L 1DFBL 2ZPKL 4WHTA 4XMLL 5T1LD 3OHXA 1LE5A 2VH5H 3LN9A 3QXDA 5DJXA 4KQ3L 3R06A 4F57H 1EJOL 3AY4C 3KPLA 4NC0B 4V1DA 3B5TA 1GGIH 4JFDE 2DWEB 1OW0C 5CCKH 1E4KA 2XA8L 3FCTB 1NUNB 5CBEA 4ERSH 1I9RH 1ZEAH 1D6VL 4S1RH 4JRYA 3C6SA 1T3FA 5L2KA 4ZS7H 4EXKA 4PGEB 1JPFB 1I8MA 1FNSL 2Q8AH 3EFFA 1AI1H 5IOPB 2VDQL 1UACH 1EFXA 4N5UA 3UTPE 4G9FE 2KKQA 1FDLH 1NC4D 4CVZA 4X7SH 1YJDL 1DVFC 5HTSA 4ZFFA 2A2QT 4KRPD 4ZNEE 2EH8L 2YD6A 2FEEL 2VLJA 3B8SA 5FM5M 1IQDA 4YDJA 5E8NA 4R90L 1CE1H 1U95B 3O3DA 5CSBA 5FYKL 3QQ4B 1GZQA 3UMTA 3O2WL 1K8DA 3VFMB 4S11A 1JV5A 2ADIA 3HZKB 4FRWA 1EEZB 3HZYA 4WRLA 3VWKD 3QEUB 4HC1L 4XP5L 2ILLA 3RKDD 1YECH 2DTSA 1XF3A 4XWGH 4MD0B 3U1SL 1ORSA 1U8JB 2ATKA 1YZZA 1T03L 4IRJC 5DD1L 4NC1C 4LFHD 5DUPH 4DKDC 4YHMH 3JXAA 5GRXG 5FECA 4R96A 2WINA 4I2XE 3B9EA 5HHNB 3I75A 3FTGA 3O41A 3TBWA 3MLZL 3KLDA 3I85A 1U0QA 5KSBF 3BIAX 3MRBA 4K3DL 4L4TE 1Z3GL 4Q2ZB 4APQB 1B0RB 1HWGB 3QIBB 2DJUA 5T5FL 1NCCH 5B3JE 5JNYB 5EBMB 3ULUD 3MV01 3SKMB 4UV7L 3E6HB 3BGFB 1SVCP 5IMMA 4OM0H 3RI5K 2WANA 3NACL 4HSQA 1NFIB 3QFJD 1PX4A 3GSNA 3NCMA 4K71C 1MCCA 2WV3A 5D7IA 3N1FC 3WIFB 1LK2B 4CU8A 2NYYD 4JANB 2ATKB 2A73A 2QKIB 1N3NB 2DLGA 5C0NC 1A6AA 3V6ZA 3WFBL 5DJZA 3HAEA 2XKSA 4X5WA 3WSQL 5I1JL 1DQLH 5DUML 5FHBH 1WJ3A 3RUGE 4Z76B 1TTFA 5FOBB 1CDYA 4BM7A 4P2RA 3MCG1 1CWVA 5GSVA 2BNQA 2HMID 3EYQC 5KVDL 1C16B 5F1NA 1NSNL 5J6HB 4C4KO 4OQTH 5GRWA 1Y6KR 1YPZA 2DQTL 2VQUA 3D39B 1DUYB 1W72A 1XGQB 4ZAKB 5DS8A 1FFQA 1CFTB 4OGYH 1KJMA 2EDFA 3D25A 4P4KB 3IDIA 4WGVB 3O6FD 3C9NA 5BOZG 1GZPA 1FG2B 1GH7A 4DUWA 4WFFD 3WFBH 3VI3E 2ICWB 3CFKB 4XGZB 3V5HA 4XH2A 5IR1B 2NNAA 4JREC 4HPYH 4JZJA 2X4UA 4NKDA 5DRNB 2WBJA 1K3ZA 5E03A 4OZFG 3V6OC 1NAMH 2HKHH 3F6LA 1E4XH 1KIRB 2BNQD 4ZTPH 3RZCC 3UTSB 3T4YB 1HSAA 2PXYD 1FVEA 1ND0A 2ED8A 2B4CL 4I4WA 4R9HA 1C5BH 3U46B 1FZJA 5DHYB 4PG2A 3IJYA 3BO8B 3CJJA 4LEOB 3RVWD 5F70A 3TA3B 5EU7E 5IVNA 4KRPC 3O2DL 4QHNA 1DL7L 2B2XL 2X1QA 4G5ZL 4L9LC 5GZNC 4BSWB 3BWAB 4XWOD 4FNLH 1HDMA 3O3EB 4GMSL 4WUKL 3TBSA 4JPIB 1I9EA 4OFPA 4NO0D 3BESR 4LAJH 5C2UB 3SQBA 3VU2A 2Q7YA 1GVIA 4JG1L 1JE6A 3G04A 5BQ7B 1F90H 2R0KL 2FBOJ 1J87A 5H37G 3D69A 4QTHA 1S5HA 3U7AA 3KYMA 4WCYH 5GGTA 3U0WL 5EC2A 3WO4C 3CDCA 1MEXH 3DARA 4G3YL 1MUJA 4TVSa 2CRYA 4RWYL 4J8RA 1ZLVK 3TZVD 4Q7DA 5BZDA 1T0PB 4QCIB 2H26B 2XNAB 4NQCA 3GMQB 4RFEA 3FT2B 4DTGL 4OM1L 5IW6B 3REWA 3S4SG 4ZMAT 2XQYK 4IIQB 4D9RE 2X44D 4PJBB 4BQBA 3A6BL 2V2TB 3EO0B 5E8EA 3TV3L 1PBYA 3B2VL 4YHML 1N5AB 2CXKA 5DT1L 1UACL 2J8HA 4K55A 5HYEA 2DLHA 3O6LH 5ALCH 4PJDF 1WIPA 4GKOA 4R3SB 3F58L 3DUSB 4PJ7B 2AXGA 3CVHL 3NCEB 2C7UB 3V4UH 4OSUH 3DURA 4P5KB 4PJEB 1RVFL 3KHQA 5EBWA 4QRSB 2HKFH 3MRMB 1NMCC 4ODUA 3HNSH 4H25A 3PQYA 3O2WH 5FDWB 3WUZA 1HH9A 1VSCA 3G5VA 3O8XC 4F57L 3TFKC 3O4OC 4MDIA 1DJSA 1CU4L 1S7UB 5CEZE 2AEIT 2F8OA 1KLUB 2VH5L 2V9RA 4S2SB 1FFOA 3PDOB 3BQUD 1UWGL 3MACL 5SX5H 4H1LG 4EKXA 5C0AE 3G5YA 2W91A 4RISH 5J1SC 1T1XB 4TPRH 4JFDD 1GCFA 1FNSH 4PGDA 5CGMA 5C0JA 5I1HL 3U7WL 5B8CA 2V7HB 2IH1B 1A3QA 3RZCA 4NBXB 2ZCHL 3FB6B 3ZSSA 3S4SA 5MHSD 5SV4A 4N5ED 1QRNA 2HH0H 3R1GL 1LO3L 2V2TA 4LSQL 4L4VB 4PJCE 4OF6A 2FSEB 4F7EA 2P5WE 1RUKL 1N5YL 3QDGD 4X7TA 2PXYA 4PJ8B 1EEYA 3MNVB 4GG6F 3KYKL 2IAND 2A6DB 5HHVL 4PRIA 5T3ZE 2ZPKH 3VXUD 4PG9B 3OG6B 2Y7QA 2VR5A 2CK0H 2JCCA 4ONGL 3BWAA 4QHMA 3RWDB 4ETQB 1L9NA 5LG1A 4FQ2L 1XGQA 4ZAKA 3NCYP 4AG4H 1JN6B 4P99A 1MCWM 1KCRL 4XPTH 3C09C 4O2EB 1WQVT 1AGCA 3P9LA 4JN2B 3LQZB 5DMYA 4Z0BH 3X3FH 1BAFH 3VXRD 4HFUH 2F5BL 5DWUH 1OM3L 2M2DA 1ZMYA 4GAJL 2FX7L 1MHPH 2FBJH 3BKJH 5T1DL 4ONFH 4LHUD 1GPOL 2ED9A 3L3IA 5HI4D 3TYFA 4PJIF 3ET9F 1X4YA 3AREC 1LNUA 3UJIL 5ESQB 4R0LA 5HPMA 1CGSH 5IB1A 5EU6D 4TUOB 3TIDB 3QG6A 1ZHBA 3E3QC 4J12A 1JHKH 1VERA 2OR8A 5DYOB 2AEQH 3ILQD 3MQIA 2B1AH 3WKML 5JHLL 3MCKA 3G6JB 5FYJH 3W11C 2R9HC 3VI3F 4TN9A 5C3TA 3F6IA 3Q5OA 4OLVH 1ORQB 3SO3C 4R3SA 3VWJD 5EWIH 2ARJA 3EYOB 4JFHD 3W2DL 5E00B 1T2QH 3IFOB 3KPTA 1FRGL 2KH2B 3E2HB 4GQPH 4PY8J 5FKPB 1CGSL 4J3UA 2DS4A 1LDSA 1NUDA 1QSFD 4XP4L 2Z93A 3FB6A 2G2RB 2BVYA 3LMJL 2LVCA 3DWTA 1S9YA 1JIBA 4JG0L 3JV6B 3BZEB 1HEZB 4X0KA 3IT8D 3STLA 2GK0B 2GHWB 4IRJA 4GAJH 1OM3H 4M1DL 4D9LL 2FJGA 1MFDH 2PCPA 5D71L 1R3LA 3KPRB 3ZYJA 1KLGA 4KY1L 3D85B 2HLAA 5SWQA 1XH3B 3TVMD 2ITCA 5EZLB 2WBKA 1HHHA 3FHQA 1IEAA 4E41A 1E27B 5GGSA 4D8PA 4R2GC 4ONGH 3LEVL 2OP4H 5L7XL 5I1DB 1LK3L 1KN2H 3QCTL 1DVFA 3DX9A 4QOKD 4S1DC 5J6GB 5J13B 4MXWH 1I8MB 4M8QA 4DN3L 4P9HC 5E4IA 4L3EA 2EIDA 4N8CH 3V52H 4X4YA 1TITA 1QNZH 4BFIA 4U6HB 4F37F 1OP9A 3BKYH 3CFJB 2Z91B 1SY6A 3K8KA 2JE8A 1A3RL 1GGCL 5KN5B 5F3HA 3WN5A 4LDOB 4YE4H 1QSED 1HZHL 4U6XA 1I3RB 5GRVK 4FTVB 5BS0E 4UDUB 2H1PH 4BFGA 1X5ZA 3RVWC 1AGDA 1A6ZB 1HCFX 4P9HH 3DLQR 4JPKL 3BIKA 4PUBH 2IQ9H 3MRGB 1FYTD 3RIAF 4P46D 3H3KA 2P5EB 2E9IA 5CWSB 4OLYL 3L3OB 4KQ4L 1I75A 4EVNB 4IS6A 3ARFD 4JKMA 4X8JA 1JNLH 4G3YH 2OTPA 1U8LA 2R4RL 2Y06L 4AM0B 2IG2H 4WCYL 3GRWH 5E00A 1U93A 2DQJL 1KSRA 5EOTA 4G6AC 3NAAL 2CH8A 4ENEC 2VLKD 1QYGL 1FPTH 4GXUM 1IC5H 1MHCA 4ODXA 1H5BC 3PV6B 5ILTL 3TLRA 1XGYL 3TV3H 2Y5TB 1QBMH 4I77L 3UJJL 2NCMA 4OZGA 4GMSH 4WUKH 2X4OA 1ZHLB 5E2VL 3SGKC 1IT9H 3DETC 3BKML 5IFAL 3MGTB 4OI7A 1NLBL 2AERT 4JQXA 4PJHB 3H9YA 4AL8L 1OARL 3CMOL 1F2QA 3SDDC 4YDIL 1LMKA 2OBGA 4NGHL 4M1CC 4XC1H 5B21A 2V5TA 2C4FT 4H8WL 3EO9H 2YZ8A 1UA6H 1NUGA 3PGCB 1FZOB 1NAML 1HHJA 5DMKA 3PHSA 3GJFB 4NKIL 1MH5B 1CLYH 3E6FA 4X6EB 5KAQF 4QY8B 2OSLB 3TFKD 5TQ2L 1MQKH 1P4LA 3QULA 3I9GH 4M4RA 4DK3A 4YO0B 3QEQD 1P53A 5T33L 1CFNA 5IJVB 2NY7L 4KDVA 2HWZH 5JW4R 4PJIB 2Y7QB 3EYUH 4HZLB 4XCNB 5I30H 5A3IC 1PG7W 1FZKA 4J3XA 4ELKB 4HK0B 3BW9B 1JPTL 2P5EA 5DJDB 1WSST 4PD4K 3MA9L 3TGXA 2D2OA 1JUFB 3BZ4B 4F7MA 4PJ8A 2ZKHL 5K9OB 4MD5A 4OT1L 1QSEE 2G9HA 4ONOA 2LE9A 4OLXL 4HCRL 1P9MA 1P4IH 1R3LB 1QPPA 4WNQB 4JHZA 3AS2A 3KLHC 1BZ7B 5E9DA 5JIKA 2VC2L 4XT1C 2HTLC 4Z7UA 3MBEC 5C0IB 2DM4A 4XXCC 3HUJE 5I1EH 2GYSA 3AY4A 4NT6B 4PRHD 4DZ8B 4DGYL 1ZVSB 5ITFB 4PTTB 2BSRB 5D1QD 2YR3A 1QOKA 1MNUL 3LPGA 3MBEB 2HP4A 4ZFFB 4NPYB 3RVUD 3U0TA 1YMHA 1I7UB 5DXWA 4F2MA 3QUYD 1T6WA 5GGVH 3QR2A 3LS5L 4WO4A 3LB6D 4LCWB 4ODBD 5CILL 1AH1A 1SVZA 1EDQA 4PP1D 4X4ZA 3H9SE 5T1KD 1DBJL 5MHSE 2Z9TA 4WTZG 3V4VH 2Z8WC 3PGDB 1SEQL 3O0RL 1F4AA 3UPRA 4XNUH 4GQ9H 4H88H 1K8IB 4LVOC 1VA9A 2P8LA 5ISZA 2XTJB 3WSQH 3B4NA 3W9DB 4Y7MA 4NJ9L 3Q1SH 3QQ9C 4MJ4A 1OARH 3GSUB 4LBEB 4LQFH 4G9FD 1LO5B 3I3EA 3OHXB 3DUHA 3MFGB 4I2XB 2VL5A 3TBYB 1AGDB 5LXGL 1TVBB 4FZEH 3QHFH 3LKRB 1KTDA 4NRXA 2FZ3B 2R8SH 3VXSA 1VEMA 1Q0YH 5A40E 1QFOA 2XN9A 1W0VB 5ESVB 4RAVA 1NDGA 2AK4B 4NHCL 1YEFH 3R8BB 3WO4B 3Q6FB 5KN5A 2DQGL 4Y4KA 4HKZA 4WEMB 1HILB 5AD0B 1F02I 5D7LB 1F8TL 1NGWA 1A3LH 3DECA 3K8LA 4LHJB 5C09A 4AEHL 2Z8SA 4U2YA 2OCFD 2BVQB 5E1AB 4YIQA 1IKFH 1JF1A 4PGCB 3T0XA 5KS9A 4QYOA 3TJHD 3QT2A 2VC2H 1DQML 4ODSH 5I0DA 1CGTA 1LD9A 3BGMB 4LPWA 12E8L 3M1BA 2LU3A 1JWSB 3GI8L 3DETD 5D7LD 3Q2CA 4PUBL 2VDRL 4HWBH 1NAKL 5D1XA 5IMOA 4Y0GA 3HMXL 4ZUUA 1TZHA 2HFEA 1KXTB 3MA9H 5A1AA 4ZQKA 2EDJA 5EBGA 3QEQA 1C5CH 1QFWM 2KZ1B 3DRQB 1KJ3L 3C5ZC 5TF1H 5D72H 4MMZC 4F9LC 1QBAA 3QG7L 2W59A 3WO3B 5INDA 3W5NA 4KXZI 3MV7D 4L1HA 1IVLA 2OR9H 3VFNB 3ZKND 3N1QC 3EW3B 3GGWB 3GO1H 3MODH 4AK1A 3OXRA 1JZ5A 4J3TA 3NH7H 4G8FB 4N8CL 1IAMA 5TQ2H 4BH8A 4YNYA 1P6AB 4U1HB 3SOBL 2D9QB 2N7BA 4TSBL 5J1AB 1OSZA 3QUMA 3OJMB 1YJDH 4UT7L 2H6PA 4OZFB 2PYEA 5DHVA 1YJDC 2NNAB 5DJ6A 4WHCA 3AB0C 3BP5B 3IDNA 3EOBB 4U1GC 1FGNL 1KCVL 1RMFH 3RQ3A 3HPLA 1EXUB 4P2QA 6FABH 1NCTA 3VD7A 2VNCA 3FFCE 4U1GB 2IPKA 2FJHA 2OLDA 3PJSA 4LAQH 1W72H 3O6FB 3B9VA 3HE7C 1J8HA 5DS8B 1BQLL 3UTQB 3VDAA 1K3IA 2NXYB 3AU1B 3QA3B 3VFTB 1JPSL 1N2RA 4HUWA 2NY2D 3BE1H 1II4E 3BH9B 4HS8L 5CJOL 1R5VA 1NKOA 4IMLB 5KANI 2F5AH 1X5HA 1TVBA 2DMKA 2ICCA 5IHUH 3VXMA 3G08B 2WZPD 1Z5LB 1YY8A 4JO4L 4NRYB 4ODHL 1JGLH 1FYTA 4JFZL 4GH7B 5EORH 5HDLA 5TPWH 1PVHA 2YC1B 3QHZL 1J1XL 1KTDB 2BFVL 5CUSH 3PUCA 1AXIB 5ENWA 1U8PB 4BYHA 3C09B 1UQSB 1JWSA 1E28B 5ABDE 1LE9A 3K81A 4GXVH 3ALXA 2WMPA 4XVSL 2MPAL 5BS0D 3GM0A 4P9HL 1IFHH 4OCXL 4WWKC 4XPAL 5F7EH 4XAWH 4F2MB 2P8LB 1SBBA 5C0AA 2IFFL 4G8GE 1CLZH 5JZ7C 5TE6H 1MJ7H 5T1MB 1T1ZB 3HE7A 2R0LL 4CMMB 1YEJL 2ZUQB 4MQTB 4P3CH 2EEAA 4BSWA 1AHWC 4PJGF 4CDHA 1GGCH 3QWRA 1TLKA 5T3XD 3B5HA 3WDIA 1RJYA 4KDWA 3EHBC 2ID5A 5JHDE 1UC6A 5HHOB 4LSSL 3P4NB 1PFCA 3DSFL 4FQHA 3EO0A 3F12B 3S35X 3FQXB 5I1KL 3GSNL 3ZKXB 1VGKA 3T0EB 4I2XA 5IB4B 1Q9LB 4ZTOL 1XR8A 1P9MC 4C83A 1R3IL 4ZFOB 3FQUA 4S1SH 3ISWA 5GRZA 1IAIH 3T0EE 2GITB 3HI6L 3ZKXC 1QA9B 5C1MB 4ZOBA 2FECI 2Y6SC 5F8QC 5LCVL 1KCRH 3RDTB 3ARQA 2UVFA 1CDCA 4CVWA 4R2GB 4J4PD 5HDQH 4W70A 2I9TA 2VDKL 3IDYB 5EZJB 4D9RD 3IS0X 5J1TC 4MQXC 1G9NH 2PYEB 2D7PA 4Q58C 2YUXA 2DM3A 2Y72A 3DUSA 3S3SA 5B39G 4ZFOL 1A5FH 4JO1L 5DO2D 1UB5A 4DZBA 2YMXH 1WAAA 3O6MH 4A6YL 5K9KB 3CPLB 1I7UA 4HW6A 3HFML 2WP3T 4NYLB 2WIMA 3K2UH 3C6LD 1NGXB 4YBLB 5DR5L 3MLVH 1B3JA 1EBAA 2BSRA 5MEND 2PO6A 4ONHB 1JGVL 1J1PH 4Q9CA 1A2YA 1ZVHA 2D03L 2R4SL 2E9JA 4KRNA 1AD9B 1FC2D 2DQFA 4XPFL 4LCIL 4HH9B 1AC0A 1G9MH 3HG1D 3IDJB 5CIPB 1JYVA 4XNQB 3IU3A 3JV5A 5F6HI 1NANI 3FOLB 1E0OB 3CFEB 3TBVB 2NTSP 2YPKA 4AIZA 2QADC 1B0GB 1DN0B 1FFNA 3HN3A 3VDBA 1OGAE 1TQBB 2AGJL 3RU8H 2A74A 1Z9MA 4LHQB 3GNML 2R0ZH 5F21B 3HMWH 4JJ5B 3WHE0 2HFGH 3WE6A 4MNQE 1KELL 5ISZE 3ZTNL 3GSVB 1X5JA 4G43A 4YGVA 4P2RB 3K4DA 5ELIA 1TVDA 3QDJD 3GMPA 5C08E 1HOCB 3U46A 2FZ3A 4H26B 3CFCH 3RBGA 3G9VA 3L5HA 3HAEB 5KTEL 4ZPTB 3TCXA 4XPTL 1CFVH 1YYMH 5DZNA 1KN4L 5I1IL 3WNPA 3FONA 3VXRE 4WFEE 1BPVA 5D6CB 1EHXA 4HIIB 1PG7H 1P7QD 2GJZB 3FQTB 4YPGA 1QSFB 2ATPA 1DLFH 2FB4L 1F11A 1OW0A 2BOBA 4RNRA 2NY5C 2CUHA 3N1PC 1N5YH 2O5YL 3IS1X 1BQUA 2V5RA 3P30H 4TSAH 2NY3C 5J12C 1KFAH 4GLRI 4BZYA 4MAUL 3C9NB 4OZHA 4D0CB 1PW3A 1U3HD 4WHDA 3JTSB 3D3VB 5ACZB 2IMNA 4M48L 1K2DA 4OFDA 1HH6A 4NRZB 2JK5B 2DICA 4YJZL 1WTGT 3MRIB 3CSBA 2ZOKA 5TGBB 3RKPA 4XB8A 1RSFA 1FFPA 2EEDA 4Y4FD 1CGYA 4X8JB 2YPVH 3HZVA 4D8PB 4N68A 4FFZH 1N3NA 4HAGA 3QDHA 1BLNB 5EOCH 3W39B 5C6PB 1A9EA 3GSWA 1MCPH 4OGXH 4G6FD 4DGIH 4GRWB 1RVFH 1CF8L 2HLFC 1PD6A 1PZ5B 4X6CE 5CSZB 3MBED 3O9WD 3BKCH 3F58H 2BRRH 2DI8A 1R5VB 4NQEE 2P43B 3STLB 4YHNB 1IGFH 5EDXA 3PQYE 3O2DA 2A9MH 4LASL 1NSNH 5KVGL 4OZFH 1ZTXL 5BRZE 4P49A 5KSUA 1HINH 2VXTL 4U6HA 2AJXL 3B6SB 3G5ZA 4HDIB 3PJSB 4YHOH 1BIHA 1S9VB 3PWNA 4Y19B 4EIGB 1GGTA 3SE8L 4TQEL 1KG0B 3O6KL 3WD5H 1M7DB 1GXEA 3D18A 1WAAE 1N64H 1I9IH 3DGCR 1XGPA 2ATPB 4LIQE 3RTQB 1YY9C 2A1WL 3QWOB 3U4EA 4ZUWA 3S34H 3VMNA 1LNUB 3ARSA 3M45A 1ZA6A 1EO8L 3PL6B 4LKCA 5HYSA 4LLDA 3P9MA 4HJJH 4NIKB 1AY1L 3QG6B 4H5SA 4FTVD 5GGSY 3AXLA 5F7YC 4M3KB 1V05A 2ENYA 2YEZA 3S97C 2BSSB 4OIBA 2CR6A 3T77A 1AKJA 2A6JB 1A6UL 3CSYB 5CAYB 4FQIL 1KCKA 4L29A 1XF2B 4JO3H 5BCAA 1Q9OA 4EZMA 1LGVA 2D4FA 1OPGL 4JCLA 4Z7WE 1DN2A 1SEQH 3O0RH 2W07A 1CLCA 1QLRB 2CLRA 5GIRA 3ARBB 4I3RL 4LK4A 4UUJA 1U6AH 3TBVA 3GSQA 5C6TL 2CDEB 1BEYH 3EOAB 1I1AD 4UT9H 5DLMH 3B9DA 1EUUA 3NA9L 1U6AL 1VEPA 4MAYC 3O6KH 1KB9K 1JZ6A 5IW3A 3SE8H 5DMGD 3JWOC 2UVEA 4PV9B 5FYKH 3QJHA 3TH3T 2M26A 1F13A 1K5NB 3NIDF 3B9AA 3QPQD 2WUBL 1KENH 3BVNA 2J12B 3UTSE 5I76B 3OKEB 2OJZL 1GHFL 3RY4A 5I75B 4P5MB 2QR0A 2NQCA 5LBSH 4OAWB 4HWNA 1CDBA 1RIHL 3SE9L 3UTPD 1ZEAL 3G5YB 3BEWB 4I48A 4LSRH 5FA3B 5E8DH 5DVKA 1IBGL 1DSFL 1JHLH 3QFJA 4B5EA 3ULUC 2IANA 4XPBH 1T5WB 2IQAB 2PYFB 3PQYB 4L8SA 1AKJD 1VKXA 1KIPA 3FN0H 2L7UA 5B3JF 1I9IL 4APQC 1MRDL 3TWCL 1WWWX 3HUJB 3QIWB 4YDKL 4LLYB 3BPOC 1M6OB 3GMLA 3QHTC 4U1NB 1XFPA 4IHOA 2ZUWA 1R24A 3WFHB 3QO0A 4YFDB 3U30C 7CGTA 4ZFOA 2EE2A 3ARDD 3MLWL 4NO5A 4L8DA 2ITDA 4OLWH 4FTVE 5HD8C 3RWHA 3CMOH 2P45B 2VDMH 5KVGH 3NPSC 1OB1B 1QR1A 2DDQL 3KXFA 5FUZH 4LNRA 4JFPB 3V4PL 1UJ3C 5LGJA 3EYOA 1FNLA 5FF6B 3Q0HA 4YH6A 3KPOA 2J8UA 5D5ME 1G7HB 4MB3A 4PJHE 3WFZA 4XHJC 5ILTH 3IVKB 2A1WH 4JAMB 5DUPL 1S9WA 3ZZ1A 5DMIH 4JKWA 1RUPL 4BSJA 2Z35B 3MJGX 3QDJE 5C08D 5F9JB 3IKCB 4YHPA 5HDBE 4L9DA 4KUCD 3CH1B 2VZTA 3BUYA 5IF0A 3BPLB 3HG1E 4MJIA 4K2UL 1X4XA 1S7XA 1UM4L 4LRNH 4PJBA 5IHBA 4WWKB 3O45A 3EJZD 1NMAH 1QFUL 5CP7A 4PG2C 1ZLSH 1I8IB 5B22A 1CXHA 3BIBX 3KJ4C 4P5MA 3B2UD 4OCWH 2WW8A 4JPKH 4IRZL 5HSFA 4S10A 3SGJA 3BVNB 1OAQL 5EU5B 5F71A 3RJQB 1NC2A 3W0WE 2WM0A 3CIQA 1QFWL 3UP1A 2IAMA 3QB7C 1BVLA 1SM3L 4R4BA 2Q8AL 1K5NA 5IFHH 3ULVL 3GMRA 2H32B 2GJ6A 5F3BA 1OSPL 1D6VH 3MJ6A 2UWEE 1AQKL 2H26A 3BPLC 5JIPA 4KPHL 1JGEB 1FG2A 3T2NL 5E2UL 4Y4HD 3MLYL 1U3HA 2CLRB 1NBZB 5JOPD 2XPGB 3TNMA 3QZWB 1FQ9C 3TO2A 4P2QB 4X6BA 3GHEH 4RX4A 1Y6NR 4YHPB 3DXAB 3LPWA 4UBDD 4D2NA 5DDHB 3ULVE 4HWZA 2QHRH 2DWDB 5L7XH 2EIZB 1JL8A 3O8XA 1O5DT 1OTTD 3BEWA 1XF1A 3IDIB 1HXYA 4O2FA 4AEFA 5CEXA 1JNHA 3DO7B 4MX7A 1IGYA 3MLUL 5AWNL 3TVMC 2HT3C 3OXSB 3C08L 5K9QG 2DIJA 3K2MC 2YD3A 3RDTC 4WVRA 1WWCA 2DQIL 2HTKC 3AS0A 1EA9C 5GRUH 4PRAB 5FYLE 4NO5B 3NCBB 1FZJB 5EU6B 2WAHA 2I27N 4CGTA 4P48A 3Q3GA 3QJHB 4JFHE 3X13A 5D1XC 4B7LA 4UOW1 1MCWW 1X5FA 5DQDL 4GBXA 4NKOA 3NN8B 3L7EB 3VI4E 4BZ1L 1Y18A 4PJAB 1DBBL 5FDWA 2W1NA 3C2AL 2K3TA 5TDPB 5BRZA 4LLUB 1V7MH 3UTTA 1BOGA 2B0SL 1HCVA 4KTDH 4Y5YC 5E2WH 5JQ6L 4ZTOH 2FIKA 3QNXB 3VH8A 3Q6GH 4ELKA 2DKMA 2CR3A 2VLLA 2OJEB 5D7KE 5FA3A 3T1FA 4P2RD 3KNBB 3KS0J 5EN2B 4TUJA 2IPTL 3HFMH 5FOBA 1AGEB 2KZWA 1UVQB 2WWKO 4IIQA 5DQDH 5I8CB 2R23A 1C16A 4PB0H 1K4CA 5K93A 3OXRB 1NDGB 3BT2H 3ZYOA 2XKUA 1G9NL 4LGRB 2FATL 3SCMB 2OI9C 4UQ2A 3WIFA 1PX3A 5CEZL 2IFGA 4KJPC 5HBBA 2M8XA 3QDGE 3MRRB 4U7MA 4KXZH 1LO5A 4X0KB 5DRWB 4WI4A 4L5FH 2AXHA 1EMTL 2FD6L 1FAIL 4ENED 5DWUL 4DUXA 2EDXA 4HS3A 4JFXB 1AGFA 1D6EA 1TVHB 3BUTA 3UPRB 5J06A 1EGJH 3EYVA 2XG5A 4I0PC 1XR9A 4DWHA 2VZVA 3VXUE 3RGVA 1KG0A 4HUNB 4RAUA 3H7BA 5EFIA 4HKXB 2JK5A 4G42B 1J8KA 2Y5TA 4KI1A 3HS0B 3IDGB 3D39E 3MBEA 3PWUA 4UNTA 1MHCB 4GMTH 3LKQA 1ND0B 1T89A 3L3GB 4XCEA 4RAVB 4HH8A 4P5TD 1YNTB 2EDTA 3FAXA 1CK0L 3GJEB 3NOIA 2P7TB 4KC3B 2NTFA 5HI4C 2JJWA 2NY1D 4F7PB 4U3XA 5T3XE 1YEGH 2V17L 3LKPA 4PS4H 3QWRD 3ARDB 1RK1A 3MX0A 1F3JA 3O9WC 4C56E 4BK4A 5JOPE 2BFVH 4ELME 1H3VA 4W4OA 1NPUA 1PYWB 5D7JB 5FYKU 3TBTB 1YYLH 3QUKA 4LVNC 2ADIB 2W60A 1ED3B 1LP9B 3H3PH 3FB5B 3OAZH 4XCEB 4UDTA 4KJYB 3L95A 1JPFA 4PRDB 4Y19A 4ZS6C 5E8NB 4XZUB 2R1XB 5AG9A 5I17A 5I2IA 5DJ2B 4DUVA 1WK0A 4GRLC 5TE6L 2F8VA 1FNAA 3FFCB 4XBGA 5LBSL 1A47A 3ARDC 2D4DA 5GISL 5DMJB 2ZOLA 1DQJA 1PKOA 2FGZA 2AK4E 4M1CD 3CFEA 4PLOB 4XC3H 1URLA 5I19H 2NY0D 1D6EB 3OGCA 4KAQL 2IBGA 4NM4L 1W8NA 3WHE1 1E27A 5CIPA 2I9LB 5D2NB 4F3FB 5H35B 4Y4FC 5LAXA 2YOCA 3KVQA 1Y18B 3QUXD 5AAWA 1DQMH 3RTQC 5D2NE 5KS9F 2XZCL 4LCUA 4NBYB 3PWPE 2GKIA 1H5BA 2ICEA 4PJAF 5EA0H 2VUOA 3PWLB 5A2LH 3RWCA 3Q3GB 2W9LA 3T3PE 3U7YL 3LN5A 3OR7B 4JY5L 4Y2DD 5ADOH 3P0VL 5CZXD 1TCRA 2JJUA 4HV8B 5IG7A 4PJGE 2NY2C 1MHHB 1XF4A 4OUUA 5FCUL 1YEFL 3SGEI 2KPNA 1FIGL 5GS1B 4E0RB 3MLSH 4U6VH 3VMPA 2MQ0A 3AROA 5HVHB 2RGSA 5EOQH 5ACZA 1BQLH 2K7QA 3UYPA 2AJVL 2ZUTA 3WNKA 4CU6A 3PXHA 1DEEB 4LLMB 3HG1A 3DRTA 3EFDL 1J18A 1EEQA 2H2SC 3AUVA 5EO0A 2LAAA 4YDVB 3HC3L 4YEFA 3LDBB 4OLZH 5IJKC 5B38B 3UTTB 3MRGA 2JIXA 1BFTA 2X4QB 3HMXH 1XR8B 2BVOA 4DKEL 3BIKB 1I7RB 1G7MB 2CIKB 4WJ5B 3EDFA 1S5IL 4HH9A 4CUCA 1FV1B 4WFGE 3MUJA 2X40A 3WL9B 5ADPL 3T0VA 1FAKT 1G6VK 1YDPB 5GGVL 4Z7VA 5EOCJ 3RY6C 4EQ2A 3RL2A 2UWEA 2NR6C 2OR9L 1VGKB 5IGXH 4DGYH 5H37H 3KJ6H 3OKNA 1OTUC 2X9XA 4GG8B 4P59H 1GHFH 5K59E 3QXAA 1UB5B 2BJML 4JLRB 1OCWH 2BY2A 4HT1L 3ARGB 2BNUB 4FZ8L 4OGYL 3CVIL 3TBTA 5I1DA 3BP6A 1RUAL 5F9OH 4ZYKB 3GIZL 3VFWB 1NGPH 5C0GB 1ZT4A 4RGNC 3KG5A 1P7KB 3GSOB 4Y4KD 2R39A 4JN1H 2ADFL 3VXPB 1UZ6F 5HYJA 3WFCH 4PGBB 3MLXL 4G6KH 3RVXC 1Y6MR 5JHDD 2FH8A 5FYKD 4OV5B 3T65A 2D31B 4JR9H 3BO8A 1MELA 3HE6B 1UQSA 2FJGB 1IGJA 3BH8A 2EC9T 3BDYL 1IGTA 2ADGA 4QXGL 2QSVA 3GJEA 1JMZA 1NCBL 1EAPB 3O3BB 4CJ1A 3STZB 4YUEL 1QSEB 2VLME 4GAFB 3AM8C 1NAMA 1TETH 4HUXA 3RWFB 2OTUA 3SY0B 4GAYB 3GMOB 2OX5A 3M17A 2ARJQ 2AS5M 5GPRA 3U82B 4P2RE 4RFOL 4HK3J 3QIBC 2R56H 3PP4L 2NX5B 4FFYL 4EBQH 2ARJB 4WO4D 4WUUE 3QA3A 3VFTA 4OIAA 3V79C 3CUPB 5TDNB 5L2JB 3T0WA 2E27L 2E8YA 4OLXH 1F6AA 3FFDA 3WLBB 1RK0A 5FM5O 3ZE0E 5I71C 1QFWI 1U41A 3TEUA 3G6JE 5J3HC 5E2VH 3MYJA 3AREA 4YFLI 4M6MH 1WIUA 3ECBA 5D5MB 4PJ9A 1IAOA 2PKDA 1OWWA 2JF1A 2NY7H 4JRXD 1PG7L 1A4KA 4FS0A 3VFSB 4MNGA 4UQ3B 1RQ5A 3MREA 4KRLB 2Q76B 3PL6D 5EOCL 2OMBA 4Z7OF 3ZDZE 3RNQB 3WD5L 4GRMB 4W81A 4QLRA 5C9JA 4PY8I 4PJCA 5I1LA 3LY6A 1MLBB 4ZQKB 2AJZB 1YQVL 1P4IL 1U42A 3JWOL 4M6OH 5JXAL 1R24B 2E9BA 1VCAA 4ORGB 4M48H 1VEOA 1CICB 1S7RA 3UBXB 1BFOA 1OVZA 3OPZH 3OSKA 5IBTH 3IDXH 1I9JL 5C09B 5DI8B 2AJVH 4POUB 1WBYB 1HZHH 3HC4H 1LO4H 3HPLB 5C9KA 4UT6L 2AJYH 3I6GA 4XNYH 2ZUXA 5D7IF 3QIWC 3QUXA 4FFZL 4EDXA 3MCLH 3PWVA 3PV7A 3WEXA 3VWJC 5FYKE 3PHOB 4KKLC 4N0FB 4NN6C 4OAWA 1NGWB 1KJ2B 3U7YH 5AUMA 3BPNC 4GAYA 3KPSD 3FQNA 1OQOA 2KL6A 3OKEA 4GRMA 4XTRC 1DE4A 2RJMA 2AV1B 3VRJA 3TVMB 5HPOA 4PP2B 3S36X 1Q9KA 1XIWA 2E8ZA 1WT5C 1JNLL 4IMLA 5CZKA 2EDEA 1PKQA 2P8MB 4MCYB 3WDHA 1S7XB 2QHLA 2R2HA 2N7AA 3AXLB 4YPJA 2JJTC 1U8IA 4WFHD 3BP4B 3ZSTA 1YEDB 3SKJL 4OZGF 3UTQA 4XPHH 3DRQA 5GISH 1Q94A 4UV4L 1CDGA 3RFZC 4JKKA 1TNMA 3P40A 4WUUD 3TT1L 3WUWB 1QBML 3QIUC 1BFOB 4KK9D 1G6RB 5C09D 3KYOA 4NPYA 3JZ7A 5J56B 4MNQB 1HIMH 2GIYA 4POZC 5FYLL 1G7PB 4JFQB 4P9MH 2MKWA 3VFPB 1S9VA 4R8WL 1O7SA 1CGWA 1UGNA 1WITA 3V6OE 4LEXL 5I1LB 4HWEL 4N9GB 5E5MB 1EMTH 2E7HA 2Y07L 3HLAB 3RI5F 5FUOH 4PJBE 1KELH 4M7JL 3RX8A 1YEGL 5KZCD 4KROB 4HWEH 3A6CH 2R69L 2H8PA 1P1ZA 1A7OL 2E5EA 4DAGH 1L7TH 5HYIA 3SBWC 5CS7A 4MJIB 1IEBB 1AD0B 4L3ED 5BVJB 1M7XA 3F7QA 5F89B 2EZ0C 3OKMB 5A16B 5K33A 5FYLH 5AYQA 4QOKA 1LK2A 4QO1A 1MCKA 4M1DH 4FQPA 3H3BC 3F5WA 4NZDA 2LU7A 1BP3B 4XCNA 3OKLA 4PRNB 1J0HA 5DJ8B 1BBJB 3DRTB 1IC7H 1KBGL 4MNHB 3CUPA 1A7OH 5JHDA 4UINH 4MGXA 4UIMB 2FBJL 3BMVA 4I18C 5K59F 4HD9A 3OKNB 1Y0LB 1JYWA 5E9DD 3R8QA 4EI5B 3QWQB 1LK3H 1T2QL 3MLTB 1YQ2A 3N1GC 25C8L 4D0BA 3KPMA 1KTRL 5EZOL 2A83B 1RJZA 1C5DB 1J0ZA 1DBBH 1OGAD 2B20A 2IBZY 2WBJC 4G9DA 3DROB 3U36B 1YDPA 5JMRA 1E4WL 5T1KB 2FHBA 2R29L 1M6OA 1T66D 4X6CB 5EUKA 4N8PA 4DKFH 3SEPA 1QSFA 1NKRA 4EI5D 1N8ZB 1ZT1A 4GAGH 3HC0A 4U4BA 4M7ZC 2GFBA 1D3CA 1XIWD 4KPHH 5ESAA 3V5HB 4KZDH 4UB0H 5SX5K 2EYRA 1VFMA 3BDXA 1OAYL 4UT6H 3LN4B 3DMMC 1D9KB 4XPHL 4Y88A 2BMKA 4MHHI 1L0XA 3ZL4H 3WDJA 1MCBA 3VA2C 4JQIH 4WWKD 1V7NL 4Y19E 4OV5A 1FRGH 4GKSA 4DAGL 5MENB 4U3CA 3BZFA 3FO0L 3QUZC 4OBSA 4RGMC 3K46A 2HLFD 4S1SL 4GBXD 3VXNA 4XZUA 5F96L 4EN3C 4HLJA 4JKLA 4KTYA 4AENA 4KHXH 5HYJE 3MRQB 4X7FC 5IB3B 5D9SB 1UXSA 3ESUF 5IV2B 2B1AL 5ITFA 5ID0B 3UTOA 3WV0A 5F6IB 3F7YB 4M5YL 2A0LC 3ILQC 4BJLA 4V2CB 1D5ZB 1D9KA 4Z7VB 3ROOB 1UKQA 1DQQB 5KVEH 4PJAE 2PTUA 1TTUA 3W11D 4O2CA 2UWEF 3MUY1 1MCOL 3EOYG 1WCQA 1XF5B 5IEHB 5DUBB 1AQDB 3NFNB 1P2CA 5C86A 4XNXH 2GQHA 4X6DA 5IESL 5I8OH 3RWGB 1TPXC 3L3HB 1D5BA 5FK9A 3DYPA 2MPAH 4JM2A 1N0XH 3BKJL 4I0PB 5T1DH 1J0YA 4X9BA 2CO6B 3ELAT 1K85A 5EG6C 3ULSA 1EZVX 2DLTA 4L4TA 4N1CA 1G9MC 1LO3H 5ID0A 2VDRH 4HWBL 4BFBD 2CLZB 1MHEB 4OCRH 3VA6A 2VDNL 3SN6N 1RZ8B 4JEGB 2FR4A 2PW2B 3Q5TA 3CPLA 4QWWD 2AKRB 3SKNA 1I8LC 2X4NB 1O0VA 1T21B 3WFEH 5J6GA 3UBXI 4RMUA 5SWSB 4UZGA 4U6YA 3EO1B 2VLRB 3LQAL 1UWGH 4CW1A 1FORH 3SJVA 4HGKC 2LTQB 3B5GA 3HZMB 1RD6A 3BE1L 4YDLC 1IAKA 3CLFL 3SOBH 5D6DA 5HGDA 4OZIA 3RRQA 1JPSH 1AQKH 1LDPH 4UI2A 1Q9WB 4H20L 4HUMB 2X09A 3CDYA 1X6NA 4A2MA 1LO2L 3FO9B 4X4ME 3O9WB 4LSQH 3IDXL 3CFBA 5FV1L 5FFLA 1T7ZA 2DTMH 3RUGA 2NXYD 3DX8B 3OAYH 4IMKA 1S7SA 4NQDA 4HMCA 4YBLC 5TF1L 3SCMA 2PTVA 4FMKA 4C83B 2LU4A 4U6XB 1JFQH 1LILA 2Y1VA 1PZUB 5DA0B 3HMXA 2XN9D 3NABL 4F58L 5IIEA 1MFBL 3VXSD 4OCLC 2X89D 4PJIE 4IOSD 3TWCH 3BJLA 2OMNA 1YQVH 1AGBB 1DBJH 1U91B 3RPKA 4G9FA 4ZTPL 4P5TA 1DTUA 3I2CL 5F88B 1CVRA 5CFHA 1U93B 5JW5B 5F8RC 4LLAA 4ZNEA 3U0WH 2UY6A 1NCBH 4R4FH 1Q72H 2XA3A 5I2IB 3GM8A 5DURB 2YD7A 2BSTB 4W68A 1H15B 3LKPB 4LMQI 3UO1H 4HKBA 3QUYA 1FC1A 1FO0L 2NY5L 2X10A 1VDGA 1U8PA 3HNTL 4TUOA 4MXQD 4LRIC 1IM9B 4I5BB 2CQVA 4FXKB 5CSGA 5HYSG 3L3IB 1LWRA 2LTQC 2BJMH 3U9PL 35C8H 5FA4B 1MEXL 1F58H 3EAKA 4FQHB 4J4PC 4ESKA 1KUMA 3RZWA 4BSVB 4HKJA 3QIUD 4FFVC 5FO7B 2VQTA 1N7ML 2YBRB 1MY7A 3V2AR 1YY9D 4ZSOB 2VXVL 4MAYD 5DHXB 4NWTL 1DSFH 4C54A 2PXYB 3QJFA 3SPVA 4JDVA 3G6JA 3NIFE 4MVBD 3BFOA 4WEUD 4WWID 3PWPB 3MRPA 4G5ZH 5CD5C 3PABA 1JGEA 4LHUA 4LLWB 4M3JA 3MV7E 4X8XA 2I24N 5IVXF 4MDJA 2DL2A 5D7JD 4DVBB 5F7LB 1RZJC 3CLEH 2AJXH 4WFED 1CD1A 3ZKMD 1DBMH 3IKKA 4NQED 4RSVA 2CMRH 4L4VE 2YPLB 1KULA 4K3DH 4CN6A 5D7SH 4S2SA 2R23B 2Z92B 4Y16A 3GUTB 3FQWB 3LKNA 4QT5B 4ZAKD 4LVEA 1YMMA 1IGYB 1M7IB 5KOMC 4PJ5B 3O3AB 4EIZC 2NW3A 3KNBA 2I60H 5T5NG 1N2RB 2DWDA 3LQAC 3I02B 1KJVA 5F7DA 1FFRA 3GBNH 3GZKA 5EZJA 3PNWB 5ETUA 1X4ZA 3S98A 4KU1A 3G5VB 1N0LA 1AHWB 2RB8A 5HJ3B 5KVMC 5ACMA 1QPXA 5DFTA 2YK1H 1T7YA 3E8UL 4H0HB 1J8HE 3ULSB 3D3VD 1P5VA 1SJEA 1BQHA 3QIWD 3ULUE 3S7GA 1HINL 4QHUB 1T0NB 3LQMA 4H8WH 3REWB 3TO4C 4XC3L 3GDBA 3GSXA 5I19L 4PS4L 1SEBB 1WFTA 4F7CA 4WY7L 4KKBD 2VSCA 3K0WA 4IRSA 2DTML 1BGXL 4WW1A 1SBSL 4X5XA 3EFDH 4KVNL 4TNVF 2X6MA 1QP1A 2SEBB 4AL8H 2I5YL 1H3XA 3DBXB 4P46A 5F9AC 2DAVA 4NZRL 2ZUSA 4HJJL 4DZBB 4QCIA 4JGMA 2GJ6D 3F7YA 3PL6C 3SKOB 2X41A 3HPJA 1OTSD 3AS1A 4NQXA 4MD4A 4HIHA 2EKSA 4MXVF 3MRDB 4QHNB 2OYPA 4PGBA 5IBLD 2Q7YB 3W0WD 3GRWL 4M8VA 2CDGB 1BFSA 1A7PL 2F19L 4HBCL 4HULB 1EGJL 4O2FB 5CEXB 2DKSA 3SE3A 4Y5VA 1S9WB 3QPXL 4MMXC 3MJ9A 4YWGL 5J11B 1WZKA 5DC9B 4PG9A 4Y16C 4YBQD 5LWYL 3ZT7A 4I48B 4DFHA 1EHLL 3MA7B 5KSBA 1QA9A 2YC1A 3BSZL 4RIRA 1IKNA 3QDGB 1HSBB 5HD8D 4DCQA 3P4MA 1T04B 1G7LA 4JY6B 5C08A 5E70A 4YHYB 4Y5YB 4TTGA 4FXGB 2CXGA 4EUPB 5E08L 4MD4B 4ISVA 3L7FA 5E1HB 1MLCA 3EUUA 1MFAH 1G9NC 3LEYH 4XP9H 4OFVA 4LHUG 3IXTA 4FFWC 3KPRE 3QO0B 2A9NH 2X1PA 3ULVF 2VDOL 1YECL 3ZDXF 3L9RA 4KV5E 3V52L 2WK2A 4XCFL 2BERA 2Q1EA 3I3DA 1F4WL 2J8UF 5F9WC 5HDOA 5HJ3A 5DSCA 2BNRA 1T04A 1FAIH 3IAPA 5GZND 5IKCA 3CFKA 5JHDB 1KEGL 4I9WD 3MJ8A 2D0HA 2EDLA 3IFNL 4I0KA 4CBPA 2NW3B 4Y2OA 1P7QA 3K1KC 2VQ1B 4OF7A 2H1PL 4JLRA 3GNMH 2AJZA 4Y1AE 4JFDB 1WTLA 1H8SA 4JPVL 1YPZB 3RL1B 3ZKMC 5ETUB 3W81A 2VABB 1HHIB 4G9FB 1U3JA 4E0RA 4JO1H 2HTLD 5GSVB 5CHNB 3ZTJH 4FQQA 5IT2L 2QLVB 3L3JB 1INQB 4RFNB 1M71B 1ZT7A 3KWWA 4ELMB 3VXSE 1IZKA 1QLEH 5D1QC 3VXOA 3VG9C 4GG6E 3L5WB 3V0VB 3FQWA 5EO1A 4G80A 1SHMA 3GSXB 4L4JA 4GRLB 5GRJH 1FSKB 2H32H 4LLDB 3HR5A 3QRFM 4JDTL 3O6FA 3X3GH 4G6AD 4YHYC 2HJLA 4E42A 2BY3A 4XHJD 3UDWA 3KPPB 4PYHA 5CEYA 1D5XB 1BZ9A 4N1HB 4QRQB 5I74B 1NMBL 2GSGB 3QUML 1A5FL 3RAJL 1X5YA 2CK0L 3DSFH 1I1AA 2Q20A 1BQSA 1QLEL 4Y4FB 2EO1A 4XI5D 2HT4C 3SDAD 5GRUL 4IMKC 1B2WH 2D7NA 4KKAD 3C60C 3TA3D 5HI3C 3D85D 5GS1A 4IM8A 4UAOB 3P73A 1IAII 4RX4D 3STZA 3SGDH 4HFWA 1S7QA 1CFQA 2R1WA 4AM0A 3CX5K 5JA8B 2CUIA 4PFEA 4UIKH 4YXKL 5FO9B 5ICZA 1NFDF 5F7EL 4OQ1A 3IJSA 2BP3A 2V6HA 3T4YA 3U4AA 1C12A 2VLKE 3AFLA 4MXQC 2P49B 4XPFH 1A4JB 1NH6A 4FQJL 3MUZ1 1UB6B 1MFNA 1VFAA 1D5BB 2A73B 3KXFE 5JQ6H 1ZLSL 1ITBB 2O5XH 3KPQB 3QH3B 5EU6E 3T4AB 1ZLUK 5CJQL 5DEGA 5T3ZL 3RGHA 4QGTA 5FGCB 2MQCA 1FYHB 3QEUA 4JM2F 4LSSH 1R3HB 4MLIA 2X4SB 1QVOA 3IDMB 2OZ4L 2D7TL 1GZQB 4OD1L 2AXFB 2YMXL 4ZO9A 3VJ6A 4K3JL 1P69B 4WUUB 4LPYA 1X3DA 4LLVA 2J88H 1HIML 2Q8BL 1K2DB 3BN9D 1CFTA 1CLOH 4ODXB 1F3RB 4PTTA 4PJDA 2BNQB 3EFFB 4YAQA 4G8EA 4X80H 4HG4J 3DX9B 4JFEA 1GL4B 4AIXA 2AQ1A 3VGDA 5DRZB 4XNZB 4OB5L 1QSFE 4HXAL 1QFUH 3MLUH 1KC5L 3I6KA 1MI5A 1YEEL 2N4IA 3EYSL 2DLFH 1WCBB 2QADB 3U79A 3JBG7 5LCVH 3KPRD 5BV7H 1B9ZA 3CMGA 4OKVB 2EYSB 1YN7B 1BJ1H 2EXWD 2J6EH 3X3GL 3M8OL 4JDTH 2OTWA 3O9WA 5CJ5A 3RX7A 5JW3H 5LVEA 3HG1B 3CDGB 5GGTL 5E2UH 3UCRA 3OKDB 4M7KH 3ARFC 1FL5A 5JLZB 4Z8FL 3LKSA 2A83A 2RHEA 4P5TB 3TZVA 2LQRA 5K9JL 3HC4L 4ZUVA 4RGMB 1MCDA 3HTLX 2I5YH 5IWLC 4P5TC 3RNKA 4PJDE 5F88A 1UXWA 3L6FA 4LGPB 1D5XA 5DZLA 5IROA 3SDCC 1U8HA 2YD9A 3V0WH 3QFJE 1BF8A 3SDYH 1TZGH 5GJTH 1NMAL 2G60L 5DZOA 2XZAH 2XTJD 1G1CA 3LHPL 2GCYA 2B4CH 4JHWL 4LP4A 5DUBA 3HI5H 4CVXA 4I0PA 4XCYB 1BLNA 3BD3A 4GSDL 3W39A 1CU4H 5CZXC 4LSTL 2EDDA 4JHAH 3MV9D 1J8HD 4DVRL 3MNWB 4ZXBA 2FDBP 1RUPH 1HOCA 2HN7B 2VMFA 3MXWL 2VISB 1GC1H 3L3JA 3CVHH 2DMBA 4FQXA 4NWUL 4BH7B 5T1LB 3X12A 3VXNB 3V6FB 2QEJA 2W65B 5L6YL 1D9KD 1B0WA 4BQ6A 2PW2A 1UVQA 4C58B 1J0KA 5IBLC 1L6ZA 2PYED 2ZWLT 2VR9A 3HA0A 1IGIH 1I8LA 4K94H 4NBZB 1KCUL 3C60A 1PY9A 5I1GH 2DQTH 2GSGA 3LRSA 4GW5B 2HRPL 1FN4B 2FIKB 3QNXA 3VH8B 3VXQB 2FLBT 4JHBA 2FR4B 1OQXA 4X99A 4M93B 3K8MA 3MCKB 5DK3A 2AJUL 4H8WC 2YSSB 5ERWB 2F19H 5MI0C 3ARGD 3BXNB 2VITB 4N0CC 2F15A 1W0WB 3V4VL 5JDSB 3GIVA 5CP3H 4XX1G 1A14H 3OJDA 2F74B 1A7NL 1S3KL 4MB5A 3VGAB 4Q0XL 2EYRB 2AEPH 3U48A 2MNUA 4G9DB 3U36A 2DKUA 3RJDA 1BVLB 1UH4A 1MNUH 5I9QB 1QRNB 4K3GA 1GGUA 4M61A 3KAAA 2ED7A 3BEVA 3U0PA 5D72L 3DTXB 1T22A 4M93C 5KS9E 3X14B 3BZFB 4G6KL 3V0AC 5TDOB 1OGAA 2X1XR 4MJ5A 1W0YT 4ACPA 1DLHA 2WUBH 2Q87A 3WFDH 4EN3A 1P7QB 2VZ3A 2VN7A 1K4DB 1PY4A 3MRQA 4H88L 1Q0XL 4JQVA 4K23L 1UFUA 2A6IA 2ZKHH 2OL3H 1YN6B 1MRFL 4U7SA 4YQXL 4NZUH 4LVNB 1JN6A 1OP3K 4HIJB 1AY1H 2Y5EA 4NCC1 4PJ5E 2HLAB 2EZ0D 3EYUL 1EO8H 2YK1L 1JNNL 4J3WA 2WLZA 4E5XB 4WHYG 5MEPA 4NQUA 5HI5D 1ZLWH 3EDKA 3F7RA 4N8VB 5L9DH 1FNHA 3W9EB 1VGEH 1NLDH 3A67L 1INDL 1ACZA 4P23C 4CVXB 5F89A 1CDUA 1MOEA 1I1AC 5FCSH 1ZVYA 2I60L 3IXTB 4PTUA 3KXFB 1JTTA 2B1HL 1JI2A 3MOAL 3BAEL 4M43H 1A9BA 1CXEA 2QSCH 4LL9A 3MNZB 1OD9A 3MRLB 2J8OA 5F1OB 1S3KH 2A6KB 5FKAA 5DVLA 1NGYB 4OM0L 4YLQT 4BQ9A 3FFCA 1S9XA 2X4RB 2OL3B 4LLYA 4OZHE 5DMGC 4J6RH 2C3VA 5F9WB 2HRLA 1XAUA 2X89A 4P3DA 3N85H 2IPKB 1YEIH 5EU4B 5FYLD 2YHGA 5C0RL 1KFAL 1FLTX 1GGYA 2ZSVA 3QI9B 4NQDD 3FRUB 1FIGH 3ROLB 1MVUB 4NP4L 5FCUH 4QRSA 5C8JA 5CCKL 2EKSB 5E94A 1ZSDB 5JO5B 1AO7B 1MREL 3OKLB 4S1DD 3NIDE 4NWTH 4Q9BA 3ILPB 5GZOD 3SKUD 4JZOB 5JA9A 5JORB 5C71A 4M1GL 4OTXH 1XGRB 1UB6A 5E99L 2OXHA 1YYML 3G9AB 1IEBA 1EO7A 3V8CA 2ZUUA 1Z0MA 4G6MH 5B38G 1XGUB 2JB6A 4M5ZH 2G5RA 3NGBC 5C0BA 2X70B 3OF6D 3L5XL 1UEYA 5M95B 3PHQB 2MOVA 1Q9KB 3MUGA 1EPFA 2NMSA 2XWJB 5TFSH 4RFEB 3UTSA 4QRUA 3SDDD 3VE0B 4I18B 3P9LB 1RZGB 5I1GL 2BC4A 2O5YH 4GKNA 3PWUB 3ZLQC 5MEPB 15C8H 3TO2B 3MLPA 1I1AB 2DOCA 2DYPD 3VFRA 2BRRL 4QRTA 3ZE0F 4TULL 4RMTA 1TZGL 3AMKA 1IRAY 4WI3A 1YMME 1MJUL 5SX4I 2RAMA 4JM2D 3TNNB 5KVFH 4ZD3L 5FHAL 5I16A 1KYOK 1R6VA 2P47B 4JJHA 2BX5A 4MQSB 4MNQA 5E8OA 1TCMA 3DVGA 4L8SC 5KS9B 3PHQA 5KTEH 1A0QL 5HPMB 4RQQA 2Y06H 2YA2A 5L8LB 1M7IA 1IKNC 5MP6H 2KDGA 4FXLA 3H42L 4GSDH 2Z92A 4L29B 4R7DB 1XF2A 3D0VB 2XZZA 3V0VA 4DEPB 1WGOA 4K8RH 3DI2B 1JTPA 4QHLB 4OBRA 1MFBH 1M71A 4IOFC 2X70A 3LEVH 1RJLB 1DQTA 1FP5A 4HXBH 4R26L 8FABA 4PP2A 5DJZB 3V6BR 1IE5A 3VCLB 5C0CA 3PP3H 1AGCB