4XX1G

Low resolution structure of lcat in complex with fab1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
210
structure length
210
Chain Sequence
SYELTQPPSVSVSPGQTASITCSGDKLGNKFTSWYQRKPGQSPVLVIYQDTKRPSGIPERFSGSTSGNTATLTISGTQAMDEADYYCQAWDSSTAWVFGGGTKLEVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Fab1 light chain
total genus 36
structure length 210
sequence length 210
chains with identical sequence L, O
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1G02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1G01
2A6IA 5IW1A 1HCFX 1CL7L 1NANI 5AUMA 3QUZA 2PO6C 1NCWH 3TT1L 5CINH 2LU3A 3E3QE 3FB8A 4P2RE 4M43L 2HKHH 3LKNA 2GW5A 2BVEA 1P4IH 3MOAL 4GXVH 4NJ9H 4Y4FD 1JHKH 1A14H 2WBWB 4H0GA 3KHQA 1MRFH 5K9JH 4WTXA 3FB5A 3HE6C 3DGGB 3MZGB 1L7TL 1U6AH 3KVQA 5FCUH 3UZVB 5GRJL 3CFCH 2AKRA 4P5MB 3BWAB 3D85B 5AWNH 2QSCL 3MV8A 3MRCB 1T1YB 3QXDA 1P6AB 5JIIA 4MJIB 3KPSA 2EECA 4IHOA 3DX8A 1RU9H 4ZUTB 4GG8B 4PRDA 1T3FB 3ETBF 5K59F 1AR1D 4L4VA 5E6ID 4YHYB 4ZFGL 5CSBA 4HFWA 3FMGL 1A7QL 4M1GL 5FOBA 5D1ZD 3NCYS 4NQXA 4NC1E 5CILH 1IGML 2ZSVB 3U9UA 3HC3L 4RSVA 1K5NB 4L8BA 1NFIB 2F53E 3MQIA 4QRRB 4AT6B 4FQHB 4WI4A 2DWDA 2X9XA 5H37G 1NGYB 4M7KH 1FZKB 2PXYD 3EYVB 2NY6D 3KG5A 3LRSB 3ULUL 3V4VL 5MEQA 4K7PY 3QDHA 4HK3N 1YYLL 2FCBA 4R4BA 2BRQA 1T0PB 4ZTPH 4CRPA 2W0PA 1QSEA 1P2CB 4XHJD 4Z76A 3TO4D 3GSNH 3GSOA 3FRUA 2ORBL 1RUQH 2B8OT 2G9HB 3BT2H 4MJ6B 4GMTH 3BSZH 4H1LB 4NN6B 4XNYH 3C5ZB 3SCMB 4S1SL 5L2JA 4MNQD 1BBDH 2NXZD 4LSQL 4UDUA 3SDXA 4OCWL 5T5NG 2A83B 4NQED 1ZHNB 5DD6B 3VH8B 4XP6H 1MJJB 2X40A 3W39A 3IDUA 3KLHD 1MI5B 3CFDB 3JWOH 2JIXD 3CK0H 1DP0A 3TCLB 2AJSH 1KLUB 5CZXD 1CDBA 2BMKA 2VZVA 5IMKA 4G8GA 4R0LB 5CSGA 1R5IA 3T1FB 5EUKB 4XGZA 1OM3L 4S0SD 1OVZA 1CDHA 2WWKT 4HUUA 3MSPA 3LS4H 4TULL 4OZIE 4XPGL 5DTFA 3MA9H 1X5JA 3EOBA 1MCPH 1DQTA 4WUUD 2R8SL 3Q3GA 2DQFB 1JYWA 2BSRA 1MHPH 1YYML 5HHMD 5FO7B 1ORSB 1YPZE 4MWFB 1NBZB 3RWFB 1JMZA 3O2DA 3PHQB 4LGSB 1B90A 1SBSH 3PDGA 4XXDB 1K2DA 1ZSDA 1V7NH 3L5JA 4NKOB 4QRPA 3SO3C 4CMMB 3RHWF 3QYCA 3KPOB 3VRLE 1KB5A 2W0KA 4PP2B 4ODSL 4RQQA 4FA8A 2FLBT 2OTWA 4ZODA 3B9EA 3OAYH 4J3WA 5I1CH 3VXUA 2HMID 4APQA 5DHXB 3FZUC 4MDJA 2H9GA 4RRPG 4XC1L 3QFDA 3MRNA 1N5YL 5I1IL 2H6PA 5F7EH 1D6EB 3D69B 1HHIB 1CZ8H 3NIGF 4HUWA 3MLVL 3V0VB 4HLJA 1HINH 4Y7MA 2J8OA 1KCUH 4F9PC 2AQ2A 5EN2B 3G6JE 5HI3D 1RZ8B 5FDWA 9CGTA 1MJ8H 3F7YB 5F7YC 1L9MA 2DYPA 4CVWA 1INDH 1FL5B 4F37F 1MCOH 1I7ZA 4P3CH 1H3PL 5GIRA 2NY3B 3AC0A 3RFZC 4ZO6A 2QEJA 4MNGA 4GG6B 1U0QA 3B6SA 3OR6B 2FECL 3MUZ1 3ULSA 3VXRD 4G7YH 4KDWA 2XACC 1D5ZB 4RISL 1DQQB 2ZOLA 3TVMA 5B3JF 5DMYA 3C8KA 5IKCA 3QISA 1AKJA 3VG9C 1FZJA 3QI9B 2BSTA 5D2LF 4LFHG 3P73B 3NZHH 1NEUA 2KKQA 4IRSB 2A9MH 1TQCC 3WNLA 1AXSA 3QUKB 3KS0H 4UILL 4MA7L 3O8XA 3B43A 2W9DH 3MJ7B 4HDIA 2BSED 3NACL 5T3XE 5IJKC 3DROB 2NX5E 1WAAE 2B1AH 3C5SB 3G08A 2NY3D 3BO8A 2FZ3B 2DLEA 2NXYC 1R3KB 3V52H 3WO4C 3DVIA 4LHUD 3C8DA 4G6FB 1SYSB 5ICXA 5IP4A 4GG6F 1WBXB 3IAGC 4LLAA 3VD3A 2NY1D 5FV2A 1T4KB 3CFDA 2VZ3A 4K8RL 4HWEH 5DFTA 1IC4H 5LGJB 4E41B 4ALAL 4I0PC 2FB4H 4Q6IA 4NSKA 1BVKB 4UAOC 4YUEL 3VXOA 1FVCA 5KVEL 4ZD3H 4G43B 5DT1H 3STBA 3LEVH 3F62A 1E4XH 4PRIB 1H5BB 4XZUB 4C83B 2XICA 3BGMB 4ODHH 3TT1H 1X9QA 1I9JH 3FCTB 4BFBD 2MPAL 3IDMB 4O02H 2HT4C 1PW3A 3VRIA 3FQNA 4JG0H 2AEPL 1DBMH 4Q9QL 3SJVB 4JN1H 3UROR 4GXVL 1NC4D 1RZ7H 4G9DA 4LCIL 3SBWC 4OT1H 4XXCA 2VZUA 2NZ9D 4AENB 4MA8L 1I3VA 1YZZA 4MX7A 4ZAKD 4ZXBD 4DGVL 2L4OA 2YOCA 1I8MA 4NJAL 4MB3A 5ERWB 3MO1A 3S6CA 4G6AC 4ENED 3Q5YA 4NO2A 3BIAX 5CEZE 4XXDA 3MLRH 1QPPA 3HAEA 1OAZH 4YZFE 3PABB 4WV1C 3O6KH 1Z0NA 2BP3A 2Q20A 1KB5B 3X3GH 3DO7B 1BFVL 4KV5E 3TO2A 3U46A 5DMKB 2PTVA 4N8VB 2GJZB 4JFPB 2Q8BL 4L4TA 2YPVL 1IZJA 5JNYA 3W9DA 4GRWH 5IT2L 4MAYC 3HFML 4KKAC 5F9JA 1G7MB 5JO5B 2DMBA 5J3HD 1CXHA 2BC4B 3VGFA 5C2UB 2B2XL 2QHRH 3KPLA 3ARYA 2EDDA 3N1PC 4YHKH 1UH3A 1E4JA 3EYFA 3TWCH 3NMEA 3BKJL 3FT4B 4H5SB 4GW1B 3U7WH 2APWA 1Z9SA 4TUKL 5E2TH 3STLA 3QB7C 5BOPA 4IRJC 3DO3A 1P7KB 4EN3B 2FJFA 3O9WB 3PWVA 4HUVB 4JFFB 5E4IA 3HCVA 4KZDH 1KB9K 1R24B 2Y72A 3A6CL 1PJ9A 4LQFL 4PJDF 1KPRA 5BVPH 4RZCB 1NGWA 4I3RH 4P5TB 1OGAA 5KAQG 3I6GB 3D25B 4XCCH 1BLNA 3TZVB 1XGTA 3KXFB 3V6ZA 3V6BR 2HT3D 3RIAK 4LP4A 5KW9L 3IXAB 4H88H 1LK3L 4FFYH 5D1XA 3BT2L 3MRKB 5EU5A 2KPNA 2GUOB 3QWRA 4WEMB 4XNYL 4C56D 3DXAA 2C1PA 1FFOA 4KK8C 3G08B 2D9CA 1HZHL 3HMXH 2FWOA 4F7EA 4KROD 3HPJA 4HIEB 1K3ZA 1UA6L 5J89A 3TP4A 4POZD 1DE4B 2CO7B 1XZ0B 5DVLA 4NP4L 2P1YA 4PS4L 1KCSL 1BQLH 3U36A 1BFSA 3K8LA 3V6OA 5EA0L 5LAXB 3QCVL 3UYRL 1RUKL 3AS0A 3RJQB 1I1CA 3HB3C 4HD9A 3VXME 1WWCA 4H20H 3WFZA 5MEND 3U2SB 1TZIB 2J8UB 1QFWI 3HNSH 3FN3A 3VXOB 5DZLA 1DUZB 1FVEB 1ZOXA 1LO3L 3BDYL 5D72L 4OIIL 3UTOA 4OZIB 3GJFK 2VITA 3SKJL 1VGEL 5I1HL 2P8PB 2WBKA 3OXSB 3KPNB 3X13A 1IZKA 2XQBL 5D9SA 4XMLH 1U42A 1FNSH 5E2WL 4E5XB 1QFWH 2BNQB 2ADIA 3HZKB 1HN1A 5J11B 4YAQB 1OGAE 4HIXH 4X6BB 3QDGB 4JZOB 3FN0H 5EZJB 5I66B 2D31A 4Y2DB 3TPKA 2VXQH 4PLKD 3O3EB 4QHNB 4X9HA 2R69H 2VXVH 4L8CA 2A0LD 4LVOB 5ICYA 3O6FD 5I8KH 3N1MC 3PE9A 4MB4A 4P59H 4HPYH 3MYJB 4G7VH 1EH9A 4V1DE 4EI5B 3OG6B 5L2KA 4FXGB 1T7XA 3MZTA 5I73C 5F71A 4DTGH 1OHQA 4AM0B 1EAJA 4NZUH 5BXFB 3U30C 3N9GL 4PR5B 3DARA 1S9VB 3GBNL 1SEQH 4W6XB 1EPFA 1HIML 1KC5L 4PJFE 1IEBB 3RKDC 2VLKA 1BGXL 3EDDA 2R0LL 1FZMB 2VDPL 5IFHH 1HINL 1HXYB 3O45A 4JM4L 5L88L 2BJML 1A1NB 3D0VA 1BD2B 4RA3A 3LPFA 5I8OH 4J3UA 4DKDC 4WHTB 1ES0B 1OP3K 3LKPB 4K3EH 3FAWA 1BQHB 4O2FB 4Z95H 4P3CL 3ARWA 5I1GH 3TNNB 4OQ1A 1FCCA 3SY0A 3MLPA 1VFUA 1QLRA 4G8IB 3GHBH 2YA1A 2KZWA 5FYKL 4JGUA 2KZ1B 4MMZC 2Y5TA 5CBEA 4HWUA 1A4KA 5D1QB 5MP6H 2VO5A 3H3PL 2IH3B 3PGFL 2E6JA 2MQ0A 3IETB 3ALPA 3OQ3B 4X6DF 5BQ7B 1SMAA 4QRRE 5DVNA 2DB8A 1MAML 3BMWA 3REVB 5EC1A 1MFDL 3LN5B 4LRNH 4MNGE 4P4KA 1JNNL 1NLDL 1X7QA 2IFGA 1KJ2A 4JHBA 1CFSB 1D5BA 3QZWB 2VTFA 3TA3B 1FYTE 5SWSA 3Q5TA 1AQDA 1AO7A 1J9CT 3U1SL 2RJMA 4XP1H 4ZO9A 1ZHLB 3MLYH 5DQJB 1QBBA 1Q94A 4JRYD 1BFTA 4WHYH 2IPTH 4F7MA 2BY1A 1HXMA 2GY5A 5HHVL 3BEVB 1NCAH 1ND0B 4UIKH 2MTPA 4JRXE 2JB5H 1DCLA 2YPLD 4LKXA 2CIIA 5HPOA 2VR4A 3IKKA 2R1YA 1IC4L 1KIQA 3CSGA 5ID0B 1BZ9A 4ZD3L 1P4IL 1FGVL 4LOUD 1I8KA 3ARXA 2EE3A 1FSKC 2DM4A 2R2HB 3OAUL 1BIHA 4KTEL 5FHAL 1OW0A 1DQLL 4QOKB 4PJ7B 2DTSA 4P2RB 5I18H 5I19H 5JW5A 1YQVL 2Z93B 3UCRA 2NTFB 3D0LA 3T0VA 1KTDA 4MA8H 3U0TA 4X83A 3S34L 4BELD 1WICA 5JHDE 4PJ9D 1KT2A 2HFFA 5I15H 5C9KA 1SMOA 1GVIA 1UB5B 5EU6A 1MCJA 1EXUB 2HRPL 4GKOA 3TN0C 2H2PD 4CU8A 4WTZG 3DMMC 3TBVA 3L3DB 4HKBA 3EFDH 1N4XL 4YHPB 4LLWA 1QYGH 4X9BA 5F6HI 3ZTJH 1ZTXL 4NC2B 2A6DA 2H1PH 5FUCC 3B8YA 4LARH 2Q7NA 5FA3A 2XTJE 1A7QH 1A6AB 4JPWL 2JTDA 1IAII 5C9JB 2R0WH 1IAIM 4M6NH 4QXWA 4YDJB 3DV6B 4NDMA 1KNOA 1IM9B 4RA0C 1NUGA 3GI9H 2DQGH 2PO6D 2FR4B 3B9DA 5DJCA 4NOFA 2DKSA 3U7WL 2NR6C 2R1WB 4NQCD 4QRUB 5C0ND 5IMMB 4IMLA 2YK1L 4RAVA 3FQXA 1BQHA 2AK1H 4P0DA 5CEXB 4GRLB 3UP1A 1CU4L 4JFOA 1NBYA 2RBLA 1ZVSB 3IJYA 2ZG3A 3FQTB 3RZCC 4BSWA 3D3VB 1PSKH 2NW2B 5DGRA 1WUNT 5HHOB 4X8JB 2HYMA 5CFHA 3NA9H 1YDPA 4PLJD 3K8MA 2QSVA 3KPTA 4HS8L 4OKDA 3TBWB 4PJEA 2F5BH 4HGMA 1BD2E 1IKNC 1Y6MR 4FNLH 5D5MF 3FMGH 1H0DB 5LWYH 1T1ZB 5T1DH 3P9LA 5C0DA 3WCYA 1FQ9C 2LU4A 4LHUB 4WO4B 5IJKA 4QWWD 4JCLA 3HMXA 3RU8L 4IDLA 5B38A 4M7JH 4HFUH 5KVFL 5FHBL 2GHWB 2P8LB 2LVEA 4OD1H 4M7KL 2GYSA 1ND0A 4QF1B 1BAFL 2QQLL 1IAKA 2N7AA 3LN9A 1UENA 3AS3A 4LKXB 5DJZA 2OMBA 1EBPA 5LG1A 1AI1L 4NKDA 3EHBC 1TENA 4X7EC 3VXRB 2PTUA 1UZ8A 4RMWA 2DMKA 5TF0A 5HYSG 5F1NB 1RUQL 1M05A 3ARRA 5A3IC 3BD3A 3T3MF 2VMFA 2ILLA 1MVUB 3M07A 5E2WH 4IM8A 4LBEB 5JDJA 3QWOA 5FYKU 4KK5D 1LEIA 5ELIA 1T83C 3B3IB 3OG4B 1U3HD 2EE2A 3OGCB 4YNYB 4X9GA 1JRHI 3B5GA 2KH2B 3HZVB 4P5TC 4WFFE 3NN8B 1MCNA 3L3IB 1S7QA 5EO1B 5DC4B 3WEXB 3MBEA 2W9LA 5CBAB 3MGOA 3ARUA 4F9LC 3RWDB 3EYSH 2BDNH 2APFA 4LSTL 2KBGA 3MOBH 5I1IH 1JPTL 5GGSB 1JE6A 4HX1A 2EDWA 5ESVB 5TGBA 5F7WC 1D9KB 2CDFA 3NCJH 1XF2B 3N9GH 3MLVH 4DJMA 3B9KA 3C2AH 3D5OF 4ORZC 1SEQL 5EZOH 5EU6D 4K55A 1CDUA 1U2HA 4F9LA 5F89B 3WXVH 1IM9A 4OGAD 4D8PB 1A8JH 4FHBD 1VFBA 4HS3A 4Q0XH 4U1SB 5C07D 3BQUD 4QOKE 2FR4A 2VDRH 3LHPL 1T22A 3O3AA 1S7TA 2DQEL 1U8HA 5E00A 4ZAKC 3R8BB 2V7NB 2BOBA 4YK4C 1K4CB 3OKLA 3ECBA 1J0KA 2ZSVA 3MRGB 4M3KB 1YEKH 2X6MA 2ZSWB 4HJ0D 4JFZL 2XKSA 1D3CA 3E6HA 4YWGL 3AUVA 5GISL 4EEEA 4LU5L 5MHSD 3GMOA 1K8DA 3P30L 3L5HA 1CXKA 1YDPB 2P43B 1QBMH 5E6YA 3C6LD 5A2FA 5HI4D 4LQ1A 2KUTA 5FK9B 4NN7B 2Q87A 3GZKA 4KDTA 5DQ9B 3KAAA 1CBVH 2IWGA 3MX0A 5DJ8A 3P9LB 5C0DB 4X9FA 2QKIA 4OZGB 2ICCA 1JF6A 5DQDH 3U1SH 1CGWA 3OKMA 2F54B 4Q7DA 4C56B 4FOMA 5EWIH 4RAHA 4LCCA 4BZ2H 4B50A 1KTLB 1K8IA 4K8RH 1MCOL 3QUZC 2IPTL 4LMQE 4CADA 1IQWH 4B53A 1NC4B 3LEVL 2OL3H 1RIHL 3RWGB 2JB5L 2BRRH 4ZUUA 5C0FA 4QT5A 1IAKB 4QOKD 3W0WB 4CGTA 3PWPE 3ULUC 2CSPA 1CD0A 2DQTL 3UYOD 1CLCA 2YHGA 3VMPA 3H9SE 4JN1L 4XP9L 4Y4KB 5FO9A 1DQLH 3QFJB 4Y4KC 2GCYA 1IRAY 3VCLB 4OV5B 4MA7H 4BFIA 2IANE 4N68A 1IGIL 2PR4H 1GIGH 2B1AL 2HAZA 3WS3B 1I1FA 3VWJD 3B2VH 4IRSD 4NRZA 4XMKH 3T4YB 5D7LD 3VFGL 3U4BH 1SJVA 2FO4A 2X89A 4WVRA 4NRYA 2MWCA 4IRSC 3V52L 4KQ4L 3S34H 2VYRE 2PCPA 4TPRL 2WNGA 5C0IB 3GSQA 2IALB 3T0EB 3RWEB 5I15L 4HCRA 3IKCB 4Y16C 2BVTA 3K80A 4YPGA 2YPVH 5GS3A 1CFTB 2EXYD 4MS8C 1WBYB 2GTWA 2GTZB 4NT6B 3SKNB 1D5MB 1F45A 3RA7L 1NMBL 3AB0B 4MWFA 3WL9A 2H1PL 5HHQB 3QDME 3ZL4H 3QXTA 2IBGA 1F2XK 1ZGLP 2VNCA 1MCKA 4JRYE 5EBLB 1Z5LA 4ONGH 4NN7C 1I9JL 3RDTC 3VWKD 1S7XB 1UWXK 4HIHA 3OL2A 1UGNA 4NZJA 5DF0A 4Z7QE 2WQ8A 4XVTL 4NQDB 4DFHA 1AXTH 1RZ7L 1WC7B 3PWPD 1LDPL 1NFDE 2GJ6E 3MV9B 4MJID 3CH1B 3MPCA 2VKXA 3VXSD 4UB0L 1NMCB 3QEGH 1MCLA 1QLFA 2H8PB 4LIQE 3E0GA 3MGAA 5BRZD 5KSAD 2VQTA 5D1ZB 5HGGS 2IAND 4ZDHB 1X4XA 1OAZL 1EHAA 1U93B 4I3RL 4JANA 3IXTA 5DJYB 5E6IB 1XIWB 3T0XA 1KB5H 2W0FA 1PZUB 4R7DB 1UQSB 2X4OB 1XGUA 2D7NA 5KSBF 2G75B 3ULVH 2ADJA 1AGDB 5JHDD 4NQCA 2XXCB 2EDFA 5C6TL 4PY7A 3BZFA 5E6ZA 4HS8H 2UZIH 3VXQA 3OXRA 4RMRA 1HSBA 4XPAH 1RZFH 3FHAA 3HMXL 2CH8A 4LCUA 4MNQE 4AIOA 4LGPB 3SGDI 4JVPA 4KKLD 5DVKA 3C8KB 3GMMA 1MNUH 4ZUWA 3S37H 3RU8H 4DAGH 1I9RH 1XGQB 2H3NB 2OI9C 3NFPA 4M7JL 3OGOE 5IVXB 5BV7B 1NCNA 3ZE0F 2WWKO 4U31A 4YC2B 4Y5VB 1X4ZA 2VJXA 1BX2B 3CSBA 1B0GA 4LQFH 3G5XA 3C5ZD 5GJTL 3MFFA 1LE5A 4Z0XA 3AFLA 3NIFF 5AYUL 5FGCB 2A6KA 2NY7H 3QUXD 4JZJB 1Z9OA 5IBTH 5IHZA 3FB6B 2VDLL 5DJ2B 2WWMD 1HH6A 3T1WA 4N0CD 1MSPA 3WXWL 3MCLH 3EAKA 4Q6IB 1M7XA 1YEDA 1JFQH 4LIQL 3EDJA 3LEYL 2CJUH 1WISA 4HWBL 1Z6JT 3B2UC 2HLAA 2X9WA 1C12A 2VXTH 4KK5C 1FYHB 4G7VL 3N06B 4PBVC 1MCRA 4GKZA 3AM8C 1ZK9A 1M7DB 5F7LB 3U0WL 2HJLB 3VGBA 3ARBB 1LQSR 3G6JA 5IQ7H 5GPRA 2APVA 5JW4Q 4BZ1H 5JXEC 1FAIH 3FFCB 5FYJU 1QACA 4HZAA 1AFVH 1RZJH 4K3GA 3SKNA 2YC1A 1CFNA 3EYOB 3LV3A 4ELKA 3C60A 4EUPA 4HIIA 1HNGA 4JFXA 2VZSA 5C0EB 2DMCA 3QUMH 2XNAA 1Q0XL 4HQQH 3ZKMD 5DJ6B 1T1WA 3O4LA 3SKJH 2LTQB 1J87A 4RIRA 3V5HA 3QHZH 5F9AC 1FLRH 3TFKC 8FABA 3NPZB 3DTXA 4X6EA 1S7XA 2K3TA 3O8XC 5JDSA 3C9NB 3MJGX 4HIXL 2NYYC 1C1EH 4LCYA 5C7XH 5KN5B 1A7OL 3ELAT 3D2UB 4OZFB 1SY6A 1UJ3A 5K9OA 1INQB 3LIZL 2H8PA 2DQEH 1NDMB 1LP9A 1G7QB 4HPYL 4Z5RB 4ZUSA 5MP6L 3QDJD 3RX7A 2YA0A 3QQNA 4LPUA 3B9KD 2YD2A 2X4UB 5E6IC 4U1JB 3D9AL 3NCYP 3F5WB 5IBLC 4N1CA 2WANA 1U58A 4PY7B 3PWLB 5ID1A 2FL5B 2F8XC 3BESR 2DRUA 2XXMB 2HG5B 4XH2B 4AL8H 5EBMB 2UYLB 1MIML 3MJ8B 4NQXB 2BHUA 4HK3J 2OZ4H 4OCMC 3RKDD 4JKKA 3TZVA 4M61A 4LGRB 5CJXA 1I3GH 2I25N 3RP1A 4FQPA 5KS9E 4ZSOB 2M1KA 3MNVB 3D18A 2XZAL 4LLMA 5CS7A 1KOAA 4XNQB 4WJ5B 4M1CC 3KYAA 2JB6B 3V5KB 2B7DT 5KZCD 1OARH 2ARJQ 4LAQH 1B0RB 2GFBB 4WWKD 1MJ7L 1I7RA 5IB3B 1HDMB 3OPZL 4OQTH 4FMKA 3U7AA 2CLRA 1EMTL 5IR1A 1MWAA 3VG0H 1CQYA 2NY1B 2X4QB 2XTJB 1MCCA 2YRPA 2X1XR 5GXBB 3QXVA 2FEDC 4ORGA 4K3DL 3VFGH 2MCG1 5HGDA 3REWA 2VITB 1JPSH 5CEZD 3WDIA 2AERT 1F58H 3EFDL 3FOLA 2OL3B 2A83A 1A6VL 3N85H 5D2NC 2YWYA 4WENB 1X5FA 2R0ZH 3RJDA 1RMFH 1PQZB 5B8CA 3Q48A 1O5DT 2EIEA 1ZLVH 2FJHA 3QBTB 1HHJB 3VJ6A 1VFAA 1NGYA 4NUJA 5EUKA 1YPZB 5T3XH 5JPMB 5CINL 5I19L 2VDKH 1AY1L 3GIZL 4JJ5A 4JPIB 3CXDL 4MLSA 2WZPD 5JDSB 3GIVA 1A14L 4ELMA 4OFKA 3PQYB 1VGKA 3VFWB 3U83A 3KYNA 3L3JB 3WLWD 1J8HA 3QEGL 2HVKA 4YX2H 2CIKA 2R2BB 4FQJH 4MQ7B 1BWWA 1HYSC 3VMOA 2W1NA 1UWEH 4PRNB 1A3LL 3UTTB 1F6LL 1NDMA 2ERJC 1IKNA 1OWWA 2RR3A 3V6OC 1IM3A 3BKYL 4FFVD 4PBWD 4P99A 3R4DA 1MFEL 4J6RH 4Y4FC 3C2SA 4H8WL 1MJJA 5DC0A 1F6FB 4YXLL 4HSQA 4X5XA 2RCSL 1WJ3A 3PWPA 4J1UA 4G6JL 4ZXBB 1WIUA 1V8HA 5GSRB 3QG6A 4UV4H 3DHMA 4R0LA 2ITDA 1C7TA 2R4RH 1UXWB 1JWMA 1OF2A 5KSVB 5DJAA 5E8NA 4I18C 2DQGL 3E1F1 3FO1A 3HR6A 4K8RC 3IDIA 1G7IA 3LVEA 1LD9A 3AY4A 4MNQA 2ZKHH 1T2JA 4I0PB 4I77H 1A2YA 1PVHA 4ODUB 1KIUA 1FL5A 4JCMA 4G6FD 3S4SB 3QPQD 1A1OB 2DIJA 4ODXA 3O6LL 3VE0B 3I02A 1P84K 3RVTD 4K7PH 3KYMB 3JUZA 1CU4H 3MRPB 3B6SB 3QUXB 2EDHA 1K2DB 4U6YA 4XNQA 3DUUB 1D5XA 4N90E 4YDVB 3ARFB 4J4PD 2JB6A 1AGCB 1JF1B 4G6ML 4PGBA 5CD5C 2VB5A 1BIIA 1W8NA 1KIPB 5C0BD 5H2BA 4OI7A 4Z78A 5LWYL 4APQB 1JL8A 1MOEA 2CIIB 2PKDA 3VFNB 3A67H 4OCNC 3BSZL 4BFEA 1XR8A 1JFQL 4LIQH 4EN3C 2NY1C 1GC1C 4P2CG 1F4YH 2CJUL 2C1OA 2C3XA 3DPBA 1NKOA 4GAFB 4TUOA 2EDEA 4IOSD 5A3ID 4XNUH 3D6GA 3G5ZB 3HE7C 1KIRB 4NFCA 2OL3A 1T5WA 3G6DL 1XF1A 1OSZA 1FFQA 2VLRE 1VADA 4RMUA 4JFDE 3ZE2E 4BZ1L 3C2AL 3MRQB 1DDHA 3JV6B 5EIVA 4D0DB 1PQZA 5E99H 2R9HD 4G80B 2AGJL 1FHGA 5SX4I 3GSWA 3KPMA 1G9NC 3DHJA 2WIIB 3OBAA 3RL2B 4XZUA 3WFHA 1PDKA 1RULH 4WHDA 4NZTL 1YY8A 1P7QB 1ZEAL 4WV1B 4R3SB 4RDQG 2JELL 2OS7A 2DI9A 4I18A 4Y4KD 2ZP0T 1R5WB 2D7MA 3RZCA 2DQUH 3U6RA 4LRIC 3FAXA 3RNQB 1TVHB 2DLFH 4PJ5E 3P9WB 3EYUH 4UT7L 1P4BL 4U7KA 3L3JA 2DL2A 3ARSA 3RI5K 2B0SL 3V9FA 1R3HB 2V7HB 3W82A 1NGPH 4XX1E 3EJYC 5FGCE 4QTHB 4ISVB 5JUEH 5F72S 3O9WD 3SN6N 5L8JB 2E27H 4HZLA 4J8RB 4KKAD 1MQKL 5BVJA 3EYSL 4LSTH 1MJUH 4EI6B 3DX8B 4U1NB 4U1GC 4ZUTA 1PG7W 2A2QT 5ICZA 3QUYC 1R5VA 1CLOL 3H42L 2WINB 4QWWC 5HJ3A 3LKRA 4U0RB 4PJHF 1UYWH 5FFLA 4FQXD 1BFOA 2UWEE 1WEJL 2XFXB 5HYJD 2Z0BA 4X5XB 1CD9B 2VZ1A 4RAVB 5FIEA 1T1XA 1FDLL 2EO9A 3DX6B 1FH5L 1IL1B 4C57C 3TIEA 1IC7H 2E7CA 3QT2A 3MV8D 4XPFL 3PHOA 4OB5H 1TVBA 2VAJA 3IS1X 1Q72L 5JQ6L 1WSST 1IQWL 4ZO8A 5D2NB 3RVVD 3UPRA 5T3XD 3QQ9D 3FCTA 3WE6A 2HJKB 4KFZC 4PJCE 4G3YL 5FB8A 5FYKD 5CGYC 1T03H 2EH7L 5TJWK 3SGEI 2ADFH 1QRNB 3SDAA 5F3BB 4K2UL 2Z8SA 3IYLW 5MEQB 2HMIC 3F12A 3H0TA 1I3GL 2IBZX 4B7IA 3DECA 5HYJB 3BH9B 3KPQA 4W4NA 1QSEB 2XZAH 3MRPA 4Y1AD 4HBQA 3VWKA 1NUDA 3RPIB 3NFSH 4LSPL 5FOJA 3UZQA 3WLWC 5TDPA 1WQVT 1EDQA 1QEWB 4OTXL 3CFJB 3QP3A 4G5ZH 4WI6A 1U3YA 4YDKH 5EIIA 4MJ6A 1W0WA 1AC6A 4LAQL 3MJ9A 2COQA 2VDQL 3K46A 1FFPA 3OJ2C 5CJXC 4K07A 1EAPB 5HBBA 4UNUA 2NXZB 1OAYL 3VG0L 2FX7L 4GRWB 1H9VA 4XVUC 1DBJL 3QIUC 3C60C 3RI5F 5D1XB 4GLRH 4U49A 3NACH 2D0FA 4J3XA 5HVHB 4DKEL 3WJLA 5D7IA 2LFGA 3ZMRA 3EFFA 4ZTOL 3BIBX 3MRDB 2FWOB 5GS1B 4URTB 2VC2H 4RGOL 3ZDXE 2QTEA 1PAMA 4Z7OF 1VPOL 3DX9A 5DHVB 1A6VH 5IB4A 4U6XB 1NDGB 4XNXL 1FL6B 5CZXC 6FABL 2YUXA 1VADB 4Z7VB 2QQKH 3BGAA 4YC2C 4BFGA 1KENH 4L4VE 5GZNC 3BVNB 1E4XL 3NZ8B 1I3RA 5I1LB 2JCCB 1EUUA 5FUOL 1A21A 3TBTB 4FP8L 3W5MA 5TGBB 5FCUL 2XZZA 2VLJA 1DN0A 2AQ1A 3H2WA 2Y25A 4E5XA 3EHBD 1R5WA 1LK2A 4GUPA 5EZIL 4N8CL 4DN4H 3QFJE 3QCTH 3S5LB 4NQSA 3TGXA 5JOFA 1NGXA 3C6LB 4GAJL 3P0YL 4CN6A 4TYUA 1UWEL 1KG0A 3LKOA 1M7IB 1YN7B 3NAAH 1JN6B 4P3DA 5SX5K 5F88A 2DIAA 4U1SA 4N8PA 4O58L 4Y19E 3F58L 4HKXB 2UVEA 5L2KB 1INEH 4N1EA 1BOGA 1ZA3A 4H8WH 1JZ4A 4JR9H 1BFOB 2YUWA 3IAPA 4ONGL 4G8FB 3KWWA 4QYOB 5EO0B 1CE1L 3ISWA 4OCSL 5J06A 2AXFB 4QNPF 2FLRT 2UZYB 3S37L 5ESAB 1JGDB 1J12A 3O41B 3AREA 1BQHG 4NFBA 3QDJA 5L7XH 1HOCB 2YD8A 3TWCL 1HXYA 4L4VD 2P8MA 1A0QL 5MEOB 1PX4A 1NL0H 2OTUA 2H32B 1SM3H 1S78D 3SPVB 2F74B 4AJ0A 3VGGA 3VXMA 4ZMAT 3STZB 4D0BB 4K7PL 3C8HA 32C2B 1N6UA 2YD6A 4WO4D 2ICEB 1OSPH 2YR3A 3NBNA 2PW2A 4RWYH 5DS8A 4RMQA 1UKQA 3CZFB 5DRNA 3T3PE 3T0EC 1MPAL 4NGHL 3VD7A 2CRIA 4ZFFB 1ZVHA 5BZWA 1H3GA 2IAMA 4HWBH 4HW6A 4JFFE 2VXTL 4F7CA 2DLGA 1EZVY 1KJ2B 4ZUVA 2GK2A 2CRZA 1G1CA 4UI2A 2I9TB 1HHHB 4M6OL 4EBQH 3JWOL 4PGCA 4QTIH 2RIKA 3S98A 3QIWC 1WFNA 2ZUYA 3O2DH 3QULA 1I7TB 2AJZA 3SQBA 2ICWA 1A7NL 5ILTH 4OGXH 1G7LA 1CCZA 4OZHA 4HQQL 5DFWH 5EA0H 2DD8H 4UNTA 2P48B 1WZLA 2EH8H 4JEGB 5KSUA 3T4YA 1WZMA 5F93C 4HXBH 2I5YL 1KPVB 2W92A 5L9DL 3RX8A 4PRAB 2FJGB 4OQTA 5D72H 1FV1B 1MWAH 2MNUA 5EU4B 1C1EL 1H8NA 2GAZA 4JDZA 3GJFB 2IQ9H 4JKMA 1MHPL 1RULL 2UVFA 4N9GB 4A6YL 1N8ZA 1QFUH 3G04B 4EDXA 4OI9A 3GSXB 1S7SB 4P2OD 3WXWH 4EUPG 4QRSB 3BP7A 1JTOA 1KEGH 3L7FA 2DQIH 1BM3H 3LIZH 4JLRB 4UV7L 4XCFH 5GGRB 5FGBC 1LK2B 4MAUH 3FN0L 4LPTA 5E5RB 1Z5LB 3FB8B 5HDBE 3TJHC 1KJVB 2GSGA 5TDNB 5SWSB 4LPCA 4IIQA 1KT2B 2B0SH 3UTTD 1DQDH 2R56L 3VFSB 3ZKQD 3P4MB 5BRZA 5IQ7L 1WC7A 8CGTA 5BOZG 1EEYB 4XC1H 1YY9C 4U1MB 3UTSA 4XVSH 5MI0B 1ZT4A 3HG1E 1IKFH 3UJIL 3BEVA 4BSVA 3BZ4A 4KKLC 5JORB 5IB2B 3CXHJ 1JPST 5B3JE 5AD0A 1S5HB 3VGAB 5KS9F 2BNUB 4WI7A 1WEJH 4QRRD 4QYOA 5GGRY 5IM7A 3EDFA 5CD3B 1FH5H 2FIKB 1KN2L 4PJIF 5IESH 3B83A 3DV6A 3ESUF 1KJ2L 2GEEA 4KJYB 2A77H 1IBGH 3MOQA 1RIUH 4OFYA 5JQ6H 3BKML 3O11A 5L88H 3OB0K 4P48A 4ZS7H 4G3YH 1AE6H 1ZA6A 3HCVB 1MFCH 5CWSB 2BNRB 4ODTL 4WIQA 1HHKA 3L3KB 3VXQB 4DWHA 2R1WA 2B5IC 1D9KC 4NCDA 2D7QA 2UUDK 3L3HA 3OV6A 4JG1H 3U7YH 1OARL 1G7HB 5I1GL 1PZ5A 2XWBB 5I1DA 3GGWA 1MJ7H 3KPRE 5T1LD 4JQVA 5EU6B 3SGDH 5F7NC 3E8UH 3FQTA 4AH2A 1IQDA 5IEKA 4UILH 4P23C 4G8EB 3VFTB 5EOTA 1FGNL 2W9DL 4LLWB 3GBLA 4TVPE 4E0RA 4EVNA 4MNHB 2F5AH 5CMAB 4ZOEA 1NLDH 2E7BA 3HI1A 3DJ9A 3T3PF 3PJSB 1MFAL 5FA4A 4NN5C 1KULA 1VB9A 3HAEH 1MCSA 1T2QL 4ZUVB 4YHLL 4WO4A 4R2GB 4PP1D 5C92A 3C6SA 4P9HC 4PGCB 3B5TA 4KV5F 1CR9H 2ATPB 4U6HB 2AS5M 4YZFF 1LO5A 5KVEH 1KBGL 3WHXA 2CK0H 4QCIB 4QY8A 5FGSA 3H6JA 2Y36L 4GBXA 1V3MA 4XNXH 4QF1A 6FABH 3MV8E 1FRGL 4PJBB 3IDXH 4UDUB 5CUSH 4JDVB 4GFTB 2VDKL 5EU7C 3NCFB 3X12B 5IV2A 3VWJC 3JV4B 4GKZB 1DQJA 4M93C 4HGWB 3T0AA 2HTLD 5DMGC 3RTQC 4DGVH 3A6BH 1YEHH 5EOCL 1FIGL 4NBZB 5BO1H 1Q8MA 4PTUB 4KRPB 2GK0A 2Q76B 3PWNA 1HILB 3T4AB 4LL9A 1UT9A 4Y1AE 1JTPA 1LE9B 2O5ZH 4QRQB 3V5HB 4JRYA 2EIZA 3E2HC 2YSSB 1BREA 4LLVA 3BXNB 2HRPH 2JJVA 3RTQA 2BXZA 5FYLL 4OAWA 1OOAA 4XWOC 5HVWA 4POZC 4LCYB 5KN5A 5IT2H 1N26A 2HVJA 4Y4HB 5DD1H 2Y06L 4LLQA 4TUJA 2XA3A 1ZT4B 5I8EB 3CDGB 1JMXA 1OPGL 1OT1A 3VFMB 5L2JB 3MRRA 4PJHA 1N0XH 4QRPB 5GGVL 3RY4A 4UUJA 1J0HA 4L3AA 3P3YA 3ES6A 3EO0B 1RJCA 1ZHNA 5DD6A 5SWZD 1BD2D 4WGWB 5LQBL 4AIZB 5E24E 1XIWD 1X5HA 5ISZD 3M45A 1A3QA 1Z2KA 3MA7B 4YE4H 1F97A 4WU5A 4P2QE 3MREB 4Y2DD 1HHGA 2VISA 4HJ0C 4OKVB 4LK4A 5J13C 1CK0L 1HHIA 1G6RA 1S9XB 3MODL 2V7NA 2NLJA 3ZDXF 4LLDB 4NQDD 2HTKC 4PJGE 5EN2A 4HEPG 1PZ5B 2X70A 2XWBA 5K59E 4L3ED 3GGWB 3BEWB 3IJSA 2ID5A 4H26A 3QR2A 1T7ZA 1GOHA 4QXTA 2GSIB 2B39A 4WW2C 3TJHD 4H88L 2BSRB 5IWLC 3A67L 1J5OL 3F65A 1B2WL 2CXKA 5HGAB 4S10A 4PUBL 4EVNB 1CGTA 3ULSB 4YEEA 4UZGA 2XZCH 3FQWB 3FFDB 4MHHI 2AK4B 5T1DL 3Q0HA 5LBSL 3RVWC 3RAJH 3VFRA 1G7JA 4O5LL 1O7SA 1S8DA 4XNMB 1QPXA 2PW1B 5JA8B 4NFDA 5HYFA 3QIBA 3RHWK 3QEQB 1RUKH 4AQ1B 4S1RL 5B22A 5CP3A 4DVBA 4YHML 5KVFH 4KRPC 4PRIE 2HFGH 3S9DB 2NY4D 2NY0D 3TBYA 3U4EA 1BAFH 3LN4B 5FV1L 3BO8B 1EHLH 1GC1H 1QO3A 4WWKA 2LVCA 1CQKA 4JM2B 3HAEG 4MD0B 2P24A 3LRHA 1JZ8A 1KGCD 2JELH 3LQAH 1S5IL 4M7LH 5MENA 3QUZB 3V5DA 5C08A 1PG7H 4HUXA 4HLZG 1HQRA 4DUWA 1FFNA 3QDGE 4TRPL 2D2OA 4DQOH 1KEGL 1ZT7B 2O5YL 3OR6A 1FORH 2GK0B 2Q76A 2AXGA 4X98B 1HNFA 1YEJH 3U0PA 4HKBB 1A6UL 1AGFA 3PG2A 4JRYB 1XF3A 4ZNCD 4GW4A 1CLOH 2VWEE 3QNYB 4QXGL 1HQ4B 1U8OB 1VCAA 5ABDE 3ARGC 1RHFA 4KQ3L 5E9DD 3BWUC 4IJ3C 4FMFA 1J05A 3RWIB 3DYOA 1GPOL 5FF6A 1JPFA 4J23A 1JPTH 4PYHA 4Y5YA 1IKFL 3T65B 4TNWK 1PFCA 4P23B 1CS6A 4A2MA 1FG2A 3FB7B 5EBLA 2EDJA 4NPYA 3V0WH 4KUCD 2CGRH 1IC1A 3HS0A 3MUGB 3UJJH 3IU4L 1T03L 2EH7H 2VLRA 2CDEA 4PRDB 5GRYA 2WBJB 1UJTA 3QNXA 4WU7A 4IOIA 4K3EL 4XBEH 4UOW0 4F2MB 4CW1B 2ITCA 2ZUTA 2EYSA 5HYQA 5FKAB 4PJAA 3OKNB 5CP7B 1P4LB 3NFSL 2QJDA 4LSPH 1WGOA 3ZKND 3I2CH 4KK6C 1A9BB 2VXUL 3WJJA 4HXAL 2MQ3A 3MRHB 4N1HB 3CMGA 3KLDA 1X5KA 1CDCA 3E8UL 3N50A 4DZBA 4D9QE 1OAYH 3TN0A 5HI5C 2Q6WA 2GTZA 1A1OA 3HUJF 2ADJB 4ODXB 4CKVX 5TE4L 1Y6KR 3HC0A 4JPKH 5CIPA 2NW3B 4O2CA 2A9NH 1U92A 2PETA 3RQ3A 1X4YA 1XH3A 3JWDC 1QSZA 4OB5L 1AHWA 1PKOA 2BHYA 4QRTA 4POUB 3OJDB 4WEBL 3O3BB 4Z77B 4UNVA 4O9HH 2AXHA 1OTTC 1NGQH 4UIKL 5D6CA 1F8TL 5DDHA 3T0ED 4BZ2L 2ADFL 5F7MC 3GRWH 3W9DB 3KR3H 5DRWA 5HYIA 3BQUA 4PJXF 5A2IH 1OAKL 4PJDE 1A1MA 3RNKB 4YHZH 4MMXC 4G6KH 3MRLB 1KENL 2I60L 3UAJD 5I2IA 3EJJX 4OTXH 1S7VB 1T2XA 3MNWB 5IB5A 4G8GB 1YQVH 2EYTA 4YGVB 2HJFB 2VDQH 2W0FB 4U05A 1MVUA 1T04A 1R5IB 4WI2A 5J1SC 5TH2B 4PRBA 3UTQB 4N9OB 5CCKL 2KL6A 4N8CH 1FNLA 1T7WA 4KY1H 4GOSA 3L5XL 3QCTL 4LOUC 3BZFB 1GIGL 4DN3L 2F8VA 2DQDH 3QIWB 1S7QB 4D9QD 1FFRA 2AABH 4NKMB 4HFWB 2XPGB 2R39A 3NAAL 2VC2L 4RGOH 3DI2B 5B39A 5E94A 1F3DJ 4LDLB 4XCNA 1CFQA 4ZYKB 4XC3H 5JA9A 5I16B 4R26L 3WSQH 5F6IB 2NPLX 5ACLA 4UT6H 1NAMA 3G5YA 4Q97A 3K4DA 3PDOB 1DANT 3C60B 1YMHA 4Z7WB 3GO1L 1H15A 3K4AA 2VDML 2IBZY 5KOVC 3Q6FA 4BA8A 4HH8A 3WNPA 1MLCA 2RQ8A 2IPKB 2XT1B 4B7LA 3FO9B 4FP8H 4U1IB 3IU3A 3MOAH 2J6EL 1CE6A 1FLTX 1UM6L 4NJ9L 1AXTL 2WBJA 4KMQA 5DD0L 5IQ9A 4WNQB 1CXEA 3IGAB 5INDB 1JGEB 4DN4L 1PKQA 2G9HA 1VACB 4Y2DC 1YQ2A 4WUUB 3ZSSA 3T08A 2FHFA 1OSPL 4LLYB 3VW3H 1P4LA 2ZJSH 4FXKA 4K9EL 4UBDC 2QR0A 4NUGH 1G9MC 1LILA 1I85A 3ZYIA 5L6YL 4UT9H 4NGHH 1KB5L 2JJTC 3THML 2ZZUT 2DN7A 1WFOA 2E5EA 4JR9L 1V05A 2XWTA 3R8QA 4LAJH 1HI6B 5H35A 4O2FA 4KI5F 4Q2ZB 1XGPA 4FFZH 1UCTA 3OKMB 1U58B 3QEQE 4BJLA 1AKJB 4PJIE 5DJDB 3FHQA 4ZPTA 4YDLC 1KTLA 3VI3F 5KG9B 5KS9A 3E6FB 2D7TH 5T3ZL 1PBYA 1A7PL 4CJ1A 2XN9D 4IDJH 4M48H 5D7LA 2NY0B 1I9RL 4X7CC 4S1RH 4M61B 4RAUB 3T2NL 5IFAH 5IMOB 3TYGH 2ZUUA 3W0WE 1AI1H 4WHYG 5F97E 3U9PL 5DUPH 1MCWM 4G9FE 2Y6SC 5BW7C 5C0RL 3DIFB 2CRMA 3BP5B 2BVOA 3KPRA 2YPKB 4NRXB 3UYPA 3QCUH 4XVUD 4CMMA 4LMQI 5GJTH 1T20A 2XA8L 5C2BH 3K8KA 4O51A 5D71H 2OTWB 2FBJH 1S7UA 2NY6B 2VIRA 5A16A 2VLLA 3QDAA 4MJ2A 4ZPVB 5DEFB 4M6AA 3BGMA 1TETH 5ESQA 5DSCA 4OLZL 3TV3L 3WIHA 4X7TB 3BHBA 3D39E 2R1YB 1UFUA 5HI4C 1QKZL 1C5BH 3O6FC 2X4QA 2XKUA 4U6TA 3FT2A 3PWLA 4S1SH 4LEXH 4QTIL 3ARFD 1N2RB 4YFDB 4HKJB 5DFVD 2NY0C 2VABB 1GOFA 5D2NE 4XVSL 3G5VB 4FABL 2R0KL 2UYLA 2X1QA 3MJ8A 1VEOA 5ILTL 3SCMD 3NTCH 1TITA 3EZJB 5JW3L 2DQHH 2CKNA 2EDXA 1LDSA 2XKNB 2ZCLL 4HULB 4ENEC 1XCTA 2EH8L 4PG9A 3GMLA 1KTRL 3MTRA 2I5YH 5EZOL 2JJTA 2P5EB 5KSAC 3LKNB 3BQUC 1XF4B 5IESL 3FL7A 3I50L 2GJZA 3OKKA 3EJYD 5SWZB 3RUGA 1QFUL 2NX5D 3V0WL 4G9FD 3FQUB 1FLRL 5ITBH 2G2RA 3IU4H 2GT9B 3LS4L 4XCFL 4N0YL 2FD6L 4JDTH 2E3VA 4U2ZA 5BZDA 3VWKC 4PPTA 2PYEA 4PGEB 1DUYB 3UDWC 4XWOD 1MCWW 4PJ5B 1RK1A 3MV8B 3WD5H 3U4AA 5HDLA 2AXFA 4GW1A 3NA4A 1KELL 3BE1H 3P11L 4X6DE 4L9LA 5F1OB 4OCYH 4PJXA 4GBXD 1FGNH 2EKSB 1BEYH 3P30H 1FO0B 3QDGD 4OZHE 4Y4HC 5F9DC 3MYZA 5E8OA 4LCUB 5EO9B 4LEOA 5T3ZE 4NQVA 3VI4F 5TE4H 1B88A 2W60A 3QUMA 1EEUA 3U9UB 3SKOB 1U8KA 1W2KT 1LVEA 1WAAF 1BOYA 2I26N 3IJYB 4MAYD 4XXCC 2I27N 1NGZA 3VXTA 5LJYH 5IW6B 4IRJD 5E9DE 1NCBL 1J1OH 4Y4FB 4JGJA 1BQUA 3LKQA 2EEAA 3VRIB 3INUH 4L5FH 1TLKA 2H26B 2W38A 1SY6H 3FTGA 5FUCE 3MFFB 3FRPA 1Q9WB 1DLHA 2XG5A 4MQSB 1OQXA 1TJHH 4JO4L 5CJQL 4NM8H 3QXDB 4UQ2B 3TVMD 4XCEA 4PJAF 4PJEE 4NDMB 3DIFA 4XP9H 4BQ8A 3CSYB 5B38B 3BZEB 3QUZD 2DF3A 3MV7D 4RISH 3DV4A 3WKNA 1KCLA 4JQXA 5DMKA 3U46B 2IJ0C 2UY6A 4KK9D 1E4WH 3K0WA 2F5AL 3B9AA 3LOWA 5LXGL 4GQ9H 4Q9BA 1EMTH 1JF5A 2EC9T 3MLXH 5ESQB 4TPRH 4R2GC 5HY9A 4M6ML 3VH8A 3BPCB 4XTRC 2JJUA 2R29L 1UWGL 4L8BB 3VXRA 4U33A 4DK6A 5FM4A 2GAZB 4BSWB 4TUOB 2C7UA 4RGMC 3BKCL 4WI8A 1NSNH 3MRMB 3RA7H 1S7SA 4OBSA 4J2XA 2CDGA 1VKXA 1A2YB 2DI7A 1SYVB 4R26H 4Y19D 4APQC 1NCWL 4PP1C 3B3IA 4HWEL 1T21B 1B4JH 1T6WA 2C3GA 1RUML 5DEGB 2ZG2A 4YK4B 1XF4A 2AAVA 2OJZH 3HZYB 1QG3A 3MRIA 4U6YB 4UB0H 2NYYD 4ODHL 1K4DB 2LU7A 3CPLB 1WBZB 3DMMD 3O8XD 4O02L 3I6KA 3RWCB 2ADGB 5T1LB 2E8ZA 5GRJH 3D25A 1BIIB 5B38G 4RX4A 5F96L 4PJ9C 3ZKMC 3KPPA 1NMAH 1YEIL 1OLZA 3PP4L 3ZSTA 3HNVH 2ARJA 4YHNB 3ET9F 1ONQA 1KCRL 1HYSD 1FFOB 1MREL 2YD7A 4G42A 4MSWB 3S5LG 2PYFA 3R0MA 1IAIH 4JY5L 2X4SA 1XZ0A 2EZ0D 5L6YH 4R8WH 3ZDZF 3THMH 4G9FB 1ZHKA 4UIMB 3CVHL 5HI3C 1HHKB 3U36B 4MJ4A 1EUTA 5DI8A 4OIAA 1VA9A 4JAMA 5BS0A 4R0LC 4Z7VF 4HUNB 1JGUH 5I1DB 3RWJA 1IGFL 4LVHC 3L3IA 2R4RL 5INCA 1ZS8B 2FEEI 3RL2A 2VLME 5DVOA 3NIGE 3I3EA 1JUFA 4TTGA 4PB0H 4Y5XA 1EA9C 5E2TL 5IEHA 1CG9A 2P5WB 1D9KA 2CDFB 4V1DD 2VR5A 2EIDA 3A0OA 4NKOA 1H5BC 1NCDH 3QDGA 4JZOA 4HS6A 1D5ZA 4RFEA 2VSCA 3WUWG 4JKWA 4KH2A 4MCYA 3FJTA 3HE6D 2ESVD 4PYGA 1MH5B 1RIVH 3IRZA 1RPQA 1XR9B 4HUKB 3GSNL 2PF6A 1UKTA 5F6IC 2CO6B 2VH5H 3IJHA 2HRLA 4PLJC 1C16B 2CKBL 1V5JA 3CSPA 5JMRA 5K93A 5KJRL 3IS0X 2B1HL 4DQOL 4F7TA 3PNWA 4BKLA 3VFOB 2MKWA 4M1DL 5HYSA 1CLYL 1RZGA 2X09A 3T2PA 5GGTH 3V0VA 1NEZB 4HG4K 4WO4C 1C5BL 1F4HA 5J6HA 1K6QH 3CK0L 3RKPA 4S0TD 1KJMB 2HKFL 2AJSL 2YPLA 5C6WH 1YECL 3X11A 4BUGA 2HN7A 4FABH 5I30H 4PG2A 4Q9RH 4MCZB 4P2OC 4U4BA 5JW3H 1E6JH 1KCSH 1MRDH 4PFEA 3QEUB 5D5MA 3QCVH 2X4PA 5L2KE 3KHOA 1IGTB 1Q9KA 4I48B 4XRCA 3ARZA 3QIUD 5FYJD 2A6JA 4M8QA 3F12B 4Y2OA 2GI7A 1BJMA 1G6RL 4YHIA 5AYQA 3LCYA 4OIIH 2BSTB 3EYQC 3BVNA 2X5PA 1DR9A 5SWSD 5BMFH 5KZCB 4H8WC 2XQYK 3VU2A 3LMJL 3CDCA 2A0LC 1OLLA 3MRCA 4YEFA 5ERWA 4LLQB 2OJEA 1YUHB 4HHAB 1S7WA 4YJZL 1FNSL 5HHQA 2GJJA 2O5YH 5C0BA 3B9KC 5I1EH 5DRZA 2AJ3B 1M6OA 4HK0B 2YA2A 3QJHB 5E2VL 4W81A 4NNPH 2IADA 1MAKA 2MHAB 3GMPB 4X4ME 2DIBA 2V5YA 3QQ4B 1JBJA 1EFXB 3GKWL 2W65B 1QR1A 3KPRD 3SBWA 2VLKD 1YJDH 4GSDL 4KQ3H 3VCLA 2Q3ZA 4BFIB 4JFDA 1J8HD 5F88B 4Z7NF 3TN0D 1EJOL 4IS6B 1K5NA 1ORQA 3X17A 1ZHKB 1AKJD 3GFUA 4Z18A 4C83A 1U8QB 4ZS6C 3GEWB 3GBNH 3EOAA 3EYFB 1T66C 5BCAA 3HPLA 1LD9B 1FDLH 1FN4B 1MUJA 1TTGA 4DUXA 4YBLB 4U0QB 5D96B 3RY6C 4H5SA 1IC7L 3WDJA 5I17A 3GSUA 1BGXH 1JGDA 3CH8A 4K94L 1IC5H 2Z92B 1B3JA 4AEHH 2I07A 2MSPA 4KJPD 4EN3A 4OLYL 5J1AB 2UWEF 3PWVB 4HUVA 5J6GB 4G6KL 1LP9E 5M7QA 3KYMA 3TCXA 4FG6D 1ED3A 1QSVA 3QUXA 2YWZA 3MFGB 4ODVL 3O2VH 1JZ3A 1GHFL 4HXAH 4RFEB 3L6FA 5JTWA 1RUAH 1AQKL 5FO8A 1TZGH 3OPZH 3L5IA 4PV8A 5FYKH 3RGVB 1A7BA 2AI0H 4JZNA 4KY1L 4X4YB 1FZOB 3WUZA 1J0IA 5F9JB 5JO5A 4F57H 1RSFA 4JPKL 4YQXH 1QLFB 4UDTA 5D2LB 2D03H 3C5JB 1QSFE 4TN9A 4BM7A 1U3JA 3CUPA 3PV7A 3G9AB 5FM8A 1BECA 3C5ZC 3W9EB 4X5WB 2ZUWA 1C7SA 2R0ZL 5CHNA 1XGUB 2I9TA 3WSQL 3LRGA 1NCUA 3EKCA 2CMRH 3KPSB 5E1AA 1KXQE 2FB4L 4H25B 1TZIA 4YHZL 4IBLT 3IFPA 1YEDB 4IEFB 5MEOA 5C0AD 1R3LB 2VDMH 4PY8J 12E8H 3C09B 4I48A 4XRCB 4XP5H 3ARDA 3BDXA 2BX5A 2FDBP 3R1GL 1PG7X 4JREB 3SGJA 4R7NB 4U3HA 1C5CH 3CXDH 1RZIA 3S37X 4CAGA 4N5ED 3BIKA 5CCKH 1XGQA 1AC0A 2YZ8A 3PWJA 4HC1A 4EOWH 2GY7B 3L5XH 2I9LA 1T0NB 3V7MA 1CFNB 3EYOA 3LV3B 4LSVL 5FYLD 4D3CL 4EUPB 1MRCL 2YMXH 3HTLX 2NY2B 3MRFA 1NUNB 1FZKA 3D1MC 3VW3L 2WMPA 5CJOL 2PNDA 4HZLB 4YHYC 4JFQA 4NUGL 2M2DA 2OMNA 3WIFA 2FO1A 4Z0XB 2IADB 2MHAA 1DVFB 1MFEH 4YR6B 5FXCH 4D9RE 4OM1L 1MCBA 4FQ1L 1HSAB 1D6EA 4NQDE 3VRJB 2JJWA 2VXSL 4JRWA 1MREH 1CTOA 5E0QA 2RCSH 4M62H 5IMLB 4GKNA 3ZKXC 1TTUA 4G6JH 4JFDB 5HHNB 4I3SH 3BUYA 3PGDA 2DYPB 2G60H 5FKAA 1S7RB 5F7KC 4L3EA 1MCFA 2AV1A 1ZKAA 3X14B 5I0ZA 2P5ED 5D2NA 5FUZL 1ZWIB 3LS5H 1JVKA 2HA1A 2X4RA 2BSSA 4NWUH 1XFPA 1JGUL 4M03A 5DD0H 4JHZA 4FQXC 2C9AA 1FV1A 3ARBA 3T2NH 5IFAL 1FIEA 4HT1L 2HH0H 4N0UB 2D31B 2IAMD 4Y2DA 1S9WB 3GMNB 4CVZA 3GB7B 1AXIB 2FSEA 5J6GA 4L8CB 5CWSA 4LCCB 4Z9KB 3F7QA 4R96B 5J9PA 1FYTA 5TDPB 1JRHH 4DKAA 1VDGA 3PF2A 3WJJC 4XCCL 3BP6A 4FQLL 2Z31B 4JFHD 4OJFH 3V8CA 1CFVH 2YUZA 1EAPA 3HB3D 5BJTA 5BXFA 3P4MA 1OAUH 5D6DC 3M8OH 4PJDB 1X7QB 3TIDA 4OLUH 1WITA 4PRPD 2VH5L 4ZOAA 2CKBH 4KROC 1F3JA 3RBGA 4LPWA 1ZHLA 1KTKE 3BPNB 4JM2D 4XBGA 5GGTA 2DQCL 4J4PC 2D7TL 2HFEA 5GGTL 1QSFA 4MA3B 1P53A 4RQQB 3MR9B 1SJEA 4NO5A 4X99A 2HT3C 4NYLA 2EYTB 5ETUA 2ZCLH 4W70A 1I75A 1KFAH 4PRIA 4PRBB 3UTQA 2CD0A 1ES0A 2HKFH 2CRYA 5E99L 1QP1A 3MRJA 2NY2C 4XP4H 1UM4L 3UTTE 5C0RH 4OGXL 4ORGB 2DLIA 3QCUL 1D5MA 4R4FH 4P2QA 3L3HB 2F8OA 4QRPE 4MXQD 3GUTB 2VDOH 1WZKA 1YC7A 1N64L 1MHHB 5D7JB 4P4KB 4AZ8A 3HAEB 4O4YL 1TVDA 5ENWA 4S2SA 2VXQL 1A47A 1EX0A 3DO7A 1MLBA 5E4EB 4KZEL 1YN6B 5C08D 3KPSD 1LO0L 2FH8A 4E0RB 5JUEL 1ZT1A 3MV9A 3HI1B 3VFUA 1TZHA 5KSBB 1WTGT 4MAUL 3H9ZA 1LE9A 4OF3A 2Q3AA 4ZXBC 3H3KA 4LNRA 1B0RA 2GFBA 4QGYA 2DQHL 1ITBB 5C8JB 4OGYL 2BC4A 3B4NA 3CU1A 4JGMA 4NN5B 3WKML 5I76A 5IB3A 3D85A 4OAWB 5AZEH 1Z0MA 1QZ1A 2NY5H 5EO0A 3HC4H 4JY4A 3C87A 3AROA 5J4MA 4HDIB 4MJIA 3G6AB 1WAAA 2NTSP 5D7IF 3VXUD 1X5YA 2RGSA 3WFDH 3STLB 4PRNA 3UTTA 3MROB 4P2YA 5HGDB 2G75A 3P77A 3KNBA 4JFFA 1AD9B 3JBG7 2A6IB 1LMKA 3WUWA 3OKOA 2CLZA 4EQ2A 4WDIB 4JVUA 1E4KA 4O00A 3MXVL 5IUSA 4XVJL 1PEWA 5CAYB 4KVCL 5T1MA 3BUTA 1B6DA 2YKLH 3WD5L 1F3RB 3QPXH 1DBAL 4WW2A 1KELH 3BE1L 2G5RA 1FL3B 4ODVH 3IXAA 2NW2A 5HHOA 1JZ6A 1CXIA 3L7EB 1A7RH 2GUOA 1UM5L 4MA1C 1AQKH 5C0GA 3UO1L 5F7DB 3GIVB 4NCC2 2WIMA 2FGWH 1AD0A 2NY6C 4FQIH 4U6VL 4CDHA 1L9NA 5IMOA 3RY6A 4LU5H 4M6MH 3CLFH 5HVGB 4YQXL 2OR7A 2FIRT 1P2CA 1AGBB 1YEFH 4KI5E 3FRUB 1CBVL 1S9YB 1HH6B 3WJLC 3FFDA 5GS2H 4RGNE 4BH8B 3U2SA 3QJFB 5JPNA 2J8UA 5HI5D 4P46B 4W68A 4JO2L 5M94B 5BRZE 2ICWB 3MR9A 3OKDB 5K9KA 1GGBH 4FQ2L 2B4CH 4L4TB 3OKYA 1AO7E 3OHXB 2FEEL 4B41A 4EUPH 4K7FB 4P2OA 1MI5D 5CJQH 5I75B 4TTDC 2YN5A 5HHME 4S1QL 1ETZB 4L3CB 1ZVSA 3LY6A 1S9XA 5CSZA 4JQIH 4JM2A 4MD0A 2WWMC 4LF3A 4KJQD 1F02I 2C3VB 3TBWA 4K7PX 5I1JH 4XGZB 4GQ9L 3TEUA 2R2CA 3HG1B 1I8LA 4XWGH 3MLXL 3MRQA 3PL6C 4NOBA 1YEHL 2GJ6A 1TCMA 4X6EB 1Y18B 3P0YH 1KCRH 4P57B 3CFBB 1RZJC 4P2QD 1U36A 4DZ8B 5SWZA 2FGZA 4KQ4H 4LDEB 5JIKA 1XCQB 1IEBA 1AGCA 4O58H 5IVZA 1OGAB 1A6WH 1YNKH 4X7SL 1MIEL 2J1KA 3WNNA 3NPSC 4X4MA 1NCCL 3QUYA 3FO2B 1L6XA 1N59B 1LGVA 3D0VB 3FFCE 5I1KL 5IK3B 4PLKC 3BGFB 1PY4A 1JP5A 4X8XA 4HF5L 5A43C 3DBXA 3DLQR 4JB9H 3L95A 1CYGA 3M17B 3CFKB 3OMZA 1VESA 2X4TA 4RFNB 2IGFH 1XGYH 5DWUL 1JHKL 3OKOB 1SM3L 5HGBA 2HLFD 2CLZB 2XN9E 2Y7QA 4LPXA 2YK1H 3V4PL 5DUMH 3SE8H 3ECBB 1T1XB 1U6AL 3HNTL 2OLDA 4LLUB 4X4ZA 1GZQA 3D2UD 5H94B 2FYYB 5CBAA 1RK0B 2EDKA 5DZOA 3TPUA 2VQ1A 4GS7B 4TSBL 1IAIL 3UPRB 3NABH 5KJRH 1YY8B 4NQTA 4R8WL 3KJ4B 4ZSOA 5GGSA 5D9SB 5IBLD 5TE6H 3D18B 1R3IL 4M8VA 3CVHH 4QHUB 3DVGA 3MCKA 3S7GA 5DQ9A 2PTTA 3B9KB 3TN0B 1XEDA 3H0TB 5I66A 1A6ZA 1UACL 4M5ZH 2FNBA 3PL6B 5DVMA 5F7HA 1MY5A 3AU1B 2YEZA 5HVFB 4EBQL 2XI9A 1RZFL 4MJ5B 5H37H 1VFBB 4EI6A 4RIRB 4D2NA 1YC8A 5CILL 4EXPX 1A7NH 2A73A 2Q7YA 4XHJC 3QH3A 4PB0L 3S96A 5TDOB 3UBXB 4YGAB 1MNUL 1QRKA 3WFCH 2X4NA 1KFAL 5I9QC 1IGYA 4PGDB 1NCDL 4JFED 1YPZF 4P2RD 4PJBA 4PR5A 1IAOA 1FSKB 3ZHDA 1UJ3B 1DZBA 3SE9H 4UQ3B 3ZKNC 2ITCB 1G6RH 4NKQB 4UMGA 1MWAL 1PX3A 5A2LH 5BMFL 4YDIH 2XRAL 4X6FB 1P69B 2XWJB 1MCEA 3QO1A 4OCRH 2EDYA 1S7VA 5IB5B 1NFDB 1S3KL 2VDOL 2DAVA 3I9GH 5MHSE 4HIJA 4KJWC 3DX9B 3MRHA 4M1DH 3PWNB 5JXED 3DVNB 4GRMB 3AVEA 5I1AB 5TH2A 3QUXC 4BH7A 3IFOB 2ICES 3TYFB 4Z6AT 4MA1B 5DJ8B 3F5WA 2C3WA 4EN3D 3GSQB 2IALA 4GMTL 4C4KO 3MLSL 3ILPA 3CNKA 3TA3C 3LEYH 4CVXB 1R0AL 1U92B 4LSQH 1EEZA 2Y5TB 3GMQA 3BPNC 3GMRA 4TVPL 4QEGA 1F11A 1X5LA 4CADB 2HG5A 4XH2A 1MCQA 3I6LD 4DEPC 3KS0J 3UJIH 1W0WB 3QWRD 3WDHA 1E6JL 1MRDL 3CU7A 4WUKL 1CFQB 4OGYH 4ZYKA 5C3LD 1DL7H 3HHRB 1I1AD 2PN5A 2FX9L 4ZUUB 1YMMA 3WFBH 3S3JA 5I71C 3UTZB 4NNYB 1ZLSH 5E8DH 4JFEE 2VLJE 4L4VB 2C4FU 3CFIC 1Q0XH 1CGYA 3H9SD 3LEXB 3DBXB 4Z7UF 3RDTD 1IBGL 4XAKD 5J13B 4WU5B 2PYEE 1OY3B 3HUJA 2APBA 4F7MB 1G7MA 4ZS7L 3OAZK 5GSRA 3LHPH 4JFOB 4K3JL 4TULH 5DHVA 3MJ9H 5I1EL 3MA9L 3CDYA 1CLZH 4LVEA 1UH4A 4PJCF 1EO7A 1OF2B 3IDJB 6CGTA 2VWEC 2EXYC 4MS8D 3FKUS 1VHPA 4ONHB 1XIWA 5GQBA 3O9WC 4BQCA 4QHMA 4ODUA 3IF1B 4KKBD 3MRBA 2NX5B 3NZ8A 2AI0L 4QOKA 1YJDL 4GSDH 2V17H 4R4BB 5DGQA 4FQQA 5SWQB 2JK5B 3VDAA 1CL7I 2Z31D 4U1GB 3ZKXB 5D8JH 3BJ91 3D48R 1BHGA 4EI5C 4DVRL 5CGMA 4U1LB 1GL4B 4U6VH 2PTTB 1JYVA 1IVLA 5DQDL 3TZVD 3IDYC 4PG2C 3S8WA 1I85C 1NC2B 2JKXA 5IHUL 1XGTB 2PW1A 2ZCKL 1KV3A 3KXFA 4NQDA 1KIPA 1AIFB 4PJCB 4RBPK 5D7JC 1EBAA 2YUVA 5D93B 5AEAA 4YPJA 2CMRL 2HWZL 4JE4B 3VFNA 4AL8L 5E95B 3P9MA 1KBGH 3EDEA 3MLTA 2UY7A 1HK6A 3S96B 4L1DA 1INDL 3UBXG 2RFXA 4WNQA 3VGHA 1KCKA 1XAUA 1CWVA 3KYNB 1FVDA 2XTJC 3VWJB 2ZUXA 3NH7H 4XPHL 3SE3A 2MFNA 5IG7B 4J3OC 4JY6B 2I60H 2KQMA 3N1QC 1UXSB 4QHKJ 5MENB 1T0MA 2J6EA 5F8RC 1D5IH 2Y9RT 3ILQC 3EGSA 3O4OB 1DDHB 5CZVH 5HD8D 3A6BL 3ZE2F 5DJCB 4LSVH 4D3CH 4L8DB 5I71B 1YEGL 4HWZB 3B2VL 4P4KD 2D7PA 3ZTNH 4PRPB 2A9ML 3SJVD 1CICB 2N1KA 2UWEA 3FQRA 1A4JB 4NBYB 2X7LA 1TMCB 1X44A 2Q86B 3ILPB 5T33L 2BY2A 5FYLH 4ESKA 3CLEH 3K2MC 1R3JA 1Q0YL 1F00I 3KPOA 4KPHL 1JPSL 3D3VA 3TBSB 4X8JA 5JOEA 4PREB 3UXFA 4CNIA 3KGRA 3TESA 3LB6C 3VXUB 1EZVX 4X7SH 2E9JA 5L8LB 5EUOF 3NOIA 4IOFD 4OGAC 2Z8VC 3CMOH 4MZ2A 3SE4C 4P9MH 4LHUA 3QQ4A 3KYKH 1MHEB 5C0BE 4WI3A 2YPKA 1AJ7L 4WW1B 1CD8A 4JB9L 4YDVA 4XCYB 5ANMB 2WLYA 4KI5C 1L7TH 1UJ3C 1MI5E 1AGEB 2BOCB 4AQOA 3FO0L 4IS6A 1J18A 1UM6H 1N3NB 1G7QA 1KUMA 1BWMA 5KSUB 2V2XB 5HHPB 1MQ8A 2VZTA 3SDXB 2R23A 4PJ8D 1QQDA 2CKBB 4LNVA 4FQJL 4LSRL 4FQLH 1EV2E 4MNGB 2VLRD 5E8EA 4GG6A 4GLRI 3SJVE 1EO5A 4NNXA 4HKJA 3DVFA 3ULVL 3SDYL 2IANA 3B9VA 3BKYH 3EDKA 1D9KD 1RAMA 2BMKB 4W4OA 4F58L 4Y0GA 3X3GL 4OZGA 1B2WH 1DSFL 4UT9L 1WIOA 1T5WB 3MLWH 5IWLA 4JKLA 4YXLH 3VWKB 5E9DA 1DJSA 2ERJB 4LSDA 4PG9B 3GMLB 1JWUB 1NCTA 4XBPB 1RZKL 1FO0H 4LEOB 2QADC 1LWRA 4B0MM 4MQXD 5MEPB 3AXLA 4DAGL 5BRZB 4BK5A 5AAMA 1RVFL 2F9BT 4YBHA 4GRWE 3RUGB 4ETQB 4AIXA 2HH0L 3BQUB 4XP4L 2IPUK 3P9MB 3IFNH 1ZLWK 3BKJH 2HFGL 1NBZA 4LSSL 3D85D 3WFCL 3LAFA 4KRNA 4WJ5A 1GC1L 4P3WA 2JCCF 4NO0D 5AD0B 3NFNB 1GSMA 2HP4A 3P4NA 5IF0B 2O61A 4HBCL 3TYGL 1BPVA 3V5KA 3DOSA 1RJYA 5F3HA 3MNWA 2BFVH 5FDYA 3AAZA 1CFVL 1S5IH 5HYJE 4PJ8A 5IBUG 2VDLH 3M8OL 4L29A 3PUCA 5JLZA 1MWAB 4KJYA 3EIFA 4XMPL 3V95A 3MRNB 4DKFH 4X6CB 4HKZA 5C2BL 4YFEA 3QZWG 4X7FC 3CVIL 4U1NA 3I9GL 1T22B 1BBDL 1TJIH 1I8KB 3WO4B 5B3NA 3NIDE 3QIWD 3UTSD 2FL5A 1I3UA 3BPOB 4ZOBA 5CBEB 3RUGF 4MX7B 4OLZH 2JIXA 3TBTA 3OKLB 4P5TD 1S9KC 2FEDD 1CIDA 2XY2A 4XP6L 3ORJA 5JHLH 3MRGA 1IL1A 3U48A 4R97C 1F4YL 5EC2A 3REVA 1L0YA 3T2OA 3DI3B 2DTMH 3BIKB 3SDAC 1FAIL 4JO3L 4OSUH 1CFSA 1I7ZB 2F58L 4ODBD 2LAAA 4X6DB 5TF1H 4AY0A 3O0RL 1NAML 5JOFB 3S35X 1M4KA 3MNVA 3QUML 1Q94B 1N6QL 3QIBD 2WBJD 3WFDL 3LKSB 1BJ1J 4RWHA 5HDBF 4NQCE 4R4FL 5JPMA 3FTGB 1NAKL 4NQEA 4LASH 2IPKA 3ARQA 4U1IA 2WW8A 1CDJA 5C6PB 1HSAA 1MHEA 3VRJA 3F8UB 1P1ZB 4HUMB 3KLAB 5DMIH 4XBEL 5T3ZD 3MLZH 1CGSH 3T8XB 3IXTB 3EO9L 2YKLL 1IGCH 2PXYA 5DHVH 4AG4H 2ZNWA 3FT4A 1DBAH 2Y1VA 2ADGA 2QQNH 3S35H 4K3JH 1SBSL 3WS6A 3U79A 1CLZL 1IEHA 2PO6A 3WHE1 2DQUL 4PJ7A 5DO2C 4JDVA 2DLFL 3O9WA 4NQCB 1QQDB 3WMSA 2J4WH 3JV4A 3WKMH 5AUMB 1QRND 4RGNC 5I1CL 4P59L 4XAWH 3DRQB 3MV01 4W6WB 4WCYH 2E27L 1KTDB 4P49A 1IEAB 4RCAA 1ZGLA 3PIQB 3FQXB 1HI6A 3SQOH 3HC4L 1EVTC 3MRMA 3CLFL 3S36H 32C2A 1FVCB 3ZYJA 1ADQH 5GS0D 3DMMB 3WS3A 3WLBA 3SDDB 1W72L 5DYOA 1AP2A 1HIMH 1E6OH 1KC5H 5IVXA 1QSFD 5TPWH 2UV3A 3S3PA 3FQNB 4RBPH 5DHYB 1T7YA 4TSCH 3QO0A 2RB8A 4PJ9B 5DRXA 1EFXD 3VXMD 4UTAL 3HPJB 4HIEA 4AENA 3ULVC 1T1ZA 1WWAX 4KRLB 1Q72H 3DYPA 3QG7L 4JM4H 1OAXL 4FQCH 1J1OL 1WBZA 1TQBC 5IROC 3QXUA 1J1XL 5LVEA 4C59B 1TJGL 4K2UH 4L9DA 4FG6C 5DD5L 3JV5A 2BVPA 2Z8RA 1YNTB 3VFRB 4O51B 3EO0A 2IG2H 1FVEA 3C5ZA 4OZHB 3UO1H 2YS4A 2LTQC 4HWNA 4NIKB 4CVUA 1AH1A 3BZDA 4IMLB 1NKRA 2IMMA 2R1XB 3PGFH 3IJHB 4G5ZL 3RUGE 4ZXBA 4C54A 3NCBB 4PRAA 1UB6B 3NIDF 4DN3H 2F19L 1YEGH 4S1DC 1BBJB 3ARBD 5GS1C 1E4WL 5C0CB 3TCLA 4KTDH 5ITFB 1KLUA 4XHQA 1QA9A 2JIXB 1DBJH 1DBBH 1VEMA 1ZE3C 4Y5YC 1RFDL 4I0PA 4Q6IC 1TFHA 2B4CL 4OLEA 1PGRB 3B2UD 3IT8D 5ESAA 1RMFL 2AV7B 2X2YA 1LNUA 5AZ2H 1F90L 4PJXE 4KPHH 1NCCH 1J11A 3SDXE 2FHCA 3BW9A 1HWGB 4GAGL 3ZKSD 1NFDF 5I1KH 1QBAA 5GSVB 5ACZA 3PGCA 4S1QH 5B8CC 2QBWA 4Y5XB 2OCFD 3EOBB 5D5MB 5JQHC 3Q3GB 3OJVC 4JPVL 4E41E 1B4JL 1TZHB 5KSBA 4ZQKA 3ARFA 2V5TA 1F6AA 3O6FA 2OQJB 3GIZH 4N90D 1AGFB 2BCKB 1DBML 4QO1A 1FBIL 4P46C 1EERB 2X1PA 3ROOA 5IFJA 1T6VN 3GMMB 2BNQE 3H9SB 5DUBA 5IB2A 1A22B 3JWOC 2YRLA 2IH1B 2ZUSA 3OAUH 4OT1L 1ZANL 2X1WL 4M7LT 4DVBB 5I18L 2Y5EA 5TQ0L 4ERSH 1JPFB 5DR5H 1U9KA 2X4UA 4JFEA 4APQD 5CP3H 2OYPA 3CGTA 3MLRL 1GYAA 4MDJB 1CN4A 5JMOC 2VLMD 2OSLA 1MF2L 2DM7A 1M05B 4AEIH 5F6HJ 2F53A 2E8YA 5TQ2L 1ZA6B 1QNZL 2V5MA 2V2TB 1R3IH 1R5VB 1A6WL 1DLFH 2P5WD 4C56E 4JFHE 1X5IA 4M00A 2BOBB 3DRQA 2WP3T 4ZFOA 1QYGL 4Z7UE 4PRPE 1HQRB 3PHSA 5DK2A 3QUMB 2AJZB 1GZPA 4UV4L 3K4ZA 2XTLA 3VXNB 1ACZA 1QHPA 4OZ4B 3E6HB 3SHSA 5EOQL 1RZKH 3GK8H 2Z35A 2ZKHL 5MENE 2R0WL 3RWFA 5BV7L 1FN4A 1HEZB 1KF9B 2BY0A 5DQJA 2IGFL 1P6FA 4PGJA 3AS2A 4XNZC 3CCHB 1JNLL 1W0VB 1Y0LB 5JW4N 3PJSA 2C5DC 4M5YL 1V3JA 4G6AD 4PJ5D 3GSXA 4JRXB 3HC0B 2AEWA 5E7BA 5C09E 2XYCA 4KZDL 5D2LE 3KXFE 2XRAH 1DQMH 4X5LA 3CSYA 3ZYOA 3BX7C 2HTKD 4NPYB 2BVPB 1T5XB 1D6VL 4PTTA 3TVMC 1N6VA 1S3KH 3DTXB 4RGMB 3TJEL 4GQPH 3ZHLA 4GBXB 5FYJE 1U8NB 4GW5B 5IJVB 1TETL 1OB1B 4RWYL 2XFXA 3OHXA 1EEYA 4K9EC 3LDBC 2R1XA 4TQEL 3NA9L 3AS1A 4L8SB 4EIGB 3DX6A 3CZJA 3MRLA 3JWDL 5EDXA 3D0LB 1ORQB 4XPBL 3H7BB 1LP9B 3QDMD 2BVQB 5C0CA 2D7OA 2LABA 5IBUB 5ITFA 3ZT5A 5J8OA 4NSKB 3UC0H 3HPLB 5HD8C 3NTCL 1TDQA 2APTA 4KXZH 1WIPA 4WUKH 2X89D 4OUUA 5T5FL 3UYRH 1IFHL 3LQMA 4NUJB 1QFHA 2V2WB 2I07B 3GSRA 5L0QB 1NUFA 2QKIB 3CJJA 1REIA 3HNSL 2CQVA 1LO3H 5CIPB 3KLSA 1NQBA 1N6QH 2VLKE 3WBDA 4KK8D 3PQYA 5IROA 4F3FB 1OTSD 2ZPKL 5GHWL 3KXFD 4JHWL 2ESVA 3SDCB 1ZAGA 3L6FB 3MCG1 4NO3A 2FD6H 2VLJB 4FFWC 5DDHB 3HRZA 3MRRB 4CMHC 4PV8B 3PABA 4JJHA 4AH2B 3V0AC 4ZNEE 3EYUL 3LQZB 2W9EL 4UT7H 3EO9H 5F1IB 3WHE0 1A1MB 3RNKA 1XGRB 4N8VA 4KROB 2HFTA 3SOBL 4PJGF 2EIBA 5I2IB 1VFOA 4NZRL 2EC8A 1BVZA 1MQKH 1A6TB 4Z7VE 4NNPL 3PP3H 4U2YA 1OP5H 4IMKC 1BVKA 43CAB 4MAYB 2BERA 1NFIA 1I1FB 2OP4H 3ZDZE 2FH6A 4OLVH 3OAYK 3UTSE 1MHCA 1F5WA 3GHEH 2J5LB 2BDNL 2VDNH 3IDIB 5BS0B 43C9A 3T0EA 5EU3B 1H3XA 1EJOH 4XPFH 3NCJL 1W0YT 2B5IB 3IAQA 4OFPA 3TNMA 2FATL 1I8MB 3D3VE 2VQ1B 5IB1A 2VE6A 3MO1B 3ARDD 1CXFA 4OM0H 5KVGL 1QUNA 3GKZA 2NTFA 1HEZA 3GM0A 4AEEA 3ZO0A 5I8OL 4NC1C 3WNOA 5HYEA 3WXVL 3P0VH 3SPVA 3DVGB 1Z9MA 4N0FA 1JNHB 4NHUB 2QHLA 1TJHL 4JO4H 1A6ZB 1P7HL 5CEYA 5EIQA 1SVZA 1MEXL 1H3TA 2YRZA 4MDIA 5C0JB 4M9PA 5CZVL 3H3PH 4JFQB 2NXYD 2VOTA 4YXHL 5J3HC 3X3FH 2YD3A 2K1MA 5D8JL 4BKLB 2EDBA 1MI5A 1V7ML 2C1OB 1C08A 1HYRC 4WGVB 3BWAA 5IQ9B 3HZMA 3G5XB 3HMWH 3CX5J 3IDNB 2EDTA 5IW3A 2MCPL 2AXJA 3HLAB 5E5MB 1UH2A 1F3JB 2E9IA 4L8SA 3MLYL 1EGJH 4LBEA 2A6KB 3V2AR 5MI0C 1UWGH 1N7ML 3T1FA 4DUVA 3VH8G 5C09B 1OSZB 2D03L 1UG9A 4LKCA 5DJ2A 4FXKB 1S78C 4K71C 3OTTA 5C08B 1T89A 2FJFB 5FYLE 2AV1B 1EGJA 4GG8A 1VPOH 3ES6B 1G7LB 1NCAL 3G9VA 2ATKA 4I13B 1DVFD 5EWIL 2VRAA 1WV7T 2H32A 4ZPVA 3C09C 1YMMD 4NO0B 3RWDA 3LZFL 5FO7A 4X7TA 1YEEL 1FNGA 3NH7L 3GM8A 1NFKA 3LPGA 3KYKL 4NM4L 4PJAE 4PJEF 3FFCD 4I18B 3V6ZB 2OJZL 5FEBA 2B20A 1G6RB 4Z8FL 1LHZA 4R96A 4NCC1 4WEUD 5CUSL 3TO4C 1TVHA 3L5WB 4Y16A 3H9HA 4P2QB 3KYOB 1HKFA 4GKSA 3T0DA 2X70B 5ICYB 1JGVH 3DETD 5DJ6A 5F96H 5H8DA 1ZANH 5D7JA 1E4KC 4I2XA 4D8PA 3QFDB 3AREC 1I4FB 1NMAL 35C8L 4EOWL 3KJ4C 3VXSB 1GJIA 1MFBH 1FNEB 2YMXL 5DURB 4JZJA 3O81A 3GSOB 3MLUH 1Q1JH 3SDYH 4CN1A 4F2MA 1QVOA 5KBNC 3HUJB 4GJTB 4AEIL 4N5EC 1DUZA 4BSVB 2VUOA 4G8GD 3QIBB 2A1WL 1TVBB 2HLAB 4JPWH 3W5NA 1N5AB 1KGCE 1JHTA 5GIRB 1JZ5A 2AJYL 3X13B 5IM7B 1NMBH 1BD2A 1MUJB 5D7IE 1GH7A 1G1YA 1OPGH 3HRPA 4YAQA 1IGJB 4PRHA 4LVNC 4WHTA 3MRBB 5TE7L 2OXHA 1RVFH 4DZBB 3W2DH 5L7XL 1F3DH 5C0NC 4PJXB 2K9UA 3GK8L 4M43H 3H8NA 5HYJA 4WI9A 5FAAA 3VFVB 3F6IA 4K23H 3FZUD 4XVTH 3C08H 4PJGA 1LDPH 4U7MA 3JVGA 5E8OB 3V5DB 3QUKA 1MRFL 2WBJC 4AEFA 5K9JL 4DGIH 4HEME 3BISA 3Q1SH 5FM5O 4OD2A 3VA2C 4NWTH 3WN5B 1L6ZA 5HHMB 4ZO7A 4QT5B 1R6VA 1VSCA 4LCWA 4RGNB 3OF6D 3D2UA 5FYJH 3IVKA 1B6UA 5EORL 1KLGA 4WFGE 5JORA 2AW2A 2P49B 3C5JA 2EEBA 5F9WB 4ZAKA 1XF2A 4OV5A 1FZMA 2V6HA 4E41A 5HHOE 3K3QA 4RFOL 1FVDB 4U3CA 1JHLL 3TO4B 3JWDH 2UZIL 1K6QL 3IDGB 4E42B 4NQUA 4OZGE 4PJ7F 4JO3H 2DWEA 2JE8A 4MXVF 3VD4A 3LPWA 1YECH 2PCPB 2OZ4A 3O2DL 4NN6C 5I30L 3QEHA 1IGMH 2H6PB 3IKCA 4YPGB 5EU6E 3OKDA 2ATKB 5C0AB 2R2EA 4QHKI 4WU7B 4IOIB 3FONB 4HXBL 3CAFA 1SJHB 3JTTB 4HBCH 3IETA 2Q8AH 2BFVL 3Q5OA 4P2OB 4KVNH 1PEZA 4XCNB 3DETC 1DN0B 2Q86A 4KUZH 5GS0H 4K71B 2IFFL 4MJIE 4N5UA 3VXSE 4YO0B 5DMIL 4XB7A 3RGVD 4H1LG 3MLZL 3FN9A 3T09A 3GJFH 3L5WA 1E28B 3S5LA 4AG4L 1U3HA 25C8H 2PYED 3VXUE 2QQNL 1BM3L 2NY7L 1TJIL 3MRFB 1RY7B 3LQAL 5E2VH 3KLHC 4MD5A 1PG7L 2X9YA 2VN4A 1JV5A 2MJWA 4I4WA 4I1NB 4Z0BH 3KJ6H 3KPQB 1PY9A 1FNEA 1DQDL 5C1MB 4XAWL 1WT5A 2HT2C 4IRZL 4NZRH 5I9QB 3HZYA 3ZTJG 4GAYB 3K2UH 3HR5B 5GS2D 1KCVL 4NKIH 4U6HA 3QJFA 3BH8A 4X0KA 2SEBA 5GJSH 5JPNB 3CDGA 2OX5A 2XQYG 5HHNA 3RPKA 5CLTA 1I7UA 1ZV5A 4YXKL 3FT3B 4HCRH 1FPTL 3O3DB 4ACPA 1IM9D 5JW5B 4LASL 4UUJB 4OCXL 4LHJB 2V9RA 1U8IB 2DM3A 3W11C 4HAGA 4TSCL 4AMKL 1F4WH 2AJUH 5ACMA 5GZOC 3EFFB 1IGJA 4PRHB 1GGTA 5F9WC 1RIUL 4RZCA 3QG7H 5C3TA 2X10A 3QHZL 4UINH 3HE6B 4GRLA 1MFCL 3CFKA 4OM0L 1NMCC 4JRXD 1UVQB 4TNVK 4XPGH 3VFVA 2ICEA 3CXHK 3S88L 4Y19A 1RZKC 3ULVF 1NDGA 5C7XL 1BZ7B 3KDMA 4D9LH 1F2QA 3FO1B 4XVJH 1I1AB 2DWDB 4JJ5B 4N8VG 3QPXL 5HDOA 3RDTB 2C1PB 4IJ3B 3WIIH 5LCVH 4JFZH 3AXLB 4G9DB 3RVWD 5BJTB 4A6YA 1V7NL 3FRPG 2JCCA 3BPLC 4MB5A 3S4SA 2WUCL