4XXCA

Hla-b*1801 in complex with a self-peptide, deleikay
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-18 alpha chain
publication title T Cell Cross-Reactivity between a Highly Immunogenic EBV Epitope and a Self-Peptide Naturally Presented by HLA-B*18:01+ Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4xxcA01
2ZOLA 2YBRB 3VFMA 1CU4H 4LSDA 1UEYA 1ORQA 2MCPH 5E6YA 3INUL 5I1JL 2OLDA 1T1XB 5T3ZL 2DMBA 4U49A 1PD6A 3AREC 5K93A 2A6IA 1AH1A 3G6DL 1CBVH 4N1HB 4APQC 5GRJH 5C07A 4L5FL 5I18H 1MVUA 3Q48A 2IBGA 1HKLH 1MFCH 4I0KA 1Y6MR 4WFED 2GI7A 5D1ZC 1FV1B 5HI4D 2AABH 2CDFB 2H2SC 2X4RA 2VNCA 3QI9C 3KPNB 1KJ2B 4N8CL 3TA3D 4ODXB 5C6PB 4ZD3H 5E95B 4NNPL 4RRPA 4YK4C 1ZT4A 4FQCL 3MLTB 1S7RB 5L0QC 4Y89A 1MCJA 1INEH 4OZGE 5FUCE 2ID5A 4HWUA 4XP9L 4H5SA 5DD6A 1KG0A 5ITBH 3DETC 2F58L 5EG6C 4KDTA 3QIWB 4KTEL 3WIHA 3QCTL 2IFGA 4GAYB 1I9JH 4RFOH 1R0AL 5JPNA 3LZFH 1I1YB 1O0VA 4Y4HB 4XMPH 1VFBA 3S36X 2J2ZA 4QRSB 5JO5A 4FTVD 1F4XH 3TN0A 1RMFH 4JREB 5EC1A 3QUML 3RTQA 4FABH 1UWEH 1AQDA 4Q9CA 4M7ZC 4OIAA 1LK3L 2PCPA 5GGQH 2VLRE 2NPLX 3P11H 4U3CA 2A74B 5CUSL 4GSDH 1D5XA 1DTUA 1CD1B 5DC9B 4PGEA 1T03L 1SYVA 2Y36L 4DAGH 1JF1A 1FNSL 5EPMA 4KKNA 1UC6A 4M7LT 3PHQA 5I76B 1N0XL 4MAUH 2PR4L 5GZND 2EEDA 5J06A 1JYVA 4Z0XB 1OHQA 2ZCHL 4OQTH 1QRNE 1KJMA 2VB5A 3S37H 2MHAA 3X3FH 2NX5B 4I4WB 1MFBH 3QDAA 2C26A 1DVFB 2AJYH 3PP4H 1R5WB 3T8XA 4L8SA 4B7IA 1DL7L 2WQ8A 1T2QL 3TYFB 1FN4A 2O26U 2PKDA 2PO6C 4LGRB 1AIFB 3OJVC 2EC9T 5C0EB 5A3IC 3LKOA 2YKLH 4I9WE 4PRNB 3HR5A 1IZKA 4JZOB 1GHFL 5I1CH 3ULVC 3GMRB 3QCUL 4WW2B 1QYGH 4XMLL 3VXQB 4M6NH 3RNKA 3WIIL 2PXYA 3FB5A 1A5FH 4JM4L 3HNSL 4WV1A 2EE2A 4EIZC 3MV9B 5DD1L 1BM3H 1G7QA 5KW9L 3A6BH 4OZ4B 5I8KH 3CVHB 3ABZA 2FWOB 4ZODA 3I85A 1BBJA 3D18A 4A2LA 4P2QE 4Z7QF 3ARDA 3HZYB 5DUML 5IBLC 3DNKA 5GZOC 2DBLH 3F5WA 3E3QC 1IAKA 4NKOB 1G7PA 5JMOC 1YYLL 4JQIL 5DJ8A 5DFTA 4HBCL 3UTQA 3TO4D 4XPGH 2RB8A 5IHZB 2NQCA 1C08A 3RUGB 4K71C 4NBXB 4QXTB 1CLYH 5IF0A 1VHPA 1OQOA 4GRWF 5JIPA 4BFEA 5DRWB 1XIWB 3VWJC 3S98A 2N7AA 1N5AA 2HTLD 4HJ0C 4JHWL 3VXRD 2R29H 3RWJA 1B90A 3L1OH 5FYJL 1UWXK 5MI0B 4H1LB 1C7TA 1HOCA 1D5IL 3TV3L 5T5NG 1VKXB 2DQCL 3M17A 5TH2B 3L7EB 2B4CH 3D1MC 5DUPL 1A7BA 3CSPA 3MRDB 1LK2A 4X7SL 4R0LC 2NNAA 5I74B 2IQAA 3VD5A 4XVTH 4K9EL 3SE9L 2ERJB 3L3JA 3DTXB 5DHYB 2PTVA 3MJ7A 4AZ8A 4JLRA 1I7ZA 2L7JA 4HG4J 3RWDB 1RULL 4JN2B 3TBSB 5EBLB 5TDNA 2FCBA 2DICA 1JZ3A 4XCEB 2AJVL 3WE6B 4PDCE 5BMFL 1ND0B 5KSVB 1LP9F 4MXVE 4S1DD 1UT9A 5FO9A 1QQDB 3QDJD 5E6ID 1PY9A 5I2IA 5FOBB 5LXGH 2QADC 1QSVA 1NCWH 3E6HB 5CZVH 3UYOD 1YJDL 3Q2CA 4JFFB 1OAQL 4FG6D 4BQ9A 3C5ZA 2Z31B 3KYAA 1ZAGA 4U6VH 5J11B 3GMNB 1OCWL 2DTML 4ONGL 2HKFH 3DYPA 1OP5K 4U3HA 5EFIB 1TZIB 4UILL 3O45A 4PLOB 1BAFL 1D9KC 1DFBH 1KJVB 2BMKB 4PD4J 4CNIB 3KHOA 4R9HA 4OT1L 5GS1A 5KVFL 3KNBA 2FATL 5DMGD 4MDIA 4YBQC 5J89A 5JDSA 3MV01 3PF2A 1T04B 3RWGA 3GO1H 1T7VA 1MI5D 3GI9H 4P4RA 4R4ND 4JFHE 4RDQG 1CZ8L 3HZKB 3A6OA 5CZKA 4QHKJ 5IIEA 1MCOH 5IW1A 4GW4A 1RZKL 4PJDF 1TITA 3CVIL 4PJXE 2P24B 5ABDE 3ZT5A 3UJJH 5JR1L 2UWEF 3U0WL 1AGDA 3FB8A 3IJSB 1DLFL 3QFJA 1AY1H 2VDPH 3FZUD 3LS4L 2H41A 1KTLA 3WFCL 2HLFC 4HEPG 4GH7B 3FO1B 2O93L 3MROB 1XR9B 4GG6F 2X4UA 2EDTA 4TSAL 4CL7A 2PYEA 2VQ1B 3OB0H 2GTWA 3NOIA 3GSVB 3W39A 3ZTJG 4WCYH 3FT2B 4I5BA 5CJOL 1M05A 1TTFA 1HHJA 1OTTD 3U4BL 5IWLC 4P23D 1JK8A 1S5IL 4K3JH 3WLBB 1BREA 4OCWL 2EECA 3QXWA 5E2UH 3G6AA 1LQVA 5M7QA 2XY2A 2D0GA 1ZHBB 2B0SL 4XB8A 5CWSB 2PW2B 3ULUD 3V4VH 1MCPL 2NW2B 3NIFF 2H9GA 5IHUL 5ADOH 4JHAH 2OTUA 3PDGA 3DXAE 4JDTH 2NY7L 3O4LA 2AKRA 4JRYD 2XV6B 1IGJB 3CSYA 1IQDB 1FE8L 1UM5H 4MA3A 4UIKL 2R69H 4WFHD 3X13A 2E6JA 3UTSA 5I71C 5FHBH 4HPYL 5DK0A 1I85C 3U79A 4LKCA 1HXYB 4F2MA 3QEHB 4DGIL 1Z9OA 1EVTC 1CFQA 4M9OA 2H8PB 5HSFA 2VLKD 3L6FB 2FZ3B 3ZKND 2E7LA 2VXQH 3H9SB 3MRGA 4JM2C 1O7SA 2AQ3A 2F19L 2WUCH 3O3AB 3V6OE 3VXNA 1REIA 3OAUH 2YWZA 2WINB 4XP5L 5HI3D 1HSAB 5ICYA 1KXVC 5DMJB 3WKMH 1JHLH 3QQ9C 1I3RA 5AYUH 4XRCB 5ENWA 2VISB 4EOWH 3GK8H 4LCWE 2JK5B 4YPGA 4P9ML 5GRWA 5DZOA 5E8EB 4RFEB 4UNVA 4LSTH 5T3XD 4LLYB 5MEOA 4PJIA 3RY5A 4PBXA 5KS9B 3H7BB 3CVHL 4XAWL 2AXHA 3MLZH 1YEHH 3C8HA 3JV6A 1WFNA 1A7OH 3OKYA 2A9ML 2M8XA 4UB0L 3R0MA 1YUHA 3IRPX 3WJLC 3TO2A 2F8XC 5F1IB 4NUJB 4DZ8A 1R5IA 1FAKT 2NTSP 4WIQA 1KN4L 4MB4A 1OLLA 3X11A 5EOCH 1KSRA 4G8FA 5D5MB 4WWKB 3QH3A 2V7NA 4MQ7A 5C2BH 3TA3A 3IGAA 3R06B 5EA0L 5FUOL 4UI2A 5MEPB 1U8OA 1VEPA 1FO0A 4MSWB 2EDYA 4YQXH 2X9YA 4U1IA 5I75B 4O58H 5E03A 2GYSA 2HT3D 4LVEA 2BRRL 4WO4C 4JRWA 5FF6B 3CX5J 1FC1A 1QBBA 1FLRH 3O41B 3G08B 2XWBA 1NCCL 1OPGL 4HFWA 3BH9A 1A1OB 4FXGB 3GSXA 4V2CB 1RZ8B 4NQXA 1AXTL 5ESVA 4Q74A 1PEWA 4ZPTB 5HVHB 1HSBB 5DK2B 4X7CC 5DQDL 3CD4A 5E1AB 3VG0L 5EZOL 1TNMA 4Z7NF 5A16B 5JW5B 1A8JH 1YMHA 4FTVA 1FG2B 3SGJC 1T1WB 2ZUVA 2B5IC 1R3KA 3G9AB 4WHTB 3ZKXC 3WN5B 1F90L 2Q6WB 2C1OB 3PWLB 1NGYA 2ICES 3DX9A 2VQTA 4RZCA 3ARFB 3UTOA 4NKMA 4G9FE 2QBWA 1NANH 3K2UH 5IQ9B 1FVDA 4XCYB 5HDBE 1YMMB 1MPAL 2XG5A 3AFLA 4JZJB 5FYKL 1B6DA 1BFOB 4KPHH 2YMXL 4QXUH 1FCGA 5E94B 4NWTH 4XI5D 5FA4A 2WZPD 4FQXB 1RK0A 1RJZB 3FFCD 4OZHA 1T4KB 3EYVA 3KPRE 3TT1H 3SGDH 1NDGB 4RIRA 5FYLE 2AV7B 2Y07L 4BKLB 1LDPH 1PAMA 1RIVH 1NBQA 1S7VA 1U3JA 4HAFA 3VE0B 3ZL4L 3I9GL 1KTKE 5GS0C 1ZLUK 4TRPL 1RD6A 1LEGA 4KAQL 5BZDA 2I07A 4V3EB 2C3VA 1YEDB 1NGPH 4P5TB 2X70A 4JG1L 3MRBA 2Y4SA 3CFEA 2PNDA 1IGIL 3KVQA 3BHBB 2PYFA 1KTDB 5IB3B 3ARED 1ZSDB 4K3GA 1T1ZA 4L3ED 4BK4A 4KRNA 4ZFGL 5JTWA 1EO8H 3MNVB 5BXFA 3CFBB 5JIHA 3TP4A 1VACB 2YPVH 4PRPE 4YDJB 4PP1C 4PJHB 3MV11 4DKDC 2P5EB 5D1ZD 1OGAD 4AENB 2AGJH 3QXVA 2VDLH 3SPVB 2HJFB 2H2SD 1VA9A 2Q8AH 4R2GC 1JYWA 1GC1H 1M1SA 2XWTB 3OZ9H 2APBA 3QI9D 4DKEH 4JY5H 4PLJC 1AGFB 1VEOA 3UPRB 3REWB 5IV2B 3HFML 1BFSA 5HJ3B 3HMXA 3FO9B 1JWSB 5I73C 1PEZA 4LVHC 1FYTD 5E2JA 3QZWB 1AGEA 3TO4A 4YHYC 3BPOB 4NT6B 4Z77A 3L5IA 5CEYB 5INDA 3V52H 3G04B 3DETD 3B9KB 3EO9H 4QT5A 4ELMA 1NUDA 3U0PB 5BRZE 2YXMA 1WISA 1VB9A 4QRUB 2VDNH 5EDXA 5B21A 1RVFL 3M1BA 3VXRA 5A2KH 3PP3H 1BBDH 1KPUB 4L8DB 4NN6B 1P84K 3IXTA 3RI5F 4K23L 4LCCB 3SE4A 3OJ2C 3CDYA 5BQ7A 2DS4A 5HHOE 1JV5B 3UBXG 1IKFH 5D70L 1IQWL 4JPIA 1R3LB 5F9OH 5KSBA 4W4OA 4WGWB 4HK0B 1K4DA 1WT5C 3OKEA 2HTKC 4XNZC 3UCRA 3TPUA 2GTZB 3PHOA 1B4JL 3CLFL 3NBNA 2RCSL 4HUUA 5JW3H 1AGCA 5D1XC 1CFNA 4UTAH 1QPPA 5FK9A 3ZKQD 3GIZL 3VD4A 3V5KB 2XKNA 4E5XA 3T0VA 4WFGE 4BSWB 3PGCB 2NLJA 1AHWC 2E9WA 4S11A 2I5YL 5C0DB 4ZFFA 2CLRA 2VLME 1A3RH 3QPXH 1DQLH 1ACZA 5EZIH 5E5MB 4UQ2A 2DOCA 3D0LA 2LV4A 1I3GH 4WHDA 3QWRD 3QDJA 4PLKD 1XF4B 5E6IA 4I48A 4YWGL 5CP7B 2CIKB 2OL3L 3QHZL 2LTQB 3H9HB 4NZRH 1WWBX 4OF6A 3ARTA 4RMUA 5IB5B 2O61A 5EU3B 3FRUA 1I7RA 2RAMA 1YPZA 1HILA 5A3ID 5FHAH 1QR4A 3NCJH 4YDIL 1GZPA 2ITDA 3ULVD 1A64A 2IMNA 4P46A 1QFWL 3MV8D 5KJRH 3RWCA 2HFGL 3DRTB 4LCYB 1D6EB 5DQ9A 4Z7VB 4KI5C 1IGCL 3BZ4A 4LVNB 2RJMA 3L3HB 1JYXA 1J0IA 1JZ6A 2J8UE 1CICB 2ZUQB 1LO5A 4RNRB 5HGGS 3C60B 1EFXA 3HC4H 4ZOAA 2YRLA 1QNZH 3BGFB 3X14A 2YWYA 3IF1B 4OF8A 5IBLD 5GZOD 2OI9A 3LN5A 2H26A 3OHXB 5HHPB 1MI5A 4V1DD 4AYFA 3ZYJA 5IG7B 2XN9B 3IVKA 4GS7B 4DK6A 4PJGA 3LD8B 4JFED 1T20A 3G5ZB 1AXIB 5H35B 4L3CA 3IU4H 4F3FB 3VWJD 4AG4L 3BEWA 3DOSA 1XF5A 5DJZA 1KJ3H 4C56B 3MCG1 2P7TB 1X6LA 2YA1A 4HCRH 3O2DA 1J11A 4FQJL 5B8CC 5E7FA 3UC0L 2GK2A 4M7LH 3E8UL 4XVSH 2FBJH 3SKJL 4U1NB 3D3VE 2GT9B 3M07A 4R7NB 3VXOB 2DLIA 5CSZA 3FQRA 4P23A 4KI5E 2BNQE 4ZO8A 5HYQB 1ED3B 3WO4B 4Y19D 4JFQB 3V6ZA 4OZFH 1A1MA 2JELH 5DRXA 4NQVA 2F53E 4S0TD 1W72B 1FDLH 5KVDL 1Q0YL 5F9JA 2ZUSA 4PG9A 4PB9L 4EI6A 3X12B 4I18C 3FHQA 3PWNA 4ZS6C 4HC1L 4XP6L 1RUPH 1KPVA 4D3CH 1N7ML 4JRYA 4R26L 3VI4E 1ZS8A 1NPUA 3FT3A 3VXPA 4HZAA 4URTB 4XTRC 2I27N 4G6FB 5C09D 2DKMA 3MJ8A 4R97B 5DHVH 2BDNL 2GSIA 2DQUH 5D2NE 5DJAA 3SCMA 1W0VB 4XP1H 5F3HA 4MJ2A 5D7LB 4FQ2L 4LLVB 2YEZB 2VITB 3UYPA 1UKSA 4LRNH 4KZDL 1TQBB 1XGYH 2FJHB 2VLKA 3QNZA 1DQJB 2GEEA 1KUMA 5F7EH 2A9NL 3HKFA 3DHJA 5IVNA 5ICXB 4S1RL 1KGCD 4LHUG 1W0YT 3KPSD 1JTOA 2VH5L 3LKSB 4GKNA 4IIQC 3RZCB 1A7QL 1P7KA 1A22B 3FJTA 2VDRH 4X8XA 6FABH 3T0EC 3TNMA 2BK8A 5F97E 1ZA3A 5C86A 2IAMA 5CD3B 1D9KD 1CLZL 4HKBA 5J1AB 4QHNB 4BSVA 2KL6A 3B9EA 3RI5K 1LE5A 5HXMA 5SWZB 2C4FU 4YBQD 1K8DA 3STZB 4NJAH 3QULB 3WFBL 5L2KB 2J4WH 1F3JB 3OKOA 3OSKA 2VLJB 2CKBB 3U1SL 2O5YL 5GGRA 3UPAA 3CMOH 3PUCA 4JZNA 4IEFB 3FT4A 3T2PA 4CN6A 5KSUA 1CGWA 5BW7A 1ZKAA 2BFVL 4UAOC 3UJIH 4IOIA 1EA9C 3NMEA 1GOGA 1UH3A 5B38B 3JUYA 1BVLB 1CK0H 1DQQA 3CUPA 4HT1H 5IJVA 2Z8WC 3VA6A 3LSOB 4O9HH 2BNUB 1A9EB 1TMCB 4ODVL 2DI8A 1BIHA 2KDGA 5ILTH 4TUJA 1CXEA 3DVGB 4KVNH 5GRYA 4YXHH 3AMKA 1CR9L 4ZUUA 4MJ4A 2GSGA 4QTHA 1NLDL 4YHOL 2H2PD 1MCWW 4FFZH 5BV7C 3BEVA 1JFMA 5IB1A 1CFSB 4XP4H 5JXAH 5HDLA 2R56L 1P6FA 4O4YL 3DX7A 3GSRA 2VIRB 3IS0X 3QQ3B 5F70A 4RGNC 3GNMH 1XR8A 3EO0A 4J3SA 2L7UA 2UZXB 4XGZB 3L5HA 4RISH 4X80L 2R2HA 3VD3A 4OFIA 3QJFA 2BCKB 4LFHD 3LHPH 3P3YA 4L8CB 4XMKL 5CEXA 1AQKL 4XCNB 2X2YA 3B8YA 2FNBA 3DURA 3BZEA 1XCTB 2V2TA 1WQVT 4QKXB 2C3HA 1IGYB 3FFCA 1R5VA 4JM2D 5E8OA 1U3HC 4NFDA 3UBXA 3QEGH 2HT2C 3SOBL 1AR1C 1L0YA 4WEBH 4EQ2A 1JMXA 1CE6A 3DROB 3QIBB 4JRXD 1XEDA 4ETQA 3DARA 4MJ6A 5I17B 5SWSB 3QQ9D 3SDDC 2W9EL 4Q2ZA 4GKZA 4PJIF 3NCEB 3EUUA 1TPXC 3P9LB 4PJ7B 5MEQA 2AK4D 3BP4B 5T1LD 2Y9RT 2B1AL 2HN7B 3SE8H 5ERWB 3AREA 3LRSA 4L3EA 2EDEA 3ZE2E 1V7NH 4LSRL 1MREL 2B1HL 4NQEE 1YEJH 4PJBE 4XPHL 2A83B 7FABL 3W5MA 3MLSH 1ZVHA 3MZGB 4P4KC 1OGAA 2APWA 1WBZA 1J9CT 3E6FA 3MNWB 5IB2A 4WJ5A 3VI3E 1GAFL 1JWMA 3EOAA 4XNYL 3P2TA 3QI9A 4FP8H 5DJ6B 4N0YH 4RAUA 4DVRL 1G7HA 3DMMC 3RGHA 1RPQA 4YXLH 5C0BD 1C7SA 1FYTA 4J2XA 3BKCL 4KMTH 2D7TH 2NXZB 4POUB 5D6CA 4HWBH 4I3RL 4F7CB 2R0ZH 1OGTA 5IFJB 2QEJA 5JLZA 5I8EA 2VR4A 3MO1B 5GIRA 5HGAA 3UBXI 3V0VA 4U1KB 3D85D 4ELKB 5DWUL 1IM3A 3QUXB 5FOJA 5L9DH 5EUKB 2VDQL 1U8LB 3R4DA 4DCQA 1R3HA 1A7RL 1FSKB 3K4ZA 1QACA 4AMKH 4GW5B 4I3SH 5DURB 5KOMC 4QGYA 5EIVA 3SN6N 2ITCB 1W72L 1T89C 1WC7A 4NKDA 3VXMB 2YD2A 4BELD 5ANMA 5JORA 4J8RA 3D5OF 2A38A 4A6YH 3DV6A 3C5SB 5C0FB 1JFQL 3MLYL 4D8PB 5E99H 5A2IH 4WFFD 3KS0J 2R0KL 1MIML 5DMKA 4NFCA 1AC0A 4BZ2H 3WDJA 1UVQA 1OL0A 3EDKA 4UUJB 1W8OA 1FGNH 3EOBB 5INCB 2NY3D 4LEXL 3DECA 1YEFL 3MQIA 4XH2A 5FO7A 4GKSB 1Q94A 4OZHF 3ARYA 1QLFB 4DOHB 4MA1B 1Y6KR 4J3VA 5T5NF 2BSSA 4OD3H 1PG7W 4XPBL 2KKQA 2WBJD 1LO3L 3VMNA 1QOKA 3FCTB 3F8UB 1X5FA 2CDEA 2YUXA 4HAGA 4KU1A 2IH1A 3FOMA 2DL9A 4ZDHA 1ONQB 4LGPB 4G5ZH 3LS5L 5HYJE 1U8HB 3QWRA 3MRCB 1MAMH 3I2CH 5GS0D 3O6FC 3BQUB 4LHQB 3CPLB 5FGCE 1DN0B 2Z9TA 4RWYL 5EC2A 1WSST 2DWEB 5HTSA 3TT3L 1ZANH 5D9SB 1OTSC 2V2XB 2A73A 1VGKA 3B9DA 2BSED 1S9YB 4JKPH 3T0XA 3MCLH 5D6DC 2XT1B 3HNVL 3C87A 4HJJH 1KCVH 5HHOD 3MV8A 1UXSB 2EEAA 4N8PA 1XGRA 3RVUC 2IANA 4U1SA 2CH8A 5J8OA 4JKWA 1NGQL 4PP1D 1Z5LB 4FHBD 2BVUA 4ZQKB 4OZIE 3HAEH 1H3WM 4ODWB 5GJTH 4YX2L 5I19L 5L88L 2MQ3A 2NY1B 4R2GD 1DBML 4M00A 4ZAKB 4NRZB 5F9WC 5D1QC 2CKBL 2MQCA 4PLJD 4EI5B 4CMHB 2AJUH 5JPMA 2AEPL 3E3QA 3D6GA 5CIPA 5T3ZE 1SJEA 4J6RH 7CGTA 1TQCC 4V1DA 5I1LB 3QDMD 3QXUA 5D4QA 2W0LA 4ELMF 4JFEA 5MENB 4DFHA 4NM4H 2Y23A 3JV4A 2EYRA 2P42B 5FYLH 1FH5H 3RA7H 3VFUB 3VWJA 4AEEA 5EU6D 1R3JB 4OLYH 1V3LA 4U1JA 2XNAA 5HHME 1MHPL 4G3YL 5AG8A 3EYOA 3QO0A 1QSEE 4KRPD 5KSBF 1PG7X 1QLEL 4R8WL 4Z7OF 5T1KB 2ATKB 2BHUA 5EO0B 1QA9A 4OGZA 4ERSL 1H9VA 4JJHA 5DDHA 4HUMB 4Y19A 1QFOA 4GRWB 2HTKD 1M7IA 2GJZB 4R0LA 5F7NC 1BIIB 5B3NA 1KEML 1EBPA 1XGQB 3HTLX 5T1DL 2CDGB 2QQKL 3VXSB 4HDIB 4QRPB 3PDOA 9CGTA 3NH7L 3MGAA 1ADQL 3ARPA 5LGJB 4Y2OA 1OSZA 3IDXH 1N3NA 2X4QB 4S2SB 2Q8BL 2MPAL 4JQVC 1LD9B 2VL5A 4LEOA 1HHIB 2X42A 5C09A 5GXBB 2RFXB 4X6EA 4KQ3L 1HZHH 1P5UA 3DX8B 4NC0B 3BDYH 4Z8FL 2AK1L 4JFDE 1EDQA 4UZGA 1DLHB 2ADIA 4HUWB 3CLEH 1KB5B 4TNVF 4Y5XB 2BSRB 1G7MA 3RX5A 5J0BA 2JE8A 4X0KB 1YPZF 4FQLL 1S5HB 5DD0H 5F89A 2YPLB 2YSSA 5MHSD 2J6EH 2VLLB 3MCKB 3QEUB 1K3IA 1F4AA 4F7PB 1FVEA 2ATPB 4BZYA 3KPSA 5E8DL 4QRTA 3O9WC 5D72H 2CO6B 3GJEB 1IC5L 4UT7L 3DGCR 1A6ZA 3D3VD 2DQTH 5DLMH 4KI5D 4UV7L 5C1MB 2E6PA 3T0AA 5DVMA 2Z92B 3MUZ1 2BRQA 4Q58C 2I9TA 4X5WB 1D9KA 2EYSA 2VZSA 1MLCB 3Q5TA 3GSOA 2R4SH 2VC2L 3EYSL 4ZSOA 1MCWM 2IALA 4DJMA 4KROB 1P4LB 4KKLD 3RNQA 5JUEH 2I60H 4OBSA 1ZTXH 1G6RA 4IJ3B 4PJGF 1QPXA 5KTEL 15C8H 1A6VH 4PRHD 2VXTL 5E00A 3IDIA 4M61A 3RIAF 1EEYA 2F5AL 3RX7A 3CSGA 2E9BA 4U05A 5FECB 4P5MA 3MLVL 1ZA6A 4FMKA 1AJ7H 1NMCC 3ZDZE 1HKFA 3JUZA 3MGOB 5BOPA 3HZMA 4S0UC 1DUYA 4PV9B 3QBTB 3PQYE 5ISZB 3VW3H 3U30C 2YR3A 4G8GB 3RPKA 4YBLB 4JY4A 4JANA 2ADJA 4NM8H 1JGUH 4I2XE 3WEXA 1L7TH 5IWLA 3VFOA 2BJMH 3KJ6L 4M3KB 1M4KA 1QHPA 1C5CL 1I4FA 4XAKD 2UWEB 2AXGB 4O2FA 4X6BA 4DEPB 3ULUF 1MHHB 1AO7E 3DO7A 2E27H 4GG6B 1P9MC 5CEZL 2ZUUA 3W9DB 5JIIA 2W91A 3SKOB 3K8LA 3MA7B 1FL5B 3WD5H 5FYJE 2QR0B 1EGJH 1QBAA 3L3KA 3WFEH 2BY2A 3MLRH 2ZUXA 3D25B 4LPTA 4XTRD 3MLXH 5DYOB 1JPGA 1TJHH 2XTJE 3V0AC 3SDCB 1ZHKB 4PGCB 1MNUL 3TBWB 3T65B 4WI8A 1I85A 4MNHA 5DJXB 2EC8A 4N9GB 4J1UA 3D48R 4OLEA 4OFYD 3GJFB 3S35H 4M5YH 3KYOB 4FXKB 5E2WH 4D0BB 4K7PX 4RA3A 4GXVH 1Z0NA 4JM2A 3PGDA 3AXLB 2VXUH 1V3JA 5F71A 3SJVB 1JGEB 1KV3A 2OTWA 2DIJA 3Q1SH 3N1GC 5LQBL 4M43L 2HFFA 3EYUH 4JRXA 1INQA 4YHMH 3VFSA 3BFOA 3MODH 4NHCH 1D5BB 3LKPB 2OZ4A 4K2UL 5I1EH 1TJGH 1CGSL 4LSPL 3T0ED 1PYWA 4WUUE 2APFA 1RZKC 2AK4A 1QO3B 5T1LA 3RL1A 4KTDL 2P8PB 4Q0XH 4M4PA 1YDPB 3OB0K 1BGXH 1UACL 5I66B 3ILPA 1PDKA 4HIJB 3V95A 1WUNT 3BDXA 4WHCA 3QIWC 3WJLA 2FLRT 4MXWL 3CDCA 5DGRA 3TCLB 4C54A 4OZGB 3OKKA 2QHRL 3UZEA 3VMOA 1H3VA 3HAEA 3TBYB 4Y4HC 3HE7B 4ZFOB 4K7FB 4LSVL 2KZWA 5C08E 1E4XL 3SY0B 1UZ6F 1BZ9A 4XXDA 2G60L 2R0LH 2V5YA 4N8VG 3QHTC 2ZP0T 4ALAH 2VXSL 2VDMH 4KKAC 4P49A 5C0BA 4ETYA 1OY3B 4GBXB 3AS1A 5I0ZA 1CXIA 3KXFD 1EAPB 1GGCH 1MF2L 1JPTH 1HXMA 4TNWF 5IW6A 3LQZA 3G5XA 3T08A 1DP0A 4R90L 1ZHLB 3Q0HA 5C6WH 3QUZA 1JHKL 1LMKA 3BIKA 4OJFL 3BJLA 3NFNA 5HGBA 2APTA 2E6QA 2FIKA 3NIDF 5EUOA 3VXUE 4D9RE 4KMQA 5E8NB 4ZUWA 3U46A 1DJSA 3RAJH 1XCQA 2R23A 3EOTH 4TNVK 3DUSB 3G5VA 3Q3GB 3SGJA 2Y06H 5I8CB 4WDIB 5H37H 3WFHA 1T0NA 1NFDB 4H88L 4O51B 4RGND 4TQEL 1FAIL 4UNUA 4FQQB 5H2BB 1H0DB 5C0RL 4G6KL 1DVFC 2HG5A 1OAXH 2W65A 1OAYH 3HS0B 3JWOL 5E8PA 2G5BA 2FB4H 5I1IH 4YPJA 43C9B 5C0AD 1I7TB 1N59B 1CF8H 2A77H 2MMXA 1PKQE 1ROWA 3I50H 3OB8A 5IVXA 1CDUA 2MCG1 4X7TB 5KZCD 4PRAA 4WW2C 3UEZA 1NJ9B 3D39D 3EYFA 1CDIA 4NZUH 1IFHH 4XB7A 1KB5L 2QQLH 5EULV 2WBJA 3FFDA 4NQUA 4DTGL 3E1F1 1JGVL 3EGSB 3LDBC 2HT2D 2IF7A 5ITFA 2BVOA 2G9HA 1AR1D 3UZVB 1Z0MA 1SY6H 2X4PA 5AZEH 2X4NB 3L5WB 5F7DA 2APXA 4S1SL 3LCYA 3LKQB 3MBEC 4A2MA 4X7DC 5BZWA 3RIAK 3B2UC 1YN7B 4IS6A 4YAQB 4LQ1A 3QA3B 1CCZA 2Z93A 5DMYA 5CILH 1FLTX 1INDL 5ICZA 4P2QB 5E9DD 1BQHB 2Q20A 4LPUA 5FKPA 3AAZB 4UBDC 3VGEA 1A6UL 2NX5E 2BNRD 2DYPB 3KWWA 2OP4L 1Z2KA 4NQSB 1OOAA 4JFYA 4CJ0A 4U1GB 3VFMB 1U91A 5IVZA 3QNXA 1BD2E 1KIPA 1ORQB 1FORL 4K8RC 1TTGA 4P4KD 3NA9H 1UM6H 4JVPA 4JDVA 4F7TA 3DGGA 4RX4D 2FGZA 4M6ML 1LEIA 2D9QB 5F44A 5IESH 3QEQD 2A6IB 1BX2A 1TVHA 3EFFA 3NIGF 5TFSL 4ORGA 5IM7A 3STLA 4HLZG 3DMMD 2R1XA 1LGVA 5I74C 3MV9E 2GY7B 2R15A 3N85L 1L0QA 2ERJC 4I0PD 3QDMA 4UV4L 3O2WH 2OJEA 4LAQL 4HSQA 1Q0XL 4PS4L 4JHBA 1I9IL 1QR1A 4XBEL 5EU6A 4W81A 4OCYH 1U3YA 2GITA 1ZT4B 4ZUVA 4MYWB 2WW8A 5BV7H 1MFEL 3TYGL 2J3SA 1JP5A 1NBZA 1F3DH 2VKXA 3TVMC 3RUGE 5F3BB 4KRMB 5DD6B 4LAJH 4AH2A 1PGRB 1PFCA 4KJWD 4NC1C 3TJEH 4RMTA 3QHFH 2FX8L 2XRAL 3L5XH 3VXTA 4L1DA 5D7JC 4LVOB 3CZFA 5JPNB 2GIYA 1AE6L 1VFBB 1KBGH 5LBSL 4CW1A 3WV0A 4P2OC 3T2NL 3TN0B 3ZYIA 4Z18A 2Z31C 5DR5H 5EC1B 3RTQB 5J11C 4CADA 2KQNA 1AQDB 1OAUH 4X4ZA 5L6YH 1NEZG 1AHWA 1RJYA 1UYWL 1ORSA 4UTBH 2D31A 3U4EB 1JI2A 1WZKA 1ZT1A 4PYHA 4WTZA 1IGMH 1SYVB 2MJWA 5I15H 2OMNA 5J7CC 1MJ8H 3B43A 1JF1B 4QRRE 3TESA 5ADPL 3HC3L 5EPMB 5JOFB 3PHQB 2WY3A 2AJSL 1JRHH 4D9LL 5E2TH 1ZLSL 4FQHA 2CRMA 1WCBB 2JIXD 4YIQA 1K5NB 2UY6A 3ULVF 1KJMB 4NC1E 1OTSD 5FYKE 2MHAB 1MWAH 2YK1L 4K94H 5IGXL 1FGVL 3GUTB 3TBTB 3GKZA 2CGRL 4M6OL 1H15A 4L8SB 3T8XB 4QWWC 1IARB 4JFFE 3DRQA 3QXDA 3RVUD 1OP9A 5FUZL 4RMQA 2H32A 4FZEH 1FN4B 1IE5A 1J86A 3BKJH 3LKOB 4NNXA 3HR5B 3HI6H 3PP3K 5T5FL 4P9HH 3WKNA 1UKQA 5J4MA 3KLAA 3RNKB 4ZFOL 1H8NA 2J12B 2QQNH 4JFZH 4O00A 5L7XH 4NNYA 3FB5B 3QPQC 1T21A 1YYMH 4HIIA 4KHTL 1NAKH 4OIIL 1DUZA 1G7QB 2DQHL 4PRHA 3LIZH 4UT9L 5LGHH 1J1XL 1BBJB 3D18B 5C0IA 3ET9F 3RIFF 3T04D 1MCHA 3B6SB 4LLWB 1IEHA 3F5WB 3WNKA 1IAKB 1MRFL 3FQUA 5JMRA 1JPSL 2EE9A 3UYRH 5DJ8B 3UTQB 2AERT 5JW4N 1C08B 5FM5O 1J88A 5B8CA 4LU5L 2YN5A 3HI5H 4CN1A 4WEUD 5I1KH 3O0RH 1U8NB 4ONFH 2V17H 4P5KA 3KYKL 1WFUA 3RWJB 1H8OA 3OKLA 5F93C 1C8PA 3PV6A 3MOAL 4PJAA 4IM8A 2G75A 1OF2A 2Q3ZA 4WVRA 1QSFD 4YXKL 1KIRA 3GRWH 3P0VL 1TETH 4NFBA 4JDZA 2Z0BA 3DUHA 1MQKH 4I18A 4XNXH 1AR2A 3OKMA 1LK2B 3VGAC 2IQAB 4HS8L 3VU2A 3L3JB 3INUH 5I1JH 4JLRB 1I7ZB 5IKCA 1YECH 3V79C 4FN0A 1HNFA 1LO0L 2MNUA 1F6FB 4JPWL 3G6DH 4KTYA 1XGUA 3B3IA 3DUUB 4NQDD 4L5FH 5TDNB 3VJ6A 2AV1A 4LCWB 1IC1A 4OFYA 1V7ML 4PGBA 5C9JA 3BYYA 4F7EA 3CFDA 5LKNA 4XPTL 1F13A 3UTTD 3FB6B 4N8CH 2YD4A 3PQYD 3P9MA 5GSVA 1J8HE 1T7XA 2RHEA 5I2IB 4P59L 4NNPH 3O9WD 5FA3A 5GRXG 2QV2A 4IIQA 4UDTA 3TIEA 1WTGT 3KPQA 4FQCH 1T7ZA 4OGAD 3H9SE 4PTUA 1HEZB 2CO7B 5JA8B 4JO1L 3T0EA 2LU7A 1S8DA 1KLFA 4XP9H 4H8WL 3AGVA 5J3HC 4QHLA 4U1HA 2F58H 4KTEH 1T5WA 35C8L 3I75A 3QCTH 4PUBL 3VRLE 4BFIB 3SO3B 1HNGA 3DVIA 4KV5E 1R0AH 4NO2A 3O45B 3MLWL 3MRKA 1FNGA 4OF3A 1OT1A 4HMDA 4MNGE 4RSVA 1ZLWH 5KS9E 3QUMH 3W0WD 1ZVYA 3KNBB 4XCCL 3ZDXF 3WXVL 3BP6A 2P49B 3H7LA 1LK3H 4OBRA 2X41A 2OQJB 3WL9A 5K59F 4EUPA 3RWGB 2FD6L 1E0OB 4NO0B 3K80A 3BUYB 5CP3H 5CUSH 1G9MC 1ZE3C 4F57H 1VEMA 4HKJB 3QJHA 4ODTL 5HI5C 4MNQE 3WN5C 4Z5RA 4XC3L 5IIEB 5IFHL 4N0UE 3P0YL 2IGFL 3KXFA 5IW1B 1T03H 1QRKA 2Y36H 4GW4B 4NQCD 5D5ME 3OGOE 5F1NA 1FNSH 2KH2B 4F37F 1PBYA 2HLAA 1AGDB 3FB8B 4TVPD 4CKVX 4UU9A 3QFJB 2FHFA 1DANT 4YDVA 1Q9LA 3BWUC 5EOQL 1KTLB 2PR4H 2EIZA 3SGKC 3LY6A 5F7WC 2X4UB 5C0CB 3WIHL 2ZCHH 2VQUA 2PYEB 4G9FB 4ISVA 4YZFF 2GTWB 2Y5TA 2B39A 3W39B 1I8KA 4I5BB 1HHJB 3QR2A 6CGTA 1JK8B 3HN3A 3NPSB 4R96A 3S34L 1XGTA 5C0NC 2GAZA 1DL7H 3QUKB 3G6AB 3KYMA 1T2QH 1URLA 3F65A 3OXRA 4NSKA 1U8QA 3IDUA 4QY8B 5BS0D 3U7AA 4NHUE 1U2HA 4U6XB 5C0AA 1OAKL 1GHFH 3QWOA 1C16B 3QCUH 2H9GB 5IMOA 5GGVY 3B5TA 1UJTA 2OTUB 2FHCA 3NCBB 1YNTA 3GBNL 3BIAX 1K3ZA 5EBMA 2AKRB 3D39A 4BYHA 5IEKA 4JM2F 4JM4H 4Z76B 3HNSH 8FABA 2D7MA 5DD1H 3CSYB 5KW9H 5IT2L 4N0FA 4PJFA 2ICWB 3UDWC 4Q9QL 4ORZC 5DK0B 4LKCB 4ZFZA 1YMME 5DUMH 2CLZA 4F2MB 3TBVA 1WIPA 1CFQB 1KCUL 3L9RB 1YYLH 3HRZA 1YEEL 4JQIH 3I6GA 4HBCH 3U7WL 4MJID 4KDWA 3VXNB 2GJ6D 5CFHA 4RGMB 4UINL 1F8TL 2W0FB 5E9DA 1DBJL 2DQFA 2BNRA 4Y0GA 1NEZA 3BPOC 4JHWH 2Z91A 43CAA 3RKPA 5I9QB 3B9KC 4C59B 5FYJH 5ENWB 1A3QA 1A7NL 4QOKD 4YPGB 1D5IH 3TV3H 2DQCH 4P4KA 1KFAH 1GYAA 2P5WE 4P2YA 5MEOB 3GFUA 4Y4HD 4RX4A 3DSNA 5DUPH 5TDPB 3QEQA 4X7SH 1S9WA 3JV6B 1WAAA 3TO2B 3DMMA 4K9EH 3SE9H 1WJ3A 3HA0A 4DZ8B 4WHYG 4OGYL 3GEWB 2P5EE 1ES0A 1P1ZA 4KKAD 4ZMAT 4YGVB 4NRXA 1RIHL 4I0PA 3X11B 1RULH 2E8YA 1KB9K 4G8FB 1LE9A 2BVEA 3QH3B 4MQ7B 3TA3B 4GAGL 3CDGA 3IGAB 5EUOF 4TSBL 4PLNC 4F9LC 2FSEA 4LKXA 1U8OB 1FO0B 1M7DB 1DSFL 1KLUA 2VZOA 4FFYL 4U1IB 3KJ4C 5EN2A 2AJVH 5CMAA 3BPNB 3IFOA 5BMFH 4XXCC 4YFEA 5EU4B 5TQ0L 1JRHI 1T89A 1D6VL 1VSCA 2XWBB 4HFWB 3BH9B 5IB4B 1OWRM 4IRZL 1YJDH 1SEQL 4LSUL 3GSXB 4CBPA 1OAQH 3G6JA 2HRPL 2ENSA 3DO3A 4NQXB 2LTQC 5ESVB 1DVFD 4U4BA 5D7KE 5DI8A 2Q7YA 2ZSWB 1NGXA 1TIUA 1ETZA 5IVXF 4FTVB 5KANG 5J6HA 2DTMH 2LE9A 3GSQA 4ONGH 1LNUB 4HXBL 3FN9A 3O8XC 1R3KB 3IB4A 5HY9A 2D9CA 5E70A 1JL8A 4UILH 1EEUA 1BAFH 3Q6GL 4L9LB 1RZFL 4LVNC 1NGYB 4M8VA 2R8SL 3DX9B 3CH1A 4KWUA 4MLSA 4RZCB 3SDXA 1JNHA 3MRIA 4NKMB 2CK0L 4OT1H 1ZT7A 3EHBC 4X6FA 3TNNA 5KVFH 1FVDB 4CDHA 1OSPL 1CICC 2ZUQC 2FATH 3WHE0 3RKDC 1KJ2H 1M6OA 3MUJA 3MRPA 4LASL 3BGFC 5K9QG 5FA4B 3ARRA 1RK0B 1HDMA 1HINL 3EYVB 1CZ8H 1Q9KA 1UM4L 3MBED 4L8BA 2CK2A 2JIXA 3LKRA 4RIRB 2QTEA 1DBKL 4ESKA 1RZKH 4RWHA 2YD7A 3CVIH 4MJ5A 4TUKL 4Z7WA 4UBDD 5JR1H 3U0WH 5D6DA 3BAEL 1DLFH 5GGVL 3LS4H 3TJHC 2Q76A 3WFCH 1MFAL 1RHFA 1LEGB 5BZDB 5DT1L 2C3VB 4TSAH 3VDBA 2X70B 1KIQA 1AD0A 3T4AA 4QHKI 4IOSD 2DM3A 4K8RD 5JA9A 3CFEB 2VDOL 5CJOH 2A6JA 2WV3A 2PYFB 1JZ7A 3U4BH 3JWDL 4PTTA 2JB6A 1KTRL 1CXKA 1S5IH 1SHMA 3DV4A 2WMPA 4OCWH 1V3KA 2EC9U 5DJDA 1HWHB 2B0SH 1ZK9A 5E7BA 1CBVL 1MCPH 4UOW0 3FKUS 5IHUH 5AWNL 4XNMA 1X5HA 2BNQB 4PRBA 4DN4H 2NY7H 3AS0A 2PW1A 3MJ6A 2NY6C 4OGXL 1T7WA 5KN5A 2MFNA 2NY5L 1E6OL 5E6ZA 1FE8H 3HHRB 1AGEB 4UIKH 2XN9E 4R4BA 3TO4B 3L95A 5D96B 1UXWA 2D3VA 5IHBA 2V5MA 3TVMD 4HPYH 4Z77B 4HKZA 4QT5B 4ELMB 4E41D 1KXTB 1ZVSA 3W82A 4DGIH 1G0YR 1RZJL 4CGTA 4HD9A 1NMAL 4NKIL 3M1BB 4C56E 3MLUL 5D7JD 3IXTB 1A6TA 5BQ7B 3BZDA 1TQBC 3QDGD 1QSFA 5I1GL 2J8UF 2FX9L 3NABL 4P2OD 3EBAA 4XP5H 4YEEA 2Z31D 1K4DB 3OKEB 3S3SA 4NOFA 3TPUB 2EYTA 2FH8A 3PHOB 3RZCC 3PE9A 3GSNA 3PL6B 4P9MH 5C7XL 5DXWA 1AGCB 4JQVA 1CFNB 1A4KB 4FFVC 3E2HB 5FK9B 4H26A 2XKNB 3KPLA 4E5XB 4GW1A 1S9XA 3CVHH 4XAWH 1WBYA 4LPCA 4X6DE 2GK0A 4UB0H 2A9MH 2ARWA 4ZUTA 4GG8B 4NQDA 4DAGL 1U92A 4ZFFB 4JEGB 2GJJA 2CLRB 3I02A 1KN4H 4ZOCA 1HHKA 1FP5A 4MX7A 3UTTA 1C1EL 3D0LB 1NCNA 2Y72A 4G6AD 4BH8A 1I75A 2H6PA 4MLIA 5E6IB 3QDJB 4I48B 3MX0A 5D7LE 5EA0H 5FUOH 4MMZC 3O9WA 1MRDL 3RRQA 2QQQA 1DBBL 3SQOL 4QWWD 3KR3L 3CFJA 2O61B 1TZGL 5I30L 1P69B 3FRUB 5E4EC 1I7RB 2BRRH 1YPZB 2HMIC 1GZPB 2ITDB 4TVSa 1TVDA 4F7MA 4P46B 1NCCH 1OPGH 3EZ8A 3RWCB 4O2CA 2YKLL 2NZ9C 1SMAA 3S36L 1OD7A 1SBSL 3BZ4B 1AXTH 2DM2A 2EIDA 2HWZL 4UQ3A 2ZJSL 3QPQD 5DQDH 5EZOH 1LO5B 4FFWD 1CDYA 3MRLA 4Z78A 1EFXB 1A5FL 1IAIM 3W0WA 5B3JF 1DE4B 3F58L 2BERA 2OI9B 2HFEB 3LN5B 5SWZE 5JHDD 1F90H 3N50A 2FHBA 1MI5B 5L2KE 2DQIL 4OCMC 1FO0L 2V2WA 2NW3A 5FV2A 5EU7C 3IVKB 4PJGB 1NEUA 3ARWA 4JQXC 5HHXL 1FJ1A 1T20B 1JGDA 4MQXC 1CN4A 1MPAH 4NQCA 5FYKH 2Q86A 2HH0L 2YMXH 4XPGL 1PLGL 4L3CB 3PGFL 4PJAF 3OBAA 4NRYA 5DJZB 5GGTH 3H0TA 2ZOKA 4GQ9L 3SE3C 2XPGA 1HHHB 2Y07H 1P9MA 4D9QE 3ZL4H 1MEXL 3I9GH 4XNQA 4HMEA 4RFNC 4Q97A 5CSZB 3FQRB 4P23B 2J1KA 4TRPH 3L3IB 3ESUF 3TZVC 3OQ3B 3HR6A 4KAQH 5DRXB 3QIBC 4NQVB 4OZIB 5D8JH 2B4CL 2FR4A 1YY8A 4JG1H 1E4KA 2GHWB 4XHJC 5F9JB 1IGIH 4ZO6A 4EI6B 1P2CA 5BS0A 2YBRA 4PBVC 4PJCA 3I6KB 5MP6L 4ZFGH 4HK3J 4X4MA 1T1XA 2VUOA 3LQAL 1KPVB 2IPKB 1ZS8B 3VXPB 2D2OA 4HWEL 4OUUA 3MJ8B 2GSIB 2IC2A 3STBA 5DJAB 3SCMB 5F3HB 4JFOB 4CMMA 3ISWA 3QSKB 1XH3A 3HFMH 1DQTA 4JN1L 5HHNA 3SGEH 2ARJA 1KJ2A 2GFBA 4LMQE 3CU1A 4ODXA 2X44D 2QL1A 3QNZB 3LN4B 1P4BL 3BN3B 4MJIA 1G7LA 5CZVL 3RWEB 2GJ6A 3MLTA 5J3HD 4C4KT 5E4IA 4GKNB 3LOWA 2WUBL 1P7KB 1QZ1A 2BY3A 1NLBL 3KG5A 1RVFH 4PGJA 5C0JA 5SWSE 3ZDYE 3TNMB 1UH4A 2X4TB 3REVA 4QOKA 2IAMB 5ALCL 1FSKC 4LLUA 3NTCL 5D70H 1IQWH 4PJ7E 4X4YB 1I1YA 4P3DA 4JY6A 4Y4HA 5DRZA 3TF7A 4HWZA 2DIAA 4PV8B 4BSVB 1T2JA 5DJYB 5B39G 4O5LL 1LE5B 2BX5A 3I3EA 3IJHA 4BH7A 1UEMA 1B4JH 1K8DB 3RDTC 3CLFH 2RCSH 3BGMA 4JPVL 1MWAB 1U3ZA 2C3GA 3HMXL 4P3CL 5EWIL 1JCKA 3GIZH 5HI5D 2DM7A 5GGRB 4JZNB 5DZNA 1CD1A 4LLQB 5D71L 4IOIB 2I5YH 2YUWA 4Z7UA 1IAII 1P7QD 1CGXA 3V4PL 4MA1C 5CGMA 1KEGL 1DQQB 1U93A 2UUDH 3CUPB 3FO2A 2BSTB 4OFDA 2HRLA 2ZUTA 3LN9A 4ODSL 5HHQA 4AIXA 4Q9RH 1BZ7A 5HPOA 4Z0XA 4YWGH 2OL3H 4TUJB 4HXAL 5KANI 4Z9KB 3SQBA 5C0ND 1MJ7L 4ZUUB 2GSGB 4QTHB 3BQUC 3RVXD 1S78C 2YA2A 3BP5A 1DVFA 5JXEA 3BEVB 5IB1B 1R5WA 1HN1A 4QO1A 4JPKL 4YDIH 3N1PC 5E2UL 3VXME 1F5WA 3DHMA 3DX7B 3GSRB 2OCFD 1J0ZA 2HFGH 1IGCH 2P48B 3EO0B 4WW2A 4ZOBA 2XKSA 5GS3A 3FO0L 4PJFF 5CEZE 3VRIB 4HUXA 5LGKA 2R2HB 2BVQA 5TE6L 1U8IB 3JZ7A 3N1FC 3KS0H 2A2QT 5TF1L 4X9HA 2YHGA 5C92A 3MJ9A 3DURB 3BZEB 1A21A 2V2TB 4OZ4A 5A1AA 2NY1C 2VABA 1C5DA 4DOHE 3BSZL 4Q6YA 4RRPG 4CMHC 1J8KA 1R5VB 1RUAL 2EDKA 3MBEA 3GI8L 5C9KA 3UBXB 5GGRY 2VXQL 1XF1A 1L6ZA 4F8QA 2W9DL 1NUFA 1CE6B 4LDLB 1U8PA 4AG4H 2NXYB 4QXTA 2OTPA 2VWEC 4MJ6B 3FQNA 4NPYA 1FNEA 2UVEA 5DRWA 5IFAL 4Q2ZB 1MCIA 1NAMA 5FDWA 4FQJH 3UC0H 3E8UH 1CG9A 4KY1L 3SKJH 5MEQB 1WAAF 4H1LA 2WWMD 4XPAL 1Q9OA 2X1XR 3AREB 3HLAA 2X40A 3SEPA 4X9BA 5HHMB 5TH2A 5J9PB 5EBGA 5EORL 1Q0YH 4O2EA 5TPWL 3MRDA 2ICWJ 1XFPA 4PB9H 5DSCA 1OGAB 1EVUA 1WBZB 3E6FB 2W0KA 5BVPL 3VFPA 5IB2B 4WJ5B 1JWMB 4NKQB 3EOAB 1CFTA 1T1YB 4AEFA 5C2UB 4RAUB 1SJXA 4ZS7L 1G7HB 4HC1H 4OLXL 4XP6H 2WLYA 5FGRA 3RWDA 3Q6FA 1BWMA 2C5DC 1N7MH 4LDOB 4R26H 4JN2A 3JWOC 3R1GL 1FYTB 1MCKA 2ORBH 1FFPA 3WFZA 2BDNH 1FNHA 5IHLB 1U95B 1OGTB 5JLZB 3TVMA 4FQ2H 1ND0A 5GIRB 1I9RL 2VWEE 3G6JF 3O2DL 4X6CA 4U1LA 3QAZC 4E41A 3BP7B 3FN0L 1IM3B 4KZDH 4Z7QE 1RZIA 4DCQB 5FOBA 1R3HB 5D7JA 5GGTA 2F8VA 4Y5XC 2LVCA 3O81A 2A9NH 3E6HA 3MV7D 1OM3L 1ERNA 3H9YA 2FEEI 2LU4A 4S1RH 3QDGA 3CXHJ 1BQSA 1G9NL 4NKDB 5L2JA 5ANMB 5JORB 4WGVB 5D93B 2VH5H 4P2OA 4NN5C 3ULUL 2Z31A 4Y4KD 1A7QH 4U33A 3O8XD 3FQXB 5E1HB 4GRWE 4M7ZB 3UTPD 4QXWA 3ZE0F 5DC4B 3FQTA 5E24E 3SDXF 2R1YA 2NY2C 1UVQB 3NFPA 1CLZH 3JSSA 1JMZA 4P2RD 4D0CA 1TCRA 4H0GA 3VXSE 4QRPE 3GMOA 3EHBD 4XH2B 1QG3A 5FO7B 3TFKC 2VTFA 1Q94B 1RZ7H 1CE1L 4CNIA 3RKDD 3N0PB 4ZG1A 2BSSB 3WFBH 5L8KB 1IKNC 4KROC 2E8ZA 3RBSA 3U1SH 2O5YH 4QXUL 4Z7WF 4IJ3C 4L4TD 1T04A 2CDEB 4ZDHB 2IH1B 2ZG1A 4L4VD 4KZEL 2X4SA 2BFVH 5F7LB 3TJHD 1NBYA 2Y25A 5IVOA 1CL7I 4WU5A 3FN3A 1K4CA 1P6AB 2IPTL 3NPZB 2F74B 4CJ1A 1I1FA 4N0CA 2A73B 3IDMA 3LKNA 3MBXL 4ODVH 2F54D 3VGHA 4AM0A 1FZOB 2EXYC 2I26N 2Z8RA 1WBXA 4JGJA 3MV8B 5T3XL 3FT2A 5KVEL 3MGTA 4HX1A 1NLDH 1XGRB 4YHOH 2IANB 4GRMA 4U1SB 4WEMB 3ZTNL 1RUML 2DQDL 1HI6A 1EEZA 2YS4A 3JTSB 2R56H 1GC1C 2SEBA 5DEGA 4X99A 3PWPD 4O4YH 2QSCL 1ZHBA 5CWSA 4K3EL 1H5BA 1N6QL 5AYQA 5GS2D 2NW2A 2VDLL 4RAHA 5FCUL 4LOUC 1WZ1H 4C55A 4F33B 3OZ9L 5JHDA 1E27A 2NY6D 1BFVL 4DKEL 1QEWA 4CAGA 3OG4B 4X80H 1SJEB 4G9DA 1GVIA 4ZOEA 4V1DB 4HLZH 4Y5VA 5C8JB 1XF2A 4G43A 4XMKH 3I6LD 1AQKH 5FFLA 3V5HA 4JFEB 1YNKL 1IGJA 5FV1L 1WCQA 3AMLA 4K71B 3JV4B 2EYRB 3N9GH 4MD5A 2LAAA 1JNLL 3P4OA 4PIRF 4Y16C 4JVUA 2N56A 3QQNA 4LCIL 1HXYA 4U1JB 3V52L 4BFGA 5JQ6L 3HZVA 4DQOL 3EYOB 3QO0B 4PRID 5ISZE 4HG4K 2XG4A 5FB8A 4OCSL 3L6FA 3SOBH 4G8GE 3VD9A 4KXZI 3KLHC 3CFKA 1CDHA 3O3AA 3FAWA 5B39A 2RIKA 4PJDE 5DDHB 3CC5A 1M7IB 4YFDB 2UWEE 4R0LB 2UZIL 2W9EH 2RGSA 4M02A 5F9OL 3RZCD 2X1PA 4FFVD 4GG6E 4XRCA 2W0PA 3PDOB 4XVJL 2VISA 2JK5A 2IADB 1EHLL 4TPRL 1OSZB 2Q7NA 1N3NB 4LSRH 1MREH 2B1HH 4XPHH 3BO8A 7FABH 3CK0L 3JTTA 3MXVL 4UOW1 2AEQH 2VL5B 1GIGL 5C09B 2ED9A 5F1IA 1GAFH 5DVOA 5L2KD 4NUJA 2CR3A 5KSAC 2VLJD 5AAWA 3NIFE 4DVRH 5EZIL 4LLMA 1J0KA 4ZTPL 4WI4A 3HMWL 1G7MB 3BKCH 1HCFX 1EJ6A 4I3RH 1FL3A 2YSSB 4MSWA 4NZRL 3SJVE 3B4NA 2HMID 5C08B 2IFFL 1FVEB 4GBXC 3NZ8B 3EFDL 3ARGC 4LSSL 4QRTB 4AEHL 3C5JA 3WDHA 2ESVB 5FF6A 1A6ZB 5DWUH 4FNLL 1IM9D 2VDQH 5DUBA 3O41A 1A7RH 3G08A 4ZPVA 3ALXA 1A6PA 1J1PL 2UYLA 1U0QA 2AXFB 4OD1L 2I9TB 1W72H 2XQBL 1D9KB 2A1WL 3QFDB 3P40A 4NO5B 3GSOB 5GS2H 4YHNB 5JW4M 1JFQH 3MLYH 3VXUB 2R0KH 5D7IA 1LWRA 4C4KO 1VFUA 3FRPA 3WNMA 3HC4L 3RNQB 1G6RB 3S37X 1EO7A 5LWYL 1SBBA 1KN2L 1RURH 3NCYS 5E00B 4PJ9C 5HYSA 3IDIB 4LEXH 1JPST 2Z8VC 4M61B 5IBUG 2Q6WA 1EEYB 4MQXD 4HIHA 1UCBL 4P5MB 4R4FL 5J6GA 1ZA6B 4XPBH 1BVKB 3SGKA 1LO3H 1DUYB 5JIKA 2UVFA 1P7QA 4P99A 5E94A 4PJ5D 1PKQB 4PG2A 3LS5H 4JY4B 4JANB 1P5VA 2ADJB 1A2YA 4G7YL 3WEXB 4IRSB 1BZQK 2AV7A 3P0GB 3VG9C 2CLVB 3TZVD 3S7GA 4RWYH 3K1DA 3QIBD 4O2FB 3RL2A 4X6BB 1PQZA 1QTYT 3TT3H 3DO7B 1NCBL 2OJZL 3I84A 4PJCF 4D0DA 2V5SA 1YEDA 3HNVH 1S7TA 3P77A 1B6UA 2CUMA 1U6AL 1NFDE 1Q38A 4HF5L 1J7VR 5BO1L 2AAVA 3L3KB 1NGQH 2D4DA 4QTIL 4M62L 1HQRA 3MNVA 3OKDA 4HEME 4YX2H 5I19H 5HGHA 1RUPL 1JGLL 2W60B 4PJHA 4K3DL 1DBMH 5DTFB 5L88H 4ZNEA 2CKBH 3UDWA 1YA5A 1MELA 4TSCL 4AENA 2X9WA 2CPCA 4Z7NE 4MNHB 2B2XL 3TC9A 2AEPH 3HUJA 3HG1E 4BJLA 4YHLL 4J1UB 4AQOA 4JKKA 5KAQG 3GMMA 1BD2B 2ZCLL 1AGFA 1R6VA 1NUNB 1L9NA 5I6XC 2AW2A 4JM2B 3PGDB 5HJ3A 3FO9A 4YLQT 4Y5YA 3CCHA 2OTWB 4HFUL 3F12B 4YHPA 1T0PB 4OCRL 3QYCA 5DVKA 5F7EL 1NBVL 1JN6A 3T0DA 2HFFB 4JRXB 5C70A 1INQB 1MCFA 2DL2A 4UOJA 3O11B 1RJCA 4XWGL 3NAAL 3ULVL 4MA8L 1MHPH 1PYWB 4G3YH 1R24B 1T0MA 4G6JL 4QRUA 2CRYA 1DEEB 1QLEH 1RQ5A 4NZTL 4R8WH 1V3MA 1KPUA 3OX8A 4OKVA 5GRUL 2AK4B 5DURD 5T1LB 3RL1B 3NGBC 4GRLC 1F3DJ 1A6AA 2QJDA 3ILPB 2A6DA 4DWHA 5SX4I 1CXLA 3RDTD 3H3BC 3IFLL 1U58B 3HC0B 1KEMH 1RFDL 3OKKB 4NCC1 4TULL 5T1DH 2QQKH 1V05A 3NH7H 4UDUB 2WBKA 4KK5C 3H6JA 3HE6C 1ADQH 1EK3A 1UH2A 4OV6F 1QVOA 3D87B 4Z7UF 1BZ9B 4XXDB 3V5KA 3MYJA 1CDBA 4ZXBC 2Q8BH 2MPAH 3RTQC 3VWKB 4F9LA 5C07E 4WW1A 1CFVL 3NCYP 3DBXB 5CHNA 5EIIA 5IMKA 5C0BB 1FRGL 1MHCA 3OTTA 5IW6B 4KQ3H 1HXMB 4XXCA 2E7HA 4HUKB 4Z8FH 4HGMA 2AK1H 3C09C 3IDYB 1QBLL 3QUZB 5E5MA 1CK0L 4NCDA 1BJ1H 2V5RA 1RK1A 4PR5A 3NFNB 2FIKB 5EUOB 4FQLH 4ZUWB 3U46B 3U36B 3V7AG 3QWQB 2CIKA 3BQUD 1S78D 3MUGB 2R0WL 3M8OH 4YXHL 1XCQB 4LBEA 3MV7A 1J1OL 1VGEL 2R23B 4QRRB 4GLRH 3LVEA 1EJOL 5E8DH 4WW2F 4GMTL 3C9NA 1IC5H 4M93C 4UT7H 2CD0A 4Y4KA 1T0NB 3WFHB 3U6RB 4MAYC 3O8XA 2XOTA 5EU5A 4HH8A 4UV7H 2HG5B 5E8PB 4ZO7A 2G5BB 1PSKL 1UQSA 1E28B 4LCYA 4Z7VA 4P2RA 2NY3B 2AXJA 3QUYC 1F4YL 2VC2H 3EYSH 5HGDA 4I13B 4PRAB 4RNRA 2NY1D 5BOZG 3EYFB 4O02H 5K9KA 2W07A 1WF5A 5KTEH 3OGCB 2HP4A 5TE4L 2VXTH 2WBJB 3FFDB 3DPBA 3K7UA 3OHXA 4L4TA 1RY7B 1IGTA 2F5AH 3BKML 5ITFB 4L4VA 2KZ1B 3KDMB 2BVOB 2G9HB 2X4PB 4HQQL 4CU7A 3MLVH 1BVZA 5F7DB 4MZ2A 3T4YA 5MEND 2HT4D 4C83B 1NQBA 1MRCL 1QBMH 3TJHA 1A9BA 5BZWB 4GUPB 4F3FA 4IS6B 1YEIL 3T77B 2Z93B 1IGFL 5FKPB 4OI7A 2F54A 3KJ6H 3F7YA 1YQVL 1C5CH 4KMLB 3RVVD 4JFYB 1JNNL 4R7NA 1U91B 3BD5A 3GHEH 1NH6A 3QNXB 3QXAB 5IVZB 1ZEAH 3ES6B 1RHHB 1ED3A 3GBLA 3S8WA 3P4NA 5CEZH 1YEJL 1G6RL 3OXSA 3DGGB 3PWPA 1CLCA 2XA8L 4KUZL 5I16A 4R2GB 1LEIB 1A1NB 2IG2L 4W6XB 3AS2A 2VZVA 4FMFA 1BX2B 1TVHB 3EFFB 1YN6B 3S6CA 4ORGB 5IM7B 3GMLA 3STLB 5A43C 1MOEA 1CGUA 4OI8A 2R1XB 3A67L 3FHAA 3V6OC 3QDMB 1G0DA 2D7NA 4X6CF 1MNUH 2OJEB 4JFPA 2EKSA 4LPYA 4KMTL 5J1SC 1GPOL 1N0LA 4DUXA 2DMKA 3MJGX 4U7KA 1W0VA 2CMRL 1QR1B 1I1RA 2CXGA 5EU6B 1WTLA 1YEKL 4RGOL 2GITB 4XC1L 4ZUVB 2YEZA 2VAAA 3BWAA 3DLQR 2BC4A 3CX2A 4KRPB 4PRIA 4BUHA 2F5BL 4AH2B 5LQBH 1H3PH 2COQA 2YPLD 3O3BA 4M43H 1D7FA 2EDFA 4NC2B 4AEIL 4CVZA 1N8ZA 3NZHL 1JZ4A 1H8SA 1AXSA 4XNZB 3QQ4A 4LSPH 4XPFL 3LKSA 1FG9C 5DQJA 3CZFB 3RZCA 2NY2D 3BIBX 3RGVB 4CW1B 2VN4A 5DEFB 1J8HB 4GJTB 1M71B 4MWFB 3RQ3A 3TFKD 1PX3A 1UACH 3LQMA 4N90E 4CADB 3OV6A 1RJYB 1T83C 2V9TA 5F7YC 4LDEB 4QHNA 1J0HA 1HWGB 4KROD 3SO3C 5K9OA 4OQTA 1KELL 2OL3B 2D31B 1ZT1B 3STZA 3AC0A 3SDAD 4LSVH 1F3JA 1E4XH 2VLJA 2G60H 4IHOA 1X5GA 3BVNA 4KK8D 3NVQA 4HUVA 2VXSH 4FQHB 4MNGB 1MAML 2OZ4L 1MF2H 4DW2L 5B38A 2AJXL 4R90H 1PW3A 3G5YA 25C8L 1JHKH 3VFWA 4OJFH 3LSOA 1IEAA 1H15B 1TMCA 3MCLL 1IM9A 3DRQB 4MNQB 4Y4FD 1KCVL 2H32B 2RR3A 2QKIA 4GRWH 4N0UB 2QLVB 2VE6A 3R8QA 3B8SA 1IEBA 3KLAB 2KQMA 4TQEH 1FAIH 2LABA 3QG6B 2C7UA 1BJ8A 4YHZH 3IJYA 2PTUA 4LOUD 5C0RH 2VIRA 3OF6D 5ALBL 4UT6L 3JWOH 3WFDL 1T21B 3BPCA 2OK0L 1S7XB 1DUZB 1TNNA 1IRAY 1RJLA 4XGZA 2VDKH 2VR9A 2X7LA 5C0IB 2AJZA 3U9PH 3P30H 3ARBD 1DN2A 4Y16D 4HJGA 4NM4L 4N1CA 3FQUB 3RJQB 1XCTA 1KB5H 2CQVA 4J3OC 4NHUB 2ARJQ 3BJ91 3VFVA 4DTGH 1JGVH 4PJ5A 4DN3L 5C6TL 1YNLL 2DLFH 5DK3A 3KLHD 1X3DA 4LSQL 4QF1A 4QHMB 4YDKL 3ROOA 1EXUB 4S1SH 3QFJE 2YD9A 1MUJA 2FDBP 2FX7L 4P5KB 3TZVA 4OF5A 3GKWL 2I25N 3C08L 4OM1L 3BRDA 3OKLB 3QIBA 1UJ3B 3PV6B 5C0CE 2G75B 2PYEE 1OF2B 1KC5L 1INDH 3FQWA 3ILQC 1KIRB 4BK5A 4PP2A 4YR6A 1I3VA 1W0WA 4LARL 3OKMB 4BUGA 4N8VB 4PJ7A 2XACC 5BJTA 1CIUA 3LAFA 2EKJA 3ZZ1A 3EO1B 2DD8L 2Q3AA 1FORH 2MOVA 2DLGA 5I9QC 5F7KC 2D4FA 2L0DA 5IKCB 2D03L 2ICEA 4M6MH 5JNYA 2EH8H 5KSAD 3FOLA 1BEYL 5TFSH 1XGUB 3B3IB 1IC4L 3O4LE 2FYYA 3VJ6B 4TTGA 4I77L 5C9JB 4F7EB 3N85H 5GS0L 4R6UA 2P5WB 4UV4H 4LPWA 1EEQA 3P4MA 4LIQL 3UTSE 5GSVB 4LAQH 3GGWB 1Q0XH 1ZLUH 3ARGD 1FIEA 3BW9A 3O6KL 4PS4H 5FA3B 4APQD 4F7CA 3NN8A 1KNOA 1I9IH 5IFJA 4XBEH 3O6LH 4EXPX 4IIQB 3TA3C 1EBAA 4UDTB 3TIEB 2E7LE 3KPQB 1PG7L 2ADFH 4JGUA 4PTUB 1MFEH 2V6HA 4U1KA 3T0EB 3TYGH 2VLRD 2XA3A 4KUCD 3IDGA 1BECA 4ELKA 1S8DB 3BPNC 2WQRA 5GSRA 1VADA 2ZKHL 2AS5M 5D7IF 3KPPB 2E7CA 4K7PY 1IT9L 2XRAH 1UFUA 2IPUK 4YO0A 1ZWIA 4NO2B 4RMRA 3RDTA 1AE6H 3MRKB 3ARXA 5LBSH 3DX6A 3MLPA 1KIUA 3T2NH 4PJ9D 2PETA 1QRND 2B7DT 4B0MM 3WO3B 3KPMA 1KPRA 3MNZB 3BP6B 4PY8I 1UYWH 4GMSL 2VL4A 1NGWA 4GKSA 3IFPB 5KG9A 1NC4D 4WFEE 3GJFH 3CMGA 3QJHB 1QLFA 1PZ5A 4Z5RB 1WVZA 4L9LC 4I9WD 1CLOL 5SV3A 2EICA 4IRJC 5F1NB 5ADPH 3HC3H 4ODHH 1JTTA 3VW3L 3KPOB 4YDVB 2AJSH 3UMTA 4D9LH 1QUNA 1ZLSH 4LNVA 4QGTA 3V4UL 3BQUA 3CPLA 4ISVB 2Y5TB 2VYRE 1DN0A 2YK1H 5IGXH 1I8KB 5EOTA 4PJEA 5D9SA 1FGVH 4R96B 4P2QD 1XGTB 4M6OH 2GAZB 4RGNB 3C6SA 4JE4B 3MFFA 4P3WA 2HJLB 4LNRA 5FUZH 2ED8A 4PJHF 2XKUA 4OB5L 4NSKB 5C0AB 3QWOB 5T5FH 4NWUL 1A7PL 4QCIA 3HUJF 2YZ1A 4FTVE 5IMOB 1E6JL 2YRPA 1YNTB 1HCVA 2GQHA 2M1KA 2JCCA 1DBAH 5KZCB 3LPGA 3D39B 1L0XA 5K33A 8FABB 3VCLA 2PO6D 5CAYB 4KHTH 2DQHH 3UTZA 5D2LA 1HYSC 4N0FB 4UT9H 1J1XH 4PJFB 3BPLB 4U0RC 1VFOA 1HE7A 1R3IL 4NN7B 5C0GA 1G7JB 5I1LA 4ZFZB 2CLZB 1AGBA 3TBVB 5MENA 3G9VA 4U7SA 2FLBT 3EAKA 2NY4B 1JPSH 2LFGA 3D69B 1J87A 4OZHE 3I6GB 1NCAL 4M1GL 4QRQB 5KOVC 1FFOA 4MCYA 3WIFA 4BQBA 1R3JA 1TPXB 4P57A 4LU5H 5E9DB 3TO4C 1FFNA 4GRLD 1BQLL 2DQFB 2BNRB 2UUDK 1NEZB 5IQ7L 1C5BL 43CAB 1KCSL 3KYKH 4OZFG 5EO0A 3PHSA 1EAJA 4YE4L 1KT2B 1I1AB 3PWVA 4MS8C 5T33L 1I8MB 3BT2L 4YXKH 4B50A 2ZWLT 4Y1AB 2GJZA 3P0VH 5D2NC 4KK5D 3HE6D 4XBPA 4U3XA 1QKZL 3QEQB 4HV8A 3PG2A 4HJ0D 4NUGL 5E08L 4ZXBD 1N5YH 3DMMB 4HS8H 3BMVA 4HH9A 1P1ZB 2W38A 4NRXB 3GB7B 1LEKB 3PL6C 2CXKA 1LO0H 4I0PB 5CGYC 1UB5B 4JPWH 1LE9B 4GKOA 1LD9A 3E2HC 4U6TA 4EDWL 3MRFB 3CDGB 2RFXA 4OCNC 5E5UB 2FSEB 4LKXB 4HS6A 4K7PL 5I8OL 1V7MH 3JVGC 5EN2B 2ADGA 5CMAB 2EIBA 4XPTH 1B0RA 4J7RA 5DJCB 1EX0A 2FO4A 3MRHB 2YD5A 5CJXC 1MJJB 1QFPA 4HIXL 4X6DB 4P59H 3KPTA 2YPLA 4BQ8A 3MCKA 4ELME 3K46A 3RY6C 5E6IC 4MAYD 4IMLB 4F80A 2ATPA 3DIFA 3KLDA 3QO1A 1RIUL 2DWDA 4Q6IC 1SYSA 4Z7VF 3VXRE 4JO1H 1JPFA 3GJEA 2VKWA 5E2VL 4JFHD 2EE6A 5DI8B 2Q7YB 1NGXB 1ETZB 4H8WH 5ESAB 1S9VA 3BYTA 1FZKA 2Z92A 3QUYD 1F97A 2QADD 5KSBE 3O3EA 2IBZX 35C8H 4HMCA 3TFKA 12E8L 4KQ4L 5HY9B 4P46C 4Z7OE 2P45B 3TPUE 3GBML 3MLWH 3U83A 4HPOL 5E0QA 1IKNA 1P4LA 4D94A 2DLEA 3CH1B 4QXGH 3SDXB 1JNHB 4RA0C 2R1WA 5DJ0A 1KENL 2AP2A 3TNNB 5M94B 3SDAA 4XCCH 3WXVH 2R2BA 1TFHA 4BM7A 2B8OT 5GHWH 3DI2B 2BVPB 2UV3A 3JTCA 2BP3A 1HDMB 5HD8C 4KH2A 1X4YA 4ODTH 3RZWA 3LKRB 2JIXB 4XC3H 5IFHH 3P0YH 2IGFH 4R4NC 4U6HA 3MRJA 3T1FA 4TUOA 4Z7WB 3QDJE 4PV9A 5LG1A 4JKMA 2O5XH 3DXAD 2YXFA 3HCVA 5EOQH 3ECBB 1L7IL 4OLVL 1QFUL 1BWWA 5DRNA 3WIHH 4Y4FA 4J23A 1KIQB 4ODUB 1AD0B 2CJUL 3C6LC 3BESR 3Q5YA 2DDQL 1YPZE 2A6JB 1JHTB 1MHHA 3BN9C 4PTTB 2JB6B 5F9WB 2DN7A 3DV4B 4Y2DB 3MXWL 1NANI 3W9DA 3AU1B 2HLFD 2V7HB 3VFNA 5F88A 5JHLL 4M8QB 3OF6A 4KDVA 1A6WL 4H20L 2Y6SC 1SJHA 4R3SA 5J13B 1OAKH 1G9NC 1OAZL 3S4SG 4XNMB 4ZYKA 3SGDI 3ULUC 3BOVA 4KGJA 3GBNH 1J12A 3ARBA 3BZFB 1ZHKA 4PGCA 2PW1B 4Y16A 1RU9L 5DJXA 1MI5E 5IT2H 2O5ZL 3U9UA 4LCWD 4R4BB 5J12B 4PJGE 1HH9B 2K3TA 4Q9QH 4FXKA 5HDQL 2YPKA 4HKZB 3SCMC 1ZVSB 2NY0B 1KCUH 3WNPA 4YEFA 1YEEH 3CFCL 4FQIL 3U7WH 4M48L 4ZTOL 2AJ3A 1A6TB 3QHFL 4L4JA 3LKPA 3IXAB 4UINH 4RMVA 1QSFB 2X9XA 4U2YA 1DBJH 2P8MA 4EKXA 2OYPA 4MDJB 3GMQA 5F1OB 1ZLVH 1KBGL 4MZ3A 2EYTB 1S7SA 1QO3A 3MUY1 3LEVL 4AL8L 2P8PA 2I9LA 3NCCB 1A3LL 5CBEA 1A7NH 3GSNB 1MJUL 5I66A 1EERB 5TJWK 2C3WA 3ULUE 4EQ3A 4CVXA 4H26B 3KPLB 5HHVL 1ACYL 3TEUA 3TCLA 4GW1B 2IAMC 4OZGA 1S9XB 3UO1L 1KYOJ 5KSAA 1WBYB 2GK0B 3TBYA 4M4RA 3T3MF 4ZUTB 4ZFOA 3CFIC 4OGYH 3LV3B 1U92B 4JRYE 2X1QA 5JZ7C 5FXCH 1VPOL 1YC8A 1NMBL 3I02B 5EO9A 1N64L 1RIHH 2XYCA 4K94C 4MX7B 2XXMB 1TVBA 4NO0D 1JRHL 4WFHE 4K07A 2J5LC 4BH8B 1NGZA 4OI9A 1MIEL 4XX1G 5L8LB 3HNTL 4OUOA 4GAGH 5GRVK 4TSBH 2NTFA 3RY4A 4NJ9L 4JB9L 4JR9L 3ARGA 3O9WB 1DCLA 1DSFH 2UZYB 4APQA 4I1NB 5EZLA 4FFYH 4NBYB 2XZQL 3U7YL 3CFJB 5BW7C 5D1ZA 5F6HI 2VLKE 5F6IB 5M95B 2VLRA 5TQ0H 1UWGL 3HPJA 4P9HC 5E8NA 5C0CD 3ZKMC 4HIEA 5KAQF 1D6VH 2WIIA 5IK3A 4G9FD 5DC0A 4F7MB 1GZQA 1NC2B 4IRZH 4O2CB 1SEQH 4LSUH 5HBBA 1XZ0A 4EEEA 2HRPH 4X98A 3DUSA 3HI1A 3S88L 4UQ3B 5IOPA 4OCLC 1NFDA 4WO4D 1OWWA 5F8QC 4XCFL 3KPRD 4LFHG 5H2BA 2BOBB 1B0GA 4IDJL 3MRLB 4Q9BA 3UZQA 1PX4A 4PJ9A 5ID1B 1QRNA 3QIUC 5FYLD 5T3XE 4HXBH 4XNUL 5D7SL 2J88H 1I7TA 4WUKL 3W0WB 1GGBL 2BHZA 4S1QL 1ZGLP 1L4IA 4DGYL 5LGHL 1FC2D 3QNYA 4PY7A 5JW4Q 1NMCB 3Q6GH 2R8SH 1RZFH 1NC4A 1NJ9A 2APVA 2NW3B 1SM3L 4HCRA 1DR9A 2CK0H 5K9JL 1JGDB 3U30B 3BMWA 1OSPH 4GXUN 1JUFA 1G7IA 5SWQB 3EGSA 1P4IH 5ETUB 4OZFA 2D7PA 5KVMC 2R2EA 4XVUC 1HINH 4NRYB 1UZ6E 3VRJA 1UM4H 3H0TB 2ZOKB 4PRPD 1MCBA 2XPGB 5GGUA 1IL1A 1DBKH 4HW6A 3ILQD 1DANU 4TUKH 4PJ7F 4XNQB 4YAQA 3BAEH 3QA3A 1T5XB 5GGVH 3PV7A 4P2QA 3WXWL 1BQHA 1MFAH 3AAZA 5DT1H 2BY0A 3MA9L 2NXYC 1L8JA 4GOSA 1XT5A 3O2VL 2OMBA 4N1EA 2FR4B 1OP3H 1VFAA 1YY8B 3W2DH 3RVWC 3UAJC 3NIDE 2VDOH 5DHVA 3HAEG 2D7OA 1P2CB 5BS0B 3JWDH 4LP4A 3O3UN 3UX9B 1CI5A 3PABA 4PJCB 1PKOA 3AS3A 1YECL 3PWUA 5BRZD 3HRPA 5DEZA 5EIQA 2AI0L 5ACLA 2PO6A 4OUUB 4KKBC 5AWNH 4JAMB 3U2SB 5EBWB 1Q9WA 4MXQC 4CMMB 4M5ZL 3PXHA 1ULVA 1FBIL 3ARZA 1XH3B 3C8KA 5F8RC 5HHNB 4MHHG 2ARJB 2GFBB 4OGXH 2NY5H 1E6OH 1A0QL 3FFCE 4MJIB 2M26A 1G7LB 3SHSA 4LQFL 2GJ6B 2IH3A 3D0VB 3JV0A 4WFGD 2PTTA 4GRLA 1RZJH 1B88A 5F3BA 1NMAH 4NKIH 3JWNC 3MLUH 5C0JB 2FGWL 4FXLA 3WS6C 3IAPA 1GRWA 3REVB 4QOKB 2VLMD 4YNYA 5I1GH 4LLUB 3TLRA 3TCXA 2FX9H 3NABH 3TPKA 3S96A 4P3DB 3CXDH 4JY6B 4EZMA 5DRZB 1J0YA 2K7PA 3HE6A 4HWZB 4L3EE 1BOGA 1SQ2N 5D93C 2XWJA 1DQML 3IJHB 4ZXBA 4X9FA 4BH7B 1TZHA 3BGMB 5C7XH 4OLUL 5F9AC 3CJJA 3BISA 1X5XA 3IKCA 1OGAE 4ONHA 2VSDA 2K7QA 3IAQA 4F57L 4IRJD 1GGTA 4CRPA 3IU3A 3U4EA 2CKNA 4MCZA 3T3PF 4MD4A 5ECJE 5ELIA 4Z7UB 3NIGE 5DS8A 1X5YA 5D1XD 1FYTE 4POYA 5JOFA 1U93B 4OV5A 1C1EH 3FO2B 4PJEF 5DD3L 5HHQB 1WCBA 1BZ7B 3ZE1F 4EBQL 3BKYL 1K5NA 2XQYK 1CQKA 1MRDH 1DBBH 1I8IA 3SQOH 4PLKC 3KR3H 1OARL 2KPNA 4MAYA 1TZGH 2R4RL 1K6QL 5I30H 3BP5B 3GUTA 2DJSA 3TBTA 4FA8A 1EZVX 2OM5A 3S4SA 1JZ8A 3GSNL 5DA0B 2JCCF 3QRGH 5ANME 1MCDA 1AI1L 3QUYA 4I3GA 5L8JB 3QCVL 4L29B 4PJXA 2GY5A 4PJ8C 2EDJA 3S36H 1SBSH 2HWZH 2DQGL 2ZJSH 5D2LF 2VXVL 3FL7A 5TDOB 4Y88A 4HUXB 2BVQB 2GUOA 1HYSD 4M7KH 3UROR 1LP9B 3LDBB 1BF2A 3VFTA 2VABB 3F58H 2BNQD 3OR6A 1C5DB 5GQBA 2DQIH 2F53D 3B6SA 1FO0H 4LLWA 3FTGA 3MBEB 5FO8A 5CSGA 2ENYA 3BI9X 5AEAA 3PWJA 5HHXH 2XI9A 4YHKL 4NYLB 2HH0H 1PLGH 3ZHLA 4HHAA 3PGFH 1U8PB 3DXAA 3B9VA 3FQNB 4NPYB 1FNEB 2V5TA 4GQ9H 1N2RA 1NSNL 1IAMA 1MVFA 1NAMB 1U8NA 5FDWB 3DYOA 4MS8D 3MRNA 1GGUA 1CG9B 1MEXH 2XTJC 4U0QB 2UY7A 3S35X 3ULVE 1Q9OB 3TH2T 4JG0L 3HLAB 4K9EC 1B2WL 3MV8E 1KFAL 5DMIL 1MCSA 2IANE 1X4ZA 4O2EB 4HWBA 5DSCB 4NDMA 1KOAA 2HYMA 4P48A 3VFPB 4WTZG 3V6OA 5CGYD 3PL6D 2H3NA 5MP6H 4PJDB 1CFTB 4F15B 3A0OA 4JGMA 3LQAH 1OVZA 3Q6FB 1F11A 2JJUA 4JVWA 3E3QE 5FCSH 1AFVL 4HWEH 3IFNH 4TVPL 3QRFM 3X17A 4V1DE 3DUUA 4YH6A 1FFPB 3IDNA 2G5RA 4LCWA 2AEIT 5I1AB 5HPMB 4JFEE 3TVMB 2E5EA 4A6YA 1AKJB 1YJDC 1Y0LA 4ZS6D 4X6CB 5TQ2H 4U1LB 4KVCL 3FB6A 4E41B 4JN1H 4J3TA 1S7WA 2EEBA 1RZIB 4JJ5A 1A14L 2X6MA 1FPTL 5D7JB 1P4BH 5CJ5A 2OSLA 5IMMA 3QDGB 4G8EA 5FKAA 1XF3B 1Q1JL 5L2JB 1HEZA 5GJSL 1IJ9A 4P2OB 5CJ8A 1U8MB 3K4DA 4X5XB 3OJDA 1ZGLB 2WUBH 3ZT7A 1NLBH 5KVGL 3J7HA 1Z6JT 1WZLA 2J7LA 4HZLA 4Y19E 4P46D 3GMPB 1UB6B 1YY9C 4J12A 3FQTB 1T83A 2R1YB 5BVJA 1XGPB 2PUQT 5ALCH 3NFPB 4BFIA 5F96L 3NTCH 4D0CB 1AP2A 1TCRB 5LAXA 5DZLA 1U36A 3DVFA 3KYNA 3GMOB 1N6UA 2AQ1A 3V6FA 5CJQL 3HPLB 4O5LH 3VH8G 1EFXD 3GHBL 2DQEL 2ZG3A 4U1MA 1HYRC 5E56A 3LH2L 4HS3A 4JPVH 1IAIL 1SEBB 1M7XA 5HD8D 4OM0L 3HMXH 4P3CH 5EWIH 1EIBA 2EH7L 2OQJA 1KJ2L 5C09E 4NO0A 3BUYA 1T22A 2H1PL 5IMLB 2EZ0C 4HKJA 4U6YA 2X4SB 4AQ1B 1S7UB 5D71H 1NBYB 5ID0A 3V4PH 4WU5B 3MRMA 1KEGH 2FJGA 1K4CB 2JJWA 3FONB 2JKXA 4P0DA 3C6LD 1I1FB 1F58L 3ME0A 4ODSH 5J1TC 1FFRA 3IYLW 3IDMB 3LKNB 5C0CA 1KGCE 3BN9D 4AM0B 1D5ZA 4G9FA 4HXAH 3KPSE 4JREC 1WBXB 1HQ4A 2ESVE 3BH8A 1MJ7H 5H37G 3MGTB 2X05A 3LMJL 4HX1B 1RUKL 4IRSC 4GRMB 3GIVA 2WBWB 3LEYL 4KJYB 1ZHNA 4FQ1L 1HI6B 1EEZB 2Y6SD 4WO4A 2SEBB 3QUKA 2AEWA 3KPRA 2DQJL 4JPKH 4NP4L 4X99B 5DEGB 2H2PC 2J8HA 1BPVA 5DVLA 1H5BB 4GFTB 3D85A 4QY8A 4ZSOE 4U6XA 3SKNA 4PP8C 1C16A 3RWFB 2WP3T 4DN4L 3FO0H 5JHDB 1E27B 1QEWB 4G9DB 3RPIA 5TE6H 4NO3B 4Y5VB 1XF2B 4G43B 3ULSA 1V8HA 4EN3B 5TF1H 4JKLA 4Z76A 3V5HB 2EO1A 3D2UD 1QFHA 4PREA 4DZBB 4MD5B 3ZTJH 5IJKC 3M45A 4LL9A 1U9KA 3P4OB 3NFSL 2ICWA 1J18A 3SCMD 4N0RA 3BSZH 4HUNB 4NQED 4Z0BH 3ZDXE 1OB1A 4PGDA 3MOQA 1RUAH 2WLZA 4YFLI 3GI8H 3HZVB 4PRPA 5K59E 3VFRA 1MLBA 1WEJH 5FB8B 2ZCKL 3L9RA 5TE7L 2NZIA 5CINL 3PJSB 2W9DH 3OR7A 3CFKB 3HG1B 4XX1E 5B39B 3C8DA 2EXWC 2DMCA 1A47A 2C9AA 1K9TA 2D0FA 2FECI 3CC5B 2W0FA 4F58L 4LF3A 3VGAB 2ZUWA 1CD0A 5IFAH 1HH6A 2HVKA 1RI8A 1U3HD 1DDHA 3GSUA 4OZGF 3L3OA 3BGAA 5JDJA 4KY1H 1BFTA 4XPAH 3UJTL 4YZFE 2IAMD 3BO8B 4EUPG 3JTTB 3FMGL 3SDDD 3MJ9L 5BRZA 5EORH 5TDPA 5TPWH 4MHHI 5JZ7D 2J6EA 4Y8AA 5BVPH 1NCDH 4F9PC 1J0JA 4RAVA 5HHOA 4WRLA 5FGBC 3H42L 4ZS7H 4YGVA 4OLXH 4LLMB 2ZOLB 1XIWC 4KRLB 3RWHA 3EDFA 3R1GH </