4XXCA

Hla-b*1801 in complex with a self-peptide, deleikay
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-18 alpha chain
publication title T Cell Cross-Reactivity between a Highly Immunogenic EBV Epitope and a Self-Peptide Naturally Presented by HLA-B*18:01+ Cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4xxcA01
3ARFB 3UC0H 3MCKA 5BMFL 4DGYH 2A38A 1KJ2H 5BRZA 1IRAY 4M43L 3MRNA 1R3HA 3H7LA 3D39D 4QRPB 3DMMB 1QSVA 4D9QE 4EI5D 2XKSA 3WKML 2YPLA 4M93C 5FCUH 3EYUL 4RMRA 2C1PB 4OZGF 5AZ2L 5EU3B 4PP1D 3QNXB 1Q9KA 1FZOB 4JFPA 5BRZB 1J05A 1Q9WA 1Z0MA 2VLME 3SJVE 1HQ4B 1HN1A 5GJTH 3MRNB 1TJIH 1R3HB 4Y5VC 1TJHH 3BP5A 3IRPX 5C0JA 1BBDH 3SDAD 4LIQE 4N0UA 3HR6A 3MMEB 5EIVA 5JO5B 5JTWA 3MACL 1OAZL 1U93A 3O0RL 5DMIH 5KN5B 3BWAA 3QFJA 4JFPB 1X5IA 1Q9WB 1SM3L 1QFOA 3GHEL 4QTHA 2XPGA 3C87A 4HKBB 4PJDF 3HKFA 2AJZA 1BD2E 3MCLH 5C3TA 4N0UB 4PJFA 2PTUA 4J6RL 3RUGE 2NY5C 3NCYS 3G5ZA 5C0DA 4M6OL 3E0GA 3H9HA 2A6KA 3MREA 3TIEB 3VXMD 4S2SA 4L8SB 4QHKI 5INCA 2QJDA 2XPGB 4GSDH 4W6WB 3SCMD 4L3AA 5CGYC 4N0FB 2AJZB 5BO1H 4PJFB 4KGLA 5C0DB 4HLJA 4LDEB 1P5VA 3KPMB 2A6KB 2I24N 3MREB 1RAMA 5IVNA 1JYVA 4PS4L 2Y07L 2DQUL 3AY4C 3QPXL 4HIEB 1LO3H 4KPHL 4BM7A 1ZS8B 5HY9B 2AK4E 3QQ9C 4APQD 1WZ1L 2EE2A 4L4VB 1CFNA 2AEQH 4KI1A 1MY5A 1RVFL 4X6FB 3MGTB 2X5PA 4BUHA 4FG6D 4G9FD 4L5FH 1S3KH 2R69H 5CEYA 1PW3A 4PRIB 4J4PA 4XX1E 2NNAA 1LWRA 4CVZA 2IQAA 1A2YB 2EKSB 1RUPH 1CFNB 3BEWB 5DVLA 4ONFH 1QLEL 1Q72L 4ZO9A 1FL6A 3WFBH 5KSUA 2BRQA 4QGTA 3U6RB 2APVA 1EHNA 3G04B 4OI9A 2Y7QA 3RY5A 4H1LA 3RNQA 3HMXH 2NNAB 3QP3A 2VDKH 4YBQD 1CFTA 1LDPL 1Z5LA 5JIPA 2Y25A 3T3ME 3WN5A 2IAMA 3CMGA 2O5ZH 2QHRH 4HK0B 4XCYB 2GSGA 3IXTA 3AB0B 3MR9B 4H1LB 1VADA 4X4ZA 3RNQB 5HDBE 3SDDD 1TNMA 1N6VA 2WY3A 4ZO6A 5DT1H 1CGUA 1CXEA 2NR6C 1K5NA 3O6FA 3UJJL 4Y4HB 5KVDH 1S9YA 1N0XH 3UZEA 1JRHI 3VDCA 4AL8L 2GSGB 3IXTB 1TZGL 1CVRA 1DQLL 2C3VA 5DVOA 2R0ZH 3U0WH 3SKNA 3EJZC 2VO5A 1X44A 4KK6D 3GI8L 5D1QC 5KAQF 5FO8A 1K5NB 4FQQB 5D7JC 1AKJA 2CUHA 3MGOA 2Z4QA 5FUZH 2FX8L 1H3PH 2JELH 5DVMA 2YXFA 2C3VB 5HJ3A 1QUNA 3UJTL 2DMBA 3SKNB 4JQVC 4HUUA 3N1GC 5GRYA 2ZPKH 5TE6L 3X3GL 1SHMA 1M1SA 4NHUA 4U33A 3ULUE 2D7MA 2H2PC 2Q3AA 1MQKL 4PJBF 4AMKH 1AKJB 3TCLA 1BFOA 3MGOB 3ZKQD 3OJMB 1FFOA 3HA0A 4JR9L 3VFRA 3JTSA 5IMLB 4YC2C 2Y36H 5BS0B 1HCVA 2NY2D 4HFUL 3EJYD 2EIDA 5F96L 1IGJA 2EYSB 2DLGA 2GY5A 5F1IA 3ZKND 1BFOB 4QWWC 3LEYL 3O3DA 2KUTA 3IFOA 2WLZA 3MV01 1I3GL 4C56A 5IBUG 1K4DA 1R3LA 5L9DL 1RUAL 4P2OB 5F1IB 4BYHA 5JHDA 4Z7UA 4EIGB 4HS8L 1V7MH 4JY5L 3L5WA 5I74B 4X6CA 2J4WL 4MA8H 4FFWD 4C56B 1B4RA 4P23C 1LEGA 1A6AA 2W60B 1DBAL 5DTFA 1S7VA 5C71A 3F7VB 5JHDB 3LQZB 5IW6A 1E6OL 4XVJL 1FO0A 1ZLWK 4LLYA 3RGVC 1KCRH 2LU7A 3L5WB 3LB6C 1S7SB 4HX1B 2XNAB 1KPRB 2HG5A 5MP6H 1I9JH 4YHNA 5D4QA 1A6AB 4AY0A 3QEGL 2DWEA 1S7VB 1L8JA 4UT7H 1JTTA 5AYUH 1A9EB 1FO0B 3VWKA 1EAJA 3VFMA 1KC5L 4POYA 3MLUH 3WS6A 4KK8D 2HG5B 3PE9A 4I0PA 1FIGH 1IC5L 1MWAH 2G5RA 1CTNA 5ISZE 3MRLA 1T0MA 4P2YA 4OSUL 8FABA 5HHQB 2WBJD 5F8RC 3IJYA 4OV6F 4ONHA 1AGCB 12E8L 5H94A 4Y5XB 5TF1H 1QBLH 4ZOEA 3GBNL 4POZC 2YMXH 2QSCL 4DJMA 5EOCH 3VGBA 1EFXA 1B0RB 1MCWW 3KR3H 1S9KC 3STBA 5AZEH 3ZYOA 2VLRA 4G8GA 4RMVA 3B9VA 3EDKA 3BJLA 5TJWK 4HBQA 1NCBH 3GMNB 5TGBA 1PG7W 2GQHA 4WENB 3CVHH 3O8XD 4JZNA 1J87A 1RIUH 3O4LA 5FYKU 3NPZB 4G8GB 4MAUL 2YWYA 3I02B 4XNMB 4R9HA 2R29L 1I7RA 3QG6B 1A64A 1TXKA 5TGBB 4X98A 1EA9C 1A3QA 1CFSB 4R26L 1PZUB 4JE4B 4EZMA 5C09E 4CVWA 1UT9A 3SKJL 3RIAF 1HXMB 4YFLI 3B4NA 3LZFL 4M7LT 2DICA 4TSBH 3RGHA 4U6VH 1ZHLA 2WANA 3I84A 4KUZL 2ZUXA 3TBWA 4X98B 5GZOD 3VI4E 1F00I 1BVLA 5JUEH 4GMSH 2VXSL 1YC7A 5B39A 5GGTA 3QJFA 3ILPA 1HH9B 5DZOA 4O00A 3NZ8A 3HNVH 1ZHLB 1JZ8A 5CP7A 4Y1AD 5DQ9A 5EOCJ 4C54A 3RL1B 1YPZE 5F9JB 3U9PH 2DQJH 1PYWA 4N90E 3RI5F 2FWOA 5E9DD 5GGRB 3S36L 3QJFB 4HUWA 1GGIH 3ILPB 1K6QL 9CGTA 2L4OA 3NZ8B 4G7VL 2BNQB 3BUYB 3VXQA 1A7OL 1XT5A 5B8CB 3WXWH 5C0AD 5TDPA 4HWEH 4YO0A 4LFHD 1EPFA 2VLJB 1CLZH 4P5TA 4XP4L 4P46B 1T1WA 4HUWB 5EU4B 2IF7A 3IXAA 2O26U 2I5YL 1CF8H 2DBLH 5TDPB 4JKPL 4LSVH 5IHZA 4MJ6A 1YEIH 1H3WM 3OXRA 4KJYA 3OKMB 5ID0A 4P5TB 3V8OA 1HHJA 2BVPA 2GITB 5DJAA 1T1WB 5FDWA 1ZEAL 1HE7A 25C8H 3WE6A 2R15A 3KPRD 4PGCB 1UXWA 5C1MB 2CQVA 3RWEA 3D0VB 4JDTH 3WSQL 4KJYB 1P84K 4DK6A 5KSBF 4Y5VA 2BVPB 5LWYH 4JHAL 4WHYH 2AEPL 5DK3A 1K9TA 4WTZG 1GIGH 3HNSL 1C12A 4NNXA 4Z7QF 2XYCA 3EYFB 4YHIB 4N8VG 1N8ZA 1XIWD 4ODBD 1QQDA 2C4FU 4LEXH 5K93A 3BIBX 4X6BB 2OI9C 5D1ZB 4I13B 1Y0LA 3BZ4A 4ZFOB 3VXSE 1MAML 3BJ91 5CZKA 3PHOB 1P7QD 3FO2B 1EEYA 4KQ3H 4CMHC 4YDKL 4PJXB 5KS9A 3TPKA 5DFTA 1BPVA 3BGFB 4DN3H 1PVHA 4D0BA 5IFHH 1Y0LB 4O4YH 1I8IA 3BZ4B 5JORA 4UQ2A 4DCQA 3GJFK 2AJXL 3V0WL 2CJUL 1PZ5B 4H20H 3I6KA 2CKBH 1IT9L 2ITCA 2YUXA 3U1SH 1MFCL 3AY4A 2Q6WA 3BESR 4NGHH 2HRPH 4R7DA 4I5BA 4XI5C 3RWIA 1KJ2A 1OAYH 3RAJH 4UQ2B 4DCQB 5EPMA 5E8PA 2NXZB 1HSAA 3CK0H 4TNWK 4OGYH 3WDJA 1BM3L 3F7YA 3C2AH 4ZSOA 2CPCA 2VTFA 1KJ2B 2NMSA 5C2BH 1YEGL 4PJFF 1ONQA 2WWKT 5DFWH 4AK1A 2AGJH 5CZVH 4ETQB 3I9GL 3IDGA 5DHXB 5E8PB 2OMNA 4LGSB 3DETC 1RZGA 2X7LB 4GQ9L 3DI3B 4ZUVB 3RL2B 5D72L 1T21A 3KPNA 2VMFA 1MNUH 1AO7D 4LCYB 2FD6H 4PGJA 2H32A 4XPBH 3U0PA 2NX5E 2GJ6A 5T3ZH 3SKMB 3G6DL 4TYUA 5F7FA 4FQ2H 1CXHA 1S9VB 1RZGB 4IRJC 5IVOA 1A6ZA 1HINH 4YE4H 2AJUL 5IBUB 2XACC 5D6DC 3O2VL 4GW5A 1J8KA 5F21B 1QYGH 1TMCB 2I26N 2QKIA 3LH2L 2R4RH 4V3DB 4KI5C 2DIJA 3DX7A 1QR1B 4ISVB 1XF2A 2GJ6B 4U1GC 3MRJA 2XWBB 1AXTL 4U0RB 3WHXA 3QDMD 5L7XH 1X5XA 2DYPA 3MLSL 4JM4L 5TPWH 4NBZB 3LRGA 5H37G 2L7UA 4LQFH 3RVXC 1C5CH 1CTOA 4NQVB 2QKIB 2G75B 2HT4C 2VJXA 5D1QA 3W0WD 4P4KB 5EZIL 1YJDL 1NGWA 3FT4A 3Q6FB 5D7JA 3NIFE 2ORBL 2Q8AL 1LD9B 3HPLA 2JCCA 4DGIL 2R8SH 4NO5B 4YEFA 2EZ0C 2VZOA 3VFWB 4U1IB 1RZ7H 2QLVB 2DQGH 3OGOE 3LKNB 3NAAH 4JQVA 1UVQB 2DLTA 4Z7WA 4KZEH 1L7TH 1NGWB 3FT4B 3ZYJA 3WDIA 2UWEA 5HI3D 4ODVL 3HPLB 1JHKL 1MCPL 5DRNB 3JWOH 3B9DA 4RGOH 3HCVA 4QNPF 4HZAA 1PGRB 3MZGB 5SX4I 3C5JB 3D2UB 1BX2B 5TQ0H 4NKDB 4OCXL 4X5WB 3FL7A 4PPTA 1OTUC 3HMXA 4OGXH 4XMPH 3RWCA 1DSFL 3MPCA 1TQBC 2B4CC 2ZNWA 4PRHB 3HCVB 4HKZB 5CAYB 4P5MB 3FFCE 5I1IH 1KN4L 1WBXA 5JIKA 4JFQA 3LAFA 3DO7B 5A43C 1WICA 3O6KL 2P5EE 3PDOB 2EDEA 3RWCB 3WUWG 5GQBA 2WUBH 1WAAA 3PWJA 1GZQA 5DJDA 3PP4L 1VGKB 5FOBB 3T8XB 2EDOA 1WBXB 3B6SA 4M6ML 1EZVX 3QUZD 4NO3A 2GJZA 2P8PA 4P23A 3GRWL 5B38A 4E5XA 3V4VH 3NCEB 1BIIB 2FJGB 3S9DB 1J12A 3MRIB 3HC0A 3PWJB 3RGVA 3T04D 2YRZA 3UBXA 5D5ME 4MWFA 5E2UH 1OP5K 2KKQA 3MLZL 3V52L 3BH9B 3V6OE 4GT7A 2FR4A 3P9LB 1YNLL 3SO3B 5C8JA 1CICB 4JQIH 3NN8A 4G6KL 3RGVB 5FYJD 5H35A 4XNYH 4J3OC 3UBXB 3ARUA 3CVIL 4W68A 4M5ZL 3JWOC 5E4EB 4JY4A 4MWFB 2A74A 4AM0A 2FR4B 4Z7UF 4KQ4L 2FH8A 5I15H 5LQBL 5H35B 5F7KC 2W92A 3ULVD 2MFNA 4X6CF 1KBGL 5DMYA 4Z8FL 4KMTH 4JPVL 2VIRA 3H42H 3RKDC 5ACMA 3REVB 4AM0B 3GM8A 2FB4H 4NQDA 2CXGA 2XRAH 2ZCHH 2N4IA 4JDVA 3J7HA 1NLDL 5JXED 1OGAA 3VD4A 5E4IA 4UT6L 1AHWB 2Q86A 4HJJL 2VIRB 5F9OL 5CUSL 3SQOL 4HWNA 1VACA 1YEKH 4CADB 2FDBP 1OP9A 4QOKD 3H3KA 4ODSL 2ZOLB 5D2LE 5JLZB 5F3HA 1CE1H 4LARH 3DIFB 1OGAB 5K59F 4NNYA 4RA3A 4GLRH 4UILL 3PWLA 1EAPA 4HS3B 4JFHE 1AP2B 4UNVA 1RY7B 4Z77A 4JFYA 2XTJE 4ODHL 5I1DB 3A6OA 3BHBA 5F3HB 2NQCA 3CFEB 2I27N 3BIKA 1OB1A 3G5VA 2W1NA 2OQJA 1DN2A 2OR9H 3ARED 4JM2C 2V5MA 2WINA 2VLKA 3E6HB 2P45B 3EO0B 5DMGD 3PHSA 2NY6B 4JFYB 1IQDA 2FX9H 1MWAA 5I30L 2L7JA 2F8OA 3WO3B 1OB1B 3G5VB 1W72A 2D0GA 4P2RB 4XPGL 35C8H 2EDJA 3ZL4L 4P3CH 4NFDA 1D6VH 4K94L 3SE8H 2QHLA 4N8VB 2A9ML 3SQBA 5HYJE 2V2XA 4L4JA 2OTWA 1IQDB 3MNZA 1ZA6A 3PP3K 4HD9A 3NGBB 4WW1A 2QQLL 1U92A 3PWPB 4XNUL 3RJDA 4D9LH 4U7SA 5L0QC 1CU4H 1IEBA 2WIIB 3JSSA 2OTWB 4XNXH 2HVKA 4ZUSA 3VFTA 3MNZB 1ZA6B 3D3VB 3VG0L 2F5BL 3WFEL 3QA3A 3CDFA 3PXJA 3W81A 4OJFH 3V4PL 4QRRA 1BECA 4WW1B 5DD5H 2V2TB 4LLVB 3CVHA 2ZUWA 4Y4FD 4NC1E 5FK9B 1AC6A 5ALBH 2HVKB 4ZUSB 3VWJC 4GAYB 5IT2L 1MCSA 3DXAD 2I9LA 1A5FL 4FG6C 5C2UB 1QFWM 4ZUTA 4M61A 3BI9X 4NHCL 4GUPA 1SJVA 4NJAL 3LRSB 1A02N 1SVZA 4BSVB 3Q6GH 5FB8B 4Q9QH 1JYXA 4LMQI 3MRHA 5FF6B 4CW1B 5EU5A 4OQTH 2R1XB 3TGXA 1DBJH 2X4NA 2I9LB 2R56L 4K07A 1MVUB 3IJHB 1EFQA 2VDOL 4LSRH 4YK4B 4M61B 4JGMA 3K4AA 2HT3D 4K3DH 2BJML 4Z5RB 2EC9T 4JVWA 3D18B 1FHGA 1UM6L 3UTTE 5CJ5A 5F7DB 4LNVA 3ORJA 4XNQA 4XP1L 4LKCA 4M3JA 5J1AB 3S35L 2OI9A 1FP5A 3DI2B 1WV7T 1P4LA 4KJWD 3D69A 4WEBH 2PO6D 3KNBA 2Y5TB 3VG9C 5INDA 1RZFL 3NIGE 3DRTA 3SDDC 3PWUB 4ZNEE 2ESVD 2DIAA 5IQ7L 5JA8B 1CL7I 3H9SA 4D94A 5CHNB 3QI9D 5D7LD 1FNFA 5GGVH 4RWYL 2BHUA 4HJGB 2CIKB 2EDLA 3VGDA 5MHSD 1CXKA 2IADA 4FRWA 3DVGB 5GRJL 1U36A 2YUVA 4P9ML 3DRTB 4YAQA 1IILE 5K9KB 4CMHB 4KK6C 1ZHBA 1FSKC 3D85D 3P9MA 4UIKH 3KHQA 4C4KO 3H9SB 3MV9A 5HHOA 1LEKB 2VISB 2ED7A 4OLYL 4LHUD 4YX2H 1SBSL 2BOBA 4WTXA 2RCSH 5L2KB 3BP4A 1RMFH 1NPUA 2IADB 5FGSA 3RDTB 2ZJSL 2CLRA 3VFNA 4W6YB 1KXQE 1ZHBB 3IF1A 5C0FB 2WLYA 4Y5YC 4HIXH 3ILQD 1TETL 3RHWF 2GW5A 2DQDH 4ZPTA 1R0AL 1T2QL 2Q8BH 3BRFA 2NTFA 2XKNB 2BOBB 5I1JH 4YHML 4ZDHA 3BP4B 4MNQB 2YUWA 2CLRB 2DB8A 4KHTL 3VFNB 5ICXA 5CEZD 1W0YT 3TVMC 3ZTNL 3BSZL 3OAZH 5I1GH 2P8MA 5KS9F 4GBXD 2BOCB 4ELMA 3CGTA 3U4EA 1NBYA 2MHAA 3HG1A 3X13B 3QNYA 3ERYA 3ZKNC 5HGAB 4R4FL 5E94A 4TPRH 1KEGL 3X3FL 3QDAA 4B5EA 4Q6IC 1KLGA 5HGHA 4NBXB 1DEDA 3ZE2F 1E4XH 2OJZH 1JIBA 5ICXB 4LLUB 4IRJA 5D6DA 4HUVA 3Q3GA 3FO1B 5GZND 1LILA 2WV3A 4ELMB 1HHHB 1ZA3A 2MHAB 4PJGA 2W0FA 1YDPB 4EVNA 3UZVB 1BVKA 4AIOA 1A7QH 2LAGB 4QXTA 3VXNA 3FB8A 1QTYT 1WLHA 1II4E 1IGTA 1WZKA 2DRUA 2Z35B 3L3JA 1T03H 2FLRT 2VABA 3ETBF 1T4KA 4IS6A 2Z92A 3QQNA 1ZA3B 3CZJA 1VFAB 2CKBA 1D5IH 3QDHA 1IAIL 5IJVA 4P2QA 3BPLC 4ZFOL 4EVNB 2YKLL 1CLYH 3VGEA 4PJ8D 1DL7H 4PB0L 5F89A 1JHLH 3FB8B 4LSSL 5IP4A 1JPGB 3S4SA 1IGTB 2AS5M 1UM5L 2W0PA 5D71H 2FX7H 2VABB 4W4NA 1T4KB 4IS6B 3S98A 4NM8H 3V8CA 2CKBB 3V6FA 1G84A 3EUUA 2BX5A 4Y19B 4JDZB 5J6HA 1JBJA 2IALB 1AE6H 1KYOK 4HWUA 3SDCC 1C5DB 1BFVH 5FUOL 3KHOA 4ODXB 3ZTJG 4OT1H 4RSVA 3V6FB 3MLXL 3ARTA 2IANB 4HLZG 5J6HB 2OM5A 2WBJC 4QY8A 4F3FA 4XZUB 4EQ3A 4KDVA 2ZOKA 5MEPA 3RX8A 4G43B 3C8DA 1A9BA 1VPOH 4ZFGH 1U3JA 2OR7A 3RWJA 3U46B 2DMKA 4M1GH 4M4PA 1CD0A 1XCQB 2ITDA 5TDNA 2H8PB 1UC6A 3IDXH 3DVIA 4G42A 3NZHL 1KSRA 4JHZA 4IIQB 2XZCL 4QY8B 2JCCF 4PLOB 4MCZB 2HTKD 4BQ6A 4EIZC 1AI1L 3CDGA 3QHFL 3TA3D 5FGCE 3ES6A 4BK4A 4LDOB 1U91B 4MNGB 1A9BB 4HCRH 4BFEA 5DD3L 2E9WA 4Z7WF 2ITDB 3M1BA 3WFCH 2DAVA 4AH2A 2F53B 4HXAH 3L3KB 3MLPA 4DVRH 1QR4A 2UWEF 3EFDL 4OCWL 5C0BE 5SV3A 1F11A 1Q0XL 1ZVSA 1JGDA 4FA8A 2A6DA 5HHME 3MCG1 3VXRD 3MNWB 4KY1L 2VLLA 1URLA 3TBVB 3OHXA 4ZFZB 3IVKA 4AH2B 3EOTH 1BZ7A 5EZLA 5SWSA 3TZVD 1OCWH 1L9MA 4HUKB 1FNSL 1M71A 4EN3B 2CK0L 4TTDC 1NDMB 3DYPA 3HC3L 2X40A 2VERN 4O2FA 5E5MB 3HI6H 1MREL 3UPRA 4XAWL 4LIQH 4KWUA 4WWKC 1FIEA 1FZKA 4XAKD 1NCDL 3SHSA 4OZHA 2VLLB 5C0CB 4FFZL 4QRTB 3IVKB 4GOSA 4JFFE 3UJIH 5EZLB 3QIWD 2P42B 1F6LL 4TSCH 5B39G 1N4XL 2YC1B 4JRYB 4TQEL 3ZLQC 1M71B 1TVBA 4XC1L 3CXDL 1WAAF 1A1NA 3UTSE 3NFNA 3R8BB 5CD3B 1NH6A 5EOTB 4KKAD 3O3BA 4O5LL 4AEHL 3GMQA 3HZYB 3TCXA 4MNHB 5L88H 1B0WA 2VQUA 4UB0L 2PUQT 1A1OA 4U7KA 3E3QC 1TVBB 1A1NB 2B0SL 3NFNB 1QG3A 4HIJA 3MV7A 4TVPL 3HUJB 4MVBC 3O3BB 3ARDD 4KROB 4ERSL 1EBPA 4GW4A 2P5WE 4RBPK 5IFAL 1OTSC 2UY6A 2BDNL 1S7RB 1YMHB 4F58H 4L4TE 1MEXL 2FO4A 5E2JA 2PN5A 1I3VA 4HIJB 5F7YC 1TTUA 1N6QL 1G1CA 1NEZA 3T2PA 1RURH 2ZP0T 4HUMB 4K9EL 4WFGD 1F97A 4JFDA 4OTXL 2CR3A 3MYJA 2JB5H 2C3HA 3QO0A 3V5KB 2E3VA 5F9AC 2GYSA 4EDXA 3FQUA 4LCIH 1IGCH 1JNNH 2FO4B 3D39A 3QDJD 5GS2H 1MPAH 2JB6A 2EDNA 5JQ6H 4TUOA 1NEZB 5C07E 3DV6A 1FLTX 3W2DH 1PX4A 4JFDB 2CDGB 4JM2A 4R8WH 5EU6B 4Z6AT 1J0IA 3DYOA 3N1QC 2P47B 2GY7B 4HEME 4M00A 4EDXB 1RUKL 3FQUB 2W9EH 3HE7D 1I9RH 1VEOA 1LO2L 2RGSA 1GC1H 4TUOB 3UZQA 5C9KA 3OKLB 3O9WD 4JM2B 3BP7A 5JW5A 1UGNA 4YDJA 3G9AB 5E2WH 4XXCC 3TYFA 2IBZY 1J1PL 3QWOB 2WBKA 4WU7A 5DJ6B 4HEPG 5GS0D 1UWGH 1ZANH 4FQXD 4JRXA 1A6UL 5GXBB 2B8OT 4JFEE 3RI5K 1L9NA 3QDME 4KKCC 3ECBA 4FFVD 4ZS6C 3H3PL 1CZ8H 3VXMA 3SY0A 3QT2A 3QULB 2XWJB 3TYFB 3K80A 5DRXA 4YJZL 5A2IH 4WU7B 4FZ8L 2I9TA 1FG2B 5EC2B 4WTWA 1V3JA 3KPSA 4LSTH 4FQLH 1IC4H 1NMAL 2AK1H 4WJ5A 1U8HB 4TNVK 5L0QB 5FGRA 1Q1JH 4GAJH 4X7TB 1ITCA 3VWJA 4WWID 2QEJA 3PNWB 2Y23A 3LKOB 3V4UL 4CKVX 3NCYP 2EO9A 3QRGH 1GYAA 3ULUH 3KXFE 1KXTB 1JNHA 2XXCB 3B8SA 3LV3B 4KZDH 2AKRB 1C1EH 4FABL 4WJ5B 3CXHJ 3VRLF 1IC7H 3GIVB 2ADJA 2V7HB 3CJJA 2WQRA 3VFOA 3VWJB 4QRSA 3L5HA 4KH2A 2P24B 1DBML 3INUL 4C57C 5EUOE 1NFDB 2YD4A 1U8JA 4ZTPL 3U4BL 1RZJL 3VRIA 1LQSR 1S9WB 4HH9B 4FTVB 3VFOB 3VDBA 3UYOD 1JPFB 4S0UC 3T4AA 1I8MA 4HKXB 4LCWD 4NYLA 3LS5L 3OZ9H 5GSRA 2OX5A 4DQOH 5JW3L 1N64H 15C8L 3SDDA 1FGNH 1UWXK 3TBTB 1J8HD 3CCHA 2Z0BA 4G80A 2DQCH 4YHLL 1QSED 3C60D 4KAQH 2YWZA 4H5SA 3U9UA 4FXKB 3WLWD 2E8ZA 3CFCH 4M7LL 4PJCE 4H25A 3MLVH 3JVGC 1JFQL 3V0AC 2YD1A 3MBEB 5D7KE 1ZSDA 2HWZH 4CRPA 1KXVC 2QR0A 5IKCB 2VL5B 5JPNA 2EXWD 1ACZA 3OJVC 3U9UB 2A6IA 3ESVF 1JGUL 1VEMA 2OJEB 1UJTA 3FB6A 3ULUC 4S1SH 1IZJA 2NW2A 2F8XC 1HDMB 1F42A 2V6HA 4NJ9L 4U1MA 3BD5A 5ITBL 1ZSDB 4WEUD 2QR0B 4Y5YA 1UM4H 3F58H 4MJID 1ZT4B 4UT9H 2VR9A 3ZDXE 3O11B 4OF3A 5HI3C 5J9PA 4PRPE 4NWTH 3CFBB 5MERB 1OAXH 4JJ5A 4OQTA 5AZEL 5IR1A 2NCMA 2AXGA 3OB8A 3DYMA 1S8DA 5J11B 3NCMA 2XN9D 3TVMA 3CH1A 5B3JF 4JO1L 3LOWA 2DN7A 1QBMH 3GSRB 4XPFH 5IGXL 1LP9E 1XF1A 4G6FB 2JJTC 5DDHB 4JJ5B 5IB3B 3FN0H 4Q6IA 5IR1B 1NGQH 2HFTA 2ZCLL 3AXLA 3D25B 4DW2H 1ORSB 3RZCB 1NCAH 3IKKA 1MJJA 3BPNB 1MAJA 5FCSH 4JKLA 3C5ZD 2DKSA 5D6CB 2Q7NA 4YXHH 2OL3B 2IH1A 3LRHA 4HAFA 4OGAD 2NY4C 4MQ7B 1KCUL 3AXLB 3QEUB 2CDFA 1R3JB 3O45A 3NH7L 4X8JA 3HC4L 4W81A 1MJJB 4M1CD 1B4JH 1Y18B 4Q9BA 1HCFX 3QZWA 3V5HA 3PQYB 2IH1B 2V2WA 3IU4L 5CMAA 1CXLA 3ZZ1A 5IMKA 3O3AA 2BNRD 3KG5A 3OMZA 3MLRH 4X8JB 4K23L 3OV6A 1R3IH 3T0BA 5ESQA 1OM3L 4IRSC 3R1GH 4Y2DD 4ELMF 3MRKB 1CD8A 2R2EA 5D96C 1VCAA 2M1KA 4I0KA 4PJEB 2C4FT 1JYNA 3DHMA 4DAGL 5E5RB 3O3AB 1I85C 5IMKB 3SDCA 4GRWE 3G6JB 3ALXA 4NCDA 4LCUA 1XF3B 3RWFA 3WFDL 5BQ7A 3A67L 4BH8B 1DFBL 3LKSA 3O6MH 1YMMD 4HIIB 4X99B 4N0YL 2ILLA 4PJGF 5BV7C 4KI5F 1LO0H 5AEAA 1MCFA 1UXSB 1A1MB 2P1YA 1UB6A 2WBJA 3SDCB 2IH3A 1AR2A 2A6JB 2V9RA 4X6EA 3RWFB 1MH5A 3MOBL 4QGYA 4M9PA 2Y5EA 1GL4B 3WIHL 4JFOA 4I48B 3VW3L 3MZTA 2FRGP 4I3SH 4BQBA 1DR9A 1UB6B 1C5BH 2JIXA 4XH2A 3OG6B 2FL5B 4E0RB 3O3UN 5JIIA 5JXEC 1AR1C 4X6EB 3OKEB 1MH5B 1DEEB 5DRWA 4GKNA 1KG0A 4U6YA 1H3GA 2MCPH 3H3BC 3MGAA 1KEMH 1YY9C 5ALCL 4JFXA 3ME0A 2B1AH 3R4DA 1A3RL 1V5JA 4ENED 1OAQH 5CKGA 1R5IA 4XVUD 2O5YL 4XMKL 4YQXH 3GGWB 5IVXA 4NQED 3WD5L 1KB5A 1VA9A 1R5VA 4QRQB 1LK3H 2DLHA 5I0DA 3VMPA 1JF1B 4XPAH 5DEGA 1BQSA 1RIVL 1D5MA 1SEBB 4QHUA 1U8OA 4WV1C 4BZ2H 4F2MB 3QUYB 3GMOB 4I9WE 1R3KB 5ICZA 1NJ9B 4JPWH 4MXVE 3ARFD 4AIZA 1MY7A 5AUMB 1G6RB 1R5IB 3L9RA 3AREC 5FO7B 1YNTA 3L7FB 2D03H 5JOPD 4WWKA 1B6UA 5GGSA 5DUML 4P9HH 4QRPD 3DMMD 5AD0A 3BE1H 5DMGC 4M3KB 5DEGB 5DHVA 1JUFB 1RIHL 4XVTL 4QHUB 2CSPA 4Z0BL 5IW3A 5JA9A 5C9JB 4LGRB 1QFWL 2ENYA 1FPTH 3A6BH 1G9NH 5BRZD 1DLFL 4UQ3B 4WWKB 2R4SH 5GGSB 1ZGLA 4LP4A 1X5LA 5DWUL 2APFA 1ED3B 1GZPA 3E3QA 4AG4L 5E9DA 2J8UE 2BRRH 4PJAB 3F6LA 5ADPL 1KENL 2ARWA 1ODAA 4MVBA 1TIUA 1QSFB 2A9NH 2CRIA 2OLDA 4R7NA 1ZGLB 3VD3A 4GRLB 3WFZA 2VYRE 5J89A 4C4KT 4QHMA 1IGMH 1B0GB 3GBLA 4HCRA 3TBSA 3P73A 3UX9B 1MCKA 5FYLE 3CPLA 2X4TB 1I4FB 1IM9B 5ESVA 5L8JB 2UZIL 1REIA 4OZHF 2PYFA 3DO3A 5ACZB 1QRNB 4QHMB 5DI8A 3P73B 1DUYB 4Z76A 1Z3GH 3CPLB 1FFPA 2VB5A 4MA7H 5FKPB 5LGHH 1IJ9A 3SEPA 4HPOH 5DJZA 4L4VD 1YQVL 5JW4N 3TT1H 1FV1B 1J86A 1MFNA 4DGVH 4HG4K 4PR5A 4PRID 1T04A 1FC2D 4GKSA 4RAHA 2AVGA 2HT3C 5I17A 3SJVB 2P8LA 4P99A 1G9NC 1Q38A 1UB5A 3H6JA 4LQFL 3Q2CA 4J23A 1EJOL 1KV3A 4XXCA 3V6ZA 1T1XB 1CL7H 2DTSA 3QB7C 5C6TL 4PRBB 5I1LB 3RUGA 2X4QA 2Z9TA 2AI0L 4KJWC 4AJ0A 5I17B 2PO6C 2P8LB 4U6XB 4D9RD 1CGYA 3OXSB 4WUUE 3QHZH 1IZKA 4JPIA 1H15B 1BD2B 1UCBH 1MI5E 2JJWA 4MXWH 4PJHE 4XHJD 3QIBB 5CBAB 3FRUA 3RUGB 4JO2L 2FJFB 4NQCE 5SWQA 4PB9H 4RNRA 5KVGL 3MXVH 2KBGA 5BMFH 5DFVD 4P4RB 1BHGA 1CFVL 4JM2F 2B2XL 4M43H 1U8NA 4JPIB 2OYPA 4Q0XL 4Y4HD 1HYRC 4I18C 1FYTB 3WKMH 2X41A 2V5TA 3BW9A 3EYUH 5SWQB 1AH1A 5AZ2H 4MD0A 3PV6A 5F93C 1F5WA 3SOBL 4LF3A 3X14B 5CBEA 2AQ3A 4X6DE 1NBZB 4KDTC 4NIKB 2HLFD 2AK4B 3O6FD 1A21A 4KJPD 4Z7VE 3IDNA 2ZUSA 3SGKC 2E7MA 3PWNB 4JZJB 3MACH 1OAZH 3O0RH 1LNUA 3PV6B 4PFEA 3T0EE 2DF3A 5CBEB 3DTXB 5T5FL 1K3ZA 1SM3H 4XP6L 3GHEH 4NKOA 2CMRL 4RFOL 3LKQB 1M4KA 1NMCC 4FHBD 2H3NB 1PQZA 4GBXC 1AKJD 2IGFL 3KPOA 2NPLX 5CP3A 5ACLA 5I76B 1AO7A 5DO2D 2VSCA 3E6FA 4J6RH 2A1WL 3BVNB 5IEHB 1DN0B 5BS0D 4M6OH 4MGXA 4NQSA 5HGDB 4D0DA 3QIUB 3PF2A 5GGUB 5E03A 4L8DB 5GZNC 3RY6C 3VGHA 3ZKXC 1KGCE 1NDGA 3E6FB 1MJ7L 4BK5A 2FECL 5FKAB 4WI9A 3T3PF 2CDEB 1BZ9B 2Y07H 4PS4H 1FLRL 2CD0A 2DQUH 2NY3B 2D0HA 2MNUA 2Z31C 3EO9L 3QPXH 4JKKA 4KPHH 1XR9B 4UDUB 3JVGA 3V6BR 4HBCL 1MCLA 1U6AL 1WZ1H 4P2OD 3OAUH 4XCNA 1RVFH 3P0GB 2YSSB 1NDGB 1P9MC 2HP4A 4KVNL 3W0WA 5I1AB 2G60L 2YS4A 3BRGC 5T1KA 2AV1A 5BOPA 2RBLA 4C56D 1SMOA 5KW9L 4TVSa 1RJZA 5CD5D 4MD5A 3GB7A 5JHDD 1QEWB 3UPCA 4DK3A 4LNRA 1QLEH 1Q72H 3MA7A 4LVNC 4PJDE 1JGEB 2Q76A 1DQTA 1EVTC 3QUKA 4UAOC 3KLDA 3U7YL 5T1KB 4RIRA 3RHWK 4YXKL 1ACYL 3ROOA 1F3RB 3L95A 3W5MA 1OLZA 1HHKB 2F58L 4IJ3C 4LPCA 3IAPA 2A0LC 1OSZA 1LDPH 1BIHA 1CG9B 5I71C 1JZ3A 1DP0A 3MA7B 4ODUA 4X5LA 2DJ4A 4FQIL 2EYTB 1TQCC 4HWBH 2BC4A 3L95B 3JV4B 2JJTA 5I66B 5EUKA 1CN4A 2APBA 2D0FA 3TWCL 1KIQA 3UJJH 2BVOB 3WLBA 5DMJB 4U2YA 2JK5B 4KRPB 1YN6B 4AL8H 1QVOA 1WWBX 1TZGH 3KYMB 1L7IL 2BC4B 1DQLH 2VITB 5MEQB 4M6NL 3H0TB 1IMHC 4I0PD 2XZQL 1AIFB 5EUKB 3P11L 1QLFB 3GI8H 1KIQB 1FFNA 3WLBB 4FXGA 1HWGB 2DI8A 4DKEL 3LN9A 2FX8H 3SE4C 1CCZA 4LVOB 2APXA 2NY4B 4M7ZC 3UJTH 4RFNB 1RZIA 4KXZI 1L6XA 2X4PA 5TE6H 3X3GH 2H41A 3JUYA 3QXVA 4K8RL 1FFNB 4PP8C 1MQKH 3V6OC 3VGAC 2Z93B 1AGDA 5F7MC 4IRSA 4YNYA 1A0QL 5IBLD 1UZ8A 4JR9H 1F13A 3P4NB 3CZFA 2KQMA 4HFUH 4LSQL 3U2SA 2GI7A 4G8GD 1D5ZA 4GKOA 5F96H 3ZYZA 3LPWA 1I85A 1RZIB 3OB0H 4U1JB 3LQMA 4LSDA 4YUEL 2NW3A 1HIML 5DC4B 1VKXB 5ISZA 2LV4A 4IRSB 4YNYB 3LEYH 2EH8L 3GFUA 3QIWC 2XZAL 3KDMA 3G08B 1I3GH 2BCKA 4L29A 4KKAC 5L9DH 5DA4A 1RUAH 1JF5A 4NO2B 5HVHB 2DQIL 5T3XD 5ISZB 4EXPX 5DJCA 2CKNA 5DZNA 4WRLA 4HS8H 4DOHE 5BXFA 4CL7A 1CGSL 1V7NL 2MKLC 3LSOB 4JY5H 2ZG3A 3KDMB 1KJMA 2J4WH 4QO1A 5GHWL 5D8JL 5JXEA 1DBAH 1UJ3C 2C3WA 4DZ8A 1DZBA 2J6EL 1E6OH 5IVZB 4XVJH 3KGRA 5DD6B 2MOVA 4M9OA 2RJMA 3ISWA 3F12A 4QOKA 4M02A 3JV6B 4LHQB 4JREC 2BNQD 4CVUA 1D5BA 2F19L 3QEGH 3MFGB 4HK3J 3GK8L 4BQ8A 1IAII 3S88L 2WP3O 2VLJD 2XTJC 1PY4A 1V3MA 2OL3L 5C09A 4LCCB 3G6AA 5E8OA 2IBZX 1A6TA 1KC5H 4WFFD 4XB8A 3HS0B 4WV1A 3D3VE 3KYKL 1MCEA 4I2XE 1HYSD 1G0XA 4UUJB 2ATPA 1NKRA 1IC5H 5IW1A 3VD7A 3DX8B 3AREA 4U3XA 3QXWA 4P5TD 4GFTB 4N68A 4NO0B 3EYSL 1ADQL 4OSUH 3G6AB 2VH5L 4LRNL 4PYGA 5EZOL 2YA1A 5MENE 4XRCB 1JNLL 4LLQB 3WCYA 5A2LH 5EBWA 12E8H 1XGYL 2ATPB 4D8PA 2BP3A 4HPYL 1TDQA 1AXIB 4OF0A 3GBNH 4OLVL 1IBGL 3B2UC 1NKOA 3FOLB 1UA6L 1YPZA 2QSCH 4WEMB 2OSLA 1CYGA 4M8QA 5IQ9B 1M7IA 1KTLB 3L6FB 2ZKHL 3L5XL 1UCTA 4RQQA 5TFSL 4D8PB 1JV5B 3QJHB 4WFHE 2NTSP 1A8JH 5IVXF 5C92A 1YPZB 1HNFA 1TCRB 3BKCL 5GGTL 4M8QB 1M7IB 1E4KC 4ONGL 1A14L 3BX7C 5D1ZD 3QQ3B 1H9VA 2YZ1A 2YBRB 3IFLL 4V1DE 4MAUH 4GH7B 4GAGL 3TH2T 3GBML 4WI4A 4L1HA 4NC1C 2R29H 4MMZC 1TITA 4R26H 3ULSA 4C83B 4WO4B 5IB5B 3SKJH 4O9HL 3U48A 3LZFH 4EJ1C 3VFVB 1SJHA 4Q58C 4OUOA 3MFFA 4KUZH 3P4OB 5AAWA 4F9LC 1GOGA 3HPJA 3ULSB 5CGYD 1PX3A 2YK1L 2LQRA 2VXSH 5J06A 3BZFA 1XR8A 2HFFB 3OGCA 4X7CC 1PJ9A 3HMWL 4PY7A 2CXKA 1XGUA 2NXZD 2CRZA 3EGSB 3ZHLA 3VXTA 2BFVL 4X7DC 4N9OB 1I3RA 2KDGA 3QQ9D 3S96A 3ARYA 3G5YB 4ORZC 3S36H 4F7PA 1XR8B 3CIQA 1K6QH 4F15B 2BZDA 3GSWA 4G7VH 3CUPA 1G6RL 1U58B 4GKZA 3VXTB 1A7OH 5EORL 1I3RB 4XTRD 3BGAA 3KPPB 5ANME 5E56A 2PO6A 5A2KH 3NTCL 3C6LC 3OPZL 4L3CA 3BKJL 4XP4H 5C3LD 3MRGA 5KJRL 1RI8A 1ZK9A 2ESVA 4YFLF 3HN3A 1D6EB 4J3TA 1KTDB 4BSJA 3VXSB 1HEZA 5DEFA 3RBSA 3CUPB 1WIOA 2G2RA 5D7LA 2I5YH 1SBBA 1QO3B 1S9XA 5I2IA 2EDHA 4O51A 4JKPH 3T65A 1NAMB 2J2ZA 2DI7A 2PTTB 4OZFG 3MRGB 5IIEB 3REWB 3QDGE 3GJEA 1N5YL 5ADOL 4I18A 2GJ6D 1ZEAH 5AWNL 5BZDB 1HEZB 5CJBA 5DEFB 2EXWC 3VE0A 4LHUA 1S9XB 2VN4A 3WSQH 3VCLA 4KDTA 3FO9A 1NUNB 5GGRY 2NR6D 4P4KD 4XGZA 3HE6B 4WU5A 2FIKB 3HB3D 3LIZL 4EBQL 1KF9B 1MLBB 2EDTA 1A4KB 4L3EE 4NP4L 3SGKA 4JHAH 3TO4B 3RUGF 3IDXL 3VE0B 1HI6A 4J12A 4S0TD 2AEPH 3FONA 4FZEL 5DJ2A 3HNSH 2DWDA 3FT3B 1J11A 3T2NL 1NGYA 1W0VB 4OD1L 3VCLB 3EJZD 1T83C 4Q2ZB 4CU7A 3TIDA 3BKYL 1G7HA 4GW1A 2FHFA 4WU5B 4GBXA 4RGMC 2NX5A 3IDYC 1VHPA 4S1DC 1WZMA 4Y19E 1MAMH 5DJ2B 2DWDB 4K2UL 4OLZL 1I1FA 3SE9L 3D2UD 4KV5E 3L3OB 3CMOL 5I16A 4YDKH 5IB4A 4RRPA 1XGTB 3TIDB 2H2PD 2XA3A 2NX5B 3RY6A 3UBXI 4P48A 1X6LA 5E0QA 1ZLSL 2IANE 4PRHD 3DVFA 2AJXH 3V0WH 3LHPL 2CJUH 1I1FB 2PXYB 1GJIA 1IT9H 5I0ZA 3QNZA 3TFKC 4LSPL 1MFCH 4NKIL 2Z31A 5IB4B 1CE6B 1BMGA 3QUXC 3GMLA 3LKRB 4NCC1 3HI5L 5KSBE 4HGWA 1MUJA 3FQWA 1P9MA 1QACA 1WSST 5E2TL 2HT2D 4WNQA 4Z7QE 1I7ZA 1G7QA 5CSBA 1BM3H 1QFUL 2ZNXA 3MRFA 2VOTA 2VUYA 4HDIA 3L3HB 4JZOA 4OIBA 1YEGH 1MUJB 4HGWB 3FQWB 4OFIA 1RD6A 3IKCA 5EC1B 3I9GH 4AEIL 5F9WC 5IOPA 2HFEA 4WNQB 4XMLL 1CT8B 5CWSA 4GQ9H 2M8XA 3MRFB 5EIQA 3CH8A 5FA4A 5D72H 4HDIB 4JZOB 4ZOCA 4TUJA 2AXFB 1CICD 4BZYA 1M05B 5FGBC 3RGVD 2YPLE 3G6DH 3GHBL 5DS8A 2I60L 5SWZE 5LJYH 3LB6D 1NGXB 5CWSB 4PRNB 1DE4A 2AJUH 5H2BA 3O2VH 1PEWA 4PD4J 3LH2H 1VFOA 4DUWA 1L6ZA 2Y6SC 1WCBA 1AY1L 2JB5L 5DQJA 4AYFA 5EBLA 1AXTH 3BPCB 1S7WA 3MLSH 3Q48A 5DS8B 4JM4H 3FFCB 3S5LA 3WNPA 4UZGA 4PJIE 2X1QA 1P6AB 3QFJE 4BFIA 4M6AA 5TE7L 1JPST 3ULUF 2ICCA 5EZIH 1WCBB 1YJDH 3E2HC 4TSAL 2VXVL 2P5EB 4NUJA 1MJ8L 5D1XB 5EBLB 2ORBH 2Q8AH 4DGIH 3EOAB 1G1YA 5EBGA 3SE4A 4QT5B 3I3EA 3DROA 2R0WL 2VDPL 5D5MA 2UYLA 5GJSL 3HUJE 6FABL 4XVUC 3SKOB 1N59A 3HNTL 1J9CT 3UCRA 3VXRA 4NQDD 3S97C 3V6OA 4CUCA 4KTEH 5GRUL 3U36A 4ODVH 5JOFA 1JHKH 1MCPH 4MHHG 2JE8A 4EI5B 2DM2A 1GVIA 3DROB 1OGAD 3VA2C 2XG4A 3K74B 2C7UB 3QFDA 3ARFC 3R8QA 2UYLB 3KJ6L 2DQFA 4PGEA 4ZAKB 4MD4A 4OCXH 3SGDI 4ZQKA 3DMMC 3VGAB 5HYEA 3VFSA 5JOFB 1DSFH 3QIWA 2LABA 1NFKA 1KN4H 1JP5A 1HILB 3QFDB 4OKVA 3PJSA 3I75A 3HLAA 5E6IC 1HSBB 1FAIL 3V7AG 2NY6D 3T1FB 4JKWA 4PBVC 2RFXB 1CDIA 4NFBA 3PP4H 2QBWA 4MA1B 4OV5A 4P2RD 4RGNE 4P49A 1T1YB 4PG9A 2A83B 4MX7B 4M6MH 2LVEA 4OKVB 4IM8A 5IB1A 4MSWA 3I75B 3HLAB 3GRWH 3STZA 1UJ3A 5JR1L 4LFHG 5D2LA 5ELIA 1KNOA 4OV5B 1CD1A 3PABB 1JPTL 2GK0A 2PKDA 5F1NA 3PWPD 4JN2A 5I1HL 3IAGC 4QNPE 5T1DL 2X4UA 4L8SC 3MLZH 4HUXA 3V52H 4F57L 5E95B 1VFBB 5TH2A 1YNLH 5D2LB 4FQHA 2O61B 5HYSA 1T20A 4G6KH 3BWUC 1OT1A 3BN3B 5F1NB 4G8IB 3CVIH 1ORQB 4JN2B 4G9FB 2I07A 4M5ZH 2X4UB 4HUXB 2RAMA 1FNGB 3PG2A 5TH2B 2IJ0C 1U8PA 3QISA 4X8XA 2XTJB 4HKJA 3FCTA 4KQ4H 2B39A 4N5ED 4FQHB 5IFJA 5LQBH 5FHAL 1G7PB 1KBGH 2GSIA 4Z8FH 2I07B 3WO4B 4P57A 4JPVH 2FYYA 4GAFB 4A2MA 3KPLA 1HWHB 4XB7A 5E1HB 4I77L 3RQ3A 2BVTA 3DUUA 4C59B 4ETYA 5HYJA 5ERWB 3FHAA 4HKJB 4NHUE 1T5WB 3WHE0 2R2HB 5C6PB 3RP1A 1NLDH 1T7WA 1HH6A 2F5AL 4JHWL 4UT6H 5F9OH 2FYYB 4HJJH 3RRQA 5CUSH 3SQOH 5DZLA 3MRCA 5HYJB 2D7NA 4OUUA 4ODSH 2R1WA 3MRMB 1W72L 1X4ZA 4XHJC 4NKMA 4X4YB 1E4KA 4OZ4A 1HH6B 4UILH 5DRZA 2GTWA 3AB0C 4FQJL 3T0DA 4HFWB 3MRCB 5DFVC 4JG0L 1F90L 4PLKC 3NABL 1KIPA 4OZFB 3VI4F 1F8TL 4EUPH 1INEL 3FB7A 3FMGL 4ODHH 4Y4HC 1PY9A 4Z7UE 5LGJA 4OZ4B 1DQDL 2PCPB 2R2CA 4HF5L 2KQNA 5FA3B 5DRZB 3BD3A 3WBDA 4X6CE 5KG9B 4XBEL 3QRFM 4UNTA 3X17A 3KAAA 3OF6D 4DKDC 4F9LA 3RX5A 3H9SD 5JDSA 1YPZF 3SPVB 3DX6A 5I30H 4KJPC 1BLNB 3MJ6A 3B3IA 2R0KL 5LGJB 4NOBA 5D9SB 5L2KD 1T0NB 1MFAL 4XPGH 5CJQL 5F3BA 3IDMA 3ZL4H 5F88A 2PR4L 3DGGA 4K94H 5EA0L 4Y16B 2G5BA 4PGZA 3VD5A 1KPVA 2A9MH 4R0LC 4U6HA 1HXYB 5E6YA 3JWDL 3TJEL 5JDSB 5LAXA 4XI5D 5D93B 2EYRB 5DO2C 3D48R 4NUGL 4ZODA 1KTRL 5F3BB 2QQLH 4MNQD 4N9GA 43C9A 4LCWA 3I6GA 4XNUH 3UTTB 4ZNEA 1I3UA 1ZHKB 1EV2E 3VFGL 4NRXA 3C6LA 5JZ7D 1RU9L 3ZDYF 1K8DB 3VG0H 3AGVA 2F5BH 3WFEH 3TNMB 1J8HA 3D87B 4WFEE 3CSGA 3V4PH 3U30C 4HC1L 43C9B 4HIHA 3FN9A 3DETD 1D7FA 3TO2B 5CZXD 3PUCA 1P1ZA 4H8WC 4UIMB 1X7QB 3C6LB 4P2OC 3HAEA 1F6AB 2Q7YA 4RZCA 5IT2H 2IG2L 4YIQA 4LPVA 1A5FH 5C0EB 1U95B 4HIHB 3F5WB 5E8EB 2VLRE 4NHCH 5I74C 3UPAA 4NJAH 4Z7OF 2XFXB 1XH3A 1KACB 2AEIT 3WIIL 5ENWB 5HGBA 4A6YA 4IHOA 4YHYB 4KI5D 1LK2A 3JUZA 2R56H 2VDOH 3O4LE 2BXYA 3ARXA 2BJMH 3RVXD 1UM6H 3F7RA 3DGCR 4LBEA 1PFCA 4LHJB 4JQXC 1R5WA 3FKUS 3IJSA 1T83A 2EE9A 5HGBB 4K94C 2HT4D 4P2QD 4XP1H 5CSZB 2XN9A 4M5YL 3S35H 1WBYB 1NUDA 1I9EA 4DUVA 4F7MB 3V9FA 1AQDA 1RZFH 1AQKL 1ZT7B 1VENA 3UO1L 1UH4A 1UZ6E 4X9IA 2N56A 3K3QA 5K9OA 1JGVL 5IQ7H 3BO8B 1LO5B 4IOIA 4JLRA 1JTOA 4R90L 3RNKA 4MDJA 3IDYB 3LEXB 2XTLA 4RWYH 5M7QA 1AQDB 2CRMA 3O41B 1QBAA 2ZSWA 4OCRH 5GRJH 4LPTA 4Y5XC 4WDIB 4P9MH 1FN4A 3B2VL 3TFKA 2Y9RT 5K9OB 4KXZH 1G6VK 1PD6A 4YBHA 4XCFL 3QUXA 5F1OB 1OTUD 2YEZA 1UACL 1MFEL 2E6JA 4OLYH 4YR6A 4RDQF 4MDJB 1SBSH 3I3BA 1EERB 5EZJB 4OF7A 3FRPA 4GG6A 2GKIA 3BZEA 4MLSA 2ZJSH 1FN4B 3T4YA 3WL9B 2BNRA 4M8VA 2AABL 2LAAA 2E7LE 4XBGB 1TETH 3QUXB 3GKWL 2F53D 2YEZB 2VDML 3QYCA 4YR6B 1R0AH 1T2QH 4L8CA 1U8LA 4YHMH 4X4XB 5IBLC 4NN5B 4OM0L 4LLMB 1LGVA 2E7CA 1CGVA 3DRQB 1NAML 4KHTH 3AAZA 2EH7L 2WUCL 3ZTNH 3BSZH 4WY7L 4U1HA 5HDQL 3SN6N 3PWVB 4BSWA 4R2GB 4L8CB 4OAWB 1YMMA 2B1HL 2BNUA 4R4FH 1KEGH 3X3FH 2XQBL 3ZHDA 1JCKA 4LK4A 4EN3D 5FGBA 1WTGT 3CSYB 2HN7A 5F9WB 2VAAB 1K8IB 2HLAA 5C0CD 3MO1A 2DIBA 4NRZA 4LVHB 1SY6L 4XBPB 4QCIA 4PTTA 4BSWB 3I6LD 3GIZL 1FZJA 1OAUL 4JRYD 1GXEA 1OP5H 4XP9L 1T7VA 4IDLA 3NIFF 4LPWA 1QBBA 3GSQB 4O2CA 2HN7B 5KVFL 2HLAB 2FHBA 5E8NA 2DD8L 4NRZB 3VMNA 1GPOL 3K8MA 4PTTB 5AG8A 1IAIH 5IHBA 3LN5A 1FZJB 2YKLH 3E2HA 1BOGB 4PB0H 4LSSH 2B4CL 4H0HB 4PJ5E 3DJ9A 2X70A 1UM5H 4U7MA 2V17L 5FGCB 3MRBB 4KROD 1P4BL 4WGVB 4ODTL 3GSXA 5B8CC 4NT6A 3MLYL 3CLEL 3L1OL 1INQA 1HHGB 3DVNB 5KS9E 3CFJA 1MAKA 4NQEA 3GUTA 3E2HB 5E99L 3BKML 4P46C 5C0BB 4R4BA 4ZUWB 1YEHL 2CLVB 5FUOH 1MCWM 1IL1A 3T0AA 5HHMB 5ID1A 1JHTA 3ARFA 3P4LA 3ZE2E 5JMOC 2E7HA 4NT6B 3C9NB 1Q94A 1INQB 3MLXH 4JANB 3MRPB 3FAWA 4KVCL 3GUTB 4QRPA 3DMMA 1F58L 1OGTB 1LE5B 2OP4L 3QWRA 1V3KA 4R4BB 5MI0B 3UTSA 1IL1B 3H7BB 4JFDD 4U3HA 5EU3A 5D7IF 4LLWB 1MELA 3QNXA 5EU6D 4RMWA 1FZOA 1Q94B 2GCYA 1NUGA 4JFFB 5E6IA 3RKPA 1HQ4A 3MYZA 3NZHH 3WNKA 4ZSOE 2C9AA 4X9HA 3CLFL 2XZCH 5SV4A 3GMRB 3AMKA 3UTSB 1AI1H 3MMEA 5JO5A 3QHFH 4GLRI 4LQ1A 1M6OB 3EOBA 5D5MF 4JM2D 5KN5A 5DMKB 5DD3H 2F15A 5C0IB 1MHHB 2GCYB 5E6IB 4K3HA 1NGPL 2BVUA 1EO7A 4X9BA 4HKBA 1IGIL 4L4TA 4IMKC 4PGDB 3EFDH 3V0VB 4OCWH 3HZKB 1Y6NR 3OQ3B 4X0KA 5DVNA 2XIDA 5D1ZC 1Q0XH 4EXKA 1YYML 1Q9OA 3JZ7A 2BSSA 3EOBB 4L9LB 2DM4A 3TIEA 1UH3A 4KY1H 2P5WB 5I18L 4L8SA 3S37L 2XQYG 3BGFC 4L4TB 2PYEE 3ROLB 4N0FA 4X0KB 5E08L 1FNSH 2C26A 2QSVA 2VQ1A 4JRXD 4ZUUA 2CUMA 2DL9A 5ETUB 2CK0H 4K7PL 1Q9OB 1RJCA 3HC3H 3JV5A 2MQ3A 2LE9A 1MREH 3BN9D 2BSSB 4XAWH 2H2SC 3KPMA 3PP3H 1NCDH 2XWTB 1T1ZB 3V79C 1WT5C 4FFZH 4RA0C 3GI9L 4HIEA 1K2DB 1ZS8A 5HY9A 4O58L 1N4XH 4TQEH 5DLML 4L4VA 2VQ1B 4XC1H 4ZUUB 3CXDH 4X6FA 1FYTE 3MGTA 3UTPD 3CU7A 5C07B 4PG2C 2JCCE 1H0DB 2ADGB 5BW7C 3KPSD 2NXZC 4O5LH 4AEHH 5KSVB 4PRIA 5TDOB 5DD0L 3EDFA 4UB0H 3QEQE 4PLNC 4Z7WE 3VWJD 3LCYA 1A2YA 1P7KA 5HVWA 2EKSA 1D3CA 3BEWA 3OAUL 5D2LF 1T2XA 2B0SH 1NFIB 2UWEE 3HFML 4HXBL 4TVPH 3U6RA 4ERSH 5KVEL 2PW2A 4OKDA 3G04A 4XTRC 5IFAH 2BDNH 4FTVD 1P7KB 1MEXH 3T08A 4ZXBC 5E24E 1RZKL 2OTUB 3GRWA 1FDLL 1KJ3L 1N6QH 4RISL 3IGAA 4JFEB 4NDMA 4HK0A 4Y88A 3QDMB 4XCYA 4K9EH 2PW2B 3FQNB 4OTXH 1NLBL 3MR9A 3BYTA 3FOMA 3DSNA 5JOEA 1G0YR 4K8RD 4QTIL 5EU7C 4BJLA 4Y4HA 2W65A 2R39A 4LHUG 3FQTB 3UYPA 1CK0L 3IGAB 4NDMB 1WC7B 2Z8SA 4NRYB 4HGKC 4U0RC 1AD9B 3KXFA 3VFUB 1WAAE 5JNYA 3KS0H 4HWBL 4G6ML 5ECJE 3FOMB 3MBED 5L2JB 3RA7L 1RUKH 1BQHG 5FYKE 4P4KC 1LO2H 4FQQA 5LXGL 2W65B 3P30L 3HB3C 1JMZA 3T0EC 3KXFB 5JNYB 5EUOA 1G7IB 3KJ4B 2VXQL 3X11B 2FSEB 4R0LA 1J1PH 1FH5L 5J3HC 1MJUL 1YYLL 2ARJQ 5I1EL 4CVXA 4ZTOL 1A6UH 5J7CC 1IFHL 3BMVA 5HVFB 5IMLA 5BS0A 5EUOB 3EZJB 3H3PH 1T7XA 4RRPG 4X80L 2EYSA 4R0LB 3FFDA 1U8KA 2BVYA 5GS1C 4K3JL 4K55A 2Q20A 1C8PA 4CVXB 4FZ8H 3ZKMD 4MQTB 4G6FD 2H26B 4XCCL 4PJCA 3PDDA 4HV8B 3RZCD 3D9AL 1IGYB 1NMAH 3MA9L 1IAMA 3TVMD 3FFDB 4K9EC 1U8KB 4BFBD 2GT9B 4P2OA 4NQDE 3V4UH 4M7KL 1A7PL 2AV7B 1W0WB 4EUPA 4PJ7E 5F1SA 3IS0X 3U30B 4E41E 4PJCB 1I7TB 5IWLC 2HT2C 4FABH 3IU3B 3F7QA 5ABDE 4PDCE 3PDGA 1GGYA 1NANH 1Z9SA 2W60A 3ARPA 1ETZB 1FJ1B 3PQYD 1Z6JT 3F7VA 4CNIB 3LQZA 4EUPB 1X5FA 1DBMH 4WHTB 3INUH 2Z8VC 4HX1A 1E4XI 1S7SA 4Y4KC 2H9GB 4NPYB 2XNAA 1KPRA 4ZTPH 3NIGF 3U4BH 1RZJH 3U7WL 1DQQB 2VKXA 3QG7L 2H45A 4JQXA 1RJYB 2N7BA 2HTLD 3C6SB 3SO3C 3BPOB 1A9EA 4MCYB 1CICC 4E9LA 5F70A 4PRPB 4F8QA 1B90A 3LS5H 5EO9A 1DBBL 2VDNL 3ZYIA 4UOJA 1FYHB 1CXFA 4OFVA 5GRVK 5JW3H 5E4EC 15C8H 2VLKE 3N1FC 5A40E 4YXLL 1ITBB 5CCKL 3GJFB 4YHLH 3F8UB 4GS7C 5J8OA 3VXUE 3ARRA 1RK0B 4U2ZA 2CLZB 1LP9B 5HHQA 1O7VA 5EO9B 3S5LG 1F4YL 3SDCD 4M7LH 1AGCA 2D4DA 1JF6A 4Y5XA 3TNNB 1JFQH 3CNKA 1T5XB 1HK6A 1B0RA 1JGUH 4KKNA 2FEEI 1JRHL 2YD3A 2G9HB 1AHWC 1S7TB 2RIKA 5BCAA 4Z95L 4U1KB 3IFNL 3CXHK 2DI9A 3A6CL 4NJ9H 4L9DA 1T89C 3UTQB 2HFGL 2WWMD 5ITBH 3GMNA 2YD6A 3SGDH 2NY7L 2Y06L 5HHVL 2JIXD 1N3NB 3ZO0A 1WWWX 3GM0A 4QRRE 1BJ1H 3I02A 2EDWA 4XNMA 1OY3B 5CILL 2E6QA 3QG6A 4JO1H 4NBYB 1OVZA 1RZJC 4LPXA 1CFSA 2WK2A 1PSKL 3QUYD 5IGXH 3MJ9L 1I75A 3MJ7B 3QO1B 2OZ4L 5HPMB 4EQ2A 2A73A 4GRWB 1B88A 2ZCLH 2CGRL 1HXMA 1G7MB 1X5GA 4OF6A 1FVCB 1YY8A 2EECA 4OCNC 2NY6C 4FS0A 4J3XA 5HSFA 2VXUL 1KCUH 3VJ6A 3R06B 1OHQA 2A73B 4TTDD 5DGRA 4GG6F 1HH9A 4M48L 2UY7A 4WWKD 1FBIL 3NH7H 1YY8B 1MSPA 3HC4H 4I4WA 5EBMA 4HGMA 3WFHA 3RL1A 5F9JA 3IU4H 2VC2L 3RVVC 1B9ZA 3WYRA 3VJ6B 5GGRA 5B4MC 4KK9D 3NGBC 2BNQA 3BUYA 4LU5L 4K23H 1OM3H 2IPTL 4I4WB 5EBMB 5B8CA 3O2WL 1FNLA 4GRLD 4DKFL 3WFHB 5B3JE 1LHZA 5HYSG 4UDTB 2VLJA 1IEAB 5ITFB 3W9DA 4X5XB 4DAGH 3IDIB 4P46A 3CSBA 5E8DL 3BIAX 1KOAA 5EU4A 5H37H 3W11C 2EIZB 2EEAA 5BVJB 3NOIA 4MVBD 1IM9D 3WFDH 3S8WA 3A67H 1DFBH 1NCWL 3TN0B 4JGJA 1QRND 1LE9B 4N0YH 3OX8A 1OTSD 3OKMA 3TEUA 2DM3A 1E4WL 3VH8G 3MV9E 5HHOE 4N5EC 3W9DB 1T7YA 2GITA 2DLFL 5A16A 5FV1L 3W9EB 4Z78B 5CJOL 4PGCA 3MOBH 1KB5L 2YPKB 3D0VA 3RBGA 3WIHH 3OX8B 1EK3A 3VW3H 1FRGL 3AS3A 3AROA 5GGVY 3Q0HA 5A16B 2J8UA 2C4XA 1DCLA 4YK4C 1UFUA 2VLMD 3SJVD 3ZT7A 3EYFA 2HJFB 4NQXB 4YHIA 1EH9A 2Y4SA 4Q74A 5KAQG 3ZE1F 5BOZG 5MEOA 1N2RA 5ALCH 3HG1E 4IMKA 4X6BA 5F7NC 1BQLL 2J8UB 3LEVL 3QI9B 5D1ZA 1A3RH 3OKYA 4I1NB 4ZFOA 3P0VL 2O5YH 4XMKH 3OAYH 3OKNA 3PHOA 4OCMC 2JF1A 1C7TA 2EDRA 3FO2A 4LAJH 3WD5H 3GMPB 4ELKA 5HXMA 1JVKA 5MEOB 1BD2D 4PJXA 1N2RB 5HGGS 3QIBD 3CAFA 4QHNB 1RIVH 3MOQA 4PJGE 2QADC 5F6IB 3FAXA 3AU1B 1WBZB 1GH7A 2ARJB 1PZ5A 4IDJL 3OKNB 4KKCD 4ZS6D 5DUMH 4ELKB 1C16B 1WT5A 4NQUA 3BOVA 4URTB 1IAOB 5IV2B 1RIHH 3RIFF 4XVTH 3OKDB 3EO1B 5A2FA 4Z0BH 4F37F 4N8CL 3NACL 1QFWH 3UTZB 4PG2A 1DLFH 4KKBC 5BW7A 3RDTC 3EOYG 3S6CA 2AK4D 2ADFL 1JPSL 5DWUH 4MB5A 1UENA 1Q9LB 3UMTA 4AG4H 5ADPH 2X9YA 1KENH 5GS2D 4ETQA 5EDXA 1MF2L 4P3WA 4WUUA 4OF8A 4W4OC 2X7LA 4ZUVA 2BHZA 3RL2A 4PJHA 5DC0A 5JZ7C 4LCYA 5FEBA 4ZXBA 1RK1B 1H3VA 4NQCA 3QHTC 4I3RL 1GGCL 3SKMA 2JJSC 2UZIH 4HQQL 3QIUD 1S9VA 4WUUB 2ID5A 5CZXC 2BSTA 5T3ZE 1ZVYA 3HAEG 1AGEB 1D9KB 1KIUA 4PJHB 1MI5B 1TMCA 1CBVL 1KLFA 5DUBB 4ZXBB 1QR1A 4NQCB 1BF8A 4ISVA 4PRAB 5GGSY 4QYOB 2XWBA 2NY3D 3NFSL 4OLXL 3FQXA 4J7RA 1YUHB 3ARBB 4ACPA 2BSTB 2PF6A 1HHIB 3LKPB 2HH0L 4NQVA 1YQVH 4TUKL 2G75A 5GRVL 4P4KA 3Q6FA 1UWXH 4PP2B 2MQ0A 4KHXL 4NQTA 1LD9A 3T0EA 2XT1B 4R96B 3FQXB 2ZZUT 4NO5A 3FB5B 3PGFL 1RUML 4X6DB 3VFWA 4U1IA 43CAA 2W0KA 3QQ4A 3LPFA 3P40A 4YHKL 1EJOH 3LKNA 1UVQA 2DTML 4Z7VB 5M94B 4Z18A 4JB9L 5C6TH 5SWSE 3NA9L 4DVBB 5T1KD 3MV8E 3T0EB 4UTBL 1TTGA 3W5NA 5DRNA 2AI0H 1I1AB 43CAB 3QQ4B 3C5JA 3D2UA 4M62L 3ULUD 1BX2A 4OZHE 4OZIE 1BWMA 1SYVB 4H88L 4NKDA 1LMKA 2HVJB 5GS1A 4X5WA 2AJ3B 4NZDA 4JO2H 4KTEL 2X4SA 2ZG2A 5KVGH 1SEQL 2XQYK 2YD9A 4PRHA 1NC4B 4HKZA 3B9EA 1CFVH 4P5MA 2B2XH 2V5RA 5JHLL 3TA3B 4Q0XH 5C08E 4MXQD 3DO7A 1YNKL 3M45A 3V5DB 5GIRA 1QLRA 3MODL 5GS1B 2F54E 3MJ8B 4K71C 2BXZA 2O5XL 2X4SB 1EEZB 5AYQA 3PDOA 4IIQC 3SOBH 4JO3L 3X12B 3LVEA 3MV7E 5FOBA 1VGKA 4QXGL 3K81A 5EUOF 3T8XA 5IWLA 3C09C 3TF7C 3P9WB 5EULV 5FOJA 4C55A 4UV4L 5GIRB 1QLRB 4ZNCD 5I73B 5LG1A 2WZPD 1BIIA 2FJGA 1LEIB 2NY4D 3MRIA 5T5FH 5DHYB 4XP6H 3ARVA 2CMRH 4Y4KA 4RFOH 4AQ1B 3L3DB 1U8MA 1XF4B 2IGFH 5F72S 3BH9A 1A3LL 3L7EA 4GMTL 4HZLB 4PJDB 1CVSC 3NCFB 2A1WH 3P9LA 3D39E 4XC3L 5C0GB 1CICA 4EN3C 2BMKB 4PJCF 4L8BA 4Y4KB 2ICWJ 2VZUA 1A7NL 1U8MB 3D0LA 4IRSD 2IQ9L 4GG8B 3L7EB 5FUCC 3AC0A 1BF2A 4BQCA 2VWEC 4QEGA 1SJXA 4XPHL 1A7RL 1MJ7H 4WI8A 3M8OL 1PG7L 5IF0B 1OP3H 4XWGL 1KPUA 1FORL 1KCVL 2DMCA 1FLRH 3EO9H 1K4CB 1JN6B 4L8BB 5IHUL 4HBCH 1U6AH 5JXAL 5ISZD 3D0LB 2FGZA 3REVA 4KVNH 2GTZB 2G60H 4GS7B 1KPUB 3KPTA 4JRXE 1P69B 5KW9H 1JZ5A 4KROC 1AHWA 2LTQB 3VXME 4J3WA 1T89A 5KZCB 4CADA 5TF0A 5EIIB 3U7YH 3MJGX 4YXKH 1ACYH 2ZOLA 4YHZL 5JLZA 5DJYA 3VI3E 2F58H 1H3UA 4R97B 3DIFA 1AR1D 3KPSE 4HS3A 3BXNB 1X5YA 5C86A 2V7NB 5GRWA 2VE6B 4CBPA 1AP2A 5DJ0B 4PLJC 4OFYD 1YY9D 3VH8B 4FQIH 1N26A 4Y2OA 3K0WA 3HE7B 5I1DA 5DJYB 1NGZA 3CFEA 5J57B 4NZRL 1UEMA 3VRJB 2D9QB 3TWCH 4DKAA 1HOCB 4G9FE 2E9IA 1N5AA 4TOYL 2D7OA 5C09D 3E6HA 3EO0A 1F02I 3FQRB 1EVUA 1G7LA 4H26B 4OM1L 1L7IH 2W91A 1XGPA 4RGNC 1NGZB 5FYJL 1EEQA 4M6NH 4FQXB 2EDQA 5KTEL 2HYMA 2XZQH 3FN3A 4P2RA 3P11H 1N5AB 4DWHA 3ZE0F 5CSGA 5BV7L 5T5NF 4N8VA 3DECA 5IHLB 4JY6B 3TBYA 1S78C 1G7LB 4DKEH 5D2NE 4DOHB 1QPPA 2C3XA 1XGPB 1PAMA 3ULVL 3C8KB 3WS3A 1U2HA 3ARZA 4MAYB 4Y8AA 5LBSL 3OJDB 3PWPA 4K8RH 3T2OA 4G9DB 1NC2A 4PV9B 4N90D 3TBYB 1A0QH 4HK3N 2WIIA 1NCNA 3BQUB 5FAAA 5I19L 4M4RA 4WI7A 4R3SB 2NZ9D 1E28B 4LSQH 3D3VA 3DURB 3WS3B 1KN2L 3BN9C 2V2TA 4YUEH 4ZFFB 4LLVA 1HIMH 4OLUL 3C5SA 1NC2B 3LS4L 4ODWB 2EH8H 2PTVA 4WO4D 5CEXB 5FK9A 4XCEB 2XZAH 3FO0L 3LY6A 5C0ND 4GAYA 2NZIA 5IK3B 4N5EA 3KWWA 4I2XB 1ZTXL 1CDBA 4ZS7L 4MLIA 3C5SB 5HDLA 2DQIH 5I9QC 4OD3L 3LRSA 4BSVA 3B9AA 4LGPB 5FB8A 3VA6A 5MENB 3GNML 5FF6A 3U0TB 1CGSH 1V7NH 3EW3B 4RWHA 4CW1A 2R1XA 3KWWB 5GGQL 5GHWH 5D8JH 1MVUA 1C08A 3IJHA 2VSDA 3ZTJH 4Z5RA 5CJXC 4J3UA 2J6EH 1ZHNA 3D18A 4HLZH 3ARGB 4PUBL 5F7DA 5J1AA 1QSEB 4MXVF 1C08B 5EB9A 5SX5K 2F19H 4H1LG 3GK8H 3S88H 3H2WA 1KFAL 1YN7B 1ZHNB 2Y5TA 4FMFA 2JLLA 2OL3H 3PWUA 3ZHKA 3ESUF 4BFGA 4K8RC 3EDJA 3NFPB 3VXSD 1SMAA 4CMMA 2DLEA 4UINL 4V1DB 5CHNA 3KYKH 3P77B 4F7TB 1S5IL 3DLQR 4HJGA 2CIKA 5E6ZA 3OR7B 1OF2A 4ZO7A 3DVGA 3MUHL 5JIHA 3EYSH 1ADQH 3MBEC 5K9KA 3OF6A 3KYNA 2NY1B 2VH5H 4LRNH 5EZOH 1BEYL 1LEKA 2VISA 1JNLH 4CMMB 5ESAA 2PETA 2QADB 3HRZB 1J5OL 1YEFL 2J8UF 1EGJL 1XGYH 2ICES 3SDYL 3N50A 5L2KA 3B9KB 4HPYH 4PJ9B 3QUML 4OLVH 2D31B 4FNLL 1IBGH 1OF2B 1UG9A 4OCRL 3RDTA 1UA6H 1J0YA 1J1XL 5HI5D 4YHPB 1EHXA 3WEXB 3QAZB 3KYNB 4XXDB 3HE6D 4LEOA 5C0FA 3A0OA 2ZKHH 3TO4D 3L5XH 4TRPL 5ESAB 3WIHA 3ZSTA 2GAZB 2XKNA 5TFSH 4OCYL 2IPUG 3QR2A 1PEZA 2ENSA 4MNQA 1PKQE 5J11C 4W4OA 4PJXF 4LEOB 3BKCH 5GGTH 3EYOB 2VR5A 4ONGH 1A14H 2BOCA 4KTYA 4Q9CA 2WWKO 3X13A 3IFLH 4Y8DC 3WNLA 1V3LA 5HGAA 4GAGH 5BZWA 3GBMH 3ZKMC 2X1OA 2JJSA 4JPKL 5ANMB 5DD1L 1J10A 3RZCC 2IFGA 4LLUA 5EO0A 3PGDA 1MFBL 3BPNC 3C2SA 2NX5D 3FO1A 5GSVB 32C2A 5IEKA 1HHHA 5DJXB 1EMTL 2F9BT 1YDPA 1RUQL 4RFEA 4O9HH 5BZWB 2AEWA 1YEEL 2EC9U 5J0BA 3WUWA 2PXYD 3WMSA 4ORGA 4RAVB 3NCBB 4PTUB 3RU8L 2Z35A 3B5HA 3QWQB 5EO0B 3PGDB 2BVEA 5CGMA 2YK1H 2L0DA 3QDGB 32C2B 5IEKB 4LOUD 1VFAA 4U1SA 1HZHL 4L3EA 4RFEB 3HMWH 1JJUA 1HNGA 4D3CL 3WUWB 2BFVH 1JPGA 4ORGB 1H5BB 3CC5A 2Z31D 1FQ9C 3MLWL 3MXWL 3KYOA 4E42B 5IVXE 3HRPA 3QBTB 4LP5A 2NY0C 4LVEA 4U1SB 4L3EB 5K9QG 2V9TA 2HTLC 5FYLL 2UVFA 1UQSA 4Y19A 4JDZA 4PYHA 1G6RH 3UYRL 4OCLC 2IALA 3I2CL 3CC5B 4UOW0 3K2UL 3LDBB 5EORH 1AXSA 1C5DA 3KYOB 3NTCH 3KPQB 4BQ9A 3OPZH 1P2CB 4ODXA 3BKJH 3BEVB 5KJRH 1YZZA 1MLCB 1UQSB 3WXVL 2IANA 3MNVA 3NIDF 1CQKA 4HS6B 1OOAA 1CIDA 2W07A 4XZUA 3M17B 3PL6C 1AXSB 1I9IL 4WGWB 3GO1L 2A0LD 4G43A 5CEZL 2R23B 4OI8A 1N5YH 1NAKL 5ADOH 4DEPB 3U46A 5KSBA 4Y1AE 3V7AE 4MS8C 1XCQA 3CFKA 2H8PA 5AWNH 4LAQL 5L6YL 4HAGA 3MNVB 4IIQA 3E3QE 2AJYL 5E9DE 4MCZA 4Z0XA 2E7LC 1AD0A 5J12C 1WVZA 1U91A 4MNGA 3TF7A 3NBNA 3BRDA 2WWMC 2X89D 3F7PC 3LIZH 2P5ED 5HI4D 3MUJA 5FXCH 5C0AE 4EBQH 4B53A 5D1XD 3CFKB 4NP4H 2F53A 4K71B 4U1LA 4CGTA 3L3KA 4FZEH 4WIQA 1YEJL 4OFDA 3T2NH 2ZSVB 4OD1H 3QXTA 5FHBL 4Z0XB 2VDLL 1AD0B 3C09B 3UROR 3BKYH 4OCSL 3MNWA 1SJEB 3TBVA 1XCTB 1CDUA 4ZFZA 4U1LB 2AXJA 4K2UH 3QUYC 4OLZH 5SWZA 2DKMA 3SE9H 2J5LB 4OD2B 5EWIL 1KIRA 4EN3A 1NDMA 3CMOH 5E5MA 4KK5D 4RMUA 3MCKB 4OLWL 3KPRE 4ZAKD 3CX5J 5DXWA 1CWVA 5C0CA 3S34L 2YD7A 3TYGL 4QRTA 1ZLSH 2YPLB 3LHPH 3O6LL 2YC1A 4JRYA 4AEEA 5SWZB 2ICWA 2QQKL 2DQHL 1KIRB 2FATL 4R4NC 3I50L 4LSPH 5CD3A 4NKIH 4PJIA 5EOTA 1Q9KB 5C6WH 1UH2A 2Q1EA 1J05B 2H32H 1ZLUH 3MC0A 1JL8A 3HZYA 4MNHA 2FEDC 3GEWB 3BP5B 3HI5H 5C0JB 1S7UA 2ZUUA 3VXPA 1KCLA 1MCOL 5FO9A 2RR3A 2ICWB 3Q1SL 5E2TH 3MRRA 1U93B 4KK9C 4G8EA 4PJIB 3BWAB 1QFUH 1A47A 3C08L 3QFJB 2BY1A 3HUJA 4QTHB 4GRLC 1S7UB 3PV7A 3VXPB 5FO9B 2D7QA 1S7RA 3HHRB 1YMHA 1BGXL 4AEIH 1ES0A 3EDEA 3MRRB 5I8OL 4HT1L 3G5ZB 5CKAA 4XMLH 3H9HB 4G8EB 2NYYD 4S2SB 8CGTA 5INCB 1BZQK 2FCBA 4KMQA 4ZD3L 1LQVA 3V5KA 2W9DL 4N1EA 1ES0B 3GHBH 2I60H 2UZXB 1IE5A 4JFHD 1DVFC 2GHWB 1ZLVK 1VSCA 2CDGA 2XTJD 1AY1H 5EU6A 1NCCL 2BSRA 4YGAB 1MCRA 1IGFL 1OTTC 1Z2KA 5DUPL 1GHFL 4JCMA 5CEYB 1E6JL 3HI1A 3OKLA 2E7BA 4KUCF 4OIIL 5TE7H 3RIAK 3DSFL 4CVZB 2IQAB 4TSAH 3F65A 2VXVH 1LO4L 1MJ8H 1I8LC 3QWOA 2BSRB 4NN7C 1AO7E 5DJ6A 1FL6B 4RGNB 5KSUB 2R0WH 1CLOL 2VDPH 2VZVA 3HI1B 4NCC2 2FH6A 5GJSH 2Y7QB 6FABH 3HNTH 3EDDA 4CN4A 5HYJD 1INDL 3B2UD 1L0QA 3QULA 2XWJA 1CFTB 5GRUH 1TJGL 1Z5LB 3QIBC 1QNZL 2B5IC 3WN5B 2IAMB 3VD9A 5IBTL 3WDHA 2Q87A 1FG2A 5EC2A 3L5JA 5FYKH 3KJ6H 1VADB 2X9WA 3MOAL 3GSUA 2CO7B 2QSTA 1U8HA 3O6FB 3K4DA 1S9YB 4K7PY 4X7TA 5LVEA 3W0WE 4OB5L 2ERJB 3PNWA 3LKOA 1JGLL 3KLAA 1IM3A 4QXWA 4PD4K 1FAIH 3LV3A 2AKRA 4Z7NF 3GSUB 2WM0A 4X7SL 2HKFH 3GIVA 5FO8B 2V7HA 5I75B 4JZJC 2Z4QB 1V8HA 1V05A 1J0JA 1PBYA 2P24A 3KLAB 5HJ3B 2C3GA 1IM3B 4Y16D 3FZUC 3QPQD 2VQTA 4HUUB 2BERA 1NFDA 5F7UA 4TTGA 4OLEA 5CJXA 5I9QB 5JR1H 4NHUB 1IC1A 3IAQA 5F8QC 4XWOC 3TCLB 1S9WA 4HH9A 4EDWL 4FTVA 1FFOB 2DLIA 1JPFA 3VFRB 1JPTH 2HJLA 3JTSB 4HKXA 5I1HH 1JZ6A 3PHQA 5T1DH 1KCSL 1IGJB 4F57H 3UTTD 1GC1C 3QIUC 2IFFL 5EG6C 1IVLA 3BUTA 3DUSA 2R1YA 3TBTA 3O3DB 5GS0L 4G7YL 5KSAC 2HJLB 1FE8L 3IFOB 2VXTL 3PHQB 2NY3C 2ZUQB 3EYQD 4FXKA 3GDBA 1OW0C 1K4DB 2Z8RA 1F2XK 1R3LB 3BDXA 3BT2L 1H3TA 3C6LD 5IESL 4EOWL 3DUSB 4FN0A 1IQWL 2R1YB 1MRFL 1UEYA 3MBEA 1KJVA 4JAMA 5FHAH 5KANI 4Z7UB 4PIRF 5IKCA 3UP1A 4MB3A 2FGWL 2VL5A 1WWCA 3RIFK 1F6FB 4X6CB 4F37K 4XNZC 4I77H 4BZ1L 2OJEA 4MQSB 1LEGB 1BAFL 5DTFB 4AENA 3LD8C 3QSKB 3ZSSA 1HDMA 4JAMB 3BFOA 1KJVB 3IS1X 5IW6B 1CDCA 1NBVL 4FP8L 1Z9OA 2GFBA 4LLYB 2F5AH 3LQAL 4JHWH 4WI2A 1ZT4A 1UYWL 3O11A 3CFBA 5MERA 3FT2A 3IDUA 5AG9A 5FYJE 4YHNB 2ATKA 5EN2A 2DWEB 4MHHI 4AENB 1A4JA 2VN7A 3U7AA 1W72H 5DC9B 5A3IC 5HYIA 4U6TA 2J6EA 3VWKB 2GFBB 3VFMB 3GSRA 1IKNC 3P0YL 2EDDA 2DQEL 4FQJH 2X1WL 3FT2B 4JG0H 1F90H 5DDHA 4I0PB 5IB3A 3RVTD 2ATKB 3ULVE 5EN2B 4NWUL 3TT3L 3NABH 3D25A 1A4JB 1ORSA 3RZCA 1F8TH 1INEH 3FMGH 5F6HI 4MXQC 4NN6B 3MRLB 2P44B 5F71A 1IAIM 1DQDH 1T0MB 3GZKA 4KRPC 2MSPA 8FABB 4S1DD 5D6CA 4HF5H 4S11A 2OL3A 3IJYB 3MROA 4ONHB 2DQTL 2WQ8A 2DBJA 4MQ7A 5H94B 4IOFC 1WQVT 4XBEH 1CQYA 5GPRA 1DBKL 3QEUA 2YXMA 1R3JA 1GAFL 5IMOA 2R0KH 1Y18A 3QCUL 1EFXB 1A6WL 1IKFL 5E7BA 1MFAH 4WUKL 3PQYA 1ADQA 3MROB 5CJQH 4QOKE 2X10A 2PR4H 4LVOC 2VLRB 5EA0H 4RFNC 4YFDB 3TFKD 1MRCL 3BDYL 3JWDH 3TJEH 5B38G 3QUXD 4ZMAT 5IMOB 1ZWIA 5I8EA 1HKLL 5JDJA 3MRKA 2AJVL 1DQML 4K3GA 4NUGH 4JZNB 4V2CB 3O4LB 1MIML 1YECL 2HMID 4PJEA 5KOMC 3UBXG 1KB9K 5DURB 3G6JA 4A6YL 1I7RB 3AS0A 3VFGH 1XF3A 4BH8A 1RU9H 1ZWIB 4R2GD 5I8EB 2RHEA 2O93L 4HIIA 4X99A 2NY0B 1FNHA 1E27A 2YD5A 4HC1H 1UXSA 1A1MA 2A2QT 3S7GA 2E5EA 2EO1A 4CDHA 4F7CA 3PL6A 2A6JA 4V3EB 3TBWB 1GGTA 5HVHC 1EO8L 2XA8L 3BAEL 4YDLC 2IMNA 2IG2H 1BVLB 4I48A 4DTGL 4MS8A 1E27B 3WKNA 5B39B 4E0RA 2FL5A 4F7CB 3PL6B 1JWSA 5B22A 2DDQL 5CP7B 4N1HB 3OKEA 4XP5L 3WIIH 2E7LA 1DEEA 5DQ9B 4YZFF 2Y6SD 3GSNL 5J13C 4KRMB 1PYWB 1QKZL 2FWOB 3RTQC 1T7ZA 1TZHA 1FCGA 3AS1A 4KV5F 5FV2A 1JWSB 4TNVF 3VXQB 3JXAA 5J12B 3GGWA 4YO0B 2BVQA 4DFHA 2MKWA 2IPUK 3JWDC 4M5YH 4QRQA 2NXYC 5DF0A 4LCCC 5C0BD 3ZDYE 1JF1A 5HHNA 1TZHB 4BH7A 1SEBA 4F2MA 1WGOA 3IXAB 3GMOA 3QUYA 4NZTL 5HHMD 1R3KA 3DXAE 1AQKH 1NJ9A 3P4MA 1ZGLP 2XY2A 3UO1H 5FO7A 1JGVH 1G6RA 1ZE3C 5AUMA 1R24A 3L7FA 4JG1L 5IHZB 4MJ6B 3OXRB 2BVQB 1I1YA 1MCQA 3WJLC 5ID0B 3K1DA 1HHJB 4R90H 3THML 3KLHC 5HHNB 1JUFA 5DJAB 5FDWB 4BH7B 3WE6B 4M93B 5I8KL 3P4MB 1IAKA 1UXWB 3B2VH 5C9JA 3RWEB 2XZZA 1CGTA 2MJWA 4U0QB 4Z7OE 1R24B 4JFFD 1FCCA 4NZUL 4UQ3A 4XCFH 5F1KC 1I1YB 1UACH 1MFEH 2J7LA 4Y5VB 5K33A 2MPAL 1ED3A 3QWRD 3UTSD 4PJ5A 2FIRT 5TE4L 1RULL 1IAKB 4NNXB 1C12B 4PJAA 2AABH 2J88L 1N8ZB 5E6ID 1QSFA 3GKWH