4XXDB

Crystal structure of mid-region amyloid beta capture by solanezumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
206
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFSRYSMSWVRQAPGKGLELVAQINSVGSSTYYPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCASGDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light Chain
publication title Molecular basis for mid-region amyloid-beta capture by leading Alzheimer's disease immunotherapies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 206
sequence length 211
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxdB01
5AZEL 2VXUL 3F7QA 3DGGB 1XF2A 3RDTD 3VGAB 1QTYT 4U31A 2VR9A 2MJWA 3PWJB 5JIIA 3V79C 3JTTB 3DURA 5I1CL 4OCWH 5HI3C 3BIBX 1LP9E 4FFZL 4O9HH 1UA6L 4MJ6B 4OLXL 4BSWA 4XP9L 4MQ7A 3NAAL 5EWIL 1UA6H 4OLXH 5HYQB 4DUXA 3NAAH 2GFBA 3RTQD 3DLQR 4CBPA 2APWA 2IBBA 4OI9A 3GGWB 1HEZA 5DD5H 4ORGA 4S0TD 5IMMB 3QNYB 1DBAL 1VPOL 2Z31C 1R3HA 5TQ2L 2V2WA 4U6TA 3P9LA 5TQ2H 1A2YB 9CGTA 3OKNB 4LLYA 1CD1B 3VXMA 2HAZA 1ZLUH 3T0AA 4K2UH 1KN2L 3L3DB 1HQRA 1Q0YL 1HCVA 2QHLA 3G6AA 1OAYL 2WLZA 4HV8A 4V1DD 1BIIB 3VMNA 5D5MB 1WWBX 4EJ1C 5IHUL 4RZCB 1U3YA 1R5VB 1EO8H 4QXUH 5EZLA 3DV4B 3B9VA 4MA1C 1HSAA 4MAYB 2WNGA 4QGTA 4WWKC 3VXTB 2EC9U 4PPTA 4ODSH 3VFTB 4FQHB 3TH2T 4WW2C 2XT1B 5E94B 2J5LC 2XZAL 2ICEA 3U4BH 2XZQL 4LEXL 5I71C 2UWEB 4ZUSA 1KNOA 3TBSA 4X99B 3QUYB 5FYJE 1Q8MA 1FC1A 2F8OA 3OJVC 4V2BA 3T4AA 3KXFA 1NBVL 2X4QA 4PRBA 3MRHB 1NBQA 1MIEH 3GRWL 3DTXB 5B4MC 1P7HL 2GAZA 3DX8B 1F4WL 3GRWH 3RUGF 4FMFA 5GS0H 4FTVE 4RQQB 4YHYC 4KRPC 3ZYOA 5J6HA 1HXYA 1GC1L 2OXGA 3L7EB 1BQLL 1RULL 2F19H 1BM3H 3R1GL 3S8WA 2QSVA 5T3ZD 4O2EB 2FYYB 3M17B 2DBLH 1EO7A 1MCJA 3EYVA 2ZOLB 4WI6A 2Q7NA 4N0YH 1S5HB 3I75B 2EDNA 1U8PA 4MHHI 3LKNA 1I7RB 4PJEF 3UPAA 3RL1A 1NAKL 4PJAA 5T1MA 2H32B 5EU5B 2GCYA 1ND0B 4XWGH 5J3HD 4L4VB 3MRJA 1AGEB 3DRTB 5EU7E 3P9MA 4P0DA 1EEZA 3UAJC 4XZUB 1RVFL 2CDFA 4IJ3B 5FK9A 4YHIA 2HFGL 2XIDA 4JKLA 3CJJA 1WBXA 3LQAL 1QBLL 2O5YL 3PWPD 2F54B 1GAFH 3JWOH 4PRHD 2I9TA 5IF0B 1KCVH 3BPOB 1CZ8H 1CGUA 4N0RA 1A6PA 2WP3T 5D8JL 3RWHB 4XGZB 5LBSL 1H3XA 3IB4A 3GHEH 3UTPE 3QCUL 2LU3A 2VDQH 4DZBB 5IIEA 4HK0A 3HZYA 2HVKA 4PJXA 5B38G 1W8OA 4POZC 4LNVA 4ZXBD 4YHPB 2WWMC 2GJ6B 4CDHA 1DLFL 4ONFL 5IBLD 2UV3A 3HC0A 4LF3A 1DLFH 3SKMB 5TE4L 1MCDA 4HD9A 3BN3B 4NGHH 3DIFB 2FWOA 3GSUA 3QDGD 2RCSH 4TYUA 3LKSB 3VU2A 3CDFA 2ZUWA 3QDJE 4PJ5E 5BS0B 4JKWA 2CIKA 3AS0A 4RA0C 1J87A 1CT8B 4TTDD 5C0EB 1LGVA 1OAKL 4YXKH 5LVEA 2EKSB 1NGPL 4OZGE 1NSNL 2AJ3A 1FFPB 3ULVL 4NFDA 3SE4A 1SEQL 2DKMA 4WUUE 4Z78B 1CBVL 3WJJA 4WY7H 5TE6H 4QT5B 3FMGL 3TPUA 3QRGL 3ARBA 1L7TH 4IIQC 4NC0B 5F7EH 1S7UB 1I7ZB 4RAVB 1IEAB 3QIUD 3NCJL 1RD6A 4PRPE 1BZ9A 1QFPA 5FO9B 1ZHKA 1SQ2N 3NCJH 1B0GA 4JFED 1NJ9A 3MYJA 3C6SB 1A47A 1IGTB 4Z5RB 1G7LB 3BZEA 1ZHBB 2BNRD 2CQVA 3BFOA 4PJDF 3CFCH 5DMKB 2YN3A 4GW4B 2P44B 1P84J 2AQ1A 5GGVH 5KSBB 4K9EL 1ZHLA 1QR4A 3H0TB 3LIZL 3WS6A 4F80A 3O3UN 4K9EH 4OV5A 4I3GA 1DJSA 4GAJH 4O2FA 5FCSH 3O9WB 4HUXA 5GPRA 3LEYL 3TJHC 1K8DA 1RZ8A 1NBYB 2BJMH 2Q6WA 3FO2B 3UTSE 2DIJA 3EBAA 1S9YB 3KJ6L 3QNXA 4NQXA 4ZAKD 4KK6C 2H32H 3SY0B 2ZNWA 5CJ8A 1DTUA 1P2CA 1XR9B 1YEFL 2K3TA 3OG6B 4ISVB 5HYFA 3QEUA 1LK2A 3ARGA 1ZV5A 4J3TA 3H9SE 4KROB 5JUEH 3BGAA 3JWDH 5M7QA 4YGVA 2MHAA 2X1WL 1Z0NA 2VDLL 4KMLB 4HC1H 4UIKH 2X2YA 4MXWH 1W2KT 3SCMA 1EJ6A 1YYML 5D1XB 1CF8L 2FIKB 3SGEH 3SEPA 2V5TA 4WNQB 1PAMA 5HYJE 4ZD3H 4HG4J 5GGTA 3U7WL 1NEZB 4GFTB 3BI9X 1UGNA 1BZQK 3FFDB 1JCKA 1IC1A 1I8MA 1KTDB 3EHBD 4P57B 4X98B 5EFIA 2NY6C 1D5MA 4IOFD 4PJBB 3VFPB 1SBSL 3MV9A 5IBUB 1CU4H 1SBSH 3N0PB 1FLTX 2CUMA 1ZT7B 2GT9B 3HG1E 5HYIA 3PWUB 3P9WB 4F58L 5AD0B 2ZG1A 1OP5K 4NCC1 1P5UA 5ETUA 4NDMA 2CKBA 4U1GC 3BKML 4JLRB 3BPNC 5A2KH 1KUMA 1GYAA 4PD4K 3VFOB 2BSSB 1OAXH 1ZS8B 4J4PA 4O4YL 3D39E 1AFVH 2EDLA 5I1AB 2C3VB 2PUQT 4Z7OF 1JZ3A 3GSOB 3MRNB 4JFYB 2ENYA 3QWOA 3DARA 5MENA 2C7UA 3H2WA 3TIEA 1FO0H 2X09A 4I2XA 1RJLA 1TCRA 5DVKA 2BOCA 4NHCH 1NFKA 4JG0L 2JE8A 5DJXB 3PL6A 5E9DE 1MJ7H 1FPTH 1NGZA 2DQFA 1D5BB 2OK0L 4LCWE 4RIRB 1ZTXH 4TVPH 1X4YA 1O7SA 5I1JL 1ACYL 2V9RA 3GSVA 4E42B 4A2MA 3QAZB 2NX5B 2P5WD 4WEMB 1DQQA 4Y5YC 4AEHL 1T04A 1SM3L 3S36L 1NCWH 4U7KA 2FBOJ 3V5HB 3IU4L 3TV3H 4AIZB 3QXDB 2SEBB 4X6CF 4S1QH 5FGBC 4HS8H 4KY1H 4Z7VA 5DI8A 4F7CB 1AQDA 1P4IH 3HB3C 4JAMB 4CVXA 2W9EH 4N8PA 4DK3A 3K2UL 2HJFB 1OP3K 3V4UH 4NO3A 1L7IH 4YFLI 3U36A 2R2HB 1I9RH 5D6DA 4S10A 3Q6FA 1AHWC 3VA2C 2PYEA 3DUHA 5ICYA 3TEUA 5ITFB 3IFOB 1LNUB 5EU6A 1FDLH 1K2DA 4OZIF 5A16B 5E00B 4XBPA 4P4KC 4NM8L 1N0LA 2AK4D 3BZDA 5D5ME 4LLVA 3C2AL 4JY4A 4K94C 1I1FB 5SX4H 4PLNC 4LNRB 3BDXA 1YUHB 2XOTA 4LRIC 2F5AH 1UQSA 5EN2B 1C7TA 2FX9H 4HBCL 3RL2A 5IW1B 1KN4H 1U42A 4NKQB 1OM3H 3S97C 4HBCH 1D9KA 4MCYB 3H42L 5E6ID 2OJEA 2EEBA 3IRPX 5H37G 4X9FA 1FGVH 3MNWA 1MFAH 4NZTH 1NUGA 1VEMA 4PV9A 4KKBD 1OHQA 4XMPH 1VFOA 3VI4E 1L9NA 1U8NB 5JDSA 4HGWB 3WO4B 3MRBA 3KYKH 4U1SA 3T1FA 4JKKA 1M05B 3HFML 4WI3A 4UTAL 4EUPG 4UTAH 2X4OB 3QDME 2FBJL 5ALBH 3UROR 4FFYL 3WDHA 2YD9A 3CSPA 3SHSA 1BWWA 2GY7B 2RGSA 3HCVA 4P5TC 4B7LA 5I17B 4Y4KB 1UKQA 5DQJB 8FABB 3G5XB 4WO4A 3QG7H 4APQD 4EKXA 1I7TA 2DAVA 1TETH 2BVPA 3HR5A 2LV4A 2D31B 1RZFL 5IESL 2NY1B 4NZRL 3VRLF 4KXZH 3V4VH 1I1AA 1TJHH 3T8XA 1VGKA 1EGJL 4AT6A 2QQQA 3I2CL 5GRUH 2P46B 1GZQB 5HGGS 3OGCB 1NLDL 4XVUD 1LEGB 3PWVA 3R8BB 5J0BA 1ZSDA 3VJ6B 3QQ9D 4OFYD 4XNZB 1NLBL 1ORSB 3H9HB 3SQBA 4L4VE 3CFIC 3UTQB 1YJDH 1PX3A 3B3IA 1PZ5B 3D25A 4YBQD 3WS3A 5FECA 3OR7B 5EZIL 3PABA 2M2DA 4I13B 4XCEB 3TZVA 2F5BH 3FB5B 4EZMA 4D8PA 4AL8L 4PJ9B 3EYQD 1YEIH 3U9UB 2HLAB 5ITBH 1ADQA 1Z5LA 5EU4B 3W9EB 1NMBH 3VXMD 4ZPVB 3OKOA 1AO7B 3CH1B 4R0LA 2YR3A 1E4WL 3IFPA 1A9BB 5C0CB 1OOAA 2BY1A 1S78C 1I3GH 5AYUH 5CKAA 1FZKB 4LSDA 2HRPH 4OGAD 4HWNA 4BA8A 1FHGA 1UEMA 1MHEA 5E03A 3EYFB 2D0GA 2KUTA 2A9NH 4Q58C 1ED3A 1LDPH 1CICB 1B0WA 2FJHB 4LLAA 4KK5D 4M43L 5ALCL 3FQTB 2GJ6E 2YBRB 6FABL 2M1KA 3PHQB 5KTEH 4Y5VA 4JY6B 1JV5B 3K4ZA 2WW8A 3QNZB 4WJ5A 3ELAT 2DS4A 2P8MB 2VJXA 3LQAC 5DFVC 4KV5F 5I1LA 1JZ4A 2CDEB 5HGBA 3K0WA 3NA9L 3UBXB 3NA9H 3KXFD 1FVCB 3P0VL 1T21A 2DLFH 4QYOA 5BS0E 1J9CT 2FZ3B 3P0VH 2DI9A 3N85L 4NC2B 3MNVB 5H35B 5LKNA 1OPGH 2YD7A 3WKMH 5CBAB 3QZWA 1LEIB 1U92B 5HHOD 1I3VA 4FZEL 5I75B 5F1OB 4PG9A 2A6DB 2OBGA 2Z93A 2A73B 1YEKL 3TBVB 5DJ2B 4PP2B 2G2RB 5IFAH 2OL3A 3ESVF 4G6FB 2AS5M 5JZ7D 4NWUH 4GKNA 4YC2B 5DRZA 1K6QL 1DP0A 1NBZB 1R6VA 4R4NC 1WEJL 4KUCF 3BO8A 4YUEL 3MROA 2OZ4A 1KJ3L 3TO2B 4TVPE 1BFOB 2OR8A 5E8PA 5GRJL 3GIVA 4RGND 2AQ3A 1KGCD 2JJSA 3BH9A 3GK8L 5DXWA 5ANMB 1NAML 2H2SD 4HPOH 4FQPA 3DETD 2P48B 5BJTA 2Z8WC 5GJTL 4WI4A 1G9MC 3VH8G 5KSBE 4GAGL 1S5IH 3HNSH 2ZKHH 1J0KA 3KPOA 4IRJC 3FB6A 1H9VA 2K9UA 4JDVA 3L5XH 2F53D 3C6LA 1AGBA 3GMQA 1A7OH 3RZCA 2ADIA 3TIDB 3EYOB 3EOAB 4G6MH 5SWQA 1HOCB 4BZ1H 4AENA 5HDBE 4CADB 1J8HB 2AEPH 4LRNH 4KZEL 3VW3H 4P23B 3QO1A 2YD8A 1XH3A 4JRXB 4PJEA 1T1WA 4JM2C 4P5MB 1W0WA 2VN4A 4XXCC 2QR0B 1YC7A 3W5MA 1C12A 3JV4B 4QRRA 5C0ND 3BD3A 1L6ZA 4KI5E 1ZHNA 4PJ7B 4IRSA 2WIIA 4PP1C 3QYCA 4K8RC 3ILQC 5KSVB 3RJQB 5I19H 3RWIA 4QNPF 5IM7A 2UYLB 3BGMA 4XBEH 3P0GB 2HT3C 2VXSL 1FFNA 3FOLB 1B4JL 5IKCA 2IF7A 1KFAL 1MCPL 4N8VA 5IV2A 1QBML 3MMEB 4FFWC 5TGBA 2MTPA 2LTQC 4QRUA 3V0VB 1F3DH 3L9RB 4BUHA 3EFDL 3MXVH 4N68A 1AKJD 1EH9A 4XMKH 2D7PA 3EFDH 3PDOA 1FBIL 4PJBE 2JB6A 1MWAB 2VE6A 4G5ZL 1MFCL 4YR6B 4PG2C 2H2PC 3ZKNC 3ARED 4JHBA 1J0HA 5JPMA 3W81A 2XWBA 3REVA 3QFJA 4TOYL 2I24N 3VXOA 1U3ZA 2WMPA 3WFBH 5HHVH 3O3BB 3FOMB 4J12A 4HH9B 3WV0A 3ARBD 4HF5L 1JPFB 1A7PH 3DVFA 1FFOB 5GZNC 5I8KL 1VFAA 5IB3A 3GSQB 1KEML 5KS9B 5DVOA 2FGWL 5F88A 5MP6L 5ISZA 4S1DD 4JFZH 4LSSL 4NUJA 1I8IA 5IWLA 4LPTA 5GGUA 1TVHB 4OJFH 3MRFA 2R9HD 2VSDA 4R7NA 1P4LA 1XGPA 3AC0A 1T83A 3AS1A 3CDYA 5MEPA 4UBDD 1QRNA 2XPGA 3BP7B 3U7AA 1RHHB 1CXIA 3RKDD 1J1PH 3TO4D 1QR1A 1ZKAA 1NC2A 3LD8B 1ZXQA 3X14A 3SDCA 3PQYB 3MQIA 2GSIA 5F8QC 1F4XH 3TT3L 1MRCL 2NX5E 1FL3A 3I6KA 3ARFB 1MRCH 1X5AA 5FUOH 3S3SA 4Y2DB 3GBNL 4JQXC 4M5ZL 4XP4L 4RAUA 3MLZL 3B8YA 1R5WA 4MA7H 1HHGA 1JWSA 4G8GD 4CMMB 5TPWL 2QHRH 3ARGD 1D5IH 4PJDA 5CZXD 3H7BB 3X13B 5F7UA 4LK4A 2ITDA 1RY7B 1NEUA 2HT4C 1H5BC 4G6AC 4YE4L 3VD9A 2CK2A 4OZFG 4M7JL 3MUY1 3Q6GL 4R96A 4M7JH 4JFFA 2ZCLH 4ZTOL 1NFDF 4ZTOH 1N59A 1ETZB 2DQEL 4JR9H 5I30L 3ME0A 2Z4QB 3ZTNL 3UPCA 3ZTNH 1FNSL 4JPWH 2VXVH 2I9LA 5FGRA 1R3KA 4HMDA 3A6CH 5HDLA 3K8KA 4IMKA 2P8LB 2OTPA 3KLHC 1U8LB 2W9DL 1ZLVK 3WNOA 5FM4A 3NGBB 5INCA 3DXAB 3V5KA 4W6XB 3QDAA 4TRPH 2IAND 1I85C 2EYRA 2XZCL 3BGFB 5CGTA 1AE6H 1I3RB 4HMCA 5C09A 1TZIB 5E2TH 2AGJL 3DMMC 4ONHA 1XZ0B 1DANT 4M6ML 3OKEA 3P2TA 1Q9LB 4X6BB 1QSVA 1ZA3A 4U6YA 4F2MA 5E2UL 1EVUA 2YK1H 3LDBC 3SDAB 5AAWA 4YK4C 5E2UH 5FA3A 1HHHA 3MBXH 4G3YL 2IH3B 1MWAH 2L7UA 1J5OL 2X5PA 4E41E 2E5EA 3WL9A 5GSVB 2PYFB 4I4WB 1A02N 2DD8H 4O51B 5CAYB 1T2XA 4M9PA 5MEND 1U8HB 4LAJH 5HD8C 5HHMD 1MF2L 1P6AB 4JO3L 5FYKH 3MV8A 2DM4A 5I1GH 3BT2H 2XN9D 1CLCA 1FCGA 5I1DA 2NXZD 5EOTA 4LCIL 4NQCB 1IGYA 4FQQB 4LCIH 3PL6D 4ZUTB 3VD5A 4HX1A 4PJ8A 1XCQA 4L8SB 1QSFB 3VWJC 3LKQB 5GGRB 5BMFH 1O7VA 5IR1B 3OB0H 2FR4B 4R26L 4GKZB 4KTEL 1A4KA 4G43A 2C4FT 5JO5A 5A3ID 4KTEH 2NR6C 1IE5A 5IQ9A 4ZOCA 1BAFL 5DJDB 4KHXL 2LVCA 3MLUL 3WDJA 3R06A 2FH6A 1KCSH 2APBA 2Y7QA 5J6GB 5IJKC 4MA3B 4Z7NF 1SMAA 4OT1L 4AQ1B 2OI9C 4LDOB 4BKLB 2VN7A 4BFIB 5ESAB 3TF7C 5BZWB 2X89A 5HGAB 2R69L 2J8UF 2JELH 2WBJD 3BXNA 1NGWB 4L4TA 4LPXA 5EUOE 2BERA 5I66A 1G7MB 3QQ4B 5J9PB 3SN6N 4QF1A 5EU3B 3ZL4H 2PYED 3RIFF 1AO7E 5DSCA 4NHUB 5EU6D 4WU5A 5C0CE 1J1OL 1G7JA 1ZLWH 1RZ7L 5FYLD 3BAEH 1J1OH 1OL0A 3U2SA 3I84A 3RJDA 3QPQC 1NCDL 5BOZG 1DQLL 4KJQD 3RX8A 1KJ2A 3O11B 2PO6C 2I25N 1HH9A 3Q5YA 2EE9A 4HIIB 4LKXA 1D9KD 2GUOB 2B5IB 4Y8DC 4I0KA 1FE8H 1W0VA 1WK0A 4PLJC 3Q5TA 1FNGA 5F71A 4P9HC 3D69B 3DHMA 3GMNB 4BK5A 1H0DB 2VDML 5GSRB 1ZGLM 1OARL 5D71L 3BP4A 3CSYB 3TCLB 1OARH 3CZJA 1YEJL 3PP4H 4DKFH 2IPKA 4N1EA 5EBWB 1YEJH 4RMQA 3B6SA 5D2LE 1YDPA 2FHCA 3O3AB 4ODHH 1RIUL 4C57C 5B3JF 1T66D 2IADA 3WUWB 2I07A 2OTWA 1QO3B 2B2XH 4ZFZB 2FJFB 5CD3A 1CN4A 1L0YA 4NWTL 2DLGA 4KPHL 4ZFOL 1QFOA 3NH7H 2PCPA 2NY7L 1IM9B 2DOCA 3WN5B 5ADPH 2VLJA 5LGKA 4QRSB 3UTZA 1CLOL 1AC6A 2KZWA 4OM1L 3NIDF 2R23A 4EDXB 2KQNA 4JM2F 1C5DA 1OTUD 3KPSD 5DHVB 3KPNA 4L9LB 3RFZC 4RFNB 2BY0A 2X4PB 3NFPA 4GKSA 1QPPA 2DQGH 3DX7A 4JZJB 2VLRB 2X6MA 3J8F7 2PNDA 2P24A 3MRCB 4URTB 4FA8A 1XFPA 1FJ1A 4NNXB 4WVRA 5CJBA 5KVGL 1LO0H 5GGQL 3KNBB 4HKZA 2Y23A 4KKCC 3QPXL 1WICA 3HUJB 3OWEA 3QPXH 5E5MA 2OR9L 3SE3C 3BSZL 4I5BB 4PJHF 2OR9H 3OAYK 3T0EE 3S35X 3NZHL 1PKQB 1VENA 1Q9WA 4YO0A 1CQKA 1RUKL 3BVNB 3I6GA 1KPUB 3VI3E 5T33H 3WLWC 4XNYL 1V5JA 1T2JA 1J8HE 4GBXA 4QTIH 2Y5TB 1LO5A 3BKJL 1QPXA 5SWZD 1E4XL 2IPTL 5JOEA 2HTKC 1CL7L 4JRXE 5JW3H 3S96A 4NYLA 4JREC 3VXNB 3AU1B 2P1YA 3C5ZA 4W6WB 2ICWB 3AY4A 1X7QA 4NP4L 4NM4H 3SDDB 5T3ZH 4PJ7E 3MRPB 5F3BB 5E5RB 1BREA 2VDRH 4JY5L 5D7SH 2A6KB 2VR4A 5CSZB 5DD6B 5C0RH 1OWWA 1UWGL 2CO7B 2VDPH 3PV6A 4BFEA 1VADB 4DAGL 5TQ0L 4Q2ZA 4NQUA 5TQ0H 3SKOA 3EYUH 3G6DH 4UOW0 3O4OC 5I73C 1IILE 2BZDA 4JCMA 3T4YA 1MHCA 1XGRA 3ARDA 3V2AR 3MV7A 3NZ8B 4ONOA 3M8OH 1A7RL 1S9WA 4R97B 4O5LL 5CEYA 2HFEA 3CU1A 3QUXD 5CMAA 3GB7B 4UDUB 4NQEB 4KDTC 3TESA 4J8RB 1AQKH 2V5YA 4P2QB 1MFDH 1J7VR 5FYKE 1G1CA 4IIQA 1CGYA 1U2HA 4OGYL 5AG8A 2ED8A 3D48R 1SJEA 4P2CG 1BJ8A 3D0LA 3G04B 1JUFB 1CGVA 2GSGB 4Y5XC 1LE9B 1H8OA 1TQBC 1PYWA 4RWHA 4DWHA 2LAGB 5I1EL 3G6JF 1T80A 4L1DA 3V95A 1IT9L 1ITCA 1EK3A 4IM8A 5HI5D 3ZE0F 5IEHA 1JL8A 4Y19D 1K3ZA 2GY5A 3W9DA 3ARPA 4RFEA 2DYPA 4TPRH 2JK5A 3C60C 4U1IB 5T1LB 2J6EL 1KJVA 3HMWL 3TA3A 1I7UB 3C8KA 4OZ4A 3QEQA 1XF5A 3TBWA 4RBPK 4O58L 3L3HB 1WWCA 43C9B 1UZ6F 1Z3GL 1M4KA 3C6LD 2FJGB 2ZWLT 3PQYE 1CK0H 1R3LB 4LFHG 5DHVH 3IDMB 5JPNB 1OTTC 4ZTPH 1EHAA 4XPBH 3VGEA 1R0AL 3RA7L 4HBQA 4FFVD 3ZHKA 3T0VA 4LEOA 5E4IA 2AVGA 3LZFH 3FN3A 4RMUA 4YDLB 3L3GB 2CKNA 3FQXB 1JZ2A 4E9LA 4C56D 2FO4B 4JDZA 5D2NC 3JWNC 4QRRD 4YDVA 3MLSH 4PGZA 4X4YB 5DD1L 4N90D 2ZSWB 2BVQB 4IRSD 5KG9A 2VZTA 3HE6C 2RFXB 4M1DL 3RGVB 3TN0C 4FXLA 2R0ZL 3PNWB 3WE6B 2ZJSL 4G6KL 1IVLA 2NY5C 1ZWIA 2JLLA 2QEJA 4YDIH 4LBEA 2ZJSH 5DYOA 4J6RH 2V6HA 4LPUA 4HDIB 2WSKA 4OBRA 1U8JA 2X42A 4RMSA 2XRAH 5FHAH 1N8ZB 4FQCH 5E8OB 2APTA 1GH7A 2F9BT 4OFKA 1A14L 1K9TA 1HQ4B 5E2WH 1GGUA 5CHNB 4F8TA 3DXAE 4LVNC 1NCBL 5J1AB 5JLZA 5J57B 5DURB 1L0XA 2VL5B 2EH7L 4LHUG 3CSGA 4H5SA 5TFSL 5D7LB 1IJ9A 2OP4H 2X4NB 2A77L 3EYSH 4OB5L 2A77H 4N9GA 3CFDA 5DJAB 1BOGA 5DRNB 5FM5O 3MLYL 3ARVA 2AXFB 4TULH 5LCVH 3MLYH 3GI8L 5HYEA 3OGOE 2VABB 3QEGL 3WBDA 4P48A 4TUJA 2MNUA 4K7PX 3BZ4A 2IQAA 3IAQA 3QEGH 4G8FA 5ISZD 1FN4A 4EI6A 2BNUA 3L5JA 4EN3B 1FSKB 1CR9L 3MPCA 1DQJA 5CIPH 5EC2A 2H1PH 2R2BB 5F6IB 1C5CL 3HNTH 4NQCE 4DVRL 1CLZH 3DPBA 5I8CB 1TMCB 1BBDH 4DVRH 3FT3B 5LQBL 2XWTA 3O2VL 3QCVH 2Q8AL 5DUML 2VUYA 1XAUA 4Y5YA 3BJLA 1WBZA 3REWA 2YPKB 5TH2A 4N1CA 2X4RB 3DUSA 3CVHL 1S9VB 1QLEH 4R4BA 5JA9A 2DM2A 4UU9A 5E99L 4OM0L 4X7SL 1KIRA 3O6FD 2DLIA 4OM0H 4OD2B 1BD2B 5FGBA 4RCAA 3ZSTA 2CR6A 4HPYL 3IETA 4UILL 5C0FB 3QULA 4OCXH 4MQXC 5L6YL 1DUZA 3BW9B 2ESVA 5IK3B 3NN8B 3LN4B 2VAJA 4G8EA 1XGYH 3MODH 5DVNA 1NMAH 3ARUA 5T3ZE 4GS7B 3I02B 1W72A 1AHWA 1JHKH 3B9KC 1U93B 1NCAL 4GJTB 4NRYA 4M02A 1F11B 4P4KA 2ED9A 4JFFD 4KMTH 1MPAL 5EC1B 2FL5A 3O8XC 4AJ0A 3DBXA 5IT2L 4MJ5B 2BVTA 1CFSA 4LOUD 1XF2B 1IL1A 1PY9A 2B39A 1HDMB 1PZUB 3G9AB 3TJEL 3TYGL 5I1HL 5K9OA 1A6ZA 4ZS7H 4BSWB 4HKJB 1GGYA 3Q5OA 4PRDA 4NSKA 2GFBB 1YPZF 3UTTB 4L8CA 3QWQB 3VXSB 1HEZB 1A3RH 3EZ8A 1R3HB 5BCAA 3P9LB 4C59B 4GG6F 3HE7C 3VXMB 1TPXB 1D6EA 4KH2A 3MLWL 2YD6A 1HQRB 2HH0L 5IHLB 3ETBF 3G6AB 4HV8B 4YEFA 2X4TB 3RVUC 3EOYG 3QI9B 3ZE2F 1BZ7A 5EZLB 3SGKC 2EDKA 2HWZL 1KG0B 5JXEA 3DOSA 1HI6A 2DWEA 4M1GL 5FHBL 2VZUA 2XV6B 5FHBH 5JW4R 4LASL 2JCCB 2ICEB 5EORH 2BDNH 4UQ3A 1RUMH 1N6QL 5INDA 1MCFA 4Z7WE 4C58B 2VLRE 4UV4L 5FCUL 5HI3D 2DQHL 2X4QB 5KVEL 4PRBB 3BDBA 5I1IH 4JZNA 4QHLA 3FTGA 2GAZB 4NJ9L 1IQWH 3QCTL 3QWRA 5L9DL 4JB9H 4I9WE 4WFED 5J1TC 2CRMA 3QCTH 4XRCB 1T2QH 5J6HB 1RU9L 3FKUS 3DO3A 2Z31D 4L3AA 3RI5K 3QXTA 4EXKA 4ETYA 4JRYA 5EU7C 1AGCA 4FQXC 4KTDH 3VFSA 5T1DH 4L4TD 1BQHB 3MR9A 3EYVB 1F4YL 4LDLB 3BPCA 3MFGB 2BNQA 1U2CA 1U8PB 3LKNB 5C9KA 2XTJC 3UJJH 3P4MA 4ODTL 4PJAB 4WWKD 5T1MB 2BNRE 3CX5K 2GCYB 3TWCH 4G80A 3UYRL 4A2LA 3MRJB 4GRLC 2WIMA 2ZPKH 3P9MB 3RPIB 1EEZB 3O3EA 2R39A 4OIBA 3S98A 2CDFB 4KAQH 4YHIB 3U83A 3GJFH 1JF5A 4Q9CA 1N5YL 1FRGL 2EEAA 2F15A 2J8UA 5DF0A 1O5DT 1WBXB 4M8QA 3D3VA 1CXLA 1OD7A 1BJ1H 3RVXC 3FT4B 2YRPA 3EO0A 5B4MD 2I9TB 3VFGL 4N5EC 4NO5A 3I9GH 3KPTA 1YEHL 5F93C 2Z91A 3BUTA 4KRPD 3PP3K 5F7MC 4NQEE 3RP1A 2Q76A 1HZHL 4OLYH 3HTLX 3T2OA 2Y06L 5JA8B 4MQSB 2DQUL 2Y06H 4MQTB 4P2QE 5F9OL 3HZYB 5EZJB 4O2CA 4PJXB 5D96B 4I0PC 5F9OH 3DVIA 4KTYA 1I9EA 3V6ZA 1U8KA 1G0XA 2VLJD 1RZKH 3VGDA 3HKFA 1S7XA 3IFNL 3E3QE 2GJZA 3SDYH 1E6OH 2KZ1B 4DK6A 5IVZA 5C0AD 3KYOA 5C3TA 3BN9C 4YHOL 4DQOL 2FWOB 3GSUB 5HHXH 3OL2A 2CIIB 4ZUUB 2AJUL 3B5HA 3P4LA 4AMKH 2CIKB 1IZJA 4Z8FH 3LEVL 3UAJD 3TP4A 5L2KA 4H1LA 1QRKA 4XXDA 2RIKA 3RU8H 4UV7L 3RBSA 4XC1L 4UAOB 2AJ3B 4YXHL 3DVGB 5D1QB 4EI5B 4GAFB 5DTFA 3T3MF 4OIAA 4YXHH 1F6AA 2FEEI 1QFWI 3IGAB 2NTFA 4G7VH 2ITCB 4X8JA 3ARBB 1EBAA 4RDQF 1TNMA 4OGZA 1AR1C 1BZ9B 3CNKA 3VGBA 4QRPB 1B0GB 2FX7L 3SKNA 3MRKA 3DJ9A 3CMOL 5CBEB 1PY4A 3MYJB 1PGRB 1OGAD 3MA7B 2VYRE 2NY4B 5FIEA 4WI8A 4ZUWA 1S9XA 1V3MA 4QHKJ 3HRPA 4POZD 2DMKA 1KXVC 5CP7A 2X9XA 4OCSL 2WWMD 4KC3B 1NH6A 4D94A 1KB9K 3BQUA 5J89A 1ZHLB 5IQ7H 1TVDA 2O5ZL 3QHFL 4OV5B 1BFSA 4R8WH 4O2FB 4HUXB 4DGVH 2R0KL 1K8DB 4LLMA 1RZ8B 2Q6WB 1QNZL 1J1XH 1QYGH 2R0KH 2HYMA 3P0YH 1GVIA 1QNZH 2F58H 4XHQA 3MV7D 4NNYB 1SEBB 4WFHE 1IGIL 3QUZB 5IBTL 3QNXB 4NQXB 5B3NA 1FYTA 3EO1B 2CDGB 4M48H 4MWFA 1T1XA 1YY9D 2I27N 4X5WA 4PJIE 3JV6B 1AI1L 1TLKA 3MLXH 3U0WL 3QEUB 3ARGB 5EA0H 1CDIA 4RA3A 3G5VB 1AI1H 1O0VA 4LCYA 3SOBL 2PW2B 5IB4A 4B50A 2L4OA 4O02H 5JW4N 4YGVB 2MHAB 3VWKC 5GS0C 2X4UA 4M6OL 3UPRA 1FV1A 2AK1L 3SCMB 4L3EB 4ACPA 3VG0H 4F37K 5D9SA 1IRAY 5I6XC 3W0WD 5D7LE 3T04D 1JRHI 1AP2A 5E56A 1T0NA 4AK1A 2VNCA 1NEZG 2AEIT 2YMXL 4WHYH 1K8IB 1HINL 2WUBH 3NCFB 4J3SA 2AXGA 2YMXH 3VGHA 3PGFL 4NN6C 1RURL 4NRZB 2J88H 5FB8A 2FECI 5EFIB 4CDGC 4LSPL 3NFNB 1LP9F 1RZGA 3K1DA 4P3DA 1D5MB 4FQIH 1DL7L 3MV9B 1KSRA 3QA3A 3I3BA 4LQ1A 3QP3A 7FABL 4LKCB 3QEQD 3L3OA 4JO2H 3KDMA 3TJHD 5K9QI 2FIRT 5D72H 5ETUB 3IAPA 3NPSC 5F9JA 2ZG2A 5CJXC 5ACLA 1YECH 1CGSL 4KUCD 1CGSH 5KW9L 3G6JA 4OUUA 5EPMA 4Q74A 3CXHK 5KW9H 2OTUA 2WANA 3L95B 2D7TH 1BD2E 3GMLB 4WHCA 4YBLB 1LK3L 3WNPA 4DN3L 2QV2A 2UVFA 4TUKL 3VGAC 4U1LB 4LARH 4X6DE 1OCWL 5EBMA 3TIEB 5K9JL 4I2XB 1N6VA 1RJLB 1TCRB 4JDTH 4Z6AT 2NXZB 3WCYA 3SE9H 5FEBA 3MCLL 2VIRA 4MJIA 4OD3L 4KUZL 3FB8A 3PL6B 2MQCA 5T1KD 2BCKB 2AI0H 3INUL 5KVMC 1E28A 3STZA 3D87B 2ORBH 3JZ7A 4BSVA 1C1EH 2DQFB 3DV6A 5A2LH 4PRIB 3V6BR 5D4QA 3V6OE 1U41A 3V0WL 4GLRI 4D0CA 3ORJA 4OZHE 3UO1L 3GKWH 3GSVB 2NY6D 1T03H 3VCLA 1VACA 1DQQB 1T04B 2ZNXA 4F7TA 1XR8A 3A67H 3EJYC 2IPUK 2O61A 3X3GH 5D1ZA 4W68A 5JHDB 1F90L 4MAYC 3O41B 4WV1A 1JZ5A 2P7TA 3BWAA 4CVXB 4G42B 4PY7A 5MI0B 5CEZH 3U9PL 4NO3B 2ZUSA 4HAFA 2A74A 3U36B 2E9JA 3O2WL 3VXME 3Q6FB 1FNFA 1CVRA 4NZDA 3QUYC 5EU6B 1K2DB 4MZ3A 2DTML 4XBPB 3V6FA 5EUKA 1JNHA 3D85D 3LHPH 3BP6A 4JZOA 1JWUB 1OQOA 2ATPA 4OAWB 5AZ2L 5BV7B 1UQSB 1OAUL 3RL2B 1EFXD 1FQ9C 6CGTA 3GI9L 5D70H 3VWJA 3FN0H 4MD0A 5CJQH 1D6VH 5C2BH 5HGHA 3P30L 4PV9B 5GGTH 2EO1A 5GS1B 1H3PH 1MI5D 1MNUH 4K71B 4R6UA 3MRBB 3IDJA 4U1SB 3T1FB 2VH5L 5J8OA 3KXFE 4IOIA 4M8VA 1DBBH 3KR3L 2C9AA 1WWAX 5F21B 5CUSL 3HCVB 1GPOL 4MX7A 3HB3D 2YWZA 1GPOH 1MHPH 2IFFL 4WO4B 1JTOA 2AEQL 2BVPB 2CKBL 2CKBH 1EGJA 4IJ3C 1I1AB 1JPSL 3JWDC 2NW3A 5TF1L 1VGKB 3T8XB 1GRWA 2HKFL 5LGJB 3H9ZA 4P4KD 5TF1H 4AT6B 2W1NA 4PGBA 3KAAA 4JO1L 1JPTL 3QQ3B 3OQ3B 4WEBL 4RGNE 3IXTA 2BC4B 2KQMA 2PO6A 3PWVB 1T7YA 1ONQA 1J0IA 3EZJB 1ZSDB 3IU3A 4HJ0C 4K3DL 4PGDA 4PJAE 5C0BB 1QBBA 5HVHB 3BPOC 2GTWB 1A7QL 4MCZA 3S34L 4JHAH 3B3IB 3D25B 1BPVA 3WS3B 5FECB 1D7FA 1GZPA 3TZVB 4D8PB 1GIGH 4GMTH 4MLSA 4NO0A 5E4EB 4W81A 4QRTA 1YN6A 1WC7A 4HKXB 3O0RL 1Z5LB 5ICXA 5EIVA 5DK3A 3O0RH 3FFCA 3O45A 2HJKA 4OFDA 1QOKA 4YXLH 4R0LB 4P5TD 1WZ1L 5CZVL 1DVFB 5L2JA 5F7FA 1CLYL 5MHSD 4PGCB 3QB7C 2DM7A 1MHEB 4PJXE 5JHLH 1ED3B 1PVHA 2KPNA 4R90L 3D0VA 4R90H 3N1FC 4M7KL 3MGTA 1UB5B 1YPZA 1KCUH 1JZ6A 2EYSA 4Y5VB 3IVKA 5DUBA 3MO1A 4GRWF 5LAXA 1G7PB 4GG6A 3VXRA 5I1LB 2D9CA 5FYLH 3U46B 1VGEL 3UBXG 1NC4B 2ZUVA 2W65A 1IKFL 1T21B 5SV3A 1XEDA 2MQ0A 3QWRD 4PJGF 4PG9B 3K4DA 2Z93B 5GISL 2CPCA 3ZSSA 1HILB 5GISH 4RWYH 2H6PA 1I3UA 15C8H 1YNTA 1MREH 2FLRT 5EOQL 1MIMH 2V17L 3O9WC 3HLAA 1S78D 2WZPD 3MROB 1S7VA 5F1IA 1CFNA 2QQNL 5CINL 5E8PB 1QHPA 2BNQD 4OLUH 2X1PA 2QQNH 4KZDL 4MNQD 3BH9B 1NAMA 4RNRA 1NMCB 4KZDH 4G9FA 3CFKA 5F7LB 1C5BH 1KPVA 3E2HB 4XX1E 5MEOA 3EOTL 5C8JA 5IG7B 2JF1A 3FJTA 3EOTH 1S7WA 2CGRL 4HAGA 4F8QA 1CDUA 4FNLH 2B0SH 4KROC 1B0RB 3KPOB 1I4FA 3QUML 3FB6B 2EDFA 1IKNA 5DFVD 4KI5C 3ULSB 5CEZE 5D1XC 1AGBB 3GMQB 2HN7A 3RZCB 2ADIB 1SYSB 3CUPA 5F6HJ 5SWQB 4M03A 2HP4A 4AENB 3E8UH 3OZ9L 3LY6A 1OGTA 1TZHB 4PTTA 4U6HA 3PE9A 2APVA 3HAEB 4N0UB 2DQDH 2WQ8A 3QXUA 1XH3B 1U95A 1A6WL 1EX0A 4Q6YA 4XNUH 5I9QB 1U8QA 1CTOA 1KB5B 3D2UD 3MTRA 4QHMA 4NQDD 1WAAA 3ARYA 2E27L 4S1RH 2WIIB 4R4ND 3P4OA 3BISA 1ADQH 1T5WA 1HYRC 3SO3B 1FFNB 3ROLA 5DD3L 3O4LB 1XT5A 5IKCB 3VXPB 5FO7B 1ZVYA 4N8VB 1JHLL 3K2MC 5TGBB 3SGDH 2DN7A 3RY4A 2DQTL 1NDGA 4QRUB 3I85A 3UJTL 4JKPL 3VRJA 4MA8L 4C54A 4ZO8A 3PDOB 1EHLH 3THMH 5C0IA 2JB6B 1A6UL 1VFBB 1UJ3A 3MV9E 1RJYA 2VE6B 4HW6A 4BQ9A 3R0NA 3V4PH 1A6UH 2X05A 4C55A 5L2KD 2EIEA 4S11A 4CVWA 5I8OL 2IG2L 4RFOH 5JPMB 2IG2H 2XWBB 3REVB 3QFJB 5H8DA 3W11C 3NACL 4WI2A 3VXOB 1YJDC 4DW2H 4JM4L 4WFFD 1Z9LA 2D3VA 1G6VK 1N4XL 4KVCH 2YPLA 4NT6A 4NZUH 1SY6L 4RRPA 1IC7H 3T0WA 2G60L 2IAMA 1HN1A 3MOAH 4JM2D 3GSWA 4MNGA 5D5MF 1VFAB 5IB3B 1N64H 2FATL 4U0RB 3QAZC 1OWRM 4XPFL 5F88B 1EO5A 4XPFH 5MENE 3SJVD 3CLEH 4NUJB 1I8IB 3DO7A 3VXQB 4PP1D 4Z0XB 4I2XE 4K8RD 3MZTA 2ZSVB 5KVFL 5GGUB 3HE6A 4HFUL 3G5YA 1JYNA 3W2DH 2OL3H 1P4LB 1XGPB 1KYOJ 2HT3D 3L1OH 4R7NB 5KVFH 4H20L 1QRNB 2UWEF 2XPGB 1MJUH 3TN0A 4NKIL 4XP5H 1SBBA 3MBEA 1QR1B 1NC2B 2WWKO 3PJSB 2OZ4H 3S35L 3X14B 3SDCB 3IXAA 1V7NL 1FLRL 2YD5A 1V7NH 4OD1L 4I3SH 4HJGA 1FL3B 3I6KB 4XNXL 1ORQB 3GIZL 1NCCH 3MXWL 4XNXH 4XHJC 4HXAH 3ZKND 1EUTA 4RAUB 1HHGB 1JWSB 4Y4HA 3PF2A 4HCRL 4NZJA 5KJRH 4LIQH 1F58H 1X5FA 1P6FA 3MJ9L 3QT2A 4I3RL 4ZFFA 5E08H 2XG5A 1WUNT 3S36X 3LEXB 1R5IA 3GMPA 2BXZA 2C3WA 1KXQE 3MRLB 5GZND 3LH2L 1PEZA 1WFUA 5IOPA 5BRZD 1PG7X 1WF5A 5EU6E 1N59B 3EJZC 3WO4C 5FYLE 1KIPB 1T20A 3MLRH 3CX2A 1PQZA 4F57L 3T2NH 4AH2B 3LSOA 5IVXB 2HG5A 3NIFE 4K23L 1M7DA 2DQJH 4KGJA 1Q1JL 1R3KB 3F7VA 1M6OB 5TDNA 3IDNA 5TDOA 3JUZA 4Y4KC 4NKOA 1YMMA 2B1AL 2H9GA 3V8CA 5INCB 2R1YA 3V5KB 2B1AH 2VXQH 1DZBA 1FVEB 2EYRB 1A6AA 5ILTH 1M7IA 2NY1C 4NBXB 4YHZL 5C09B 3EDKA 3U4EA 2JJTC 2W07A 3OKEB 1OP9A 1G6RL 3K81A 3VXUD 1RZJL 4WUKL 1ZA3B 4F2MB 1H3GA 4OCLC 1H15A 4XMLL 5FA3B 4WENB 5BZDB 2X4SB 3WL9B 4UT7L 4FXGA 3TT1L 3WFCH 3UJIL 4CGTA 2ARJA 4UT7H 4XNZC 4HUWA 3C87A 5DMJB 2IQ9H 2HT4D 2A0LC 4G6AD 4HKBA 4K3JL 3MV8B 4K3JH 2YS4A 5E24E 5I1DB 4JN1H 4NKMB 3ZO0A 1INQA 2V5RA 3NCEB 4MJID 4OF6A 4PJ8B 1XCQB 3UYPA 4Z95H 5T3XL 4EOWL 4PJ9C 3RWFA 5I0ZA 4XT1C 5DC9B 2VDKL 4G43B 4G8IA 5BO1L 4BM7A 2VDKH 4LLWB 5JO5B 4F9LA 4H25B 1MCNA 5IQ9B 4M62L 1C08A 2MKWA 1BBJA 3KLHD 3R06B 4WCYH 4Q7DA 4Y4FB 2Y7QB 4PB0L 2NZ9D 4PY8I 2VDNL 3PGDB 3PWNB 3WHXA 1QSEA 2VDNH 4PB9L 35C8H 2GW5A 1AD0B 1G1YA 1BF2A 1GOFA 2RJMA 5GGSY 5J06A 5GGRY 1CICC 3WEXB 5FFLA 1AXSB 1UKTA 3BXNB 3HZKA 1A1NA 3P40A 4UB0L 1ZA6B 4QF1B 4YAQA 3B9DA 5DSCB 1T22A 4WU5B 3B9EA 4AIXA 4KHTL 1I9JL 4AG4L 5HD8D 1A7NL 2Q8BH 4P2RA 1I9JH 4Y89A 1A7NH 2AJZA 3N9GH 43CAA 1MFEH 1KJ2B 1UWEH 5HGDA 4CNIB 2BRRH 2CJUL 4OZFB 1V05A 1T1ZA 5I75C 4H0IA 4Q0XL 5D7IA 2OMNA 2Q86A 2NXYB 2YUVA 3VWJD 5DT1L 1HXMA 4Z77A 4LLQA 4UT6H 5IROA 3RDTA 2C3HA 3SBWC 3OAZK 4CVZA 5HDBF 4A6YB 1MAML 3BP4B 3GDBA 1JK8A 4YC2C 1JFQL 1G0YR 1CE1L 1CFVL 5DEGB 2IPKB 2XFXA 1RK1B 4WI9A 3CZFB 3V52H 3B6SB 1J05B 1EHNA 2IADB 3X12B 2BX5A 1UM5L 4R4FH 5F3HA 2I07B 2OTWB 4ZFGL 5I15L 1REIA 5B8CA 4IRZL 5CD3B 4ZFGH 1A3LH 1QFWM 4K7PL 4KI5F 1KC5L 3QIBB 2P42B 4EIZC 1RFDH 2D9QB 2PCPB 3CCHA 1WT5C 2CLZA 1AXTL 1NANH 3OKKA 3UTZB 4Z7UF 2B1HH 3S88L 3ES6A 2NPLX 1U91A 2P47B 4V1DA 4FRWA 2CLVA 4F7MA 1G9NH 2YRZA 2R23B 5DHYA 4XVJL 4WI5A 4UUJA 1C5DB 1QA9A 4HIJB 4TUOB 4XVJH 3KPNB 2HTLC 3F7YA 3QPQD 4U3XA 3NFPB 4GKSB 3DX7B 2PO6D 1LO3L 3WSQH 1FJ1B 4U3HA 4P23C 4UI2A 4HKZB 2NTSP 3OG4B 1UZ8A 4HQQH 4MJ2A 3MCG1 4PLJD 4XCCL 4JN2A 5EBLA 5AUMA 3VMPA 4LIQE 1YNLL 5LXGL 1MCIA 4L4JA 4YO0B 4NO0D 4PRAA 1NQBA 4U49A 4JQIL 2Q3AA 1EAPA 1SJVA 4GBXB 1LO5B 3SDXA 3FFCD 1B4RA 4LVHB 4CN4A 3S96B 1TZGL 3VFRB 4I0PA 2D2OA 4J23A 3O6LL 3C5ZB 1BX2A 4QRRE 3KG5A 5IFHH 1CXEA 5JW4Q 2BSTA 4LSRH 4MDJA 5F96L 2PXYB 3OKYA 4ZNEA 4CJ0A 4XWOC 4DGYL 4Q2ZB 3U1SL 3O4LE 3WIHA 3C08H 4RGOH 3RAJL 3SKOB 3ZKQD 1JIBA 2BMKA 4OCRL 5J56B 3T4YB 1MHCB 3ARDB 4X4MA 3MGOA 2L0DA 2AV1A 3MV7B 4LSVL 5DRWB 2COQA 4WHTA 3WIFA 4KK8D 4K7PY 4GOSA 5JXAH 1CIDA 1KJ2H 3NABL 3BH8A 5DJ0B 1P7QB 4QXTB 5CEYB 3FO0L 5CMAB 3STLB 3CAFA 4ENEC 4X5XA 5SX5K 3SKJH 2YUZA 4OF5A 1A6VL 5BVJA 1Y6MR 5HDQL 3F5WB 4K7FA 2ZOKA 3QFJE 3PWPA 1CFTA 1JGEA 4FQLH 1ZLSH 2QKIA 3HZVA 4HHAA 2EDYA 3WLWD 4K55A 1OY3B 5ID0A 1RJZB 3ARTA 4P3CH 1DE4A 1F2QA 2CR3A 3OBAA 1SJEB 2AJSH 5FA4B 2HTKD 1JF1A 1PYWB 5C6WH 3KPMA 1QQDA 1WCBA 2AABL 3BKYH 3LD8C 3S5LA 3RWCA 2UUDH 5IEHB 1A21A 3ARFC 1DFBL 2J6EA 3CVIL 3W9DB 5ISZE 2KH2B 4Y2DC 4RFEB 2DYPB 4UDTB 4PGJA 1DFBH 2JK5B 4FXKA 4YLQT 4F9PC 1KJVB 3EUUA 3B2VL 3TA3B 4PJGA 3C8KB 4QOKD 4OZ4B 2FEEL 1XF5B 1SYVA 4GG8A 3TBWB 1QFWL 5ADOL 1QRNE 1MH5A 3BUYA 1QFWH 5MEQA 4LHUA 1IAKA 25C8L 3UC0H 3QDGA 5F7DA 2IFGA 2V9QA 5KAQG 3WJLA 1JYWA 4JFDA 3GHBH 5JOPD 5T5FL 3I6LD 4BQ6A 3ILPA 4DKEL 4LEOB 5B39A 1FAKT 2I5YL 3CSBA 4M3KB 3IFLH 1IM3A 1NGXA 1IGFH 4NKDB 2XKNA 5I76A 3VWKA 1FFQA 5ESVA 2FD6L 4U1HB 3UTOA 4L3CA 3DYPA 4PJDE 3KPRD 1NGQL 1R3JA 4YGAB 1NGQH 4YDVB 3MCKA 1V7ML 3QIUA 3UDWA 2EXWC 3NGBC 1FYHB 4JFFE 4HT1H 1LEKA 3GUTB 3BGFC 3GMMA 1M71A 4LBEB 2DM3A 1A5FL 3C60D 1U6AL 1A5FH 2FCBA 3SDAC 3EJJX 4JO4L 5IVXE 1U8JB 1WFNA 2QL1A 1J0JA 5JIKA 4TSCH 1I8KA 1FNEB 2EYTA 1BEYL 3CFJA 1UJTA 3LKPA 2M26A 2W59A 3L5WA 3BHBA 3IDYB 4BH8B 1TFHA 1JRHL 3IYLW 5CJXA 3LS5L 3RIFK 5E9DA 1OTTD 3BX7C 5KSAA 5C09E 1GGBH 4H5SB 2AW2A 3HC3L 4HXBH 5GS3A 3HC3H 1LO4L 2R0WH 5DLMH 2YPLD 1LO4H 4L8SC 3EFFA 4N9GB 3CFDB 3DGGA 4ZNCD 3JTTA 4L29B 3N06B 4YHNA 1F3JA 4TUJB 3E6FA 4GAYB 2IQAB 2FSEB 4G8FB 5C2UB 3BE1H 5DS8A 2X70A 4EI6B 3B43A 2BNUB 5GJSL 5BVPH 2P4AB 1X4ZA 5GJSH 3MV8E 1MCCA 2VLKD 1DQJB 1KLFA 2WV3A 1ODAA 3BMVA 2WM0A 3RI5F 3W39A 3HE6D 2HA1A 1TJGL 5C07D 3TN0D 4WTXA 4S1SH 4WHDA 2YUWA 2ERJB 3OHXA 4XPTL 1CWVA 2NW2A 3CVHA 2QQKH 3REWB 2PTVA 3DUSB 3TBTB 4F3FA 4YQXL 4HUVB 1RUQH 4DJMA 4Z7OE 4NRXB 4UU9B 1JPST 1YEDA 3T3PF 1B2WL 1LWRA 1R5VA 4OZGB 3DV4A 4WFEE 4X7FC 4MAYA 2XTLA 1INEH 3QULB 2CK0H 1DUZB 4LHQB 4NO2A 2ESVB 1KBGL 5F7WC 2HT2C 3GKZA 4G8EB 3RHWK 5GRXG 2NY3B 1F42A 3ZYZA 1ZVSB 2AJVH 2B5IC 2X9WA 2UWEA 2WBWB 1JPGA 1W72B 4OF0A 2R8SH 1XF3A 4BYHA 3V0AC 2DL2A 4L4TE 3QUYA 4NRYB 4H0GA 4X99A 5E8NA 4D9RD 3MLPA 3MJ7B 2AV7B 2FHFA 3U7YL 3K80A 1MFBL 1UM4H 3SE8L 1RIVL 1AJ7H 2X41A 1CFSB 1RIVH 1IL1B 4IEFB 3HMXL 5SWSD 4ODUA 4ODVH 5K9OB 4UNTA 3KGRA 1TNNA 2V2TA 1DUYB 4KVNL 5E6YA 3ARXA 4NQVA 3WD5L 4FMKA 5EIIB 2HMIC 1YMMD 4NSKB 4PRDB 2DTSA 2WUCH 3LB6D 4L8CB 4P2YA 3LV3A 3M17A 1X5XA 4LPYA 3T1WA 3WN5C 2P5WA 3FO1B 3TGXA 5DWUH 4DTGL 1S5HA 4LU5L 1B9ZA 2GJJA 3VE0A 4DTGH 3NFSL 1D6EB 4GMSL 4FZ8L 2O5XH 2PTTA 1I7RA 3QIWB 1C8PA 4XCNB 5ESQB 1FIGL 3H9SB 4L9LC 4MQXD 4P4RB 4RFNC 5DQDL 5EU5A 1JNLL 4FQJL 4JZJC 3P11H 3CLFL 1AGEA 3DRTA 3ZDZF 1QKZL 3CLFH 1VFMA 1BLNA 4OLWL 4PJ7F 1W8NA 5C0GB 2BOBB 4XZUA 1IGCL 4X4XA 3ULUL 3B9KD 1ERNA 5K59F 1VEPA 1OSPH 1KIQA 1CDCA 2VLJE 4ZUVA 1LVEA 3D18B 2FH8A 1A1MA 3ALPA 3DX9A 2AK4A 2F54A 3LKRB 4ZO6A 2Y07H 4NUGL 2GITB 3ZTJH 2XQBL 3NTCH 5INDB 1NL0L 2W9LA 2OJZL 4U1MB 1P4BL 1HKFA 4YX2H 5I18H 4NNPH 1Y6NR 1Q72H 5E6IA 3FTGB 1IAII 4EBQL 1JZ8A 1ZVHA 1MJ8L 2E7BA 2QQLL 4OQTL 5DDHB 1QSED 1VCAA 4GH7B 3FAXA 5EO1A 4YHPA 4PJCA 2J7LA 3SDDC 4JRYB 4QKXB 1OAQL 2C4FU 3VRLE 3HE7D 4DKAA 1AGCB 3OX8A 1OAQH 1UYWL 1AR2A 2UZIL 3MFFA 3VFSB 1UYWH 4BUGA 2UZIH 5FYJD 3MR9B 3DIFA 1H3WM 3P73A 1AY1H 5KS9F 3RVUD 3AS3A 2A1WL 3DNKA 3LKSA 1JGVL 3BPCB 4APQA 1N5AA 3P4MB 4MVBC 1CT8A 3LS4H 4R97C 4P2RD 4KJYB 2IEPA 4FTVD 4H88H 4U7MA 5JOFB 3PWLB 5DA4A 4U6XA 3O3EB 1W72H 4K3GA 1DBKH 1DBML 4F37F 4TQEL 5I1KL 4ETQA 1S7UA 3DSFH 3C5SA 3SQOL 4K94L 4N8CL 5AZEH 3LKOA 4M8QB 4OFYA 2VXUH 3D3VB 4GT7A 4XC3L 4F15B 3MV7E 3VMOA 5C1MB 3EO0B 5I1CH 1CDHA 3OKMA 3C6SA 3E3QC 4WHYG 4JFOB 4J3OC 1PD6A 4Z5RA 4NO5B 4FFZH 1ZHBA 2XACC 2Z91B 1BJMA 4XP9H 1X5LA 1X3DA 2ZCHL 5EWIH 4GQ9L 5DMKA 1HH6B 4AEEA 2ATKA 2X10A 1DBAH 1VPOH 3H0TA 4O2CB 4X9HA 3UP1A 3BEWB 4FQXD 4FP8L 1U8KB 3NA4A 3O9WA 4FP8H 4XCFL 1QACA 1NBYA 3T77A 1JJUA 1KN2H 1Q0YH 4U6VL 1I1CA 4XCFH 1S7XB 5DUPL 1OAYH 4GKOA 3S3JA 4KKLC 2XTJD 1P84K 4KV5E 5C08A 3KYOB 1WFTA 5IHUH 3D9AL 5FOJA 5D7JA 3D9AH 4U7SA 2H26A 3LCYA 5E8DL 5KVDL 4MD4A 2R0LL 1CYGA 3UTPD 4YDLC 2IBZX 2XQYG 3BZFA 3QEQE 4H1LB 2XZAH 4XXDB 5FXCH 2XZQH 4Q97A 5T5NF 4LEXH 4Y7MA 2HKHL 2FIKA 4WTZA 5DTFB 1F6AB 2NY0D 4J1UA 3RVXD 1IC5L 1UXSB 3EOBB 4Z7UA 3QDMB 2DKUA 3CFEB 4N5ED 1NBVH 2Y6SC 1MQKL 3FFDA 2NLJB 3RGVC 1KB9J 5HHOA 1S7SA 1F4WH 4P57A 2FEDC 3MLVL 5DJ8A 4X98A 4WU7A 3MRKB 1T7WA 3Q2CA 3VFPA 1GC1H 2Z35A 4PJ5D 5TJWK 4ZUWB 1OD9A 1BQLH 1RULH 4I0PD 5DZNA 2IGFL 3R1GH 3K3QA 2Z8VC 4XX1G 5FOBB 5IB5A 2YA1A 1ZT7A 1UVQB 3PWUA 4JPKL 1IAOB 3VG9B 5CP7B 1Z0MA 2QSTA 4LVEA 1F02I 3BQUB 4Z0BL 4MB3A 4WUUD 3HR6A 4JEGB 1UXWA 3BN9D 4LFHD 3VFOA 5AG9A 3JUYA 4LLMB 1J0YA 2XKSA 1N0XL 1C16B 1NAKH 3H9YA 3RWJA 1E4XI 4NQTA 4PRPD 1CL7I 4MD5A 1G84A 2C3GA 4HWBL 3MRNA 4OKDA 1T1YA 1FYTB 4MGXA 3T08A 1S7RB 4FQ1L 4M4RA 4MWFB 4LGPB 3GBLA 2GHWB 1U3HA 4X5WB 2CH8A 1PLGL 1RVFH 2HFGH 4X6EB 2F53A 4ZPTB 3O2DL 2DB8A 5F6HI 4LCYB 4AZ8A 1WWWX 2D7OA 5IB4B 4I18A 5JR1L 3KJ4B 4EN3C 3LQAH 1FSKC 1QBLH 2CRIA 2O5YH 3K1KC 2X4UB 3WXVL 3UPRB 3TCXA 5F6IC 1AR1D 5L88L 4QNPE 1D5BA 4XH2B 2QADB 1J18A 2DI8A 1AP2B 3UTSD 5IP4A 4KKBC 5D8JH 4YHML 4OI8A 4PREB 5CGMA 2AQ2A 5LBSH 1K4CB 4RMWA 4DGIL 4NOFA 3QCUH 2VKWA 4P46B 5FB8B 5DEFA 2R2CA 4ZQKA 5H94A 3GO1L 12E8L 1Y0LA 2VWEE 3G9VA 4HEPG 3QA3B 4F7CA 3L3OB 3BEVB 5HSFA 4OSUL 4ONFH 3KDMB 3ZYIA 3CXHJ 4OSUH 5TE4H 4LHUD 4XVSL 1DCLA 3F58L 1DEEB 4GS7C 1AKJA 4NQSA 5HYJD 4IDJL 5F9JB 4DN4L 5ITFA 4JFDD 1HIML 2W0KA 4NJAL 1G9ML 4OUUB 2PTUA 3V6OC 3AREA 2OTUB 1OAKH 4LNRA 3HI6L 1FO0B 1NGPH 1NSNH 4H1LH 3QQ9C 4GSDL 1U58B 3VWKD 3I50L 2A83A 5GS0D 5HPMA 5EBMB 3ULVH 2ESVE 1SEQH 1JGDA 1CBVH 2EE2A 1KIUA 3FMGH 3QRGH 4ODWA 3HI1B 3BKCL 1DDHA 2VIRB 3FB8B 4MXVE 1DSFL 1E28B 3RY6C 1U8NA 3STZB 4BSVB 3IS0X 1GXEA 1K3IA 1RZKC 3D39D 4D0CB 3MRQA 1TPXC 1VACB 3B4NA 3RNKA 1U8OA 4K8RL 2B4CC 1XR8B 2BY3A 3HUJF 4Y4KA 5C0DA 3C9NA 4K8RH 1PKOA 4PV8A 5DQJA 3QG6A 3LIZH 5D1ZB 3QI9C 5TDPA 3TO4A 1D3CA 3SGJA 3LEYH 5F7NC 4WV1B 2FB4L 3BWAB 2FB4H 5E9DD 1BVKA 5KSAD 5DJZA 1FNLA 1X5IA 4HWEL 1GZQA 4DUVA 3OGCA 2A74B 3KJ6H 4LQFL 3WLBB 3MYZA 2NCMA 3DUUB 2R4SL 3V7MA 4G8GA 4X9BA 3B2UC 1MFNA 4XB8A 1YEFH 1EMTL 5EO0B 2EDDA 1NKRA 2G5BB 2UVEA 5ECJE 5MHSE 3V6FB 4NCC2 1JNHB 3UTQA 2MMXA 3QH3B 2VDLH 4M6NL 3O6ML 4ORZC 3NVQA 2ATPB 1YYMH 2YEZA 3OR7A 1CF8H 4D9QE 1BQSA 3FQRB 4LVOB 4XCEA 1I1YB 2R29L 1OW0C 1A1OA 2GTZA 1MOEA 5HPOA 3U7WH 4JRWA 4H8WC 4YH6A 5HGHB 4ODXA 5EU4A 3W9EA 4ZPVA 1RZIA 3CK0L 4X7CC 3CH1A 3WFDL 3IDJB 3WFZA 3WFDH 3EJYD 3VFWA 1FZKA 3KPPA 4X5LA 1DQML 4Y88A 4MAYD 4F58H 2G75A 2IANA 5K9KA 1WBYA 3DVNB 1GGCL 3DETC 3BKMH 4JRYE 3ULUC 3A6OA 2NZIA 4JY6A 1JV5A 4G7YL 4O4YH 1ZK9A 3QNZA 1EA9C 2P8MA 3QUYD 1IGML 1QBAA 1MLCA 4KJWC 2CDEA 2YKLL 2Q7YA 4PGBB 3TVMB 2VERN 5HJ3A 2BNQE 4ZOEA 2F8VA 3M07A 3JVGA 4NN5B 5H35A 1ONQB 4Y16A 5CBAA 2XN9A 1U92A 5E8EA 2K7QA 1X9QA 4GQPH 4QLRA 3WNLA 4JG0H 4MCZB 2A73A 1INDL 4QHNA 4MJ4A 3TBVA 1INDH 4MNHB 4DCQA 5IUSA 1K4DA 1GZPB 3SBWA 3WIIL 5D96C 2DQIL 2OK0H 5I1JH 3LRGA 3WHE0 1ACYH 1NBZA 5FM5M 4QRTB 3D3VE 4NN7B 5F1NA 1YN6B 1WC7B 3QHZL 3WYRA 4AEHH 4YIQA 1SM3H 3S36H 3TO2A 5ICXB 3QHZH 3DSNA 3FFCB 2WQRA 3O45B 2HJKB 3IDGA 4WW2F 1PG7L 3IU4H 4U2ZA 5CLTA 3Q3GA 5ANMA 1CDJA 2B8OT 5IB2A 1MRFL 1JTTA 4UT9L 2XXMB 5DR5L 3FT2A 3K2UH 4HFWA 2WBJA 1SMOA 2ID5A 4QTHB 3D0VB 2C4XA 4UAOC 4YFLF 2G9HA 1YY8A 5D1QC 4EI5C 5CGYC 2EYSB 4OUOA 4HLZH 2F54D 3IVKB 3NCYS 1P1ZB 5DUBB 4NM8H 4DVBA 1XGUA 1J86A 3ARBC 3VXRB 3C2AH 4D9LL 2JTDA 4QRQA 3VDBA 3CFBA 3WO3B 2W65B 3MRDB 5B3JE 4JVPA 4P5MA 4M00A 2XWJB 1EAJA 4KWUA 2EDXA 2QR0A 3TLRA 3OJDB 3H42H 4PR5A 3ZDYE 4P2OA 4CUCA 1MQ8A 5CCKL 5L2KE 2LVEA 2NY4C 3ABZA 4XP1L 1UC6A 1KB5L 3ULVE 4KI1A 3NPZB 5CFHA 4E5XA 2GJ6D 2H6PB 3HFMH 3WS6C 2NYYC 1YNTB 5HHNA 2FBJH 4R2GB 4E41B 2A2QT 3HLAB 3L9RA 1B6DA 1VDGA 4FFYH 4GUPB 5F1IB 3PG2A 1CFNB 3KYMB 5BS0D 1NAMB 4RNRB 2DIBA 3QUZC 1AC0A 4LLDA 4FABL 4G9FB 1FORL 4FABH 1KPVB 1RZFH 5MEOB 1SJXA 5C8JB 5IESH 4NZRH 2JIXB 4AM0B 5IMOA 2VLLA 3MJGX 3ARRA 3ARGC 3QUMA 1EGJH 1MRDL 3FB7A 3KPSA 3AS2A 3I2CH 1I4FB 3EDJA 3FAWA 2BSED 3SCMC 2CMRL 4JFQA 1JPFA 1NLDH 2KL6A 4Q6IB 5L7XL 1T89C 5CEXA 2EKJA 3CIQA 5IMLB 1NLBH 1OGTB 4PTTB 1A4JB 5KS9A 4U6HB 1FYTE 2DF3A 3HAEG 2DBJA 1KV3A 2GK2A 2XA8L 4ZO7A 4JPVL 2LU7A 2NY2B 4P9HL 2OYPA 5EZIH 4QY8B 3HNVL 1PFCA 4L1HA 1CFQA 4AL8H 2Y4SA 5KBNC 4P5KA 1RHHA 5HYSA 4OFVA 5EUOB 1FZJB 2MPAL 3O9WD 1XIWB 5SWZA 1T5WB 3ZZ1A 2IALB 5JTWA 1T0MB 1E4WH 5FKPA 4N8VG 5ABDE 3ARFA 1HHJA 5C08D 3CDGA 5F8RC 5GHWL 1J10A 4ZDHA 4J4PC 4F9PA 2H8PA 2DQCL 3VRJB 1OT2A 2J8OA 5D7JD 1YNKL 2P49B 4D0BA 4ZOAA 5C0IB 1UCBL 1UJ3B 1RJYB 1SJHA 3WFEL 4KROD 5C7XL 4YBLC 4M43H 5ALCH 5E7BA 1IC4L 4RX4A 4X8XA 5C7XH 4HWZB 6FABH 4KI5D 5D1XD 4WW1A 2I60L 1CXHA 3GSNL 2NXZC 2YXMA 1SY6A 4D0DB 4JGUA 3DHJA 3PL6C 5D2LB 3LMJL 2YPLB 2R4RL 3QUXA 1ETZA 1MCQA 3N85H 3G6JE 1X44A 1KCRL 2IAMB 4OLZL 3L5HA 2Z4QA 3GSWB 1KEGL 1RUAL 4OLZH 4FZEH 4ALAL 1WCQA 3GMOA 1BOYA 1YEKH 3AB0B 2P8LA 3DO7B 1IQDB 3MACL 3LN5B 4PJFB 3PV7A 3G5YB 2JCCF 1K6QH 4MJIE 4LAQL 1WEJH 1PSKL 4YUEH 3JSSA 3CXDL 5ACZA 1KJ3H 3MBEB 1XZ0A 3I3DA 5TE7L 5MI0C 1Q9LA 4X6BA 4Y19A 4GXVL 5GRJH 3NCYP 3SDAA 3GK8H 2IH3A 5D6DC 1NAMH 4MMXC 2BK8A 4OFIA 3RUGA 3UXFA 3VD7A 4CAGA 1F4AA 4QCIB 4O51A 4HCRA 1IGJA 1VEOA 5GJTH 3VFNB 1G7HA 1AIFA 2X7LB 1U3HD 4Y4HB 4ZYKB 4OIIL 4GAGH 1YEEL 5HI4C 3WXWL 1TIUA 3MJ9A 3W11D 4OIIH 3T0EB 3WXWH 5KOMC 5BV7C 1FZMA 1RJCA 2V7NB 4KQ4L 4BH7A 4ZUTA 4P3WA 4K3EL 4L8SA 1QSFA 2YD1A 5GGSA 3LKQA 5GGRA 5HY9B 1R5IB 3GMPB 4J3XA 3U0TA 2Y25A 2DKSA 4KZEH 1EFQA 1T3FA 5GS1C 2NX5D 4C56A 3U6RB 1HKLL 4K71C 4AEIL 5DJDA 1TTUA 1T20B 1AGDA 5DO2C 1E27A 1PQZB 3GSRA 3LSOB 4MA3A 2HG5B 1M7DB 3ULUF 5D7KE 2A9ML 5DMGC 3F7VB 3VDAA 1F6FB 5TDOB 4BKLA 5ESAA 4ODBD 5E1AB 3WMSA 4NKOB 5HGAA 1YMMB 2VXSH 1B4JH 4WO4C 2R1YB 1KFAH 1ULVA 1MCPH 1QBMH 1NGWA 1Q0XL 2W0FB 3U79A 1M7IB 1G6RA 1F3RB 3KS0H 4U05A 1I1AC 1WQVT 4LLUA 4NHUA 2LU4A 1BMGA 1A9EA 1FBIH 1IAIM 4U4BA 4XHJD 1MUJA 3B9AA 1H15B 1K5NB 1WZLA 1MFCH 4G5ZH 1RV6X 1TJIL 4LCCB 2K1MA 4W4NA 5IJVB 4PJXF 2BSRB 2ARJB 4TOYH 5HVHC 3OKDA 4HUWB 4HIIA 2C1PB 2GUOA 2YWYA 4HKBB 2E3VA 1OSZA 5FYKU 1AD9B 4HZLB 2ZUYA 3W5NA 2JB5L 1OP5H 4HF5H 1ZLUK 1ZT4A 3RWEA 1INQB 2F8XC 1DN0B 3EJZD 3TZVC 2PR4L 3CSYA 1RSFA 5I8KH 4A6YL 1KEMH 5E4EC 3RWFB 2FGWH 1JNNL 3F12B 5MP6H 3HI5L 1MCOL 1TQCB 3HI5H 4LSSH 1ZMYA 1FAIL 1QG3A 3WUWA 1RMFL 1BBJB 3GBML 4R0LC 3AFLA 4IS6B 4NPYB 4Y4KD 4H26A 4MDIA 4BQCA 1B6UA 1DVFC 1UCTA 5IFJA 5GZOC 3WHXB 4HEME 3FCTA 3IJHA 3FRUA 2NY5L 1IBGL 1JF6A 2NY1D 3OAUL 4POYA 4X6FA 3P77B 4X7TB 3TT3H 4ONGL 1KENL 3QBTB 1KELL 4EDXA 3HZKB 1PJ9A 3O6FA 1QVOB 1A1NB 3GBNH 1VSCA 4M5ZH 4XP4H 1TXKA 4Y5VC 3FFCE 5J11B 4YAQB 3MLZH 4JZJA 1T22B 3ZHDA 2YZ8A 5TPWH 5DQ9B 1YEGL 2A0LD 3D5OF 4BQBA 1H8SA 1NGYA 5KN5A 4FS0A 1EZVX 4P2RB 2C26A 3HUJA 2AJZB 2LAAA 3BPLB 3JV5A 43CAB 2HJLA 4PFEA 5HGDB 1J12A 4YE4H 1CIUA 1T1ZB 2VQUA 5D7IB 3Q6GH 2Q86B 1OP3H 1PKQA 1YPZE 2DMBA 2V7HA 1RIHL 1HXMB 4PJ9D 1HSBA 1OQXA 3IF1A 4LLQB 5C71A 1UKSA 4AYFA 2DQEH 3RDTB 2VXTL 5I30H 1FVDB 4OV6F 4CVZB 2E6QA 2Y5TA 4GG6E 3VXRE 5D93B 1AO7D 1RHFA 1A0QL 1FNSH 3B5TA 4HK3J 5C0CD 2R2EB 2XFXB 3L3JA 1F13A 2CLRA 1HYSC 3VXNA 5L0QB 3RTQB 2WLYA 3BYYA 1ZANL 2W9DH 2ICWA 1NMCC 1WIPA 3ZE2E 3QO0B 5DD0L 5B8CB 4ZFOB 1CICD 3X3FL 5F3BA 2XZCH 3E2HC 2A6KA 1U8MA 2YHGA 5DD6A 4M1CD 2AGJH 3CCHB 1VADA 1JN6B 2CLZB 4M6MH 3VFMA 5IEKA 3WUZA 3OKKB 3K46A 2O93L 4WDIB 5DK0A 1U91B 4V1DB 2CLVB 1XF4A 4G3YH 4F7MB 2VZSA 1J5OH 5DHYB 1S3KL 4UUJB 5H2BB 4CN6A 3RZCC 2AJYL 2WBKA 4JE4B 1IAIL 4XPAL 1WZKA 5CJOL 4UDUA 4Y16D 4G9FE 1MF2H 4JO3H 1QFUL 1MCWW 1UZ8B 5EBLB 5AUMB 4CW1A 1CD0A 4U1KA 2YN5A 5I9QC 1TDQA 4ELKB 4HJJL 4PUBL 2NY0B 4G6FD 2MSPA 4TTGA 5F9AC 4UOJA 1MLBA 3G04A 4R26H 1CGTA 1LE9A 3VD3A 3O81A 1EAPB 4R3SA 2CO6B 1BAFH 3SO3C 3UBXI 5JOPE 5E0QA 4KHXH 5F70A 3MLUH 3MJ8B 3SDXB 3TH3T 3GNML 4OT1H 5E2JA 2VC2L 5T1LA 2Z31A 3CD4A 3EGSA 4IDLA 2HFTA 3MJ6A 1BX2B 2R69H 2J4WL 1WAAE 3IJYB 3MC0A 5DC0A 4YFEA 3DX6A 4MDJB 1TTGA 1XGQB 4N1HB 5FYJL 3PGCB 4FQ2L 1R3LA 3EO9L 3IDMA 3KYNA 2HTLD 1RZ7H 4WWKA 2BMKB 1J8HD 3NMEA 1NDMA 3MGOB 2BFVL 1NCDH 2WAHA 1QSZA 4P23D 3PIQA 1DQLH 5FKAA 4JRXD 4WW2A 5J7CC 4WHTB 4X6CA 4QXGL 3WIFB 4XPHL 2MKLC 4QXGH 4XPHH 3BH8B 2FO4A 4EQ2A 4U0RC 1HHKA 4P2OD 3KPQA 3QHTC 1KJMB 1H8NA 1Q9OA 4XAKD 5EIQA 2ZSWA 3PWPB 4JGMA 4JHWL 5IWLC 1CFTB 1JGEB 3HC4L 4ZODA 2VDMH 2QKIB 4PRHB 1F8TL 3HZVB 4HHAB 5D71H 4U0QB 2RFXA 5L8LB 3C5JA 3CC5B 1T83C 3FONA 5K9QG 3RGVA 4L5FL 1DE4B 5IB1A 4OZIA 3PNWA 2YPLE 5EDXA 5FF6B 1ZGLB 1CE6B 1JF1B 1RIUH 2DJ4A 3KPMB 3HA0A 1QQDB 4HUMB 4MNGE 3S5LB 5C0JB 4HDIA 3SDCC 4JANA 3RWCB 4CVUA 3AMLA 3NIFF 4PBXA 3LPWA 1EDQA 4NWTH 1GJIA 4ELMF 2Q3ZA 1N8ZA 4KPHH 5E8OA 1R3IL 3BRGC 3MRMB 2NY7H 4AEFA 2Z92A 4ZXBB 2X1XR 1HQ4A 4PJGB 5CHNA 4PJFE 4POUB 4YPGB 4YJZL 1SYVB 4XWOD 3RHWF 1CLOH 1JP5A 4RGMB 4F7EA 3BUYB 4OM1H 5C0AA 5MEQB 2E7HA 1IAKB 1ZEAL 2X4NA 3QDGB 5F7DB 4Z7WB 1JNJA 2AXFA 4P59L 5KVGH 2P5EA 3U82B 5GGQH 1MCBA 4ENED 5B39B 3VFVB 4W4OC 3MNZA 3TM6A 1NGXB 4EN3A 3S4SA 5ESVB 2P8PB 3BSZH 4L3CB 3I3EA 2R2BA 4CMHB 3NZHH 4M93B 3ZE1E 4Q9QL 1R3JB 1YMHA 1RUKH 2EH8L 4IMKC 5BQ7B 3FT3A 3MCKB 4HZAA 3QIUB 4XNYH 1S8DA 3RVVC 5FO8A 3BKJH 4JFEB 4P99A 2EXYC 4DEPB 3OR6A 3PQYD 3MV01 2YPKA 1E4XH 1OGAA 2IPTH 1LEKB 2A6IA 1CL7H 3GMMB 1A7BA 3ARFD 5E2VL 3IDIA 1M71B 3L7FA 2BNRB 2VUOA 4Y2DD 4UTBL 5C6TL 5I8EA 4OD2A 3T0BA 1UB6A 3H3PL 4OTXL 4NP4H 5C0FA 4KQ3L 2DDQL 2IWGA 3BW9A 4JY5H 2OQJB 3LN4A 2EYTB 4XP6L 1DN2A 4RX4D 1UWGH 3CFJB 3R0MA 1YMME 4DAGH 1KACB 3L5WB 5LGHL 3WIHL 3WIHH 5KSAB 1A7RH 4ZAKB 1GHFL 5EZOL 5I2IB 3V6OA 4PJ8C 3EFFB 4MJ5A 5IVNA 4O5LH 1PDKA 3ZTJG 4OCWL 3WFHB 1HDMA 5HDOA 3CMGA 4Y8AA 4YHNB 4O9HL 1F3JB 3E6FB 5CIPB 3O6KL 5DS8B 2X70B 1ZT1A 4IHOB 3W0WA 3O6KH 4HKJA 4OGYH 4WWID 4Y1AA 4Y4FC 3UTTA 2EXWD 3DXAD 3W39B 5DD5L 3RY6A 3VXSA 4HGMA 4M9OA 5I1EH 1LQSR 4TSAL 1IT9H 3OHXB 4KJPC 4GRWH 4K2UL 4TSAH 2NW2B 3CVHB 3SDAD 3R4DA 1XCTB 4OKVB 4F3FB 2J6EH 2X4TA 3V8OA 3HMWH 1EO8L 4QXUL 3QI9A 1YEDB 4GW5B 5GIRA 1EBPA 3B5GA 4O58H 1KG0A 3MREB 1BF8A 1QSEE 3AAZA 4ODSL 4S0SD 5GQBA 2WP3O 3ZT5A 1Z3GH 4NO2B 4NQCD 3U4BL 2JCCA 2X44D 1R0AH 1JPGB 1QSFD 3RA7H 2NXYC 1XF3B 1ACZA 2D4DA 5E8NB 5DJYA 2ILLA 2OX5A 2JJVA 4PLKC 4Z76B 5L8KB 1MIEL 1MY7A 5ID1A 5FM8A 4DUWA 4MLIA 3NBNA 1LHZA 1CD8A 1Y6KR 3HMXA 5GS0L 3GSXA 2V2XB 4P2RE 3RGHA 4ODUB 4XRCA 2V2TB 5T1KA 2F19L 1OW0A 5DD1H 1BM3L 4NQVB 5D7IE 3GMRA 4M1DH 1RUPL 3QIBC 2DBLL 1DLHB 3OXRA 2R0ZH 1RUPH 1JYXA 3LV3B 4G6KH 1JYVA 2P5WB 1BQHA 4N0YL 5A2IH 1D5XA 2W60B 2NNAA 5F97E 2D4FA 5F89A 3VE0B 4PJIB 2PTTB 2DWDA 4XNMB 1WISA 3KPLB 2BVOB 4XWGL 1A14H 2D7QA 2IBZY 2HT2D 5HHQB 2CXKA 1SHMA 1NCBH 1X5ZA 3HPLA 3RPIA 1BLNB 1VHPA 3VA6A 1ZLVH 2EH7H 4X4XB 5TFSH 1BFTA 5DK2A 1KIQB 1HNFA 4ZUVB 4OB5H 1GAFL 5T3XD 3JWOL 1A1MB 4V1DE 3DX9B 2AK4B 3FT4A 5DRXA 3GI8H 4PGEA 2XTJE 1MHHA 1KCVL 3C8DA 1CZ8L 3D85A 1VERA 3RRQA 3E6HA 4GBXC 1MCLA 3GHEL 1EFXA 2PETA 4LVHC 1CR9H 1UH3A 5E6IB 4OQTA 2VDQL 4XNQA 4HUUA 1C5CH 2HMID 5EZJA 3D1MC 3L3KA 3F7RA 2EIZB 3BDYL 4PY8J 1PW3A 1IM9D 3BDYH 3L5IA 5LQBH 3C5ZC 2APXA 3O2VH 1MI5A 5EO1B 3AY4C 2Q8AH 5DUMH 4PJCB 4S2SA 2PXYC 3OJ2C 1UM6L 4NGHL 3CVHH 1NFIB 3OX8B 1UM6H 3MFFB 1KF9B 4UZGA 2RCSL 5E99H 4PRNA 2FO1A 1KTLB 3P73B 4X7SH 3SDXE 2CIIA 2R1XA 2VLRD 4ZUUA 1S7TA 4HPYH 1CD9B 3ARDC 4X6DB 4UILH 4CN1A 5KZCD 4J2XA 4APQB 1N5AB 5B21A 5L6YH 4X80L 2RAMA 4X80H 4YXKL 4I9WD 1YY9C 2YA0A 1DR9A 3DVGA 3KLDA 3GJFB 5D1QA 4EI5A 1N6UA 4JFPA 4U6XB 1NCAH 1OF2A 5SV4A 4WY7L 5TE6L 1JWMB 4JPIA 4ZNEE 3IGAA 2VLMD 3PHOB 1L7TL 3NIGF 3LVEA 5F7EL 1MPAH 2ITCA 4OZHB 4ETQB 5IT2H 3C5SB 3N1PC 3QFDA 4GRMA 4LRIA 4BFBD 3LKOB 4QRPA 3DURB 3NCCB 4X4ME 1MCHA 5CBEA 3OKMB 3TJEH 3TYGH 5I1HH 1WIOA 3MA7A 4XBGA 4MQ7B 3CFCL 2AKRA 1Q9KA 5GGVL 4ORGB 2ATKB 3SDDD 2AXJA 3PWPE 2V2WB 4GAJL 3TA3C 3AGVA 4PRHE 2OCFD 4LLYB 1NFDA 2BJML 3MLWH 3T77B 4P5TA 1LE5A 4X83A 1QZ1A 2HH0H 3IAGC 4NNYA 3RWDA 1SEBA 4GRWE 3QUZA 5C08B 3EO1A 2CDGA 5IVXF 4MVBD 1I8LC 1HSAB 2DMCA 3FO9A 5D7JB 3U30B 2H26B 2HWZH 3JV6A 4NQED 4MD4B 5JUEL 3G5VA 2ICWI 4M1GH 3JWDL 4AIOA 4PJGE 2PW2A 4P2QD 4H1LG 4HC1L 1V3JA 3BZFB 4UIKL 2VR5A 4MXWL 4LASH 5A2FA 4ZUSB 3B8SA 1KNOB 4L3EA 3TBSB 1FIEA 2R1WA 1BP3B 4DZ8A 1T89A 5BOPA 4J1UB 1N6QH 3QDGE 4ZD3L 1P5VA 3T4AB 3FQNA 3KXFB 4Z7UB 5F9WB 3T0DA 4UV4H 5FCUH 4JFDE 1K8IA 2DQHH 5KVEH 3GJEA 4D2NA 2KDGA 5HHOB 1S7SB 4NRZA 4NJ9H 5DJ8B 5L9DH 2PW1A 4WU7B 3NFNA 5B38A 1HXYB 1X5JA 4PTUA 5T1LD 1RU9H 1CU4L 2Z35B 2HRLA 2RR3A 5F7HA 4LKCA 1BQUA 1EUUA 4K3HA 5IB5B 2BY2A 5FGSA 4GO6B 3OAYH 4MXQC 5KANI 3F6LA 1F4YH 4M61A 1JMZA 3IDYC 2CUHA 4JFEE 4KKLD 3RY5A 1OAXL 1UXWB 4RGNB 1AFVL 4MNQA 2CD0A 3RL1B 4LHJB 4ODTH 3RWJB 4HWBA 4MD5B 3WNNA 4C4KT 3L95A 3GMLA 4Y2OA 4TNVF 1T1YB 5GGVY 3UYRH 4U1LA 3FQUA 4R7DA 3TBYA 1FO0L 3HHRB 5FK9B 3O2DA 1U3HB 2F53B 3KHOA 4NHCL 3ARQA 1N5YH 1FRGH 4I18B 1CDYA 4JVWA 5JNYA 2IMMA 4FOMA 1MJ7L 2VWEC 1FPTL 2BCKA 4MAUL 2Y6SD 4MAUH 3RGVD 4M3JA 1ZTXL 4PRIA 4TVPL 1J11A 3VFGH 2FEDD 4HIHA 1YEHH 2ERJC 2H45A 1NCWL 3N1MC 4WFHD 1HZHH 4G9DA 1NCUA 3G5ZA 3D2UA 5IIEB 4HK0B 3TV3L 2HVKB 2DQUH 5IW6A 1EV2E 4NQDA 5DEFB 4L9DA 1CCZA 4ZQKB 4S1QL 5H94B 3MOQA 4HS8L 4KY1L 1Y0LB 5JHDA 2EZ0C 1P4IL 2W9EL 3O41A 4G42A 3EKCA 3HC0B 4LF3B 3V4UL 3IFNH 5DURD 1L7IL 2ADGA 1I9RL 2F74A 2NY3C 5D7LD 4DQOH 4YHOH 1AKJB 1LO2L 2FNBA 4NQSB 1FDLL 2VQ1A 1LO2H 1TITA 4OBSA 2AJUH 4P9ML 2P5ED 3JTSA 4ZO9A 5FV2A 1VA9A 4P9MH 4IRJA 3LEVH 3AREB 4NFCA 2F5AL 3GM8A 4UV7H 1JWUA 2FX9L 4OAWA 3H3KA 4U3CA 4XC1H 4ELMA 1KN4L 1OM3L 4EN3D 1T4KA 2A83B 2ADFL 3ZDXF 4RBPH 5HPMB 1M1SA 1FFRA 1JGDB 2ADFH 3TPUB 1FGVL 3BJ91 1U3JA 1MFAL 4NZTL 5F7YC 4ODWB 1Z9OA 3QJHA 2UWEE 4XMPL 5DJCA 5JW4M 4JM2A 1DDHB 1ZHKB 1HWGB 5GS1A 1NJ9B 3KYKL 4XXCA 2FX7H 2XXCB 2FRGP 1EEYA 3CMOH 4HMEA 3BZEB 2J2ZA 5ALBL 3SJVA 2UY7A 5C92A 3CGTA 3RIAK 3MRQB 3BP5A 3RNKB 3HPJA 1U8OB 1BD2D 3QIWC 1TVBA 4OCSH 2Y9RT 4GW1A 5C0DB 2ARWA 3C9NB 3QG7L 4PV8B 3RX5A 1TETL 3QG6B 4PJHA 3E1F1 2O5ZH 3QHFH 4DFIA 5TDPB 3TO4B <