4XXDB

Crystal structure of mid-region amyloid beta capture by solanezumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
206
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFSRYSMSWVRQAPGKGLELVAQINSVGSSTYYPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCASGDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light Chain
publication title Molecular basis for mid-region amyloid-beta capture by leading Alzheimer's disease immunotherapies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 206
sequence length 211
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xxdB01
2OXGA 3RTQB 4G42A 5I30H 4U0RC 2BOBB 4LPYA 2ICWI 1I3RB 4HWZA 2PW1B 1JTOA 1RJZA 3KS0J 5B39A 3DRQA 4U1MA 3L7FB 5DJXB 3QO0B 5SX4H 3U0WH 4R4BA 3IDXL 3LRSB 3VFOB 2LVEA 3BEWA 3TFKC 5DUPH 4AEFA 2X1PA 3ES6B 3KGRA 3HNVH 2X89A 5F9AC 1YYLL 1DUZA 4NQCE 1LVEA 2JIXD 5EO1A 2DBJA 1U8QA 3EYSH 4Z7UB 3EO9L 3UDWC 2CLRA 2JELL 4R90L 4NCC2 4MJ6A 1VENA 2A9MH 4HDIB 3MLVL 1S7QB 4XMPL 4YHLL 4M5YL 4Y89A 1EGJH 1FG9C 3CFJA 1L6ZA 4KDVA 1FNLA 5A3IC 3OAUL 4DK3A 5D72L 5JQHC 1BD2A 2AEQL 3VFPA 4MJ5A 4NWTL 4HGKC 1A7PH 5DWUH 1YDPA 3BDXA 4DEPB 2ZCLL 3K74B 4I4WB 5IT2H 3C87A 3LEXA 3SGKA 3MPCA 1AXTH 2BDNL 2R0ZL 3BWAB 3V52H 1GGYA 3I3DA 4EOWH 4G8IB 2XPGA 1IEAB 4M6MH 3QCVL 4ZTPH 1OQXA 3MLZH 3AU1A 3FQWB 5D2LB 4HF5L 4JFED 4O2EA 1CFSB 3N85L 2EDOA 3P0YL 1UJTA 3MBXH 4U49A 3MOAH 3SKJL 5IBTL 2ESVE 4Y2DA 3ARBC 5ID1B 3NTCH 4XCYA 1KEMH 1MCFA 4JDTL 2DM3A 2GFBB 3FO1B 2MSPA 4POUB 3CU7A 4QTHB 4O58H 2UVFA 1OARH 3RY6C 4EZMA 2E9WA 4JVWA 3TN0C 4Y5YB 2ADGB 3GRWA 1P6AB 2X1WL 1U92A 3W2DH 4M3JA 1A0QL 1AGDB 5A16A 4PJ5B 4MD5B 4WV1A 5JDSA 4GW5A 4AENB 3UX9B 3PWPE 4OTXL 4P5TB 2FX9H 1HH6A 4LVNB 1BMGA 3IKCB 4OCNC 3VFUB 1G84A 4HAFA 5ISZA 2Y07L 3OKLB 4JPVH 3U1SL 1BIIB 2PXYA 3O4LD 3KJ4C 4G8EA 1QOKA 2CLZB 1HQ4B 1N8ZB 4YBLB 1WZMA 4K7PY 4GAGL 5BZDA 4ISVB 4OV6F 4IEFB 2W0KA 2WP3T 4XVTH 2FWOA 4FFWC 2W07A 4KHXL 4AIOA 3BRFA 3VGHA 3MV9E 4LOUD 3NACL 3PWLB 2HRPL 5EBGA 1QBMH 3SKOB 3K4AA 1G9EA 5F1SA 1B3JA 3MTRA 4F7MA 1WSST 4OB5H 3OKMA 4YDIL 1INDH 3JTTB 1MHEA 4KAQL 5IQ9B 2IG2L 1F13A 2F74B 1MFAH 1T0PB 1EAJA 3O8XA 4P99A 1JF6A 4H25A 1KG0A 5I76A 1NEZB 3PDDA 4ZFOB 4JFDA 3D1MC 2CH8A 3T77B 1AO7D 1TLKA 3MCLH 2FLBT 1JPTH 3BYTA 5DDHB 4HULB 4XPGH 1CTOA 4UOW0 3ALWA 3BSZH 3GFUA 3P0VL 1NL0H 4PJFB 3WUWA 3SDXF 3ZO0A 1C1EL 1ZLVH 3WIFB 4KROD 3DX8A 4Y4HB 4WU7A 2BHZA 4Z76A 4S1SH 3QXDB 3AGVA 3BP6A 1IL1B 1AGEA 3EYFB 4OGYH 3RUGE 4DGYL 4X7TB 4RMTA 2EDXA 1T04A 3WKNA 3O2DA 1CFBA 2F53B 5F8RC 5TFSL 3CZFB 4IRSB 5E4IA 4X9HA 3V0AC 3PHQB 4ELKA 5I1DA 5CJQH 4M4RA 5BMFL 2HVJB 1CD9B 3NA4A 4D9QD 1W2KT 3S6CA 2YUVA 3FN0H 3X3GH 5I17B 2OTWB 1U91B 1KC5L 3OXRB 3MFFA 4HIXH 1M7DB 5HYSA 4YHYC 1JV5B 1EDQA 1KNOB 1VERA 1X5LA 1QHOA 1J0ZA 5C08B 1WC7A 5MEQA 1AGFA 3BP7A 1FO0L 1EJOL 5CGTA 1P4BL 3T4YA 2G60L 3KYKL 3OGCA 2R2HA 3C9NB 2UWEA 3TIDA 4IOIA 1AXSA 1GGBH 3PHSA 1GHFL 5ALBH 5GSRA 4ESKA 4JJ5B 2IPKB 1AE6L 1AFVL 1HZHH 3RHWK 1G7QA 4JHBA 3FT4B 1RIHH 4XVJH 4UIMA 2XZAL 4I1NB 5ILTH 4F57L 3MRQB 3T0WA 4WJ5A 2EXYC 3BKML 5JHDD 4WFEE 5DJCA 3VJ6B 3QAZC 1R0AL 1WZ1L 5TE7H 1KFAH 1HKLL 1VCAA 1I85C 5E1HB 5BQ7A 3GDBA 4LCYA 3T0AA 3DURA 3B4NA 4MNGB 5MENB 2IAND 3VH8B 2XN9A 4PGBB 5EFIA 3E8UL 1EK3A 3ZKNC 3IETB 1ORQA 1X7QA 4F9PA 5TE6H 4WGWB 1U58A 2NW2A 5D4QA 2H32B 5FK9B 2XZQL 1FDLH 1MCWM 3HHRB 4OGAD 1BX2B 4ZYKB 4P2QD 4D8PA 1QSEE 3HI5H 4CL7A 1FJ1B 3IXTB 5DMGD 5C7XL 1H9VA 3ARFC 3KYOA 3RDTD 4RWYH 5IBUG 3D25A 4HZLB 2J4WL 4PJ8B 1Q9KA 3I6GB 5DI8A 1IGCL 1XR8B 4J6RH 5KSUB 1IBGL 1D6VL 4WU5A 1H3XA 1S7VB 3QXUA 4LVEA 2X4QA 1CN4A 3ARDB 3DYOA 1EFXA 2DIJA 3QDJB 4N5EC 1AI1L 4ZPVA 5JXAL 3PP3K 4XBPA 1KELH 3AMLA 3QG7H 4V1DD 1T66D 2PN5A 4U6XB 1GZPA 1U3HA 5AD0A 1M4KA 1YJDL 2AV7A 3DVFA 5IF0A 2BOCB 3UPRB 3CSBA 1SM3L 5TDNA 1LILA 4C4KT 1EX0A 3AS2A 1NCDL 3CFDA 3DVNA 2XWBA 2CLVB 2JCCA 3FZUD 3GSOA 4XI5D 2O61A 1DVFD 4Y2DC 4XXDA 1N3NB 2FATL 3C5ZD 3S96A 4WWKD 2F54E 4BK5A 1DBAH 1ZT7B 5D71H 1ED3B 5DT1H 2J5LB 4XGZA 3WKML 3ZDZE 2EDJA 2P7TB 4D9LH 5ACMA 1Z5LA 4P2OC 4NHCL 1WT5C 5JZ7D 5GRUL 4XNZB 3QDMD 2ZCKH 1N6UA 5FA3B 5J4MA 4XP1L 4Y4KC 1JCKA 2CJUL 3SGJA 3HZKA 4Q7DA 3GMLB 3CVHB 5HDBF 3VXRB 3RI5K 3BT2H 3CX2A 3PV6B 4YBQD 2GJ6B 1OSZA 3VXNB 1I7ZA 5HD8D 5D1XA 3P73B 3ALXA 4OV5A 2F5BL 4RNRA 3Q1SL 5GS1C 1KCRL 5IFHL 3BD4A 4PJDB 5HHOA 5D2LE 4XP9L 2CUMA 3KPQA 4GRMB 1V3LA 4ZTOH 1CCZA 3G6JA 1AQDB 1QQDA 1S7SB 2OJZL 3HRPA 4ZS6C 5HVHC 4KMTL 4TQEH 3RNKA 2G5RA 1H3PL 5IMKB 2UZIL 4X6BA 5J11C 3DGGB 2VDNL 3LN4B 3NIDE 4LNRA 3D69B 5KS9B 5E2TH 3PNWA 4ZO9A 4TSAH 2XKNA 4M48L 3JTSA 1QACA 3D0LA 4KZEL 2ZG2A 1WCQA 4NO5A 2VLJA 4YHIB 5ITBH 1OF2A 1W0VA 3SGDH 3H0TB 1T1ZB 1UZ8A 4WW2B 3RWEA 2P8PA 9CGTA 4TNWK 1U6AL 5D7LD 4PJ5E 3PXHA 4IMKC 4PJHA 3Q5OA 5CP3H 1OT1A 1MJ7H 4LSRL 4F7CB 4RCAA 2MJWA 3TO2B 2Z8RA 3QNZB 3QJFA 2JB6B 3BGMB 3C08L 5GRVK 3TBTA 1R3HA 1A7QL 2LFGA 2FR4A 5DMIH 1T1YA 2Q86A 4G7VH 5IJVA 1KEGL 1U3JA 2NNAA 2ADFL 1EHNA 3NGBB 3PP4H 4MWFB 4NM4H 1XCTA 3MV7A 4RBPH 2M2DA 4QT5A 1UB5A 3QQNA 2X4NA 2Q8AL 3T65B 3QIBB 3WNOA 4JFEA 1PG7L 4HS3B 5I1LA 3MRDA 3B9KC 1MFDH 2AXFA 1ZHBB 4K23L 4QCIA 3O6FD 4J1UB 5GS0D 5F93C 4OF3A 3BO8B 4Z0BH 1H5BB 4GXUN 2FEDD 5J57B 5GGUB 1PEWA 3FN3A 2D9QB 4S2SA 3ZKMC 4APQD 4H1LG 3QIWD 1CDBA 5CBAA 5L7XL 2D03H 4MJIA 4D0CB 2LAAA 1CDHA 5L0QB 4M7ZC 2ZPKL 3BUTA 4QXTA 4C56D 1DBKL 2FLRT 3D0VB 1YNTA 4HXBL 3MO1A 4ALAL 3QDHA 5HHMD 1PG7W 3P40A 1OW0C 1J0KA 5DVLA 4NBXB 3O4LA 5CFHA 5HGDA 1FZMB 1OGAA 1R24B 2IPTH 1MCHA 3DROA 4JHZA 4OD2A 4EI5C 5EZJA 3NABL 1JGEB 5E5UB 1IGYB 2FH6A 3DRTB 2J2ZA 4MVBD 4E41D 5B3JE 4MCYA 1FBIH 4GW1A 3MACH 3H7BA 3TBVB 4PS4H 1J11A 1MLBA 4O5LL 1J8HB 4LF3A 1KJ2A 3LN5A 3GSQA 3RFZC 2G75B 2YD6A 4HMDA 4BZ2H 4F7EA 1DE4B 1BFOB 2XTJC 4TUJB 4ZS7L 5CD3A 1FQ9C 1CLOH 3IVKA 3B2UC 5GGRA 4UV7H 3CLEH 4L8SC 3GIVA 1XCQB 3MRBB 4O9HH 1UM5H 3MJ9H 3E0GA 4J3XA 3KPRB 5MHSE 1MQKL 3ZT6A 4H20H 4XPFL 3S37X 2D31A 3UTZB 1EVTC 2YUWA 3RGHA 4OZHA 1YN7A 3OKDA 3KPSE 2H32H 2A1WL 4JO1H 3TYFA 3RKDD 1OAXL 2M8XA 5FM5O 1U95B 4YWGL 5MENE 1KB9K 4JFOB 1DN0B 3EJYC 1CL7L 1PYWA 1U3ZA 5LAXA 2O5ZL 4L4VE 4CDGC 2V7NB 1S9YA 5DUMH 3D87B 4UB0H 3KNBB 3V4VH 3DV6B 1KIQB 3ZSTA 4HJJH 5H2BA 4EI6A 1SJEA 5FYLD 3UTQA 3MYJB 4XNQB 3TA3C 3FQUA 3SE8L 2VDOL 3Q3GA 1JZ5A 1LEKB 4Y4FC 1R5WA 4FTVB 4CW1B 3ZMRA 4TSCH 4WFHE 3VRLE 3KLHD 4ZFFA 2EO1A 1EEZA 2H26B 2P5ED 4I3SL 1ZMYA 4FQJL 4UAOB 4ZUWB 4PRNB 1WWAX 5I1EH 1EZVX 1J1PL 1UQSB 1XGQB 2B39A 3NFPB 5GJTH 1B0GA 1GC1C 4L9LA 4AEIH 3QDJE 4N9GA 3QFJE 3ROOA 1TITA 4FQPA 2LU7A 3CFCH 2AERT 3UTSD 3K2UH 5DVOA 5GHWH 5EULV 3L3IA 4FS0A 4JFZH 4NOFA 3RVXC 5IG7A 5IIEA 2ZSWA 1RZ8A 2VZUA 2MCPH 1OPGH 1QHPA 1CDGA 1DLFH 4QOKB 4JFHE 4OZIF 2FZ3B 3SPVA 2IANA 4JFFB 3EFFB 4I8DA 3QEGL 3QI9D 2COQA 3RVVC 1DANT 2R15A 1DANU 5DRNB 3MV8D 5J56B 1WITA 2RFXA 3CVHH 2EEDA 2H8PA 4HFWA 1MREL 1DQMH 2YHGA 2YPLD 1FFQA 3QULB 4XCCL 4XVSL 4D94A 2JJSA 4PJGB 5FYKH 1HHJB 1NCWL 4WFGE 1F45A 1PLGL 5JNYB 2VDPH 1WWBX 2WUCH 1R3LA 1BOGB 2WW8A 4RAUB 3VXRE 3D85B 4ENED 1JNNH 2GJ6E 3IFLL 3ARGB 5T5FH 2CUHA 1MCWW 5DJDA 4FZ8H 3G08B 4LGRB 1A6AA 4WI4A 2V7HB 2VQ1B 3ILQD 4ODVH 1RUPL 1R5IA 2PTTB 3QHTC 1S78C 1JGLH 3W0WD 4EN3D 4I9WE 5DUBA 2B4CC 3LHPH 4A6YL 4U0QB 3B43A 4S1DD 4KC3B 4E5XB 3V0WH 3OX8B 1H3UA 3VRJB 2KL6A 4PGEA 4H8WH 1F4XH 1N6QL 1A6TA 1EMTL 4QRRB 2A83B 4IRZH 1DVFA 1IFHL 2ORBL 1HNFA 2OJEB 4JO2L 4KTDL 4NFDA 4JR9L 3DIFA 3HRZB 3QJHB 4WWKA 5IBLD 4J4PD 4JY6A 3U46A 7CGTA 5DMYA 1G0XA 4PB0H 3L3OB 3W5NA 4U1JB 2AK1L 2EO9A 1RJYA 2NX5A 3RL2A 1QR1A 1BJ1J 1XGUA 1FCCA 3NCYS 4FFZH 3UZEA 5C2UB 3SQOL 3LDBC 5C0FB 5JOPD 4JQIH 4HGMA 1LK2B 4S0TD 1G0DA 5HDQL 5AZ2H 4Z95L 4MA3A 3VFRB 2O93L 1T5WA 2V2WA 2XT1B 3GSUA 4LLQA 5J1AB 5EIVA 3O0RL 4MA8L 1C08B 1QSFE 3S88L 1SY6H 3EJZD 2HAZA 3KPNB 4L8BB 1QNZL 4P5KA 4X6FB 5L88L 2YSSB 1ZGLB 5KTEH 2DB8A 3S35H 1Q0XL 5DMKA 1CFTA 5ICZB 5IMLB 4XRCB 4LIQE 1XAUA 3R1GH 5DK3A 5KVEL 1VSCA 3VGFA 3ZT7A 3ARYA 3BRDA 4H26A 4KHTH 4NKMB 1D9KD 5CWSB 4K3DH 5ALCL 1JE6A 2DQUH 3FT2B 5DEGB 3AXLA 1OWWA 1G6RA 2FSEB 1LK3L 4OCSH 5C2BL 4MNQB 3A6CH 1RZKC 43CAB 3LMJH 5GGTA 3VXMA 3QNYB 4LOUC 3ZKXB 3CUPB 2YPVL 4NO0D 3M1BA 3D18B 1MH5B 4XAWH 5HXMA 5IBUB 3ZHDA 2VZ1A 4WY7H 1JGUL 3NCMA 1UGNA 2PF6A 4EVNA 3S97C 1NMBH 5HPMB 5K9KA 5JA8B 4NNPL 3U7AA 1KN4L 2APXA 1UEMA 2NY1B 1GIGH 5JA9A 1ACZA 1U41A 3C09B 4NM8L 4X7FC 2R23A 1YN6B 2P5WE 4GBXB 3VWKB 3TESA 4MQTB 2VDRH 3WLBB 5IFAH 5D93C 5I8CB 2X1QA 4X7DC 1YQVL 4PGCA 5DSCB 1CFVL 3EZJB 3P0GB 4O4YL 4GKZB 2WMPA 4KROC 4OLZH 2D7NA 6CGTA 2PW2B 3ECBA 2QSQA 3LD8B 4NDMA 4NPYA 1SEQL 2V5MA 5CSZB 2GI7A 1I8KA 2NY5H 3KPMB 5B39G 5I75C 3BRGC 4ZNEA 4BQ8A 3QUMB 5AUMA 3LSOA 4QHKI 5HYJE 3WFDL 1VPOL 2HN7B 4WEBH 4G9FB 1T1WB 4EJ1C 4ZOAA 5C0RH 4U1HA 2I27N 3BWUC 3OAYK 1E4XI 4M8QA 5EOCH 3SDAA 3SKMA 1X9QA 4PG9B 5CD5D 2P43B 5IOPB 2ESVD 3LY6A 4JDVA 4ZUTB 4MD0A 4AL8H 1JWUA 1WFTA 2BXZA 3O6FA 1EAPB 5C0AA 4G8GB 4K71C 4NZDA 1GPOH 1SBBA 3AB0B 3DOSA 3I6LE 3QUXA 5ANME 5FM4A 5IVXB 3RBSA 5C0GB 2A9NL 1DQJB 2BFVL 4X6DF 3GMPA 2AEIT 5H94B 2H2PD 1F4WH 3FCTB 1G1CA 5C0JA 2ARJQ 4NGHH 5IB4B 2BNQB 1WBZB 3LS5H 4C56A 2HTLD 1N64L 3PWPD 4P9HH 3GB7B 1M6OA 4JO4H 3WDIA 4OAWA 4H0IA 3OKOA 1PSKH 1RZFH 1XF3B 5L2KD 3VWJB 5E6IC 3W39B 1X5ZA 2YC1B 4P3CH 3PF2A 1KCSL 1DL7L 4AK1A 1LDPL 2BSRA 3ULUF 2V17L 1X5GA 1GSMA 2XA3A 4ZAKD 4HC1L 2DL9A 1S7WB 2MFNA 1RV6X 1BOYA 3DHMA 2FCBA 4JGJA 4PJBB 4OGAC 4FTVE 4F9LA 3DO7B 5CS7A 1AC0A 1UFUA 1UXWA 4WRLA 2OXHA 5GZND 1JL8A 4LKXB 3RGVB 5J8OA 5DMGC 1YYLH 4JRYB 4XCEB 2XTLA 3RDTC 5J7CC 1BJ8A 4AEHH 3O45A 4RAVB 2JELH 4R90H 5EU7E 3RKPA 5CKGA 4WO4D 3MLVH 5AEAA 4LLMA 4YHLH 2CO6B 4M5YH 5DRWB 1YEIL 4OZGA 5TDPA 4AG4L 3HMXL 3MRJA 5H35B 1JZ2A 4OIBA 2DBLL 3FQNA 5D72H 4YNYB 4PJXF 2AEQH 1T66C 4NQEE 4NWTH 1IGFH 2PYFA 2ZCLH 4P4RA 4KY1L 3QNXB 4JFFE 5HHVH 3RWIA 4PP2A 3HCVA 2Z4QB 5DJ8A 1UVQA 2R0ZH 1MELA 3FZUC 4K8RL 4XI5C 2BNRB 3EKCA 1DVFC 3ARQA 2XY1A 2XFXB 2OMBA 4EDXB 3C5ZC 1JHTB 4NO2B 4WWKC 3REWB 3QCVH 5DRXB 2WWMC 1B88A 1RZIB 4HF5H 1DBML 1TQCC 1FN4B 3HZYB 4LPCA 2ICCA 4WDIB 5KSBF 3N85H 1N26A 3P0YH 4N0YL 5DGRA 5IJKA 5JZ7C 1LEGB 2VRAA 5IBTH 1N59A 5CMAA 3ULVL 1JTPA 5T5NG 3VGGA 2EYRA 5IVOA 4PJ7B 4JDTH 1BVZA 1J1OL 1ZOXA 2APVA 4Y8AA 5EWIH 1ZK9A 3DV4A 1JZ8A 3GUTA 4UBDD 5ICXA 1EBPA 3G04B 2IBGA 3PWVB 5C07B 1S8DB 5TDOB 1ZSDA 5HD8C 1N5AB 4FQXB 5KVMC 1N5YL 4HIHB 2CDFB 4C58B 5FUZL 3UTSA 2DKUA 2X41A 1A0QH 1CT8B 1BZ7B 5CUSL 5IK3A 1XGRB 4NHUA 5KOVC 4WFED 3BDBA 4OTXH 4D9RE 3IJSB 1ES0A 2ADJB 3MLTA 2FO4B 2BHYA 2Y07H 1T22B 3L7EA 3U1SH 2EYTA 4M9PA 1HWHB 1S9XB 3EDEA 2F58L 4MSWB 4F8TA 4NZRL 1KLGA 3CC5A 3BH9B 3WCYA 8FABB 2VDML 5ESAA 4GAGH 3CCHB 2HFFA 5LQBL 4IM8A 3MOQA 3EHBD 5I74C 2P1YA 5EPMA 3FO0L 4Z5RB 4LKCB 4MAYD 2Q7YB 3V6OA 5HYSG 2AXHA 3NFNA 2YPLA 4KHXH 4P57B 5FGBC 4JM2D 4TVPE 1I8MA 3HI1B 3NACH 1QSED 3GSWA 2HRPH 3AVEA 4GRLA 1KTRL 4MAUL 3BH8A 2C1PA 3DXAE 5DK0B 3TO4A 2Y5TB 1B6UA 4YDIH 2CKBA 1SVZA 4U0RB 5C86A 2DI9A 3L3JA 5GIRB 3LPFA 2V5SA 2IG2H 3VFVA 1J12A 5L6YL 4PJEB 4F2MA 3M17A 3MLRL 3VXPA 3O4OC 3W0WA 4PRHE 4EN3A 5TE4L 4BM7A 2J8UB 3KHOA 3BPNC 2J8OA 1A7RL 3UTTA 3P0VH 5F96H 2VR4A 4XT1C 2FNBA 1C1EH 4UQ3B 2F8OA 1BQUA 2ZUWA 5KZCB 4OM1L 3KLDA 1FCGA 2HT3D 1X4ZA 4O51A 4PG2A 4DGYH 1ZLUK 2VTFA 5F3HA 1I1YA 3O6FC 1BBJB 3OB8A 4JZJA 3GBML 4ZD3L 1I9JL 3TPKA 2F54D 4UNVA 1D5ZA 3PIQA 5BW7A 3IDUA 3VD9A 3HUJB 3ULSA 4APQC 1LD9A 4HKBB 2V9TA 3RP1A 3AUVA 4F7PB 4QRSB 4JDZB 3QIWC 4J3VA 3BEVA 5I2IB 1NGXA 4QF1A 5CHNB 3EYVB 1I9RL 4PV9B 4U3XA 2AGJL 1W72A 2P8MB 1AD0B 1ZA6A 3EYUL 3GSRB 4HIEA 1CICD 3LZFL 1MHHB 5I8KH 1PJ9A 2CK0L 2GTZA 3OKKA 1P4BH 4UU9A 2G60H 3KYKH 5BZWB 4DZ8A 5DHXB 4UINL 4DKAA 1GHFH 2B4CL 3F65A 4G9FE 1AE6H 1AFVH 1WLHA 2EIBA 3BHBA 4D0DA 4MVBC 1KJMB 4XXCC 2XZAH 2V9RA 1A4KA 1NANH 1S7UA 3SOBH 2AK4B 1R0AH 1WZ1H 1QUNA 5DD6B 4U1NB 4G8GE 2IWGA 2NLJA 4D0BB 4LL9A 1L4IA 3L9RA 2PCPA 3WIIH 3E8UH 2XXCB 1G7MB 1IZJA 4MDIB 2IAMB 3PJSB 5DFVD 3T0XA 4JO3L 4BUGA 3KPOB 3CH8A 2VC2L 1L0QA 4DWHA 1ZLWH 1P7QD 4NQDE 2XZQH 1KJVA 3T1FA 1PGRB 4BA8A 1GGCL 3FB7A 4JPIA 1Q9WB 3QFDB 4MXWL 1I4FB 5IEHB 1S5HA 2XZZA 4Y1AA 1Q8MA 3ZE2F 1MUJB 5HPOA 2B1AL 5IM7B 3G9VA 3GJEB 3RKDC 2J4WH 4IDJH 3MRKB 4TUOA 3QBTB 2N56A 1MY5A 3PWNB 3ZE1E 1IC5L 4XC3L 1DQQA 1IGCH 3IJYB 4B50A 2IGFL 4R7DB 5GGSA 1D6VH 5EUOF 4KJPD 1X44A 3H6JA 4JM4L 3RX8A 3LPWA 2P42B 4XNXL 2R0KL 1AI1H 3MA7A 5JXAH 3ULVF 2E7HA 4PJBE 5EUKB 2MHAB 4NUGH 4EKXA 1ZS8B 3MCKB 2BCKA 2BX5A 1YJDH 3FL7A 4I0PC 3L5JA 5D6DA 3QQ4B 2JKXA 4HBCH 4DVBA 1SM3H 4JRYE 4YHNA 4ZUSB 3ILPA 1Q38A 1TNMA 1NCDH 3KLHC 4MB5A 1CE6B 4NC1C 1FZOA 4O2FA 2FATH 5E8OA 1ZA3A 5IB5A 3GSNB 3DX9A 3UMTA 1HHGB 3MUGB 4LCUB 5ACZA 4X6DB 3OR7A 1NUGA 5FM8A 1LNUB 3WKMH 2GJZA 2DM2A 1KXTB 4PYHA 2OYPA 4R2GC 2A6KB 3FONB 1ADQL 2R1XB 4NHCH 2BNUA 3HB3D 4UQ2A 5GRUH 1Y18A 5FUCE 2Z35A 3WNMA 4X7CC 1AHWA 5L2KA 4YDLB 2CJUH 5HY9B 1JZ6A 3P4OA 1ND0A 1TENA 4IRJA 4FQCH 5HHQB 1JWSB 2BNRE 4R3SA 3OXSB 3PWJA 1XZ0B 4DCQB 4YHYB 3QI9C 2F5BH 1CGVA 4ZAKA 3Q1SH 1A2YA 2P8LA 5JIKA 5IFHH 1KCRH 1RUMH 2WIIB 4ZUVB 2C7UA 4M5ZL 5EU3A 1JYVA 4XP9H 4PP1D 3DMMD 3MUZ1 4XB8A 1WBYA 1UH3A 5DJYA 5DC4B 3WE6A 4QTIL 5EDXA 4KMTH 4XBGB 4YHZH 2GUOB 4WHTB 4U6YB 1H3PH 1U3YA 1EERB 1TZHB 1JK8A 2RQ8A 1TPXC 1J0YA 5C0IA 4PJ7E 3NIFE 3VGEA 3SBWC 4M48H 4H5SA 5C0CB 4ENEC 5IR1A 4BQ9A 1MCBA 4A6YB 4KZEH 1EHLL 4G6ML 1RJZB 5B39B 3DRQB 4U1MB 2FJGA 5B38G 4PJ9A 1NAMA 3ILQC 4R4BB 3REVA 1MNUL 4XNMA 5I8EA 1U6AH 2DQHL 3VXSB 4Y19E 5MHSD 4LHUA 5D1QA 3UBXI 2R8SL 1MWAB 3OF6D 2PUQT 4EN3C 1T21A 4LSRH 1DUZB 4UDUA 2VH5H 5EO1B 5FOJA 3KPSD 3RWDB 4I0KA 3C08H 4S1DC 1U8KA 1D5XA 1A7QH 4MJ6B 4LSUL 3GJFH 4QRUA 1NFKA 1T4KA 5DC9B 4L4VD 1KEGH 3WFHA 3A0OA 2X4UA 2ADFH 5IBLC 2EE2A 1UA6H 4J4PC 2WSKA 1BD2B 3MZGB 2DDQL 4MJ5B 4QXGH 1ZKAA 4XC1H 1YDPB 5D1ZD 1PG7H 5DLML 1VHPA 1RK0B 4QHLA 1X5YA 4LRNL 4EUPH 3UC0L 4G43A 2YUZA 2YKLL 3G5XA 1WZLA 4WFHD 4K23H 4F37K 1N4XL 3HKFA 3GZKA 2XPGB 1JZ3A 1A7OL 3QA3B 1CGYA 4PJEE 3NCYP 4ZO8A 2M26A 3AU1B 5KVFL 5MEOA 8CGTA 1G7HA 4O2EB 3EJZC 3MJGX 4N8CH 1QG3A 3E1F1 1TJHL 3D2UB 2J8UE 1SMOA 3QFJD 3T08A 1TCRA 5L7XH 1U0QA 2JJTA 3ARPA 1HNGA 4Y2DB 3V0VA 1KCKA 5F7NC 1D9KC 1DBKH 4JKMA 4HXBH 1VFAA 4ALAH 4MS8D 3PGDB 5BV7B 3I2CH 4JAMB 4JFHD 4MB3A 1T7VA 2NY3C 3T8XA 1HEZB 1U92B 5A16B 3NABH 2YN5A 3HPJB 4KPHH 5JDSB 4GW5B 4GFTB 4Y4KB 3HUJE 5B21A 1HH6B 1BWWA 3GBNH 1J87A 4J3TA 5JW4Q 4F15B 3S9DB 5AYQA 3L3DA 2A6JB 2E3VA 4JM2A 1FFRA 4JFYB 1SVCP 1P9MA 4LVOB 5CJXC 5DJZA 4MNHA 4QXUH 4G8EB 4O5LH 1GL4B 1OP5H 3ARZA 4Z7NF 5GS1B 4WFGD 2I07A 1YY8A 3PL6D 1A3RH 4PJIA 5A2FA 5DK2B 2IEPA 4JGUA 2L0DA 4OLVL 4ZS7H 2GJ6D 5BZDB 1P84K 5HVHB 2XWTB 1KCUL 5T3ZH 3D39A 4S1QL 4LSTL 2B20A 5KJRL 3KXFB 5D6CA 2IALA 3LKRB 4I9WD 4F7MB 1MQKH 2ZUQB 2EDDA 3OKMB 4FQ2L 4XPFH 4S0SD 5T3ZE 1MI5D 1MHEB 5DR5L 3QQ9D 3TH2T 2H6PA 4FXKB 4NO3A 3O8XB 1P4LB 2A1WH 4H25B 4ELMF 1ZWIA 1KG0B 1OAXH 5CD5C 4YWGH 4K3HA 4JFDB 1F2XK 3RI5F 5T33L 1I1CA 5D5MF 2PKDA 5D6DC 2I5YL 1K6QL 1A1MB 2EDFA 4NSKA 2O5ZH 4LQFL 1MCSA 1GZQB 4MMXC 2W0PA 3FMGH 4P2RB 3NIGE 3DX8B 2GYSA 4WU7B 1V7NL 4Z76B 3O2WL 4XWOD 3O3AA 2DYPA 3I75A 4PREA 3RIFF 1VKXB 2HVKA 2WBJA 5DQDL 3BP6B 2H2PC 1AGEB 3UEZA 2W65B 4FG6D 3BJLA 1KTDA 4KUZL 3U4BL 3P9MB 4IS6A 5GPRA 4UILL 4HUWB 4Y5VA 2I9LB 1KV3A 1J88A 2HTLC 1JZ4A 1CXEA 1A1NA 4I3SH 4FQJH 4ELKB 5I1DB 4U05A 2VERN 4JRXD 3F6IA 1QSFD 5E2WH 4MB4A 1G7PA 4U1GC 3GIZL 2UZXB 4HX1A 1P53A 4J3SA 4Q9QL 4MXVE 2VLRD 2ZOKA 4TNWF 5KG9B 2Y7QA 3VFGL 1MQ8A 4LPWA 1MFBH 5HYSB 5I1KL 2HLAB 4ZAKC 3LKSA 3GSNH 1WC7B 3ARRA 5D7SL 1AGFB 3BP7B 1J86A 4WCYL 1MCJA 3QIUD 1RUAL 4LSQL 5DMJB 4WWID 3T4YB 4LFHD 3ET9F 3OGCB 2D2OA 2UWEB 1AXSB 2R4SL 5GZNC 1GAFL 4M7ZB 5GSRB 3SDCD 3QEGH 1V3KA 4UIMB 5IMMA 3WEXA 4WJ5B 4ONHA 1P7QA 3S5LA 1TQBC 4M8VA 5DJCB 2GITA 1OOAA 1JP5A 1BFVL 4PJCB 5F89A 5CEZD 2P5WD 4WO4C 5BQ7B 1MREH 4LCYB 4RQQA 1QFWL 1FNGA 4XCCH 3DURB 4NT6A 4Q2ZB 5EBLB 4OGXL 2EEBA 1ORQB 2QR0A 3ZKSD 2KDGA 1HH9A 2QQNL 3MGTA 1U58B 2NW2B 2QSTA 2VWEE 5EZLB 3QYCA 3IFLH 3SO3C 4XHQA 3SO5A 5ETUA 1RK1A 1UZ6E 4D8PB 1RUPH 3E3QE 5CIPA 2XTJB 5E4EB 4K07A 5HYJD 1WAAE 3KYOB 1N7ML 4A6YH 1B0WA 5FECA 3S3SA 1IKFH 2EKSA 4UDTA 4UTAL 4WU5B 3OPZH 1XF2A 2V2XA 1I3UA 1N6QH 1CFQA 1EMTH 1MWAH 1NCAH 5C0CE 2EEAA 5CGMA 5E1AA 2H3NA 1IFHH 4ZPVB 4KTDH 5KSAD 2PYEB 1I7RA 4MLIA 3VDCA 4Y5XA 2IPUK 2V9QA 1GZPB 3C6LD 4UBDC 4ODUA 4K7PL 2AV7B 1VGKA 4X7EC 3IU3A 3UROR 2AK1H 2B5IC 5TDNB 1YEGL 4M1DL 3TCXA 2R2EB 3CFDB 1J1XL 3DVNB 6FABL 3CMGA 4KDWA 2QJDA 5D5MA 4YEFA 2O61B 3GSOB 5DD3L 4U1KA 1VEOA 2JJTC 4XXDB 4FZEH 1WIOA 4H88L 4Z95H 1CQYA 3E2HC 1YC7A 5MEPA 3TA3B 4XGZB 3O0RH 4MA8H 3S88H 3N1GC 5L88H 1QNZH 5JUEL 1Z5LB 3U0PA 3H3PH 1Q0XH 1AH1A 4MJ2A 1TIUA 3FFDB 1A4JA 3N50A 4MDJA 5E5MA 5ALCH 2BC4A 2ZOLA 4MAYC 2VE6A 3HZKB 1LK3H 4TULH 5C2BH 3V7MA 5EU5A 3MLSL 4FTVD 5ITFB 3O3EA 3IB4A 1OSZB 2YPVH 4OV5B 4RNRB 3C60D 4JFPA 1BZ9A 4P3DA 2D0HA 1QBAA 2ZG3A 1KIPA 3G6JB 1LP9F 2VDLL 2X1XR 3UBXA 3R8BB 4NNPH 4Q0XL 1KN4H 4G3YL 2VO5A 3IDNA 4NM8H 4X6BB 3VDAA 1NJ9A 1NBVL 3OF6A 2F9BT 4LNRB 1DEDA 2JIXB 3PNWB 2XKNB 5E24E 3JTSB 1FGVL 4NQED 3D0LB 1YQVH 1CFVH 2MQ0A 1A7NL 3QUZD 3V6FA 1OF2B 1W0VB 3N0PB 1UM6L 3JV6A 4PRPD 1CU4L 2OMNA 4JFFD 3QUKB 5C0ND 2HT3C 3QH3A 2PNDA 1PZUB 1SEQH 4PJHB 2OR7A 5J1TC 2RHEA 1I7UB 2CIKA 5SX5H 3MUY1 2SEBB 1MCOL 5J6HB 1QEWB 5D1ZA 5ISZE 3WFDH 2DLIA 5KAQG 3U0TA 3TBTB 1IAOB 5IGXL 1R3HB 2FR4B 2AKRB 3SGEH 3TZVD 4NFCA 3WN5A 1T1YB 2E8ZA 1UADC 5JQ6L 5IJVB 1RURL 4X8JB 3I3EA 3JWOC 2C4XA 4FXGA 3TPUA 4WHYG 5EC1B 4AMKL 2A74A 4LLWA 4IBLT 2H2SD 4DEPC 1XCTB 4OIIH 4PD4K 4QT5B 4V2BA 4KKAD 5CJ8A 5F9WC 2X4NB 5HJ3B 4JFEB 4P23D 3CXDL 1CICC 4M6AA 3H9HB 2YXFA 5I1LB 3MRDB 3OL2A 5DJ0A 3MRCA 2AXFB 2Y25A 3GGWA 1H0DA 4M7JL 3VCLA 4P48A 4D3CL 4CNIA 2IF7A 1UB6A 1HSBA 1XIWD 2VAAA 4D9RD 5KBNC 4JFDE 1X4YA 3VFNA 3OJVC 25C8H 4OLUL 4GG6F 1UKTA 4NZUL 1TTFA 4L5FL 1EUUA 1KCSH 1DL7H 5CBAB 4KV5F 5EO0B 1LO4L 1LDPH 2EDYA 2V17H 4QXTB 5B38B 4Y5YC 4HC1H 1OAUL 5DFVC 3WJJC 2E8YA 3O4LB 2YD4A 4TVPD 1KYOJ 4YDKH 4LCCA 3HPLB 4R0LA 1A6ZA 4OD2B 4P5TC 5EZJB 4K2UL 1YEDA 3U48A 3L5HA 4LVNC 3T2OA 3DXAD 4Y16D 4KVCL 5FCUL 1QSVA 5DF0A 3MRRA 4KI5E 1ZTXH 5DD1L 5JHLH 4GW1B 4YAQB 4GKNA 5GS2H 4KI1A 1YEJL 1G7IB 4JB9H 4YBLC 3FO9B 1U8HB 3BX7C 1A6WL 4LF3B 3LN5B 4PRHD 3OKNA 4KJPC 4W70A 1D6EA 1IC1A 5CLWA 1YEIH 4CUCA 4AG4H 5A2JH 4QYOB 1MI5A 5IHLB 2AJXL 4F7EB 3HMXH 1HOCB 5CD3B 4NKOA 1PY4A 1T0MA 1UXSA 3IVKB 4OFVA 5DTFA 3L95B 2NPLX 2UWEE 5DHYA 2X4SB 3MV01 4JQXC 1OP3K 4KY1H 4E0RB 1AO7B 1T7XA 4KGLA 4PPTA 4AT6A 3U0WL 5T1DL 4E42B 1IC7L 1G9MC 2D31B 5C1MB 3LQAC 4FMFA 4OZHB 2GKIA 2VR5A 3S7GA 3TT1L 3QG6B 3TYFB 1LO5A 1HHIA 4Y5XC 3U9PH 3FTGB 3O6LH 3U7WL 4M43L 1EA9C 3KJ6L 2XN9E 2EECA 1PYWB 1ZHNA 5I1JH 1JF5A 4N0YH 3JV5A 4DOHE 5I75B 3RJQB 5LAXB 4N0FA 4AQ1B 3FQRA 3HB3C 5F9JB 1B90A 1EGJL 4NCC1 3V5HB 4JRXA 1NDGA 2ADIA 1KPUA 4HCRA 5H2BB 1J1OH 1SJEB 4LHJB 2VLRA 3UTQB 4NN7B 1FVDA 1F02I 5HGAB 4HMCA 3FQUB 3SY0B 3MODH 4HUUB 2UUDK 1N5YH 1E4XL 5FUZH 4ZFFB 4ERSL 5JMRA 2MWCA 1U93A 2C3VA 4DN3L 4G80A 2Q7NA 3B5HA 4PP1C 3DMMC 5C0EA 2DQDL 3QIUA 4X9GA 5DZOA 2NY7L 4ZTPL 3KHQA 1FFOA 1BQLH 3SDCA 3WL9B 3ROOB 3UPAA 3TBWA 5HGBA 1FNEB 1IGTB 1NC4A 2F58H 4NZRH 3GMNA 3MOAL 4ONOA 5FKPB 3VI4E 5JHDB 2IC2A 3IXAA 3L3IB 4LLYA 3MRLB 4NQDD 1KEML 4RX4D 5IG7B 5IIEB 1RZ8B 1PKOA 4BFBD 4PRIE 1T5XA 2JCCE 3HE6D 4XMKL 5INCB 2IANB 3AY4A 3ROLA 4O58L 2VXQH 4HLZG 4MAUH 3IS1X 3SDXE 4NRZB 5TGBA 5EC2A 4F8QA 4CVZB 2XY2A 2RFXB 4HKXA 3RU8L 1NFDB 2H8PB 4HFWB 4P2QB 2FX9L 5L6YH 3MLRH 1ZT4A 5F7WC 4HJGB 3RDTB 1R3LB 1OY3B 4F33A 1MCNA 2D7MA 2OL3L 2HWZL 4PTUA 1DUYA 5DJDB 4AH2A 4OM1H 1ZGLP 1A6AB 2X4TA 3PV7A 1WTGT 4JRYD 3MRIB 5HHOE 1R5IB 2CR6A 5DJ6A 5KSAA 4POYA 3G6JE 1RZ7L 4D2NA 5GRZA 3JZ7A 2EDEA 4V1DB 4W6WB 3GBMH 5DUBB 1I9JH 4ZD3H 4U1IB 5SV3A 3ARDC 3MREA 4NWUH 4RFEA 3AMKA 3KYMB 4H0HB 4PGEB 5HGGS 4WI2A 1A6TB 3BQUA 4KXZI 1DVFB 3GNML 2EDLA 2A73A 3C5ZB 3G5ZA 2VLJE 3DX6A 3DIFB 2RR3A 3P4LA 2HP4A 4WWKB 4MGXA 2AGJH 4HV8A 5IW6A 4MS8C 1E4KC 3EYUH 4OF8A 5ID0B 1TQCB 4XPGL 1UH2A 1YY9C 3BSZL 4PJHE 3LZFH 1NL0L 5HYFA 2CK0H 1FH5L 1RJYB 3GK8H 3RL2B 1XGUB 2Y06L 3BPCB 1UG9A 4S1SL 2DJSA 3BPLB 3QZWG 3QDMB 4UINH 3U6RA 4Q9RL 3NA9L 2B4CH 3KWWA 3CSGA 2J5LC 4GXUM 3VFMA 1L7TL 2P4AB 2IBZY 2V2WB 3GSUB 2BVPA 1DCLA 3MJ8B 4P5KB 4CN6A 3FHAA 3MV7E 5DMKB 4KUCF 3C60A 1CFTB 4Z7VA 2QHRL 3V9FA 3MGAA 3PL6C 5KOMC 2OP4L 3FN0L 2NMSA 2WWKO 4YDVA 4H26B 1N0XL 5D7JD 5CGYD 1ZANL 3AXLB 1G6RB 1FSKC 1AGBB 2J88H 4JO3H 1AR2A 1AIFA 3FB8A 2VC2H 4XCNB 2DQJL 2IQ9L 3VXMB 4HKJA 5E5RB 4Y19D 4KKNA 3MBED 2CRIA 3CJJA 1JUFA 3H42L 4MXWH 1S3KL 1GGBL 5I74B 3PP3H 3QQ9C 5ALBL 2B1AH 4PRPA 3WHE1 4EVNB 5IV2A 5E08L 3BFOA 5K9KB 3MRPB 5C8JB 5JPMB 3MRGA 5D7LB 1YPZA 4MJIE 1AR1D 4BSVB 3WFCL 1IC5H 2R23B 4XC3H 5F44A 3AM8A 5TE7L 5E8EA 4JM4H 5D7IB 4PJAF 4WW2C 2QSCL 5GZOD 4HD9A 1JPGB 2R0KH 1QRNA 4PY8I 1IARB 1CGUA 1OGAE 1RZKH 3TZVA 4XWOC 3O3UN 4NDMB 4NPYB 1JGDA 4F80A 5HHNB 3A67L 1CXKA 5TE6L 1JTTA 3O4OB 4FG6C 1I8KB 5SWSA 1S7XB 3BPNB 2KBGA 3LSOB 1FIGL 2Y23A 4P23A 4LHUG 2A6DB 3P2TA 2X4PA 4BELD 1PEZA 4U1HB 4JVUA 3NBNA 4G9DA 4M8QB 3SKMB 4KDTA 1QR4A 5F6HI 1MJJA 3EYOA 4JDVB 2ZG1A 4MD0B 3KS0H 1ADQH 1SBSL 3O6FB 1ZV5A 2B2XH 2DJUA 4W4NA 2BSSB 4ZPTB 1XIWA 1F3DH 5FF6A 2B7DT 2XYCA 3ARED 3DYMA 3HR6A 3EZ8A 2R2BB 4YR6A 4APQB 3GMPB 3MC0A 4HFUL 5BVJA 3QIUC 1YNKH 1TVHA 3QG7L 4DGVL 3QIWB 4U4BA 3OV6A 5CCKL 5C0JB 1XGYL 1WF5A 4OZHE 4FA8A 3GMMA 4C56B 1MLCA 1WFNA 3IDJA 2QKIA 5HHMB 5K9OB 5K9JH 1M6OB 4OAWB 4M5ZH 3WO4C 1DQLL 3OKOB 4TNVF 3GMQA 3H9ZA 4LCIL 1XEDA 4NQUA 3WSQL 3DXAA 4I2XA 4ODWB 2GAZB 4Q58C 3AY4C 4D9LL 4E41B 1MCKA 5I16A 2FYYA 3VMPA 3R4DA 2Z31D 5E2VL 4IOSD 5L8LB 1ETZA 2N7BA 2EIDA 1EHLH 4PIRF 1ONQB 4PFEA 4G6MH 4P4KD 1NSNL 4PRAB 1MNUH 3GI8L 4YPJA 2DQHH 1TETL 4GLRI 2JK5B 3ARXA 1U8MA 3KYAA 4OZFA 4Y7MA 5D70H 3CLFL 4MHHG 5DZLA 3STLA 3O45B 3GMRA 5FGCE 4HXAL 3FO2A 5E7FA 1IE5A 4LSUH 3CFKB 5FUOH 4RRPA 1NGYA 2C4FU 4QWWD 4WNQA 3QR2A 3ZYZA 2IAMD 4OZGB 5TDPB 1P4IL 1Z0MA 4TQEL 4LEOA 3MRJB 5KSAC 3FQNB 3WIHL 1MIEH 5ADPL 2DDQH 1W8OA 3C6LC 2VITA 2ENSA 2PYFB 4X6CA 3RUGF 2IANE 4P4RB 3MJ6A 4BFEA 5K33A 5DLMH 1CDUA 1JPST 5BVPH 5JORB 1I1FA 3UC0H 2YKLH 3HCVB 3DUHA 5HYQA 3P4NB 3DSFL 4XH2A 4Y0GA 1N4XH 1MOEA 4PJAA 1A7OH 3T0EA 4FFYL 1WV7T 3BI9X 5KVFH 1YUHA 1T0NA 2EYSA 5EZOH 3CDGA 4RSVA 1TJHH 4EIZC 1I1AA 2W91A 1K8DA 1N59B 5DHVB 2P5EB 1S9WA 2W92A 3A6BH 3WS3A 3JBG7 4OCLC 3DV4B 1T83C 5BO1H 4S11A 4FQLL 1T03H 3TBYA 4M1GL 4HIIB 5FKAA 1JGVH 1G9ML 5IWLA 5DD5H 1KLUA 2YR3A 3UTSB 3LQAL 3C60C 1GGTA 3FOMA 4ZFOL 4YHKL 1NLDL 4NQDA 5JPNA 4RX4A 1ZHLA 5ICYA 1X6NA 5EU7C 1U8LB 1WIPA 1ES0B 3RIAK 4TN9A 3MLTB 3HE6A 5FO9B 4M02A 1C5DA 3QI9B 3TVMA 2Y9RT 3NCJL 1NC2D 4X9BA 5JOFA 1KLGB 2ARWA 5ESAB 3B6SA 2HFFB 3MV8B 4KKLD 4M61A 5EPMB 3QUZC 4OLVH 4MD4B 2NX5E 3Q5TA 4YXKL 1VACB 3TJEL 1I8IA 1KCUH 2YPLB 1IAMA 4TYUA 5DA0B 5C0NC 4S1QH 1BQHA 4LSTH 4M9OA 1M71A 2VZOA 5EU6A 1BWMA 3HMWL 4I48A 2R9HD 4B41A 2CMRL 4KTYA 1NMCC 1N2RA 2C1PB 2OI9B 3BIKA 3C5JA 3PWUA 4FQ2H 4LQ1A 2CKBB 3LKOB 1G6RH 4YO0B 3HC3L 5DR5H 4RA3A 3VFVB 1U9KA 4JQVC 2IFGA 1FNHA 1A9BA 3QEUB 3UTPE 4K7PX 5GGTH 4KK9D 3NN8A 4F2MB 3M17B 2W9EL 3S5LG 4OFIA 4RZCB 3VXPB 5C0CD 3JUZA 1WICA 3W0WB 4EN3B 5BOZG 2I5YH 1K6QH 3MOBH 2BK8A 4KKAC 4LQFH 4MLSA 2X7LB 3VXME 1SYVA 3W81A 1XH3A 4G8FB 1MCQA 3L3GA 4I5BA 4J3WA 1HXYA 4UV7L 4Z7UF 3OB0K 3BD5A 3DBXA 1RVFH 4KUZH 3U4BH 1LDSA 3TV3L 3WNKA 1QVOB 4UILH 4L3CA 1FLTX 4L29A 1O0VA 1I1YB 3MJ9L 4JZJB 1LEIA 1XIWC 3S34L 3PIQB 4HWBL 3T3MF 2RIKA 1IGIL 5HBBA 4LEXL 1MHPL 2OLDA 4M03A 4N0UE 4M62L 4QXWA 2OSLB 4OZIE 15C8L 3GIZH 1LD9B 3DPBA 2ZUYA 4Q9QH 2KPNA 2DLTA 1EFQA 3BUYA 3BEVB 4YK4C 4DUWA 2HJFA 4QF1B 3U4EA 4KMLB 4LLDA 5CBEA 3TH3T 1HILA 1W72B 4X99A 5I1KH 1PKQB 1TZIA 4RAHA 5F3BA 2CSPA 4HIEB 5DUML 5JIPA 5D7SH 2FB4H 4S1RL 5DQ9B 4WCYH 3OKKB 2AV1A 5A2IH 4UU9B 3FRUA 5JW4N 4ZNEE 3I6KB 5F1IA 2E9JA 1X5XA 2R4SH 2HRLA 4PY7A 5D2LF 2R0LL 4Q6YA 4Y16C 5C09D 2E7LA 1D9KB 3BHBB 4QRTA 4OCYL 3OG4B 2V6HA 4TSCL 2FEEI 3OKEA 4J8RB 1S7UB 1BFVH 5C0AE 1F11B 2OTUA 3NIDF 3MBEA 1FIEA 3JWDC 4ODSL 4OF6A 5F1NA 2NLJB 4ORZC 1XFPA 4CBPA 2FX7L 5CILL 1OB1A 2PCPB 2QADD 4OGXH 3ZKXC 3B2VL 2X70A 3MA9H 3RWHB 2UYLA 2AQ1A 1XF4B 3T1FB 4RGMC 2VZVA 4WUUA 4ZUUB 5ABDE 4C56E 2F8XC 3FB7B 5BRZA 4JPIB 3S36X 2DS4A 2MCPL 5IW3A 3B9EA 2DQGL 3LH2L 3HI6L 3F7YB 1KGCD 1OGTA 3Q6GL 1BQSA 4MCZA 4B5EA 4Z7QE 1CYGA 5ISZD 5SWZD 4PGDA 5D2NA 1FVCA 3MR9A 4Z0XA 2PXYD 3VWKC 1HWGB 2AJSL 5AWNH 5I71B 3ZL4L 4POZD 3IDGA 4TUOB 2MKWA 5GISL 4CVXB 3HC4L 4WI3A 1KB5A 5GGSB 1IT9H 3UBXG 1UH4A 2QBWA 3CAFA 1VFOA 2VB5A 1RSFA 4YXHL 3NMEA 4YPGA 5C0DA 5H37H 3P11L 3QZWB 5C6WH 2BCKB 5BOPA 1NDMB 2X4OA 2DWDA 1XGPB 5FYKD 4DVBB 3H9SD 2C3GA 5EOCJ 4YHNB 4N1EA 2MPAL 3ILPB 1YEGH 3SE4C 1J1XH 1I3RA 5DD3H 3JUYA 4H88H 1ZA3B 4JFDD 4YFLI 5IB5B 3DX9B 3KLSA 3ZDXF 1SQ2N 5JIHA 5JXED 4OZGE 4RFNC 4R7NA 4PJFF 2GJZB 2W9LA 4JKLA 5JUEH 3MROB 5IWLC 1V7ML 3K80A 1Q94A 1MY7A 1S7QA 5FYLH 1UWXK 1J05B 1AHWB 1INQA 4U1GB 5L2KB 1G6VK 2ZCHL 1RZGA 3P4OB 1M1SA 3C6SA 4PB0L 3KYNB 3HE6C 4R3SB 5IW1A 1KN2L 4OQTL 5CZVL 3IKKA 1AP2A 4NKQB 5DHVH 2VXSL 4JHAH 1CG9B 4ZAKB 1A2YB 4JLRA 4KI5D 5FYLE 5C3TA 5B3JF 1MRFL 2Z31A 4M6NL 3U30B 2C7UB 5EU3B 1WBYB 4GH7B 5DJYB 4P4KA 2VDLH 3WE6B 3BWAA 3V4PL 1C12B 4Q0XH 2VKWA 4G3YH 1DN2A 4G8IA 5C9JA 3FFCD 1DFBL 1S9KC 1IEAA 1NBVH 5D8JH 3X13A 5KTEL 3S35L 4PRBA 1JNHA 1BECA 1ZE3C 2X2YA 4H5SB 1TQBB 1FGVH 3QQ3B 5IR1B 3C8DA 1A7NH 4YFEA 1YEHL 4RIRA 4WO4B 4KHTL 5INDA 1CU4H 5ID1A 1UWGL 3REVB 3HZVA 4XNMB 2IPUG 4LHUB 5D1QB 1JMZA 1II4E 2GFBA 5JOEA 1T1XA 1J0HA 3HG1E 4MX7B 1MCOH 1RU9H 4UDUB 5FV1L 4JKKA 4R96A 2MCG1 3RUGB 2WINA 1AGDA 2XN9D 4PGZA 4X0KA 1RQ5A 3PUCA 4MD5A 5JQ6H 1AQKH 1RURH 4KKCD 3UO1L 4LCWD 4V2CB 3N06B 1MCPL 4Z9KB 5JW5A 2X4UB 4AMKH 3QB7C 5FUCC 1ITBB 3V6OE 2MQCA 4C57C 4Q97A 2YPLE 5F9DC 3OKLA 1BIIA 1BJMA 3CXDH 5CP3A 2BRRL 4QHLB 1JBJA 1N8ZA 4BH8A 3VRLF 3G5XB 3ULUE 4M7JH 4NRYA 4YHPB 4D3CH 3E6FA 1QTYT 4O2CA 3BD3A 4TTDD 2DQFA 4ZFZB 1ZHKA 4M3KB 1G7HB 5ESQB 3WYRA 2J6EL 3GKZA 1EFXD 1NBYA 2B5IB 4LBEA 1M7XA 4NZUH 3K7UA 4L5FH 5IQ9A 3UTTE 5EOCL 1Z9OA 1U3HD 3V0VB 2GIYA 2LU4A 1LO4H 4LPTA 5D7JC 5CGYC 1NEZA 4FQXC 4MQSB 4CGTA 1F4YL 3IFOA 3OHXB 4PRID 1R3JA 3JVGA 4HAGA 3F5WA 1OL0A 4PJFA 4PTTA 3TJHD 3RZCA 1NC2A 4I3GA 1MCLA 4NZJA 1CZ8L 1NH6A 2E6PA 3WIFA 4K2UH 1FORH 1IQDB 1F4WL 4Y4HA 4KVCH 1YMHA 3S4SA 3QXDA 2YD7A 5FOBA 4MAYB 1KIUA 4G6KL 3TWCL 3TLRA 5DD1H 3SE9L 3L3DB 3OKYA 4JM2B 2F53A 1YEJH 2ATPB 4HLZH 4JO4L 2V2TA 2XQBH 4B53A 3EGSB 1A6WH 1CGTA 2R56L 2IADA 2DKMA 1YY8B 4IOFD 5GZOC 2X40A 4PJIB 1C16B 1X5IA 2AJXH 4RMUA 1QFOA 2Z8SA 5T3XD 1IAII 5C92A 2A77L 5D1XD 5I17A 1ACYH 3BN9D 4JZNA 5KSBE 3W82A 4AIZA 2Q6WA 1F00I 4OLYL 5HHOD 2OQJA 1ZVYA 3QHZL 5D6CB 2XKUA 2AQ3A 3EOTL 3VFTB 3UZVB 1CGWA 5T1DH 1IC7H 3DI3B 5KN5B 3QEHA 4O02L 1U36A 2H6PB 3VU2A 1EEQA 5IQ7H 3C9NA 4NO3B 1JWMA 3T2NH 2GTWA 4GRWB 3TT1H 5KS9F 2NYYD 2EKJA 3DO3A 4X6EA 3U7WH 1HXMB 1UT9A 4M43H 1TCMA 3FT4A 3KJ6H 4AEHL 2A2QT 3LS4L 2GT9B 3MRQA 2VLJD 4NSKB 4WW2F 2F54B 5D7KE 1LMKA 1R3IL 2WLYA 3QCTL 4HEPG 3AREC 1H3GA 1CTNA 2W0FB 4LSDA 5H8DA 2W60B 3O3AB 4PREB 4FMKA 5EA0L 1F6AA 5J06A 2WBJB 1F58H 3MQIA 1FYTD 3W9EA 1IGFL 3H2WA 4Y1AE 2CGRL 4IS6B 1E4XH 1S7TA 4HK3J 2H32A 5FK9A 5F9WB 1AGCA 1E6OL 5IVNA 5HHVL 4ERSH 1OCWL 2DQIL 1CICB 3PQYD 3CFBA 4DN3H 4HHAA 4P46D 1A9EA 4ZYKA 2DM4A 3HFML 2DQDH 3T1WA 3MNVA 4NJ9L 1T20A 4HX1B 4L4TE 2NY7H 3MV7D 3CGTA 2D7TL 3PE9A 2ZOKB 3IXTA 4L8DA 4DN4L 5C09A 3QCUL 1HHKA 4Z7WA 1MSPA 4HZLA 4W6XB 5IMOA 4R6UA 1FZKA 3EJJX 3V5KA 1XR8A 1Y6MR 1JI1A 1S7VA 4OBRA 5FB8A 1WTLA 2HA1A 5ADOH 1P5UA 1JIBA 4QRQA 5EWIL 4XMKH 5F7EL 4ZQKA 4U3HA 3U82B 4HLJA 4OSUH 4U6XA 4OQ1A 2DICA 3H3BC 3IS0X 4NZTL 5IMMB 1QA9B 3WEXB 3DECA 4ONHB 1P7QB 3S5LB 3UPRA 2VJXA 2X9WA 4MJID 3GI9H 4HIJB 5HTSA 2Y5EA 5A1AA 3NVQA 4JANB 3RU8H 5F89B 4NFBA 4RQQB 5CLTA 1FNGB 2PR4L 4J3OC 1ULVA 4WI6A 4YDJB 2Y1VA 2IAMC 1JHLH 2CDGA 4NT6B 4M93B 1ZLUH 5SWZA 5L2KE 2OM5A 5I6XC 1MCDA 3DUUB 5J0BA 2QR0B 1OGAD 1HH9B 2O5YL 2Q1EA 2OZ4A 3THML 2P7TA 4TVPL 3R0MA 5J89A 2R2CA 4CMMA 1U2CA 3L3HA 2OBGA 2OL3H 2HWZH 2RAMA 2X5PA 1HDMB 5ETUB 1RK1B 3OR6A 5J6GA 3IDMA 4G5ZL 4RGOL 1RZ7H 3GMLA 1KSRA 4X4ZA 4LGPB 3CVHA 3X11A 5FECB 4KH2A 3P73A 3JWDL 1F4AA 2EKSB 4CU8A 4IIQA 2VMFA 3H9SA 4PJDA 1HCVA 2V2XB 1GRWA 1AY1L 1MVUA 5B22A 1CFQB 1AQDA 5E1AB 2H3NB 2VL5B 3GNMH 1S7SA 4HK0B 2EH7L 3VFWA 1BZQK 4GMSL 5K59F 4Y5XB 1TVDA 5JXEA 4N0RA 2HKFL 3VE0A 3D69A 3P4MA 5F96L 3IU3B 2ID5A 2BP3A 3BMVA 1SYSA 1FH5H 2Y06H 2H9GB 4LRIC 4YHIA 4U1KB 4Q9RH 3NA9H 5JLZB 1CDYA 4NNXB 2DTSA 4JPKL 1L7TH 2G9HA 3FT3A 5MEPB 1B4JL 4LLUB 4HGWA 3TO2A 1CGXA 2G5BA 3QNZA 2ICEA 2QHRH 2NY4B 4QHMA 3BJ91 5A40E 4YDLC 1A4JB 4JPWH 4MDJB 2OP4H 3DMMB 4KKLC 1MRDL 1N0XH 2VWEC 4OUOA 2BC4B 2FBJL 4MA7H 1ZANH 2VE6B 3QUML 5IB3B 4PLKD 2NZ9D 5F71A 1R3KB 5EU5B 2IFFL 2VXUL 1QRKA 3ZTJH 1OWRM 1CVRA 3FFCA 2DQJH 2IQ9H 1G7JB 1QLRA 3E3QC 3STBA 2R9HC 5I8KL 5EG6C 2XKSA 3T65A 3QIBA 4JFPB 1VGEL 3ULVE 4BQBA 4P3DB 3H42H 4DKDC 1GGIL 1S3KH 1SY6A 3SDDD 5KVGL 5E08H 2IH3B 2NXYD 5EU4B 3UBXB 2GY7B 2CDEB 3H8NA 4KK9C 2D9CA 4UT9L 3IDNB 3WFCH 1NJ9B 2E7MA 4LSVL 2ERJB 3SOBL 4GG8A 1H5BA 1VEPA 4QHNA 3KPSB 2QSCH 1CLZL 3IU4L 4NN6C 4WHDA 5GGUA 3ZZ1A 5J9PA 3L6FB 2AVGA 3BZ4A 3DARA 3LKNB 4Y8DC 3V6FB 2ITDA 3KG5A 3HLAB 3WIIL 4KRPD 1LQSR 4D0CA 3MMEA 3QH3B 1HIML 3A67H 4L4VB 4LCWA 3D0VA 2NCMA 3LCYA 2CIKB 2AJZA 5FIEA 1CLYL 4TPRH 2DLGA 1MHCA 4HG4J 1FIGH 5D1ZB 5IHZA 1L0XA 4HUNB 4PJGF 3HN3A 4U7MA 1KTLA 4OZFG 3T2PA 3WN5B 1JGEA 3WHXA 3P77A 1IGYA 3HAEA 4PJIE 4FXGB 1V5JA 4IDJL 2A74B 4LLWB 1UCTA 1SBSH 4RRPG 1WWWX 2AJVH 4JHWL 4N9OB 3TBVA 3D39E 4NKDA 5AAMA 3SGKC 2OK0H 3STZA 1J8HA 4CADA 5E00A 1BVKA 2V5TA 3QFJB 5DJ0B 3MRCB 4HFUH 4KQ4L 1F3JA 4OFKA 4WENB 4NUGL 1KLFA 5GGQL 1AD9A 4DGVH 1BFOA 3GGWB 3BPOC 5IUSA 5HHXH 3VCLB 4N8VA 5CCKH 1XGYH 4CNIB 2EDNA 1CI5A 1UB6B 4GRWE 4HBCL 3HTLX 1HSBB 4HUVB 1DQLH 4PRIA 3G6DL 4X5WB 2B8OT 4GKOA 4YQXL 3VFNB 3JWOH 2OR9H 1ZAGA 4LCIH 3SDXA 3WSQH 3QDAA 5BV7C 5F72S 5F7LB 2NY6D 1ZXQA 2QADC 4ZNCD 4JFOA 2NX5D 1X5HA 2YA1A 5E03A 5E2VH 1CLCA 1UJ3A 2GSIA 2Q76B 4ZXBD 3TCLA 4MZ3A 2EDTA 1X6LA 1CXHA 2H45A 4WV1C 1NSNH 4R0LB 2FL5B 1A6ZB 1Z9LA 3KNBA 3PL6B 3GI8H 4YGVA 5CJ5A 1A6UL 1TETH 2ED8A 4F15C 3K2MC 4IMLA 1A3QA 4FQCL 4BZ1L 1H8SA 2B0SL 3L5WB 2ARJA 3F58L 4LVOC 1VFUA 1FSKB 2PXYC 4XNQA 4BH7A 3CLFH 3UTPD 3DGCR 1RUML 1LEKA 4GKNB 4AM0A 4HXAH 2QV2A 2L7UA 3C2AH 4DZBA 5FGSA 3OKNB 1I75A 1RD6A 4YHZL 1P4IH 1MI5B 2GK0B 4ODBD 1XGQA 1BGXL 4NKOB 4NUJA 3VXMD 5J1SC 1T0MB 3WIHH 2V5YA 5ADPH 3DETC 5D96B 5DTFB 5DHYB 5FO8B 1FG2B 5HGHA 2KH2B 2ZUQC 4Z77A 4JN1H 1BEYL 4PV8A 4AZ8A 3BDYL 2X10A 35C8L 1BQHG 3IRZA 3O8XC 3DSFH 3O6MH 3LEYL 2CQVA 1DLHA 2A38A 4QOKA 3BW9B 2FZ3A 4FFYH 2VH5L 1PDKA 3NH7L 1FYTA 4XTRD 4B7LA 4X4MA 1FPTL 2JB5L 4L4JA 4N0FB 5DRNA 3FQRB 5TF1L 4XPBL 3PQYA 3ZKQD 3LKPA 4P46A 1B4RA 4JRXB 3Q2CA 1QSFB 1NDGB 2ADIB 1KPUB 1CWVA 2AJUL 1UA6L 2BVOA 2DL2A 4PJGA 2P46B 1G9NC 1HHJA 2VLRB 3AS1A 1FVDB 4QXGL 4FQLH 4XC1L 4Z7NE 5JNYA 4M7LT 4M1GH 1HI6A 5EN2A 4UTBH 1IRAY 4RAUA 1G9MH 2F19L 5T1LD 2CRZA 3LQAH 4KI5C 3IFNL 4YHKH 3JV4B 4BK4A 3SDAD 4G80B 3G08A 1NLDH 4Q6IA 5DJAB 2ITCB 3QIUB 3TFKD 3ZE0E 2PTTA 2QQLL 4RISH 5FHBL 5C0AD 4LLVB 1S7RB 5IVXF 3RWCA 3CPLA 3QUXD 1FFOB 3QEQA 3VD4A 2QEJA 4RDQG 4ZO6A 1FRGL 3SDCB 4YLQT 3MLWH 4N8CL 3TBWB 3R0NA 1I7TA 3NCJH 4E5XA 3GMNB 2X44D 3WO4B 3OX8A 1JPFB 3EOAB 3IXAB 4OCWH 4LLYB 3KPPB 4CAGA 2P5WB 4YXKH 3O41A 4QRRA 4OFDA 3TJEH 2DM7A 5A3ID 5D5ME 1T5XB 2HFEB 3HRZA 3QJHA 3HR5B 1RIUL 3EIFA 3HMWH 3I2CL 2XNAA 2IQAA 2DWEB 3L3OA 2CMRH 5TGBB 2R1WA 4KPHL 3HC3H 4TRPL 2APWA 3QP3A 2EH8L 4GT7A 3GBNL 2W9EH 3HE7A 3H3KA 4F9PC 7FABH 5HYJB 1ZT4B 3SCMA 4PJBF 2VXVL 4QXUL 5J1AA 5I73C 2X09A 1C08A 1ZGLA 4IJ3C 2P44B 3B9AA 3V6ZA 4OF7A 4ETQB 1A3RL 5F7DA 4PTUB 5E4EC 4AH2B 3ARBD 2CXKA 3WBDA 1K3IA 3D6GA 3WS6A 5T3ZL 1J8KA 5ANMB 1EVUA 2HFGL 2WP3O 1B9ZA 1O5DT 4I18A 5DEGA 5KSAB 2FSEA 3O3DB 3TV3H 5J13B 1E4WL 4MNQA 4TTDC 2VZSA 43CAA 3RPKA 3C6LB 3QNYA 3S34H 4HWBH 1K2DA 1IGIH 1EV2E 1MHPH 4LEXH 2VABA 4M62H 1MH5A 3MREB 3PG2A 5E9DD 15C8H 2NY5C 2UY6A 5DYOB 1U8OA 1L7IH 1JI2A 1U3HC 2YBRA 2A73B 4GAFB 5HPMA 4I0CC 1Q72L 4CKVX 3NAAL 4IDLA 5IW6B 3EO1A 1YN6A 1FVEA 1A1OB 4GBXA 2DIAA 4S1RH 4JVPA 4MYWB 3U36B 4CMHC 4X5XB 3FMGL 5I8CA 2FO1A 3TJHC 1NAKL 1NUFA 1W0YT 5IEKA 4GKZA 3U6RB 1CL7I 2R0LH 3KWWB 1OM3L 3BP5A 4L3EE 2VDQL 1IM3A 5C71A 1WCBA 3VFMB 2GCYA 4KK6D 4OCYH 5CSZA 3RNQA 4X83A 1EO7A 3INUL 2BVPB 5I1CH 3ARWA 4GXVL 2D7QA 4OCRL 1LHZA 5E2WL 3C60B 4PJ7F 3VRIA 4NP4L 2AXGA 4ODSH 3ISWA 3NIFF 3SGJC 4IOFC 1P6FA 2FX7H 5CILH 3SDDA 1KXVC 4YDVB 4NYLA 5KVDL 1FO0A 1QBLL 3GM0A 5CEYB 3B2VH 5D1XC 1MFBL 1OT2A 1PZ5A 1CE1L 3FB8B 4ZUTA 3S3JA 4HKJB 1PQZA 3GSNL 4YFDB 2IBBA 1IM9D 3TT3H 3FOLB 4XP6L 1DQJA 1Z9MA 3HG1D 3TF7C 2DQGH 1JUFB 3HI6H 3LH2H 4NQEB 4ONFH 3GJFK 3Q6GH 3QO1A 3QUZB 3OWEA 1JN6A 4PRPB 4QHUA 5IV2B 3FCTA 2AJSH 3SJVD 2NYYC 3RWJA 3ZL4H 2WANA 1CD8A 3MRGB 1YPZB 1KACB 1WBZA 2BNQA 5GISH 4X9IA 3HC4H 1NMCB 4N5UA 3LKQA 5E8EB 5K93A 3CFEA 1XF1A 1XF3A 4WTWA 1X4XA 5ECJE 3VWJA 2XI9A 3W39A 3KPLB 4AY0A 3UPCA 4YXHH 3TZVB 5T1MA 1MFEL 4K9EC 2FGZA 2YRPA 4GRLD 3P11H 1JGDB 5L9DL 1M7IA 1OAQH 2CIIA 3RIAF 1A8JH 2L4OA 1YECL 3TO4D 4I77H 3ULUD 1HINL 1S7WA 4U1SB 4FNLH 1ZVSA 2MPAH 2DLFH 3T09A 5LXGH 2YD1A 2WK2A 1RULL 5LGHL 4PJEF 4P23B 3BESR 4QKXB 2XQYK 2VAJA 3DO7A 2J8UF 4Z78A 4G9DB 3BKYL 4BFIB 4HUXA 4L1DA 1IAIM 4LKXA 1MI5E 2BERA 3UTTD 3IJHB 2DKSA 2C26A 1IKFL 5IB1B 1E0OB 2EXYD 2DIBA 2J3SA 2BVQB 1XIWB 2FHBA 4RAVA 3OPZL 5FF6B 1V7MH 1MWAL 1NCAL 4YR6B 5GQBA 3WXVH 4JRWA 5BVJB 3QDGD 3DVGA 1NLBL 1TVHB 2ZCHH 4NN5B 4R4FL 5CSBA 3BMWA 4YK4B 4NBYB 3M8OL 4PLOB 1KN2H 2Z91A 3F12B 4OQTH 5CZVH 3GMMB 4B0MM 2VXSH 3HUJF 3K0WA 3IDJB 4R8WL 1MRFH 4M6NH 1BM3L 4HCRH 5BJTB 4ZXBA 4C4KO 1Z0NA 2ZSVB 1MIMH 5EBWB 4FZEL 4MQXD 2YEZA 3WFBL 1MPAL 3I9GH 3V4PH 4X4YA 4LIQH 1E6JH 4NRXA 4OZ4A 5A2LH 1EHXA 3DXAB 4Y16B 1JHTA 1NFIA 1QLEL 3REWA 1DFBH 3ARFD 4JRXE 1IKNA 2HH0L 4OKVA 5DRXA 1RZIA 3VFSA 3H3PL 4MXQD 2VLRE 1T7ZA 3IGAB 1ETZB 4OIAA 2HJKA 2I26N 1CD1B 3E6HA 3ZYJA 3BN3B 2KZ1B 1YEHH 2FIKA 4PRHB 1NEZG 1UWGH 1C7TA 2FEEL 4TULL 5LG1A 1IVLA 5CJOL 1U8MB 1K9TA 5EORL 3ZLQC 1KPVB 3WD5L 2Q3ZA 4OZFB 3EOBB 5FYJE 1TTGA 3PWVA 5C07A 5TDOA 5CEZH 4RGMB 1OQOA 2GSGA 3S4SG 3T0VA 2CDFA 5J12C 1NGYB 1BZ7A 4WNQB 5BV7L 3V79C 3VXUA 3WS6C 4Y2OA 5D7KD 3QUYA 3UO1H 1MCPH 4LEOB 2N1KA 1PFCA 4XP5L 3IJSA 4N0UA 1RAMA 3RA7H 3GRWL 5CEZE 3MLYL 2FO4A 3UP1A 1B6DA 3P3YA 4OZIA 3T3PF 2VITB 4P2OD 1LE9B 1RHHA 4GMTL 4RMRA 1S9XA 2BRRH 4MSWA 3AROA 3EOYG 5C6TL 2DQTL 4Y1AD 1RZJC 4WTXA 3L5XH 3L3KA 2Z0BA 5HYQB 1HCFX 2AQ2A 5AG8A 4XH2B 2Q7YA 1HYSD 1UKSA 3GJFA 4HH9A 5KANG 4L4TD 4MXVF 2YD2A 2XXMB 2EYSB 3CDGB 2J6EH 1NBQA 5AYUL 3BXNB 5T1LA 3QXAA 1H3TA 1H8NA 1K8DB 5GIRA 4YX2H 4X98A 1S9WB 1HK6A 4ZS6D 2H1PL 4NN7C 1QO3A 2A0LD 4CVUA 1BHGA 4HKZA 4EUPA 4PLKC 4OIIL 2NZ9C 1A7BA 1F4YH 4RFNB 3QWOB 4ORGB 5ESVA 4GUPA 2Y36L 3TBYB 4GKSA 2G2RB 4EXPX 2N7AA 3UDWA 1KLUB 4NQTA 2AS5M 1CZ8H 2N4IA 4L9LC 3BZDA 4NQDB 3SDDC 2YS4A 2NR6D 1BLNB 1ZHLB 5F9OL 5E0QA 3VXTB 1VFMA 4G6KH 3D9AL 4K7FA 3TWCH 2NXYC 3SE9H 4OBSA 3B8YA 5ELIA 4PR5A 3GSVA 1SHMA 3HE6B 5E70A 1OP3H 1BBJA 4NNYA 25C8L 2DQCL 2R56H 1OSPL 2WZPD 3PXJA 3O2DL 3B6SB 1OAKH 5I1GL 3MGOA 4IRJD 1G9NL 4HKBA 4KK8D 1ORSA 4F7PA 4QRSA 2A77H 4JDZA 3MLXL 4KRPC 5I2IA 5I18L 1BQHB 1UZ6F 4PV9A 5F7HA 1M71B 4OLYH 5EU6B 3S37L 1C5CL 1AD0A 3QHZH 1TXKA 4RMQA 2HKHL 1P69B 1WAAF 3EOTH 4YDKL 1V3JA 2ZUUA 3U4AA 1MHHA 3ZDYE 2ICWJ 1NUNB 3BIKB 3PWUB 3B9KD 4KKBD 5DQJA 4O02H 1XT5A 2JJSC 1P2CA 4KJQD 1R5VA 3ARBA 3EW3B 4Z7VE 3HS0B 3FB5B 1ZTXL 4JY4A 5JHLL 5HI5D 2NZIA 3F7PC 2UUDH 3LS4H 4JB9L 4ODHL 4MA1C 3RY6A 3TN0A 1FE8H 4PJ9D 3ZKMD 4U1NA 1HQRB 1G0YR 1R3IH 3QCTH 3X12A 2Q3AA 4LHUD 5D1QD 2BSTA 4MMZC 4GAYB 4ZDHB 5E9DA 1PAMA 5EA0H 2EIZA 1HXYB 1ZLSH 3DBXB 2CGRH 1A5FL 4PRPE 4L29B 3F7VA 4W68A 5F7FA 1LEIB 1E6OH 4HS6A 4ONGH 3IAPA 1OCWH 1YPZE 2DQIH 2X42A 1YYML 3LPGA 3ZHLA 4EI5D 1Q9WA 5ERWB 3HFMH 2AEWA 3OJMB 4NJ9H 5CJBA 3CVIH 3EFDL 4H1LB 2D7TH 3U9PL 1NMAL 3BUYB 3TNNB 3O6LL 1QRNE 2HJFB 4K8RD 3QCUH 5T1KD 3U4EB 4DN4H 2NY6C 1A47A 3GJEA 1NGZA 1D3CA 3N1QC 5CBEB 3MRKA 1YEEL 4X99B 1EUTA 2VXTH 1KIRA 1TZIB 5F3BB 3PWNA 3BPLC 4XAKD 2XWJA 2JJVA 5MI0C 4GSDL 4WIQA 5SWSE 2AV1B 3FRUB 4HEME 1OD7A 2NTFA 5EUKA 3ULVD 2MHAA 4QRPD 5F7EH 3WUWG 3GEWB 5D7JB 3MODL 4YBQC 3VXOB 1IKNC 1ZS8A 4QRTB 4TVSa 5EOQH 4NZTH 5HVGB 3OKEB 4TOYL 5IB2B 3VDBA 3G5VB 1KOAA 3TNMA 4Y19B 1Q9LA 1IM9A 1D5BB 1T2QL 2EDHA 3RWFB 2OTUB 3MBEB 5IROA 1CE6A 4JZOA 5C70A 3HG1A 2HTKD 2VLKE 2PR4H 3GSNA 3MUGA 2VL4A 4LCUA 4X6DA 1BQLL 4O00A 1NGWA 2X70B 3HC0B 3BGFC 3BKJL 3SJVA 3THMH 2O5YH 3O6KL 4TVPH 3FONA 2R1XA 5TJWK 3I02B 4WUUB 4FQIH 4KJWD 1OP9A 4MHHI 4PRDB 1BVLA 1LE5B 2WAHA 1OGTB 4U1LA 4WI7A 5HY9A 4G5ZH 4RGOH 1IEBB 4MCZB 5TQ0L 2YMXL 3K8KA 3JXAA 1FVCB 3MR9B 2VXQL 4ZFGL 1JWSA 1FAIH 4OLXL 3OXSA 3IDGB 4XTRC 4I2XE 3JWDH 2E9BA 1JPSL 5I1JL 2R69L 1GC1L 2DD8L 1KB5B 2QL1A 4ZUVA 3RL1B 1AY1H 5JR1L 3D39D 2EXWD 5HVWA 5HVFB 2EH7H 1EXUB 4GMSH 5E8NA 4WHTA 3KLAB 4U6YA 3TBSA 2HKFH 4XX1G 1UWEH 1ROWA 2BRQA 2X4OB 4K94C 1MFCH 2HT4D 4YFLF 5DJ2B 4A6YA 4P49A 1FNFA 3RVXD 1I85A 1RUQH 3SDAC 3AREB 5T5NF 2UV3A 3N1MC 1F3DJ 3VXSA 4JPKH 1F8TL 3QDGA 1B4JH 5GS0C 4KZDL 1MWAA 4R7NB 1K5NB 3QUXC 3AS0A 4PJXA 3RVVD 2FEDC 1FHGA 4NWUL 1WZKA 3RWDA 3HAEG 1URLA 2DYPD 1X5AA 4DFIA 1Q94B 2WBJD 4K9EL 4X6CE 5F6IC 5EB9A 1MRDH 1FZJB 1U8JB 1INQB 1B0RB 2FBJH 4OCMC 5DS8A 1F3RB 3O81A 3QUMH 4RGNE 1RZGB 2IFFH 2APBA 2VXUH 3U9UA 4K3GA 2VSCA 3C6SB 5IW1B 3ARFA 4R4ND 5I15L 2EDBA 4PJAE 4Q9CA 2ZUVA 1AP2B 4P3WA 4BYHA 4KI5F 3UTOA 2VSDA 3T0EE 3WMSA 4JLRB 3GK8L 1VGEH 2Z31B 1RK0A 4N8VG 1GGIH 5KSBA 2AAVA 4U2ZA 1WVZA 2NQCA 1EH9A 4P4KB 5KVGH 2EZ0D 3DTXA 1LO3L 1S78D 3CD4A 4NQSA 3UJJL 4OM0H 4UT9H 1OAZL 5C9JB 1CFNB 4HQQL 3QA3A 4LSVH 3X13B 5FHAL 4PRBB 1JNHB 5TH2B 3IU4H 1CLZH 4F9LC 2ZUSA 2UWEF 4LAQL 4HWUA 3D2UA 5CINL 4GAJL 1WUNT 1F4HA 4RIRB 5INDB 3U2SB 5I1AB 4DKEH 3HZVB 1HIMH 2VDKL 2J88L 4L1HA 4NKIH 4C83A 1DDHB 5I6XB 3PGDA 1T1XB 1CLYH 4PJCF 3K1KC 2FGWL 4JAMA 4P2OA 1WT5A 2ZKHL 4R96B 1UYWL 4WW1A 1HEZA 2WINB 4DJMA 3HPJA 4X0KB 4X9FA 4HPOL 4Y4KA 1PG7X 4YZFE 2KKQA 1CF8L 5JW5B 2Y6SD 3PGCA 1CXLA 5JTWA 2UVEA 2DRUA 2W38A 2A6JA 4YIQB 5F88B 4JHWH 4JFYA 2YRLA 3MNWA 4L4TA 4P5MA 2BMKB 5EU6E 1CK0L 3ESVF 4ZSOA 3O3BB 5GS1A 2QQKL 2A6IA 4FQQA 1KUMA 3BZFB 5LBSL 2YK1L 4KQ4H 1RZKL 4BH8B 2KQMA 3EO0A 5GGQH 5DK2A 3RPIB 2VUYA 4NRYB 4KTEL 2XWTA 1KJ2L 3E6FB 4O2CB 3LV3A 3D48R 4KK6C 1FL3A 2DQFB 2WBKA 1P7KA 3KXFA 4KXZH 2FHCA 1ZHKB 5IJKC 5HDOA 3SKUD 3G6DH 4JG0L 4YQXH 3LKRA 4QO1A 1NBYB 4LBEB 4RA0C 4U2YA 1DQDL 1K85A 4LDOB 4OI8A 1JF1A 5EOTB 3V4UL 5FO7A 5M7QA 4FXKA 3VI4F 1EO8L 1FYHB 3QHFL 1P4LA 2H41A 3ARSA 4IMKA 2B2XL 2AJ3B 1YEFL 1RMFL 5DRZB 3IFOB 5JW4M 1RZJL 2JCCF 1R3JB 1A1MA 3F5WB 3G5YA 2O26U 4KRNA 4KK5D 5DEFA 4H1LH 4PTTB 3RZCB 1KPRB 1NC2B 1JFQL 3FQXA 5IROC 1GZQA 1YNKL 1A6UH 5EIIB 1QFUL 4P2RA 1UM4H 4BKLA 1YMHB 4R9HA 3S4SB 4BZ1H 1VKXA 2B0SH 1NEUA 5FOBB 3F58H 3LRHA 1UCBL 1DEEA 4XVUD 2W65A 5IKCA 3DSNA 3IF1A 2NY4D 3P9MA 5K9JL 4HUWA 2I9LA 1A22B 2V2TB 1RJLA 4YJZL 5CEXA 1FAKT 4BSJA 2BHUA 4ZODA 1Y6KR 5E56A 5E8PB 2IADB 1FGNL 1KB9J 3V6OC 4HC1A 4ZMAT 1XMWA 3B9KA 1J18A 4LAJH 3G6AA 1BGXH 4DTGL 4LVHB 5KG9A 4JZNB 4GRLC 4M4PA 4N68A 4AIZB 2Q6WB 2OI9C 2NY0D 3TO4C 4G42B 5GRVL 2OQJB 3ULUC 1BEYH 2HLAA 4AQOA 3G6JF 4HWZB 3J7HA 1L9NA 2EC9T 3BDYH 2EC9U 3OGOE 4NN6B 2D7PA 5DURD 35C8H 3IRPX 1KJ3L 3BEWB 3LEYH 3MJ7A 3QEHB 1JWMB 2GTWB 2O5XL 4K3EL 5D70L 2P24A 4X6EB 3NH7H 1U8QB 3RJDA 2CLRB 3HMXA 1FPTH 3QWRD 1OW0A 4LMQE 3SKNA 5FUOL 1VA9A 2JB5H 2BVEA 3VA2C 2XG5A 4OLEA 5TF1H 4XPBH 4PJCA 5E6ID 3CFJB 4UUJA 4PG2C 4PJHF 4WUUE 4EI5A 1JYNA 3IFPA 2RCSL 4NCDA 2AJYL 4ZOBA 5BRZE 2AJUH 1MIEL 4Q2ZA 1F6AB 4OLWL 3RHWF 3VFPB 3CDCA 4JZJC 1WFOA 1DR9A 5EBLA 1KB5H 3W9EB 5T1KA 5HHPA 2M1KA 5BW7C 2JLLA 2C5DC 1VESA 1XF5A 5D2NE 1O7VA 4L3ED 2F19H 1S7TB 5EZLA 5BVPL 3LEXB 1AGCB 3IFNH 3V95A 3CFBB 1WBXA 4HHAB 5EUOA 1A9EB 3MUJA 3MXWH 3QRFM 4MQXC 1YNLL 4ETYA 3MNVB 1ERNA 2QQLH 1T20B 5FHBH 3BPOB 3UJIL 4M6OL 3BZEA 4PUBH 5I1HH 1NCUA 4QRPA 4L8DB 4UT6L 1FRGH 5C09B 1JHKL 4GS7C 5L8KB 1HHKB 4Z7WB 4FRWA 4TTGA 5EZOL 1MAJA 4WI8A 4L8SA 3M07A 5IMOB 3O9WD 1FZKB 3QXVA 4MXQC 5FDWA 1LO0L 3V5KB 4U31A 5FB8B 4XCYB 12E8L 3A6BL 2NW3A 3V7AG 5TPWL 2YD3A 2YOCA 2PYEA 3GMOA 4QRQB 5BO1L 4ZQKB 3TEUA 1RIUH 3AFLA 1WQVT 1T03L 2QADB 4GJTB 1JGVL 3A6OA 5DD5L 2YA0A 4WV1B 4TRPH 2R2EA 1X5JA 1A64A 1F90L 4Z7UE 1GGUA 2EH8H 1I8LA 4JJHA 1CGSL 3OB0H 3R8QA 2CDGB 1OHQA 5ISZB 2WWMD 5SWZB 3T3ME 2PXYB 1A21A 2VXVH 4OT1L 3TA3A 4XHJD 4QNPE 3D3VD 5C6PB 4NC0B 4GLRH 4Y4FA 3W9DA 1H3VA 4CMMB 3L3HB 3WXWH 4YHOL 2NXZD 5E2JA 5I9QC 3FFDA 1MCIA 3MNZA 5DC0A 1ZT1A 2FWOB 3OR6B 5J6GB 2DTML 3RVWD 2HFGH 5I71C 3IDMB 1HYSC 5ITFA 1E4WH 2AP2A 4Y88A 3X11B 4X4XA 3ORJA 3F7RA 4N90E 1TMCB 2ICWA 4IIQB 1G6RL 3H9SB 2KUTA 3NPSC 2Q20A 4ODTL 1MVUB 3NZ8A 5GGTL 4DW2H 4MQ7A 2LE9A 4BSWA 3RIFK 1M05A 2E5EA 5F21B 5I76B 4Z7OE 5KSVA 3VFWB 1CIUA 2A0LC 1Q72H 2X6MA 1LO2L 4YE4L 3LIZL 1F42A 2DLEA 3NAAH 4UV4L 1C5BL 3MOBL 3VE0B 2B1HL 3P4MB 2JIXA 3WUWB 4OZHF 1SYSB 5MP6L 1NAKH 1WISA 2DQEL 1D5IH 2GK2A 5B8CA 4HWNA 1OM3H 2HJLA 2PO6D 3FAWA 2VDQH 5E99H 3QUKA 1T04B 1E27A 2NR6C 1RVFL <