4XXEA

Structure of agra lyttr domain in complex with promoters
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Transcription/dna
total genus 24
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xxeA00
4XXEA 3BS1A 4XQQA 4XQNA 4XQJA 4CBVA 4XYQA 4XYOA 4G4KA
chains in the Genus database with same CATH superfamily
1HJPA 4IJLA 3TQYA 3HOYB 5C44B 1I3QB 3TMEA 2HCIA 3K7AH 1TT2A 2XTIA 4JK1C 1E1OA 2YYZA 1EL0A 1GO3E 3HOZG 5M3MG 3J80E 1PMRA 5EAYA 1B8AA 4C3IB 1W6JA 5CV5A 1BBWA 1D8LA 1X6OA 3I4NH 1G6PA 1GUWA 3S15B 1JB3A 4R8NA 3I56A 4OEMB 3MEFA 1V9PA 1ENAA 4K5VA 1WYDA 3T1HL 1XXGA 3HOYH 4K5XA 3OW7A 4KY6A 5C44H 4JI5Q 1I3QH 1I94L 4A3KB 3DWPA 1GM5A 4PQXA 2JEAI 1L1OA 1LO5D 4KLKA 2CVRA 1VQIA 4DXGA 3I91A 3K80C 5LMNQ 4X3KA 1HRJA 3S15H 4GOPA 4IOAA 2UXDQ 4EX5A 1ET9A 2KQ3A 2A5HA 4CDCC 5IODA 4A3MB 4GNXA 4A3JB 2XVSA 3MVVA 2J4XA 4HCSA 4A3KH 5E4WC 2SNSA 4RKBA 3R93A 1L0YB 1D5ZC 5ELNA 1HXYD 1T5EA 4QUCA 4BWGB 1EYGA 4DR4Q 2TSSA 3KLWA 4DV6Q 3X3MA 5LL6X 2F52A 3NEMA 1ICWA 3H91A 3KBGA 4KMUC 1XPOA 3FDTA 2OF1A 2F0VA 1SAPA 3PO3B 4A3MH 1PH8A 4A3JH 3AB9A 1AP0A 3DEOA 1YZ6A 4EQ5A 1IBLL 4RGTA 5ELBA 2LS01 5GAHC 5CV8A 2F0EA 1QUQB 5KYLA 1II3A 3A8IE 4Z9CB 2K28A 4OX9L 2O2LD 2G9HD 2QEJC 4RHRA 3HZXA 3BJUA 3FPPA 4K2KA 5C5LA 3I2ZA 2UUCL 2B2UC 3PO3H 4IALA 3MHBA 3S2HB 4OXPA 3AEVA 4LFAQ 2F0JA 3VR4A 3G6JB 4QUFA 4NXMQ 3L3OC 4K6DA 3DM1A 1VQ5A 4IO9A 4A3DB 3STBD 3TRZA 1OXUA 1MHWC 4K8IA 1I4PA 2HT1A 5J22A 4KHPQ 4JPBW 2CQAA 1VQ4A 2F0UA 4JCVE 5KGUA 1QNUA 3HKZG 4NXNQ 2A68C 3S2HH 4KD3A 5D65A 2Q8RE 2BA1A 4RFBA 3L9AX 4DAYB 3GTGB 2EYOA 1NCVA 2K5QA 1SMYD 4LF9Q 2YU9B 1WCMG 1GKHA 1D1KA 2CWAA 1O7IA 1PZKD 1LUZA 1TIID 4A3DH 4FF4A 2WKDA 5JJLA 4X65L 1NBWA 1CKMA 4ILWA 4AQYQ 3R2TA 3RR5A 4NDXA 1SE4A 1TS4A 1VQPA 3D3RA 4X66L 3M7GA 4DNIA 2JA5B 2ATWA 4K0KL 3K59A 1U4PA 1YJWA 3GTGH 1KAAA 2IX0A 1PHJA 1TWGB 2L55A 4DV5Q 2YU9H 4B3SL 4DR6Q 2VL6A 1EY6A 3TZDA 2IX3A 2CCZA 5IT9E 3ER0A 5FLXc 1KQSA 3HOVB 2B8GA 4HCEA 2DY7A 4JI4Q 2CH4W 4LWCA 1DOMA 2C5CA 3H3VI 2JA5H 3JAME 1K9MC 1VQAA 2F03A 3PUVA 1Q3LA 2JN4A 5COYA 2Y0SB 1XPUA 3BVZA 1TWGH 1ZYRC 2QDBA 4GKKL 2MGSA 3S16B 3F8TA 1TKWB 1TS2A 2LXJA 3Q6SA 3QIAA 1NR2A 2VXWA 4JI2L 4BBSB 3HOVH 3BDOA 3QO2A 2NUCA 5E3FA 2K03A 4QGUA 1HPCA 2Q2HA 2ZJQA 4A3FG 5ELFA 1STHA 4RMFA 2F0GA 1XTDA 2KJXA 1XWEA 2R7ZG 2E2DC 1SLJA 3HFZB 1ET6A 2SNMA 3WOFA 1J8IA 4DF7A 3S16H 4ZKBB 1HNWL 2F0WA 2MO1A 5TSSA 3L2PA 5CV9A 3ULLA 1SFOB 3FKIG 4BBSH 2K01A 2JJQA 3I73A 1LLRD 2AHOB 2AQ1B 4LUOA 3GTQB 1FYCA 3PMFA 1JWMD 4X64Q 1X3FA 2Z0SA 4JOIC 5JEAJ 3JC66 5C0XH 3PSIA 2JA6B 3GQBA 4JI0L 1VF5C 2OWOA 3MXNB 1EFWA 1WTHA 1K8GA 4BXXH 3T53B 3CHBD 3NPPA 1NTGA 4JI1Q 1LABA 4MNOA 1BCPF 1GHJA 3P7JA 1EQTA 5BR8Q 1SFOH 1C4QA 3NK9A 3UI2A 1ESFA 5EBCA 3OWFA 3CC7A 4L5QA 4NW2A 5JEAH 4LF8Q 4AYBB 1MIUA 3GTQH 3KJPA 3I4MG 1GUGA 5LMNW 1GVPA 1LT4D 2NVTB 3KOJA 2JA6H 5C4JB 1QOHA 5I4DA 3NXWA 1EY7A 5IP7H 4B08A 1VQ9A 1SNOA 2A1AA 5EKLA 4QY7A 2E8GA 1WI5A 4LF5Q 4BY7B 1YBYA 2X6GA 4B3ML 4DR7Q 4F87A 5AJ3L 5ISRA 4DR1Q 5CR3A 2E75C 3CP0A 2N8NA 4GLVB 1E0BA 1VQJA 4DAPA 2NVTH 2SEBD 2A68D 1JOOA 5IGBA 3H94A 4PMBA 1CI3M 3R8BA 1SRUA 1U0LA 2UU9Q 4GN4B 1A2TA 2E5LQ 4BY7H 1Y8PB 2VW9A 4LUVA 1BNZA 1PH2A 2E76C 5G3LF 1JICA 2NWGA 4YWKA 2UUBQ 5IYDG 1OXSC 3CCRA 1UE7A 1SYGA 4LF7L 1P16A 1A3TA 2WP8J 2XNAC 3E9IA 3NENA 4J15A 4DUYQ 3RLNA 1K8OA 2F3IA 3OW2A 4JI7Q 2Z6KA 1K3BC 2AWOA 1CHPD 1S3OA 2RHQB 2JA7B 1Y1WB 5HGTA 1LTAD 1N32Q 4LF6Q 5K5PA 5A2QE 3S9WA 4L5TA 1JC7A 3SVMA 2FINB 1RJTA 2HD3A 4HJ7A 3AMUA 3E5SA 3CCUA 4PZ7A 3J80i 3TP8A 1EY4A 1ENCA 3K5MA 3DM3A 1HUMA 1H9JA 3MA2B 1F9PA 3URYA 3HOUG 2VB3X 2MQHA 1HH2P 3NBHB 1TR5A 5KNCA 4A3IB 4GN5A 2JA7H 4B3RL 4A93G 3I4OA 1Y1WH 1U9RA 1V8QA 4HJ8A 2NN6G 4G7ZC 2F0LA 4JYAQ 4YWMA 2FXQA 4LFCL 5FJ8H 3FVQA 1GUSA 3PUYA 2VQEQ 4A75A 1JB7A 3W1GA 4QMGA 2JXMB 1TWCB 5GROA 4E6IA 3MWYW 2JSOA 1ILPA 1LTID 4HIOA 1H9MA 2D5DA 5JPMC 1EIYB 2NTTA 4A3IH 4DV0Q 3H15A 3RZOB 5C4XG 2DNEA 5CBAE 4A3CH 1BR9A 1QVFA 1BDOA 2EE1A 4OIKA 1XNQQ 3VR3A 2NN6I 5DEHA 3B6YA 1IZ6A 2BCOA 3L7ZC 4JBMA 4LNQA 4BA2I 3FEWX 5A35A 1PFSA 4A3LG 1TWCH 1WTVA 3TDQA 1YNJC 3SXHA 3CAMA 1IKMA 4FP5D 5I2YA 3M7NA 2R93G 3RZOH 2J7ZA 2HQLA 3CQZB 5CBEE 3F2BA 1XTCD 2ENBA 3VYTA 4ZQ3A 1X54A 4UPAA 4JI3L 5DAUA 3A7AB 1TVXA 3H09A 3Q23A 5JVG3 1V1QA 2K6AA 2KCMA 4JI6L 1EY5A 3KF6B 1CQVA 1STAA 2DNCA 3HOXG 3PF4A 2KVMA 3BU2A 4DUZQ 3A8KE 1CA6A 1B4OA 1SYCA 1H9RA 1BBUA 1HZ9A 2ZXPA 2EYFA 3CQZH 3S1MB 3BYYB 1S5DD 5LMUL 2I5LX 1GXDC 5M3FG 1XX8A 2M00A 2A69C 3NSWA 2KA7A 4J6HA 4DV2L 2WFWA 1N34L 1H9SB 2IPKD 3NUCA 4TKOB 4RGOS 3U4VA 4GLAC 5EGTA 3G4SA 3AFQA 4MN3A 4YHHL 1WTOA 4FVMA 1N36Q 4DV4Q 3U4ZA 4HSVA 2F0DA 3ERSX 4YCWA 3S1MH 2VQFL 4C3HG 1EZ8A 5C3EB 4YIJA 5JJZA 1L2FA 2B2TA 1KDAA 5C3WA 1EQQA 4DV7Q 1K8AC 2CQOA 4ABNA 4G57A 1AH9A 3F2DA 1KDCA 1UE1A 1KRTA 2C35B 3NQIA 1ONLA 1GUOA 1SE8A 2IL8A 3W1BA 1Y8NB 4KJOA 4XT1B 4Y7NB 3QOJA 1HFNA 3S1RB 5C3EH 3PF5A 4IUPA 1EIGA 1XMOL 1J5EQ 4XQNA 2WAQG 1ZEQX 5C44G 3TP6A 2KHIA 1I5FA 1EIHA 3I7FA 1BCPC 3D0FA 2VY3A 1A15A 4Y7NH 2QEXA 1ENFA 3VYRA 1DM0B 3S1RH 1TY0A 5C6AA 2VNUD 5CORA 3JAMi 3KDFB 1Y1VB 4XYQA 3CKIB 4KTAA 1M4VA 4V0BA 1SR3A 1FD7D 5JVH3 3J81i 3F1ZA 3GD7A 2RKSA 2NVXB 2OEOA 4X62Q 3S1NB 3UDIA 1S5BD 1SYBA 2ZM6Q 4RAUC 3W3AA 4QIWE 2D0PA 4V190 2G9DA 3CPFA 3K5OA 2DUDA 2R7FA 4JI8L 2XSCA 1IHZA 3RNUA 1RTNA 1NAPA 1IBKQ 1TWHH 1UE5A 5BN3A 1KIXA 1Y1VH 1F2YA 1VQLA 5C5MA 1D5MC 1I4XA 2Q8IB 4A3MG 4N9TA 3EQLC 2AMCB 1SNDA 1B1ZA 3FHWA 4DR3Q 3L0OA 2NVXH 2H4OA 3GTPB 3S1NH 2LMCB 1LACA 2NYZD 1CM9A 1S72A 1YNJD 4KY5A 5LMNL 1YIJA 4N8FA 2F0FA 2K14A 2UXDL 3J81j 1KABA 1FGUA 1KRSA 2PNHA 1HZCA 3ITPA 1KLGD 1SEBD 5FLXE 1HUNA 1OXTA 2EJMA 3G7LA 5J1ZA 3A55A 3FRPB 1JMCA 3QOLA 1JWSD 1PYWD 3D4DA 1VQKA 5E1FA 3GTPH 1WTPA 4DR4L 1G6ZA 3S2DB 1E24A 2NZOA 1TY2A 2PMZB 1EY0A 2ES2A 3W2DA 4UY8C 3M3YB 3J7A5 3VA7A 1Y14B 2WB1B 5J3BA 3RN5A 1JE4A 4ID6A 1QVCA 2N3SA 5JPNC 1QWYA 3DUZA 4DV1Q 2A69D 2K5HA 2UUAL 5K36H 4RGNA 1MJCA 5I6YA 2E2IB 1X3EA 1AN8A 2JYOA 3A8JE 3PIP3 2E2JB 2CKZB 2WACA 4FNFA 1MJEA 4S3SA 3PIO3 1VQFA 4C3IH 3S2DH 2X69A 3WDNA 1TWAB 4WJ3M 1JJCB 3ZYYX 5GQOA 2QF7A 1SJHD 3KUPA 3M3YH 3E9HA 2B3GA 2F0TA 3HKZE 1UUPA 2RCNA 4B3TL 2A6ED 1O7YA 4U68A 4LFAL 5AFWA 1PA6A 5GAEC 2E2IH 2BDOA 4NXML 1PRTF 4IZ8A 2E2JH 4ZUIA 2K5DA 2BOSA 2VB2X 1TWAH 4IUUA 4A3BB 1DYQA 4IURA 3H3VC 1JOQA 1A8VA 4XIGS 4KHPL 3OOCA 3E3XA 5EPKA 2R92G 3CMEA 3U9SA 1EQRA 1FVIA 3D4RA 2JP1A 2N88A 1EZ6A 3K0XA 2XRQD 4IUVA 2JA5G 2F4VL 2FMMA 3KK7A 2EY6A 1RIPA 2DN8A 3MFYA 4IUQA 4POGA 3DWQA 3PCOB 2BE5C 4YY3Q 1FR3A 1I4RA 4C3JB 5GAGC 4JV5Q 1NNXA 1JE5A 5EKIA 3DLLA 1YHBA 4A3BH 1WTRA 1I4QA 5IGCA 2A19A 3HOVG 1SNPA 3NBHA 4ME3A 1TS5A 3UDXA 4IN3A 2ZT9C 1GUNA 1HZAA 2EY5A 2PQAB 1WFQA 2YV5A 5M3MB 4C56C 1RCVD 1CFMA 1U4LA 4HMIA 1HQMC 4DV5L 4UDUC 4DR5L 2Y0SG 2RDGA 4A76A 2IHEA 4DR6L 4CDFC 4C3JH 1V1OA 1BCPB 2I07B 5IP9H 1TU2B 4C1NI 1R4PB 1L1OC 1VQNA 3I4LA 3HRZC 4BBSG 4JI4L 1G8ZD 1VMCA 3EA6A 4GOPC 1HR0Q 3P1HA 1W6KA 1LV9A 2DGYA 1N8RC 1CK1A 4O42A 5M3MH 4FYDA 4NMZA 4GNXC 1EUJA 1CSQA 1SXTA 3CCSA 4OO1H 1HNZL 4B9XA 4AIMA 1WTQA 4LJZC 3SHLA 2CHBD 4J1MA 1CKNB 2NVQB 1UAPA 4QIWB 2A6HC 2AUJD 1ZKOA 2L1BA 5T1IA 3MFGA 1IBMQ 3DWAA 1K28A 4H13C 2L11A 2NTSA 4IPDA 5G3LD 3CCJA 4DAMA 4JBKA 3CC2A 1FNWA 3NBIA 3GTMB 5JEAG 4K14A 4BY1G 1QILA 2R3ZA 4DU9A 1CZWA 3T51B 1CA5A 1HTLD 2JA6G 5I9OA 5IP7G 5L37A 4IFDJ 1CT1D 4HJ9A 1KTKA 1YJ9A 4OX9Q 2QDLA 2NVQH 3KF6A 1RD9D 1GHKA 2AWNA 4PMCA 3PUWA 2MHVA 4WFN3 2KHJA 1M1KC 2EYHA 3GTMH 4AYBG 1Z9FA 1VCIA 4MIUA 4IFDH 5LHY1 1Q1BA 3OYYA 2PO4A 4J8QA 1SN8A 2IT1A 4IPGA 1Z7TA 1EYAA 2EOTA 4A3EG 2XRSD 5M5YB 5JAVA 1TWFB 4BY7G 5D3IB 4OWTB 2PCFB 3VR6A 1X65A 4LF8L 4HR7B 2I5MX 3OMGA 1FNVA 1Q81C 1FJGL 1KL9A 1GJXA 2B2VA 2ICEC 4HN7A 4KD4A 4DKAC 1Q1EA 3QB3A 3TN2A 2SDFA 4Q5VA 2B2WA 4DGZA 2F3WA 4DK6C 1SYEA 5FLXL 2AQ2B 2JA8B 2MNAA 1C9OA 1EU4A 4R4OA 5C0XJ 4LF4L 4JG2A 5I9PA 5DLQE 2ZXOA 3UE0A 3V2TA 5M5YH 1TWFH 3A56A 4X65Q 3CCVA 4CKEA 4DR1L 3NE5B 2D2CC 4DPGA 2B63B 4PV1C 3HG9A 3CD6A 2A73B 5HGQA 1TXYA 3EIVA 5IYBG 3DHQA 1GD7A 4K0KQ 5CV4A 2RSOA 1SDFA 5IWAL 1WCMB 1IL8A 1NMGA 1EWCA 3UE1A 2RDFA 1CZGA 1PZID 3RMHA 3SGIA 2JA8H 2F0OA 3GTJB 3ONAB 4R1JA 3BZDB 3QJYA 4WJWA 1ZXTA 2IX1A 2N55A 1V43A 1Y1WG 3T16A 1EWIA 5I2XA 4RHSA 3CRLC 1QJOA 5FJ8G 2UUBL 2AKWB 4KHZA 5FK9C 2B63H 1AZPA 1E3PA 2F0NA 4G4KA 3SK5A 1T9HA 4OIJA 3IL8A 1SYDA 1D6EC 5D14A 2MFIA 1VQBA 4TSSA 3GTJH 4A3IG 2AUKA 4GKKQ 1JT8A 3K57A 3T13A 4A3CG 5JOBA 1DCZA 1MBYA 1VQMA 4LF6L 3KFUA 1BF4A 4HEDA 3SDZA 2UXBQ 3BYTB 4YCUA 1K83B 3H3VH 1KC8C 1PFMA 2F0HA 1CKOA 3HS0C 2R61A 1WVLA 3C46A 1KNAA 1QNKA 2QILA 3HKSA 5HURA 1A2UA 4ULLA 2RA4A 2Z4IA 2XGTA 2EQSA 3KLSA 1S5ED 1NE3A 3GV6A 1YNNC 5C4JH 5CMDA 2EY2A 5IYCH 3K6OA 3BVGA 1B9NA 3IAYA 4DK3C 2K1BA 4HAEA 2A6HD 1RHPA 1K83H 3VR5A 4A3FB 3Q8DA 1Q90A 2B2YA 4RCNA 2JK8A 1PRTC 2R7ZB 4GOPB 4DK1A 3UDGA 2EY1A 1Y69U 1BXTA 1TS3A 2YTVA 4HIKA 4GNXB 1KXLA 1HNXQ 1SJED 4MZ9A 1WD0A 4DV3Q 3MTSA 2RHSB 1BUVT 1JJ2A 2K33A 4WRDA 3PUXA 4EQPA 1YHQA 3BVMA 3VR2A 3CCLA 1XNQL 3GTLB 4A3FH 3VYUA 1EYDA 2R7ZH 2F0QA 5ELEA 1A62A 3N6RA 4N9PA 3CC4A 2O4XA 1HR0W 1NR4A 3CCQA 2KBNA 2B39A 2PI2A 3PQIA 1ZYRD 4UHVA 4B3MQ 5AJ3Q 4QF4A 2KUMA 3HGBA 3I4MB 3GTLH 1N33L 1JCKB 3A5ZB 2LKVA 3K5NA 4DUZL 2RVLA 2ID0A 5IE8A 3CRKC 2CFMA 2GN5A 3I3CA 4CJ2C 2F0KA 3K8AA 1HFGA 1E2VA 4CGYB 4DR2Q 2IY5B 3AU7A 3P75A 3ULJA 5KNBA 3VA5A 4IUTA 1EOVA 3G71A 2RBMA 2E2HB 3D8GA 2ZJRA 1QG7A 3J81c 3D4WA 4LF7Q 3MXGA 1EU3A 4DFAA 5EQ0A 4C1NK 1BOSA 4A3GB 4XT3B 4DV4L 1I6VC 5IGGA 1YEZA 1G2TA 1S5CD 1F77A 1PZJD 1VDZA 3IRBA 1AEXA 2PW5A 2Z6KC 2WAQE 2CWPA 1KD1C 3HOWG 4DV7L 2F4IA 1X3QA 1QUQA 2E2HH 2ZTEA 1T5XD 1Q8IA 4RKLA 4IJHA 4DNTB 3KF8B 1RL2A 3LNNA 4A3GH 1LT6D 1RKNA 3ERQA 3A0JA 3C1EA 2L5TA 2PQAA 3EJIA 4P2CB 4AH6A 4PG3A 2KCNA 3EBEA 5IGEA 1A3UA 4CBVA 2QGQA 5NUCA 1IYJB 4ODGA 3MAQA 4PZ6A 1B70B 1W2BA 2KEEA 1O78A 1XMQQ 1U4MA 2N49A 4H7BA 1M8AA 4DAVA 1NY4A 2JEBI 4XQQA 1R9TB 4NB3A 4GKJL 2F0MA 2C9OA 2DJFC 3Q22A 1STNA 4XQJA 2J0TD 4F7XA 1SNQA 2EYMA 1PFNA 4Y52H 4DAYA 2VZAA 3A54A 3GV3A 3E0EA 5EPJA 1UEAB 4BBRB 2SOBA 2H1EA 3IFTA 2Q2TA 1CKNA 5ELDA 1ASZA 3NTKA 1I6HB 1HHVA 1LTTD 2Z4HA 3AYHB 1MSHA 3M9BA 1UE6A 2Z8LA 4KN7C 2WKCA 2ZM6L 1BVSA 2XWBB 5C4XB 1R9TH 3SK4A 3LX0A 3I4NG 1DOKA 1F9RA 1O7ZA 4L8JA 1DOLA 4HJ5A 2A8VA 1L0XB 2L4NA 4QL5A 1XPRA 4JI3Q 2EYJA 1PDQA 4BBRH 5T1GA 3HOYG 2UXCQ 4JI6Q 3G6EA 1D2BA 2F0SA 1I6HH 1X32A 1PRTB 1AZQA 4MTKA 2WIIB 3T1YL 4ZKCB 1PLFA 2IWHA 2K5WA 3VYSA 5C4XH 1SE2A 4C3IG 5FKAC 1HA5A 1MD2D 4K2LA 1D5XC 2E74C 4KY7A 3OTOQ 2WB1G 1RODA 1WTWA 1I4GA 2QW7A 2EYLA 1PTOF 5C4ZA 4HJAA 1VQOA 5J39A 5DM63 3SEBA 3T56B 3U9OA 3SK8A 3HOXB 4QCLA 3U58A 2EJFC 1IXRA 3OPOA 4A3KG 4LFBQ 1X9NA 4HMJA 2CW0C 2BA0A 3NWTA 3S24A 3IFDA 2KECA 4F8MA 4P72A 2Z1CA 2IJ0A 1EOTA 2VQFQ 1RDPD 1JR0D 4OONA 5IY0A 1V1PB 3RUZA 4P74A 4DV1L 4JI5L 2FHTA 1Z47A 2OQ0A 2B2TC 3HOXH 4A3JG 2FFKB 1XJVA 3PO2B 4RCOA 1QCBD 2L0CA 1D7QA 3STBC 1Z6HA 1VS0A 4O2DA 3UDFA 4CDEC 5FO7B 4A3BG 1S5FD 3MZ5A 2R6GA 4RA8A 3LWUA 2KCCA 1XMOQ 1B53A 3MXNA 1SMXA 2LSSA 3PO3G 2I5HA 1SMYC 4KKTA 4PZ8A 4RWSC 3LGJA 3PO2H 2K75A 4EQNA 2QKIC 4FF1A 3FP9A 2GA4B 4C3JG 1J9OA 4DV6L 2VS1A 5IP9G 5ELOA 2OT2A 3NELA 3QWNA 2WAQB 1JORA 3PUZA 2Q2UA 1PH3A 5HY6A 2Y0SE 4K5WA 4I7AA 2ZTDA 3TP7A 4DA2A 2F1MA 4OO1G 1PH6A 4JVZA 4YY3L 1C0AA 4IPCA 3D6CA 4GN3B 4KN4C 1XNRQ 4JV5L 4HIDA 1X56A 4KK7A 1F2LA 1WOCA 2GVAA 2HHHQ 2JQOA 4QB4A 4FXDA 4X6AH 3TP5A 2B2UA 4A3DG 4JI8Q 3GO5A 4RGMA 5FLMH 4KKSA 3RZDB 4DK0A 1FNUA 1YNXA 3ULPA 3H0GB 4EQOA 3BZCA 2X6LA 4UP9A 4ZRZA 1NUCA 3TSSA 3M4PA 4ALPA 2F0IA 4M1UB 4CDDC 1PH4A 4TQUS 2ICIA 4OO1I 5ELCA 3K58A 1YJNA 1GOZA 1IW7C 2TMPA 5FOBB 3RZDH 1A6XA 1HR0L 5CGKA 2OTJA 2D0OA 2PZUA 1HCZA 3G48A 4NXNL 1B3AA 4L5SA 2HCCA 3H0GH 2K50A 3CU7A 3BS1A 5KIXA 2VUMB 2JE6I 3TREA 4IFDG 1LT5D 4JBWA 4LF9L 2NB0A 1FL0A 3CW2C 2RQXA 1IBML 1BCPD 1H9KA 1TQOA 1O7LA 4DXFA 4AYBE 2XIWA 4L5RC 4AQYL 2MO0A 1X3GA 2EDGA 2OTLA 1EYCA 3T1HQ 4JC0A 3M4OB 4R4TA 1UEBA 1NSNS 2K04A 2H5XA 1EWHA 3I55A 2UUAQ 4H02A 1I94Q 3S17B 3HOZB 4H0LC 4UAIA 2VUMH 1F2ZA 3U50C 3NWSA 4CJ1B 4L6TB 4GZYC 4IFDI 3J7AV 2M2LA 2HDLA 2CW0D 2PPBC 5BN4A 1I4HA 1QB5D 3S14B 4B9WA 4KV6A 4B3TQ 1HTPA 4UP7A 4FXKC 2K4KA 1O80A 1EY9A 5KYIA 2L12A 4ZUJA 2RCFA 2AQ3B 3M4OH 4K8JA 4P73A 5CV6A 2ASBA 2A74C 1F9QA 3OIQA 4EGVA 2NZHA 3S17H 2PNRC 3HOZH 5C0XG 2KOLA 1PXUA 1LM0A 1STYA 3D31A 5GADC 2JA8G 2XN9C 3EVQA 4BXXG 3FPUB 1L0WA 3MXPA 3PGZA 1PYBA 4NP5A 3F2UA 4L63B 2IW3A 3S14H 1PFBA 3OWEB 3J7YW 2IHFA 1AFPA 1VMPA 1AE2A 2B29A 3K81C 4KJNA 2B63G 1BBXC 3WWVA 3AQQA 1BQQT 1I50B 4R4CA 1G91A 4M8AA 1IBLQ 2F4VQ 1B2TA 5I6WA 2NVYB 1JQYD 4ZK9B 5C0XI 4PMWA 2OXPA 4XYOA 3GTOB 1K8MA 5KEEA 3TS0A 2R92B 1FGBD 4JOIA 2EZVA 3KF8A 3W5OA 2UUCQ 4Q0FA 2LFNA 5KRUA 4HIMA 4X64L 1MSGA 2WV6D 1N9WA 2MUYA 4NKLA 1JOKA 3K7UC 1I50H 1QE6A 2MP1A 4DR5Q 1SSOA 2NVYH 4POFA 1KAWA 2QA4A 2MPMA 3GP7A 1SNMA 4JI1L 3GTOH 3HP3A 5IYCG 1VQ6A 1LTRD 1H9SA 1PTOC 3IKJA 3AFPA 2CH4A 5BR8L 2HUGA 4KI0A 2R92H 3QG1A 4HTHA 1E2ZA 4G7OC 2B8FA 3J80c 3BDCA 1QZGA 1E2WA 3N52A 1OTCA 1K0RA 2ZJPA 1WTXA 2QCPX 1ILQA 1HNZQ 5EJWA 1YVCA 4X3TA 3J81E 3K5LA 4X3SA 1B44D 4YCVA 3ND9A 4OELB 5BN5A 4LF5L 4MHEA 2UXBL 4DR7L 2G5DA 3RLOA 1OO9B 1YHAA 3HKZB 1IW7D 4APVA 3SK6A 5M9OA 4X66Q 4FDBA 3BDLA 1PV4A 2V1CC 1VQEA 4O0AA 3A74A 1Q12A 2FMCA 2GVBA 2BDNA 3KLRA 5LL6S 4H44C 2EJGC 5FO9B 4B3SQ 4P71A 3NQTA 2UU9L 1VF7A 2BE5D 3J80L 2E5LL 2JA7G 4WORA 2PZWA 5CC4A 1D1IA 3CPWA 2I0QA 4IOCA 1C8CA 2P5ZX 1BO0A 2K5VA 3Q0AA 1LTLA 5CYUA 2HDMA 4BY1B 1VQHA 1M90C 1LT3D 4DUYL 3P20A 4CKBA 1DONA 4JI7L 1HNXL 1YI2A 1WCMH 3KDFA 1Q7YC 3OHXC 1NJIC 5EBDA 2YTXA 1W3SA 4DV3L 1KDBA 1NMFA 3RD4A 1HA6A 1N32L 4ME5A 4K6LA 1EQVA 3M85A 2KEDA 4JI2Q 4FXGC 5IOCA 5E7NA 3CMAA 2D62A 4OWWB 2R7DA 2I46A 4MTNA 1FJGQ 4IPHA 4R4QA 4BY1H 1CHQD 4CKCA 3GDEA 3E6ZX 2PYKA 1A0IA 5DM73 1QVGA 2O5JC 2B2VC 1RF2D 4C2MB 3ZJYC 1V1PA 3OIPA 2F3VA 4A3EB 4LF4Q 2B2WC 3KLSX 3RLFA 4KKUA 3K0YA 4GS3A 1HNWQ 3C3LA 3HEJA 1CTMA 1F9SA 4I7ZC 1L1OB 4G7HC 3GTKB 5EPLA 3O13A 4JYAL 1J6QA 3DMUA 4KHVA 1VQ8A 2VQEL 1PH1A 4FF2A 4ZYSA 1HQRD 1HZBA 5FO8B 1RTOA 3VDYA 1G291 1QZHA 5IWAQ 1K0SA 1KNEA 4JI0Q 4C2MH 4A3GG 1Q46A 4DV0L 1PH5A 4A3EH 4RH6A 3CF5A 1CUKA 4NPSA 4DR2L 4OGQC 4TVAB 1B50A 3FKIB 4EVOA 4UP8A 3GTKH 1LYLA 1EIFA 3WOEA 3TBIB 2K32A 1K73C 1LTBD 1UNSA 2KENA 2KHSA 5JJKA 4F88A 1Q82C 1KLUD 2K52A 2RF4A 2HQEA 4DN4M 1MI2A 3DXJC 1UWVA 1PYSB 1CQFA 1EY8A 1SROA 1U5KA 1Q8KA 1C48A 2BH8A 3OMCA 3J7AF 1DGSA 3FKIH 3LWEA 4CHTB 1PTOD 1R4QB 3F2CA 3OSOA 2K05A 4IQZA 5IYBH 5M5XB 4ZAIA 2JA9A 1VQ7A 1P8LA 5EKKA 2FJ2A 5CV7A 3PV0A 5IT9c 4TRDA 4N8X1 1Q86C 3ICEA 1B9MA 2F0PA 1ESRA 3NHHA 2DY8A 1PTOB 5C3EG 3M4QA 4U673 2ZTCA 3R3OA 3C2PA 3JAMc 4BBRG 4FF3A 3I4MH 3TZUA 2WINB 3NTHA 4ZLTF 1MKHA 5H1SE 1XMQL 5M5XH 3QR8A 3T4AC 2B2YC 1VQCA 1X3PA 4O1NA 1N36L 1SNCA 3SE0A 1PVOA 3NTIA 1DD2A 4XTCS 1IYUA 3PIPA 3E0JA 1E7ZA 1MGSA 1PTOH 5D3DA 3PIOA 5IT9L 2M9VA 3EN2A 5E4XA 4BA1I 4QQBX 4LUZA 1G2SA 1EFID 1E22A 1EEFD 1ICFB 3I90A 2PMZE 1A63A 2WB1E 3JAML 5F2DA 1WJJA 3EROA 1SYFA 3A5UA 4B3RQ 1LTSD 3J81L 2DJGC 2PI2E 4R9WA 1J5EL 5IIFA 1Y1VG 3BG3A 4IUNA 2UXCL 4JBJA 4LFCQ 5IYDH 4RG1A 1PH9A 3BZKA 2EVBA 3HOUB 1N33Q 1STBA 3SR1A 3RN2A 4LAAA 1PH7A 1H95A 4A4IA 2Z9HA 1GUTA 3I8ZA 2Q8TA 1YNND 4XXEA 4A93B 1S40A 2KCTA 3OTOL 3R2IA 3V96A 4PNYA 1DJRD 4ZCKA 3I72A 2L15A 1AW7A 5IGDA 3HOUH 1A3VA 3KJOA 4LFBL 2EXDA 4X62L 3PO2G 1PRTD 1STGA 3C1FA 2HIVA 1OXXK 2ALYB 1F2MA 3D6WA 4X3UA 3X3NA 4HSPA 2OCEA 1WD1A 2MJ8A 2PW7A 4A93H 2N78A 2A6EC 1IBKL 1DXMA 2NN6H 1AE3A 2V4DA 2RDHA 4LMQD 2EPBA 4GLXA 1OXVA 1YITA 3EFXD 1Y8OB 4JW0A 4DR3L 3TEHB 1KHIA 5C4HA 5K36G 1DZ1A 1IL2A 1JWUD 3NP8A 2R93B 3MXUA 3I70A 4OWXB 5C3XA 2O5IC 3MC0B 4P75A 1VQGA 4OL7A 1E1TA 4YWLA 1CSPA 2BH2A 5LMUQ 5IGFA 2PQEA 3HOWB 2NZ1D 5FLMG 1JJGA 3FMCA 4WJ4A 4DV2Q 1N34Q 1B7YB 4QJFA 4A3LH 3A7LA 5DNFA 5JJIA 1EEID 1G51A 3MEHA 4YHHQ 4GKJQ 2R93H 1ML0D 2EIFA 2K7VA 2YTYA 4LK1C 1U4RA 2LY7A 1ASYA 3TS2A 2RSNA 3ND8A 3Q24A 5M3FB 1TWHB 1X55A 3HOWH 2NBFA 1S4ZA 2ZXRA 2OQKA 2EXZA 2K5NA 2XWJB 1XYIA 3H0GG 1IKLA 1SBBB 5KNDA 3CCEA 3S1QB 5M5WB 1XNRL 1STEA 3M4YA 1B3QA 1LTGD 1K3RA 2HHHL 2HIXA 1BKBA 2EYPA 4C3HB 3DEPA 4FO2A 4CJ0B 5M3FH 4R8IA 3H6MA 3V05A 4DNRB 3K7AB 3CCMA 5A2QL 3J7ZC 4OHJA 2D9UA 2L9HA 1SE3A 1VQDA 2Z6BA 2LXKA 3S1QH 1IYVA 2VUMG 5M5WH 3T1YQ 2Q2IA 4R4IA 3CXCA 1C7YA 3I4NB 3KBXA 4BS9A 4LW1A 2PZTA 4XDXA 3KYHC 4C3HH 4I65A
chains in the Genus database with same CATH topology
3HOYB 5C44B 1I3QB 3TMEA 2HCIA 1TT2A 4JK1C 2YYZA 1EL0A 3J80E 1PMRA 4C3IB 1W6JA 5CV5A 1GUWA 3S15B 1JB3A 4R8NA 1ENAA 4K5VA 1XXGA 4K5XA 3OW7A 4KY6A 4A3KB 3DWPA 4PQXA 2JEAI 1LO5D 2CVRA 4DXGA 3I91A 4X3KA 1HRJA 1ET9A 2KQ3A 2A5HA 5IODA 4A3MB 4A3JB 2XVSA 3MVVA 2J4XA 4HCSA 5E4WC 2SNSA 4RKBA 3R93A 1L0YB 1D5ZC 1HXYD 1T5EA 4QUCA 4BWGB 2TSSA 3X3MA 5LL6X 1ICWA 3H91A 3KBGA 4KMUC 3FDTA 2OF1A 2F0VA 1SAPA 3PO3B 3AB9A 1AP0A 3DEOA 4RGTA 5ELBA 2LS01 5CV8A 2F0EA 5KYLA 1II3A 3A8IE 4Z9CB 2K28A 2O2LD 2G9HD 2QEJC 4RHRA 3HZXA 3FPPA 4K2KA 5C5LA 2B2UC 4IALA 3MHBA 3S2HB 2F0JA 3VR4A 3G6JB 4QUFA 3L3OC 4K6DA 3DM1A 4A3DB 1OXUA 4K8IA 1I4PA 5J22A 2CQAA 2F0UA 5KGUA 1QNUA 2A68C 4KD3A 5D65A 2Q8RE 2BA1A 4RFBA 3L9AX 3GTGB 2EYOA 1NCVA 2K5QA 1SMYD 2YU9B 1D1KA 1PZKD 1TIID 4FF4A 2WKDA 4ILWA 3R2TA 4NDXA 1SE4A 1TS4A 3D3RA 3M7GA 2JA5B 3K59A 1U4PA 1KAAA 2IX0A 1TWGB 2L55A 1EY6A 3TZDA 2IX3A 5IT9E 3HOVB 2B8GA 4HCEA 2DY7A 1DOMA 2C5CA 3JAME 2F03A 3PUVA 1Q3LA 5COYA 2Y0SB 3BVZA 1ZYRC 2QDBA 2MGSA 3S16B 1TKWB 1TS2A 3Q6SA 3QIAA 1NR2A 2VXWA 4BBSB 3BDOA 3QO2A 2NUCA 5E3FA 2K03A 1HPCA 5ELFA 1STHA 2F0GA 2KJXA 1XWEA 2E2DC 1ET6A 2SNMA 3WOFA 1J8IA 4DF7A 4ZKBB 2F0WA 5TSSA 5CV9A 1SFOB 2K01A 3I73A 1LLRD 2AQ1B 3GTQB 1FYCA 3PMFA 1JWMD 5JEAJ 5C0XH 2JA6B 3GQBA 1VF5C 3T53B 3CHBD 3NPPA 1LABA 1BCPF 1GHJA 3P7JA 1EQTA 1C4QA 3NK9A 3UI2A 1ESFA 5EBCA 3OWFA 4NW2A 5JEAH 4AYBB 1GUGA 2NVTB 1LT4D 5C4JB 1QOHA 5I4DA 3NXWA 1EY7A 4B08A 1SNOA 5EKLA 4BY7B 2X6GA 4F87A 5ISRA 5CR3A 2E75C 1E0BA 4DAPA 2SEBD 2A68D 1JOOA 5IGBA 3H94A 4PMBA 1CI3M 3R8BA 1A2TA 1Y8PB 1BNZA 2E76C 5G3LF 1JICA 2NWGA 1OXSC 1SYGA 1A3TA 2WP8J 2XNAC 1K8OA 2AWOA 1CHPD 2JA7B 1Y1WB 5HGTA 1LTAD 5K5PA 5A2QE 3S9WA 1JC7A 3SVMA 2FINB 1RJTA 3AMUA 3E5SA 3TP8A 1EY4A 1ENCA 3K5MA 1HUMA 1H9JA 3MA2B 1F9PA 3URYA 2VB3X 1TR5A 5KNCA 4A3IB 1U9RA 1V8QA 2NN6G 4G7ZC 2F0LA 3FVQA 1GUSA 3PUYA 4QMGA 2JXMB 4E6IA 1TWCB 3MWYW 2JSOA 1ILPA 1LTID 1H9MA 2D5DA 5JPMC 2NTTA 3RZOB 2DNEA 5CBAE 1BR9A 1BDOA 2EE1A 4OIKA 3VR3A 2NN6I 5DEHA 2BCOA 3L7ZC 4BA2I 3FEWX 5A35A 1WTVA 3TDQA 1YNJC 3SXHA 1IKMA 4FP5D 5I2YA 3M7NA 2J7ZA 3CQZB 5CBEE 1XTCD 2ENBA 3VYTA 4ZQ3A 5DAUA 3A7AB 1TVXA 3H09A 3Q23A 5JVG3 2K6AA 1EY5A 1CQVA 1STAA 2DNCA 2KVMA 3A8KE 1CA6A 1B4OA 1H9RA 1SYCA 2ZXPA 2EYFA 3S1MB 3BYYB 1S5DD 1GXDC 1XX8A 2M00A 2A69C 3NSWA 2KA7A 4J6HA 1H9SB 2IPKD 3NUCA 4TKOB 4RGOS 5EGTA 4MN3A 1WTOA 4FVMA 4HSVA 2F0DA 4C3HG 1EZ8A 5C3EB 4YIJA 5JJZA 2B2TA 1KDAA 5C3WA 4ABNA 4G57A 1KDCA 3NQIA 1ONLA 1GUOA 2IL8A 1Y8NB 4KJOA 4XT1B 4Y7NB 3QOJA 1HFNA 3S1RB 4IUPA 1EIGA 4XQNA 1ZEQX 3TP6A 1EIHA 1BCPC 1A15A 1ENFA 3VYRA 1DM0B 1TY0A 5C6AA 2VNUD 5CORA 1Y1VB 4XYQA 3CKIB 4KTAA 1M4VA 4V0BA 1FD7D 5JVH3 3GD7A 2RKSA 2NVXB 2OEOA 3S1NB 1S5BD 1SYBA 4RAUC 3W3AA 4V190 2G9DA 3K5OA 2XSCA 1IHZA 1RTNA 1NAPA 5BN3A 1F2YA 5C5MA 1D5MC 1I4XA 2Q8IB 4N9TA 3EQLC 1SNDA 1B1ZA 2H4OA 3GTPB 2LMCB 1LACA 2NYZD 1CM9A 1YNJD 4KY5A 2F0FA 1KABA 3ITPA 1KLGD 1SEBD 5FLXE 1HUNA 1OXTA 2EJMA 3G7LA 5J1ZA 3A55A 3FRPB 3QOLA 1JWSD 1PYWD 3D4DA 5E1FA 1WTPA 1G6ZA 3S2DB 1TY2A 2PMZB 1EY0A 3W2DA 3M3YB 3VA7A 2WB1B 1JE4A 4ID6A 5JPNC 1QWYA 3DUZA 2A69D 5K36H 4RGNA 5I6YA 2E2IB 1AN8A 2JYOA 3A8JE 3PIP3 2E2JB 4FNFA 2WACA 4S3SA 3PIO3 2X69A 3WDNA 1TWAB 3ZYYX 2QF7A 1SJHD 3KUPA 2F0TA 1UUPA 2A6ED 1O7YA 4U68A 5AFWA 2BDOA 1PRTF 4IZ8A 4ZUIA 2K5DA 2BOSA 2VB2X 4IUUA 4A3BB 1DYQA 4IURA 3H3VC 1JOQA 4XIGS 3OOCA 5EPKA 3U9SA 3D4RA 2JP1A 2N88A 1EZ6A 2XRQD 4IUVA 2FMMA 3KK7A 2EY6A 2DN8A 3MFYA 4IUQA 3DWQA 2BE5C 1FR3A 1I4RA 4C3JB 5EKIA 1WTRA 1I4QA 5IGCA 1SNPA 3NBHA 1TS5A 4IN3A 2ZT9C 1GUNA 2EY5A 5M3MB 4C56C 1RCVD 1CFMA 1U4LA 4HMIA 1HQMC 4UDUC 2RDGA 1V1OA 1BCPB 2I07B 1TU2B 4C1NI 1R4PB 3I4LA 3HRZC 1G8ZD 1VMCA 3EA6A 3P1HA 1W6KA 1LV9A 1CK1A 4O42A 4FYDA 4NMZA 4OO1H 1SXTA 4B9XA 1WTQA 4LJZC 3SHLA 2CHBD 4J1MA 2NVQB 1UAPA 5T1IA 4QIWB 2AUJD 1ZKOA 2A6HC 2L1BA 3MFGA 3DWAA 4H13C 2L11A 2NTSA 5G3LD 1FNWA 3NBIA 3GTMB 5JEAG 4K14A 1QILA 2R3ZA 4DU9A 1CZWA 3T51B 1CA5A 1HTLD 5I9OA 4IFDJ 1CT1D 1KTKA 1RD9D 1GHKA 2AWNA 4PMCA 3PUWA 2MHVA 4WFN3 2EYHA 1VCIA 4MIUA 4IFDH 5LHY1 1Q1BA 2PO4A 4J8QA 2IT1A 1Z7TA 1EYAA 2EOTA 2XRSD 5M5YB 5JAVA 1TWFB 5D3IB 2PCFB 3VR6A 4HR7B 3OMGA 1FNVA 1GJXA 2B2VA 2ICEC 4HN7A 4KD4A 1Q1EA 3QB3A 3TN2A 2SDFA 4Q5VA 2B2WA 4DGZA 2F3WA 1SYEA 5FLXL 2AQ2B 2JA8B 1EU4A 5C0XJ 5I9PA 2ZXOA 3V2TA 3A56A 4CKEA 3NE5B 2D2CC 2B63B 4PV1C 3HG9A 2A73B 3DHQA 5CV4A 1SDFA 2RSOA 1WCMB 1IL8A 1EWCA 2RDFA 1CZGA 1PZID 3RMHA 2F0OA 3GTJB 3ONAB 3BZDB 3QJYA 4WJWA 1ZXTA 2IX1A 2N55A 1V43A 3T16A 5I2XA 4RHSA 3CRLC 1QJOA 4KHZA 5FK9C 1AZPA 2F0NA 4G4KA 3SK5A 4OIJA 3IL8A 1SYDA 1D6EC 5D14A 4TSSA 2AUKA 3K57A 3T13A 5JOBA 1DCZA 1MBYA 1BF4A 4HEDA 3SDZA 3BYTB 1K83B 1PFMA 2F0HA 3HS0C 2R61A 1WVLA 3C46A 1KNAA 1QNKA 2QILA 5HURA 1A2UA 4ULLA 2RA4A 2Z4IA 3KLSA 1S5ED 3GV6A 1YNNC 5CMDA 2EY2A 3K6OA 3BVGA 1B9NA 3IAYA 2K1BA 4HAEA 2A6HD 1RHPA 3VR5A 4A3FB 1Q90A 2B2YA 4RCNA 1PRTC 2R7ZB 4DK1A 2EY1A 1Y69U 1BXTA 1TS3A 1SJED 1WD0A 3MTSA 1BUVT 2K33A 4WRDA 3PUXA 4EQPA 3BVMA 3VR2A 3GTLB 3VYUA 1EYDA 2F0QA 5ELEA 3N6RA 4N9PA 2O4XA 1NR4A 2B39A 1ZYRD 4QF4A 2KUMA 3HGBA 3I4MB 1JCKB 2LKVA 3K5NA 2RVLA 2ID0A 3CRKC 4CJ2C 3I3CA 2F0KA 1HFGA 1E2VA 4CGYB 3AU7A 3P75A 5KNBA 3VA5A 4IUTA 2RBMA 2E2HB 3D8GA 1QG7A 3D4WA 3MXGA 1EU3A 4DFAA 5EQ0A 4C1NK 1BOSA 4A3GB 4XT3B 1I6VC 5IGGA 1G2TA 1S5CD 1F77A 1PZJD 1VDZA 1AEXA 2PW5A 2F4IA 1X3QA 1T5XD 1Q8IA 4RKLA 4DNTB 3LNNA 1LT6D 1RKNA 3ERQA 3C1EA 2L5TA 3EJIA 4P2CB 2KCNA 5IGEA 1A3UA 4CBVA 5NUCA 4ODGA 3MAQA 2KEEA 1O78A 1U4MA 4H7BA 1M8AA 4DAVA 2JEBI 4XQQA 1R9TB 2F0MA 2C9OA 3Q22A 1STNA 4XQJA 2J0TD 4F7XA 1SNQA 2EYMA 1PFNA 4DAYA 3A54A 3GV3A 5EPJA 1UEAB 4BBRB 2SOBA 2H1EA 3IFTA 5ELDA 1I6HB 3NTKA 1HHVA 1LTTD 2Z4HA 1MSHA 4KN7C 2Z8LA 2WKCA 2XWBB 5C4XB 3SK4A 3LX0A 1DOKA 1F9RA 1O7ZA 4L8JA 1DOLA 1L0XB 2L4NA 2EYJA 1PDQA 5T1GA 1D2BA 2F0SA 1X32A 1PRTB 1AZQA 2WIIB 4ZKCB 1PLFA 2IWHA 2K5WA 3VYSA 1SE2A 4C3IG 5FKAC 1HA5A 1MD2D 4K2LA 1D5XC 2E74C 4KY7A 1RODA 1WTWA 1I4GA 2EYLA 1PTOF 5C4ZA 5J39A 5DM63 3SEBA 3T56B 3U9OA 3SK8A 3HOXB 4QCLA 2EJFC 3OPOA 4HMJA 2CW0C 2BA0A 3NWTA 3IFDA 2KECA 4F8MA 2Z1CA 2IJ0A 1EOTA 1RDPD 1JR0D 1V1PB 3RUZA 2FHTA 1Z47A 2B2TC 2FFKB 3PO2B 4RCOA 1QCBD 2L0CA 1Z6HA 5FO7B 1S5FD 3MZ5A 2R6GA 4RA8A 3LWUA 2KCCA 1B53A 3MXNA 1SMYC 4KKTA 4RWSC 4EQNA 2QKIC 4FF1A 2GA4B 4C3JG 1J9OA 2OT2A 3QWNA 2WAQB 1JORA 3PUZA 4K5WA 3TP7A 4DA2A 2F1MA 4OO1G 3D6CA 4KN4C 4KK7A 1F2LA 4QB4A 4FXDA 3TP5A 2B2UA 3GO5A 4RGMA 4KKSA 3RZDB 4DK0A 1FNUA 3H0GB 4EQOA 2X6LA 4ZRZA 1NUCA 3TSSA 2F0IA 4M1UB 4TQUS 2ICIA 4OO1I 5ELCA 3K58A 1GOZA 1IW7C 2TMPA 5FOBB 1A6XA 5CGKA 2PZUA 1HCZA 1B3AA 2HCCA 3CU7A 3BS1A 5KIXA 2VUMB 2JE6I 4IFDG 1LT5D 4JBWA 2NB0A 2RQXA 1BCPD 1H9KA 1TQOA 1O7LA 4DXFA 2XIWA 2EDGA 1EYCA 3M4OB 1NSNS 2K04A 1EWHA 3S17B 3HOZB 4H0LC 4UAIA 1F2ZA 4CJ1B 3NWSA 4L6TB 4GZYC 4IFDI 3J7AV 2M2LA 2HDLA 2CW0D 2PPBC 5BN4A 1I4HA 1QB5D 3S14B 4B9WA 4KV6A 1HTPA 4FXKC 1O80A 1EY9A 5KYIA 2L12A 4ZUJA 2AQ3B 4K8JA 5CV6A 2A74C 1F9QA 3OIQA 4EGVA 2PNRC 5C0XG 2KOLA 1PXUA 1STYA 3D31A 2XN9C 3EVQA 3FPUB 3MXPA 4NP5A 3F2UA 4L63B 2IW3A 1PFBA 3OWEB 3J7YW 1AFPA 1VMPA 4KJNA 1BBXC 1BQQT 1I50B 1G91A 4M8AA 1B2TA 5I6WA 2NVYB 1JQYD 4ZK9B 5C0XI 4PMWA 2OXPA 4XYOA 3GTOB 1K8MA 5KEEA 2R92B 1FGBD 2EZVA 3KF8A 4Q0FA 2LFNA 5KRUA 1MSGA 2WV6D 2MUYA 4NKLA 1JOKA 1QE6A 2MP1A 1SSOA 2MPMA 3GP7A 1SNMA 3HP3A 1LTRD 1H9SA 1PTOC 3IKJA 2HUGA 4KI0A 3QG1A 4HTHA 1E2ZA 4G7OC 2B8FA 3BDCA 1E2WA 3N52A 1WTXA 2QCPX 1ILQA 5EJWA 4X3TA 3J81E 3K5LA 4X3SA 1B44D 3ND9A 5BN5A 4MHEA 1OO9B 3HKZB 1IW7D 3SK6A 5M9OA 3BDLA 1Q12A 2FMCA 2BDNA 3KLRA 5LL6S 4H44C 2EJGC 5FO9B 3NQTA 1VF7A 2BE5D 3J80L 4WORA 2PZWA 5CC4A 1D1IA 1C8CA 1BO0A 3Q0AA 5CYUA 2HDMA 4BY1B 1LT3D 3P20A 4CKBA 1DONA 3OHXC 5EBDA 1KDBA 3RD4A 1HA6A 4ME5A 4K6LA 1EQVA 3M85A 2KEDA 4FXGC 5IOCA 2D62A 2I46A 1CHQD 4CKCA 3E6ZX 2PYKA 5DM73 2O5JC 2B2VC 1RF2D 4C2MB 1V1PA 3OIPA 2F3VA 4A3EB 2B2WC 3KLSX 3RLFA 4KKUA 3K0YA 3C3LA 3HEJA 1CTMA 1F9SA 4I7ZC 4G7HC 3GTKB 5EPLA 3O13A 3DMUA 4KHVA 4FF2A 4ZYSA 1HQRD 5FO8B 1RTOA 1G291 1KNEA 4RH6A 4OGQC 1B50A 3FKIB 4EVOA 3WOEA 3TBIB 2K32A 1LTBD 1UNSA 2KHSA 4F88A 1KLUD 4DN4M 2HQEA 1MI2A 3DXJC 1CQFA 1EY8A 1C48A 3OMCA 3J7AF 3LWEA 4CHTB 1PTOD 1R4QB 3OSOA 2K05A 4IQZA 5M5XB 4ZAIA 5EKKA 2FJ2A 5CV7A 3PV0A 4TRDA 1B9MA 2F0PA 1ESRA 3NHHA 2DY8A 1PTOB 4U673 3R3OA 3C2PA 4FF3A 3TZUA 2WINB 3NTHA 4ZLTF 3T4AC 2B2YC 1X3PA 4O1NA 1SNCA 3SE0A 3NTIA 1DD2A 4XTCS 1IYUA 3E0JA 1MGSA 1PTOH 5D3DA 5IT9L 2M9VA 5E4XA 4BA1I 1G2SA 1EFID 1EEFD 3I90A 3JAML 5F2DA 3EROA 1SYFA 1LTSD 3J81L 4R9WA 5IIFA 3BG3A 4IUNA 2EVBA 3HOUB 1STBA 3SR1A 4LAAA 1GUTA 3I8ZA 2Q8TA 1YNND 4XXEA 4A93B 3R2IA 3V96A 4PNYA 1DJRD 3I72A 1AW7A 5IGDA 1A3VA 1PRTD 1STGA 3C1FA 1OXXK 1F2MA 3D6WA 4X3UA 3X3NA 4HSPA 1WD1A 2MJ8A 2PW7A 2A6EC 1DXMA 2NN6H 2V4DA 2RDHA 4LMQD 2EPBA 1OXVA 3EFXD 1Y8OB 5C4HA 5K36G 1DZ1A 1JWUD 3NP8A 2R93B 3MXUA 3I70A 5C3XA 2O5IC 3MC0B 4OL7A 5IGFA 2PQEA 3HOWB 2NZ1D 3FMCA 3A7LA 5DNFA 1EEID 3MEHA 1ML0D 2K7VA 4LK1C 1U4RA 2LY7A 2RSNA 3ND8A 3Q24A 5M3FB 1TWHB 2NBFA 1S4ZA 2ZXRA 2EXZA 2XWJB 1XYIA 1IKLA 1SBBB 5KNDA 3S1QB 5M5WB 1STEA 3M4YA 1LTGD 2EYPA 4C3HB 3DEPA 4FO2A 4CJ0B 4R8IA 3H6MA 3V05A 4DNRB 3K7AB 5A2QL 4OHJA 2D9UA 2L9HA 1SE3A 1IYVA 3I4NB 3KBXA 4BS9A 2PZTA 4XDXA 4I65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXE A;  3BS1 A;  4XQQ A;  4XQN A;  4XQJ A;  4CBV A;  4XYQ A;  4XYO A;  4G4K A; 
#chains in the Genus database with same CATH topology
 1HJP A;  4IJL A;  3TQY A;  3HOY B;  5C44 B;  1I3Q B;  3TME A;  2HCI A;  3K7A H;  1TT2 A;  2XTI A;  4JK1 C;  1E1O A;  2YYZ A;  1EL0 A;  1GO3 E;  3HOZ G;  5M3M G;  3J80 E;  1PMR A;  5EAY A;  1B8A A;  4C3I B;  1W6J A;  5CV5 A;  1BBW A;  1D8L A;  1X6O A;  3I4N H;  1G6P A;  1GUW A;  3S15 B;  1JB3 A;  4R8N A;  3I56 A;  4OEM B;  3MEF A;  1V9P A;  1ENA A;  4K5V A;  1WYD A;  3T1H L;  1XXG A;  3HOY H;  4K5X A;  3OW7 A;  4KY6 A;  5C44 H;  4JI5 Q;  1I3Q H;  1I94 L;  4A3K B;  3DWP A;  1GM5 A;  4PQX A;  2JEA I;  1L1O A;  1LO5 D;  4KLK A;  2CVR A;  1VQI A;  4DXG A;  3I91 A;  3K80 C;  5LMN Q;  4X3K A;  1HRJ A;  3S15 H;  4GOP A;  4IOA A;  2UXD Q;  4EX5 A;  1ET9 A;  2KQ3 A;  2A5H A;  4CDC C;  5IOD A;  4A3M B;  4GNX A;  4A3J B;  2XVS A;  3MVV A;  2J4X A;  4HCS A;  4A3K H;  5E4W C;  2SNS A;  4RKB A;  3R93 A;  1L0Y B;  1D5Z C;  5ELN A;  1HXY D;  1T5E A;  4QUC A;  4BWG B;  1EYG A;  4DR4 Q;  2TSS A;  3KLW A;  4DV6 Q;  3X3M A;  5LL6 X;  2F52 A;  3NEM A;  1ICW A;  3H91 A;  3KBG A;  4KMU C;  1XPO A;  3FDT A;  2OF1 A;  2F0V A;  1SAP A;  3PO3 B;  4A3M H;  1PH8 A;  4A3J H;  3AB9 A;  1AP0 A;  3DEO A;  1YZ6 A;  4EQ5 A;  1IBL L;  4RGT A;  5ELB A;  2LS0 1;  5GAH C;  5CV8 A;  2F0E A;  1QUQ B;  5KYL A;  1II3 A;  3A8I E;  4Z9C B;  2K28 A;  4OX9 L;  2O2L D;  2G9H D;  2QEJ C;  4RHR A;  3HZX A;  3BJU A;  3FPP A;  4K2K A;  5C5L A;  3I2Z A;  2UUC L;  2B2U C;  3PO3 H;  4IAL A;  3MHB A;  3S2H B;  4OXP A;  3AEV A;  4LFA Q;  2F0J A;  3VR4 A;  3G6J B;  4QUF A;  4NXM Q;  3L3O C;  4K6D A;  3DM1 A;  1VQ5 A;  4IO9 A;  4A3D B;  3STB D;  3TRZ A;  1OXU A;  1MHW C;  4K8I A;  1I4P A;  2HT1 A;  5J22 A;  4KHP Q;  4JPB W;  2CQA A;  1VQ4 A;  2F0U A;  4JCV E;  5KGU A;  1QNU A;  3HKZ G;  4NXN Q;  2A68 C;  3S2H H;  4KD3 A;  5D65 A;  2Q8R E;  2BA1 A;  4RFB A;  3L9A X;  4DAY B;  3GTG B;  2EYO A;  1NCV A;  2K5Q A;  1SMY D;  4LF9 Q;  2YU9 B;  1WCM G;  1GKH A;  1D1K A;  2CWA A;  1O7I A;  1PZK D;  1LUZ A;  1TII D;  4A3D H;  4FF4 A;  2WKD A;  5JJL A;  4X65 L;  1NBW A;  1CKM A;  4ILW A;  4AQY Q;  3R2T A;  3RR5 A;  4NDX A;  1SE4 A;  1TS4 A;  1VQP A;  3D3R A;  4X66 L;  3M7G A;  4DNI A;  2JA5 B;  2ATW A;  4K0K L;  3K59 A;  1U4P A;  1YJW A;  3GTG H;  1KAA A;  2IX0 A;  1PHJ A;  1TWG B;  2L55 A;  4DV5 Q;  2YU9 H;  4B3S L;  4DR6 Q;  2VL6 A;  1EY6 A;  3TZD A;  2IX3 A;  2CCZ A;  5IT9 E;  3ER0 A;  5FLX c;  1KQS A;  3HOV B;  2B8G A;  4HCE A;  2DY7 A;  4JI4 Q;  2CH4 W;  4LWC A;  1DOM A;  2C5C A;  3H3V I;  2JA5 H;  3JAM E;  1K9M C;  1VQA A;  2F03 A;  3PUV A;  1Q3L A;  2JN4 A;  5COY A;  2Y0S B;  1XPU A;  3BVZ A;  1TWG H;  1ZYR C;  2QDB A;  4GKK L;  2MGS A;  3S16 B;  3F8T A;  1TKW B;  1TS2 A;  2LXJ A;  3Q6S A;  3QIA A;  1NR2 A;  2VXW A;  4JI2 L;  4BBS B;  3HOV H;  3BDO A;  3QO2 A;  2NUC A;  5E3F A;  2K03 A;  4QGU A;  1HPC A;  2Q2H A;  2ZJQ A;  4A3F G;  5ELF A;  1STH A;  4RMF A;  2F0G A;  1XTD A;  2KJX A;  1XWE A;  2R7Z G;  2E2D C;  1SLJ A;  3HFZ B;  1ET6 A;  2SNM A;  3WOF A;  1J8I A;  4DF7 A;  3S16 H;  4ZKB B;  1HNW L;  2F0W A;  2MO1 A;  5TSS A;  3L2P A;  5CV9 A;  3ULL A;  1SFO B;  3FKI G;  4BBS H;  2K01 A;  2JJQ A;  3I73 A;  1LLR D;  2AHO B;  2AQ1 B;  4LUO A;  3GTQ B;  1FYC A;  3PMF A;  1JWM D;  4X64 Q;  1X3F A;  2Z0S A;  4JOI C;  5JEA J;  3JC6 6;  5C0X H;  3PSI A;  2JA6 B;  3GQB A;  4JI0 L;  1VF5 C;  2OWO A;  3MXN B;  1EFW A;  1WTH A;  1K8G A;  4BXX H;  3T53 B;  3CHB D;  3NPP A;  1NTG A;  4JI1 Q;  1LAB A;  4MNO A;  1BCP F;  1GHJ A;  3P7J A;  1EQT A;  5BR8 Q;  1SFO H;  1C4Q A;  3NK9 A;  3UI2 A;  1ESF A;  5EBC A;  3OWF A;  3CC7 A;  4L5Q A;  4NW2 A;  5JEA H;  4LF8 Q;  4AYB B;  1MIU A;  3GTQ H;  3KJP A;  3I4M G;  1GUG A;  5LMN W;  1GVP A;  1LT4 D;  2NVT B;  3KOJ A;  2JA6 H;  5C4J B;  1QOH A;  5I4D A;  3NXW A;  1EY7 A;  5IP7 H;  4B08 A;  1VQ9 A;  1SNO A;  2A1A A;  5EKL A;  4QY7 A;  2E8G A;  1WI5 A;  4LF5 Q;  4BY7 B;  1YBY A;  2X6G A;  4B3M L;  4DR7 Q;  4F87 A;  5AJ3 L;  5ISR A;  4DR1 Q;  5CR3 A;  2E75 C;  3CP0 A;  2N8N A;  4GLV B;  1E0B A;  1VQJ A;  4DAP A;  2NVT H;  2SEB D;  2A68 D;  1JOO A;  5IGB A;  3H94 A;  4PMB A;  1CI3 M;  3R8B A;  1SRU A;  1U0L A;  2UU9 Q;  4GN4 B;  1A2T A;  2E5L Q;  4BY7 H;  1Y8P B;  2VW9 A;  4LUV A;  1BNZ A;  1PH2 A;  2E76 C;  5G3L F;  1JIC A;  2NWG A;  4YWK A;  2UUB Q;  5IYD G;  1OXS C;  3CCR A;  1UE7 A;  1SYG A;  4LF7 L;  1P16 A;  1A3T A;  2WP8 J;  2XNA C;  3E9I A;  3NEN A;  4J15 A;  4DUY Q;  3RLN A;  1K8O A;  2F3I A;  3OW2 A;  4JI7 Q;  2Z6K A;  1K3B C;  2AWO A;  1CHP D;  1S3O A;  2RHQ B;  2JA7 B;  1Y1W B;  5HGT A;  1LTA D;  1N32 Q;  4LF6 Q;  5K5P A;  5A2Q E;  3S9W A;  4L5T A;  1JC7 A;  3SVM A;  2FIN B;  1RJT A;  2HD3 A;  4HJ7 A;  3AMU A;  3E5S A;  3CCU A;  4PZ7 A;  3J80 i;  3TP8 A;  1EY4 A;  1ENC A;  3K5M A;  3DM3 A;  1HUM A;  1H9J A;  3MA2 B;  1F9P A;  3URY A;  3HOU G;  2VB3 X;  2MQH A;  1HH2 P;  3NBH B;  1TR5 A;  5KNC A;  4A3I B;  4GN5 A;  2JA7 H;  4B3R L;  4A93 G;  3I4O A;  1Y1W H;  1U9R A;  1V8Q A;  4HJ8 A;  2NN6 G;  4G7Z C;  2F0L A;  4JYA Q;  4YWM A;  2FXQ A;  4LFC L;  5FJ8 H;  3FVQ A;  1GUS A;  3PUY A;  2VQE Q;  4A75 A;  1JB7 A;  3W1G A;  4QMG A;  2JXM B;  1TWC B;  5GRO A;  4E6I A;  3MWY W;  2JSO A;  1ILP A;  1LTI D;  4HIO A;  1H9M A;  2D5D A;  5JPM C;  1EIY B;  2NTT A;  4A3I H;  4DV0 Q;  3H15 A;  3RZO B;  5C4X G;  2DNE A;  5CBA E;  4A3C H;  1BR9 A;  1QVF A;  1BDO A;  2EE1 A;  4OIK A;  1XNQ Q;  3VR3 A;  2NN6 I;  5DEH A;  3B6Y A;  1IZ6 A;  2BCO A;  3L7Z C;  4JBM A;  4LNQ A;  4BA2 I;  3FEW X;  5A35 A;  1PFS A;  4A3L G;  1TWC H;  1WTV A;  3TDQ A;  1YNJ C;  3SXH A;  3CAM A;  1IKM A;  4FP5 D;  5I2Y A;  3M7N A;  2R93 G;  3RZO H;  2J7Z A;  2HQL A;  3CQZ B;  5CBE E;  3F2B A;  1XTC D;  2ENB A;  3VYT A;  4ZQ3 A;  1X54 A;  4UPA A;  4JI3 L;  5DAU A;  3A7A B;  1TVX A;  3H09 A;  3Q23 A;  5JVG 3;  1V1Q A;  2K6A A;  2KCM A;  4JI6 L;  1EY5 A;  3KF6 B;  1CQV A;  1STA A;  2DNC A;  3HOX G;  3PF4 A;  2KVM A;  3BU2 A;  4DUZ Q;  3A8K E;  1CA6 A;  1B4O A;  1SYC A;  1H9R A;  1BBU A;  1HZ9 A;  2ZXP A;  2EYF A;  3CQZ H;  3S1M B;  3BYY B;  1S5D D;  5LMU L;  2I5L X;  1GXD C;  5M3F G;  1XX8 A;  2M00 A;  2A69 C;  3NSW A;  2KA7 A;  4J6H A;  4DV2 L;  2WFW A;  1N34 L;  1H9S B;  2IPK D;  3NUC A;  4TKO B;  4RGO S;  3U4V A;  4GLA C;  5EGT A;  3G4S A;  3AFQ A;  4MN3 A;  4YHH L;  1WTO A;  4FVM A;  1N36 Q;  4DV4 Q;  3U4Z A;  4HSV A;  2F0D A;  3ERS X;  4YCW A;  3S1M H;  2VQF L;  4C3H G;  1EZ8 A;  5C3E B;  4YIJ A;  5JJZ A;  1L2F A;  2B2T A;  1KDA A;  5C3W A;  1EQQ A;  4DV7 Q;  1K8A C;  2CQO A;  4ABN A;  4G57 A;  1AH9 A;  3F2D A;  1KDC A;  1UE1 A;  1KRT A;  2C35 B;  3NQI A;  1ONL A;  1GUO A;  1SE8 A;  2IL8 A;  3W1B A;  1Y8N B;  4KJO A;  4XT1 B;  4Y7N B;  3QOJ A;  1HFN A;  3S1R B;  5C3E H;  3PF5 A;  4IUP A;  1EIG A;  1XMO L;  1J5E Q;  4XQN A;  2WAQ G;  1ZEQ X;  5C44 G;  3TP6 A;  2KHI A;  1I5F A;  1EIH A;  3I7F A;  1BCP C;  3D0F A;  2VY3 A;  1A15 A;  4Y7N H;  2QEX A;  1ENF A;  3VYR A;  1DM0 B;  3S1R H;  1TY0 A;  5C6A A;  2VNU D;  5COR A;  3JAM i;  3KDF B;  1Y1V B;  4XYQ A;  3CKI B;  4KTA A;  1M4V A;  4V0B A;  1SR3 A;  1FD7 D;  5JVH 3;  3J81 i;  3F1Z A;  3GD7 A;  2RKS A;  2NVX B;  2OEO A;  4X62 Q;  3S1N B;  3UDI A;  1S5B D;  1SYB A;  2ZM6 Q;  4RAU C;  3W3A A;  4QIW E;  2D0P A;  4V19 0;  2G9D A;  3CPF A;  3K5O A;  2DUD A;  2R7F A;  4JI8 L;  2XSC A;  1IHZ A;  3RNU A;  1RTN A;  1NAP A;  1IBK Q;  1TWH H;  1UE5 A;  5BN3 A;  1KIX A;  1Y1V H;  1F2Y A;  1VQL A;  5C5M A;  1D5M C;  1I4X A;  2Q8I B;  4A3M G;  4N9T A;  3EQL C;  2AMC B;  1SND A;  1B1Z A;  3FHW A;  4DR3 Q;  3L0O A;  2NVX H;  2H4O A;  3GTP B;  3S1N H;  2LMC B;  1LAC A;  2NYZ D;  1CM9 A;  1S72 A;  1YNJ D;  4KY5 A;  5LMN L;  1YIJ A;  4N8F A;  2F0F A;  2K14 A;  2UXD L;  3J81 j;  1KAB A;  1FGU A;  1KRS A;  2PNH A;  1HZC A;  3ITP A;  1KLG D;  1SEB D;  5FLX E;  1HUN A;  1OXT A;  2EJM A;  3G7L A;  5J1Z A;  3A55 A;  3FRP B;  1JMC A;  3QOL A;  1JWS D;  1PYW D;  3D4D A;  1VQK A;  5E1F A;  3GTP H;  1WTP A;  4DR4 L;  1G6Z A;  3S2D B;  1E24 A;  2NZO A;  1TY2 A;  2PMZ B;  1EY0 A;  2ES2 A;  3W2D A;  4UY8 C;  3M3Y B;  3J7A 5;  3VA7 A;  1Y14 B;  2WB1 B;  5J3B A;  3RN5 A;  1JE4 A;  4ID6 A;  1QVC A;  2N3S A;  5JPN C;  1QWY A;  3DUZ A;  4DV1 Q;  2A69 D;  2K5H A;  2UUA L;  5K36 H;  4RGN A;  1MJC A;  5I6Y A;  2E2I B;  1X3E A;  1AN8 A;  2JYO A;  3A8J E;  3PIP 3;  2E2J B;  2CKZ B;  2WAC A;  4FNF A;  1MJE A;  4S3S A;  3PIO 3;  1VQF A;  4C3I H;  3S2D H;  2X69 A;  3WDN A;  1TWA B;  4WJ3 M;  1JJC B;  3ZYY X;  5GQO A;  2QF7 A;  1SJH D;  3KUP A;  3M3Y H;  3E9H A;  2B3G A;  2F0T A;  3HKZ E;  1UUP A;  2RCN A;  4B3T L;  2A6E D;  1O7Y A;  4U68 A;  4LFA L;  5AFW A;  1PA6 A;  5GAE C;  2E2I H;  2BDO A;  4NXM L;  1PRT F;  4IZ8 A;  2E2J H;  4ZUI A;  2K5D A;  2BOS A;  2VB2 X;  1TWA H;  4IUU A;  4A3B B;  1DYQ A;  4IUR A;  3H3V C;  1JOQ A;  1A8V A;  4XIG S;  4KHP L;  3OOC A;  3E3X A;  5EPK A;  2R92 G;  3CME A;  3U9S A;  1EQR A;  1FVI A;  3D4R A;  2JP1 A;  2N88 A;  1EZ6 A;  3K0X A;  2XRQ D;  4IUV A;  2JA5 G;  2F4V L;  2FMM A;  3KK7 A;  2EY6 A;  1RIP A;  2DN8 A;  3MFY A;  4IUQ A;  4POG A;  3DWQ A;  3PCO B;  2BE5 C;  4YY3 Q;  1FR3 A;  1I4R A;  4C3J B;  5GAG C;  4JV5 Q;  1NNX A;  1JE5 A;  5EKI A;  3DLL A;  1YHB A;  4A3B H;  1WTR A;  1I4Q A;  5IGC A;  2A19 A;  3HOV G;  1SNP A;  3NBH A;  4ME3 A;  1TS5 A;  3UDX A;  4IN3 A;  2ZT9 C;  1GUN A;  1HZA A;  2EY5 A;  2PQA B;  1WFQ A;  2YV5 A;  5M3M B;  4C56 C;  1RCV D;  1CFM A;  1U4L A;  4HMI A;  1HQM C;  4DV5 L;  4UDU C;  4DR5 L;  2Y0S G;  2RDG A;  4A76 A;  2IHE A;  4DR6 L;  4CDF C;  4C3J H;  1V1O A;  1BCP B;  2I07 B;  5IP9 H;  1TU2 B;  4C1N I;  1R4P B;  1L1O C;  1VQN A;  3I4L A;  3HRZ C;  4BBS G;  4JI4 L;  1G8Z D;  1VMC A;  3EA6 A;  4GOP C;  1HR0 Q;  3P1H A;  1W6K A;  1LV9 A;  2DGY A;  1N8R C;  1CK1 A;  4O42 A;  5M3M H;  4FYD A;  4NMZ A;  4GNX C;  1EUJ A;  1CSQ A;  1SXT A;  3CCS A;  4OO1 H;  1HNZ L;  4B9X A;  4AIM A;  1WTQ A;  4LJZ C;  3SHL A;  2CHB D;  4J1M A;  1CKN B;  2NVQ B;  1UAP A;  4QIW B;  2A6H C;  2AUJ D;  1ZKO A;  2L1B A;  5T1I A;  3MFG A;  1IBM Q;  3DWA A;  1K28 A;  4H13 C;  2L11 A;  2NTS A;  4IPD A;  5G3L D;  3CCJ A;  4DAM A;  4JBK A;  3CC2 A;  1FNW A;  3NBI A;  3GTM B;  5JEA G;  4K14 A;  4BY1 G;  1QIL A;  2R3Z A;  4DU9 A;  1CZW A;  3T51 B;  1CA5 A;  1HTL D;  2JA6 G;  5I9O A;  5IP7 G;  5L37 A;  4IFD J;  1CT1 D;  4HJ9 A;  1KTK A;  1YJ9 A;  4OX9 Q;  2QDL A;  2NVQ H;  3KF6 A;  1RD9 D;  1GHK A;  2AWN A;  4PMC A;  3PUW A;  2MHV A;  4WFN 3;  2KHJ A;  1M1K C;  2EYH A;  3GTM H;  4AYB G;  1Z9F A;  1VCI A;  4MIU A;  4IFD H;  5LHY 1;  1Q1B A;  3OYY A;  2PO4 A;  4J8Q A;  1SN8 A;  2IT1 A;  4IPG A;  1Z7T A;  1EYA A;  2EOT A;  4A3E G;  2XRS D;  5M5Y B;  5JAV A;  1TWF B;  4BY7 G;  5D3I B;  4OWT B;  2PCF B;  3VR6 A;  1X65 A;  4LF8 L;  4HR7 B;  2I5M X;  3OMG A;  1FNV A;  1Q81 C;  1FJG L;  1KL9 A;  1GJX A;  2B2V A;  2ICE C;  4HN7 A;  4KD4 A;  4DKA C;  1Q1E A;  3QB3 A;  3TN2 A;  2SDF A;  4Q5V A;  2B2W A;  4DGZ A;  2F3W A;  4DK6 C;  1SYE A;  5FLX L;  2AQ2 B;  2JA8 B;  2MNA A;  1C9O A;  1EU4 A;  4R4O A;  5C0X J;  4LF4 L;  4JG2 A;  5I9P A;  5DLQ E;  2ZXO A;  3UE0 A;  3V2T A;  5M5Y H;  1TWF H;  3A56 A;  4X65 Q;  3CCV A;  4CKE A;  4DR1 L;  3NE5 B;  2D2C C;  4DPG A;  2B63 B;  4PV1 C;  3HG9 A;  3CD6 A;  2A73 B;  5HGQ A;  1TXY A;  3EIV A;  5IYB G;  3DHQ A;  1GD7 A;  4K0K Q;  5CV4 A;  2RSO A;  1SDF A;  5IWA L;  1WCM B;  1IL8 A;  1NMG A;  1EWC A;  3UE1 A;  2RDF A;  1CZG A;  1PZI D;  3RMH A;  3SGI A;  2JA8 H;  2F0O A;  3GTJ B;  3ONA B;  4R1J A;  3BZD B;  3QJY A;  4WJW A;  1ZXT A;  2IX1 A;  2N55 A;  1V43 A;  1Y1W G;  3T16 A;  1EWI A;  5I2X A;  4RHS A;  3CRL C;  1QJO A;  5FJ8 G;  2UUB L;  2AKW B;  4KHZ A;  5FK9 C;  2B63 H;  1AZP A;  1E3P A;  2F0N A;  4G4K A;  3SK5 A;  1T9H A;  4OIJ A;  3IL8 A;  1SYD A;  1D6E C;  5D14 A;  2MFI A;  1VQB A;  4TSS A;  3GTJ H;  4A3I G;  2AUK A;  4GKK Q;  1JT8 A;  3K57 A;  3T13 A;  4A3C G;  5JOB A;  1DCZ A;  1MBY A;  1VQM A;  4LF6 L;  3KFU A;  1BF4 A;  4HED A;  3SDZ A;  2UXB Q;  3BYT B;  4YCU A;  1K83 B;  3H3V H;  1KC8 C;  1PFM A;  2F0H A;  1CKO A;  3HS0 C;  2R61 A;  1WVL A;  3C46 A;  1KNA A;  1QNK A;  2QIL A;  3HKS A;  5HUR A;  1A2U A;  4ULL A;  2RA4 A;  2Z4I A;  2XGT A;  2EQS A;  3KLS A;  1S5E D;  1NE3 A;  3GV6 A;  1YNN C;  5C4J H;  5CMD A;  2EY2 A;  5IYC H;  3K6O A;  3BVG A;  1B9N A;  3IAY A;  4DK3 C;  2K1B A;  4HAE A;  2A6H D;  1RHP A;  1K83 H;  3VR5 A;  4A3F B;  3Q8D A;  1Q90 A;  2B2Y A;  4RCN A;  2JK8 A;  1PRT C;  2R7Z B;  4GOP B;  4DK1 A;  3UDG A;  2EY1 A;  1Y69 U;  1BXT A;  1TS3 A;  2YTV A;  4HIK A;  4GNX B;  1KXL A;  1HNX Q;  1SJE D;  4MZ9 A;  1WD0 A;  4DV3 Q;  3MTS A;  2RHS B;  1BUV T;  1JJ2 A;  2K33 A;  4WRD A;  3PUX A;  4EQP A;  1YHQ A;  3BVM A;  3VR2 A;  3CCL A;  1XNQ L;  3GTL B;  4A3F H;  3VYU A;  1EYD A;  2R7Z H;  2F0Q A;  5ELE A;  1A62 A;  3N6R A;  4N9P A;  3CC4 A;  2O4X A;  1HR0 W;  1NR4 A;  3CCQ A;  2KBN A;  2B39 A;  2PI2 A;  3PQI A;  1ZYR D;  4UHV A;  4B3M Q;  5AJ3 Q;  4QF4 A;  2KUM A;  3HGB A;  3I4M B;  3GTL H;  1N33 L;  1JCK B;  3A5Z B;  2LKV A;  3K5N A;  4DUZ L;  2RVL A;  2ID0 A;  5IE8 A;  3CRK C;  2CFM A;  2GN5 A;  3I3C A;  4CJ2 C;  2F0K A;  3K8A A;  1HFG A;  1E2V A;  4CGY B;  4DR2 Q;  2IY5 B;  3AU7 A;  3P75 A;  3ULJ A;  5KNB A;  3VA5 A;  4IUT A;  1EOV A;  3G71 A;  2RBM A;  2E2H B;  3D8G A;  2ZJR A;  1QG7 A;  3J81 c;  3D4W A;  4LF7 Q;  3MXG A;  1EU3 A;  4DFA A;  5EQ0 A;  4C1N K;  1BOS A;  4A3G B;  4XT3 B;  4DV4 L;  1I6V C;  5IGG A;  1YEZ A;  1G2T A;  1S5C D;  1F77 A;  1PZJ D;  1VDZ A;  3IRB A;  1AEX A;  2PW5 A;  2Z6K C;  2WAQ E;  2CWP A;  1KD1 C;  3HOW G;  4DV7 L;  2F4I A;  1X3Q A;  1QUQ A;  2E2H H;  2ZTE A;  1T5X D;  1Q8I A;  4RKL A;  4IJH A;  4DNT B;  3KF8 B;  1RL2 A;  3LNN A;  4A3G H;  1LT6 D;  1RKN A;  3ERQ A;  3A0J A;  3C1E A;  2L5T A;  2PQA A;  3EJI A;  4P2C B;  4AH6 A;  4PG3 A;  2KCN A;  3EBE A;  5IGE A;  1A3U A;  4CBV A;  2QGQ A;  5NUC A;  1IYJ B;  4ODG A;  3MAQ A;  4PZ6 A;  1B70 B;  1W2B A;  2KEE A;  1O78 A;  1XMQ Q;  1U4M A;  2N49 A;  4H7B A;  1M8A A;  4DAV A;  1NY4 A;  2JEB I;  4XQQ A;  1R9T B;  4NB3 A;  4GKJ L;  2F0M A;  2C9O A;  2DJF C;  3Q22 A;  1STN A;  4XQJ A;  2J0T D;  4F7X A;  1SNQ A;  2EYM A;  1PFN A;  4Y52 H;  4DAY A;  2VZA A;  3A54 A;  3GV3 A;  3E0E A;  5EPJ A;  1UEA B;  4BBR B;  2SOB A;  2H1E A;  3IFT A;  2Q2T A;  1CKN A;  5ELD A;  1ASZ A;  3NTK A;  1I6H B;  1HHV A;  1LTT D;  2Z4H A;  3AYH B;  1MSH A;  3M9B A;  1UE6 A;  2Z8L A;  4KN7 C;  2WKC A;  2ZM6 L;  1BVS A;  2XWB B;  5C4X B;  1R9T H;  3SK4 A;  3LX0 A;  3I4N G;  1DOK A;  1F9R A;  1O7Z A;  4L8J A;  1DOL A;  4HJ5 A;  2A8V A;  1L0X B;  2L4N A;  4QL5 A;  1XPR A;  4JI3 Q;  2EYJ A;  1PDQ A;  4BBR H;  5T1G A;  3HOY G;  2UXC Q;  4JI6 Q;  3G6E A;  1D2B A;  2F0S A;  1I6H H;  1X32 A;  1PRT B;  1AZQ A;  4MTK A;  2WII B;  3T1Y L;  4ZKC B;  1PLF A;  2IWH A;  2K5W A;  3VYS A;  5C4X H;  1SE2 A;  4C3I G;  5FKA C;  1HA5 A;  1MD2 D;  4K2L A;  1D5X C;  2E74 C;  4KY7 A;  3OTO Q;  2WB1 G;  1ROD A;  1WTW A;  1I4G A;  2QW7 A;  2EYL A;  1PTO F;  5C4Z A;  4HJA A;  1VQO A;  5J39 A;  5DM6 3;  3SEB A;  3T56 B;  3U9O A;  3SK8 A;  3HOX B;  4QCL A;  3U58 A;  2EJF C;  1IXR A;  3OPO A;  4A3K G;  4LFB Q;  1X9N A;  4HMJ A;  2CW0 C;  2BA0 A;  3NWT A;  3S24 A;  3IFD A;  2KEC A;  4F8M A;  4P72 A;  2Z1C A;  2IJ0 A;  1EOT A;  2VQF Q;  1RDP D;  1JR0 D;  4OON A;  5IY0 A;  1V1P B;  3RUZ A;  4P74 A;  4DV1 L;  4JI5 L;  2FHT A;  1Z47 A;  2OQ0 A;  2B2T C;  3HOX H;  4A3J G;  2FFK B;  1XJV A;  3PO2 B;  4RCO A;  1QCB D;  2L0C A;  1D7Q A;  3STB C;  1Z6H A;  1VS0 A;  4O2D A;  3UDF A;  4CDE C;  5FO7 B;  4A3B G;  1S5F D;  3MZ5 A;  2R6G A;  4RA8 A;  3LWU A;  2KCC A;  1XMO Q;  1B53 A;  3MXN A;  1SMX A;  2LSS A;  3PO3 G;  2I5H A;  1SMY C;  4KKT A;  4PZ8 A;  4RWS C;  3LGJ A;  3PO2 H;  2K75 A;  4EQN A;  2QKI C;  4FF1 A;  3FP9 A;  2GA4 B;  4C3J G;  1J9O A;  4DV6 L;  2VS1 A;  5IP9 G;  5ELO A;  2OT2 A;  3NEL A;  3QWN A;  2WAQ B;  1JOR A;  3PUZ A;  2Q2U A;  1PH3 A;  5HY6 A;  2Y0S E;  4K5W A;  4I7A A;  2ZTD A;  3TP7 A;  4DA2 A;  2F1M A;  4OO1 G;  1PH6 A;  4JVZ A;  4YY3 L;  1C0A A;  4IPC A;  3D6C A;  4GN3 B;  4KN4 C;  1XNR Q;  4JV5 L;  4HID A;  1X56 A;  4KK7 A;  1F2L A;  1WOC A;  2GVA A;  2HHH Q;  2JQO A;  4QB4 A;  4FXD A;  4X6A H;  3TP5 A;  2B2U A;  4A3D G;  4JI8 Q;  3GO5 A;  4RGM A;  5FLM H;  4KKS A;  3RZD B;  4DK0 A;  1FNU A;  1YNX A;  3ULP A;  3H0G B;  4EQO A;  3BZC A;  2X6L A;  4UP9 A;  4ZRZ A;  1NUC A;  3TSS A;  3M4P A;  4ALP A;  2F0I A;  4M1U B;  4CDD C;  1PH4 A;  4TQU S;  2ICI A;  4OO1 I;  5ELC A;  3K58 A;  1YJN A;  1GOZ A;  1IW7 C;  2TMP A;  5FOB B;  3RZD H;  1A6X A;  1HR0 L;  5CGK A;  2OTJ A;  2D0O A;  2PZU A;  1HCZ A;  3G48 A;  4NXN L;  1B3A A;  4L5S A;  2HCC A;  3H0G H;  2K50 A;  3CU7 A;  3BS1 A;  5KIX A;  2VUM B;  2JE6 I;  3TRE A;  4IFD G;  1LT5 D;  4JBW A;  4LF9 L;  2NB0 A;  1FL0 A;  3CW2 C;  2RQX A;  1IBM L;  1BCP D;  1H9K A;  1TQO A;  1O7L A;  4DXF A;  4AYB E;  2XIW A;  4L5R C;  4AQY L;  2MO0 A;  1X3G A;  2EDG A;  2OTL A;  1EYC A;  3T1H Q;  4JC0 A;  3M4O B;  4R4T A;  1UEB A;  1NSN S;  2K04 A;  2H5X A;  1EWH A;  3I55 A;  2UUA Q;  4H02 A;  1I94 Q;  3S17 B;  3HOZ B;  4H0L C;  4UAI A;  2VUM H;  1F2Z A;  3U50 C;  3NWS A;  4CJ1 B;  4L6T B;  4GZY C;  4IFD I;  3J7A V;  2M2L A;  2HDL A;  2CW0 D;  2PPB C;  5BN4 A;  1I4H A;  1QB5 D;  3S14 B;  4B9W A;  4KV6 A;  4B3T Q;  1HTP A;  4UP7 A;  4FXK C;  2K4K A;  1O80 A;  1EY9 A;  5KYI A;  2L12 A;  4ZUJ A;  2RCF A;  2AQ3 B;  3M4O H;  4K8J A;  4P73 A;  5CV6 A;  2ASB A;  2A74 C;  1F9Q A;  3OIQ A;  4EGV A;  2NZH A;  3S17 H;  2PNR C;  3HOZ H;  5C0X G;  2KOL A;  1PXU A;  1LM0 A;  1STY A;  3D31 A;  5GAD C;  2JA8 G;  2XN9 C;  3EVQ A;  4BXX G;  3FPU B;  1L0W A;  3MXP A;  3PGZ A;  1PYB A;  4NP5 A;  3F2U A;  4L63 B;  2IW3 A;  3S14 H;  1PFB A;  3OWE B;  3J7Y W;  2IHF A;  1AFP A;  1VMP A;  1AE2 A;  2B29 A;  3K81 C;  4KJN A;  2B63 G;  1BBX C;  3WWV A;  3AQQ A;  1BQQ T;  1I50 B;  4R4C A;  1G91 A;  4M8A A;  1IBL Q;  2F4V Q;  1B2T A;  5I6W A;  2NVY B;  1JQY D;  4ZK9 B;  5C0X I;  4PMW A;  2OXP A;  4XYO A;  3GTO B;  1K8M A;  5KEE A;  3TS0 A;  2R92 B;  1FGB D;  4JOI A;  2EZV A;  3KF8 A;  3W5O A;  2UUC Q;  4Q0F A;  2LFN A;  5KRU A;  4HIM A;  4X64 L;  1MSG A;  2WV6 D;  1N9W A;  2MUY A;  4NKL A;  1JOK A;  3K7U C;  1I50 H;  1QE6 A;  2MP1 A;  4DR5 Q;  1SSO A;  2NVY H;  4POF A;  1KAW A;  2QA4 A;  2MPM A;  3GP7 A;  1SNM A;  4JI1 L;  3GTO H;  3HP3 A;  5IYC G;  1VQ6 A;  1LTR D;  1H9S A;  1PTO C;  3IKJ A;  3AFP A;  2CH4 A;  5BR8 L;  2HUG A;  4KI0 A;  2R92 H;  3QG1 A;  4HTH A;  1E2Z A;  4G7O C;  2B8F A;  3J80 c;  3BDC A;  1QZG A;  1E2W A;  3N52 A;  1OTC A;  1K0R A;  2ZJP A;  1WTX A;  2QCP X;  1ILQ A;  1HNZ Q;  5EJW A;  1YVC A;  4X3T A;  3J81 E;  3K5L A;  4X3S A;  1B44 D;  4YCV A;  3ND9 A;  4OEL B;  5BN5 A;  4LF5 L;  4MHE A;  2UXB L;  4DR7 L;  2G5D A;  3RLO A;  1OO9 B;  1YHA A;  3HKZ B;  1IW7 D;  4APV A;  3SK6 A;  5M9O A;  4X66 Q;  4FDB A;  3BDL A;  1PV4 A;  2V1C C;  1VQE A;  4O0A A;  3A74 A;  1Q12 A;  2FMC A;  2GVB A;  2BDN A;  3KLR A;  5LL6 S;  4H44 C;  2EJG C;  5FO9 B;  4B3S Q;  4P71 A;  3NQT A;  2UU9 L;  1VF7 A;  2BE5 D;  3J80 L;  2E5L L;  2JA7 G;  4WOR A;  2PZW A;  5CC4 A;  1D1I A;  3CPW A;  2I0Q A;  4IOC A;  1C8C A;  2P5Z X;  1BO0 A;  2K5V A;  3Q0A A;  1LTL A;  5CYU A;  2HDM A;  4BY1 B;  1VQH A;  1M90 C;  1LT3 D;  4DUY L;  3P20 A;  4CKB A;  1DON A;  4JI7 L;  1HNX L;  1YI2 A;  1WCM H;  3KDF A;  1Q7Y C;  3OHX C;  1NJI C;  5EBD A;  2YTX A;  1W3S A;  4DV3 L;  1KDB A;  1NMF A;  3RD4 A;  1HA6 A;  1N32 L;  4ME5 A;  4K6L A;  1EQV A;  3M85 A;  2KED A;  4JI2 Q;  4FXG C;  5IOC A;  5E7N A;  3CMA A;  2D62 A;  4OWW B;  2R7D A;  2I46 A;  4MTN A;  1FJG Q;  4IPH A;  4R4Q A;  4BY1 H;  1CHQ D;  4CKC A;  3GDE A;  3E6Z X;  2PYK A;  1A0I A;  5DM7 3;  1QVG A;  2O5J C;  2B2V C;  1RF2 D;  4C2M B;  3ZJY C;  1V1P A;  3OIP A;  2F3V A;  4A3E B;  4LF4 Q;  2B2W C;  3KLS X;  3RLF A;  4KKU A;  3K0Y A;  4GS3 A;  1HNW Q;  3C3L A;  3HEJ A;  1CTM A;  1F9S A;  4I7Z C;  1L1O B;  4G7H C;  3GTK B;  5EPL A;  3O13 A;  4JYA L;  1J6Q A;  3DMU A;  4KHV A;  1VQ8 A;  2VQE L;  1PH1 A;  4FF2 A;  4ZYS A;  1HQR D;  1HZB A;  5FO8 B;  1RTO A;  3VDY A;  1G29 1;  1QZH A;  5IWA Q;  1K0S A;  1KNE A;  4JI0 Q;  4C2M H;  4A3G G;  1Q46 A;  4DV0 L;  1PH5 A;  4A3E H;  4RH6 A;  3CF5 A;  1CUK A;  4NPS A;  4DR2 L;  4OGQ C;  4TVA B;  1B50 A;  3FKI B;  4EVO A;  4UP8 A;  3GTK H;  1LYL A;  1EIF A;  3WOE A;  3TBI B;  2K32 A;  1K73 C;  1LTB D;  1UNS A;  2KEN A;  2KHS A;  5JJK A;  4F88 A;  1Q82 C;  1KLU D;  2K52 A;  2RF4 A;  2HQE A;  4DN4 M;  1MI2 A;  3DXJ C;  1UWV A;  1PYS B;  1CQF A;  1EY8 A;  1SRO A;  1U5K A;  1Q8K A;  1C48 A;  2BH8 A;  3OMC A;  3J7A F;  1DGS A;  3FKI H;  3LWE A;  4CHT B;  1PTO D;  1R4Q B;  3F2C A;  3OSO A;  2K05 A;  4IQZ A;  5IYB H;  5M5X B;  4ZAI A;  2JA9 A;  1VQ7 A;  1P8L A;  5EKK A;  2FJ2 A;  5CV7 A;  3PV0 A;  5IT9 c;  4TRD A;  4N8X 1;  1Q86 C;  3ICE A;  1B9M A;  2F0P A;  1ESR A;  3NHH A;  2DY8 A;  1PTO B;  5C3E G;  3M4Q A;  4U67 3;  2ZTC A;  3R3O A;  3C2P A;  3JAM c;  4BBR G;  4FF3 A;  3I4M H;  3TZU A;  2WIN B;  3NTH A;  4ZLT F;  1MKH A;  5H1S E;  1XMQ L;  5M5X H;  3QR8 A;  3T4A C;  2B2Y C;  1VQC A;  1X3P A;  4O1N A;  1N36 L;  1SNC A;  3SE0 A;  1PVO A;  3NTI A;  1DD2 A;  4XTC S;  1IYU A;  3PIP A;  3E0J A;  1E7Z A;  1MGS A;  1PTO H;  5D3D A;  3PIO A;  5IT9 L;  2M9V A;  3EN2 A;  5E4X A;  4BA1 I;  4QQB X;  4LUZ A;  1G2S A;  1EFI D;  1E22 A;  1EEF D;  1ICF B;  3I90 A;  2PMZ E;  1A63 A;  2WB1 E;  3JAM L;  5F2D A;  1WJJ A;  3ERO A;  1SYF A;  3A5U A;  4B3R Q;  1LTS D;  3J81 L;  2DJG C;  2PI2 E;  4R9W A;  1J5E L;  5IIF A;  1Y1V G;  3BG3 A;  4IUN A;  2UXC L;  4JBJ A;  4LFC Q;  5IYD H;  4RG1 A;  1PH9 A;  3BZK A;  2EVB A;  3HOU B;  1N33 Q;  1STB A;  3SR1 A;  3RN2 A;  4LAA A;  1PH7 A;  1H95 A;  4A4I A;  2Z9H A;  1GUT A;  3I8Z A;  2Q8T A;  1YNN D;  4XXE A;  4A93 B;  1S40 A;  2KCT A;  3OTO L;  3R2I A;  3V96 A;  4PNY A;  1DJR D;  4ZCK A;  3I72 A;  2L15 A;  1AW7 A;  5IGD A;  3HOU H;  1A3V A;  3KJO A;  4LFB L;  2EXD A;  4X62 L;  3PO2 G;  1PRT D;  1STG A;  3C1F A;  2HIV A;  1OXX K;  2ALY B;  1F2M A;  3D6W A;  4X3U A;  3X3N A;  4HSP A;  2OCE A;  1WD1 A;  2MJ8 A;  2PW7 A;  4A93 H;  2N78 A;  2A6E C;  1IBK L;  1DXM A;  2NN6 H;  1AE3 A;  2V4D A;  2RDH A;  4LMQ D;  2EPB A;  4GLX A;  1OXV A;  1YIT A;  3EFX D;  1Y8O B;  4JW0 A;  4DR3 L;  3TEH B;  1KHI A;  5C4H A;  5K36 G;  1DZ1 A;  1IL2 A;  1JWU D;  3NP8 A;  2R93 B;  3MXU A;  3I70 A;  4OWX B;  5C3X A;  2O5I C;  3MC0 B;  4P75 A;  1VQG A;  4OL7 A;  1E1T A;  4YWL A;  1CSP A;  2BH2 A;  5LMU Q;  5IGF A;  2PQE A;  3HOW B;  2NZ1 D;  5FLM G;  1JJG A;  3FMC A;  4WJ4 A;  4DV2 Q;  1N34 Q;  1B7Y B;  4QJF A;  4A3L H;  3A7L A;  5DNF A;  5JJI A;  1EEI D;  1G51 A;  3MEH A;  4YHH Q;  4GKJ Q;  2R93 H;  1ML0 D;  2EIF A;  2K7V A;  2YTY A;  4LK1 C;  1U4R A;  2LY7 A;  1ASY A;  3TS2 A;  2RSN A;  3ND8 A;  3Q24 A;  5M3F B;  1TWH B;  1X55 A;  3HOW H;  2NBF A;  1S4Z A;  2ZXR A;  2OQK A;  2EXZ A;  2K5N A;  2XWJ B;  1XYI A;  3H0G G;  1IKL A;  1SBB B;  5KND A;  3CCE A;  3S1Q B;  5M5W B;  1XNR L;  1STE A;  3M4Y A;  1B3Q A;  1LTG D;  1K3R A;  2HHH L;  2HIX A;  1BKB A;  2EYP A;  4C3H B;  3DEP A;  4FO2 A;  4CJ0 B;  5M3F H;  4R8I A;  3H6M A;  3V05 A;  4DNR B;  3K7A B;  3CCM A;  5A2Q L;  3J7Z C;  4OHJ A;  2D9U A;  2L9H A;  1SE3 A;  1VQD A;  2Z6B A;  2LXK A;  3S1Q H;  1IYV A;  2VUM G;  5M5W H;  3T1Y Q;  2Q2I A;  4R4I A;  3CXC A;  1C7Y A;  3I4N B;  3KBX A;  4BS9 A;  4LW1 A;  2PZT A;  4XDX A;  3KYH C;  4C3H H;  4I65 A; 
#chains in the Genus database with same CATH homology
 3HOY B;  5C44 B;  1I3Q B;  3TME A;  2HCI A;  1TT2 A;  4JK1 C;  2YYZ A;  1EL0 A;  3J80 E;  1PMR A;  4C3I B;  1W6J A;  5CV5 A;  1GUW A;  3S15 B;  1JB3 A;  4R8N A;  1ENA A;  4K5V A;  1XXG A;  4K5X A;  3OW7 A;  4KY6 A;  4A3K B;  3DWP A;  4PQX A;  2JEA I;  1LO5 D;  2CVR A;  4DXG A;  3I91 A;  4X3K A;  1HRJ A;  1ET9 A;  2KQ3 A;  2A5H A;  5IOD A;  4A3M B;  4A3J B;  2XVS A;  3MVV A;  2J4X A;  4HCS A;  5E4W C;  2SNS A;  4RKB A;  3R93 A;  1L0Y B;  1D5Z C;  1HXY D;  1T5E A;  4QUC A;  4BWG B;  2TSS A;  3X3M A;  5LL6 X;  1ICW A;  3H91 A;  3KBG A;  4KMU C;  3FDT A;  2OF1 A;  2F0V A;  1SAP A;  3PO3 B;  3AB9 A;  1AP0 A;  3DEO A;  4RGT A;  5ELB A;  2LS0 1;  5CV8 A;  2F0E A;  5KYL A;  1II3 A;  3A8I E;  4Z9C B;  2K28 A;  2O2L D;  2G9H D;  2QEJ C;  4RHR A;  3HZX A;  3FPP A;  4K2K A;  5C5L A;  2B2U C;  4IAL A;  3MHB A;  3S2H B;  2F0J A;  3VR4 A;  3G6J B;  4QUF A;  3L3O C;  4K6D A;  3DM1 A;  4A3D B;  1OXU A;  4K8I A;  1I4P A;  5J22 A;  2CQA A;  2F0U A;  5KGU A;  1QNU A;  2A68 C;  4KD3 A;  5D65 A;  2Q8R E;  2BA1 A;  4RFB A;  3L9A X;  3GTG B;  2EYO A;  1NCV A;  2K5Q A;  1SMY D;  2YU9 B;  1D1K A;  1PZK D;  1TII D;  4FF4 A;  2WKD A;  4ILW A;  3R2T A;  4NDX A;  1SE4 A;  1TS4 A;  3D3R A;  3M7G A;  2JA5 B;  3K59 A;  1U4P A;  1KAA A;  2IX0 A;  1TWG B;  2L55 A;  1EY6 A;  3TZD A;  2IX3 A;  5IT9 E;  3HOV B;  2B8G A;  4HCE A;  2DY7 A;  1DOM A;  2C5C A;  3JAM E;  2F03 A;  3PUV A;  1Q3L A;  5COY A;  2Y0S B;  3BVZ A;  1ZYR C;  2QDB A;  2MGS A;  3S16 B;  1TKW B;  1TS2 A;  3Q6S A;  3QIA A;  1NR2 A;  2VXW A;  4BBS B;  3BDO A;  3QO2 A;  2NUC A;  5E3F A;  2K03 A;  1HPC A;  5ELF A;  1STH A;  2F0G A;  2KJX A;  1XWE A;  2E2D C;  1ET6 A;  2SNM A;  3WOF A;  1J8I A;  4DF7 A;  4ZKB B;  2F0W A;  5TSS A;  5CV9 A;  1SFO B;  2K01 A;  3I73 A;  1LLR D;  2AQ1 B;  3GTQ B;  1FYC A;  3PMF A;  1JWM D;  5JEA J;  5C0X H;  2JA6 B;  3GQB A;  1VF5 C;  3T53 B;  3CHB D;  3NPP A;  1LAB A;  1BCP F;  1GHJ A;  3P7J A;  1EQT A;  1C4Q A;  3NK9 A;  3UI2 A;  1ESF A;  5EBC A;  3OWF A;  4NW2 A;  5JEA H;  4AYB B;  1GUG A;  2NVT B;  1LT4 D;  5C4J B;  1QOH A;  5I4D A;  3NXW A;  1EY7 A;  4B08 A;  1SNO A;  5EKL A;  4BY7 B;  2X6G A;  4F87 A;  5ISR A;  5CR3 A;  2E75 C;  1E0B A;  4DAP A;  2SEB D;  2A68 D;  1JOO A;  5IGB A;  3H94 A;  4PMB A;  1CI3 M;  3R8B A;  1A2T A;  1Y8P B;  1BNZ A;  2E76 C;  5G3L F;  1JIC A;  2NWG A;  1OXS C;  1SYG A;  1A3T A;  2WP8 J;  2XNA C;  1K8O A;  2AWO A;  1CHP D;  2JA7 B;  1Y1W B;  5HGT A;  1LTA D;  5K5P A;  5A2Q E;  3S9W A;  1JC7 A;  3SVM A;  2FIN B;  1RJT A;  3AMU A;  3E5S A;  3TP8 A;  1EY4 A;  1ENC A;  3K5M A;  1HUM A;  1H9J A;  3MA2 B;  1F9P A;  3URY A;  2VB3 X;  1TR5 A;  5KNC A;  4A3I B;  1U9R A;  1V8Q A;  2NN6 G;  4G7Z C;  2F0L A;  3FVQ A;  1GUS A;  3PUY A;  4QMG A;  2JXM B;  4E6I A;  1TWC B;  3MWY W;  2JSO A;  1ILP A;  1LTI D;  1H9M A;  2D5D A;  5JPM C;  2NTT A;  3RZO B;  2DNE A;  5CBA E;  1BR9 A;  1BDO A;  2EE1 A;  4OIK A;  3VR3 A;  2NN6 I;  5DEH A;  2BCO A;  3L7Z C;  4BA2 I;  3FEW X;  5A35 A;  1WTV A;  3TDQ A;  1YNJ C;  3SXH A;  1IKM A;  4FP5 D;  5I2Y A;  3M7N A;  2J7Z A;  3CQZ B;  5CBE E;  1XTC D;  2ENB A;  3VYT A;  4ZQ3 A;  5DAU A;  3A7A B;  1TVX A;  3H09 A;  3Q23 A;  5JVG 3;  2K6A A;  1EY5 A;  1CQV A;  1STA A;  2DNC A;  2KVM A;  3A8K E;  1CA6 A;  1B4O A;  1H9R A;  1SYC A;  2ZXP A;  2EYF A;  3S1M B;  3BYY B;  1S5D D;  1GXD C;  1XX8 A;  2M00 A;  2A69 C;  3NSW A;  2KA7 A;  4J6H A;  1H9S B;  2IPK D;  3NUC A;  4TKO B;  4RGO S;  5EGT A;  4MN3 A;  1WTO A;  4FVM A;  4HSV A;  2F0D A;  4C3H G;  1EZ8 A;  5C3E B;  4YIJ A;  5JJZ A;  2B2T A;  1KDA A;  5C3W A;  4ABN A;  4G57 A;  1KDC A;  3NQI A;  1ONL A;  1GUO A;  2IL8 A;  1Y8N B;  4KJO A;  4XT1 B;  4Y7N B;  3QOJ A;  1HFN A;  3S1R B;  4IUP A;  1EIG A;  4XQN A;  1ZEQ X;  3TP6 A;  1EIH A;  1BCP C;  1A15 A;  1ENF A;  3VYR A;  1DM0 B;  1TY0 A;  5C6A A;  2VNU D;  5COR A;  1Y1V B;  4XYQ A;  3CKI B;  4KTA A;  1M4V A;  4V0B A;  1FD7 D;  5JVH 3;  3GD7 A;  2RKS A;  2NVX B;  2OEO A;  3S1N B;  1S5B D;  1SYB A;  4RAU C;  3W3A A;  4V19 0;  2G9D A;  3K5O A;  2XSC A;  1IHZ A;  1RTN A;  1NAP A;  5BN3 A;  1F2Y A;  5C5M A;  1D5M C;  1I4X A;  2Q8I B;  4N9T A;  3EQL C;  1SND A;  1B1Z A;  2H4O A;  3GTP B;  2LMC B;  1LAC A;  2NYZ D;  1CM9 A;  1YNJ D;  4KY5 A;  2F0F A;  1KAB A;  3ITP A;  1KLG D;  1SEB D;  5FLX E;  1HUN A;  1OXT A;  2EJM A;  3G7L A;  5J1Z A;  3A55 A;  3FRP B;  3QOL A;  1JWS D;  1PYW D;  3D4D A;  5E1F A;  1WTP A;  1G6Z A;  3S2D B;  1TY2 A;  2PMZ B;  1EY0 A;  3W2D A;  3M3Y B;  3VA7 A;  2WB1 B;  1JE4 A;  4ID6 A;  5JPN C;  1QWY A;  3DUZ A;  2A69 D;  5K36 H;  4RGN A;  5I6Y A;  2E2I B;  1AN8 A;  2JYO A;  3A8J E;  3PIP 3;  2E2J B;  4FNF A;  2WAC A;  4S3S A;  3PIO 3;  2X69 A;  3WDN A;  1TWA B;  3ZYY X;  2QF7 A;  1SJH D;  3KUP A;  2F0T A;  1UUP A;  2A6E D;  1O7Y A;  4U68 A;  5AFW A;  2BDO A;  1PRT F;  4IZ8 A;  4ZUI A;  2K5D A;  2BOS A;  2VB2 X;  4IUU A;  4A3B B;  1DYQ A;  4IUR A;  3H3V C;  1JOQ A;  4XIG S;  3OOC A;  5EPK A;  3U9S A;  3D4R A;  2JP1 A;  2N88 A;  1EZ6 A;  2XRQ D;  4IUV A;  2FMM A;  3KK7 A;  2EY6 A;  2DN8 A;  3MFY A;  4IUQ A;  3DWQ A;  2BE5 C;  1FR3 A;  1I4R A;  4C3J B;  5EKI A;  1WTR A;  1I4Q A;  5IGC A;  1SNP A;  3NBH A;  1TS5 A;  4IN3 A;  2ZT9 C;  1GUN A;  2EY5 A;  5M3M B;  4C56 C;  1RCV D;  1CFM A;  1U4L A;  4HMI A;  1HQM C;  4UDU C;  2RDG A;  1V1O A;  1BCP B;  2I07 B;  1TU2 B;  4C1N I;  1R4P B;  3I4L A;  3HRZ C;  1G8Z D;  1VMC A;  3EA6 A;  3P1H A;  1W6K A;  1LV9 A;  1CK1 A;  4O42 A;  4FYD A;  4NMZ A;  4OO1 H;  1SXT A;  4B9X A;  1WTQ A;  4LJZ C;  3SHL A;  2CHB D;  4J1M A;  2NVQ B;  1UAP A;  5T1I A;  4QIW B;  2AUJ D;  1ZKO A;  2A6H C;  2L1B A;  3MFG A;  3DWA A;  4H13 C;  2L11 A;  2NTS A;  5G3L D;  1FNW A;  3NBI A;  3GTM B;  5JEA G;  4K14 A;  1QIL A;  2R3Z A;  4DU9 A;  1CZW A;  3T51 B;  1CA5 A;  1HTL D;  5I9O A;  4IFD J;  1CT1 D;  1KTK A;  1RD9 D;  1GHK A;  2AWN A;  4PMC A;  3PUW A;  2MHV A;  4WFN 3;  2EYH A;  1VCI A;  4MIU A;  4IFD H;  5LHY 1;  1Q1B A;  2PO4 A;  4J8Q A;  2IT1 A;  1Z7T A;  1EYA A;  2EOT A;  2XRS D;  5M5Y B;  5JAV A;  1TWF B;  5D3I B;  2PCF B;  3VR6 A;  4HR7 B;  3OMG A;  1FNV A;  1GJX A;  2B2V A;  2ICE C;  4HN7 A;  4KD4 A;  1Q1E A;  3QB3 A;  3TN2 A;  2SDF A;  4Q5V A;  2B2W A;  4DGZ A;  2F3W A;  1SYE A;  5FLX L;  2AQ2 B;  2JA8 B;  1EU4 A;  5C0X J;  5I9P A;  2ZXO A;  3V2T A;  3A56 A;  4CKE A;  3NE5 B;  2D2C C;  2B63 B;  4PV1 C;  3HG9 A;  2A73 B;  3DHQ A;  5CV4 A;  1SDF A;  2RSO A;  1WCM B;  1IL8 A;  1EWC A;  2RDF A;  1CZG A;  1PZI D;  3RMH A;  2F0O A;  3GTJ B;  3ONA B;  3BZD B;  3QJY A;  4WJW A;  1ZXT A;  2IX1 A;  2N55 A;  1V43 A;  3T16 A;  5I2X A;  4RHS A;  3CRL C;  1QJO A;  4KHZ A;  5FK9 C;  1AZP A;  2F0N A;  4G4K A;  3SK5 A;  4OIJ A;  3IL8 A;  1SYD A;  1D6E C;  5D14 A;  4TSS A;  2AUK A;  3K57 A;  3T13 A;  5JOB A;  1DCZ A;  1MBY A;  1BF4 A;  4HED A;  3SDZ A;  3BYT B;  1K83 B;  1PFM A;  2F0H A;  3HS0 C;  2R61 A;  1WVL A;  3C46 A;  1KNA A;  1QNK A;  2QIL A;  5HUR A;  1A2U A;  4ULL A;  2RA4 A;  2Z4I A;  3KLS A;  1S5E D;  3GV6 A;  1YNN C;  5CMD A;  2EY2 A;  3K6O A;  3BVG A;  1B9N A;  3IAY A;  2K1B A;  4HAE A;  2A6H D;  1RHP A;  3VR5 A;  4A3F B;  1Q90 A;  2B2Y A;  4RCN A;  1PRT C;  2R7Z B;  4DK1 A;  2EY1 A;  1Y69 U;  1BXT A;  1TS3 A;  1SJE D;  1WD0 A;  3MTS A;  1BUV T;  2K33 A;  4WRD A;  3PUX A;  4EQP A;  3BVM A;  3VR2 A;  3GTL B;  3VYU A;  1EYD A;  2F0Q A;  5ELE A;  3N6R A;  4N9P A;  2O4X A;  1NR4 A;  2B39 A;  1ZYR D;  4QF4 A;  2KUM A;  3HGB A;  3I4M B;  1JCK B;  2LKV A;  3K5N A;  2RVL A;  2ID0 A;  3CRK C;  4CJ2 C;  3I3C A;  2F0K A;  1HFG A;  1E2V A;  4CGY B;  3AU7 A;  3P75 A;  5KNB A;  3VA5 A;  4IUT A;  2RBM A;  2E2H B;  3D8G A;  1QG7 A;  3D4W A;  3MXG A;  1EU3 A;  4DFA A;  5EQ0 A;  4C1N K;  1BOS A;  4A3G B;  4XT3 B;  1I6V C;  5IGG A;  1G2T A;  1S5C D;  1F77 A;  1PZJ D;  1VDZ A;  1AEX A;  2PW5 A;  2F4I A;  1X3Q A;  1T5X D;  1Q8I A;  4RKL A;  4DNT B;  3LNN A;  1LT6 D;  1RKN A;  3ERQ A;  3C1E A;  2L5T A;  3EJI A;  4P2C B;  2KCN A;  5IGE A;  1A3U A;  4CBV A;  5NUC A;  4ODG A;  3MAQ A;  2KEE A;  1O78 A;  1U4M A;  4H7B A;  1M8A A;  4DAV A;  2JEB I;  4XQQ A;  1R9T B;  2F0M A;  2C9O A;  3Q22 A;  1STN A;  4XQJ A;  2J0T D;  4F7X A;  1SNQ A;  2EYM A;  1PFN A;  4DAY A;  3A54 A;  3GV3 A;  5EPJ A;  1UEA B;  4BBR B;  2SOB A;  2H1E A;  3IFT A;  5ELD A;  1I6H B;  3NTK A;  1HHV A;  1LTT D;  2Z4H A;  1MSH A;  4KN7 C;  2Z8L A;  2WKC A;  2XWB B;  5C4X B;  3SK4 A;  3LX0 A;  1DOK A;  1F9R A;  1O7Z A;  4L8J A;  1DOL A;  1L0X B;  2L4N A;  2EYJ A;  1PDQ A;  5T1G A;  1D2B A;  2F0S A;  1X32 A;  1PRT B;  1AZQ A;  2WII B;  4ZKC B;  1PLF A;  2IWH A;  2K5W A;  3VYS A;  1SE2 A;  4C3I G;  5FKA C;  1HA5 A;  1MD2 D;  4K2L A;  1D5X C;  2E74 C;  4KY7 A;  1ROD A;  1WTW A;  1I4G A;  2EYL A;  1PTO F;  5C4Z A;  5J39 A;  5DM6 3;  3SEB A;  3T56 B;  3U9O A;  3SK8 A;  3HOX B;  4QCL A;  2EJF C;  3OPO A;  4HMJ A;  2CW0 C;  2BA0 A;  3NWT A;  3IFD A;  2KEC A;  4F8M A;  2Z1C A;  2IJ0 A;  1EOT A;  1RDP D;  1JR0 D;  1V1P B;  3RUZ A;  2FHT A;  1Z47 A;  2B2T C;  2FFK B;  3PO2 B;  4RCO A;  1QCB D;  2L0C A;  1Z6H A;  5FO7 B;  1S5F D;  3MZ5 A;  2R6G A;  4RA8 A;  3LWU A;  2KCC A;  1B53 A;  3MXN A;  1SMY C;  4KKT A;  4RWS C;  4EQN A;  2QKI C;  4FF1 A;  2GA4 B;  4C3J G;  1J9O A;  2OT2 A;  3QWN A;  2WAQ B;  1JOR A;  3PUZ A;  4K5W A;  3TP7 A;  4DA2 A;  2F1M A;  4OO1 G;  3D6C A;  4KN4 C;  4KK7 A;  1F2L A;  4QB4 A;  4FXD A;  3TP5 A;  2B2U A;  3GO5 A;  4RGM A;  4KKS A;  3RZD B;  4DK0 A;  1FNU A;  3H0G B;  4EQO A;  2X6L A;  4ZRZ A;  1NUC A;  3TSS A;  2F0I A;  4M1U B;  4TQU S;  2ICI A;  4OO1 I;  5ELC A;  3K58 A;  1GOZ A;  1IW7 C;  2TMP A;  5FOB B;  1A6X A;  5CGK A;  2PZU A;  1HCZ A;  1B3A A;  2HCC A;  3CU7 A;  3BS1 A;  5KIX A;  2VUM B;  2JE6 I;  4IFD G;  1LT5 D;  4JBW A;  2NB0 A;  2RQX A;  1BCP D;  1H9K A;  1TQO A;  1O7L A;  4DXF A;  2XIW A;  2EDG A;  1EYC A;  3M4O B;  1NSN S;  2K04 A;  1EWH A;  3S17 B;  3HOZ B;  4H0L C;  4UAI A;  1F2Z A;  4CJ1 B;  3NWS A;  4L6T B;  4GZY C;  4IFD I;  3J7A V;  2M2L A;  2HDL A;  2CW0 D;  2PPB C;  5BN4 A;  1I4H A;  1QB5 D;  3S14 B;  4B9W A;  4KV6 A;  1HTP A;  4FXK C;  1O80 A;  1EY9 A;  5KYI A;  2L12 A;  4ZUJ A;  2AQ3 B;  4K8J A;  5CV6 A;  2A74 C;  1F9Q A;  3OIQ A;  4EGV A;  2PNR C;  5C0X G;  2KOL A;  1PXU A;  1STY A;  3D31 A;  2XN9 C;  3EVQ A;  3FPU B;  3MXP A;  4NP5 A;  3F2U A;  4L63 B;  2IW3 A;  1PFB A;  3OWE B;  3J7Y W;  1AFP A;  1VMP A;  4KJN A;  1BBX C;  1BQQ T;  1I50 B;  1G91 A;  4M8A A;  1B2T A;  5I6W A;  2NVY B;  1JQY D;  4ZK9 B;  5C0X I;  4PMW A;  2OXP A;  4XYO A;  3GTO B;  1K8M A;  5KEE A;  2R92 B;  1FGB D;  2EZV A;  3KF8 A;  4Q0F A;  2LFN A;  5KRU A;  1MSG A;  2WV6 D;  2MUY A;  4NKL A;  1JOK A;  1QE6 A;  2MP1 A;  1SSO A;  2MPM A;  3GP7 A;  1SNM A;  3HP3 A;  1LTR D;  1H9S A;  1PTO C;  3IKJ A;  2HUG A;  4KI0 A;  3QG1 A;  4HTH A;  1E2Z A;  4G7O C;  2B8F A;  3BDC A;  1E2W A;  3N52 A;  1WTX A;  2QCP X;  1ILQ A;  5EJW A;  4X3T A;  3J81 E;  3K5L A;  4X3S A;  1B44 D;  3ND9 A;  5BN5 A;  4MHE A;  1OO9 B;  3HKZ B;  1IW7 D;  3SK6 A;  5M9O A;  3BDL A;  1Q12 A;  2FMC A;  2BDN A;  3KLR A;  5LL6 S;  4H44 C;  2EJG C;  5FO9 B;  3NQT A;  1VF7 A;  2BE5 D;  3J80 L;  4WOR A;  2PZW A;  5CC4 A;  1D1I A;  1C8C A;  1BO0 A;  3Q0A A;  5CYU A;  2HDM A;  4BY1 B;  1LT3 D;  3P20 A;  4CKB A;  1DON A;  3OHX C;  5EBD A;  1KDB A;  3RD4 A;  1HA6 A;  4ME5 A;  4K6L A;  1EQV A;  3M85 A;  2KED A;  4FXG C;  5IOC A;  2D62 A;  2I46 A;  1CHQ D;  4CKC A;  3E6Z X;  2PYK A;  5DM7 3;  2O5J C;  2B2V C;  1RF2 D;  4C2M B;  1V1P A;  3OIP A;  2F3V A;  4A3E B;  2B2W C;  3KLS X;  3RLF A;  4KKU A;  3K0Y A;  3C3L A;  3HEJ A;  1CTM A;  1F9S A;  4I7Z C;  4G7H C;  3GTK B;  5EPL A;  3O13 A;  3DMU A;  4KHV A;  4FF2 A;  4ZYS A;  1HQR D;  5FO8 B;  1RTO A;  1G29 1;  1KNE A;  4RH6 A;  4OGQ C;  1B50 A;  3FKI B;  4EVO A;  3WOE A;  3TBI B;  2K32 A;  1LTB D;  1UNS A;  2KHS A;  4F88 A;  1KLU D;  4DN4 M;  2HQE A;  1MI2 A;  3DXJ C;  1CQF A;  1EY8 A;  1C48 A;  3OMC A;  3J7A F;  3LWE A;  4CHT B;  1PTO D;  1R4Q B;  3OSO A;  2K05 A;  4IQZ A;  5M5X B;  4ZAI A;  5EKK A;  2FJ2 A;  5CV7 A;  3PV0 A;  4TRD A;  1B9M A;  2F0P A;  1ESR A;  3NHH A;  2DY8 A;  1PTO B;  4U67 3;  3R3O A;  3C2P A;  4FF3 A;  3TZU A;  2WIN B;  3NTH A;  4ZLT F;  3T4A C;  2B2Y C;  1X3P A;  4O1N A;  1SNC A;  3SE0 A;  3NTI A;  1DD2 A;  4XTC S;  1IYU A;  3E0J A;  1MGS A;  1PTO H;  5D3D A;  5IT9 L;  2M9V A;  5E4X A;  4BA1 I;  1G2S A;  1EFI D;  1EEF D;  3I90 A;  3JAM L;  5F2D A;  3ERO A;  1SYF A;  1LTS D;  3J81 L;  4R9W A;  5IIF A;  3BG3 A;  4IUN A;  2EVB A;  3HOU B;  1STB A;  3SR1 A;  4LAA A;  1GUT A;  3I8Z A;  2Q8T A;  1YNN D;  4XXE A;  4A93 B;  3R2I A;  3V96 A;  4PNY A;  1DJR D;  3I72 A;  1AW7 A;  5IGD A;  1A3V A;  1PRT D;  1STG A;  3C1F A;  1OXX K;  1F2M A;  3D6W A;  4X3U A;  3X3N A;  4HSP A;  1WD1 A;  2MJ8 A;  2PW7 A;  2A6E C;  1DXM A;  2NN6 H;  2V4D A;  2RDH A;  4LMQ D;  2EPB A;  1OXV A;  3EFX D;  1Y8O B;  5C4H A;  5K36 G;  1DZ1 A;  1JWU D;  3NP8 A;  2R93 B;  3MXU A;  3I70 A;  5C3X A;  2O5I C;  3MC0 B;  4OL7 A;  5IGF A;  2PQE A;  3HOW B;  2NZ1 D;  3FMC A;  3A7L A;  5DNF A;  1EEI D;  3MEH A;  1ML0 D;  2K7V A;  4LK1 C;  1U4R A;  2LY7 A;  2RSN A;  3ND8 A;  3Q24 A;  5M3F B;  1TWH B;  2NBF A;  1S4Z A;  2ZXR A;  2EXZ A;  2XWJ B;  1XYI A;  1IKL A;  1SBB B;  5KND A;  3S1Q B;  5M5W B;  1STE A;  3M4Y A;  1LTG D;  2EYP A;  4C3H B;  3DEP A;  4FO2 A;  4CJ0 B;  4R8I A;  3H6M A;  3V05 A;  4DNR B;  3K7A B;  5A2Q L;  4OHJ A;  2D9U A;  2L9H A;  1SE3 A;  1IYV A;  3I4N B;  3KBX A;  4BS9 A;  2PZT A;  4XDX A;  4I65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...