4XXEA

Structure of agra lyttr domain in complex with promoters
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Transcription/dna
molecule keywords Accessory gene regulator A
total genus 24
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xxeA00
4XXEA 4XQNA 4XQQA 4G4KA 4XQJA 4XYOA 4XYQA 4CBVA 3BS1A
chains in the Genus database with same CATH superfamily
2I46A 3MVVA 1HNWQ 1QVCA 2R7FA 1STEA 1HTLD 4JG2A 4DAYB 1EY5A 1TR5A 3EFXD 2GN5A 1TY0A 1K8AC 3Q6SA 3PO3B 4R4TA 2NVTH 1XPOA 3WWVA 2J7ZA 4H02A 4B3MQ 3S2DB 2D5DA 2EPBA 4LAAA 2WAQG 1PVOA 4NW2A 3VA5A 3U9SA 3PO3H 1EWHA 2PMZB 1TS5A 2A69C 3P75A 1N34L 2UUAL 4GOPB 1AN8A 1HFNA 2A74C 5I6WA 1M90C 1JWUD 5KGUA 3J80i 4YY3L 3C3LA 1NMFA 3S15B 3EBEA 4QY7A 3J80L 4HSVA 5I2XA 5M3MB 1Q81C 2HDLA 3M4QA 4BBRG 2E5LQ 1GJXA 4C2MB 1X55A 1HHVA 4OWWB 4L5RC 4N8X1 1Q8IA 3GTKH 1NMGA 1JOQA 1VQBA 4WJWA 1GUSA 2IWHA 2D62A 3WDNA 4KI0A 1Q1EA 1F9PA 1MGSA 2IHEA 1XNQQ 3KUPA 2KCMA 1VQ7A 5CV5A 2CHBD 3QOJA 1NJIC 1L1OB 1F9RA 3TP8A 4A3EG 3J80E 3TS0A 1CT1D 4KHZA 1NR2A 2PI2A 4CJ2C 1F2MA 3M4OH 1I4GA 2RDFA 3AYHB 3IAYA 3ITPA 3NPPA 3Q8DA 5M9OA 1WTOA 1CFMA 3SEBA 4C3IG 4DNIA 3CXCA 2F0GA 1EY8A 3ND9A 2BCOA 1JB7A 3S17B 2K52A 3CPWA 1VMCA 2F0IA 1EY6A 2BH8A 3LWEA 5IIFA 5KNDA 4WJ4A 5M5WH 4JBMA 3Q22A 2AWOA 3K5NA 4DV5Q 3H3VC 4J8QA 1S72A 3S1NH 1DM0B 4JI3L 1KQSA 4GN5A 3FKIB 2L5TA 2XIWA 3RR5A 5DEHA 1ASYA 5CMDA 1BF4A 4AYBB 5M3MG 4CHTB 5COYA 2Z6KC 3P7JA 1G2TA 1KDAA 2A1AA 4JW0A 1IBML 5I6YA 5FLXE 2B2WC 1BQQT 4NMZA 4KD4A 1IL8A 1O7ZA 2K05A 2L11A 2ZXPA 3M4OB 5FKAC 1S40A 2EXZA 1G8ZD 4P74A 1ESRA 1AE2A 2UXCQ 1EY7A 3J7A5 2MO0A 1DYQA 4BBSB 2OQ0A 1NBWA 2RKSA 1N32L 4B08A 2L55A 4JBJA 2UXDL 4KY6A 1XMOL 3QG1A 5E7NA 1YJWA 5I9PA 4A3MB 1NE3A 3GTKB 2CW0C 2G9DA 2KHJA 4NP5A 1K9MC 4TRDA 2HD3A 2SNSA 1D5XC 4DV2L 5KEEA 2ZTDA 1PRTC 3U4ZA 4QB4A 3I4LA 4AIMA 3MFYA 2EYMA 4HJAA 2UUCL 3RZOB 1S5ED 5I2YA 1Z9FA 1Y1WH 1PDQA 1TWCB 1SNPA 1SYCA 5M5YH 1KD1C 3RUZA 2NTTA 4ABNA 1B2TA 1OXXK 2D9UA 2B2UA 4F7XA 3STBD 3W1GA 4ZKBB 1CHQD 1S4ZA 3JAMi 1CSPA 5LHY1 3MA2B 3UDFA 4TSSA 1JB3A 2WAQE 2BA0A 4GN3B 2WFWA 1J9OA 4DK6C 2R92H 1ET6A 2FHTA 5LMUQ 4RCOA 3CW2C 4IO9A 1JOKA 2KHSA 2CKZB 3TDQA 3H0GB 2L0CA 3GTJB 3MWYW 3ZJYC 3HGBA 4YY3Q 2HQEA 2QCPX 4I7ZC 1EIYB 3NTHA 2KEEA 5AFWA 3I8ZA 3HOVH 3JAMc 1PLFA 2KUMA 2LFNA 3MXUA 2UXBL 4JPBW 4A3LH 2X69A 4H7BA 1EY4A 4KK7A 1KLGD 5KYIA 2K5WA 2UU9Q 4EQOA 2VQFQ 4N9TA 3BYYB 5KNBA 3J81i 4Y52H 3PIP3 1KAWA 3OMGA 4HIDA 1CA6A 4ULLA 4A3JB 1WTQA 1I6VC 1HJPA 4O1NA 5ELFA 4LF7Q 1EY9A 1EWIA 1WCMH 4A3FH 1CKNA 1B7YB 1K83H 1RTNA 3GV3A 5M3FH 3D4DA 1IBMQ 2NVQB 5T1GA 1N8RC 2F4IA 3DEPA 1C4QA 2Q8TA 1JT8A 1RCVD 3MTSA 5D65A 2ENBA 2ZXRA 1CA5A 4H44C 1MHWC 3MAQA 3T1HQ 1PH5A 1XNRQ 3I4NG 1ESFA 3MC0B 4P2CB 1MD2D 4U68A 3DMUA 2J0TD 2IX0A 2MNAA 2EYLA 2R93B 1GUOA 4HAEA 3VA7A 3UDGA 1IBLL 4A3BG 3S14B 1L2FA 1QILA 1E22A 1FGBD 2F0LA 4KHPL 2E75C 2QW7A 1SNCA 3TP6A 3X3MA 4B3TL 2NN6I 2EYPA 4PV1C 5IODA 4MTKA 2R61A 4BY1G 4GKJQ 1QVFA 5CV7A 4C3JB 2I5MX 3CKIB 4G7HC 1W3SA 3TBIB 1XXGA 1LTLA 4RG1A 2E74C 1QG7A 3G6EA 4HIKA 1EOVA 1JCKB 1YIJA 3HKZB 5C3EH 2NVTB 4A75A 1EIHA 5KRUA 1NR4A 1SFOB 1B44D 5C0XG 1ICFB 2KOLA 1IYJB 2Y0SG 1OXSC 5C3EB 5EPLA 3J81L 1IBKL 4LF4Q 5K5PA 3JC66 3PUVA 1BCPB 4RHRA 4AH6A 2F1MA 1A2UA 3W3AA 3TQYA 1STHA 5E4WC 1ENFA 2RSNA 2Q8IB 3ULJA 4A3MH 1JJCB 3A8KE 1KRSA 4JBKA 3UI2A 4EQ5A 1J8IA 3E9HA 3FDTA 1BCPF 4JBWA 5J22A 3BJUA 2CWPA 4B3ML 5GAGC 2R93G 1A6XA 2OF1A 3J7YW 5CR3A 3A5UA 2B8GA 4P72A 1YNJC 4WRDA 1UNSA 4N8FA 3VR5A 2Z4HA 4JI4L 4IFDJ 1V8QA 4H0LC 1F77A 5LMNQ 2L12A 4K14A 1G6PA 2UU9L 4RKBA 2E2HH 1LACA 5EKKA 3AB9A 3CQZH 5BR8L 3S14H 4LFBQ 4GOPC 2F0NA 5FO7B 4QIWE 3KJPA 4A3GB 4OXPA 2JA6G 1VQ4A 1HA5A 5HGQA 1FVIA 4IQZA 1Z7TA 2C5CA 4YWLA 2EXDA 3MEHA 2EY2A 2B8FA 2JA6B 4LF6L 4DAVA 1B8AA 1OXVA 1KNEA 3L2PA 3K57A 2NVQH 2R7ZG 1X3EA 1RIPA 1H9SA 2Y0SE 3BVZA 1X54A 2GVBA 2AQ2B 3RLOA 1BDOA 3PO2G 4G7OC 1PH9A 3AQQA 4KN4C 4IZ8A 1PZKD 4Z9CB 2ZJRA 2BA1A 2L15A 2PNRC 4ZLTF 4A3EB 2B2YA 1UWVA 4QQBX 4FF3A 1KAAA 5ELEA 4LW1A 2J4XA 3G6JB 2B2UC 1VF5C 2D0PA 2LXKA 4LF7L 1SROA 2PZTA 1YEZA 4L63B 2HCIA 2ICIA 3EQLC 4CBVA 3S1RB 1HXYD 4K8JA 1NSNS 3FPPA 2O4XA 4P73A 4DXGA 2Q2UA 3I4MG 4Q5VA 4LF8Q 5FLXc 3GO5A 1IKMA 1NTGA 1YHAA 3PGZA 4LWCA 4GKKL 1JMCA 4DAMA 2D0OA 1HR0W 1SYEA 4S3SA 4DR2L 4OELB 4OEMB 4RKLA 4BXXG 1LT3D 1TS2A 1DONA 4B3RL 2JA5G 1VCIA 2H4OA 1ASZA 1PHJA 1SMYD 3CF5A 1E2WA 4X3UA 2A6HC 5K36G 1X6OA 4F87A 4X64L 1DOMA 4QJFA 3SE0A 2VQEQ 3E9IA 5M5YB 4FF2A 3K7AB 1I50H 3FP9A 4L8JA 1Y1WB 4POGA 2TMPA 4A3GG 2OEOA 4DV2Q 3PSIA 3ERQA 1AFPA 4OGQC 1IW7C 4DV1L 1PTOF 3TP7A 5FLXL 3I91A 2OTJA 1GUWA 1HFGA 1PRTB 3PMFA 5CV8A 1TKWB 3PUYA 4NXNL 2EIFA 3FKIG 3I4MB 4KLKA 4OIJA 3VR6A 1OXUA 2A6ED 2K01A 4PZ7A 3W5OA 1ML0D 4DR3L 5C4JB 2Y0SB 4E6IA 4DV0L 4HJ5A 2AQ1B 4BA2I 3FPUB 1ENAA 1B9MA 4GNXA 3FEWX 3U50C 5G3LD 3A56A 1QWYA 1AH9A 1GM5A 1SYDA 3KBGA 2EYFA 2FJ2A 1TT2A 1LTAD 3D8GA 4QUCA 3W1BA 3G4SA 1A15A 1PFSA 5CORA 1VDZA 5C5MA 1ILQA 2NVXH 5CYUA 3E0JA 4QIWB 4IFDI 1TY2A 4KD3A 5CGKA 4DR4L 4LUOA 1I6HB 4JI4Q 3F2BA 1SE4A 4XDXA 1SXTA 2M9VA 1PH3A 4CKCA 4R4CA 1AE3A 4X3TA 5IOCA 3SGIA 3AEVA 1STBA 2Z6BA 4L6TB 4UP9A 1WVLA 2XNAC 4IUNA 1PXUA 3CMEA 2AKWB 2EYJA 5IP9G 3HOYH 1STAA 1EFID 3RNUA 2F3WA 3DWAA 2E76C 3MZ5A 2NVYH 5CV6A 2E2DC 2E8GA 4X62L 1Q46A 1KLUD 1TS4A 4UDUC 1PV4A 1DXMA 4DV3L 2EOTA 1K73C 1TWHB 2NVXB 1CZWA 3L7ZC 1QJOA 2HIXA 3A5ZB 5DM63 1C48A 1V9PA 4IUQA 3BU2A 4C1NI 1BUVT 3N52A 4P71A 1HA6A 1GVPA 3F2CA 4A76A 2KCCA 2RDHA 3F8TA 4L5TA 4JYAQ 4DV4Q 3GTJH 3NE5B 1HH2P 4K5WA 3NBHA 5C4JH 3GP7A 2Q8RE 2XTIA 1EYCA 1S5CD 1FNUA 2IY5B 2DY7A 1FR3A 4R1JA 1OXTA 1ZYRD 2A68C 4I65A 5ELBA 3KK7A 4ZK9B 4DV7Q 3QO2A 3VR4A 5JJKA 4ZQ3A 2X6GA 4JCVE 4HMIA 4K0KL 4P75A 1U5KA 1E7ZA 3CRKC 5IYDH 4BY1B 1NNXA 1IYUA 1JQYD 4CKBA 1DJRD 2F4VQ 3BDLA 1HZ9A 1ZYRC 5LMUL 1D5ZC 1SBBB 1VQ6A 4LFAQ 3HOVG 5C4XG 4HJ7A 3RZDB 5CV9A 4A3IG 2VQEL 5FLMH 3NP8A 2PW5A 4DAYA 1PYWD 4DUZL 3I7FA 2F0SA 3TZUA 2JP1A 5IT9L 3HOXB 1J5EQ 3PF5A 1ET9A 4BBSH 3A8IE 3G7LA 3CCSA 4DN4M 1RKNA 5C5LA 4DR5L 2BDNA 1XX8A 4IUTA 2ALYB 1HUNA 3G71A 3I4NB 3QB3A 1QCBD 4JOIA 1F9QA 3HOZG 1HQMC 1B9NA 2IPKD 3NENA 5FK9C 1VQCA 3DUZA 1HRJA 3QR8A 4DV0Q 3SHLA 3UE1A 4LUZA 5IYBG 2XWJB 2Q2TA 5GQOA 1L0WA 2YU9H 3HOUB 1KL9A 4BA1I 1O7YA 4XTCS 2QKIC 1N33Q 4JI7Q 4OO1I 4DV1Q 1EYGA 3HS0C 2O2LD 4A3CH 2BDOA 4A3BH 1D8LA 2NYZD 2NZ1D 5T1IA 5L37A 4ILWA 3TN2A 5CBEE 1D6EC 4PZ8A 1TWAB 1EQTA 4K6LA 5FJ8G 1V1PA 2QDBA 2C9OA 4A3DG 4PNYA 2OCEA 4MNOA 4HCEA 1XMQL 3GTGH 5BR8Q 1PH7A 2OQKA 1XYIA 1XNQL 4DR1L 1GKHA 3D0FA 2AMCB 3P20A 4JI0L 3NQTA 4IFDH 3NHHA 1UEAB 2R3ZA 4IN3A 5C3EG 2RBMA 2CQAA 3HRZC 1SR3A 2B2VA 3K5LA 1Y1VH 1BBWA 3DHQA 3H0GH 4UP8A 3H15A 4GOPA 4NXNQ 4F8MA 5J1ZA 2C35B 4IUVA 1PZJD 2MGSA 1BO0A 2CH4W 1WFQA 1LTTD 2K5HA 4A3JG 3LWUA 2F0WA 4DV5L 1M4VA 1B53A 4X65L 1EQVA 1CHPD 2B29A 5C6AA 2MQHA 5I4DA 3A0JA 5JJLA 1PYBA 4FYDA 2BE5C 4KHVA 1RD9D 1FNWA 5IGFA 3S1MH 4CDCC 1XTCD 2R6GA 2WINB 1CZGA 4C3JH 2B2TC 3NWTA 3HOWG 4EGVA 3ERSX 1FYCA 1Q12A 3NTIA 1XPRA 1BOSA 4K0KQ 2K14A 3S2HH 4OO1G 4X64Q 2IL8A 3MXNA 4BBRB 4JV5L 3F1ZA 1U4RA 4WFN3 3A55A 1B70B 2F3VA 2EQSA 2X6LA 5BN5A 2ATWA 4L5QA 3HP3A 3SXHA 4PZ6A 1O78A 1UE1A 4B3SL 4DV6L 3GTQB 1H9JA 1IL2A 1IHZA 1SE2A 1XMOQ 1PTOC 4PG3A 3HOWB 2B2VC 2R7ZH 4LFCL 2F03A 2EVBA 3N6RA 1CKMA 1HZCA 2F0KA 1BNZA 4ZAIA 4YCUA 2WACA 4H13C 1PFBA 2K1BA 3M4PA 4XXEA 2Z1CA 1SN8A 2ZM6L 5D14A 3Q24A 3R93A 1VQNA 1K83B 2VS1A 3HKSA 3HEJA 5IP7G 4YIJA 2B2WA 3O13A 1JWSD 3PIOA 4LNQA 2KQ3A 5ELDA 5M5XB 1QVGA 1N34Q 2UUAQ 1H95A 5IE8A 3CCRA 4CJ0B 1HPCA 1AZPA 3V2TA 2RHQB 1EFWA 2WV6D 5IT9c 3ER0A 2AQ3B 3E0EA 3OHXC 5JJIA 4A3EH 1QNKA 1G2SA 2KVMA 1PH6A 5GADC 1RHPA 2YTXA 4UAIA 2QEXA 2UUCQ 1S5DD 4Y7NH 3K81C 4DKAC 1SNMA 4K8IA 4RFBA 4C3IH 3J81j 3C1EA 3E6ZX 3PV0A 1I4RA 2A5HA 1YITA 5K36H 3OYYA 1GUGA 1SE8A 5JPNC 2DY8A 3K0YA 3VDYA 5TSSA 3CU7A 2M2LA 4A3IB 3DWPA 1XJVA 3QOLA 4A3GH 5IWAQ 4JOIC 3R2IA 4IALA 5M3MH 4CDDC 4C56C 2E2HB 1CUKA 3OMCA 4KKSA 3PUXA 3BZKA 1C9OA 1EEID 1S3OA 4GKKQ 4G7ZC 3QWNA 4MIUA 2VUMH 2DNCA 4V190 3L9AX 1JICA 3MXNB 2LS01 4NXMQ 1QUQA 1TWFH 2PZUA 2RSOA 2VQFL 2VL6A 2IX3A 1K0SA 1MIUA 4X65Q 5NUCA 5IGCA 2K28A 4UPAA 3PUZA 3BYTB 1WYDA 1DCZA 1G6ZA 1MJEA 3SK8A 2XRQD 2UXCL 2YTVA 2VUMB 3H09A 2N8NA 3K7UC 3PIPA 3T1YQ 2F3IA 1Y1WG 4ZYSA 4O0AA 1TWGB 1HNXQ 1SAPA 3NWSA 1HZBA 2UXBQ 2DUDA 1H9MA 1E1OA 1EWCA 1L1OA 4YWMA 3KF8A 1TXYA 5LL6S 4A3KG 3RN2A 5GAEC 2XWBB 1Y8OB 3IFDA 2RHSB 1Z6HA 2XN9C 1VQEA 3K5OA 1AEXA 4DR3Q 2K5NA 3OIQA 3HG9A 2EE1A 1EY0A 1DD2A 2R92G 4DR6Q 3S1NB 3R3OA 4HCSA 4ZUJA 5AJ3Q 4JI2Q 1EEFD 4FNFA 4GLXA 1II3A 3URYA 3A7LA 4IUUA 4CKEA 1H9RA 4DR4Q 4HEDA 1TWHH 4RA8A 1SYGA 2F0MA 1JWMD 1WTXA 2N49A 3NBIA 3PQIA 4PMWA 2KJXA 3M7GA 4KY5A 3T51B 4BY7B 2K4KA 2JA8H 3D6CA 1KDBA 1N33L 4A3BB 1EIGA 4KJNA 1E2VA 5EGTA 2WP8J 4OX9Q 4BY7G 2NVYB 3ZYYX 2CWAA 4LUVA 3KLSA 3GD7A 5EBCA 2AHOB 1D5MC 2YU9B 4HTHA 4ME3A 4NDXA 4R8IA 4EX5A 2NN6H 4A3DB 5IYDG 1W6KA 4KKUA 1HNZL 1ZKOA 5ELCA 4XT3B 1B3AA 2F0JA 4EQNA 1CQVA 3OWEB 2A6HD 3WOEA 3HKZG 1LTRD 2KBNA 3S1QH 4IPDA 3D31A 4DV6Q 1EUJA 3T13A 5JAVA 3I4NH 1RF2D 2YYZA 4LFCQ 3GTPB 1KTKA 3TS2A 3CC4A 1SRUA 2FFKB 2EJFC 3U4VA 1RTOA 2PYKA 5J3BA 1EOTA 3ND8A 3F2UA 4LFAL 1A3TA 4JI1L 3DLLA 5HY6A 4JI3Q 3CCLA 4DU9A 3SVMA 3I56A 3HOUG 2HHHQ 3EN2A 1EU3A 1B50A 1XMQQ 2QGQA 5C44G 2D2CC 1WD0A 3NXWA 5EPJA 3HZXA 1WTHA 4AYBE 1PYSB 1K8MA 1MI2A 4IURA 4BY1H 4RHSA 1KHIA 3FMCA 1CSQA 5H1SE 3NUCA 3I90A 2JN4A 2CQOA 1DZ1A 1RODA 1STYA 4DGZA 2SNMA 1G51A 3IRBA 1I4QA 3I4OA 3RLNA 4JI6Q 1I94Q 4OL7A 3SK4A 1PTOH 4RMFA 2NTSA 3F2DA 2I07B 4ME5A 2XRSD 1VQ5A 1VQ8A 1SMXA 1ENCA 3A8JE 4KY7A 1IXRA 2Z9HA 4A3MG 4NKLA 2HIVA 4RH6A 3PUWA 2E5LL 2SOBA 1W2BA 3PO2B 1Y1VB 4G57A 3M4YA 3OTOL 2N55A 2EZVA 2F52A 4A3DH 2IX1A 4FF1A 2NWGA 2XGTA 1KDCA 1Q7YC 1PA6A 3GTGB 4N9PA 4KKTA 3TMEA 4PMBA 5D3DA 2RCFA 1Y1VG 1Q90A 1F2LA 3D6WA 3L0OA 1AZQA 2HCCA 1CKOA 4DUYQ 2O5JC 2JA7B 3FHWA 4X3SA 5AJ3L 2PMZE 2YTYA 3HOZB 4DR7L 4LK1C 3EA6A 4TKOB 2KEDA 2ZXOA 5M5XH 1Z47A 5JPMC 5IT9E 2QEJC 3HOYB 2JA7G 2NZOA 4KHPQ 4C3HG 5IGEA 4F88A 3S17H 1OTCA 1LT5D 2AWNA 5DAUA 2QILA 4FP5D 1VQJA 3CRLC 5EAYA 1FJGL 1YJ9A 2VB2X 1E3PA 4LFBL 2ASBA 4RWSC 3PO2H 4DAPA 5HGTA 1QB5D 3P1HA 1UE5A 4HR7B 3M3YH 1Y8NB 3GDEA 2F0FA 1PFNA 3STBC 2VNUD 1PTOB 1I3QB 3HOWH 2MPMA 4KJOA 3GQBA 3ICEA 2H1EA 4JVZA 4UP7A 4OO1H 1GUNA 2RVLA 1C8CA 1STGA 5EJWA 4JI0Q 1EZ6A 2F0HA 4LF5Q 3CCJA 2RCNA 3BVGA 2E2JB 3RMHA 1BCPC 4IOCA 3I4MH 1TWCH 2MFIA 3D3RA 1JE5A 4A93H 2JSOA 3CCEA 5KNCA 5IYCG 3UDXA 4BBRH 2PQAB 2G9HD 1K8OA 3GV6A 2Q2HA 1NY4A 2ZM6Q 4A93B 1D7QA 4C1NK 2JA9A 3W2DA 4BXXH 1HQRD 3H91A 4JI2L 1KXLA 3K7AH 5DNFA 3AFPA 1VQIA 4FXKC 2F0OA 3V05A 1Y8PB 5A35A 3K80C 1TVXA 1LLRD 1YNJD 2A69D 3I55A 1X3PA 3WOFA 1GHJA 5IWAL 1X3FA 4AYBG 1ICWA 5BN4A 2TSSA 5IP7H 3GTPH 3JAML 3T1HL 4AQYQ 2JJQA 2N78A 5I9OA 3S1QB 1LV9A 3KLWA 2UUBQ 1HCZA 4R4QA 2JEAI 1CM9A 4RGOS 1N36L 1YNNC 1C7YA 1GUTA 1NUCA 3LNNA 4LF9L 3CMAA 1AP0A 1VQDA 1YHBA 3FKIH 4JYAL 2YV5A 4DFAA 4IJLA 1X56A 2RQXA 1DOLA 4K5VA 3BDOA 2G5DA 3KOJA 1HZAA 4X3KA 1CI3M 1LTGD 3OOCA 4QCLA 4DUYL 1VMPA 5JOBA 3DXJC 1V1OA 4DR7Q 4DUZQ 2EY6A 2KHIA 2AUJD 3J7AV 2F0VA 2OT2A 3TSSA 2K7VA 4BS9A 2RA4A 1UE7A 4X66L 3IKJA 2CH4A 4GNXC 2SDFA 2NUCA 2F0QA 4XIGS 1YBYA 2SEBD 4O42A 4OONA 2PQAA 5JJZA 1M1KC 1MJCA 3T16A 4YHHL 4IJHA 5IP9H 1VQGA 3HOYG 4L5SA 3G48A 4QL5A 5E1FA 3T56B 4B3TQ 3I72A 1IZ6A 2K75A 2F0PA 5C4ZA 5CC4A 2VUMG 1WTPA 2LSSA 1A63A 1SLJA 3OTOQ 1KABA 3S15H 2Z8LA 3L3OC 1FJGQ 3X3NA 4XQQA 1HNXL 1XTDA 1GOZA 2JQOA 4PMCA 5LMNL 1PZID 4KTAA 1UUPA 3S2DH 2R7ZB 5EQ0A 1GD7A 3U9OA 4B9WA 3HOXH 3GTOB 2DJFC 1IBKQ 1KRTA 4JC0A 3KDFA 3DWQA 3NK9A 1YVCA 1Q8KA 2E2IB 4DV3Q 3CAMA 4DR6L 3I2ZA 1D1IA 1QOHA 1HR0Q 4A3KH 4U673 1TWFB 4HIOA 2MUYA 4DR1Q 3S2HB 3LX0A 4JI1Q 5HURA 2ZTEA 1FGUA 1EQQA 2HUGA 2OWOA 2HHHL 1VS0A 2R7DA 4MZ9A 1B4OA 5A2QE 4XT1B 1WD1A 1HUMA 3H3VH 4Q0FA 3RLFA 2N88A 4NXML 2E2JH 2K03A 1WOCA 4ZRZA 2JK8A 2L1BA 1SMYC 2VB3X 1PH8A 1K0RA 4KN7C 5ELOA 4BWGB 1NCVA 2PQEA 3C1FA 4B3RQ 3M3YB 1RL2A 1IYVA 3BZDB 3CHBD 4HJ9A 2I5HA 4CDEC 5C0XI 5C4XH 2JA5B 4A3FG 1WCMG 4A3IH 2B63B 3T53B 1DOKA 5FLMG 1Y69U 1O7IA 5M3FG 2JA8G 4YCWA 1KIXA 1STNA 4ZUIA 2FINB 5A2QL 1MKHA 2BE5D 4BBSG 5JEAG 1S5FD 1C0AA 3QJYA 1IW7D 4BY7H 4QMGA 1GO3E 2ZTCA 1A8VA 4QGUA 4X66Q 3HKZE 5KIXA 5G3LF 3HOZH 2NN6G 5E4XA 5FOBB 1SYBA 3VR3A 2FXQA 1XWEA 4DNTB 2CFMA 4EQPA 5LL6X 5JVH3 1VQAA 2K33A 3A54A 4JI5Q 1T5XD 1YJNA 2PW7A 4OIKA 1U4PA 3B6YA 3D4WA 4ALPA 3BVMA 1ONLA 1EL0A 4RCNA 1LTBD 2CW0D 2EYHA 2BH2A 4M1UB 4DV7L 2ZJPA 3HOUH 3MXGA 4NB3A 2A68D 2VY3A 1QZGA 1F2ZA 3H6MA 1VQFA 5C4HA 5C3WA 3TZDA 5JEAJ 4YHHQ 1XPUA 5C0XH 2K04A 1BBXC 5EKIA 3T4AC 1I94L 2WB1G 4I7AA 4DV4L 4FXDA 3ULPA 2B63G 1VQPA 1ZXTA 3OW7A 3E5SA 4CDFC 1HNZQ 2FMCA 4XYQA 1Y14B 1N36Q 1B3QA 4V0BA 3V96A 3SDZA 3M85A 4KMUC 3RD4A 4A3KB 1Q82C 2NBFA 3BS1A 2JEBI 2LXJA 4O2DA 1LABA 1J5EL 4MN3A 1K3RA 1PMRA 2HT1A 3NSWA 3S1MB 4FDBA 1JJGA 4OHJA 1X3QA 2QF7A 3KF8B 3GTMB 1PFMA 2WIIB 3BG3A 3KYHC 3UE0A 1TU2B 5F2DA 1BR9A 5JVG3 1SDFA 3KF6A 4FXGC 1FD7D 5BN3A 4HMJA 5KYLA 4XQNA 3GTLH 1BVSA 3CCUA 2WAQB 2O5IC 3CCVA 1KNAA 1YI2A 3VYTA 1I4HA 3PO3G 3CPFA 4WORA 1BKBA 4GNXB 4DF7A 3S1RH 1PH1A 1IBLQ 3J7AF 3OIPA 1L0YB 2JA7H 5CBAE 4LF4L 1OO9B 3VR2A 1VQOA 4ODGA 4C3HH 1WTVA 2PNHA 2OTLA 2F4VL 1Q1BA 3K59A 5FO8B 5CV4A 1TWAH 2K5DA 4K2KA 1D1KA 2HQLA 1VQKA 1X3GA 3NTKA 5DM73 4RGMA 3AMUA 3OWFA 2K50A 1RDPD 4RGNA 3S24A 4FF4A 2ES2A 2KCTA 5J39A 2A19A 1BBUA 5M5WB 3K0XA 2A6EC 5C3XA 2ID0A 1N9WA 1HNWL 3AU7A 2F0UA 3FRPB 4YWKA 1A2TA 3OSOA 3SR1A 1K3BC 2B39A 1G91A 2EJMA 4IOAA 3MFGA 3IFTA 3M9BA 4IPHA 3SK5A 2JA5H 5C4XB 4APVA 3QIAA 3OPOA 3UDIA 2UXDQ 2ZT9C 4GLAC 1I4PA 4QF4A 4A93G 2DGYA 3MEFA 4LF5L 1UEBA 5IYCH 4C3HB 4J1MA 1LTSD 2KCNA 3CQZB 1ILPA 3R2TA 1R4QB 1JC7A 2N3SA 1SSOA 1I5FA 2JYOA 2Z0SA 5GAHC 3EIVA 4LF8L 1UE6A 1ZEQX 2WKDA 2DNEA 3H94A 2PI2E 4GS3A 3NBHB 1JORA 4X6AH 4C2MH 4YCVA 1JR0D 2IT1A 3GTLB 3RZDH 3PCOB 5C44B 4HIMA 2WB1E 2MJ8A 1RJTA 1E24A 1TS3A 1JJ2A 2K5VA 4JV5Q 3A74A 3HFZB 4UHVA 2E2IH 3Q23A 3C46A 4EVOA 3GTMH 2KA7A 2I0QA 3GTOH 3TREA 1S5BD 1X65A 2F0DA 4K6DA 2DJGC 1PH2A 1VQLA 4LF6Q 1HTPA 2VW9A 1T5EA 1SEBD 1U4MA 3EJIA 2V1CC 3IL8A 3U58A 1U9RA 4XYOA 1SFOH 3KDFB 3R8BA 2ZJQA 5IGBA 1SNQA 1K8GA 1SNOA 3DM1A 1LT6D 2MP1A 4DK1A 2A8VA 4JI8L 2K6AA 1VQMA 4CGYB 2EJGC 1Q3LA 1VQHA 5EBDA 2MO1A 1T9HA 1YNND 4MTNA 4DNRB 4R9WA 3J80c 3KF6B 1EYDA 2F0EA 3VYUA 1LO5D 1EU4A 1QNUA 5ISRA 1EIFA 1PH4A 1G291 3K58A 5C0XJ 1O7LA 2A73B 4Y7NB 2VZAA 3CCMA 3OW2A 1TIID 3MXPA 1B1ZA 4AQYL 3DEOA 3S16B 1H9KA 3PIO3 3J7ZC 1QUQB 1L1OC 2UUBL 1SYFA 3DM3A 3A7AB 1A0IA 2EDGA 5FO9B 1YNXA 5LMNW 3NELA 1XNRL 2WB1B 4OWXB 3ONAB 4GLVB 1WCMB 2KECA 2M00A 1U4LA 2PCFB 1V43A 4GZYC 1MSGA 3EROA 4DPGA 2NB0A 3I3CA 5M3FB 1VQ9A 1W6JA 2LMCB 4DA2A 3E3XA 1J6QA 3Q0AA 4A3LG 4JI7L 3RN5A 1X32A 1H9SB 3CC2A 2HDMA 4G4KA 1SJHD 4DK0A 5IGGA 2B2TA 2H5XA 1LYLA 2AUKA 3D4RA 1HR0L 1I6HH 4TVAB 3VYRA 1EZ8A 1FL0A 3TP5A 1YZ6A 2V4DA 3ULLA 3BZCA 3KLSX 2ICEC 3TRZA 1EYAA 3HOXG 3J81c 1AW7A 2I5LX 1CK1A 5IGDA 3I70A 2EYOA 3HOVB 4TQUS 1CQFA 3SK6A 1CTMA 4DR5Q 4ID6A 3K8AA 2JXMB 4R8NA 2R92B 1BCPD 4ZCKA 4JI6L 1LUZA 4HSPA 2LKVA 3TEHB 1A62A 3GTQH 1E0BA 1VF7A 4X62Q 3CP0A 4J6HA 1P16A 1LM0A 2OXPA 2DN8A 1YHQA 4IPCA 1FNVA 2B3GA 4OX9L 4CJ1B 3PF4A 1R4PB 3RZOH 4HN7A 2L9HA 4KV6A 3VYSA 4QUFA 1PRTF 3KJOA 2MHVA 4DK3C 1I50B 2VXWA 4J15A 4DXFA 2IHFA 3MHBA 4RAUC 4LJZC 2LY7A 4IPGA 4R4IA 2P5ZX 1V1QA 4LMQD 3M7NA 2RF4A 5JEAH 4FVMA 1I3QH 5DLQE 5IYBH 1M8AA 2WKCA 4B9XA 1I4XA 4POFA 2Z4IA 4FO2A 1E2ZA 1EQRA 5C44H 1WJJA 1BXTA 2JE6I 1QZHA 1KC8C 3JAME 2Q2IA 1MSHA 4HJ8A 4UY8C 3K5MA 1E1TA 2Z6KA 1PTOD 4C3IB 4A3CG 2K32A 4WJ3M 1X9NA 1U0LA 3LGJA 2PO4A 4RGTA 1MBYA 1SJED 3CC7A 1A3VA 2EY1A 1LT4D 5D3IB 4R4OA 5FJ8H 1Q86C 1JE4A 1CKNB 2RDGA 5E3FA 3KFUA 3FVQA 2R93H 5GROA 3EVQA 1A3UA 2FMMA 2JA8B 5IY0A 3S9WA 4JI5L 2L4NA 1LTID 4NPSA 1SNDA 5EKLA 1JOOA 3NQIA 4JK1C 1L0XB 1R9TH 1D2BA 4IFDG 4A4IA 2XVSA 3AFQA 1WTWA 4MHEA 2PPBC 1F2YA 3I73A 5EPKA 4XQJA 2GA4B 2GVAA 3H0GG 3J81E 2K5QA 2CVRA 3BDCA 4ZKCB 2JA6H 2PZWA 3KBXA 4A3FB 1GXDC 4IUPA 1R9TB 2B63H 3KLRA 3C2PA 2IW3A 3K6OA 3CD6A 1O80A 4A3JH 2F0TA 4DR2Q 1P8LA 1F9SA 4K2LA 1N32Q 1UAPA 1WI5A 3S16H 1QE6A 4LF9Q 5ELNA 2NZHA 3NEMA 1SE3A 2BOSA 1K28A 2CCZA 3T1YL 4GN4B 4GKJL 1TWGH 2B2YC 4M8AA 3CCQA 4B3SQ 4JI8Q 1NAPA 2KENA 2XSCA 1IKLA 4C3JG 4OWTB 4PQXA 1TQOA 2QDLA 1DGSA 2EY5A 4K5XA 3H3VI 2IJ0A 1GHKA 1V1PB 1PRTD 1WTRA 2QA4A
chains in the Genus database with same CATH topology
2I46A 3MVVA 1STEA 1HTLD 1EY5A 1TR5A 3EFXD 1TY0A 3Q6SA 3PO3B 2J7ZA 3S2DB 2D5DA 2EPBA 4LAAA 4NW2A 3VA5A 3U9SA 1EWHA 2PMZB 1TS5A 2A69C 3P75A 1AN8A 1HFNA 2A74C 5I6WA 1JWUD 5KGUA 3C3LA 3S15B 3J80L 4HSVA 5I2XA 5M3MB 2HDLA 1GJXA 4C2MB 1HHVA 1Q8IA 1JOQA 4WJWA 1GUSA 2IWHA 2D62A 3WDNA 4KI0A 1Q1EA 1F9PA 1MGSA 3KUPA 5CV5A 2CHBD 3QOJA 1F9RA 3TP8A 3J80E 1CT1D 4KHZA 1NR2A 4CJ2C 1F2MA 1I4GA 2RDFA 3IAYA 3ITPA 3NPPA 5M9OA 1WTOA 1CFMA 3SEBA 4C3IG 2F0GA 1EY8A 3ND9A 2BCOA 3S17B 1VMCA 2F0IA 1EY6A 3LWEA 5IIFA 5KNDA 3Q22A 2AWOA 3K5NA 3H3VC 4J8QA 1DM0B 3FKIB 2L5TA 2XIWA 5DEHA 5CMDA 1BF4A 4AYBB 4CHTB 5COYA 3P7JA 1G2TA 1KDAA 5I6YA 5FLXE 2B2WC 1BQQT 4NMZA 4KD4A 1IL8A 1O7ZA 2K05A 2L11A 2ZXPA 3M4OB 5FKAC 2EXZA 1G8ZD 1ESRA 1EY7A 1DYQA 4BBSB 2RKSA 4B08A 2L55A 4KY6A 3QG1A 5I9PA 4A3MB 3GTKB 2CW0C 2G9DA 4NP5A 4TRDA 2SNSA 1D5XC 5KEEA 1PRTC 4QB4A 3I4LA 3MFYA 2EYMA 3RZOB 1S5ED 5I2YA 1PDQA 1TWCB 1SNPA 1SYCA 3RUZA 2NTTA 4ABNA 1B2TA 1OXXK 2D9UA 2B2UA 4F7XA 4ZKBB 1CHQD 1S4ZA 5LHY1 3MA2B 4TSSA 1JB3A 2BA0A 1J9OA 1ET6A 2FHTA 4RCOA 1JOKA 2KHSA 3TDQA 3GTJB 3H0GB 2L0CA 3MWYW 3HGBA 2HQEA 2QCPX 4I7ZC 3NTHA 2KEEA 5AFWA 3I8ZA 1PLFA 2KUMA 2LFNA 3MXUA 2X69A 4H7BA 1EY4A 4KK7A 1KLGD 5KYIA 2K5WA 4EQOA 4N9TA 3BYYB 5KNBA 3PIP3 3OMGA 1CA6A 4ULLA 4A3JB 1WTQA 1I6VC 4O1NA 5ELFA 1EY9A 1RTNA 3GV3A 3D4DA 2NVQB 5T1GA 2F4IA 3DEPA 1C4QA 2Q8TA 1RCVD 3MTSA 5D65A 2ENBA 2ZXRA 1CA5A 4H44C 3MAQA 1ESFA 3MC0B 4P2CB 1MD2D 4U68A 3DMUA 2J0TD 2IX0A 2EYLA 2R93B 1GUOA 4HAEA 3VA7A 3S14B 1QILA 1FGBD 2F0LA 2E75C 3TP6A 1SNCA 3X3MA 2NN6I 2EYPA 4PV1C 5IODA 2R61A 5CV7A 4C3JB 3CKIB 4G7HC 3TBIB 1XXGA 2E74C 1QG7A 1JCKB 3HKZB 2NVTB 1EIHA 5KRUA 1NR4A 1SFOB 1B44D 5C0XG 2KOLA 1OXSC 5C3EB 5EPLA 3J81L 5K5PA 3PUVA 1BCPB 4RHRA 2F1MA 1A2UA 3W3AA 1STHA 5E4WC 1ENFA 2RSNA 2Q8IB 3A8KE 3UI2A 1J8IA 4JBWA 3FDTA 1BCPF 5J22A 1A6XA 2OF1A 3J7YW 5CR3A 2B8GA 1YNJC 4WRDA 1UNSA 3VR5A 2Z4HA 4IFDJ 1V8QA 4H0LC 1F77A 2L12A 4K14A 4RKBA 1LACA 5EKKA 3AB9A 2F0NA 5FO7B 4A3GB 1HA5A 4IQZA 1Z7TA 2C5CA 3MEHA 2EY2A 2JA6B 2B8FA 4DAVA 1OXVA 1KNEA 3K57A 1H9SA 3BVZA 2AQ2B 1BDOA 4G7OC 4KN4C 4IZ8A 1PZKD 4Z9CB 2BA1A 2PNRC 4ZLTF 4A3EB 2B2YA 4FF3A 1KAAA 5ELEA 2J4XA 3G6JB 2B2UC 1VF5C 2PZTA 4L63B 2HCIA 2ICIA 3EQLC 4CBVA 3S1RB 1HXYD 4K8JA 1NSNS 3FPPA 2O4XA 4DXGA 4Q5VA 3GO5A 1IKMA 1SYEA 4S3SA 4RKLA 1LT3D 1TS2A 1DONA 1VCIA 2H4OA 1SMYD 1E2WA 4X3UA 2A6HC 5K36G 4F87A 1DOMA 3SE0A 5M5YB 4FF2A 3K7AB 4L8JA 1Y1WB 2TMPA 2OEOA 3ERQA 1AFPA 4OGQC 1IW7C 1PTOF 3TP7A 5FLXL 3I91A 1GUWA 1HFGA 1PRTB 3PMFA 5CV8A 1TKWB 3PUYA 3I4MB 4OIJA 3VR6A 1OXUA 2A6ED 2K01A 1ML0D 5C4JB 2Y0SB 4E6IA 2AQ1B 4BA2I 3FPUB 1ENAA 1B9MA 3FEWX 5G3LD 3A56A 1QWYA 1SYDA 3KBGA 2EYFA 2FJ2A 1TT2A 1LTAD 3D8GA 4QUCA 1A15A 5CORA 1VDZA 5C5MA 1ILQA 5CYUA 3E0JA 4QIWB 4IFDI 1TY2A 4KD3A 5CGKA 1I6HB 1SE4A 4XDXA 1SXTA 2M9VA 4CKCA 4X3TA 5IOCA 1STBA 1WVLA 4L6TB 2XNAC 4IUNA 1PXUA 2EYJA 1STAA 1EFID 2F3WA 3DWAA 2E76C 3MZ5A 5CV6A 2E2DC 1KLUD 1TS4A 4UDUC 1DXMA 2EOTA 1TWHB 2NVXB 1CZWA 1QJOA 3L7ZC 5DM63 1C48A 4IUQA 4C1NI 1BUVT 3N52A 1HA6A 2KCCA 2RDHA 3NE5B 4K5WA 3NBHA 3GP7A 2Q8RE 1EYCA 1S5CD 1FNUA 2DY7A 1FR3A 1OXTA 1ZYRD 2A68C 4I65A 5ELBA 3KK7A 4ZK9B 3QO2A 3VR4A 4ZQ3A 2X6GA 4HMIA 3CRKC 4BY1B 1IYUA 1JQYD 4CKBA 1DJRD 3BDLA 1ZYRC 1D5ZC 1SBBB 3RZDB 5CV9A 3NP8A 2PW5A 4DAYA 1PYWD 2F0SA 3TZUA 2JP1A 5IT9L 3HOXB 1ET9A 3A8IE 3G7LA 4DN4M 1RKNA 5C5LA 2BDNA 1XX8A 4IUTA 1HUNA 3I4NB 3QB3A 1QCBD 1F9QA 1HQMC 1B9NA 2IPKD 5FK9C 3DUZA 1HRJA 3SHLA 2XWJB 3HOUB 4BA1I 1O7YA 4XTCS 2QKIC 4OO1I 3HS0C 2O2LD 2BDOA 2NYZD 2NZ1D 5T1IA 4ILWA 3TN2A 5CBEE 1D6EC 1TWAB 1EQTA 4K6LA 1V1PA 2QDBA 2C9OA 4PNYA 4HCEA 1XYIA 3P20A 3NQTA 4IFDH 3NHHA 1UEAB 2R3ZA 4IN3A 2RBMA 2CQAA 3HRZC 2B2VA 3K5LA 3DHQA 4F8MA 5J1ZA 4IUVA 1PZJD 2MGSA 1BO0A 1LTTD 3LWUA 2F0WA 1M4VA 1B53A 1EQVA 1CHPD 5C6AA 5I4DA 4FYDA 2BE5C 1RD9D 4KHVA 1FNWA 5IGFA 1XTCD 2R6GA 2WINB 1CZGA 2B2TC 3NWTA 4EGVA 1FYCA 1Q12A 3NTIA 1BOSA 4OO1G 2IL8A 3MXNA 4BBRB 1U4RA 4WFN3 3A55A 2F3VA 2X6LA 5BN5A 3HP3A 3SXHA 1O78A 3GTQB 1H9JA 1IHZA 1SE2A 3HOWB 1PTOC 2B2VC 2F03A 2EVBA 3N6RA 2F0KA 1BNZA 4ZAIA 2WACA 4H13C 1PFBA 2K1BA 4XXEA 2Z1CA 5D14A 3Q24A 3R93A 1K83B 3HEJA 4YIJA 2B2WA 3O13A 1JWSD 2KQ3A 5ELDA 5M5XB 4CJ0B 1HPCA 1AZPA 3V2TA 2WV6D 2AQ3B 3OHXC 1QNKA 1G2SA 2KVMA 1RHPA 4UAIA 1S5DD 1SNMA 4K8IA 4RFBA 3C1EA 3E6ZX 3PV0A 1I4RA 2A5HA 5K36H 1GUGA 5JPNC 2DY8A 3K0YA 5TSSA 3CU7A 2M2LA 4A3IB 3DWPA 3QOLA 3R2IA 4IALA 4C56C 2E2HB 3OMCA 4KKSA 3PUXA 1EEID 4G7ZC 3QWNA 4MIUA 2DNCA 4V190 3L9AX 1JICA 2LS01 2PZUA 2RSOA 2IX3A 5NUCA 5IGCA 2K28A 3PUZA 3BYTB 1DCZA 1G6ZA 3SK8A 2XRQD 2VUMB 3H09A 4ZYSA 1TWGB 1SAPA 3NWSA 1H9MA 1EWCA 3KF8A 5LL6S 2XWBB 1Y8OB 3IFDA 1Z6HA 2XN9C 3K5OA 1AEXA 3OIQA 3HG9A 2EE1A 1EY0A 1DD2A 3S1NB 3R3OA 4HCSA 4ZUJA 1EEFD 4FNFA 1II3A 3URYA 3A7LA 4IUUA 4CKEA 1H9RA 4HEDA 4RA8A 1SYGA 2F0MA 1JWMD 1WTXA 3NBIA 4PMWA 2KJXA 3M7GA 4KY5A 3T51B 4BY7B 3D6CA 1KDBA 4A3BB 1EIGA 4KJNA 1E2VA 5EGTA 2WP8J 2NVYB 3ZYYX 3KLSA 3GD7A 5EBCA 1D5MC 2YU9B 4HTHA 4NDXA 4R8IA 2NN6H 4A3DB 1W6KA 4KKUA 1ZKOA 5ELCA 4XT3B 1B3AA 2F0JA 4EQNA 1CQVA 3OWEB 2A6HD 3WOEA 1LTRD 3D31A 3T13A 5JAVA 1RF2D 2YYZA 3GTPB 1KTKA 2FFKB 2EJFC 1RTOA 2PYKA 1EOTA 3ND8A 3F2UA 1A3TA 4DU9A 3SVMA 1EU3A 1B50A 2D2CC 1WD0A 3NXWA 5EPJA 3HZXA 1K8MA 1MI2A 4IURA 4RHSA 3FMCA 3NUCA 3I90A 1DZ1A 1RODA 1STYA 4DGZA 2SNMA 1I4QA 4OL7A 3SK4A 1PTOH 2NTSA 2I07B 4ME5A 2XRSD 1ENCA 3A8JE 4KY7A 4NKLA 4RH6A 3PUWA 2SOBA 3PO2B 1Y1VB 3M4YA 4G57A 2N55A 2EZVA 2IX1A 4FF1A 2NWGA 1KDCA 3GTGB 4N9PA 4KKTA 3TMEA 4PMBA 5D3DA 1Q90A 1F2LA 3D6WA 1AZQA 2HCCA 2O5JC 2JA7B 4X3SA 3HOZB 4LK1C 3EA6A 4TKOB 2KEDA 2ZXOA 1Z47A 5JPMC 5IT9E 2QEJC 3HOYB 4C3HG 5IGEA 4F88A 1LT5D 2AWNA 5DAUA 2QILA 3CRLC 4FP5D 2VB2X 4RWSC 4DAPA 5HGTA 1QB5D 3P1HA 4HR7B 1Y8NB 2F0FA 1PFNA 2VNUD 1PTOB 1I3QB 2MPMA 4KJOA 3GQBA 2H1EA 4OO1H 1GUNA 2RVLA 1C8CA 1STGA 5EJWA 1EZ6A 2F0HA 3BVGA 2E2JB 3RMHA 1BCPC 3D3RA 2JSOA 5KNCA 2G9HD 1K8OA 3GV6A 4A93B 4C1NK 3W2DA 1HQRD 3H91A 5DNFA 4FXKC 2F0OA 3V05A 1Y8PB 5A35A 1TVXA 1LLRD 1YNJD 2A69D 1X3PA 3WOFA 1GHJA 1ICWA 5BN4A 2TSSA 3JAML 5I9OA 3S1QB 1LV9A 1HCZA 2JEAI 1CM9A 4RGOS 1YNNC 1GUTA 1NUCA 3LNNA 1AP0A 4DFAA 2RQXA 1DOLA 4K5VA 3BDOA 4X3KA 1CI3M 1LTGD 3OOCA 4QCLA 1VMPA 5JOBA 3DXJC 1V1OA 2EY6A 2AUJD 3J7AV 2F0VA 2OT2A 3TSSA 2K7VA 4BS9A 2RA4A 3IKJA 2SDFA 2NUCA 2F0QA 4XIGS 2SEBD 4O42A 5JJZA 3T16A 5E1FA 3T56B 3I72A 2F0PA 5C4ZA 5CC4A 1WTPA 1KABA 2Z8LA 3L3OC 3X3NA 4XQQA 1GOZA 4PMCA 1PZID 4KTAA 1UUPA 2R7ZB 5EQ0A 3U9OA 4B9WA 3GTOB 3DWQA 3NK9A 2E2IB 1D1IA 1QOHA 4U673 1TWFB 2MUYA 3S2HB 3LX0A 5HURA 2HUGA 1B4OA 5A2QE 4XT1B 1WD1A 1HUMA 4Q0FA 3RLFA 2N88A 2K03A 4ZRZA 2L1BA 1SMYC 2VB3X 4KN7C 4BWGB 1NCVA 2PQEA 3C1FA 3M3YB 1IYVA 3BZDB 3CHBD 5C0XI 2JA5B 2B63B 3T53B 1DOKA 1Y69U 1STNA 4ZUIA 2FINB 5A2QL 2BE5D 5JEAG 1S5FD 3QJYA 1IW7D 4QMGA 5KIXA 5G3LF 2NN6G 5E4XA 5FOBB 1SYBA 3VR3A 1XWEA 4DNTB 4EQPA 5LL6X 5JVH3 2K33A 3A54A 1T5XD 2PW7A 4OIKA 1U4PA 3D4WA 3BVMA 1ONLA 1EL0A 4RCNA 1LTBD 2CW0D 2EYHA 4M1UB 3MXGA 2A68D 1F2ZA 3H6MA 5C4HA 5C3WA 3TZDA 5JEAJ 5C0XH 2K04A 1BBXC 5EKIA 3T4AC 4FXDA 1ZXTA 3OW7A 3E5SA 2FMCA 4XYQA 4V0BA 3V96A 3SDZA 3M85A 4A3KB 4KMUC 3RD4A 2NBFA 3BS1A 2JEBI 1LABA 4MN3A 1PMRA 3NSWA 3S1MB 4OHJA 1X3QA 2QF7A 3GTMB 1PFMA 2WIIB 3BG3A 1TU2B 5F2DA 1BR9A 5JVG3 1SDFA 4FXGC 1FD7D 5BN3A 4HMJA 5KYLA 4XQNA 2WAQB 2O5IC 1KNAA 3VYTA 1I4HA 4WORA 4DF7A 3J7AF 3OIPA 1L0YB 5CBAE 1OO9B 3VR2A 4ODGA 1WTVA 1Q1BA 3K59A 5FO8B 5CV4A 2K5DA 4K2KA 1D1KA 3NTKA 5DM73 4RGMA 3AMUA 3OWFA 1RDPD 4RGNA 4FF4A 5J39A 5M5WB 2A6EC 5C3XA 2ID0A 3AU7A 2F0UA 3FRPB 1A2TA 3OSOA 3SR1A 2B39A 1G91A 2EJMA 3MFGA 3IFTA 3SK5A 5C4XB 3QIAA 3OPOA 2ZT9C 1I4PA 4QF4A 4C3HB 4J1MA 1LTSD 2KCNA 3CQZB 1ILPA 3R2TA 1R4QB 1JC7A 1SSOA 2JYOA 1ZEQX 2WKDA 2DNEA 3H94A 1JORA 1JR0D 2IT1A 3GTLB 5C44B 2MJ8A 1RJTA 1TS3A 3Q23A 3C46A 4EVOA 2KA7A 1S5BD 2F0DA 4K6DA 1HTPA 1T5EA 1SEBD 1U4MA 3EJIA 3IL8A 1U9RA 4XYOA 3R8BA 5IGBA 1SNQA 1SNOA 3DM1A 1LT6D 2MP1A 4DK1A 2K6AA 4CGYB 2EJGC 1Q3LA 5EBDA 1YNND 4DNRB 4R9WA 1EYDA 2F0EA 3VYUA 1LO5D 1EU4A 1QNUA 5ISRA 1G291 3K58A 5C0XJ 1O7LA 2A73B 4Y7NB 1TIID 3MXPA 1B1ZA 3DEOA 3S16B 1H9KA 3PIO3 1SYFA 3A7AB 2EDGA 5FO9B 2WB1B 3ONAB 1WCMB 2KECA 2M00A 1U4LA 2PCFB 1V43A 4GZYC 1MSGA 3EROA 2NB0A 3I3CA 5M3FB 1W6JA 2LMCB 4DA2A 3Q0AA 1X32A 1H9SB 2HDMA 4G4KA 1SJHD 4DK0A 5IGGA 2B2TA 2AUKA 3D4RA 3VYRA 1EZ8A 3TP5A 2V4DA 3KLSX 2ICEC 1EYAA 1AW7A 1CK1A 5IGDA 3I70A 2EYOA 3HOVB 4TQUS 1CQFA 3SK6A 1CTMA 4ID6A 2JXMB 4R8NA 2R92B 1BCPD 4HSPA 2LKVA 1E0BA 1VF7A 4J6HA 2OXPA 2DN8A 1FNVA 4CJ1B 1R4PB 4HN7A 2L9HA 4KV6A 3VYSA 4QUFA 1PRTF 2MHVA 1I50B 2VXWA 4DXFA 3MHBA 4RAUC 4LJZC 2LY7A 4LMQD 3M7NA 5JEAH 4FVMA 4B9XA 1M8AA 2WKCA 1I4XA 2Z4IA 4FO2A 1E2ZA 1BXTA 2JE6I 3JAME 1MSHA 3K5MA 1PTOD 4C3IB 2K32A 2PO4A 4RGTA 1MBYA 1SJED 1A3VA 2EY1A 1LT4D 5D3IB 1JE4A 2RDGA 5E3FA 3FVQA 3EVQA 1A3UA 2FMMA 2JA8B 3S9WA 2L4NA 1LTID 1SNDA 5EKLA 1JOOA 3NQIA 4JK1C 1L0XB 1D2BA 4IFDG 2XVSA 1WTWA 4MHEA 2PPBC 1F2YA 3I73A 5EPKA 4XQJA 2GA4B 3J81E 2K5QA 2CVRA 3BDCA 4ZKCB 2PZWA 3KBXA 4A3FB 1GXDC 4IUPA 1R9TB 3KLRA 3C2PA 2IW3A 3K6OA 1O80A 2F0TA 1F9SA 4K2LA 1UAPA 1QE6A 1SE3A 2BOSA 2B2YC 4M8AA 1NAPA 2XSCA 1IKLA 4C3JG 4PQXA 1TQOA 2EY5A 4K5XA 2IJ0A 1GHKA 1V1PB 1PRTD 1WTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXE A;  4XQN A;  4XQQ A;  4G4K A;  4XQJ A;  4XYO A;  4XYQ A;  4CBV A;  3BS1 A; 
#chains in the Genus database with same CATH topology
 2I46 A;  3MVV A;  1HNW Q;  1QVC A;  2R7F A;  1STE A;  1HTL D;  4JG2 A;  4DAY B;  1EY5 A;  1TR5 A;  3EFX D;  2GN5 A;  1TY0 A;  1K8A C;  3Q6S A;  3PO3 B;  4R4T A;  2NVT H;  1XPO A;  3WWV A;  2J7Z A;  4H02 A;  4B3M Q;  3S2D B;  2D5D A;  2EPB A;  4LAA A;  2WAQ G;  1PVO A;  4NW2 A;  3VA5 A;  3U9S A;  3PO3 H;  1EWH A;  2PMZ B;  1TS5 A;  2A69 C;  3P75 A;  1N34 L;  2UUA L;  4GOP B;  1AN8 A;  1HFN A;  2A74 C;  5I6W A;  1M90 C;  1JWU D;  5KGU A;  3J80 i;  4YY3 L;  3C3L A;  1NMF A;  3S15 B;  3EBE A;  4QY7 A;  3J80 L;  4HSV A;  5I2X A;  5M3M B;  1Q81 C;  2HDL A;  3M4Q A;  4BBR G;  2E5L Q;  1GJX A;  4C2M B;  1X55 A;  1HHV A;  4OWW B;  4L5R C;  4N8X 1;  1Q8I A;  3GTK H;  1NMG A;  1JOQ A;  1VQB A;  4WJW A;  1GUS A;  2IWH A;  2D62 A;  3WDN A;  4KI0 A;  1Q1E A;  1F9P A;  1MGS A;  2IHE A;  1XNQ Q;  3KUP A;  2KCM A;  1VQ7 A;  5CV5 A;  2CHB D;  3QOJ A;  1NJI C;  1L1O B;  1F9R A;  3TP8 A;  4A3E G;  3J80 E;  3TS0 A;  1CT1 D;  4KHZ A;  1NR2 A;  2PI2 A;  4CJ2 C;  1F2M A;  3M4O H;  1I4G A;  2RDF A;  3AYH B;  3IAY A;  3ITP A;  3NPP A;  3Q8D A;  5M9O A;  1WTO A;  1CFM A;  3SEB A;  4C3I G;  4DNI A;  3CXC A;  2F0G A;  1EY8 A;  3ND9 A;  2BCO A;  1JB7 A;  3S17 B;  2K52 A;  3CPW A;  1VMC A;  2F0I A;  1EY6 A;  2BH8 A;  3LWE A;  5IIF A;  5KND A;  4WJ4 A;  5M5W H;  4JBM A;  3Q22 A;  2AWO A;  3K5N A;  4DV5 Q;  3H3V C;  4J8Q A;  1S72 A;  3S1N H;  1DM0 B;  4JI3 L;  1KQS A;  4GN5 A;  3FKI B;  2L5T A;  2XIW A;  3RR5 A;  5DEH A;  1ASY A;  5CMD A;  1BF4 A;  4AYB B;  5M3M G;  4CHT B;  5COY A;  2Z6K C;  3P7J A;  1G2T A;  1KDA A;  2A1A A;  4JW0 A;  1IBM L;  5I6Y A;  5FLX E;  2B2W C;  1BQQ T;  4NMZ A;  4KD4 A;  1IL8 A;  1O7Z A;  2K05 A;  2L11 A;  2ZXP A;  3M4O B;  5FKA C;  1S40 A;  2EXZ A;  1G8Z D;  4P74 A;  1ESR A;  1AE2 A;  2UXC Q;  1EY7 A;  3J7A 5;  2MO0 A;  1DYQ A;  4BBS B;  2OQ0 A;  1NBW A;  2RKS A;  1N32 L;  4B08 A;  2L55 A;  4JBJ A;  2UXD L;  4KY6 A;  1XMO L;  3QG1 A;  5E7N A;  1YJW A;  5I9P A;  4A3M B;  1NE3 A;  3GTK B;  2CW0 C;  2G9D A;  2KHJ A;  4NP5 A;  1K9M C;  4TRD A;  2HD3 A;  2SNS A;  1D5X C;  4DV2 L;  5KEE A;  2ZTD A;  1PRT C;  3U4Z A;  4QB4 A;  3I4L A;  4AIM A;  3MFY A;  2EYM A;  4HJA A;  2UUC L;  3RZO B;  1S5E D;  5I2Y A;  1Z9F A;  1Y1W H;  1PDQ A;  1TWC B;  1SNP A;  1SYC A;  5M5Y H;  1KD1 C;  3RUZ A;  2NTT A;  4ABN A;  1B2T A;  1OXX K;  2D9U A;  2B2U A;  4F7X A;  3STB D;  3W1G A;  4ZKB B;  1CHQ D;  1S4Z A;  3JAM i;  1CSP A;  5LHY 1;  3MA2 B;  3UDF A;  4TSS A;  1JB3 A;  2WAQ E;  2BA0 A;  4GN3 B;  2WFW A;  1J9O A;  4DK6 C;  2R92 H;  1ET6 A;  2FHT A;  5LMU Q;  4RCO A;  3CW2 C;  4IO9 A;  1JOK A;  2KHS A;  2CKZ B;  3TDQ A;  3H0G B;  2L0C A;  3GTJ B;  3MWY W;  3ZJY C;  3HGB A;  4YY3 Q;  2HQE A;  2QCP X;  4I7Z C;  1EIY B;  3NTH A;  2KEE A;  5AFW A;  3I8Z A;  3HOV H;  3JAM c;  1PLF A;  2KUM A;  2LFN A;  3MXU A;  2UXB L;  4JPB W;  4A3L H;  2X69 A;  4H7B A;  1EY4 A;  4KK7 A;  1KLG D;  5KYI A;  2K5W A;  2UU9 Q;  4EQO A;  2VQF Q;  4N9T A;  3BYY B;  5KNB A;  3J81 i;  4Y52 H;  3PIP 3;  1KAW A;  3OMG A;  4HID A;  1CA6 A;  4ULL A;  4A3J B;  1WTQ A;  1I6V C;  1HJP A;  4O1N A;  5ELF A;  4LF7 Q;  1EY9 A;  1EWI A;  1WCM H;  4A3F H;  1CKN A;  1B7Y B;  1K83 H;  1RTN A;  3GV3 A;  5M3F H;  3D4D A;  1IBM Q;  2NVQ B;  5T1G A;  1N8R C;  2F4I A;  3DEP A;  1C4Q A;  2Q8T A;  1JT8 A;  1RCV D;  3MTS A;  5D65 A;  2ENB A;  2ZXR A;  1CA5 A;  4H44 C;  1MHW C;  3MAQ A;  3T1H Q;  1PH5 A;  1XNR Q;  3I4N G;  1ESF A;  3MC0 B;  4P2C B;  1MD2 D;  4U68 A;  3DMU A;  2J0T D;  2IX0 A;  2MNA A;  2EYL A;  2R93 B;  1GUO A;  4HAE A;  3VA7 A;  3UDG A;  1IBL L;  4A3B G;  3S14 B;  1L2F A;  1QIL A;  1E22 A;  1FGB D;  2F0L A;  4KHP L;  2E75 C;  2QW7 A;  1SNC A;  3TP6 A;  3X3M A;  4B3T L;  2NN6 I;  2EYP A;  4PV1 C;  5IOD A;  4MTK A;  2R61 A;  4BY1 G;  4GKJ Q;  1QVF A;  5CV7 A;  4C3J B;  2I5M X;  3CKI B;  4G7H C;  1W3S A;  3TBI B;  1XXG A;  1LTL A;  4RG1 A;  2E74 C;  1QG7 A;  3G6E A;  4HIK A;  1EOV A;  1JCK B;  1YIJ A;  3HKZ B;  5C3E H;  2NVT B;  4A75 A;  1EIH A;  5KRU A;  1NR4 A;  1SFO B;  1B44 D;  5C0X G;  1ICF B;  2KOL A;  1IYJ B;  2Y0S G;  1OXS C;  5C3E B;  5EPL A;  3J81 L;  1IBK L;  4LF4 Q;  5K5P A;  3JC6 6;  3PUV A;  1BCP B;  4RHR A;  4AH6 A;  2F1M A;  1A2U A;  3W3A A;  3TQY A;  1STH A;  5E4W C;  1ENF A;  2RSN A;  2Q8I B;  3ULJ A;  4A3M H;  1JJC B;  3A8K E;  1KRS A;  4JBK A;  3UI2 A;  4EQ5 A;  1J8I A;  3E9H A;  3FDT A;  1BCP F;  4JBW A;  5J22 A;  3BJU A;  2CWP A;  4B3M L;  5GAG C;  2R93 G;  1A6X A;  2OF1 A;  3J7Y W;  5CR3 A;  3A5U A;  2B8G A;  4P72 A;  1YNJ C;  4WRD A;  1UNS A;  4N8F A;  3VR5 A;  2Z4H A;  4JI4 L;  4IFD J;  1V8Q A;  4H0L C;  1F77 A;  5LMN Q;  2L12 A;  4K14 A;  1G6P A;  2UU9 L;  4RKB A;  2E2H H;  1LAC A;  5EKK A;  3AB9 A;  3CQZ H;  5BR8 L;  3S14 H;  4LFB Q;  4GOP C;  2F0N A;  5FO7 B;  4QIW E;  3KJP A;  4A3G B;  4OXP A;  2JA6 G;  1VQ4 A;  1HA5 A;  5HGQ A;  1FVI A;  4IQZ A;  1Z7T A;  2C5C A;  4YWL A;  2EXD A;  3MEH A;  2EY2 A;  2B8F A;  2JA6 B;  4LF6 L;  4DAV A;  1B8A A;  1OXV A;  1KNE A;  3L2P A;  3K57 A;  2NVQ H;  2R7Z G;  1X3E A;  1RIP A;  1H9S A;  2Y0S E;  3BVZ A;  1X54 A;  2GVB A;  2AQ2 B;  3RLO A;  1BDO A;  3PO2 G;  4G7O C;  1PH9 A;  3AQQ A;  4KN4 C;  4IZ8 A;  1PZK D;  4Z9C B;  2ZJR A;  2BA1 A;  2L15 A;  2PNR C;  4ZLT F;  4A3E B;  2B2Y A;  1UWV A;  4QQB X;  4FF3 A;  1KAA A;  5ELE A;  4LW1 A;  2J4X A;  3G6J B;  2B2U C;  1VF5 C;  2D0P A;  2LXK A;  4LF7 L;  1SRO A;  2PZT A;  1YEZ A;  4L63 B;  2HCI A;  2ICI A;  3EQL C;  4CBV A;  3S1R B;  1HXY D;  4K8J A;  1NSN S;  3FPP A;  2O4X A;  4P73 A;  4DXG A;  2Q2U A;  3I4M G;  4Q5V A;  4LF8 Q;  5FLX c;  3GO5 A;  1IKM A;  1NTG A;  1YHA A;  3PGZ A;  4LWC A;  4GKK L;  1JMC A;  4DAM A;  2D0O A;  1HR0 W;  1SYE A;  4S3S A;  4DR2 L;  4OEL B;  4OEM B;  4RKL A;  4BXX G;  1LT3 D;  1TS2 A;  1DON A;  4B3R L;  2JA5 G;  1VCI A;  2H4O A;  1ASZ A;  1PHJ A;  1SMY D;  3CF5 A;  1E2W A;  4X3U A;  2A6H C;  5K36 G;  1X6O A;  4F87 A;  4X64 L;  1DOM A;  4QJF A;  3SE0 A;  2VQE Q;  3E9I A;  5M5Y B;  4FF2 A;  3K7A B;  1I50 H;  3FP9 A;  4L8J A;  1Y1W B;  4POG A;  2TMP A;  4A3G G;  2OEO A;  4DV2 Q;  3PSI A;  3ERQ A;  1AFP A;  4OGQ C;  1IW7 C;  4DV1 L;  1PTO F;  3TP7 A;  5FLX L;  3I91 A;  2OTJ A;  1GUW A;  1HFG A;  1PRT B;  3PMF A;  5CV8 A;  1TKW B;  3PUY A;  4NXN L;  2EIF A;  3FKI G;  3I4M B;  4KLK A;  4OIJ A;  3VR6 A;  1OXU A;  2A6E D;  2K01 A;  4PZ7 A;  3W5O A;  1ML0 D;  4DR3 L;  5C4J B;  2Y0S B;  4E6I A;  4DV0 L;  4HJ5 A;  2AQ1 B;  4BA2 I;  3FPU B;  1ENA A;  1B9M A;  4GNX A;  3FEW X;  3U50 C;  5G3L D;  3A56 A;  1QWY A;  1AH9 A;  1GM5 A;  1SYD A;  3KBG A;  2EYF A;  2FJ2 A;  1TT2 A;  1LTA D;  3D8G A;  4QUC A;  3W1B A;  3G4S A;  1A15 A;  1PFS A;  5COR A;  1VDZ A;  5C5M A;  1ILQ A;  2NVX H;  5CYU A;  3E0J A;  4QIW B;  4IFD I;  1TY2 A;  4KD3 A;  5CGK A;  4DR4 L;  4LUO A;  1I6H B;  4JI4 Q;  3F2B A;  1SE4 A;  4XDX A;  1SXT A;  2M9V A;  1PH3 A;  4CKC A;  4R4C A;  1AE3 A;  4X3T A;  5IOC A;  3SGI A;  3AEV A;  1STB A;  2Z6B A;  4L6T B;  4UP9 A;  1WVL A;  2XNA C;  4IUN A;  1PXU A;  3CME A;  2AKW B;  2EYJ A;  5IP9 G;  3HOY H;  1STA A;  1EFI D;  3RNU A;  2F3W A;  3DWA A;  2E76 C;  3MZ5 A;  2NVY H;  5CV6 A;  2E2D C;  2E8G A;  4X62 L;  1Q46 A;  1KLU D;  1TS4 A;  4UDU C;  1PV4 A;  1DXM A;  4DV3 L;  2EOT A;  1K73 C;  1TWH B;  2NVX B;  1CZW A;  3L7Z C;  1QJO A;  2HIX A;  3A5Z B;  5DM6 3;  1C48 A;  1V9P A;  4IUQ A;  3BU2 A;  4C1N I;  1BUV T;  3N52 A;  4P71 A;  1HA6 A;  1GVP A;  3F2C A;  4A76 A;  2KCC A;  2RDH A;  3F8T A;  4L5T A;  4JYA Q;  4DV4 Q;  3GTJ H;  3NE5 B;  1HH2 P;  4K5W A;  3NBH A;  5C4J H;  3GP7 A;  2Q8R E;  2XTI A;  1EYC A;  1S5C D;  1FNU A;  2IY5 B;  2DY7 A;  1FR3 A;  4R1J A;  1OXT A;  1ZYR D;  2A68 C;  4I65 A;  5ELB A;  3KK7 A;  4ZK9 B;  4DV7 Q;  3QO2 A;  3VR4 A;  5JJK A;  4ZQ3 A;  2X6G A;  4JCV E;  4HMI A;  4K0K L;  4P75 A;  1U5K A;  1E7Z A;  3CRK C;  5IYD H;  4BY1 B;  1NNX A;  1IYU A;  1JQY D;  4CKB A;  1DJR D;  2F4V Q;  3BDL A;  1HZ9 A;  1ZYR C;  5LMU L;  1D5Z C;  1SBB B;  1VQ6 A;  4LFA Q;  3HOV G;  5C4X G;  4HJ7 A;  3RZD B;  5CV9 A;  4A3I G;  2VQE L;  5FLM H;  3NP8 A;  2PW5 A;  4DAY A;  1PYW D;  4DUZ L;  3I7F A;  2F0S A;  3TZU A;  2JP1 A;  5IT9 L;  3HOX B;  1J5E Q;  3PF5 A;  1ET9 A;  4BBS H;  3A8I E;  3G7L A;  3CCS A;  4DN4 M;  1RKN A;  5C5L A;  4DR5 L;  2BDN A;  1XX8 A;  4IUT A;  2ALY B;  1HUN A;  3G71 A;  3I4N B;  3QB3 A;  1QCB D;  4JOI A;  1F9Q A;  3HOZ G;  1HQM C;  1B9N A;  2IPK D;  3NEN A;  5FK9 C;  1VQC A;  3DUZ A;  1HRJ A;  3QR8 A;  4DV0 Q;  3SHL A;  3UE1 A;  4LUZ A;  5IYB G;  2XWJ B;  2Q2T A;  5GQO A;  1L0W A;  2YU9 H;  3HOU B;  1KL9 A;  4BA1 I;  1O7Y A;  4XTC S;  2QKI C;  1N33 Q;  4JI7 Q;  4OO1 I;  4DV1 Q;  1EYG A;  3HS0 C;  2O2L D;  4A3C H;  2BDO A;  4A3B H;  1D8L A;  2NYZ D;  2NZ1 D;  5T1I A;  5L37 A;  4ILW A;  3TN2 A;  5CBE E;  1D6E C;  4PZ8 A;  1TWA B;  1EQT A;  4K6L A;  5FJ8 G;  1V1P A;  2QDB A;  2C9O A;  4A3D G;  4PNY A;  2OCE A;  4MNO A;  4HCE A;  1XMQ L;  3GTG H;  5BR8 Q;  1PH7 A;  2OQK A;  1XYI A;  1XNQ L;  4DR1 L;  1GKH A;  3D0F A;  2AMC B;  3P20 A;  4JI0 L;  3NQT A;  4IFD H;  3NHH A;  1UEA B;  2R3Z A;  4IN3 A;  5C3E G;  2RBM A;  2CQA A;  3HRZ C;  1SR3 A;  2B2V A;  3K5L A;  1Y1V H;  1BBW A;  3DHQ A;  3H0G H;  4UP8 A;  3H15 A;  4GOP A;  4NXN Q;  4F8M A;  5J1Z A;  2C35 B;  4IUV A;  1PZJ D;  2MGS A;  1BO0 A;  2CH4 W;  1WFQ A;  1LTT D;  2K5H A;  4A3J G;  3LWU A;  2F0W A;  4DV5 L;  1M4V A;  1B53 A;  4X65 L;  1EQV A;  1CHP D;  2B29 A;  5C6A A;  2MQH A;  5I4D A;  3A0J A;  5JJL A;  1PYB A;  4FYD A;  2BE5 C;  4KHV A;  1RD9 D;  1FNW A;  5IGF A;  3S1M H;  4CDC C;  1XTC D;  2R6G A;  2WIN B;  1CZG A;  4C3J H;  2B2T C;  3NWT A;  3HOW G;  4EGV A;  3ERS X;  1FYC A;  1Q12 A;  3NTI A;  1XPR A;  1BOS A;  4K0K Q;  2K14 A;  3S2H H;  4OO1 G;  4X64 Q;  2IL8 A;  3MXN A;  4BBR B;  4JV5 L;  3F1Z A;  1U4R A;  4WFN 3;  3A55 A;  1B70 B;  2F3V A;  2EQS A;  2X6L A;  5BN5 A;  2ATW A;  4L5Q A;  3HP3 A;  3SXH A;  4PZ6 A;  1O78 A;  1UE1 A;  4B3S L;  4DV6 L;  3GTQ B;  1H9J A;  1IL2 A;  1IHZ A;  1SE2 A;  1XMO Q;  1PTO C;  4PG3 A;  3HOW B;  2B2V C;  2R7Z H;  4LFC L;  2F03 A;  2EVB A;  3N6R A;  1CKM A;  1HZC A;  2F0K A;  1BNZ A;  4ZAI A;  4YCU A;  2WAC A;  4H13 C;  1PFB A;  2K1B A;  3M4P A;  4XXE A;  2Z1C A;  1SN8 A;  2ZM6 L;  5D14 A;  3Q24 A;  3R93 A;  1VQN A;  1K83 B;  2VS1 A;  3HKS A;  3HEJ A;  5IP7 G;  4YIJ A;  2B2W A;  3O13 A;  1JWS D;  3PIO A;  4LNQ A;  2KQ3 A;  5ELD A;  5M5X B;  1QVG A;  1N34 Q;  2UUA Q;  1H95 A;  5IE8 A;  3CCR A;  4CJ0 B;  1HPC A;  1AZP A;  3V2T A;  2RHQ B;  1EFW A;  2WV6 D;  5IT9 c;  3ER0 A;  2AQ3 B;  3E0E A;  3OHX C;  5JJI A;  4A3E H;  1QNK A;  1G2S A;  2KVM A;  1PH6 A;  5GAD C;  1RHP A;  2YTX A;  4UAI A;  2QEX A;  2UUC Q;  1S5D D;  4Y7N H;  3K81 C;  4DKA C;  1SNM A;  4K8I A;  4RFB A;  4C3I H;  3J81 j;  3C1E A;  3E6Z X;  3PV0 A;  1I4R A;  2A5H A;  1YIT A;  5K36 H;  3OYY A;  1GUG A;  1SE8 A;  5JPN C;  2DY8 A;  3K0Y A;  3VDY A;  5TSS A;  3CU7 A;  2M2L A;  4A3I B;  3DWP A;  1XJV A;  3QOL A;  4A3G H;  5IWA Q;  4JOI C;  3R2I A;  4IAL A;  5M3M H;  4CDD C;  4C56 C;  2E2H B;  1CUK A;  3OMC A;  4KKS A;  3PUX A;  3BZK A;  1C9O A;  1EEI D;  1S3O A;  4GKK Q;  4G7Z C;  3QWN A;  4MIU A;  2VUM H;  2DNC A;  4V19 0;  3L9A X;  1JIC A;  3MXN B;  2LS0 1;  4NXM Q;  1QUQ A;  1TWF H;  2PZU A;  2RSO A;  2VQF L;  2VL6 A;  2IX3 A;  1K0S A;  1MIU A;  4X65 Q;  5NUC A;  5IGC A;  2K28 A;  4UPA A;  3PUZ A;  3BYT B;  1WYD A;  1DCZ A;  1G6Z A;  1MJE A;  3SK8 A;  2XRQ D;  2UXC L;  2YTV A;  2VUM B;  3H09 A;  2N8N A;  3K7U C;  3PIP A;  3T1Y Q;  2F3I A;  1Y1W G;  4ZYS A;  4O0A A;  1TWG B;  1HNX Q;  1SAP A;  3NWS A;  1HZB A;  2UXB Q;  2DUD A;  1H9M A;  1E1O A;  1EWC A;  1L1O A;  4YWM A;  3KF8 A;  1TXY A;  5LL6 S;  4A3K G;  3RN2 A;  5GAE C;  2XWB B;  1Y8O B;  3IFD A;  2RHS B;  1Z6H A;  2XN9 C;  1VQE A;  3K5O A;  1AEX A;  4DR3 Q;  2K5N A;  3OIQ A;  3HG9 A;  2EE1 A;  1EY0 A;  1DD2 A;  2R92 G;  4DR6 Q;  3S1N B;  3R3O A;  4HCS A;  4ZUJ A;  5AJ3 Q;  4JI2 Q;  1EEF D;  4FNF A;  4GLX A;  1II3 A;  3URY A;  3A7L A;  4IUU A;  4CKE A;  1H9R A;  4DR4 Q;  4HED A;  1TWH H;  4RA8 A;  1SYG A;  2F0M A;  1JWM D;  1WTX A;  2N49 A;  3NBI A;  3PQI A;  4PMW A;  2KJX A;  3M7G A;  4KY5 A;  3T51 B;  4BY7 B;  2K4K A;  2JA8 H;  3D6C A;  1KDB A;  1N33 L;  4A3B B;  1EIG A;  4KJN A;  1E2V A;  5EGT A;  2WP8 J;  4OX9 Q;  4BY7 G;  2NVY B;  3ZYY X;  2CWA A;  4LUV A;  3KLS A;  3GD7 A;  5EBC A;  2AHO B;  1D5M C;  2YU9 B;  4HTH A;  4ME3 A;  4NDX A;  4R8I A;  4EX5 A;  2NN6 H;  4A3D B;  5IYD G;  1W6K A;  4KKU A;  1HNZ L;  1ZKO A;  5ELC A;  4XT3 B;  1B3A A;  2F0J A;  4EQN A;  1CQV A;  3OWE B;  2A6H D;  3WOE A;  3HKZ G;  1LTR D;  2KBN A;  3S1Q H;  4IPD A;  3D31 A;  4DV6 Q;  1EUJ A;  3T13 A;  5JAV A;  3I4N H;  1RF2 D;  2YYZ A;  4LFC Q;  3GTP B;  1KTK A;  3TS2 A;  3CC4 A;  1SRU A;  2FFK B;  2EJF C;  3U4V A;  1RTO A;  2PYK A;  5J3B A;  1EOT A;  3ND8 A;  3F2U A;  4LFA L;  1A3T A;  4JI1 L;  3DLL A;  5HY6 A;  4JI3 Q;  3CCL A;  4DU9 A;  3SVM A;  3I56 A;  3HOU G;  2HHH Q;  3EN2 A;  1EU3 A;  1B50 A;  1XMQ Q;  2QGQ A;  5C44 G;  2D2C C;  1WD0 A;  3NXW A;  5EPJ A;  3HZX A;  1WTH A;  4AYB E;  1PYS B;  1K8M A;  1MI2 A;  4IUR A;  4BY1 H;  4RHS A;  1KHI A;  3FMC A;  1CSQ A;  5H1S E;  3NUC A;  3I90 A;  2JN4 A;  2CQO A;  1DZ1 A;  1ROD A;  1STY A;  4DGZ A;  2SNM A;  1G51 A;  3IRB A;  1I4Q A;  3I4O A;  3RLN A;  4JI6 Q;  1I94 Q;  4OL7 A;  3SK4 A;  1PTO H;  4RMF A;  2NTS A;  3F2D A;  2I07 B;  4ME5 A;  2XRS D;  1VQ5 A;  1VQ8 A;  1SMX A;  1ENC A;  3A8J E;  4KY7 A;  1IXR A;  2Z9H A;  4A3M G;  4NKL A;  2HIV A;  4RH6 A;  3PUW A;  2E5L L;  2SOB A;  1W2B A;  3PO2 B;  1Y1V B;  4G57 A;  3M4Y A;  3OTO L;  2N55 A;  2EZV A;  2F52 A;  4A3D H;  2IX1 A;  4FF1 A;  2NWG A;  2XGT A;  1KDC A;  1Q7Y C;  1PA6 A;  3GTG B;  4N9P A;  4KKT A;  3TME A;  4PMB A;  5D3D A;  2RCF A;  1Y1V G;  1Q90 A;  1F2L A;  3D6W A;  3L0O A;  1AZQ A;  2HCC A;  1CKO A;  4DUY Q;  2O5J C;  2JA7 B;  3FHW A;  4X3S A;  5AJ3 L;  2PMZ E;  2YTY A;  3HOZ B;  4DR7 L;  4LK1 C;  3EA6 A;  4TKO B;  2KED A;  2ZXO A;  5M5X H;  1Z47 A;  5JPM C;  5IT9 E;  2QEJ C;  3HOY B;  2JA7 G;  2NZO A;  4KHP Q;  4C3H G;  5IGE A;  4F88 A;  3S17 H;  1OTC A;  1LT5 D;  2AWN A;  5DAU A;  2QIL A;  4FP5 D;  1VQJ A;  3CRL C;  5EAY A;  1FJG L;  1YJ9 A;  2VB2 X;  1E3P A;  4LFB L;  2ASB A;  4RWS C;  3PO2 H;  4DAP A;  5HGT A;  1QB5 D;  3P1H A;  1UE5 A;  4HR7 B;  3M3Y H;  1Y8N B;  3GDE A;  2F0F A;  1PFN A;  3STB C;  2VNU D;  1PTO B;  1I3Q B;  3HOW H;  2MPM A;  4KJO A;  3GQB A;  3ICE A;  2H1E A;  4JVZ A;  4UP7 A;  4OO1 H;  1GUN A;  2RVL A;  1C8C A;  1STG A;  5EJW A;  4JI0 Q;  1EZ6 A;  2F0H A;  4LF5 Q;  3CCJ A;  2RCN A;  3BVG A;  2E2J B;  3RMH A;  1BCP C;  4IOC A;  3I4M H;  1TWC H;  2MFI A;  3D3R A;  1JE5 A;  4A93 H;  2JSO A;  3CCE A;  5KNC A;  5IYC G;  3UDX A;  4BBR H;  2PQA B;  2G9H D;  1K8O A;  3GV6 A;  2Q2H A;  1NY4 A;  2ZM6 Q;  4A93 B;  1D7Q A;  4C1N K;  2JA9 A;  3W2D A;  4BXX H;  1HQR D;  3H91 A;  4JI2 L;  1KXL A;  3K7A H;  5DNF A;  3AFP A;  1VQI A;  4FXK C;  2F0O A;  3V05 A;  1Y8P B;  5A35 A;  3K80 C;  1TVX A;  1LLR D;  1YNJ D;  2A69 D;  3I55 A;  1X3P A;  3WOF A;  1GHJ A;  5IWA L;  1X3F A;  4AYB G;  1ICW A;  5BN4 A;  2TSS A;  5IP7 H;  3GTP H;  3JAM L;  3T1H L;  4AQY Q;  2JJQ A;  2N78 A;  5I9O A;  3S1Q B;  1LV9 A;  3KLW A;  2UUB Q;  1HCZ A;  4R4Q A;  2JEA I;  1CM9 A;  4RGO S;  1N36 L;  1YNN C;  1C7Y A;  1GUT A;  1NUC A;  3LNN A;  4LF9 L;  3CMA A;  1AP0 A;  1VQD A;  1YHB A;  3FKI H;  4JYA L;  2YV5 A;  4DFA A;  4IJL A;  1X56 A;  2RQX A;  1DOL A;  4K5V A;  3BDO A;  2G5D A;  3KOJ A;  1HZA A;  4X3K A;  1CI3 M;  1LTG D;  3OOC A;  4QCL A;  4DUY L;  1VMP A;  5JOB A;  3DXJ C;  1V1O A;  4DR7 Q;  4DUZ Q;  2EY6 A;  2KHI A;  2AUJ D;  3J7A V;  2F0V A;  2OT2 A;  3TSS A;  2K7V A;  4BS9 A;  2RA4 A;  1UE7 A;  4X66 L;  3IKJ A;  2CH4 A;  4GNX C;  2SDF A;  2NUC A;  2F0Q A;  4XIG S;  1YBY A;  2SEB D;  4O42 A;  4OON A;  2PQA A;  5JJZ A;  1M1K C;  1MJC A;  3T16 A;  4YHH L;  4IJH A;  5IP9 H;  1VQG A;  3HOY G;  4L5S A;  3G48 A;  4QL5 A;  5E1F A;  3T56 B;  4B3T Q;  3I72 A;  1IZ6 A;  2K75 A;  2F0P A;  5C4Z A;  5CC4 A;  2VUM G;  1WTP A;  2LSS A;  1A63 A;  1SLJ A;  3OTO Q;  1KAB A;  3S15 H;  2Z8L A;  3L3O C;  1FJG Q;  3X3N A;  4XQQ A;  1HNX L;  1XTD A;  1GOZ A;  2JQO A;  4PMC A;  5LMN L;  1PZI D;  4KTA A;  1UUP A;  3S2D H;  2R7Z B;  5EQ0 A;  1GD7 A;  3U9O A;  4B9W A;  3HOX H;  3GTO B;  2DJF C;  1IBK Q;  1KRT A;  4JC0 A;  3KDF A;  3DWQ A;  3NK9 A;  1YVC A;  1Q8K A;  2E2I B;  4DV3 Q;  3CAM A;  4DR6 L;  3I2Z A;  1D1I A;  1QOH A;  1HR0 Q;  4A3K H;  4U67 3;  1TWF B;  4HIO A;  2MUY A;  4DR1 Q;  3S2H B;  3LX0 A;  4JI1 Q;  5HUR A;  2ZTE A;  1FGU A;  1EQQ A;  2HUG A;  2OWO A;  2HHH L;  1VS0 A;  2R7D A;  4MZ9 A;  1B4O A;  5A2Q E;  4XT1 B;  1WD1 A;  1HUM A;  3H3V H;  4Q0F A;  3RLF A;  2N88 A;  4NXM L;  2E2J H;  2K03 A;  1WOC A;  4ZRZ A;  2JK8 A;  2L1B A;  1SMY C;  2VB3 X;  1PH8 A;  1K0R A;  4KN7 C;  5ELO A;  4BWG B;  1NCV A;  2PQE A;  3C1F A;  4B3R Q;  3M3Y B;  1RL2 A;  1IYV A;  3BZD B;  3CHB D;  4HJ9 A;  2I5H A;  4CDE C;  5C0X I;  5C4X H;  2JA5 B;  4A3F G;  1WCM G;  4A3I H;  2B63 B;  3T53 B;  1DOK A;  5FLM G;  1Y69 U;  1O7I A;  5M3F G;  2JA8 G;  4YCW A;  1KIX A;  1STN A;  4ZUI A;  2FIN B;  5A2Q L;  1MKH A;  2BE5 D;  4BBS G;  5JEA G;  1S5F D;  1C0A A;  3QJY A;  1IW7 D;  4BY7 H;  4QMG A;  1GO3 E;  2ZTC A;  1A8V A;  4QGU A;  4X66 Q;  3HKZ E;  5KIX A;  5G3L F;  3HOZ H;  2NN6 G;  5E4X A;  5FOB B;  1SYB A;  3VR3 A;  2FXQ A;  1XWE A;  4DNT B;  2CFM A;  4EQP A;  5LL6 X;  5JVH 3;  1VQA A;  2K33 A;  3A54 A;  4JI5 Q;  1T5X D;  1YJN A;  2PW7 A;  4OIK A;  1U4P A;  3B6Y A;  3D4W A;  4ALP A;  3BVM A;  1ONL A;  1EL0 A;  4RCN A;  1LTB D;  2CW0 D;  2EYH A;  2BH2 A;  4M1U B;  4DV7 L;  2ZJP A;  3HOU H;  3MXG A;  4NB3 A;  2A68 D;  2VY3 A;  1QZG A;  1F2Z A;  3H6M A;  1VQF A;  5C4H A;  5C3W A;  3TZD A;  5JEA J;  4YHH Q;  1XPU A;  5C0X H;  2K04 A;  1BBX C;  5EKI A;  3T4A C;  1I94 L;  2WB1 G;  4I7A A;  4DV4 L;  4FXD A;  3ULP A;  2B63 G;  1VQP A;  1ZXT A;  3OW7 A;  3E5S A;  4CDF C;  1HNZ Q;  2FMC A;  4XYQ A;  1Y14 B;  1N36 Q;  1B3Q A;  4V0B A;  3V96 A;  3SDZ A;  3M85 A;  4KMU C;  3RD4 A;  4A3K B;  1Q82 C;  2NBF A;  3BS1 A;  2JEB I;  2LXJ A;  4O2D A;  1LAB A;  1J5E L;  4MN3 A;  1K3R A;  1PMR A;  2HT1 A;  3NSW A;  3S1M B;  4FDB A;  1JJG A;  4OHJ A;  1X3Q A;  2QF7 A;  3KF8 B;  3GTM B;  1PFM A;  2WII B;  3BG3 A;  3KYH C;  3UE0 A;  1TU2 B;  5F2D A;  1BR9 A;  5JVG 3;  1SDF A;  3KF6 A;  4FXG C;  1FD7 D;  5BN3 A;  4HMJ A;  5KYL A;  4XQN A;  3GTL H;  1BVS A;  3CCU A;  2WAQ B;  2O5I C;  3CCV A;  1KNA A;  1YI2 A;  3VYT A;  1I4H A;  3PO3 G;  3CPF A;  4WOR A;  1BKB A;  4GNX B;  4DF7 A;  3S1R H;  1PH1 A;  1IBL Q;  3J7A F;  3OIP A;  1L0Y B;  2JA7 H;  5CBA E;  4LF4 L;  1OO9 B;  3VR2 A;  1VQO A;  4ODG A;  4C3H H;  1WTV A;  2PNH A;  2OTL A;  2F4V L;  1Q1B A;  3K59 A;  5FO8 B;  5CV4 A;  1TWA H;  2K5D A;  4K2K A;  1D1K A;  2HQL A;  1VQK A;  1X3G A;  3NTK A;  5DM7 3;  4RGM A;  3AMU A;  3OWF A;  2K50 A;  1RDP D;  4RGN A;  3S24 A;  4FF4 A;  2ES2 A;  2KCT A;  5J39 A;  2A19 A;  1BBU A;  5M5W B;  3K0X A;  2A6E C;  5C3X A;  2ID0 A;  1N9W A;  1HNW L;  3AU7 A;  2F0U A;  3FRP B;  4YWK A;  1A2T A;  3OSO A;  3SR1 A;  1K3B C;  2B39 A;  1G91 A;  2EJM A;  4IOA A;  3MFG A;  3IFT A;  3M9B A;  4IPH A;  3SK5 A;  2JA5 H;  5C4X B;  4APV A;  3QIA A;  3OPO A;  3UDI A;  2UXD Q;  2ZT9 C;  4GLA C;  1I4P A;  4QF4 A;  4A93 G;  2DGY A;  3MEF A;  4LF5 L;  1UEB A;  5IYC H;  4C3H B;  4J1M A;  1LTS D;  2KCN A;  3CQZ B;  1ILP A;  3R2T A;  1R4Q B;  1JC7 A;  2N3S A;  1SSO A;  1I5F A;  2JYO A;  2Z0S A;  5GAH C;  3EIV A;  4LF8 L;  1UE6 A;  1ZEQ X;  2WKD A;  2DNE A;  3H94 A;  2PI2 E;  4GS3 A;  3NBH B;  1JOR A;  4X6A H;  4C2M H;  4YCV A;  1JR0 D;  2IT1 A;  3GTL B;  3RZD H;  3PCO B;  5C44 B;  4HIM A;  2WB1 E;  2MJ8 A;  1RJT A;  1E24 A;  1TS3 A;  1JJ2 A;  2K5V A;  4JV5 Q;  3A74 A;  3HFZ B;  4UHV A;  2E2I H;  3Q23 A;  3C46 A;  4EVO A;  3GTM H;  2KA7 A;  2I0Q A;  3GTO H;  3TRE A;  1S5B D;  1X65 A;  2F0D A;  4K6D A;  2DJG C;  1PH2 A;  1VQL A;  4LF6 Q;  1HTP A;  2VW9 A;  1T5E A;  1SEB D;  1U4M A;  3EJI A;  2V1C C;  3IL8 A;  3U58 A;  1U9R A;  4XYO A;  1SFO H;  3KDF B;  3R8B A;  2ZJQ A;  5IGB A;  1SNQ A;  1K8G A;  1SNO A;  3DM1 A;  1LT6 D;  2MP1 A;  4DK1 A;  2A8V A;  4JI8 L;  2K6A A;  1VQM A;  4CGY B;  2EJG C;  1Q3L A;  1VQH A;  5EBD A;  2MO1 A;  1T9H A;  1YNN D;  4MTN A;  4DNR B;  4R9W A;  3J80 c;  3KF6 B;  1EYD A;  2F0E A;  3VYU A;  1LO5 D;  1EU4 A;  1QNU A;  5ISR A;  1EIF A;  1PH4 A;  1G29 1;  3K58 A;  5C0X J;  1O7L A;  2A73 B;  4Y7N B;  2VZA A;  3CCM A;  3OW2 A;  1TII D;  3MXP A;  1B1Z A;  4AQY L;  3DEO A;  3S16 B;  1H9K A;  3PIO 3;  3J7Z C;  1QUQ B;  1L1O C;  2UUB L;  1SYF A;  3DM3 A;  3A7A B;  1A0I A;  2EDG A;  5FO9 B;  1YNX A;  5LMN W;  3NEL A;  1XNR L;  2WB1 B;  4OWX B;  3ONA B;  4GLV B;  1WCM B;  2KEC A;  2M00 A;  1U4L A;  2PCF B;  1V43 A;  4GZY C;  1MSG A;  3ERO A;  4DPG A;  2NB0 A;  3I3C A;  5M3F B;  1VQ9 A;  1W6J A;  2LMC B;  4DA2 A;  3E3X A;  1J6Q A;  3Q0A A;  4A3L G;  4JI7 L;  3RN5 A;  1X32 A;  1H9S B;  3CC2 A;  2HDM A;  4G4K A;  1SJH D;  4DK0 A;  5IGG A;  2B2T A;  2H5X A;  1LYL A;  2AUK A;  3D4R A;  1HR0 L;  1I6H H;  4TVA B;  3VYR A;  1EZ8 A;  1FL0 A;  3TP5 A;  1YZ6 A;  2V4D A;  3ULL A;  3BZC A;  3KLS X;  2ICE C;  3TRZ A;  1EYA A;  3HOX G;  3J81 c;  1AW7 A;  2I5L X;  1CK1 A;  5IGD A;  3I70 A;  2EYO A;  3HOV B;  4TQU S;  1CQF A;  3SK6 A;  1CTM A;  4DR5 Q;  4ID6 A;  3K8A A;  2JXM B;  4R8N A;  2R92 B;  1BCP D;  4ZCK A;  4JI6 L;  1LUZ A;  4HSP A;  2LKV A;  3TEH B;  1A62 A;  3GTQ H;  1E0B A;  1VF7 A;  4X62 Q;  3CP0 A;  4J6H A;  1P16 A;  1LM0 A;  2OXP A;  2DN8 A;  1YHQ A;  4IPC A;  1FNV A;  2B3G A;  4OX9 L;  4CJ1 B;  3PF4 A;  1R4P B;  3RZO H;  4HN7 A;  2L9H A;  4KV6 A;  3VYS A;  4QUF A;  1PRT F;  3KJO A;  2MHV A;  4DK3 C;  1I50 B;  2VXW A;  4J15 A;  4DXF A;  2IHF A;  3MHB A;  4RAU C;  4LJZ C;  2LY7 A;  4IPG A;  4R4I A;  2P5Z X;  1V1Q A;  4LMQ D;  3M7N A;  2RF4 A;  5JEA H;  4FVM A;  1I3Q H;  5DLQ E;  5IYB H;  1M8A A;  2WKC A;  4B9X A;  1I4X A;  4POF A;  2Z4I A;  4FO2 A;  1E2Z A;  1EQR A;  5C44 H;  1WJJ A;  1BXT A;  2JE6 I;  1QZH A;  1KC8 C;  3JAM E;  2Q2I A;  1MSH A;  4HJ8 A;  4UY8 C;  3K5M A;  1E1T A;  2Z6K A;  1PTO D;  4C3I B;  4A3C G;  2K32 A;  4WJ3 M;  1X9N A;  1U0L A;  3LGJ A;  2PO4 A;  4RGT A;  1MBY A;  1SJE D;  3CC7 A;  1A3V A;  2EY1 A;  1LT4 D;  5D3I B;  4R4O A;  5FJ8 H;  1Q86 C;  1JE4 A;  1CKN B;  2RDG A;  5E3F A;  3KFU A;  3FVQ A;  2R93 H;  5GRO A;  3EVQ A;  1A3U A;  2FMM A;  2JA8 B;  5IY0 A;  3S9W A;  4JI5 L;  2L4N A;  1LTI D;  4NPS A;  1SND A;  5EKL A;  1JOO A;  3NQI A;  4JK1 C;  1L0X B;  1R9T H;  1D2B A;  4IFD G;  4A4I A;  2XVS A;  3AFQ A;  1WTW A;  4MHE A;  2PPB C;  1F2Y A;  3I73 A;  5EPK A;  4XQJ A;  2GA4 B;  2GVA A;  3H0G G;  3J81 E;  2K5Q A;  2CVR A;  3BDC A;  4ZKC B;  2JA6 H;  2PZW A;  3KBX A;  4A3F B;  1GXD C;  4IUP A;  1R9T B;  2B63 H;  3KLR A;  3C2P A;  2IW3 A;  3K6O A;  3CD6 A;  1O80 A;  4A3J H;  2F0T A;  4DR2 Q;  1P8L A;  1F9S A;  4K2L A;  1N32 Q;  1UAP A;  1WI5 A;  3S16 H;  1QE6 A;  4LF9 Q;  5ELN A;  2NZH A;  3NEM A;  1SE3 A;  2BOS A;  1K28 A;  2CCZ A;  3T1Y L;  4GN4 B;  4GKJ L;  1TWG H;  2B2Y C;  4M8A A;  3CCQ A;  4B3S Q;  4JI8 Q;  1NAP A;  2KEN A;  2XSC A;  1IKL A;  4C3J G;  4OWT B;  4PQX A;  1TQO A;  2QDL A;  1DGS A;  2EY5 A;  4K5X A;  3H3V I;  2IJ0 A;  1GHK A;  1V1P B;  1PRT D;  1WTR A;  2QA4 A; 
#chains in the Genus database with same CATH homology
 2I46 A;  3MVV A;  1STE A;  1HTL D;  1EY5 A;  1TR5 A;  3EFX D;  1TY0 A;  3Q6S A;  3PO3 B;  2J7Z A;  3S2D B;  2D5D A;  2EPB A;  4LAA A;  4NW2 A;  3VA5 A;  3U9S A;  1EWH A;  2PMZ B;  1TS5 A;  2A69 C;  3P75 A;  1AN8 A;  1HFN A;  2A74 C;  5I6W A;  1JWU D;  5KGU A;  3C3L A;  3S15 B;  3J80 L;  4HSV A;  5I2X A;  5M3M B;  2HDL A;  1GJX A;  4C2M B;  1HHV A;  1Q8I A;  1JOQ A;  4WJW A;  1GUS A;  2IWH A;  2D62 A;  3WDN A;  4KI0 A;  1Q1E A;  1F9P A;  1MGS A;  3KUP A;  5CV5 A;  2CHB D;  3QOJ A;  1F9R A;  3TP8 A;  3J80 E;  1CT1 D;  4KHZ A;  1NR2 A;  4CJ2 C;  1F2M A;  1I4G A;  2RDF A;  3IAY A;  3ITP A;  3NPP A;  5M9O A;  1WTO A;  1CFM A;  3SEB A;  4C3I G;  2F0G A;  1EY8 A;  3ND9 A;  2BCO A;  3S17 B;  1VMC A;  2F0I A;  1EY6 A;  3LWE A;  5IIF A;  5KND A;  3Q22 A;  2AWO A;  3K5N A;  3H3V C;  4J8Q A;  1DM0 B;  3FKI B;  2L5T A;  2XIW A;  5DEH A;  5CMD A;  1BF4 A;  4AYB B;  4CHT B;  5COY A;  3P7J A;  1G2T A;  1KDA A;  5I6Y A;  5FLX E;  2B2W C;  1BQQ T;  4NMZ A;  4KD4 A;  1IL8 A;  1O7Z A;  2K05 A;  2L11 A;  2ZXP A;  3M4O B;  5FKA C;  2EXZ A;  1G8Z D;  1ESR A;  1EY7 A;  1DYQ A;  4BBS B;  2RKS A;  4B08 A;  2L55 A;  4KY6 A;  3QG1 A;  5I9P A;  4A3M B;  3GTK B;  2CW0 C;  2G9D A;  4NP5 A;  4TRD A;  2SNS A;  1D5X C;  5KEE A;  1PRT C;  4QB4 A;  3I4L A;  3MFY A;  2EYM A;  3RZO B;  1S5E D;  5I2Y A;  1PDQ A;  1TWC B;  1SNP A;  1SYC A;  3RUZ A;  2NTT A;  4ABN A;  1B2T A;  1OXX K;  2D9U A;  2B2U A;  4F7X A;  4ZKB B;  1CHQ D;  1S4Z A;  5LHY 1;  3MA2 B;  4TSS A;  1JB3 A;  2BA0 A;  1J9O A;  1ET6 A;  2FHT A;  4RCO A;  1JOK A;  2KHS A;  3TDQ A;  3GTJ B;  3H0G B;  2L0C A;  3MWY W;  3HGB A;  2HQE A;  2QCP X;  4I7Z C;  3NTH A;  2KEE A;  5AFW A;  3I8Z A;  1PLF A;  2KUM A;  2LFN A;  3MXU A;  2X69 A;  4H7B A;  1EY4 A;  4KK7 A;  1KLG D;  5KYI A;  2K5W A;  4EQO A;  4N9T A;  3BYY B;  5KNB A;  3PIP 3;  3OMG A;  1CA6 A;  4ULL A;  4A3J B;  1WTQ A;  1I6V C;  4O1N A;  5ELF A;  1EY9 A;  1RTN A;  3GV3 A;  3D4D A;  2NVQ B;  5T1G A;  2F4I A;  3DEP A;  1C4Q A;  2Q8T A;  1RCV D;  3MTS A;  5D65 A;  2ENB A;  2ZXR A;  1CA5 A;  4H44 C;  3MAQ A;  1ESF A;  3MC0 B;  4P2C B;  1MD2 D;  4U68 A;  3DMU A;  2J0T D;  2IX0 A;  2EYL A;  2R93 B;  1GUO A;  4HAE A;  3VA7 A;  3S14 B;  1QIL A;  1FGB D;  2F0L A;  2E75 C;  3TP6 A;  1SNC A;  3X3M A;  2NN6 I;  2EYP A;  4PV1 C;  5IOD A;  2R61 A;  5CV7 A;  4C3J B;  3CKI B;  4G7H C;  3TBI B;  1XXG A;  2E74 C;  1QG7 A;  1JCK B;  3HKZ B;  2NVT B;  1EIH A;  5KRU A;  1NR4 A;  1SFO B;  1B44 D;  5C0X G;  2KOL A;  1OXS C;  5C3E B;  5EPL A;  3J81 L;  5K5P A;  3PUV A;  1BCP B;  4RHR A;  2F1M A;  1A2U A;  3W3A A;  1STH A;  5E4W C;  1ENF A;  2RSN A;  2Q8I B;  3A8K E;  3UI2 A;  1J8I A;  4JBW A;  3FDT A;  1BCP F;  5J22 A;  1A6X A;  2OF1 A;  3J7Y W;  5CR3 A;  2B8G A;  1YNJ C;  4WRD A;  1UNS A;  3VR5 A;  2Z4H A;  4IFD J;  1V8Q A;  4H0L C;  1F77 A;  2L12 A;  4K14 A;  4RKB A;  1LAC A;  5EKK A;  3AB9 A;  2F0N A;  5FO7 B;  4A3G B;  1HA5 A;  4IQZ A;  1Z7T A;  2C5C A;  3MEH A;  2EY2 A;  2JA6 B;  2B8F A;  4DAV A;  1OXV A;  1KNE A;  3K57 A;  1H9S A;  3BVZ A;  2AQ2 B;  1BDO A;  4G7O C;  4KN4 C;  4IZ8 A;  1PZK D;  4Z9C B;  2BA1 A;  2PNR C;  4ZLT F;  4A3E B;  2B2Y A;  4FF3 A;  1KAA A;  5ELE A;  2J4X A;  3G6J B;  2B2U C;  1VF5 C;  2PZT A;  4L63 B;  2HCI A;  2ICI A;  3EQL C;  4CBV A;  3S1R B;  1HXY D;  4K8J A;  1NSN S;  3FPP A;  2O4X A;  4DXG A;  4Q5V A;  3GO5 A;  1IKM A;  1SYE A;  4S3S A;  4RKL A;  1LT3 D;  1TS2 A;  1DON A;  1VCI A;  2H4O A;  1SMY D;  1E2W A;  4X3U A;  2A6H C;  5K36 G;  4F87 A;  1DOM A;  3SE0 A;  5M5Y B;  4FF2 A;  3K7A B;  4L8J A;  1Y1W B;  2TMP A;  2OEO A;  3ERQ A;  1AFP A;  4OGQ C;  1IW7 C;  1PTO F;  3TP7 A;  5FLX L;  3I91 A;  1GUW A;  1HFG A;  1PRT B;  3PMF A;  5CV8 A;  1TKW B;  3PUY A;  3I4M B;  4OIJ A;  3VR6 A;  1OXU A;  2A6E D;  2K01 A;  1ML0 D;  5C4J B;  2Y0S B;  4E6I A;  2AQ1 B;  4BA2 I;  3FPU B;  1ENA A;  1B9M A;  3FEW X;  5G3L D;  3A56 A;  1QWY A;  1SYD A;  3KBG A;  2EYF A;  2FJ2 A;  1TT2 A;  1LTA D;  3D8G A;  4QUC A;  1A15 A;  5COR A;  1VDZ A;  5C5M A;  1ILQ A;  5CYU A;  3E0J A;  4QIW B;  4IFD I;  1TY2 A;  4KD3 A;  5CGK A;  1I6H B;  1SE4 A;  4XDX A;  1SXT A;  2M9V A;  4CKC A;  4X3T A;  5IOC A;  1STB A;  1WVL A;  4L6T B;  2XNA C;  4IUN A;  1PXU A;  2EYJ A;  1STA A;  1EFI D;  2F3W A;  3DWA A;  2E76 C;  3MZ5 A;  5CV6 A;  2E2D C;  1KLU D;  1TS4 A;  4UDU C;  1DXM A;  2EOT A;  1TWH B;  2NVX B;  1CZW A;  1QJO A;  3L7Z C;  5DM6 3;  1C48 A;  4IUQ A;  4C1N I;  1BUV T;  3N52 A;  1HA6 A;  2KCC A;  2RDH A;  3NE5 B;  4K5W A;  3NBH A;  3GP7 A;  2Q8R E;  1EYC A;  1S5C D;  1FNU A;  2DY7 A;  1FR3 A;  1OXT A;  1ZYR D;  2A68 C;  4I65 A;  5ELB A;  3KK7 A;  4ZK9 B;  3QO2 A;  3VR4 A;  4ZQ3 A;  2X6G A;  4HMI A;  3CRK C;  4BY1 B;  1IYU A;  1JQY D;  4CKB A;  1DJR D;  3BDL A;  1ZYR C;  1D5Z C;  1SBB B;  3RZD B;  5CV9 A;  3NP8 A;  2PW5 A;  4DAY A;  1PYW D;  2F0S A;  3TZU A;  2JP1 A;  5IT9 L;  3HOX B;  1ET9 A;  3A8I E;  3G7L A;  4DN4 M;  1RKN A;  5C5L A;  2BDN A;  1XX8 A;  4IUT A;  1HUN A;  3I4N B;  3QB3 A;  1QCB D;  1F9Q A;  1HQM C;  1B9N A;  2IPK D;  5FK9 C;  3DUZ A;  1HRJ A;  3SHL A;  2XWJ B;  3HOU B;  4BA1 I;  1O7Y A;  4XTC S;  2QKI C;  4OO1 I;  3HS0 C;  2O2L D;  2BDO A;  2NYZ D;  2NZ1 D;  5T1I A;  4ILW A;  3TN2 A;  5CBE E;  1D6E C;  1TWA B;  1EQT A;  4K6L A;  1V1P A;  2QDB A;  2C9O A;  4PNY A;  4HCE A;  1XYI A;  3P20 A;  3NQT A;  4IFD H;  3NHH A;  1UEA B;  2R3Z A;  4IN3 A;  2RBM A;  2CQA A;  3HRZ C;  2B2V A;  3K5L A;  3DHQ A;  4F8M A;  5J1Z A;  4IUV A;  1PZJ D;  2MGS A;  1BO0 A;  1LTT D;  3LWU A;  2F0W A;  1M4V A;  1B53 A;  1EQV A;  1CHP D;  5C6A A;  5I4D A;  4FYD A;  2BE5 C;  1RD9 D;  4KHV A;  1FNW A;  5IGF A;  1XTC D;  2R6G A;  2WIN B;  1CZG A;  2B2T C;  3NWT A;  4EGV A;  1FYC A;  1Q12 A;  3NTI A;  1BOS A;  4OO1 G;  2IL8 A;  3MXN A;  4BBR B;  1U4R A;  4WFN 3;  3A55 A;  2F3V A;  2X6L A;  5BN5 A;  3HP3 A;  3SXH A;  1O78 A;  3GTQ B;  1H9J A;  1IHZ A;  1SE2 A;  3HOW B;  1PTO C;  2B2V C;  2F03 A;  2EVB A;  3N6R A;  2F0K A;  1BNZ A;  4ZAI A;  2WAC A;  4H13 C;  1PFB A;  2K1B A;  4XXE A;  2Z1C A;  5D14 A;  3Q24 A;  3R93 A;  1K83 B;  3HEJ A;  4YIJ A;  2B2W A;  3O13 A;  1JWS D;  2KQ3 A;  5ELD A;  5M5X B;  4CJ0 B;  1HPC A;  1AZP A;  3V2T A;  2WV6 D;  2AQ3 B;  3OHX C;  1QNK A;  1G2S A;  2KVM A;  1RHP A;  4UAI A;  1S5D D;  1SNM A;  4K8I A;  4RFB A;  3C1E A;  3E6Z X;  3PV0 A;  1I4R A;  2A5H A;  5K36 H;  1GUG A;  5JPN C;  2DY8 A;  3K0Y A;  5TSS A;  3CU7 A;  2M2L A;  4A3I B;  3DWP A;  3QOL A;  3R2I A;  4IAL A;  4C56 C;  2E2H B;  3OMC A;  4KKS A;  3PUX A;  1EEI D;  4G7Z C;  3QWN A;  4MIU A;  2DNC A;  4V19 0;  3L9A X;  1JIC A;  2LS0 1;  2PZU A;  2RSO A;  2IX3 A;  5NUC A;  5IGC A;  2K28 A;  3PUZ A;  3BYT B;  1DCZ A;  1G6Z A;  3SK8 A;  2XRQ D;  2VUM B;  3H09 A;  4ZYS A;  1TWG B;  1SAP A;  3NWS A;  1H9M A;  1EWC A;  3KF8 A;  5LL6 S;  2XWB B;  1Y8O B;  3IFD A;  1Z6H A;  2XN9 C;  3K5O A;  1AEX A;  3OIQ A;  3HG9 A;  2EE1 A;  1EY0 A;  1DD2 A;  3S1N B;  3R3O A;  4HCS A;  4ZUJ A;  1EEF D;  4FNF A;  1II3 A;  3URY A;  3A7L A;  4IUU A;  4CKE A;  1H9R A;  4HED A;  4RA8 A;  1SYG A;  2F0M A;  1JWM D;  1WTX A;  3NBI A;  4PMW A;  2KJX A;  3M7G A;  4KY5 A;  3T51 B;  4BY7 B;  3D6C A;  1KDB A;  4A3B B;  1EIG A;  4KJN A;  1E2V A;  5EGT A;  2WP8 J;  2NVY B;  3ZYY X;  3KLS A;  3GD7 A;  5EBC A;  1D5M C;  2YU9 B;  4HTH A;  4NDX A;  4R8I A;  2NN6 H;  4A3D B;  1W6K A;  4KKU A;  1ZKO A;  5ELC A;  4XT3 B;  1B3A A;  2F0J A;  4EQN A;  1CQV A;  3OWE B;  2A6H D;  3WOE A;  1LTR D;  3D31 A;  3T13 A;  5JAV A;  1RF2 D;  2YYZ A;  3GTP B;  1KTK A;  2FFK B;  2EJF C;  1RTO A;  2PYK A;  1EOT A;  3ND8 A;  3F2U A;  1A3T A;  4DU9 A;  3SVM A;  1EU3 A;  1B50 A;  2D2C C;  1WD0 A;  3NXW A;  5EPJ A;  3HZX A;  1K8M A;  1MI2 A;  4IUR A;  4RHS A;  3FMC A;  3NUC A;  3I90 A;  1DZ1 A;  1ROD A;  1STY A;  4DGZ A;  2SNM A;  1I4Q A;  4OL7 A;  3SK4 A;  1PTO H;  2NTS A;  2I07 B;  4ME5 A;  2XRS D;  1ENC A;  3A8J E;  4KY7 A;  4NKL A;  4RH6 A;  3PUW A;  2SOB A;  3PO2 B;  1Y1V B;  3M4Y A;  4G57 A;  2N55 A;  2EZV A;  2IX1 A;  4FF1 A;  2NWG A;  1KDC A;  3GTG B;  4N9P A;  4KKT A;  3TME A;  4PMB A;  5D3D A;  1Q90 A;  1F2L A;  3D6W A;  1AZQ A;  2HCC A;  2O5J C;  2JA7 B;  4X3S A;  3HOZ B;  4LK1 C;  3EA6 A;  4TKO B;  2KED A;  2ZXO A;  1Z47 A;  5JPM C;  5IT9 E;  2QEJ C;  3HOY B;  4C3H G;  5IGE A;  4F88 A;  1LT5 D;  2AWN A;  5DAU A;  2QIL A;  3CRL C;  4FP5 D;  2VB2 X;  4RWS C;  4DAP A;  5HGT A;  1QB5 D;  3P1H A;  4HR7 B;  1Y8N B;  2F0F A;  1PFN A;  2VNU D;  1PTO B;  1I3Q B;  2MPM A;  4KJO A;  3GQB A;  2H1E A;  4OO1 H;  1GUN A;  2RVL A;  1C8C A;  1STG A;  5EJW A;  1EZ6 A;  2F0H A;  3BVG A;  2E2J B;  3RMH A;  1BCP C;  3D3R A;  2JSO A;  5KNC A;  2G9H D;  1K8O A;  3GV6 A;  4A93 B;  4C1N K;  3W2D A;  1HQR D;  3H91 A;  5DNF A;  4FXK C;  2F0O A;  3V05 A;  1Y8P B;  5A35 A;  1TVX A;  1LLR D;  1YNJ D;  2A69 D;  1X3P A;  3WOF A;  1GHJ A;  1ICW A;  5BN4 A;  2TSS A;  3JAM L;  5I9O A;  3S1Q B;  1LV9 A;  1HCZ A;  2JEA I;  1CM9 A;  4RGO S;  1YNN C;  1GUT A;  1NUC A;  3LNN A;  1AP0 A;  4DFA A;  2RQX A;  1DOL A;  4K5V A;  3BDO A;  4X3K A;  1CI3 M;  1LTG D;  3OOC A;  4QCL A;  1VMP A;  5JOB A;  3DXJ C;  1V1O A;  2EY6 A;  2AUJ D;  3J7A V;  2F0V A;  2OT2 A;  3TSS A;  2K7V A;  4BS9 A;  2RA4 A;  3IKJ A;  2SDF A;  2NUC A;  2F0Q A;  4XIG S;  2SEB D;  4O42 A;  5JJZ A;  3T16 A;  5E1F A;  3T56 B;  3I72 A;  2F0P A;  5C4Z A;  5CC4 A;  1WTP A;  1KAB A;  2Z8L A;  3L3O C;  3X3N A;  4XQQ A;  1GOZ A;  4PMC A;  1PZI D;  4KTA A;  1UUP A;  2R7Z B;  5EQ0 A;  3U9O A;  4B9W A;  3GTO B;  3DWQ A;  3NK9 A;  2E2I B;  1D1I A;  1QOH A;  4U67 3;  1TWF B;  2MUY A;  3S2H B;  3LX0 A;  5HUR A;  2HUG A;  1B4O A;  5A2Q E;  4XT1 B;  1WD1 A;  1HUM A;  4Q0F A;  3RLF A;  2N88 A;  2K03 A;  4ZRZ A;  2L1B A;  1SMY C;  2VB3 X;  4KN7 C;  4BWG B;  1NCV A;  2PQE A;  3C1F A;  3M3Y B;  1IYV A;  3BZD B;  3CHB D;  5C0X I;  2JA5 B;  2B63 B;  3T53 B;  1DOK A;  1Y69 U;  1STN A;  4ZUI A;  2FIN B;  5A2Q L;  2BE5 D;  5JEA G;  1S5F D;  3QJY A;  1IW7 D;  4QMG A;  5KIX A;  5G3L F;  2NN6 G;  5E4X A;  5FOB B;  1SYB A;  3VR3 A;  1XWE A;  4DNT B;  4EQP A;  5LL6 X;  5JVH 3;  2K33 A;  3A54 A;  1T5X D;  2PW7 A;  4OIK A;  1U4P A;  3D4W A;  3BVM A;  1ONL A;  1EL0 A;  4RCN A;  1LTB D;  2CW0 D;  2EYH A;  4M1U B;  3MXG A;  2A68 D;  1F2Z A;  3H6M A;  5C4H A;  5C3W A;  3TZD A;  5JEA J;  5C0X H;  2K04 A;  1BBX C;  5EKI A;  3T4A C;  4FXD A;  1ZXT A;  3OW7 A;  3E5S A;  2FMC A;  4XYQ A;  4V0B A;  3V96 A;  3SDZ A;  3M85 A;  4A3K B;  4KMU C;  3RD4 A;  2NBF A;  3BS1 A;  2JEB I;  1LAB A;  4MN3 A;  1PMR A;  3NSW A;  3S1M B;  4OHJ A;  1X3Q A;  2QF7 A;  3GTM B;  1PFM A;  2WII B;  3BG3 A;  1TU2 B;  5F2D A;  1BR9 A;  5JVG 3;  1SDF A;  4FXG C;  1FD7 D;  5BN3 A;  4HMJ A;  5KYL A;  4XQN A;  2WAQ B;  2O5I C;  1KNA A;  3VYT A;  1I4H A;  4WOR A;  4DF7 A;  3J7A F;  3OIP A;  1L0Y B;  5CBA E;  1OO9 B;  3VR2 A;  4ODG A;  1WTV A;  1Q1B A;  3K59 A;  5FO8 B;  5CV4 A;  2K5D A;  4K2K A;  1D1K A;  3NTK A;  5DM7 3;  4RGM A;  3AMU A;  3OWF A;  1RDP D;  4RGN A;  4FF4 A;  5J39 A;  5M5W B;  2A6E C;  5C3X A;  2ID0 A;  3AU7 A;  2F0U A;  3FRP B;  1A2T A;  3OSO A;  3SR1 A;  2B39 A;  1G91 A;  2EJM A;  3MFG A;  3IFT A;  3SK5 A;  5C4X B;  3QIA A;  3OPO A;  2ZT9 C;  1I4P A;  4QF4 A;  4C3H B;  4J1M A;  1LTS D;  2KCN A;  3CQZ B;  1ILP A;  3R2T A;  1R4Q B;  1JC7 A;  1SSO A;  2JYO A;  1ZEQ X;  2WKD A;  2DNE A;  3H94 A;  1JOR A;  1JR0 D;  2IT1 A;  3GTL B;  5C44 B;  2MJ8 A;  1RJT A;  1TS3 A;  3Q23 A;  3C46 A;  4EVO A;  2KA7 A;  1S5B D;  2F0D A;  4K6D A;  1HTP A;  1T5E A;  1SEB D;  1U4M A;  3EJI A;  3IL8 A;  1U9R A;  4XYO A;  3R8B A;  5IGB A;  1SNQ A;  1SNO A;  3DM1 A;  1LT6 D;  2MP1 A;  4DK1 A;  2K6A A;  4CGY B;  2EJG C;  1Q3L A;  5EBD A;  1YNN D;  4DNR B;  4R9W A;  1EYD A;  2F0E A;  3VYU A;  1LO5 D;  1EU4 A;  1QNU A;  5ISR A;  1G29 1;  3K58 A;  5C0X J;  1O7L A;  2A73 B;  4Y7N B;  1TII D;  3MXP A;  1B1Z A;  3DEO A;  3S16 B;  1H9K A;  3PIO 3;  1SYF A;  3A7A B;  2EDG A;  5FO9 B;  2WB1 B;  3ONA B;  1WCM B;  2KEC A;  2M00 A;  1U4L A;  2PCF B;  1V43 A;  4GZY C;  1MSG A;  3ERO A;  2NB0 A;  3I3C A;  5M3F B;  1W6J A;  2LMC B;  4DA2 A;  3Q0A A;  1X32 A;  1H9S B;  2HDM A;  4G4K A;  1SJH D;  4DK0 A;  5IGG A;  2B2T A;  2AUK A;  3D4R A;  3VYR A;  1EZ8 A;  3TP5 A;  2V4D A;  3KLS X;  2ICE C;  1EYA A;  1AW7 A;  1CK1 A;  5IGD A;  3I70 A;  2EYO A;  3HOV B;  4TQU S;  1CQF A;  3SK6 A;  1CTM A;  4ID6 A;  2JXM B;  4R8N A;  2R92 B;  1BCP D;  4HSP A;  2LKV A;  1E0B A;  1VF7 A;  4J6H A;  2OXP A;  2DN8 A;  1FNV A;  4CJ1 B;  1R4P B;  4HN7 A;  2L9H A;  4KV6 A;  3VYS A;  4QUF A;  1PRT F;  2MHV A;  1I50 B;  2VXW A;  4DXF A;  3MHB A;  4RAU C;  4LJZ C;  2LY7 A;  4LMQ D;  3M7N A;  5JEA H;  4FVM A;  4B9X A;  1M8A A;  2WKC A;  1I4X A;  2Z4I A;  4FO2 A;  1E2Z A;  1BXT A;  2JE6 I;  3JAM E;  1MSH A;  3K5M A;  1PTO D;  4C3I B;  2K32 A;  2PO4 A;  4RGT A;  1MBY A;  1SJE D;  1A3V A;  2EY1 A;  1LT4 D;  5D3I B;  1JE4 A;  2RDG A;  5E3F A;  3FVQ A;  3EVQ A;  1A3U A;  2FMM A;  2JA8 B;  3S9W A;  2L4N A;  1LTI D;  1SND A;  5EKL A;  1JOO A;  3NQI A;  4JK1 C;  1L0X B;  1D2B A;  4IFD G;  2XVS A;  1WTW A;  4MHE A;  2PPB C;  1F2Y A;  3I73 A;  5EPK A;  4XQJ A;  2GA4 B;  3J81 E;  2K5Q A;  2CVR A;  3BDC A;  4ZKC B;  2PZW A;  3KBX A;  4A3F B;  1GXD C;  4IUP A;  1R9T B;  3KLR A;  3C2P A;  2IW3 A;  3K6O A;  1O80 A;  2F0T A;  1F9S A;  4K2L A;  1UAP A;  1QE6 A;  1SE3 A;  2BOS A;  2B2Y C;  4M8A A;  1NAP A;  2XSC A;  1IKL A;  4C3J G;  4PQX A;  1TQO A;  2EY5 A;  4K5X A;  2IJ0 A;  1GHK A;  1V1P B;  1PRT D;  1WTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...