4XXEA

Structure of agra lyttr domain in complex with promoters
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Transcription/dna
total genus 24
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xxeA00
4XYOA 4XQNA 4XYQA 4XQQA 4CBVA 3BS1A 4XQJA 4XXEA 4G4KA
chains in the Genus database with same CATH superfamily
3U9OA 4A75A 5A2QE 1Y8NB 2RCNA 4RFBA 1AZQA 2F0HA 4B9WA 2F0JA 2F1MA 4UP9A 5IE8A 4A93H 3OMGA 2F0WA 3MFYA 1WTQA 1EYAA 4RGNA 3CC7A 3TREA 4C1NI 4HIMA 3W3AA 4LF5L 2R7FA 1BCPB 2PI2A 1BOSA 4V190 1TQOA 4KD3A 3QO2A 4ID6A 2JA8B 1R9TB 1LLRD 2K05A 5GQOA 4IPDA 2HIXA 3I70A 4RHSA 2ATWA 1YNJC 3Q23A 4KJOA 5DLQE 2E76C 1HQMC 1IKMA 1RF2D 1UE7A 2YTYA 1H9SB 4I65A 1WYDA 4MZ9A 3S15H 3EIVA 5AJ3L 4DAYA 5C4XH 2KEDA 2EQSA 5AFWA 4C3HB 2IX1A 3CPFA 3GTLB 5IGDA 1Y1VH 3PF4A 1BBXC 1TT2A 3D4RA 5JOBA 4DXGA 1I50H 3GTMB 2ZJPA 4LF5Q 1D5XC 1HNXQ 4A3JB 1YNND 1IYVA 1S5ED 5IGFA 1K73C 1KDCA 2PW5A 1PXUA 1KHIA 2VS1A 3HOVB 1BCPD 5I6YA 4WJ4A 3S16H 4FXKC 4ZK9B 1E2VA 4A3BH 4GKJQ 4POGA 4GNXB 3CXCA 2L55A 5IGEA 2ZTDA 4PZ6A 2N55A 4DR6Q 1FGUA 1E2WA 3J80E 4OIJA 3SGIA 3FKIG 5TSSA 1VQJA 3IKJA 4K8IA 2M9VA 3AFPA 3QIAA 2KHSA 5FLXL 1SR3A 3GTOH 3A8KE 2B2UA 3KLWA 4EQ5A 4A3EB 2EDGA 1MJCA 4CBVA 1X6OA 3CPWA 1LT6D 1B9MA 5FJ8H 1WD1A 3CCUA 3BU2A 3R2IA 5BR8L 4ZLTF 3S14H 2FMMA 3E6ZX 3EROA 3IRBA 5ELNA 3PQIA 4RH6A 4ALPA 4MHEA 3PO3G 1CKNA 1LV9A 4GOPA 1K8GA 3QWNA 4A3CG 2BE5C 1NAPA 3I72A 5IT9E 3SK5A 4QCLA 2JEAI 4RHRA 3TP8A 3VA5A 1GO3E 2EXZA 4J6HA 3TZUA 1YNXA 4DR4Q 2WV6D 3GTQB 1F2MA 3K80C 3I4NG 4BA2I 2HCCA 3NWSA 5C0XH 3S1RH 3C1EA 2D62A 2FMCA 1VQLA 1JJ2A 1CT1D 3NTKA 3HGBA 1Z9FA 3LX0A 4YHHQ 4OELB 1CI3M 1W2BA 1CKNB 4IFDJ 1U9RA 4GOPB 3H09A 3SK4A 2JXMB 3J7A5 4A93B 2KA7A 2HHHL 4G7ZC 2PZWA 2VXWA 4QY7A 3GQBA 2RDHA 1I4QA 1JWMD 4DV3L 4DPGA 1NMFA 3U4VA 4N8FA 1EY8A 5LL6X 1HFGA 2C9OA 3K5OA 4HIDA 3CAMA 1XYIA 2Z0SA 2RCFA 4K5WA 4RWSC 3S15B 5GAEC 1X3FA 5CV7A 1XJVA 1VQNA 3DMUA 5C4XB 3GO5A 3MHBA 1LTRD 3VYRA 4CJ0B 1JT8A 4C3JG 2Z6KC 1S40A 2IHFA 1Y1VB 1N9WA 3M4QA 2F3IA 3NE5B 3U4ZA 3J81L 2FFKB 4RCNA 4NP5A 2HHHQ 2MP1A 2EJMA 1AP0A 4JV5L 1I50B 3D4WA 3S24A 4HJ7A 1HXYD 4DV3Q 2IX0A 3VYSA 2EE1A 2MFIA 5G3LF 1B44D 1QUQA 5KNCA 1JR0D 3SVMA 3BVGA 4A3KB 1SNDA 2K5DA 1EQRA 1WOCA 1PDQA 3S16B 4FVMA 2EYLA 4A3BB 1QZGA 2R61A 1VQDA 2K4KA 4CJ1B 4ZAIA 2MJ8A 2UUBL 2LY7A 3E3XA 3P75A 1XNRQ 2BOSA 3J7YW 3GTOB 2AQ1B 4DFAA 2B63B 1N32L 4ODGA 4IPCA 5JEAG 2F4VL 1EY7A 1MGSA 2UXDL 2B2VA 4JV5Q 2B2TA 1SYGA 2EYOA 2N3SA 4KHPQ 4ME5A 4O1NA 2JA7G 4DV1L 3S14B 2F0QA 1OO9B 3FKIH 3M7NA 2CW0C 2LS01 1NJIC 1PYWD 3N52A 2PQEA 1K0SA 4C3IB 1A3TA 4HJ9A 1XMQQ 1BR9A 1X32A 2EY2A 4PMWA 1SNCA 1R4QB 1D1IA 2A68C 1JJGA 1YNJD 2RDFA 1ESRA 1LO5D 1IBLQ 4LF9L 1SEBD 3CCQA 4DV0Q 1K0RA 2PNRC 1VQ8A 2P5ZX 1PFBA 2Q2HA 4HR7B 1WTPA 1TS4A 3HKSA 5CGKA 3FEWX 5IGGA 4UP8A 1P8LA 1RTNA 2LKVA 3R8BA 2F0DA 1DOLA 1N32Q 1Y69U 1E22A 4A3CH 3S1RB 2UXDQ 4JI4Q 3J7AV 4GKKQ 4NPSA 1O78A 3UDXA 2OWOA 4P71A 1XPOA 2Q8TA 3D0FA 2F0SA 2ICEC 5M5WH 1S3OA 4DR3L 2L12A 3I4NH 1HNWQ 4RAUC 1LUZA 2FXQA 1FD7D 3KLRA 5LMNQ 4L5RC 1EEFD 2F0LA 2NB0A 1Q81C 3PIPA 3CKIB 3V96A 3J7AF 1HUNA 2H1EA 2Q2IA 2QILA 3D6CA 5NUCA 3H94A 1RL2A 2QEJC 2RA4A 1V1PA 1Y8PB 2QKIC 1NTGA 1S5CD 2K5WA 3LGJA 4IZ8A 1ENAA 2UUAL 5ISRA 3NPPA 3J80c 1A3UA 4ZCKA 1XTDA 2OQKA 1IZ6A 4DXFA 2B2YC 1O7ZA 2EY5A 3C1FA 4DR3Q 4OX9Q 1VF5C 4B3TL 3KLSA 1I3QB 2GVBA 1E2ZA 2BE5D 2ZTEA 1HQRD 3B6YA 4H44C 1L1OA 3NTIA 4DK3C 1ZEQX 1PFMA 2F0UA 4RKLA 4G7OC 4JPBW 2WAQE 4GN5A 4C3JH 1K83H 3CCMA 3HRZC 2G9DA 3K7UC 5JPMC 1J6QA 4FO2A 5IT9c 1YZ6A 3WOEA 4E6IA 2EYMA 5GADC 3BDLA 1G91A 1RD9D 1JB7A 5I9PA 4A3MG 5C4ZA 5C44B 5ELEA 2G9HD 4LF7L 1XXGA 2IPKD 4IUPA 1Q82C 4PG3A 3H0GG 1T5EA 3MXNB 2AHOB 1KABA 1U4MA 4WJWA 2FINB 3HOVG 2JYOA 3FKIB 1I5FA 1BDOA 3A55A 2WAQG 3Q8DA 1AN8A 1KDAA 4OO1G 1UWVA 1JORA 4K0KL 1K3RA 5JEAH 5JJIA 1SYDA 1XX8A 3T53B 4DKAC 5F2DA 1CTMA 3A5UA 1SN8A 3MZ5A 3AB9A 2ZTCA 4V0BA 4LF8L 2JA7H 3NHHA 1WCMG 2R7ZB 3NUCA 2B3GA 3KFUA 2Z1CA 3PO3B 4JBWA 4LF7Q 3CCRA 1ET6A 1MIUA 2R3ZA 4MTKA 1CSQA 3MVVA 1LTLA 3LNNA 3V2TA 3J81i 2RF4A 1HR0W 4ULLA 1HNZL 1SNPA 3CCVA 3RN2A 3NSWA 3A5ZB 3EN2A 4XIGS 1TWHH 2KOLA 1HZBA 4L5TA 4C1NK 2M00A 1YIJA 3HOUG 2MHVA 1WTWA 1N8RC 5M5WB 2EZVA 5CC4A 3I4NB 1WD0A 3Q22A 1O7IA 3H6MA 3AQQA 1A63A 2RKSA 2WKDA 1K8MA 1AZPA 1JB3A 3HFZB 2JA5G 4JCVE 2V1CC 2QCPX 2RSOA 4P75A 4LF8Q 1RTOA 4NB3A 3I4LA 1A3VA 5JPNC 3PUZA 2X6GA 3BVZA 1I6HB 2CH4A 4OHJA 4JK1C 1VQOA 1F2LA 4FF2A 4XTCS 1HNZQ 2ZXPA 2J4XA 4KK7A 1FNUA 1SYFA 5CV8A 2OEOA 4HJ8A 4JOIA 1QE6A 1TXYA 1HJPA 3ERQA 2CW0D 5IYBG 1SYBA 4TKOB 4IUNA 3ZYYX 1PMRA 1NUCA 3VR5A 5M3MG 4EX5A 2F0EA 3A0JA 2L4NA 1LABA 4FXDA 1Q90A 2K32A 2A68D 2X69A 3OIQA 3T16A 1B50A 3M9BA 1V9PA 1KLGD 4APVA 1JMCA 2BA0A 1WVLA 1STNA 1EQVA 3KOJA 4C3JB 1K83B 4IPHA 5D14A 3SR1A 1WTOA 4POFA 1BBWA 1GUWA 1EY4A 4IALA 2ENBA 1EWIA 3FPUB 4HSPA 3H91A 4H0LC 1BXTA 3A7LA 5K36G 1GUOA 3TZDA 1E1OA 3PUYA 4IO9A 1YHAA 3DWQA 2E2DC 1A62A 4L63B 4JW0A 4HJ5A 1S72A 4DGZA 3AYHB 4NW2A 4A3KG 1BBUA 1B70B 5GAHC 1FVIA 4A3MH 2DJFC 1JE4A 2A73B 4DAVA 1SE2A 2KEEA 4BBSB 1F2ZA 1S5BD 4BBRB 3T1HL 3H0GH 3CP0A 3NBHB 3HOVH 5JJLA 2B63G 4LF4Q 2JA7B 2IHEA 2Q8IB 4OO1H 3NQIA 1RDPD 3MFGA 3H3VI 4OWWB 3HP3A 2DGYA 1YHBA 2E2JB 4C3IG 1V1OA 1BQQT 5CORA 3K7AB 5G3LD 1BVSA 3U58A 4FF1A 1TWHB 1WCMH 3BVMA 1VQGA 1WFQA 4NXNL 1Y8OB 3K8AA 1YVCA 4PNYA 3X3NA 5IGCA 3K0XA 3T1HQ 4NKLA 2JP1A 3UE1A 3ONAB 1N34L 4JC0A 5EPKA 4DK1A 3HOUH 5E1FA 1STAA 3BZCA 2K28A 3A74A 4I7AA 4K5XA 1JOQA 1ASZA 3GTQH 4G4KA 4JG2A 4PQXA 2JA5H 3SDZA 2IY5B 2RVLA 1F9PA 3CCJA 4MNOA 2NVTH 1D2BA 4IPGA 4JI0Q 3ULLA 3CD6A 1XPRA 4NXNQ 4UY8C 4IJLA 3KDFB 3LWEA 4DV2Q 1UE5A 2E2HH 2Q8RE 4X6AH 1L0XB 4Z9CB 1X54A 3I56A 4JI2L 2BH2A 4RCOA 1OTCA 1OXTA 2E5LQ 1N34Q 3F2BA 1LTTD 5BN5A 4DAPA 5IYBH 1AW7A 1HNXL 2SDFA 3DM3A 5M3MH 1NMGA 4GN4B 3FP9A 1RJTA 1TWGH 1HFNA 2KVMA 2K5QA 5DM63 2JA9A 3QR8A 4UHVA 4BWGB 4GKJL 1ENCA 1BF4A 5L37A 3VR2A 3F8TA 1V1QA 1WTVA 5GAGC 3OMCA 4DR6L 3JC66 4GNXA 1Q1EA 2SOBA 5CV6A 4WFN3 3GV3A 2CQOA 3M7GA 2CVRA 4JI2Q 5DAUA 5IP9G 4XYQA 4BS9A 3EBEA 5FLMG 1F77A 2AUKA 5K36H 2UXCL 4DV6Q 1AE2A 1O7YA 3H15A 2Q2UA 4A3MB 4N8X1 4KV6A 2VW9A 1Q46A 3HOZG 2HQEA 4C2MH 3QOJA 1HCZA 3HS0C 3H0GB 5C44G 4DV4L 2F0NA 3I4MB 4A3KH 2NBFA 2HD3A 2K75A 1SNQA 3K58A 4FF3A 3A8IE 4R4IA 1B53A 4LWCA 3T4AC 2WAQB 5LL6S 2KENA 2NZOA 2TMPA 4DR4L 3FPPA 2CWAA 4DNRB 3PMFA 4K14A 2JEBI 2KBNA 2B63H 2UXCQ 3I90A 1YI2A 4FXGC 1WCMB 1QVGA 3AEVA 1ENFA 1S5FD 3EA6A 4YHHL 1ASYA 2R7ZG 4ZUJA 4DV4Q 3JAML 1SFOH 4C3IH 5KYIA 2NZHA 4R4OA 1SJED 1QNKA 4M1UB 3URYA 4XQJA 3S1QB 2QEXA 3HOUB 1HR0Q 5IYCG 3CC2A 4XYOA 4G7HC 1A15A 2B2VC 2F3VA 1UEAB 1VQAA 3TSSA 2A74C 2DUDA 1RKNA 1LM0A 1ESFA 2MO0A 4MTNA 1VQEA 1V8QA 2JA5B 2GN5A 4BY1G 2JA6G 5EBDA 4DNIA 2NVTB 2IT1A 2HQLA 3I4OA 3TP6A 2B2WC 3Q6SA 1D1KA 2E2HB 1STHA 4QUCA 4YIJA 1DOMA 3RR5A 4R8NA 5IOCA 2NTTA 4LNQA 1CFMA 1Q3LA 4LUVA 1EL0A 1SBBB 1YITA 2RBMA 5M3FG 3T1YQ 4P72A 2L5TA 1NCVA 2ES2A 4LF6Q 2Q2TA 4DUYL 4O42A 1X56A 4GS3A 1E24A 5M3MB 1EY0A 1PTOF 4DK0A 4YY3Q 1GUSA 1QNUA 1TWGB 2KHJA 4P2CB 1PH9A 3VR4A 2F0TA 2E75C 1MKHA 2A19A 3CW2C 1JQYD 3ND9A 4DR1L 5FK9C 1XNRL 5D3DA 5E3FA 5J39A 2FJ2A 1I3QH 3K81C 4ZKCB 5EPJA 4AQYL 3W5OA 4AH6A 3G71A 3TMEA 2N78A 2CWPA 4KHPL 1LT3D 5FKAC 3OOCA 1U4RA 1FJGL 4WORA 4DUYQ 3CCSA 4C2MB 1IBKQ 5I6WA 4XDXA 4YWMA 5IP9H 1DZ1A 5FLMH 1EYDA 2R92B 5C0XI 1XMQL 2H4OA 1WI5A 1HA5A 3KK7A 1G8ZD 1IBLL 2NN6G 3BJUA 3BZKA 4DV0L 1PYSB 4CKEA 2LXKA 2D9UA 5ELOA 1ICFB 3MWYW 3HOZH 4X66L 1L1OC 4DR1Q 2I5HA 5C44H 2PQAA 4BBSG 3KUPA 1V43A 2BCOA 2UUCQ 4OGQC 3M4OH 3L9AX 2I5LX 4BBRG 4DU9A 4AQYQ 4R4TA 2BDNA 4JI4L 2F0MA 4GKKL 1KRSA 4A3IB 1PLFA 3I73A 1FJGQ 1C0AA 3OIPA 4MIUA 1JOOA 5H1SE 2AKWB 1QWYA 2JK8A 5C4HA 3L3OC 1SFOB 2QDLA 1CA5A 1SYEA 1SXTA 3PCOB 1NNXA 3MEFA 5FLXE 1HNWL 2NVQH 2XWJB 4K8JA 1KDBA 5LMNL 3D8GA 2QA4A 3D3RA 2K50A 3D6WA 3PSIA 4A3FB 2PQAB 1Y14B 1TS2A 2WB1E 4X66Q 2R7ZH 3PO3H 4HEDA 1SNOA 1LYLA 3RLNA 4FP5D 1UE1A 1QZHA 2HDLA 3DXJC 1TWFH 4JI3L 3VDYA 5C5MA 1EY6A 2C35B 5IYCH 2RSNA 3SXHA 1SLJA 2AWOA 4IUUA 3M3YH 1I94L 1MSHA 4RGTA 4ZRZA 1MD2D 2E2IH 1GOZA 3PO2G 1F9QA 4OX9L 2L9HA 3HZXA 4BY1H 2JA6H 4F87A 1JICA 2Y0SG 2VB2X 1VQIA 4N9TA 2UXBL 4L8JA 2EY1A 2K33A 1LTAD 5T1GA 2YYZA 1PTOC 4R4CA 4OXPA 1PH4A 1HUMA 5LMUQ 1EOVA 2WB1G 2ICIA 4QGUA 5EJWA 4H02A 3EVQA 3RUZA 1I6HH 1XWEA 3EJIA 4OIKA 4TRDA 5IYDG 2PMZB 4DAMA 3TS0A 4JI3Q 4LW1A 4JBJA 5M5XH 2QF7A 2WINB 1K3BC 2FHTA 2C5CA 4L5QA 5CBAE 1S5DD 1VQPA 2V4DA 2XSCA 5M3FH 1U0LA 2I07B 2F52A 3UDIA 1I94Q 3GTKH 3CHBD 2Z6KA 5J3BA 1B8AA 1SMXA 4RGMA 3JAMi 1VDZA 2D5DA 4P74A 5ELFA 4K6DA 2UXBQ 2B29A 4KY6A 1VQKA 1KAAA 1UE6A 3W1BA 2GA4B 3MXNA 2AQ2B 1PH8A 4HCEA 1I6VC 1SE4A 1DD2A 3PUXA 1SYCA 1I4RA 2CH4W 2QW7A 3CU7A 3VA7A 2EIFA 3KF8B 4XT3B 3HKZB 1ILPA 2LMCB 4K5VA 1T9HA 1OXSC 3J81E 1VQ6A 1VMPA 1WTHA 3D4DA 3KJOA 1AE3A 3HOZB 3E9IA 2A8VA 1M4VA 3PUVA 3ZJYC 1C4QA 2F4IA 1JE5A 4XQNA 3M4OB 1QOHA 1SJHD 2AMCB 3J7ZC 1LTSD 2KQ3A 3I4MG 1HZAA 2NN6H 1X3EA 1X65A 1NE3A 2E74C 3W1GA 1XTCD 2HUGA 4BBSH 3VR3A 2OXPA 2NVQB 1LTID 4BBRH 1LTGD 1U4LA 1KNAA 1RODA 2NVYH 5C5LA 4LUZA 1GM5A 1TVXA 1J8IA 4YWLA 4LJZC 1CHPD 3WOFA 3MAQA 4YCWA 5HY6A 3T13A 3QOLA 1TWFB 3KBGA 2NWGA 5IWAL 3MXPA 3BG3A 4UP7A 2E2JH 4EGVA 4PV1C 5IP7G 4O2DA 3A56A 1D5ZC 3K7AH 1WJJA 3M3YB 1NBWA 1B2TA 4X65L 4EVOA 4I7ZC 1GJXA 1B7YB 2E2IB 1G6ZA 2MUYA 4A3GG 1PH3A 1E1TA 2JE6I 4P73A 4BY1B 2JA6B 2VZAA 1MSGA 3OHXC 1VQHA 3L2PA 1HZ9A 4ABNA 1PA6A 1EFWA 2OTJA 1GKHA 4KHZA 5JJZA 1GUNA 1N36Q 3OWFA 2N8NA 4TVAB 1EYCA 3E0JA 4AYBE 4GZYC 4ZQ3A 1B4OA 3E9HA 5IWAQ 5EAYA 1KTKA 2HT1A 2SNMA 2WKCA 1SAPA 5M5XB 2Z4IA 3GDEA 5M3FB 1EOTA 4XQQA 3H3VC 4X65Q 3K0YA 3GTKB 1B9NA 3DLLA 4K2KA 4HAEA 4ILWA 5A2QL 1KD1C 4CHTB 1BUVT 4IQZA 5IYDH 3MA2B 1PFNA 4RMFA 3S2DH 1HA6A 4G57A 1PTOB 2MQHA 1KQSA 1QG7A 4JVZA 4N9PA 1VF7A 3DEOA 3NENA 1I4HA 1SNMA 2QDBA 1KXLA 4ZUIA 2XVSA 4AYBG 5C3WA 3Q0AA 1VQ7A 1PFSA 1IBML 3PF5A 2IL8A 2TSSA 1AFPA 2XRQD 1UAPA 3DWPA 5FLXc 3RN5A 1IHZA 1C7YA 4DA2A 3CRLC 3ICEA 3DWAA 4DF7A 2YU9B 1EU3A 1PV4A 4JBMA 4LF4L 1A0IA 1DJRD 3NBHA 4HSVA 4YWKA 4OONA 1C9OA 4QIWB 4NMZA 2EJGC 2L0CA 3VR6A 4QB4A 2NYZD 1VQ5A 5FO8B 4QJFA 1HZCA 1O7LA 5CBEE 2AWNA 2BDOA 3CMAA 1GUGA 1UEBA 1E0BA 3K59A 2R92G 1QILA 4QUFA 4X3SA 1TY2A 1A8VA 1YHQA 3G6JB 1TKWB 5KNDA 2K1BA 1J5EL 1PTOD 4ZKBB 3CMEA 2L11A 3I91A 4DR7Q 1IBMQ 3ITPA 1M8AA 4A76A 1KNEA 4AIMA 3A7AB 2IJ0A 1IKLA 4NDXA 3I4MH 3SE0A 5I4DA 1JOKA 4MN3A 1W6JA 2NVYB 2Z6BA 5C0XJ 3U9SA 3CCLA 1X55A 1L0YB 4X3TA 4A3IG 1SROA 3J80L 1UUPA 3TP7A 4KHVA 2IW3A 1IW7C 3O13A 3RZOB 3S1NB 4WRDA 4CKCA 1ICWA 2Z9HA 4HTHA 3RNUA 1JJCB 1TS5A 3AU7A 4X3UA 4GLXA 4PZ7A 5IIFA 1DYQA 1J5EQ 1CUKA 4O0AA 4JYAL 3G7LA 4JI0L 1YJ9A 2ZJQA 3G6EA 4DV2L 4DUZQ 1B3AA 3ND8A 4A3FG 4TSSA 1UNSA 3KDFA 1Z47A 5K5PA 5IP7H 1H9MA 1VS0A 3Q24A 2E5LL 2DJGC 1W3SA 3NTHA 2PMZE 5IT9L 3ULPA 4LFAL 3S1QH 3L7ZC 5C3XA 2B2UC 1TIID 3PO2B 1YJWA 4A3GH 1SDFA 3S2HH 2RHQB 5KRUA 1AH9A 3PIO3 2Y0SB 2DY7A 2MGSA 1Q86C 1QVCA 2EJFC 5E7NA 5J22A 4FYDA 3MEHA 4UPAA 3NEMA 5CV9A 5HGQA 2WB1B 2KUMA 3KF6A 4HMJA 4JYAQ 4GOPC 3FRPB 4YCVA 1PH1A 1QCBD 1PVOA 5COYA 2EOTA 4A3LG 3S2DB 1LACA 3E5SA 3LWUA 2HDMA 5C4JH 2ZXRA 3HKZE 3GP7A 4DV6L 2M2LA 2VY3A 4HIOA 3KJPA 3EQLC 3E0EA 4LFAQ 3MC0B 4OO1I 3OPOA 4KLKA 1VQBA 3R3OA 3NP8A 4CDEC 4WJ3M 1M90C 4B08A 4F7XA 3ULJA 3R2TA 3SK6A 1BNZA 4GLVB 3K57A 3KF6B 1G291 4JI8L 4Q5VA 1DXMA 3HOWB 2B8FA 2LSSA 1HRJA 5I2XA 1K8OA 4FNFA 4Q0FA 2BH8A 1YEZA 4B3SL 1SSOA 2HCIA 1TY0A 4A3DG 1FNWA 4DV5L 3NBIA 3VYUA 3HKZG 1CSPA 4ZYSA 1EIYB 2PZUA 2A6HC 3CCEA 2I0QA 4J15A 5EPLA 4B3ML 1Q12A 1K28A 1CZGA 2DNCA 2EYPA 1Z6HA 1NSNS 1VCIA 3OW7A 2PNHA 2R7DA 3RMHA 3IAYA 2R93G 5HGTA 2R92H 4KKUA 4JI8Q 3TEHB 3OWEB 2Z8LA 3SK8A 4DK6C 4EQNA 2EY6A 3I7FA 1HR0L 3IL8A 3F2CA 3F2UA 1JWSD 2DY8A 3GD7A 4B3SQ 1ZYRC 4R1JA 1CM9A 3F2DA 5M5YB 1ILQA 4RGOS 4DV5Q 2WACA 3NQTA 1L0WA 1STYA 2PW7A 2VQEL 3NXWA 2F0GA 4DR5L 5D65A 2VUMB 4OWTB 1A2TA 4DAYB 1MJEA 4A3IH 4B3MQ 4RG1A 4IN3A 5AJ3Q 5D3IB 3TS2A 5FO9B 3BZDB 3M4YA 4F8MA 4BY7G 1GVPA 1D5MC 1ONLA 5CV5A 3CC4A 3GTPB 4QL5A 1B1ZA 1CKMA 1X3PA 1STGA 1EZ8A 4X62L 1IL2A 1FR3A 5J1ZA 3UI2A 3HOXG 1FGBD 4H13C 4A3GB 3T1YL 2B2TC 4EQPA 1CA6A 4A3FH 4LF6L 3S2HB 1QJOA 2A69C 1KLUD 2XTIA 2KHIA 4YY3L 5DNFA 1MI2A 1K8AC 2EYJA 2RHSB 2VQEQ 2CKZB 3P7JA 4X64L 4DR5Q 1YJNA 4K2LA 4DN4M 1Y1WB 2E8GA 1NY4A 2I5MX 5C4JB 5BN4A 1OXUA 4ME3A 3V05A 4X62Q 1Z7TA 5KEEA 2A6EC 2L15A 4K6LA 3MTSA 1PZKD 4B3RL 2ASBA 1X3GA 3J80i 4GLAC 1STBA 3OSOA 5BR8Q 1IBKL 4QIWE 5CV4A 4A3LH 4LFBL 1IW7D 4KTAA 2ZM6L 1R4PB 3S9WA 2KCTA 1EIFA 1HTLD 1D7QA 4X64Q 2HIVA 4HN7A 2SNSA 5C3EG 3HG9A 4AYBB 1EQTA 1EUJA 1ZXTA 1FL0A 1U4PA 3MXUA 4R8IA 1D8LA 3STBC 4CGYB 2PO4A 2UUCL 1N33L 1AEXA 2PZTA 4U68A 5JVG3 2AUJD 3FDTA 4QQBX 5JEAJ 4KY5A 2VNUD 4B9XA 2ZJRA 2KECA 1RCVD 4B3RQ 2YV5A 1XNQL 4LFBQ 4RKBA 1KL9A 4A3DH 2ZM6Q 4IFDG 1CHQD 2MNAA 1EWCA 1L2FA 4LMQD 1PH2A 3TRZA 3D31A 1EU4A 1FNVA 1H95A 3GTGH 3X3MA 3ERSX 3TBIB 1E7ZA 2XIWA 2IWHA 2NZ1D 4UAIA 5E4XA 2R93H 2R6GA 1N33Q 3RZDH 1U5KA 4XXEA 5I9OA 3DUZA 1F2YA 3RD4A 2CFMA 3A54A 3N6RA 5DEHA 3OW2A 1GHJA 1PRTF 1XNQQ 2F0FA 2WFWA 1TR5A 4LUOA 4OEMB 1TWCH 4Y7NH 4IUQA 4JBKA 2JJQA 3C2PA 2G5DA 2CQAA 2J0TD 1EY5A 3TN2A 3I8ZA 2NUCA 2Y0SE 2EXDA 1A2UA 4DV7L 1PZID 5KIXA 2K5VA 1EY9A 1OXVA 1KIXA 1NR2A 5LHY1 5LMUL 1T5XD 1QUQB 2OF1A 4IJHA 5KNBA 3CF5A 4BY7H 2WP8J 4A4IA 4LK1C 1H9JA 2B8GA 3P20A 4FF4A 1GHKA 4CKBA 3JAME 4GN3B 4IUTA 1OXXK 5EBCA 1XPUA 2J7ZA 1C48A 3UE0A 1PH5A 5IODA 2K6AA 2B2WA 2DN8A 4KMUC 3HOXH 2A6HD 1ET9A 1EYGA 3HOYG 1ML0D 3BYTB 4H7BA 4EQOA 2UUBQ 2OT2A 1HPCA 2D0PA 4OL7A 1BKBA 2JSOA 2B39A 2CHBD 1Q7YC 3IFTA 2F4VQ 4DV7Q 1DGSA 3SEBA 1D6EC 2PPBC 4CDCC 3MXGA 1EZ6A 2AQ3B 4DV1Q 1X3QA 1ZYRD 5DM73 1NR4A 1SE8A 2K01A 3KF8A 3RLOA 2SEBD 1SRUA 4PMCA 4PZ8A 4LF9Q 4PMBA 4DR2L 1KC8C 4KKTA 2K5NA 2F0OA 3GV6A 5A35A 4NXML 1TU2B 2D0OA 1F9RA 2EYFA 2F0IA 2LFNA 2MO1A 3UDGA 3J81j 4KN7C 2OCEA 1PTOH 2F03A 1KRTA 4LAAA 2X6LA 5C3EH 3T51B 4KI0A 4JI1L 3DEPA 2XWBB 1GXDC 1JCKB 5FO7B 1LT4D 1STEA 4DNTB 3HOWG 1BCPF 1JC7A 4IOAA 3PIOA 2K7VA 2RQXA 4U673 4A3DB 1QB5D 2A69D 4JOIC 1J9OA 1PHJA 2F0VA 2PI2E 2F0KA 1S4ZA 4RA8A 1IYJB 1ZKOA 1DOKA 1SMYC 2JA8G 3K5LA 2YU9H 4BXXG 2IX3A 4DR2Q 1VQCA 4XT1B 3GTGB 5JAVA 4NXMQ 1CQVA 4KJNA 4IFDH 2R93B 1V1PB 2OQ0A 2YTXA 3RZDB 4L6TB 3NWTA 4IURA 1W6KA 1PRTC 3QG1A 4JI1Q 2UUAQ 4C3HG 4HCSA 3I3CA 2A6ED 1CZWA 3L0OA 2K52A 2F0PA 1HTPA 4KY7A 1BO0A 3S17H 1TWCB 4Y7NB 3NELA 1IXRA 2NVXH 3NK9A 3RLFA 1SE3A 1HH2P 4B3TQ 3VYTA 4A3JG 3S1MH 1EWHA 2VL6A 1L1OB 2RDGA 2L1BA 1CQFA 1WTXA 5EKIA 1N36L 4CJ2C 1G2TA 4UDUC 2VUMG 4BY7B 3DM1A 3STBD 1DCZA 2EVBA 3RZOH 1VMCA 3S1NH 4HIKA 5E4WC 3I55A 2OTLA 1HHVA 2KCCA 2O5JC 2K03A 3A8JE 3HOXB 1IYUA 4KN4C 5C6AA 4CDDC 3WDNA 4IOCA 4A3EG 1TWAH 4YCUA 1PZJD 4R9WA 2YTVA 2EYHA 2Z4HA 1G2SA 5FOBB 3AFQA 5IY0A 1WTRA 3ER0A 3GTJH 5ELDA 3HOYH 4IFDI 4HMIA 1M1KC 3PO2H 2O2LD 5EGTA 3KBXA 1YBYA 3K6OA 1P16A 2JN4A 2F3WA 2NN6I 3P1HA 5M9OA 1Y1WG 2XGTA 4K0KQ 1RIPA 3QJYA 1EFID 1F9SA 3SHLA 2ID0A 3R93A 2B2YA 1VQ4A 1QVFA 1O80A 2K5HA 1YNNC 3W2DA 1PYBA 4JI7L 2O4XA 3BS1A 4TQUS 3TDQA 1LT5D 5C3EB 1BCPC 1KAWA 3CQZH 4CDFC 1GUTA 4OWXB 4IUVA 1VQ9A 2MPMA 4A93G 3BYYB 4DR7L 1MHWC 2JQOA 1CK1A 3PGZA 3PUWA 1VQFA 2VQFL 5CYUA 3G48A 3H3VH 2K04A 5KYLA 4JI6L 1EIGA 1DONA 3FHWA 2XRSD 1EIHA 2KJXA 3HEJA 3HOWH 2LXJA 3TQYA 5JVH3 1G6PA 5HURA 2UU9L 2H5XA 1I4XA 1X9NA 3JAMc 2NTSA 4JI7Q 4LFCL 5C4XG 1JWUD 5T1IA 3T56B 3TP5A 3DHQA 1Q8IA 1RHPA 1PH6A 5EQ0A 3FMCA 2JA8H 4BXXH 1R9TH 3U50C 4M8AA 2GVAA 2KCMA 1E3PA 1VQMA 3I2ZA 3EFXD 1Y1VG 3F1ZA 4FDBA 3S17B 3M85A 2NVXB 2I46A 1K9MC 4DUZL 2VQFQ 1IL8A 4KD4A 2XN9C 4GNXC 3S1MB 1CKOA 3IFDA 3K5NA 3K5MA 4JI6Q 1MBYA 1B3QA 4C3HH 3GTLH 3PV0A 1GD7A 4C56C 1LTBD 4A3BG 2UU9Q 4Y52H 4HJAA 3GTMH 4JI5L 1PRTB 4LFCQ 3CRKC 1II3A 5M5YH 4QMGA 2PCFB 2ZT9C 4A3JH 2N49A 4L5SA 1Q8KA 1EQQA 3BDOA 3WWVA 2ALYB 2EPBA 2D2CC 2CCZA 3KYHC 1I4PA 3OTOL 2VUMH 1TWAB 2QGQA 4X3KA 1H9RA 5FJ8G 1Q1BA 3M4PA 3PIP3 1G51A 4KKSA 3GTPH 4J1MA 5EKKA 3BDCA 2BA1A 3AMUA 1EEID 2VB3X 1SMYD 3C3LA 3GTJB 3HOYB 1DM0B 4S3SA 2K14A 1XMOL 2ZXOA 4R4QA 4A3EH 5CR3A 4QF4A 2PYKA 5BN3A 4JI5Q 2XNAC 4F88A 2A5HA 4J8QA 1I4GA 3OYYA 5CMDA 3J81c 3QB3A 2KCNA 1A6XA 2A1AA 5ELBA 1PRTD 5ELCA 1C8CA 5C0XG 3OTOQ 3KLSX 5KGUA 4BA1I 3G4SA 2N88A 3UDFA 1Y1WH 5IGBA 5I2YA 1TS3A 5LMNW 2WIIB 3FVQA 3CQZB 3C46A 1H9KA 5JJKA 1XMOQ 2DNEA 1FYCA 5EKLA 5GROA 2O5IC 1PH7A 1H9SA
chains in the Genus database with same CATH topology
3U9OA 5A2QE 1Y8NB 4RFBA 1AZQA 2F0HA 4B9WA 2F0JA 2F1MA 3OMGA 2F0WA 3MFYA 1WTQA 1EYAA 4RGNA 4C1NI 3W3AA 1BCPB 1BOSA 4V190 1TQOA 4KD3A 3QO2A 4ID6A 2JA8B 1R9TB 1LLRD 2K05A 3I70A 4RHSA 1YNJC 3Q23A 4KJOA 2E76C 1HQMC 1IKMA 1RF2D 1H9SB 4I65A 4DAYA 2KEDA 5AFWA 4C3HB 2IX1A 3GTLB 5IGDA 1BBXC 1TT2A 3D4RA 5JOBA 4DXGA 3GTMB 1D5XC 4A3JB 1YNND 1IYVA 1S5ED 5IGFA 1KDCA 2PW5A 1PXUA 3HOVB 1BCPD 5I6YA 4FXKC 4ZK9B 1E2VA 2L55A 5IGEA 2N55A 1E2WA 3J80E 4OIJA 5TSSA 3IKJA 4K8IA 2M9VA 3QIAA 2KHSA 5FLXL 3A8KE 2B2UA 4A3EB 2EDGA 4CBVA 1LT6D 1B9MA 1WD1A 3R2IA 4ZLTF 2FMMA 3E6ZX 3EROA 4RH6A 4MHEA 1LV9A 3QWNA 2BE5C 1NAPA 3I72A 5IT9E 3SK5A 4QCLA 2JEAI 4RHRA 3TP8A 3VA5A 2EXZA 4J6HA 3TZUA 2WV6D 3GTQB 1F2MA 4BA2I 2HCCA 3NWSA 5C0XH 3C1EA 2D62A 2FMCA 1CT1D 3NTKA 3HGBA 3LX0A 1CI3M 4IFDJ 1U9RA 3H09A 3SK4A 2JXMB 4A93B 2KA7A 4G7ZC 2PZWA 2VXWA 3GQBA 2RDHA 1I4QA 1JWMD 5LL6X 1EY8A 1HFGA 2C9OA 3K5OA 1XYIA 4K5WA 4RWSC 3S15B 5CV7A 3DMUA 5C4XB 3GO5A 3MHBA 1LTRD 3VYRA 4CJ0B 4C3JG 1Y1VB 3NE5B 3J81L 2FFKB 4RCNA 4NP5A 2MP1A 2EJMA 1AP0A 1I50B 3D4WA 1HXYD 2IX0A 3VYSA 2EE1A 5G3LF 1B44D 5KNCA 1JR0D 3SVMA 3BVGA 4A3KB 1SNDA 2K5DA 1PDQA 3S16B 4FVMA 2EYLA 4A3BB 2R61A 4CJ1B 4ZAIA 2MJ8A 2LY7A 3P75A 2BOSA 3J7YW 3GTOB 2AQ1B 4DFAA 2B63B 4ODGA 5JEAG 1EY7A 1MGSA 2B2VA 2B2TA 1SYGA 2EYOA 4ME5A 4O1NA 3S14B 2F0QA 1OO9B 3M7NA 2CW0C 2LS01 1PYWD 3N52A 2PQEA 4C3IB 1A3TA 1BR9A 1X32A 2EY2A 4PMWA 1SNCA 1R4QB 1D1IA 2A68C 1YNJD 2RDFA 1ESRA 1LO5D 1SEBD 2PNRC 4HR7B 1PFBA 1WTPA 1TS4A 5CGKA 3FEWX 5IGGA 1RTNA 2LKVA 3R8BA 2F0DA 1DOLA 1Y69U 3S1RB 3J7AV 1O78A 2Q8TA 2F0SA 2ICEC 2L12A 4RAUC 1FD7D 3KLRA 1EEFD 2F0LA 2NB0A 3CKIB 3V96A 3J7AF 1HUNA 2H1EA 2QILA 3D6CA 5NUCA 3H94A 2QEJC 2RA4A 1V1PA 1Y8PB 2QKIC 1S5CD 2K5WA 4IZ8A 1ENAA 5ISRA 3NPPA 1A3UA 4DXFA 2B2YC 1O7ZA 2EY5A 3C1FA 1VF5C 3KLSA 1I3QB 1E2ZA 2BE5D 1HQRD 4H44C 3NTIA 1ZEQX 1PFMA 2F0UA 4RKLA 4G7OC 3HRZC 2G9DA 5JPMC 4FO2A 3WOEA 4E6IA 2EYMA 3BDLA 1G91A 1RD9D 5I9PA 5C4ZA 5C44B 5ELEA 2G9HD 1XXGA 2IPKD 4IUPA 1T5EA 1KABA 1U4MA 4WJWA 2FINB 2JYOA 3FKIB 1BDOA 3A55A 1AN8A 1KDAA 4OO1G 1JORA 5JEAH 1SYDA 1XX8A 3T53B 5F2DA 1CTMA 3MZ5A 3AB9A 4V0BA 3NHHA 2R7ZB 3NUCA 2Z1CA 3PO3B 4JBWA 1ET6A 2R3ZA 3MVVA 3LNNA 3V2TA 4ULLA 1SNPA 3NSWA 4XIGS 2KOLA 4C1NK 2M00A 2MHVA 1WTWA 5M5WB 2EZVA 5CC4A 3I4NB 1WD0A 3Q22A 3H6MA 2RKSA 2WKDA 1K8MA 1AZPA 1JB3A 2QCPX 2RSOA 1RTOA 3I4LA 1A3VA 5JPNC 3PUZA 2X6GA 3BVZA 1I6HB 4OHJA 4JK1C 1F2LA 4FF2A 4XTCS 2ZXPA 2J4XA 4KK7A 1FNUA 1SYFA 5CV8A 2OEOA 1QE6A 3ERQA 2CW0D 1SYBA 4TKOB 4IUNA 3ZYYX 1PMRA 1NUCA 3VR5A 2F0EA 2L4NA 1LABA 4FXDA 1Q90A 2K32A 2A68D 2X69A 3OIQA 3T16A 1B50A 1KLGD 2BA0A 1WVLA 1STNA 1EQVA 4C3JB 1K83B 5D14A 3SR1A 1WTOA 1GUWA 1EY4A 4IALA 2ENBA 3FPUB 4HSPA 3H91A 4H0LC 1BXTA 3A7LA 5K36G 1GUOA 3TZDA 3PUYA 3DWQA 2E2DC 4L63B 4DGZA 4NW2A 1JE4A 2A73B 4DAVA 1SE2A 2KEEA 4BBSB 1F2ZA 1S5BD 4BBRB 2JA7B 2Q8IB 4OO1H 3NQIA 1RDPD 3MFGA 3HP3A 2E2JB 4C3IG 1V1OA 1BQQT 5CORA 3K7AB 5G3LD 4FF1A 1TWHB 3BVMA 1Y8OB 4PNYA 3X3NA 5IGCA 4NKLA 2JP1A 3ONAB 5EPKA 4DK1A 5E1FA 1STAA 2K28A 4K5XA 1JOQA 4G4KA 4PQXA 3SDZA 2RVLA 1F9PA 1D2BA 3LWEA 2Q8RE 1L0XB 4Z9CB 4RCOA 1OXTA 1LTTD 5BN5A 4DAPA 1AW7A 2SDFA 1RJTA 1HFNA 2KVMA 2K5QA 5DM63 4BWGB 1ENCA 1BF4A 3VR2A 1WTVA 3OMCA 1Q1EA 2SOBA 5CV6A 4WFN3 3GV3A 3M7GA 2CVRA 5DAUA 4XYQA 4BS9A 1F77A 2AUKA 5K36H 1O7YA 4A3MB 4KV6A 2HQEA 3QOJA 1HCZA 3HS0C 3H0GB 2F0NA 3I4MB 2NBFA 1SNQA 3K58A 4FF3A 3A8IE 1B53A 3T4AC 2WAQB 5LL6S 2TMPA 3FPPA 4DNRB 3PMFA 4K14A 2JEBI 3I90A 4FXGC 1WCMB 1ENFA 1S5FD 3EA6A 4ZUJA 3JAML 5KYIA 1SJED 1QNKA 4M1UB 3URYA 4XQJA 3S1QB 3HOUB 4XYOA 4G7HC 1A15A 2B2VC 2F3VA 1UEAB 3TSSA 2A74C 1RKNA 1ESFA 1V8QA 2JA5B 5EBDA 2NVTB 2IT1A 3TP6A 2B2WC 3Q6SA 1D1KA 2E2HB 1STHA 4QUCA 4YIJA 1DOMA 4R8NA 5IOCA 2NTTA 1CFMA 1Q3LA 1EL0A 1SBBB 2RBMA 2L5TA 1NCVA 4O42A 5M3MB 1EY0A 1PTOF 4DK0A 1GUSA 1QNUA 1TWGB 4P2CB 3VR4A 2F0TA 2E75C 1JQYD 3ND9A 5FK9C 5D3DA 5E3FA 5J39A 2FJ2A 4ZKCB 5EPJA 3TMEA 1LT3D 5FKAC 3OOCA 1U4RA 4WORA 4C2MB 5I6WA 4XDXA 1DZ1A 1EYDA 2R92B 5C0XI 2H4OA 1HA5A 3KK7A 1G8ZD 2NN6G 4CKEA 2D9UA 3MWYW 3KUPA 1V43A 2BCOA 4OGQC 3L9AX 4DU9A 2BDNA 2F0MA 4A3IB 1PLFA 3I73A 3OIPA 4MIUA 1JOOA 1QWYA 5C4HA 3L3OC 1SFOB 1CA5A 1SYEA 1SXTA 5FLXE 2XWJB 4K8JA 1KDBA 3D8GA 3D3RA 3D6WA 4A3FB 1TS2A 4HEDA 1SNOA 4FP5D 2HDLA 3DXJC 5C5MA 1EY6A 2RSNA 3SXHA 2AWOA 4IUUA 1MSHA 4RGTA 4ZRZA 1MD2D 1GOZA 1F9QA 2L9HA 3HZXA 4F87A 1JICA 2VB2X 4N9TA 4L8JA 2EY1A 2K33A 1LTAD 5T1GA 2YYZA 1PTOC 1HUMA 2ICIA 5EJWA 3EVQA 3RUZA 1XWEA 4OIKA 3EJIA 4TRDA 2PMZB 2QF7A 2WINB 2FHTA 2C5CA 5CBAE 1S5DD 2V4DA 2XSCA 2I07B 3CHBD 4RGMA 1VDZA 2D5DA 5ELFA 4K6DA 4KY6A 1KAAA 2GA4B 3MXNA 2AQ2B 4HCEA 1I6VC 1SE4A 1DD2A 3PUXA 1SYCA 1I4RA 3CU7A 3VA7A 4XT3B 3HKZB 1ILPA 2LMCB 4K5VA 1OXSC 3J81E 1VMPA 3D4DA 3HOZB 1M4VA 3PUVA 1C4QA 2F4IA 4XQNA 3M4OB 1QOHA 1SJHD 1LTSD 2KQ3A 2NN6H 2E74C 1XTCD 2HUGA 3VR3A 2OXPA 2NVQB 1LTID 1LTGD 1U4LA 1KNAA 1RODA 5C5LA 1TVXA 1J8IA 4LJZC 1CHPD 3WOFA 3MAQA 3T13A 3QOLA 1TWFB 3KBGA 2NWGA 3MXPA 3BG3A 4EGVA 4PV1C 3A56A 1D5ZC 3M3YB 1B2TA 4EVOA 4I7ZC 1GJXA 2E2IB 1G6ZA 2MUYA 2JE6I 4BY1B 2JA6B 1MSGA 3OHXC 4ABNA 4KHZA 5JJZA 1GUNA 3OWFA 1EYCA 3E0JA 4GZYC 4ZQ3A 1B4OA 1KTKA 2SNMA 2WKCA 1SAPA 5M5XB 2Z4IA 5M3FB 1EOTA 4XQQA 3H3VC 3K0YA 3GTKB 1B9NA 4K2KA 4HAEA 4ILWA 5A2QL 4CHTB 1BUVT 4IQZA 3MA2B 1PFNA 1HA6A 4G57A 1PTOB 1QG7A 4N9PA 1VF7A 3DEOA 1I4HA 1SNMA 2QDBA 4ZUIA 2XVSA 5C3WA 3Q0AA 2IL8A 2TSSA 1AFPA 2XRQD 1UAPA 3DWPA 1IHZA 4DA2A 3CRLC 3DWAA 4DF7A 2YU9B 1EU3A 1DJRD 3NBHA 4HSVA 4QIWB 4NMZA 2EJGC 2L0CA 3VR6A 4QB4A 2NYZD 5FO8B 1O7LA 5CBEE 2AWNA 2BDOA 1GUGA 1E0BA 3K59A 1QILA 4QUFA 4X3SA 1TY2A 3G6JB 1TKWB 5KNDA 2K1BA 1PTOD 4ZKBB 2L11A 3I91A 3ITPA 1M8AA 1KNEA 3A7AB 2IJ0A 1IKLA 4NDXA 3SE0A 5I4DA 1JOKA 4MN3A 1W6JA 2NVYB 5C0XJ 3U9SA 1L0YB 4X3TA 3J80L 1UUPA 3TP7A 4KHVA 2IW3A 1IW7C 3O13A 3RZOB 3S1NB 4WRDA 4CKCA 1ICWA 4HTHA 1TS5A 3AU7A 4X3UA 5IIFA 1DYQA 3G7LA 1B3AA 3ND8A 4TSSA 1UNSA 1Z47A 5K5PA 1H9MA 3Q24A 5IT9L 3NTHA 3L7ZC 5C3XA 2B2UC 1TIID 3PO2B 1SDFA 5KRUA 3PIO3 2Y0SB 2DY7A 2MGSA 4FYDA 2EJFC 5J22A 3MEHA 5CV9A 2WB1B 2KUMA 4HMJA 3FRPB 1QCBD 5COYA 2EOTA 3S2DB 1LACA 3E5SA 3LWUA 2HDMA 2ZXRA 3GP7A 2M2LA 3EQLC 3MC0B 4OO1I 3OPOA 3R3OA 3NP8A 4B08A 4F7XA 3R2TA 3SK6A 1BNZA 3K57A 1G291 4Q5VA 1DXMA 3HOWB 2B8FA 1HRJA 5I2XA 1K8OA 4FNFA 4Q0FA 1SSOA 2HCIA 1TY0A 1FNWA 3NBIA 3VYUA 4ZYSA 2PZUA 2A6HC 5EPLA 1Q12A 1CZGA 2DNCA 2EYPA 1Z6HA 1NSNS 1VCIA 3OW7A 3RMHA 3IAYA 5HGTA 4KKUA 3OWEB 2Z8LA 3SK8A 4EQNA 2EY6A 3IL8A 3F2UA 1JWSD 2DY8A 3GD7A 1ZYRC 1CM9A 5M5YB 1ILQA 4RGOS 2WACA 3NQTA 1STYA 2PW7A 3NXWA 2F0GA 5D65A 2VUMB 1A2TA 4IN3A 5D3IB 5FO9B 3BZDB 3M4YA 4F8MA 1D5MC 1ONLA 5CV5A 3GTPB 1B1ZA 1X3PA 1STGA 1EZ8A 1FR3A 5J1ZA 3UI2A 1FGBD 4H13C 4A3GB 2B2TC 4EQPA 1CA6A 3S2HB 1QJOA 2A69C 1KLUD 5DNFA 1MI2A 2EYJA 3P7JA 4K2LA 4DN4M 1Y1WB 5C4JB 5BN4A 1OXUA 3V05A 1Z7TA 5KEEA 2A6EC 4K6LA 3MTSA 1PZKD 1STBA 3OSOA 5CV4A 4KTAA 1IW7D 1R4PB 3S9WA 1HTLD 4HN7A 2SNSA 3HG9A 4AYBB 1EQTA 1ZXTA 1U4PA 3MXUA 4R8IA 4CGYB 2PO4A 1AEXA 2PZTA 4U68A 5JVG3 2AUJD 3FDTA 5JEAJ 4KY5A 2VNUD 4B9XA 2KECA 1RCVD 4RKBA 4IFDG 1CHQD 1EWCA 4LMQD 3D31A 1EU4A 1FNVA 3X3MA 3TBIB 2XIWA 2IWHA 2NZ1D 4UAIA 5E4XA 2R6GA 4XXEA 5I9OA 3DUZA 1F2YA 3RD4A 3N6RA 3A54A 5DEHA 1GHJA 1PRTF 2F0FA 1TR5A 4IUQA 3C2PA 2CQAA 2J0TD 1EY5A 3TN2A 3I8ZA 2NUCA 1A2UA 1PZID 5KIXA 1EY9A 1OXVA 1NR2A 5LHY1 1T5XD 2OF1A 5KNBA 2WP8J 4LK1C 1H9JA 2B8GA 3P20A 4FF4A 1GHKA 4CKBA 3JAME 4IUTA 1OXXK 5EBCA 2J7ZA 1C48A 5IODA 2K6AA 2B2WA 2DN8A 4KMUC 2A6HD 1ET9A 1ML0D 3BYTB 4H7BA 4EQOA 2OT2A 1HPCA 4OL7A 2JSOA 2B39A 2CHBD 3IFTA 3SEBA 1D6EC 2PPBC 3MXGA 1EZ6A 2AQ3B 1X3QA 1ZYRD 5DM73 1NR4A 2K01A 3KF8A 2SEBD 4PMCA 4PMBA 4KKTA 2F0OA 3GV6A 5A35A 1TU2B 1F9RA 2EYFA 2F0IA 2LFNA 4KN7C 1PTOH 2F03A 4LAAA 2X6LA 3T51B 4KI0A 3DEPA 2XWBB 1GXDC 1JCKB 5FO7B 1LT4D 1STEA 4DNTB 1BCPF 1JC7A 2K7VA 2RQXA 4U673 4A3DB 1QB5D 2A69D 1J9OA 2F0VA 2F0KA 1S4ZA 4RA8A 1ZKOA 1DOKA 1SMYC 3K5LA 2IX3A 4XT1B 3GTGB 5JAVA 1CQVA 4KJNA 4IFDH 2R93B 1V1PB 3RZDB 4L6TB 3NWTA 4IURA 1W6KA 1PRTC 3QG1A 4C3HG 4HCSA 3I3CA 2A6ED 1CZWA 2F0PA 1HTPA 4KY7A 1BO0A 1TWCB 4Y7NB 3NK9A 3RLFA 1SE3A 3VYTA 1EWHA 2RDGA 2L1BA 1CQFA 1WTXA 5EKIA 4CJ2C 1G2TA 4UDUC 4BY7B 3DM1A 1DCZA 2EVBA 1VMCA 5E4WC 1HHVA 2KCCA 2O5JC 2K03A 3A8JE 3HOXB 1IYUA 4KN4C 5C6AA 3WDNA 1PZJD 4R9WA 2EYHA 2Z4HA 1G2SA 5FOBB 1WTRA 5ELDA 4IFDI 4HMIA 2O2LD 5EGTA 3KBXA 3K6OA 2F3WA 2NN6I 3P1HA 5M9OA 3QJYA 1EFID 1F9SA 3SHLA 2ID0A 3R93A 2B2YA 1O80A 1YNNC 3W2DA 2O4XA 3BS1A 4TQUS 3TDQA 1LT5D 5C3EB 1BCPC 1GUTA 4IUVA 2MPMA 3BYYB 1CK1A 3PUWA 5CYUA 2K04A 5KYLA 1EIGA 1DONA 2XRSD 1EIHA 2KJXA 3HEJA 5JVH3 5HURA 1I4XA 2NTSA 1JWUD 5T1IA 3T56B 3TP5A 3DHQA 1Q8IA 1RHPA 5EQ0A 3FMCA 4M8AA 3EFXD 3S17B 3M85A 2NVXB 2I46A 1IL8A 4KD4A 2XN9C 3S1MB 3K5NA 3IFDA 3K5MA 1MBYA 3PV0A 4C56C 1LTBD 1PRTB 3CRKC 1II3A 4QMGA 2PCFB 2ZT9C 3BDOA 2EPBA 2D2CC 1I4PA 1TWAB 4X3KA 1H9RA 1Q1BA 3PIP3 4KKSA 4J1MA 5EKKA 3BDCA 2BA1A 3AMUA 1EEID 2VB3X 1SMYD 3C3LA 3GTJB 3HOYB 1DM0B 4S3SA 2ZXOA 5CR3A 4QF4A 2PYKA 5BN3A 2XNAC 4F88A 2A5HA 4J8QA 1I4GA 5CMDA 3QB3A 2KCNA 1A6XA 5ELBA 1PRTD 5ELCA 1C8CA 5C0XG 3KLSX 5KGUA 4BA1I 2N88A 5IGBA 5I2YA 1TS3A 2WIIB 3FVQA 3CQZB 3C46A 1H9KA 2DNEA 1FYCA 5EKLA 2O5IC 1H9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYO A;  4XQN A;  4XYQ A;  4XQQ A;  4CBV A;  3BS1 A;  4XQJ A;  4XXE A;  4G4K A; 
#chains in the Genus database with same CATH topology
 3U9O A;  4A75 A;  5A2Q E;  1Y8N B;  2RCN A;  4RFB A;  1AZQ A;  2F0H A;  4B9W A;  2F0J A;  2F1M A;  4UP9 A;  5IE8 A;  4A93 H;  3OMG A;  2F0W A;  3MFY A;  1WTQ A;  1EYA A;  4RGN A;  3CC7 A;  3TRE A;  4C1N I;  4HIM A;  3W3A A;  4LF5 L;  2R7F A;  1BCP B;  2PI2 A;  1BOS A;  4V19 0;  1TQO A;  4KD3 A;  3QO2 A;  4ID6 A;  2JA8 B;  1R9T B;  1LLR D;  2K05 A;  5GQO A;  4IPD A;  2HIX A;  3I70 A;  4RHS A;  2ATW A;  1YNJ C;  3Q23 A;  4KJO A;  5DLQ E;  2E76 C;  1HQM C;  1IKM A;  1RF2 D;  1UE7 A;  2YTY A;  1H9S B;  4I65 A;  1WYD A;  4MZ9 A;  3S15 H;  3EIV A;  5AJ3 L;  4DAY A;  5C4X H;  2KED A;  2EQS A;  5AFW A;  4C3H B;  2IX1 A;  3CPF A;  3GTL B;  5IGD A;  1Y1V H;  3PF4 A;  1BBX C;  1TT2 A;  3D4R A;  5JOB A;  4DXG A;  1I50 H;  3GTM B;  2ZJP A;  4LF5 Q;  1D5X C;  1HNX Q;  4A3J B;  1YNN D;  1IYV A;  1S5E D;  5IGF A;  1K73 C;  1KDC A;  2PW5 A;  1PXU A;  1KHI A;  2VS1 A;  3HOV B;  1BCP D;  5I6Y A;  4WJ4 A;  3S16 H;  4FXK C;  4ZK9 B;  1E2V A;  4A3B H;  4GKJ Q;  4POG A;  4GNX B;  3CXC A;  2L55 A;  5IGE A;  2ZTD A;  4PZ6 A;  2N55 A;  4DR6 Q;  1FGU A;  1E2W A;  3J80 E;  4OIJ A;  3SGI A;  3FKI G;  5TSS A;  1VQJ A;  3IKJ A;  4K8I A;  2M9V A;  3AFP A;  3QIA A;  2KHS A;  5FLX L;  1SR3 A;  3GTO H;  3A8K E;  2B2U A;  3KLW A;  4EQ5 A;  4A3E B;  2EDG A;  1MJC A;  4CBV A;  1X6O A;  3CPW A;  1LT6 D;  1B9M A;  5FJ8 H;  1WD1 A;  3CCU A;  3BU2 A;  3R2I A;  5BR8 L;  4ZLT F;  3S14 H;  2FMM A;  3E6Z X;  3ERO A;  3IRB A;  5ELN A;  3PQI A;  4RH6 A;  4ALP A;  4MHE A;  3PO3 G;  1CKN A;  1LV9 A;  4GOP A;  1K8G A;  3QWN A;  4A3C G;  2BE5 C;  1NAP A;  3I72 A;  5IT9 E;  3SK5 A;  4QCL A;  2JEA I;  4RHR A;  3TP8 A;  3VA5 A;  1GO3 E;  2EXZ A;  4J6H A;  3TZU A;  1YNX A;  4DR4 Q;  2WV6 D;  3GTQ B;  1F2M A;  3K80 C;  3I4N G;  4BA2 I;  2HCC A;  3NWS A;  5C0X H;  3S1R H;  3C1E A;  2D62 A;  2FMC A;  1VQL A;  1JJ2 A;  1CT1 D;  3NTK A;  3HGB A;  1Z9F A;  3LX0 A;  4YHH Q;  4OEL B;  1CI3 M;  1W2B A;  1CKN B;  4IFD J;  1U9R A;  4GOP B;  3H09 A;  3SK4 A;  2JXM B;  3J7A 5;  4A93 B;  2KA7 A;  2HHH L;  4G7Z C;  2PZW A;  2VXW A;  4QY7 A;  3GQB A;  2RDH A;  1I4Q A;  1JWM D;  4DV3 L;  4DPG A;  1NMF A;  3U4V A;  4N8F A;  1EY8 A;  5LL6 X;  1HFG A;  2C9O A;  3K5O A;  4HID A;  3CAM A;  1XYI A;  2Z0S A;  2RCF A;  4K5W A;  4RWS C;  3S15 B;  5GAE C;  1X3F A;  5CV7 A;  1XJV A;  1VQN A;  3DMU A;  5C4X B;  3GO5 A;  3MHB A;  1LTR D;  3VYR A;  4CJ0 B;  1JT8 A;  4C3J G;  2Z6K C;  1S40 A;  2IHF A;  1Y1V B;  1N9W A;  3M4Q A;  2F3I A;  3NE5 B;  3U4Z A;  3J81 L;  2FFK B;  4RCN A;  4NP5 A;  2HHH Q;  2MP1 A;  2EJM A;  1AP0 A;  4JV5 L;  1I50 B;  3D4W A;  3S24 A;  4HJ7 A;  1HXY D;  4DV3 Q;  2IX0 A;  3VYS A;  2EE1 A;  2MFI A;  5G3L F;  1B44 D;  1QUQ A;  5KNC A;  1JR0 D;  3SVM A;  3BVG A;  4A3K B;  1SND A;  2K5D A;  1EQR A;  1WOC A;  1PDQ A;  3S16 B;  4FVM A;  2EYL A;  4A3B B;  1QZG A;  2R61 A;  1VQD A;  2K4K A;  4CJ1 B;  4ZAI A;  2MJ8 A;  2UUB L;  2LY7 A;  3E3X A;  3P75 A;  1XNR Q;  2BOS A;  3J7Y W;  3GTO B;  2AQ1 B;  4DFA A;  2B63 B;  1N32 L;  4ODG A;  4IPC A;  5JEA G;  2F4V L;  1EY7 A;  1MGS A;  2UXD L;  2B2V A;  4JV5 Q;  2B2T A;  1SYG A;  2EYO A;  2N3S A;  4KHP Q;  4ME5 A;  4O1N A;  2JA7 G;  4DV1 L;  3S14 B;  2F0Q A;  1OO9 B;  3FKI H;  3M7N A;  2CW0 C;  2LS0 1;  1NJI C;  1PYW D;  3N52 A;  2PQE A;  1K0S A;  4C3I B;  1A3T A;  4HJ9 A;  1XMQ Q;  1BR9 A;  1X32 A;  2EY2 A;  4PMW A;  1SNC A;  1R4Q B;  1D1I A;  2A68 C;  1JJG A;  1YNJ D;  2RDF A;  1ESR A;  1LO5 D;  1IBL Q;  4LF9 L;  1SEB D;  3CCQ A;  4DV0 Q;  1K0R A;  2PNR C;  1VQ8 A;  2P5Z X;  1PFB A;  2Q2H A;  4HR7 B;  1WTP A;  1TS4 A;  3HKS A;  5CGK A;  3FEW X;  5IGG A;  4UP8 A;  1P8L A;  1RTN A;  2LKV A;  3R8B A;  2F0D A;  1DOL A;  1N32 Q;  1Y69 U;  1E22 A;  4A3C H;  3S1R B;  2UXD Q;  4JI4 Q;  3J7A V;  4GKK Q;  4NPS A;  1O78 A;  3UDX A;  2OWO A;  4P71 A;  1XPO A;  2Q8T A;  3D0F A;  2F0S A;  2ICE C;  5M5W H;  1S3O A;  4DR3 L;  2L12 A;  3I4N H;  1HNW Q;  4RAU C;  1LUZ A;  2FXQ A;  1FD7 D;  3KLR A;  5LMN Q;  4L5R C;  1EEF D;  2F0L A;  2NB0 A;  1Q81 C;  3PIP A;  3CKI B;  3V96 A;  3J7A F;  1HUN A;  2H1E A;  2Q2I A;  2QIL A;  3D6C A;  5NUC A;  3H94 A;  1RL2 A;  2QEJ C;  2RA4 A;  1V1P A;  1Y8P B;  2QKI C;  1NTG A;  1S5C D;  2K5W A;  3LGJ A;  4IZ8 A;  1ENA A;  2UUA L;  5ISR A;  3NPP A;  3J80 c;  1A3U A;  4ZCK A;  1XTD A;  2OQK A;  1IZ6 A;  4DXF A;  2B2Y C;  1O7Z A;  2EY5 A;  3C1F A;  4DR3 Q;  4OX9 Q;  1VF5 C;  4B3T L;  3KLS A;  1I3Q B;  2GVB A;  1E2Z A;  2BE5 D;  2ZTE A;  1HQR D;  3B6Y A;  4H44 C;  1L1O A;  3NTI A;  4DK3 C;  1ZEQ X;  1PFM A;  2F0U A;  4RKL A;  4G7O C;  4JPB W;  2WAQ E;  4GN5 A;  4C3J H;  1K83 H;  3CCM A;  3HRZ C;  2G9D A;  3K7U C;  5JPM C;  1J6Q A;  4FO2 A;  5IT9 c;  1YZ6 A;  3WOE A;  4E6I A;  2EYM A;  5GAD C;  3BDL A;  1G91 A;  1RD9 D;  1JB7 A;  5I9P A;  4A3M G;  5C4Z A;  5C44 B;  5ELE A;  2G9H D;  4LF7 L;  1XXG A;  2IPK D;  4IUP A;  1Q82 C;  4PG3 A;  3H0G G;  1T5E A;  3MXN B;  2AHO B;  1KAB A;  1U4M A;  4WJW A;  2FIN B;  3HOV G;  2JYO A;  3FKI B;  1I5F A;  1BDO A;  3A55 A;  2WAQ G;  3Q8D A;  1AN8 A;  1KDA A;  4OO1 G;  1UWV A;  1JOR A;  4K0K L;  1K3R A;  5JEA H;  5JJI A;  1SYD A;  1XX8 A;  3T53 B;  4DKA C;  5F2D A;  1CTM A;  3A5U A;  1SN8 A;  3MZ5 A;  3AB9 A;  2ZTC A;  4V0B A;  4LF8 L;  2JA7 H;  3NHH A;  1WCM G;  2R7Z B;  3NUC A;  2B3G A;  3KFU A;  2Z1C A;  3PO3 B;  4JBW A;  4LF7 Q;  3CCR A;  1ET6 A;  1MIU A;  2R3Z A;  4MTK A;  1CSQ A;  3MVV A;  1LTL A;  3LNN A;  3V2T A;  3J81 i;  2RF4 A;  1HR0 W;  4ULL A;  1HNZ L;  1SNP A;  3CCV A;  3RN2 A;  3NSW A;  3A5Z B;  3EN2 A;  4XIG S;  1TWH H;  2KOL A;  1HZB A;  4L5T A;  4C1N K;  2M00 A;  1YIJ A;  3HOU G;  2MHV A;  1WTW A;  1N8R C;  5M5W B;  2EZV A;  5CC4 A;  3I4N B;  1WD0 A;  3Q22 A;  1O7I A;  3H6M A;  3AQQ A;  1A63 A;  2RKS A;  2WKD A;  1K8M A;  1AZP A;  1JB3 A;  3HFZ B;  2JA5 G;  4JCV E;  2V1C C;  2QCP X;  2RSO A;  4P75 A;  4LF8 Q;  1RTO A;  4NB3 A;  3I4L A;  1A3V A;  5JPN C;  3PUZ A;  2X6G A;  3BVZ A;  1I6H B;  2CH4 A;  4OHJ A;  4JK1 C;  1VQO A;  1F2L A;  4FF2 A;  4XTC S;  1HNZ Q;  2ZXP A;  2J4X A;  4KK7 A;  1FNU A;  1SYF A;  5CV8 A;  2OEO A;  4HJ8 A;  4JOI A;  1QE6 A;  1TXY A;  1HJP A;  3ERQ A;  2CW0 D;  5IYB G;  1SYB A;  4TKO B;  4IUN A;  3ZYY X;  1PMR A;  1NUC A;  3VR5 A;  5M3M G;  4EX5 A;  2F0E A;  3A0J A;  2L4N A;  1LAB A;  4FXD A;  1Q90 A;  2K32 A;  2A68 D;  2X69 A;  3OIQ A;  3T16 A;  1B50 A;  3M9B A;  1V9P A;  1KLG D;  4APV A;  1JMC A;  2BA0 A;  1WVL A;  1STN A;  1EQV A;  3KOJ A;  4C3J B;  1K83 B;  4IPH A;  5D14 A;  3SR1 A;  1WTO A;  4POF A;  1BBW A;  1GUW A;  1EY4 A;  4IAL A;  2ENB A;  1EWI A;  3FPU B;  4HSP A;  3H91 A;  4H0L C;  1BXT A;  3A7L A;  5K36 G;  1GUO A;  3TZD A;  1E1O A;  3PUY A;  4IO9 A;  1YHA A;  3DWQ A;  2E2D C;  1A62 A;  4L63 B;  4JW0 A;  4HJ5 A;  1S72 A;  4DGZ A;  3AYH B;  4NW2 A;  4A3K G;  1BBU A;  1B70 B;  5GAH C;  1FVI A;  4A3M H;  2DJF C;  1JE4 A;  2A73 B;  4DAV A;  1SE2 A;  2KEE A;  4BBS B;  1F2Z A;  1S5B D;  4BBR B;  3T1H L;  3H0G H;  3CP0 A;  3NBH B;  3HOV H;  5JJL A;  2B63 G;  4LF4 Q;  2JA7 B;  2IHE A;  2Q8I B;  4OO1 H;  3NQI A;  1RDP D;  3MFG A;  3H3V I;  4OWW B;  3HP3 A;  2DGY A;  1YHB A;  2E2J B;  4C3I G;  1V1O A;  1BQQ T;  5COR A;  3K7A B;  5G3L D;  1BVS A;  3U58 A;  4FF1 A;  1TWH B;  1WCM H;  3BVM A;  1VQG A;  1WFQ A;  4NXN L;  1Y8O B;  3K8A A;  1YVC A;  4PNY A;  3X3N A;  5IGC A;  3K0X A;  3T1H Q;  4NKL A;  2JP1 A;  3UE1 A;  3ONA B;  1N34 L;  4JC0 A;  5EPK A;  4DK1 A;  3HOU H;  5E1F A;  1STA A;  3BZC A;  2K28 A;  3A74 A;  4I7A A;  4K5X A;  1JOQ A;  1ASZ A;  3GTQ H;  4G4K A;  4JG2 A;  4PQX A;  2JA5 H;  3SDZ A;  2IY5 B;  2RVL A;  1F9P A;  3CCJ A;  4MNO A;  2NVT H;  1D2B A;  4IPG A;  4JI0 Q;  3ULL A;  3CD6 A;  1XPR A;  4NXN Q;  4UY8 C;  4IJL A;  3KDF B;  3LWE A;  4DV2 Q;  1UE5 A;  2E2H H;  2Q8R E;  4X6A H;  1L0X B;  4Z9C B;  1X54 A;  3I56 A;  4JI2 L;  2BH2 A;  4RCO A;  1OTC A;  1OXT A;  2E5L Q;  1N34 Q;  3F2B A;  1LTT D;  5BN5 A;  4DAP A;  5IYB H;  1AW7 A;  1HNX L;  2SDF A;  3DM3 A;  5M3M H;  1NMG A;  4GN4 B;  3FP9 A;  1RJT A;  1TWG H;  1HFN A;  2KVM A;  2K5Q A;  5DM6 3;  2JA9 A;  3QR8 A;  4UHV A;  4BWG B;  4GKJ L;  1ENC A;  1BF4 A;  5L37 A;  3VR2 A;  3F8T A;  1V1Q A;  1WTV A;  5GAG C;  3OMC A;  4DR6 L;  3JC6 6;  4GNX A;  1Q1E A;  2SOB A;  5CV6 A;  4WFN 3;  3GV3 A;  2CQO A;  3M7G A;  2CVR A;  4JI2 Q;  5DAU A;  5IP9 G;  4XYQ A;  4BS9 A;  3EBE A;  5FLM G;  1F77 A;  2AUK A;  5K36 H;  2UXC L;  4DV6 Q;  1AE2 A;  1O7Y A;  3H15 A;  2Q2U A;  4A3M B;  4N8X 1;  4KV6 A;  2VW9 A;  1Q46 A;  3HOZ G;  2HQE A;  4C2M H;  3QOJ A;  1HCZ A;  3HS0 C;  3H0G B;  5C44 G;  4DV4 L;  2F0N A;  3I4M B;  4A3K H;  2NBF A;  2HD3 A;  2K75 A;  1SNQ A;  3K58 A;  4FF3 A;  3A8I E;  4R4I A;  1B53 A;  4LWC A;  3T4A C;  2WAQ B;  5LL6 S;  2KEN A;  2NZO A;  2TMP A;  4DR4 L;  3FPP A;  2CWA A;  4DNR B;  3PMF A;  4K14 A;  2JEB I;  2KBN A;  2B63 H;  2UXC Q;  3I90 A;  1YI2 A;  4FXG C;  1WCM B;  1QVG A;  3AEV A;  1ENF A;  1S5F D;  3EA6 A;  4YHH L;  1ASY A;  2R7Z G;  4ZUJ A;  4DV4 Q;  3JAM L;  1SFO H;  4C3I H;  5KYI A;  2NZH A;  4R4O A;  1SJE D;  1QNK A;  4M1U B;  3URY A;  4XQJ A;  3S1Q B;  2QEX A;  3HOU B;  1HR0 Q;  5IYC G;  3CC2 A;  4XYO A;  4G7H C;  1A15 A;  2B2V C;  2F3V A;  1UEA B;  1VQA A;  3TSS A;  2A74 C;  2DUD A;  1RKN A;  1LM0 A;  1ESF A;  2MO0 A;  4MTN A;  1VQE A;  1V8Q A;  2JA5 B;  2GN5 A;  4BY1 G;  2JA6 G;  5EBD A;  4DNI A;  2NVT B;  2IT1 A;  2HQL A;  3I4O A;  3TP6 A;  2B2W C;  3Q6S A;  1D1K A;  2E2H B;  1STH A;  4QUC A;  4YIJ A;  1DOM A;  3RR5 A;  4R8N A;  5IOC A;  2NTT A;  4LNQ A;  1CFM A;  1Q3L A;  4LUV A;  1EL0 A;  1SBB B;  1YIT A;  2RBM A;  5M3F G;  3T1Y Q;  4P72 A;  2L5T A;  1NCV A;  2ES2 A;  4LF6 Q;  2Q2T A;  4DUY L;  4O42 A;  1X56 A;  4GS3 A;  1E24 A;  5M3M B;  1EY0 A;  1PTO F;  4DK0 A;  4YY3 Q;  1GUS A;  1QNU A;  1TWG B;  2KHJ A;  4P2C B;  1PH9 A;  3VR4 A;  2F0T A;  2E75 C;  1MKH A;  2A19 A;  3CW2 C;  1JQY D;  3ND9 A;  4DR1 L;  5FK9 C;  1XNR L;  5D3D A;  5E3F A;  5J39 A;  2FJ2 A;  1I3Q H;  3K81 C;  4ZKC B;  5EPJ A;  4AQY L;  3W5O A;  4AH6 A;  3G71 A;  3TME A;  2N78 A;  2CWP A;  4KHP L;  1LT3 D;  5FKA C;  3OOC A;  1U4R A;  1FJG L;  4WOR A;  4DUY Q;  3CCS A;  4C2M B;  1IBK Q;  5I6W A;  4XDX A;  4YWM A;  5IP9 H;  1DZ1 A;  5FLM H;  1EYD A;  2R92 B;  5C0X I;  1XMQ L;  2H4O A;  1WI5 A;  1HA5 A;  3KK7 A;  1G8Z D;  1IBL L;  2NN6 G;  3BJU A;  3BZK A;  4DV0 L;  1PYS B;  4CKE A;  2LXK A;  2D9U A;  5ELO A;  1ICF B;  3MWY W;  3HOZ H;  4X66 L;  1L1O C;  4DR1 Q;  2I5H A;  5C44 H;  2PQA A;  4BBS G;  3KUP A;  1V43 A;  2BCO A;  2UUC Q;  4OGQ C;  3M4O H;  3L9A X;  2I5L X;  4BBR G;  4DU9 A;  4AQY Q;  4R4T A;  2BDN A;  4JI4 L;  2F0M A;  4GKK L;  1KRS A;  4A3I B;  1PLF A;  3I73 A;  1FJG Q;  1C0A A;  3OIP A;  4MIU A;  1JOO A;  5H1S E;  2AKW B;  1QWY A;  2JK8 A;  5C4H A;  3L3O C;  1SFO B;  2QDL A;  1CA5 A;  1SYE A;  1SXT A;  3PCO B;  1NNX A;  3MEF A;  5FLX E;  1HNW L;  2NVQ H;  2XWJ B;  4K8J A;  1KDB A;  5LMN L;  3D8G A;  2QA4 A;  3D3R A;  2K50 A;  3D6W A;  3PSI A;  4A3F B;  2PQA B;  1Y14 B;  1TS2 A;  2WB1 E;  4X66 Q;  2R7Z H;  3PO3 H;  4HED A;  1SNO A;  1LYL A;  3RLN A;  4FP5 D;  1UE1 A;  1QZH A;  2HDL A;  3DXJ C;  1TWF H;  4JI3 L;  3VDY A;  5C5M A;  1EY6 A;  2C35 B;  5IYC H;  2RSN A;  3SXH A;  1SLJ A;  2AWO A;  4IUU A;  3M3Y H;  1I94 L;  1MSH A;  4RGT A;  4ZRZ A;  1MD2 D;  2E2I H;  1GOZ A;  3PO2 G;  1F9Q A;  4OX9 L;  2L9H A;  3HZX A;  4BY1 H;  2JA6 H;  4F87 A;  1JIC A;  2Y0S G;  2VB2 X;  1VQI A;  4N9T A;  2UXB L;  4L8J A;  2EY1 A;  2K33 A;  1LTA D;  5T1G A;  2YYZ A;  1PTO C;  4R4C A;  4OXP A;  1PH4 A;  1HUM A;  5LMU Q;  1EOV A;  2WB1 G;  2ICI A;  4QGU A;  5EJW A;  4H02 A;  3EVQ A;  3RUZ A;  1I6H H;  1XWE A;  3EJI A;  4OIK A;  4TRD A;  5IYD G;  2PMZ B;  4DAM A;  3TS0 A;  4JI3 Q;  4LW1 A;  4JBJ A;  5M5X H;  2QF7 A;  2WIN B;  1K3B C;  2FHT A;  2C5C A;  4L5Q A;  5CBA E;  1S5D D;  1VQP A;  2V4D A;  2XSC A;  5M3F H;  1U0L A;  2I07 B;  2F52 A;  3UDI A;  1I94 Q;  3GTK H;  3CHB D;  2Z6K A;  5J3B A;  1B8A A;  1SMX A;  4RGM A;  3JAM i;  1VDZ A;  2D5D A;  4P74 A;  5ELF A;  4K6D A;  2UXB Q;  2B29 A;  4KY6 A;  1VQK A;  1KAA A;  1UE6 A;  3W1B A;  2GA4 B;  3MXN A;  2AQ2 B;  1PH8 A;  4HCE A;  1I6V C;  1SE4 A;  1DD2 A;  3PUX A;  1SYC A;  1I4R A;  2CH4 W;  2QW7 A;  3CU7 A;  3VA7 A;  2EIF A;  3KF8 B;  4XT3 B;  3HKZ B;  1ILP A;  2LMC B;  4K5V A;  1T9H A;  1OXS C;  3J81 E;  1VQ6 A;  1VMP A;  1WTH A;  3D4D A;  3KJO A;  1AE3 A;  3HOZ B;  3E9I A;  2A8V A;  1M4V A;  3PUV A;  3ZJY C;  1C4Q A;  2F4I A;  1JE5 A;  4XQN A;  3M4O B;  1QOH A;  1SJH D;  2AMC B;  3J7Z C;  1LTS D;  2KQ3 A;  3I4M G;  1HZA A;  2NN6 H;  1X3E A;  1X65 A;  1NE3 A;  2E74 C;  3W1G A;  1XTC D;  2HUG A;  4BBS H;  3VR3 A;  2OXP A;  2NVQ B;  1LTI D;  4BBR H;  1LTG D;  1U4L A;  1KNA A;  1ROD A;  2NVY H;  5C5L A;  4LUZ A;  1GM5 A;  1TVX A;  1J8I A;  4YWL A;  4LJZ C;  1CHP D;  3WOF A;  3MAQ A;  4YCW A;  5HY6 A;  3T13 A;  3QOL A;  1TWF B;  3KBG A;  2NWG A;  5IWA L;  3MXP A;  3BG3 A;  4UP7 A;  2E2J H;  4EGV A;  4PV1 C;  5IP7 G;  4O2D A;  3A56 A;  1D5Z C;  3K7A H;  1WJJ A;  3M3Y B;  1NBW A;  1B2T A;  4X65 L;  4EVO A;  4I7Z C;  1GJX A;  1B7Y B;  2E2I B;  1G6Z A;  2MUY A;  4A3G G;  1PH3 A;  1E1T A;  2JE6 I;  4P73 A;  4BY1 B;  2JA6 B;  2VZA A;  1MSG A;  3OHX C;  1VQH A;  3L2P A;  1HZ9 A;  4ABN A;  1PA6 A;  1EFW A;  2OTJ A;  1GKH A;  4KHZ A;  5JJZ A;  1GUN A;  1N36 Q;  3OWF A;  2N8N A;  4TVA B;  1EYC A;  3E0J A;  4AYB E;  4GZY C;  4ZQ3 A;  1B4O A;  3E9H A;  5IWA Q;  5EAY A;  1KTK A;  2HT1 A;  2SNM A;  2WKC A;  1SAP A;  5M5X B;  2Z4I A;  3GDE A;  5M3F B;  1EOT A;  4XQQ A;  3H3V C;  4X65 Q;  3K0Y A;  3GTK B;  1B9N A;  3DLL A;  4K2K A;  4HAE A;  4ILW A;  5A2Q L;  1KD1 C;  4CHT B;  1BUV T;  4IQZ A;  5IYD H;  3MA2 B;  1PFN A;  4RMF A;  3S2D H;  1HA6 A;  4G57 A;  1PTO B;  2MQH A;  1KQS A;  1QG7 A;  4JVZ A;  4N9P A;  1VF7 A;  3DEO A;  3NEN A;  1I4H A;  1SNM A;  2QDB A;  1KXL A;  4ZUI A;  2XVS A;  4AYB G;  5C3W A;  3Q0A A;  1VQ7 A;  1PFS A;  1IBM L;  3PF5 A;  2IL8 A;  2TSS A;  1AFP A;  2XRQ D;  1UAP A;  3DWP A;  5FLX c;  3RN5 A;  1IHZ A;  1C7Y A;  4DA2 A;  3CRL C;  3ICE A;  3DWA A;  4DF7 A;  2YU9 B;  1EU3 A;  1PV4 A;  4JBM A;  4LF4 L;  1A0I A;  1DJR D;  3NBH A;  4HSV A;  4YWK A;  4OON A;  1C9O A;  4QIW B;  4NMZ A;  2EJG C;  2L0C A;  3VR6 A;  4QB4 A;  2NYZ D;  1VQ5 A;  5FO8 B;  4QJF A;  1HZC A;  1O7L A;  5CBE E;  2AWN A;  2BDO A;  3CMA A;  1GUG A;  1UEB A;  1E0B A;  3K59 A;  2R92 G;  1QIL A;  4QUF A;  4X3S A;  1TY2 A;  1A8V A;  1YHQ A;  3G6J B;  1TKW B;  5KND A;  2K1B A;  1J5E L;  1PTO D;  4ZKB B;  3CME A;  2L11 A;  3I91 A;  4DR7 Q;  1IBM Q;  3ITP A;  1M8A A;  4A76 A;  1KNE A;  4AIM A;  3A7A B;  2IJ0 A;  1IKL A;  4NDX A;  3I4M H;  3SE0 A;  5I4D A;  1JOK A;  4MN3 A;  1W6J A;  2NVY B;  2Z6B A;  5C0X J;  3U9S A;  3CCL A;  1X55 A;  1L0Y B;  4X3T A;  4A3I G;  1SRO A;  3J80 L;  1UUP A;  3TP7 A;  4KHV A;  2IW3 A;  1IW7 C;  3O13 A;  3RZO B;  3S1N B;  4WRD A;  4CKC A;  1ICW A;  2Z9H A;  4HTH A;  3RNU A;  1JJC B;  1TS5 A;  3AU7 A;  4X3U A;  4GLX A;  4PZ7 A;  5IIF A;  1DYQ A;  1J5E Q;  1CUK A;  4O0A A;  4JYA L;  3G7L A;  4JI0 L;  1YJ9 A;  2ZJQ A;  3G6E A;  4DV2 L;  4DUZ Q;  1B3A A;  3ND8 A;  4A3F G;  4TSS A;  1UNS A;  3KDF A;  1Z47 A;  5K5P A;  5IP7 H;  1H9M A;  1VS0 A;  3Q24 A;  2E5L L;  2DJG C;  1W3S A;  3NTH A;  2PMZ E;  5IT9 L;  3ULP A;  4LFA L;  3S1Q H;  3L7Z C;  5C3X A;  2B2U C;  1TII D;  3PO2 B;  1YJW A;  4A3G H;  1SDF A;  3S2H H;  2RHQ B;  5KRU A;  1AH9 A;  3PIO 3;  2Y0S B;  2DY7 A;  2MGS A;  1Q86 C;  1QVC A;  2EJF C;  5E7N A;  5J22 A;  4FYD A;  3MEH A;  4UPA A;  3NEM A;  5CV9 A;  5HGQ A;  2WB1 B;  2KUM A;  3KF6 A;  4HMJ A;  4JYA Q;  4GOP C;  3FRP B;  4YCV A;  1PH1 A;  1QCB D;  1PVO A;  5COY A;  2EOT A;  4A3L G;  3S2D B;  1LAC A;  3E5S A;  3LWU A;  2HDM A;  5C4J H;  2ZXR A;  3HKZ E;  3GP7 A;  4DV6 L;  2M2L A;  2VY3 A;  4HIO A;  3KJP A;  3EQL C;  3E0E A;  4LFA Q;  3MC0 B;  4OO1 I;  3OPO A;  4KLK A;  1VQB A;  3R3O A;  3NP8 A;  4CDE C;  4WJ3 M;  1M90 C;  4B08 A;  4F7X A;  3ULJ A;  3R2T A;  3SK6 A;  1BNZ A;  4GLV B;  3K57 A;  3KF6 B;  1G29 1;  4JI8 L;  4Q5V A;  1DXM A;  3HOW B;  2B8F A;  2LSS A;  1HRJ A;  5I2X A;  1K8O A;  4FNF A;  4Q0F A;  2BH8 A;  1YEZ A;  4B3S L;  1SSO A;  2HCI A;  1TY0 A;  4A3D G;  1FNW A;  4DV5 L;  3NBI A;  3VYU A;  3HKZ G;  1CSP A;  4ZYS A;  1EIY B;  2PZU A;  2A6H C;  3CCE A;  2I0Q A;  4J15 A;  5EPL A;  4B3M L;  1Q12 A;  1K28 A;  1CZG A;  2DNC A;  2EYP A;  1Z6H A;  1NSN S;  1VCI A;  3OW7 A;  2PNH A;  2R7D A;  3RMH A;  3IAY A;  2R93 G;  5HGT A;  2R92 H;  4KKU A;  4JI8 Q;  3TEH B;  3OWE B;  2Z8L A;  3SK8 A;  4DK6 C;  4EQN A;  2EY6 A;  3I7F A;  1HR0 L;  3IL8 A;  3F2C A;  3F2U A;  1JWS D;  2DY8 A;  3GD7 A;  4B3S Q;  1ZYR C;  4R1J A;  1CM9 A;  3F2D A;  5M5Y B;  1ILQ A;  4RGO S;  4DV5 Q;  2WAC A;  3NQT A;  1L0W A;  1STY A;  2PW7 A;  2VQE L;  3NXW A;  2F0G A;  4DR5 L;  5D65 A;  2VUM B;  4OWT B;  1A2T A;  4DAY B;  1MJE A;  4A3I H;  4B3M Q;  4RG1 A;  4IN3 A;  5AJ3 Q;  5D3I B;  3TS2 A;  5FO9 B;  3BZD B;  3M4Y A;  4F8M A;  4BY7 G;  1GVP A;  1D5M C;  1ONL A;  5CV5 A;  3CC4 A;  3GTP B;  4QL5 A;  1B1Z A;  1CKM A;  1X3P A;  1STG A;  1EZ8 A;  4X62 L;  1IL2 A;  1FR3 A;  5J1Z A;  3UI2 A;  3HOX G;  1FGB D;  4H13 C;  4A3G B;  3T1Y L;  2B2T C;  4EQP A;  1CA6 A;  4A3F H;  4LF6 L;  3S2H B;  1QJO A;  2A69 C;  1KLU D;  2XTI A;  2KHI A;  4YY3 L;  5DNF A;  1MI2 A;  1K8A C;  2EYJ A;  2RHS B;  2VQE Q;  2CKZ B;  3P7J A;  4X64 L;  4DR5 Q;  1YJN A;  4K2L A;  4DN4 M;  1Y1W B;  2E8G A;  1NY4 A;  2I5M X;  5C4J B;  5BN4 A;  1OXU A;  4ME3 A;  3V05 A;  4X62 Q;  1Z7T A;  5KEE A;  2A6E C;  2L15 A;  4K6L A;  3MTS A;  1PZK D;  4B3R L;  2ASB A;  1X3G A;  3J80 i;  4GLA C;  1STB A;  3OSO A;  5BR8 Q;  1IBK L;  4QIW E;  5CV4 A;  4A3L H;  4LFB L;  1IW7 D;  4KTA A;  2ZM6 L;  1R4P B;  3S9W A;  2KCT A;  1EIF A;  1HTL D;  1D7Q A;  4X64 Q;  2HIV A;  4HN7 A;  2SNS A;  5C3E G;  3HG9 A;  4AYB B;  1EQT A;  1EUJ A;  1ZXT A;  1FL0 A;  1U4P A;  3MXU A;  4R8I A;  1D8L A;  3STB C;  4CGY B;  2PO4 A;  2UUC L;  1N33 L;  1AEX A;  2PZT A;  4U68 A;  5JVG 3;  2AUJ D;  3FDT A;  4QQB X;  5JEA J;  4KY5 A;  2VNU D;  4B9X A;  2ZJR A;  2KEC A;  1RCV D;  4B3R Q;  2YV5 A;  1XNQ L;  4LFB Q;  4RKB A;  1KL9 A;  4A3D H;  2ZM6 Q;  4IFD G;  1CHQ D;  2MNA A;  1EWC A;  1L2F A;  4LMQ D;  1PH2 A;  3TRZ A;  3D31 A;  1EU4 A;  1FNV A;  1H95 A;  3GTG H;  3X3M A;  3ERS X;  3TBI B;  1E7Z A;  2XIW A;  2IWH A;  2NZ1 D;  4UAI A;  5E4X A;  2R93 H;  2R6G A;  1N33 Q;  3RZD H;  1U5K A;  4XXE A;  5I9O A;  3DUZ A;  1F2Y A;  3RD4 A;  2CFM A;  3A54 A;  3N6R A;  5DEH A;  3OW2 A;  1GHJ A;  1PRT F;  1XNQ Q;  2F0F A;  2WFW A;  1TR5 A;  4LUO A;  4OEM B;  1TWC H;  4Y7N H;  4IUQ A;  4JBK A;  2JJQ A;  3C2P A;  2G5D A;  2CQA A;  2J0T D;  1EY5 A;  3TN2 A;  3I8Z A;  2NUC A;  2Y0S E;  2EXD A;  1A2U A;  4DV7 L;  1PZI D;  5KIX A;  2K5V A;  1EY9 A;  1OXV A;  1KIX A;  1NR2 A;  5LHY 1;  5LMU L;  1T5X D;  1QUQ B;  2OF1 A;  4IJH A;  5KNB A;  3CF5 A;  4BY7 H;  2WP8 J;  4A4I A;  4LK1 C;  1H9J A;  2B8G A;  3P20 A;  4FF4 A;  1GHK A;  4CKB A;  3JAM E;  4GN3 B;  4IUT A;  1OXX K;  5EBC A;  1XPU A;  2J7Z A;  1C48 A;  3UE0 A;  1PH5 A;  5IOD A;  2K6A A;  2B2W A;  2DN8 A;  4KMU C;  3HOX H;  2A6H D;  1ET9 A;  1EYG A;  3HOY G;  1ML0 D;  3BYT B;  4H7B A;  4EQO A;  2UUB Q;  2OT2 A;  1HPC A;  2D0P A;  4OL7 A;  1BKB A;  2JSO A;  2B39 A;  2CHB D;  1Q7Y C;  3IFT A;  2F4V Q;  4DV7 Q;  1DGS A;  3SEB A;  1D6E C;  2PPB C;  4CDC C;  3MXG A;  1EZ6 A;  2AQ3 B;  4DV1 Q;  1X3Q A;  1ZYR D;  5DM7 3;  1NR4 A;  1SE8 A;  2K01 A;  3KF8 A;  3RLO A;  2SEB D;  1SRU A;  4PMC A;  4PZ8 A;  4LF9 Q;  4PMB A;  4DR2 L;  1KC8 C;  4KKT A;  2K5N A;  2F0O A;  3GV6 A;  5A35 A;  4NXM L;  1TU2 B;  2D0O A;  1F9R A;  2EYF A;  2F0I A;  2LFN A;  2MO1 A;  3UDG A;  3J81 j;  4KN7 C;  2OCE A;  1PTO H;  2F03 A;  1KRT A;  4LAA A;  2X6L A;  5C3E H;  3T51 B;  4KI0 A;  4JI1 L;  3DEP A;  2XWB B;  1GXD C;  1JCK B;  5FO7 B;  1LT4 D;  1STE A;  4DNT B;  3HOW G;  1BCP F;  1JC7 A;  4IOA A;  3PIO A;  2K7V A;  2RQX A;  4U67 3;  4A3D B;  1QB5 D;  2A69 D;  4JOI C;  1J9O A;  1PHJ A;  2F0V A;  2PI2 E;  2F0K A;  1S4Z A;  4RA8 A;  1IYJ B;  1ZKO A;  1DOK A;  1SMY C;  2JA8 G;  3K5L A;  2YU9 H;  4BXX G;  2IX3 A;  4DR2 Q;  1VQC A;  4XT1 B;  3GTG B;  5JAV A;  4NXM Q;  1CQV A;  4KJN A;  4IFD H;  2R93 B;  1V1P B;  2OQ0 A;  2YTX A;  3RZD B;  4L6T B;  3NWT A;  4IUR A;  1W6K A;  1PRT C;  3QG1 A;  4JI1 Q;  2UUA Q;  4C3H G;  4HCS A;  3I3C A;  2A6E D;  1CZW A;  3L0O A;  2K52 A;  2F0P A;  1HTP A;  4KY7 A;  1BO0 A;  3S17 H;  1TWC B;  4Y7N B;  3NEL A;  1IXR A;  2NVX H;  3NK9 A;  3RLF A;  1SE3 A;  1HH2 P;  4B3T Q;  3VYT A;  4A3J G;  3S1M H;  1EWH A;  2VL6 A;  1L1O B;  2RDG A;  2L1B A;  1CQF A;  1WTX A;  5EKI A;  1N36 L;  4CJ2 C;  1G2T A;  4UDU C;  2VUM G;  4BY7 B;  3DM1 A;  3STB D;  1DCZ A;  2EVB A;  3RZO H;  1VMC A;  3S1N H;  4HIK A;  5E4W C;  3I55 A;  2OTL A;  1HHV A;  2KCC A;  2O5J C;  2K03 A;  3A8J E;  3HOX B;  1IYU A;  4KN4 C;  5C6A A;  4CDD C;  3WDN A;  4IOC A;  4A3E G;  1TWA H;  4YCU A;  1PZJ D;  4R9W A;  2YTV A;  2EYH A;  2Z4H A;  1G2S A;  5FOB B;  3AFQ A;  5IY0 A;  1WTR A;  3ER0 A;  3GTJ H;  5ELD A;  3HOY H;  4IFD I;  4HMI A;  1M1K C;  3PO2 H;  2O2L D;  5EGT A;  3KBX A;  1YBY A;  3K6O A;  1P16 A;  2JN4 A;  2F3W A;  2NN6 I;  3P1H A;  5M9O A;  1Y1W G;  2XGT A;  4K0K Q;  1RIP A;  3QJY A;  1EFI D;  1F9S A;  3SHL A;  2ID0 A;  3R93 A;  2B2Y A;  1VQ4 A;  1QVF A;  1O80 A;  2K5H A;  1YNN C;  3W2D A;  1PYB A;  4JI7 L;  2O4X A;  3BS1 A;  4TQU S;  3TDQ A;  1LT5 D;  5C3E B;  1BCP C;  1KAW A;  3CQZ H;  4CDF C;  1GUT A;  4OWX B;  4IUV A;  1VQ9 A;  2MPM A;  4A93 G;  3BYY B;  4DR7 L;  1MHW C;  2JQO A;  1CK1 A;  3PGZ A;  3PUW A;  1VQF A;  2VQF L;  5CYU A;  3G48 A;  3H3V H;  2K04 A;  5KYL A;  4JI6 L;  1EIG A;  1DON A;  3FHW A;  2XRS D;  1EIH A;  2KJX A;  3HEJ A;  3HOW H;  2LXJ A;  3TQY A;  5JVH 3;  1G6P A;  5HUR A;  2UU9 L;  2H5X A;  1I4X A;  1X9N A;  3JAM c;  2NTS A;  4JI7 Q;  4LFC L;  5C4X G;  1JWU D;  5T1I A;  3T56 B;  3TP5 A;  3DHQ A;  1Q8I A;  1RHP A;  1PH6 A;  5EQ0 A;  3FMC A;  2JA8 H;  4BXX H;  1R9T H;  3U50 C;  4M8A A;  2GVA A;  2KCM A;  1E3P A;  1VQM A;  3I2Z A;  3EFX D;  1Y1V G;  3F1Z A;  4FDB A;  3S17 B;  3M85 A;  2NVX B;  2I46 A;  1K9M C;  4DUZ L;  2VQF Q;  1IL8 A;  4KD4 A;  2XN9 C;  4GNX C;  3S1M B;  1CKO A;  3IFD A;  3K5N A;  3K5M A;  4JI6 Q;  1MBY A;  1B3Q A;  4C3H H;  3GTL H;  3PV0 A;  1GD7 A;  4C56 C;  1LTB D;  4A3B G;  2UU9 Q;  4Y52 H;  4HJA A;  3GTM H;  4JI5 L;  1PRT B;  4LFC Q;  3CRK C;  1II3 A;  5M5Y H;  4QMG A;  2PCF B;  2ZT9 C;  4A3J H;  2N49 A;  4L5S A;  1Q8K A;  1EQQ A;  3BDO A;  3WWV A;  2ALY B;  2EPB A;  2D2C C;  2CCZ A;  3KYH C;  1I4P A;  3OTO L;  2VUM H;  1TWA B;  2QGQ A;  4X3K A;  1H9R A;  5FJ8 G;  1Q1B A;  3M4P A;  3PIP 3;  1G51 A;  4KKS A;  3GTP H;  4J1M A;  5EKK A;  3BDC A;  2BA1 A;  3AMU A;  1EEI D;  2VB3 X;  1SMY D;  3C3L A;  3GTJ B;  3HOY B;  1DM0 B;  4S3S A;  2K14 A;  1XMO L;  2ZXO A;  4R4Q A;  4A3E H;  5CR3 A;  4QF4 A;  2PYK A;  5BN3 A;  4JI5 Q;  2XNA C;  4F88 A;  2A5H A;  4J8Q A;  1I4G A;  3OYY A;  5CMD A;  3J81 c;  3QB3 A;  2KCN A;  1A6X A;  2A1A A;  5ELB A;  1PRT D;  5ELC A;  1C8C A;  5C0X G;  3OTO Q;  3KLS X;  5KGU A;  4BA1 I;  3G4S A;  2N88 A;  3UDF A;  1Y1W H;  5IGB A;  5I2Y A;  1TS3 A;  5LMN W;  2WII B;  3FVQ A;  3CQZ B;  3C46 A;  1H9K A;  5JJK A;  1XMO Q;  2DNE A;  1FYC A;  5EKL A;  5GRO A;  2O5I C;  1PH7 A;  1H9S A; 
#chains in the Genus database with same CATH homology
 3U9O A;  5A2Q E;  1Y8N B;  4RFB A;  1AZQ A;  2F0H A;  4B9W A;  2F0J A;  2F1M A;  3OMG A;  2F0W A;  3MFY A;  1WTQ A;  1EYA A;  4RGN A;  4C1N I;  3W3A A;  1BCP B;  1BOS A;  4V19 0;  1TQO A;  4KD3 A;  3QO2 A;  4ID6 A;  2JA8 B;  1R9T B;  1LLR D;  2K05 A;  3I70 A;  4RHS A;  1YNJ C;  3Q23 A;  4KJO A;  2E76 C;  1HQM C;  1IKM A;  1RF2 D;  1H9S B;  4I65 A;  4DAY A;  2KED A;  5AFW A;  4C3H B;  2IX1 A;  3GTL B;  5IGD A;  1BBX C;  1TT2 A;  3D4R A;  5JOB A;  4DXG A;  3GTM B;  1D5X C;  4A3J B;  1YNN D;  1IYV A;  1S5E D;  5IGF A;  1KDC A;  2PW5 A;  1PXU A;  3HOV B;  1BCP D;  5I6Y A;  4FXK C;  4ZK9 B;  1E2V A;  2L55 A;  5IGE A;  2N55 A;  1E2W A;  3J80 E;  4OIJ A;  5TSS A;  3IKJ A;  4K8I A;  2M9V A;  3QIA A;  2KHS A;  5FLX L;  3A8K E;  2B2U A;  4A3E B;  2EDG A;  4CBV A;  1LT6 D;  1B9M A;  1WD1 A;  3R2I A;  4ZLT F;  2FMM A;  3E6Z X;  3ERO A;  4RH6 A;  4MHE A;  1LV9 A;  3QWN A;  2BE5 C;  1NAP A;  3I72 A;  5IT9 E;  3SK5 A;  4QCL A;  2JEA I;  4RHR A;  3TP8 A;  3VA5 A;  2EXZ A;  4J6H A;  3TZU A;  2WV6 D;  3GTQ B;  1F2M A;  4BA2 I;  2HCC A;  3NWS A;  5C0X H;  3C1E A;  2D62 A;  2FMC A;  1CT1 D;  3NTK A;  3HGB A;  3LX0 A;  1CI3 M;  4IFD J;  1U9R A;  3H09 A;  3SK4 A;  2JXM B;  4A93 B;  2KA7 A;  4G7Z C;  2PZW A;  2VXW A;  3GQB A;  2RDH A;  1I4Q A;  1JWM D;  5LL6 X;  1EY8 A;  1HFG A;  2C9O A;  3K5O A;  1XYI A;  4K5W A;  4RWS C;  3S15 B;  5CV7 A;  3DMU A;  5C4X B;  3GO5 A;  3MHB A;  1LTR D;  3VYR A;  4CJ0 B;  4C3J G;  1Y1V B;  3NE5 B;  3J81 L;  2FFK B;  4RCN A;  4NP5 A;  2MP1 A;  2EJM A;  1AP0 A;  1I50 B;  3D4W A;  1HXY D;  2IX0 A;  3VYS A;  2EE1 A;  5G3L F;  1B44 D;  5KNC A;  1JR0 D;  3SVM A;  3BVG A;  4A3K B;  1SND A;  2K5D A;  1PDQ A;  3S16 B;  4FVM A;  2EYL A;  4A3B B;  2R61 A;  4CJ1 B;  4ZAI A;  2MJ8 A;  2LY7 A;  3P75 A;  2BOS A;  3J7Y W;  3GTO B;  2AQ1 B;  4DFA A;  2B63 B;  4ODG A;  5JEA G;  1EY7 A;  1MGS A;  2B2V A;  2B2T A;  1SYG A;  2EYO A;  4ME5 A;  4O1N A;  3S14 B;  2F0Q A;  1OO9 B;  3M7N A;  2CW0 C;  2LS0 1;  1PYW D;  3N52 A;  2PQE A;  4C3I B;  1A3T A;  1BR9 A;  1X32 A;  2EY2 A;  4PMW A;  1SNC A;  1R4Q B;  1D1I A;  2A68 C;  1YNJ D;  2RDF A;  1ESR A;  1LO5 D;  1SEB D;  2PNR C;  4HR7 B;  1PFB A;  1WTP A;  1TS4 A;  5CGK A;  3FEW X;  5IGG A;  1RTN A;  2LKV A;  3R8B A;  2F0D A;  1DOL A;  1Y69 U;  3S1R B;  3J7A V;  1O78 A;  2Q8T A;  2F0S A;  2ICE C;  2L12 A;  4RAU C;  1FD7 D;  3KLR A;  1EEF D;  2F0L A;  2NB0 A;  3CKI B;  3V96 A;  3J7A F;  1HUN A;  2H1E A;  2QIL A;  3D6C A;  5NUC A;  3H94 A;  2QEJ C;  2RA4 A;  1V1P A;  1Y8P B;  2QKI C;  1S5C D;  2K5W A;  4IZ8 A;  1ENA A;  5ISR A;  3NPP A;  1A3U A;  4DXF A;  2B2Y C;  1O7Z A;  2EY5 A;  3C1F A;  1VF5 C;  3KLS A;  1I3Q B;  1E2Z A;  2BE5 D;  1HQR D;  4H44 C;  3NTI A;  1ZEQ X;  1PFM A;  2F0U A;  4RKL A;  4G7O C;  3HRZ C;  2G9D A;  5JPM C;  4FO2 A;  3WOE A;  4E6I A;  2EYM A;  3BDL A;  1G91 A;  1RD9 D;  5I9P A;  5C4Z A;  5C44 B;  5ELE A;  2G9H D;  1XXG A;  2IPK D;  4IUP A;  1T5E A;  1KAB A;  1U4M A;  4WJW A;  2FIN B;  2JYO A;  3FKI B;  1BDO A;  3A55 A;  1AN8 A;  1KDA A;  4OO1 G;  1JOR A;  5JEA H;  1SYD A;  1XX8 A;  3T53 B;  5F2D A;  1CTM A;  3MZ5 A;  3AB9 A;  4V0B A;  3NHH A;  2R7Z B;  3NUC A;  2Z1C A;  3PO3 B;  4JBW A;  1ET6 A;  2R3Z A;  3MVV A;  3LNN A;  3V2T A;  4ULL A;  1SNP A;  3NSW A;  4XIG S;  2KOL A;  4C1N K;  2M00 A;  2MHV A;  1WTW A;  5M5W B;  2EZV A;  5CC4 A;  3I4N B;  1WD0 A;  3Q22 A;  3H6M A;  2RKS A;  2WKD A;  1K8M A;  1AZP A;  1JB3 A;  2QCP X;  2RSO A;  1RTO A;  3I4L A;  1A3V A;  5JPN C;  3PUZ A;  2X6G A;  3BVZ A;  1I6H B;  4OHJ A;  4JK1 C;  1F2L A;  4FF2 A;  4XTC S;  2ZXP A;  2J4X A;  4KK7 A;  1FNU A;  1SYF A;  5CV8 A;  2OEO A;  1QE6 A;  3ERQ A;  2CW0 D;  1SYB A;  4TKO B;  4IUN A;  3ZYY X;  1PMR A;  1NUC A;  3VR5 A;  2F0E A;  2L4N A;  1LAB A;  4FXD A;  1Q90 A;  2K32 A;  2A68 D;  2X69 A;  3OIQ A;  3T16 A;  1B50 A;  1KLG D;  2BA0 A;  1WVL A;  1STN A;  1EQV A;  4C3J B;  1K83 B;  5D14 A;  3SR1 A;  1WTO A;  1GUW A;  1EY4 A;  4IAL A;  2ENB A;  3FPU B;  4HSP A;  3H91 A;  4H0L C;  1BXT A;  3A7L A;  5K36 G;  1GUO A;  3TZD A;  3PUY A;  3DWQ A;  2E2D C;  4L63 B;  4DGZ A;  4NW2 A;  1JE4 A;  2A73 B;  4DAV A;  1SE2 A;  2KEE A;  4BBS B;  1F2Z A;  1S5B D;  4BBR B;  2JA7 B;  2Q8I B;  4OO1 H;  3NQI A;  1RDP D;  3MFG A;  3HP3 A;  2E2J B;  4C3I G;  1V1O A;  1BQQ T;  5COR A;  3K7A B;  5G3L D;  4FF1 A;  1TWH B;  3BVM A;  1Y8O B;  4PNY A;  3X3N A;  5IGC A;  4NKL A;  2JP1 A;  3ONA B;  5EPK A;  4DK1 A;  5E1F A;  1STA A;  2K28 A;  4K5X A;  1JOQ A;  4G4K A;  4PQX A;  3SDZ A;  2RVL A;  1F9P A;  1D2B A;  3LWE A;  2Q8R E;  1L0X B;  4Z9C B;  4RCO A;  1OXT A;  1LTT D;  5BN5 A;  4DAP A;  1AW7 A;  2SDF A;  1RJT A;  1HFN A;  2KVM A;  2K5Q A;  5DM6 3;  4BWG B;  1ENC A;  1BF4 A;  3VR2 A;  1WTV A;  3OMC A;  1Q1E A;  2SOB A;  5CV6 A;  4WFN 3;  3GV3 A;  3M7G A;  2CVR A;  5DAU A;  4XYQ A;  4BS9 A;  1F77 A;  2AUK A;  5K36 H;  1O7Y A;  4A3M B;  4KV6 A;  2HQE A;  3QOJ A;  1HCZ A;  3HS0 C;  3H0G B;  2F0N A;  3I4M B;  2NBF A;  1SNQ A;  3K58 A;  4FF3 A;  3A8I E;  1B53 A;  3T4A C;  2WAQ B;  5LL6 S;  2TMP A;  3FPP A;  4DNR B;  3PMF A;  4K14 A;  2JEB I;  3I90 A;  4FXG C;  1WCM B;  1ENF A;  1S5F D;  3EA6 A;  4ZUJ A;  3JAM L;  5KYI A;  1SJE D;  1QNK A;  4M1U B;  3URY A;  4XQJ A;  3S1Q B;  3HOU B;  4XYO A;  4G7H C;  1A15 A;  2B2V C;  2F3V A;  1UEA B;  3TSS A;  2A74 C;  1RKN A;  1ESF A;  1V8Q A;  2JA5 B;  5EBD A;  2NVT B;  2IT1 A;  3TP6 A;  2B2W C;  3Q6S A;  1D1K A;  2E2H B;  1STH A;  4QUC A;  4YIJ A;  1DOM A;  4R8N A;  5IOC A;  2NTT A;  1CFM A;  1Q3L A;  1EL0 A;  1SBB B;  2RBM A;  2L5T A;  1NCV A;  4O42 A;  5M3M B;  1EY0 A;  1PTO F;  4DK0 A;  1GUS A;  1QNU A;  1TWG B;  4P2C B;  3VR4 A;  2F0T A;  2E75 C;  1JQY D;  3ND9 A;  5FK9 C;  5D3D A;  5E3F A;  5J39 A;  2FJ2 A;  4ZKC B;  5EPJ A;  3TME A;  1LT3 D;  5FKA C;  3OOC A;  1U4R A;  4WOR A;  4C2M B;  5I6W A;  4XDX A;  1DZ1 A;  1EYD A;  2R92 B;  5C0X I;  2H4O A;  1HA5 A;  3KK7 A;  1G8Z D;  2NN6 G;  4CKE A;  2D9U A;  3MWY W;  3KUP A;  1V43 A;  2BCO A;  4OGQ C;  3L9A X;  4DU9 A;  2BDN A;  2F0M A;  4A3I B;  1PLF A;  3I73 A;  3OIP A;  4MIU A;  1JOO A;  1QWY A;  5C4H A;  3L3O C;  1SFO B;  1CA5 A;  1SYE A;  1SXT A;  5FLX E;  2XWJ B;  4K8J A;  1KDB A;  3D8G A;  3D3R A;  3D6W A;  4A3F B;  1TS2 A;  4HED A;  1SNO A;  4FP5 D;  2HDL A;  3DXJ C;  5C5M A;  1EY6 A;  2RSN A;  3SXH A;  2AWO A;  4IUU A;  1MSH A;  4RGT A;  4ZRZ A;  1MD2 D;  1GOZ A;  1F9Q A;  2L9H A;  3HZX A;  4F87 A;  1JIC A;  2VB2 X;  4N9T A;  4L8J A;  2EY1 A;  2K33 A;  1LTA D;  5T1G A;  2YYZ A;  1PTO C;  1HUM A;  2ICI A;  5EJW A;  3EVQ A;  3RUZ A;  1XWE A;  4OIK A;  3EJI A;  4TRD A;  2PMZ B;  2QF7 A;  2WIN B;  2FHT A;  2C5C A;  5CBA E;  1S5D D;  2V4D A;  2XSC A;  2I07 B;  3CHB D;  4RGM A;  1VDZ A;  2D5D A;  5ELF A;  4K6D A;  4KY6 A;  1KAA A;  2GA4 B;  3MXN A;  2AQ2 B;  4HCE A;  1I6V C;  1SE4 A;  1DD2 A;  3PUX A;  1SYC A;  1I4R A;  3CU7 A;  3VA7 A;  4XT3 B;  3HKZ B;  1ILP A;  2LMC B;  4K5V A;  1OXS C;  3J81 E;  1VMP A;  3D4D A;  3HOZ B;  1M4V A;  3PUV A;  1C4Q A;  2F4I A;  4XQN A;  3M4O B;  1QOH A;  1SJH D;  1LTS D;  2KQ3 A;  2NN6 H;  2E74 C;  1XTC D;  2HUG A;  3VR3 A;  2OXP A;  2NVQ B;  1LTI D;  1LTG D;  1U4L A;  1KNA A;  1ROD A;  5C5L A;  1TVX A;  1J8I A;  4LJZ C;  1CHP D;  3WOF A;  3MAQ A;  3T13 A;  3QOL A;  1TWF B;  3KBG A;  2NWG A;  3MXP A;  3BG3 A;  4EGV A;  4PV1 C;  3A56 A;  1D5Z C;  3M3Y B;  1B2T A;  4EVO A;  4I7Z C;  1GJX A;  2E2I B;  1G6Z A;  2MUY A;  2JE6 I;  4BY1 B;  2JA6 B;  1MSG A;  3OHX C;  4ABN A;  4KHZ A;  5JJZ A;  1GUN A;  3OWF A;  1EYC A;  3E0J A;  4GZY C;  4ZQ3 A;  1B4O A;  1KTK A;  2SNM A;  2WKC A;  1SAP A;  5M5X B;  2Z4I A;  5M3F B;  1EOT A;  4XQQ A;  3H3V C;  3K0Y A;  3GTK B;  1B9N A;  4K2K A;  4HAE A;  4ILW A;  5A2Q L;  4CHT B;  1BUV T;  4IQZ A;  3MA2 B;  1PFN A;  1HA6 A;  4G57 A;  1PTO B;  1QG7 A;  4N9P A;  1VF7 A;  3DEO A;  1I4H A;  1SNM A;  2QDB A;  4ZUI A;  2XVS A;  5C3W A;  3Q0A A;  2IL8 A;  2TSS A;  1AFP A;  2XRQ D;  1UAP A;  3DWP A;  1IHZ A;  4DA2 A;  3CRL C;  3DWA A;  4DF7 A;  2YU9 B;  1EU3 A;  1DJR D;  3NBH A;  4HSV A;  4QIW B;  4NMZ A;  2EJG C;  2L0C A;  3VR6 A;  4QB4 A;  2NYZ D;  5FO8 B;  1O7L A;  5CBE E;  2AWN A;  2BDO A;  1GUG A;  1E0B A;  3K59 A;  1QIL A;  4QUF A;  4X3S A;  1TY2 A;  3G6J B;  1TKW B;  5KND A;  2K1B A;  1PTO D;  4ZKB B;  2L11 A;  3I91 A;  3ITP A;  1M8A A;  1KNE A;  3A7A B;  2IJ0 A;  1IKL A;  4NDX A;  3SE0 A;  5I4D A;  1JOK A;  4MN3 A;  1W6J A;  2NVY B;  5C0X J;  3U9S A;  1L0Y B;  4X3T A;  3J80 L;  1UUP A;  3TP7 A;  4KHV A;  2IW3 A;  1IW7 C;  3O13 A;  3RZO B;  3S1N B;  4WRD A;  4CKC A;  1ICW A;  4HTH A;  1TS5 A;  3AU7 A;  4X3U A;  5IIF A;  1DYQ A;  3G7L A;  1B3A A;  3ND8 A;  4TSS A;  1UNS A;  1Z47 A;  5K5P A;  1H9M A;  3Q24 A;  5IT9 L;  3NTH A;  3L7Z C;  5C3X A;  2B2U C;  1TII D;  3PO2 B;  1SDF A;  5KRU A;  3PIO 3;  2Y0S B;  2DY7 A;  2MGS A;  4FYD A;  2EJF C;  5J22 A;  3MEH A;  5CV9 A;  2WB1 B;  2KUM A;  4HMJ A;  3FRP B;  1QCB D;  5COY A;  2EOT A;  3S2D B;  1LAC A;  3E5S A;  3LWU A;  2HDM A;  2ZXR A;  3GP7 A;  2M2L A;  3EQL C;  3MC0 B;  4OO1 I;  3OPO A;  3R3O A;  3NP8 A;  4B08 A;  4F7X A;  3R2T A;  3SK6 A;  1BNZ A;  3K57 A;  1G29 1;  4Q5V A;  1DXM A;  3HOW B;  2B8F A;  1HRJ A;  5I2X A;  1K8O A;  4FNF A;  4Q0F A;  1SSO A;  2HCI A;  1TY0 A;  1FNW A;  3NBI A;  3VYU A;  4ZYS A;  2PZU A;  2A6H C;  5EPL A;  1Q12 A;  1CZG A;  2DNC A;  2EYP A;  1Z6H A;  1NSN S;  1VCI A;  3OW7 A;  3RMH A;  3IAY A;  5HGT A;  4KKU A;  3OWE B;  2Z8L A;  3SK8 A;  4EQN A;  2EY6 A;  3IL8 A;  3F2U A;  1JWS D;  2DY8 A;  3GD7 A;  1ZYR C;  1CM9 A;  5M5Y B;  1ILQ A;  4RGO S;  2WAC A;  3NQT A;  1STY A;  2PW7 A;  3NXW A;  2F0G A;  5D65 A;  2VUM B;  1A2T A;  4IN3 A;  5D3I B;  5FO9 B;  3BZD B;  3M4Y A;  4F8M A;  1D5M C;  1ONL A;  5CV5 A;  3GTP B;  1B1Z A;  1X3P A;  1STG A;  1EZ8 A;  1FR3 A;  5J1Z A;  3UI2 A;  1FGB D;  4H13 C;  4A3G B;  2B2T C;  4EQP A;  1CA6 A;  3S2H B;  1QJO A;  2A69 C;  1KLU D;  5DNF A;  1MI2 A;  2EYJ A;  3P7J A;  4K2L A;  4DN4 M;  1Y1W B;  5C4J B;  5BN4 A;  1OXU A;  3V05 A;  1Z7T A;  5KEE A;  2A6E C;  4K6L A;  3MTS A;  1PZK D;  1STB A;  3OSO A;  5CV4 A;  4KTA A;  1IW7 D;  1R4P B;  3S9W A;  1HTL D;  4HN7 A;  2SNS A;  3HG9 A;  4AYB B;  1EQT A;  1ZXT A;  1U4P A;  3MXU A;  4R8I A;  4CGY B;  2PO4 A;  1AEX A;  2PZT A;  4U68 A;  5JVG 3;  2AUJ D;  3FDT A;  5JEA J;  4KY5 A;  2VNU D;  4B9X A;  2KEC A;  1RCV D;  4RKB A;  4IFD G;  1CHQ D;  1EWC A;  4LMQ D;  3D31 A;  1EU4 A;  1FNV A;  3X3M A;  3TBI B;  2XIW A;  2IWH A;  2NZ1 D;  4UAI A;  5E4X A;  2R6G A;  4XXE A;  5I9O A;  3DUZ A;  1F2Y A;  3RD4 A;  3N6R A;  3A54 A;  5DEH A;  1GHJ A;  1PRT F;  2F0F A;  1TR5 A;  4IUQ A;  3C2P A;  2CQA A;  2J0T D;  1EY5 A;  3TN2 A;  3I8Z A;  2NUC A;  1A2U A;  1PZI D;  5KIX A;  1EY9 A;  1OXV A;  1NR2 A;  5LHY 1;  1T5X D;  2OF1 A;  5KNB A;  2WP8 J;  4LK1 C;  1H9J A;  2B8G A;  3P20 A;  4FF4 A;  1GHK A;  4CKB A;  3JAM E;  4IUT A;  1OXX K;  5EBC A;  2J7Z A;  1C48 A;  5IOD A;  2K6A A;  2B2W A;  2DN8 A;  4KMU C;  2A6H D;  1ET9 A;  1ML0 D;  3BYT B;  4H7B A;  4EQO A;  2OT2 A;  1HPC A;  4OL7 A;  2JSO A;  2B39 A;  2CHB D;  3IFT A;  3SEB A;  1D6E C;  2PPB C;  3MXG A;  1EZ6 A;  2AQ3 B;  1X3Q A;  1ZYR D;  5DM7 3;  1NR4 A;  2K01 A;  3KF8 A;  2SEB D;  4PMC A;  4PMB A;  4KKT A;  2F0O A;  3GV6 A;  5A35 A;  1TU2 B;  1F9R A;  2EYF A;  2F0I A;  2LFN A;  4KN7 C;  1PTO H;  2F03 A;  4LAA A;  2X6L A;  3T51 B;  4KI0 A;  3DEP A;  2XWB B;  1GXD C;  1JCK B;  5FO7 B;  1LT4 D;  1STE A;  4DNT B;  1BCP F;  1JC7 A;  2K7V A;  2RQX A;  4U67 3;  4A3D B;  1QB5 D;  2A69 D;  1J9O A;  2F0V A;  2F0K A;  1S4Z A;  4RA8 A;  1ZKO A;  1DOK A;  1SMY C;  3K5L A;  2IX3 A;  4XT1 B;  3GTG B;  5JAV A;  1CQV A;  4KJN A;  4IFD H;  2R93 B;  1V1P B;  3RZD B;  4L6T B;  3NWT A;  4IUR A;  1W6K A;  1PRT C;  3QG1 A;  4C3H G;  4HCS A;  3I3C A;  2A6E D;  1CZW A;  2F0P A;  1HTP A;  4KY7 A;  1BO0 A;  1TWC B;  4Y7N B;  3NK9 A;  3RLF A;  1SE3 A;  3VYT A;  1EWH A;  2RDG A;  2L1B A;  1CQF A;  1WTX A;  5EKI A;  4CJ2 C;  1G2T A;  4UDU C;  4BY7 B;  3DM1 A;  1DCZ A;  2EVB A;  1VMC A;  5E4W C;  1HHV A;  2KCC A;  2O5J C;  2K03 A;  3A8J E;  3HOX B;  1IYU A;  4KN4 C;  5C6A A;  3WDN A;  1PZJ D;  4R9W A;  2EYH A;  2Z4H A;  1G2S A;  5FOB B;  1WTR A;  5ELD A;  4IFD I;  4HMI A;  2O2L D;  5EGT A;  3KBX A;  3K6O A;  2F3W A;  2NN6 I;  3P1H A;  5M9O A;  3QJY A;  1EFI D;  1F9S A;  3SHL A;  2ID0 A;  3R93 A;  2B2Y A;  1O80 A;  1YNN C;  3W2D A;  2O4X A;  3BS1 A;  4TQU S;  3TDQ A;  1LT5 D;  5C3E B;  1BCP C;  1GUT A;  4IUV A;  2MPM A;  3BYY B;  1CK1 A;  3PUW A;  5CYU A;  2K04 A;  5KYL A;  1EIG A;  1DON A;  2XRS D;  1EIH A;  2KJX A;  3HEJ A;  5JVH 3;  5HUR A;  1I4X A;  2NTS A;  1JWU D;  5T1I A;  3T56 B;  3TP5 A;  3DHQ A;  1Q8I A;  1RHP A;  5EQ0 A;  3FMC A;  4M8A A;  3EFX D;  3S17 B;  3M85 A;  2NVX B;  2I46 A;  1IL8 A;  4KD4 A;  2XN9 C;  3S1M B;  3K5N A;  3IFD A;  3K5M A;  1MBY A;  3PV0 A;  4C56 C;  1LTB D;  1PRT B;  3CRK C;  1II3 A;  4QMG A;  2PCF B;  2ZT9 C;  3BDO A;  2EPB A;  2D2C C;  1I4P A;  1TWA B;  4X3K A;  1H9R A;  1Q1B A;  3PIP 3;  4KKS A;  4J1M A;  5EKK A;  3BDC A;  2BA1 A;  3AMU A;  1EEI D;  2VB3 X;  1SMY D;  3C3L A;  3GTJ B;  3HOY B;  1DM0 B;  4S3S A;  2ZXO A;  5CR3 A;  4QF4 A;  2PYK A;  5BN3 A;  2XNA C;  4F88 A;  2A5H A;  4J8Q A;  1I4G A;  5CMD A;  3QB3 A;  2KCN A;  1A6X A;  5ELB A;  1PRT D;  5ELC A;  1C8C A;  5C0X G;  3KLS X;  5KGU A;  4BA1 I;  2N88 A;  5IGB A;  5I2Y A;  1TS3 A;  2WII B;  3FVQ A;  3CQZ B;  3C46 A;  1H9K A;  2DNE A;  1FYC A;  5EKL A;  2O5I C;  1H9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...