4XXHA

Trehalose repressor from escherichia coli
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
SDKVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNIDGVVLFGFTGITEEMLAHWQSSLVLLARDAKGFASVCYDDEGAIKILMQRLYDQGHRNISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGYENVAKVITPETTALLCATDTLALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVDPGYAEAGRQAACQLIAQVTGRSEPQQIIIPATLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator TreR
publication title CRYSTAL STRUCTURE OF THE EFFECTOR-BINDING DOMAIN OF THE TREHALOSE-REPRESSOR OF ESCHERICHIA COLI, A MEMBER OF THE LACI FAMILY, IN ITS COMPLEXES WITH INDUCER TREHALOSE-6-PHOSPHATE AND NONINDUCER TREHALOSE.
pubmed doi rcsb
molecule tags Gene regulation
total genus 90
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xxhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xxhA02
1FSPA 2MYUA 3L6UA 1QO0D 3I42A 4WZZA 5ABPA 2W42A 4OLAA 3VNBA 3I09A 1QP4A 3SY8A 1KRXA 4L4UA 1Z16A 5DLEA 3UKJA 4ETNA 3Q41A 5PNTA 2PUAA 1K68A 4HYEA 4PICA 3BILA 8ABPA 2JVJA 3MQ4A 4ZPJA 3NNDA 4WT7A 4WUTA 1JDNA 4HNRA 5EWMA 1U2QA 3BBLA 4F11A 2QVCA 2GX6A 3LFTA 3RVQA 2E4WA 4RK5A 3HXMA 3IDOA 2HPHA 3G85A 4MS1A 1E6MA 5EWJA 6CHYA 3GWGA 2E4YA 1XHFA 3LUHA 4KMRA 4IRXA 1NTRA 1NY5A 1PEYA 1JFTA 2A9QA 4O1IA 1RPJA 5E3JA 3OMXA 4MQEA 3H1GA 3Q7RA 1D1PA 4JASB 3N53A 1U04A 4NV3A 3HV2A 5ED4A 1PUXA 4RK1A 1APBA 1L5YA 2FVYA 4W5TA 4YWHA 4F3TA 3GT7A 2B1JA 2FN8A 3LUKA 4Q6WA 3OM0A 1CYEA 2MYNA 1GUDA 4XFKA 3A0UA 4W5QA 3NBMA 3QLTA 5DGCA 5BQ3A 2LUOA 5FBHA 3RVPA 4KREA 3N0RA 4G0MA 4XAQA 1DP4A 1FFSA 2E4ZA 3CS3A 3ILYA 2FW0A 5IC5A 3FFWA 4MQFB 1BA2A 1YS6A 1BDIA 4Q7EA 3DLBA 1E6LA 1I3CA 1VLZA 5DKFA 1DBQA 3HM9A 1F51E 2NZVG 3O2SB 3EDCA 2FMKA 3OMWA 3H6HA 3G1WA 2IPNA 4EVQA 1EAYA 3H5VA 3KLOA 5C5CA 5TQ0B 2NZUG 4YGXB 2MSKA 4MGEA 4TLMB 2L17A 3EGCA 1ZGGA 3F6PA 2FEWB 4KK4A 1QMPA 5TQ2B 1MB3A 2NT4A 4JB2A 5I4CA 2RJOA 3Q15C 3CNBA 3O2JA 1JLKA 1KMIY 4P1ZA 4QYMA 4OG2A 4JAVC 2MYTA 7ABPA 2WJAA 2CD7A 5JNSA 2R4QA 5JS1A 3JVIA 1ZHHA 2GKGA 1YIOA 4E7PA 4F12A 4YLEA 3GL9A 1M5UA 3E3MA 3QLUC 5CNKA 3BRQA 3H6GA 2PL9A 3I5AA 4OTZA 2N9UA 1JDPA 5FWYB 5BRJA 2IDMA 4MR7B 4S04A 3TMYA 1YVUA 4NQRA 5CNIA 5HKOA 1LBIA 2J48A 3N0WA 3KTOA 3KYJB 4Z4HA 3C3KA 3SQNA 1EWVA 4MS3B 2WRZA 3S99A 3QELB 4LDAA 3OQNA 2ID7A 1YK0A 2ZWMA 3BREA 4G0OA 4MS4A 5IBQA 2VUIB 3Q7TA 4N03A 2RJNA 2RGYA 4OBBA 2IPAB 4YO7A 1MAVA 4KQCA 3QEMA 2FTKE 2QW1A 2P4UA 4WXMA 2FQWA 1SXGA 3JS5A 2PUEA 3Q7SA 5CNJA 4Z4FA 1Y1LA 4ML3A 1URPA 4TMYA 5FWXA 1LJUA 2P9HA 2PJUA 2H3HA 2TMYA 3CHYA 4PYRA 3IPAA 3TB6A 3M9XA 4NCBA 1C0EA 5IEJA 2PUFA 1Z25A 3NNSA 4LE0A 4RK7A 4W5NA 4KZKA 3RVOA 4EYKA 3SAJA 4Z4GA 3LKBA 4YP9A 3UK0A 4MR8A 4ZMSA 1ZN2A 4Z9AA 2HSGA 1NXSA 3O1JC 4KFCA 3QLUA 1USKA 2YHAA 4XXHA 1JWLA 4EYGA 2RDMA 1A2OA 3A10A 4ETIA 1Z18A 2M98A 3O21A 1Z26A 1C4WA 1ZVVA 4HNQA 4KV7A 4RKQA 2F8TA 2WWVD 1YMUA 3EULA 3IP9A 3N8IA 1PNRA 1QPZA 3O1HB 4WWHA 3MYYA 1DCFA 3E61A 3HEBA 3OLZA 5JNTA 1FFGA 2ID9A 2LPMA 4RK0A 1JH9A 1ZITA 3GYBA 3KYIB 1H9CA 3TX6A 4ZMRA 1DCKA 1QNLA 2KYRA 3FFTA 5CNMA 4N0PA 3SNKA 4MRMA 3R0JA 2PUDA 5IUKC 1JHZA 1DC8A 3HUUA 4GPAA 3KKEA 2M1ZA 2GBPA 3OO0A 4MYRA 3NNNA 4IGAA 4H3KB 4JOQA 4EYOA 4UHJA 2A9RA 1OXBB 1SD5A 5JNWA 3OO1A 4MLCA 4RDCA 4IF4A 2PE5A 3OLXA 4QYWA 3ROTA 4Z9BA 4O5AA 1W9HA 5EWMB 2FLWA 2VUHB 5IX8A 2HJ9A 1ABEA 1JYFA 3MA0A 1ZESA 4LX8A 5HQJA 3LKVA 4F06A 2QVGA 4B09A 4E7OA 4NICA 4GNRA 3H5LA 5EWJB 3KSMA 3QK7A 2FMIA 1AB5A 2VYCA 3C6QA 3O1IC 3QEKA 2BGGA 4G0YA 1YS7A 2CHFA 4LE1A 4ZYLA 4TN5A 2WMYA 4MQEB 1DC7A 2R25B 5GQSA 2AYXA 3KS9A 1QO0A 3GRCA 3L49A 1DCMA 2A9PA 4EVRA 1GCAA 4KNYA 3M9WA 3T8YA 3HCWA 1RZRA 1EFAA 1XWWA 3EQ2A 5TPZD 1WETA 1HEYA 3JPYA 3EJWA 1USGA 1ZGZA 3LUJA 4RV5A 2JVIA 1CHNA 3A0RB 1D2AA 1JX6A 2L2QA 4Z99A 3N6VA 3C97A 3HO1A 3KHTA 3RVJA 1S8NA 1BDHA 1ZY2A 3I45A 3HSYA 3JVDA 3O2QB 1VKRA 1U0SY 3FFXA 1P2FA 4H60A 4RU1A 4H3HB 1A04A 2FEPA 5HM6A 2QXYA 5JS2A 3K9CA 2QU7A 5TE9A 4N0QA 1QP7A 1NXOA 3HDGA 5TPWB 1EWTA 4OLBA 3D8UA 2GWRA 2IPMA 2PLNA 4G0QA 2QZJA 3F73A 4IILA 3OQOA 3DLHA 2A9OA 3F7NA 3CZCA 1JFVA 3Q9SA 4YS6A 3RVNA 3RVRA 2PUGA 5KQPA 2FLKA 3FGZA 4CBVA 3CRNA 3LTEA 4DADA 4Z0NA 4QICA 1QQBA 3H5IA 3IPCA 3HS3A 4QPJC 2Q5CA 2HQOA 2JVKA 4L85A 5EWLA 1Z17A 3JTEA 4KQ9A 5TQJA 2YHBA 4MR9A 5IULC 2ZAYA 1ISRA 5KC9A 4Z4EA 2WJWA 3HJFA 1USIA 5JNVA 4RXUA 2JBAB 3VNAA 1OXKB 2LP4Y 2E4UA 3ILHA 1TVMA 2FEKA 3LUDA 5KQMA 2CWDA 4RWEA 2CHEA 3H75A 4RY8A 6ABPA 4RZSA 3QX9A 1PHRA 1U8TA 3EQZA 4YCSA 1LJLA 2GI4A 3F6CA 1PEAA 1YTUA 1W25A 2NUBA 3GBPA 3MMNA 3LUFA 3LUGA 2IKSA 2JB9A 3OLYA 3RVSA 1NXTA 1FQWA 3URMA 3RVKA 4ETMA 4KK3A 1MB0A 2WY2D 2LIVA 3DGFC 3D02A 3T38A 4DN6A 4G0ZA 4MS4B 1A0OA 1IIBA 1GLGA 1D1QA 1MVOA 2JK1A 1Z2EA 2OQRA 3CTPA 4RK6A 3QEMB 1ZAYA 1BVHA 2I6FA 3RVLA 2JRLA 1DRKA 1FFWA 3QLVC 4G0PA 5T7BA 3QX8A 1Z12A 2F8SA 3MF4A 1GCGA 5FWXB 2E4XA 3CKMA 4G97A 1XHEA 5IEBA 3RH0A 2QSJA 2V0NA 3HDVA 1J56A 4EYQA 4W5RA 1T34A 2FSPA 3DZDA 4Y9TA 1PNTA 1RZRD 1JYEA 2IOYA 2PKXA 3C3WA 1YK1A 4RY9A 1NATA 2MSWA 1BDJA 3MM4A 4LDZA 4WXEA 5DCLA 3OQMA 1ZH2A 1AB6A 4P98A 4MR8B 1JBEA 3O74A 2FN9A 4JB0A 4YV7A 4YRZA 4S05A 1MIHA 2NT3A 4LZLA 4D6YA 4G86A 5B3JC 2DRIA 2L19A 5HSGA 1QQAA 1TLFA 1ZDMA 1RNLA 3O75A 4Q6BA 3HZHA 4NCAA 3LOPA 4N76A 3KCNA 1E2BA 1DG9A 1B00A 4MQFA 3HVRA 3CLKA 1D4ZA 3CG0A 4KRFA 3H5OA 1LK0A 2XDYA 3CU5A 5BRAA 1LBHA 1P8AA 4MS1B 3RQIA 3NHMA 3EODA 5KC8A 5JNUA 3DGEC 2PL1A 4ZJPA 2PUBA 3C3MA 4KPYA 1SRRA 3JPWA 4W5OA 4Z4IA 1TJYA 4MLDA 1BAPA 4OATA 1M2FA 3H1FA 3N0XA 5TQ0A 1EWKA 4MRMB 2B4AA 4RXTA 1SXIA 5FBKA 2AYZA 4EGSA 4RS3A 4D74A 3QLVA 3FMVA 4EY3A 2OENG 1D5WA 5IUNC 2X7XA 4JA2A 5TQ2A 1U2PA 5IUJC 2WB4A 3GBVA 1SXHA 2QV0A 4N47A 3IP5A 1QP0A 3LUAA 4LRQA 2FMFA 2FKAA 2MYPA 4TLLB 3TO5A 3KG2A 2HQRA 4PEVA 5BR1A 1RXEA 1DRJA 1UDRA 3BRSA 4RKRA 5B3JA 5KQGA 1GUBA 5TPWA 3LUCA 1NXXA 4Z4CA 1VPWA 2FXIA 5JNRA 3NHZA 1ZH4A 2E4VA 1NXPA 3SG0A 5FWYA 3CG4A 3RVMA 1ISSA 1M2EA 1P6QA 4MR7A 1TMYA 3KLNA 5DTEA 1JFSA 3H5WA 1NXWA 2IPLA 4N41A 4G0XA 4XLTA 4MS3A 3W9SA 3DBIA 3IP7A 3KJXA 3ROFA 3QELA 1Z15A 1YMVA 3UUGA 3GA5A 3EAFA 3TD9A 3K4HA 1M5TA 2H0AA 1KGSA 4JP1A 2IYNA 4IMIB 2VK2A 5GOTA 3H5TA 2JBAA 2QR3A 3OLVA 4RXMA 1JF8A 3A3KA 2FQYA 4DQDA 2HQBA 1NXVA 5CHYA 1EHCA 4IMJB 3MIZA 4D6XA 4EVSA 3P9YA 4PZ0A 2MSLA 2FMHA 4FE4A 3H1EA 1DJMA 4RK4A 1TM2A 2PMCA 3T6KA 1KRWA 1F4VA 4UHKA 5C5EA 5F64A 5KI6A 1RXIA 5T3YA 2FQXA 2LBPA 3B2NA 1DBPA 3JY6A 4PE5B 2L18A 3M6MD 3LMKA 2R47A 1Z2DA 3CZ5A 1K66A 4KVFA 3HUTA 3GV0A 1JL3A 4RY0A 3CFYA 3OM1A 9ABPA 4FB4A 4O1HA 1VRVA 2O20A 4MAAA 5TPZA 1QKKA 4XARA 3SM9A 4F8JA 5EWLB 4EUKA 3IP6A 2R48A 1ABFA 5D2CA 2PAFA 1P6UA 5KQLA 1Z13A 3FDFA 1E6KA 4FE7A 4LE2A 2PUCA 4MR9B 1DBWA 5KWSA 3HK2A 1L5ZA 4M88A 3T95A 4XASA 4MPTA 3OLWA 4YR7A 1R8JA 1CEYA 4HNSA 3N75A 4RSMA 1DZ3A 2JCGA
chains in the Genus database with same CATH superfamily
3OHSX 5AI4A 1X2EA 3L6UA 1NIPA 1KIFA 1PJQA 1QVRA 2HPZA 4HLDA 5A4DA 1MEOA 2RHOA 1Q1BA 4F7WA 3OIFA 4KIJA 1D7AA 4TTRA 5I7UA 4RS4A 5DLEA 2VYVD 3ZJVA 1UBEA 2XAAA 4TWJA 4F6LA 1DDIA 4MV1A 3PIIA 5GM2A 3IAS1 3KDPA 5CT9A 3KZKA 1RJFA 3WXMA 3A32A 1O96A 1XTJA 3BXOA 3WWCA 1VLQA 4CLOB 2EW1A 4EJFA 4RX1A 3PFIA 4YJDA 4LNHA 4B6EA 1K3FA 1JECA 5CURA 1MJFA 3UWKA 1KJ9A 2Q27A 2CFRA 5BYAA 5C1BA 4YHHB 1VCMA 4GF5A 4WZBB 1JZQA 1VFNA 2PKEA 4HAXA 1T9ZA 3WLRA 3CWZA 3N3AC 4ZQFA 2GYVA 5BSKA 3RFXA 2NP6A 2PLAA 1M1UA 1PEYA 3L8HA 4ZZIA 5CB4B 1GPKA 3IR6A 4R3UC 3B7PA 3IOEA 5CCEA 1SULA 1S96A 4NBVA 3MNFA 1HC7A 4FCVA 3OH8A 2WHPA 4NBSA 4UQOA 4YJ2B 3UOWA 4CN9A 3KHUA 3N5KA 3BTUA 4R7GA 4RL6A 3WQHA 5ED4A 4UM9D 3DLAA 4AD8A 1F12A 1S4MA 2XOXA 2H4FA 4EPRA 4EIWA 4GPBA 4I1UA 3UK1A 2IPXA 5I9BA 3T5DA 3UB4A 3ZLVA 4PZUA 3RGWS 3AEYA 2PX6A 3T9CA 5CBKA 2DT8A 1HV8A 4TMXA 4MLPA 1WE2A 2FY8A 3FRJA 4HEHA 3TDMA 3WBFA 3D8NA 1BXGA 2Y1GA 4JQCA 3V8RA 1AUVA 1T0JB 1ODFA 1TEXA 5EC8A 4E33A 1ZOLA 3KNZA 1U9ZA 3HM9A 3OP4A 3I72A 4B4WA 3OE4A 1GPBA 1UKVY 1G8PA 1W85B 2CHGA 2IHVA 2TMDA 4F9GA 1C1DA 3ZCQA 1W36C 1IWOA 1DQRA 1FFCA 4ZT4A 2NQ2C 3G1WA 3WS7A 5F9FA 4LZZA 1QGED 1AIPA 3O38A 4P5DA 2EQ5A 3GJRA 3VPFA 3N8KA 3PHCA 1NVKA 1WMSA 1ZJ4A 2NZUG 2SCUA 4A03A 3R9XA 4ZVUA 4RVCA 2BFWA 2H1IA 4V0NA 1BXRB 3M3HA 3PHBE 1OYYA 1TIKA 2GCOB 3AHFA 1FVHA 3DVSX 4MUNA 1W8DA 2J30A 4FS3A 1U7UA 4MWZA 4L9SA 5KWIA 1ZISA 4ECEA 1MZVA 1GIAA 1ZN9A 5KTPA 2I2WA 2VN8A 3CUEF 2XQIA 2W22A 1E8DA 2P8JA 3WHIA 3O2JA 3BMXA 1C80A 3F4KA 5FBWB 5AH0A 4CT0A 3S1SA 4XJTA 4DR4B 1UPFA 2MYTA 1T1SA 2QVZX 3SI7A 5BN3A 1OUMA 4JLDA 1M5RA 1PLJA 4GLBA 4CKEA 5C7LO 2J9FB 2IHTA 5JVDB 2WA2A 2AL7A 3HVKA 3HBAA 4HQLA 4OQLA 3T0FA 4F12A 5HKBA 1HETA 2Q21A 3CH7A 4FYJA 4L6AA 4V2UA 3A1CA 3IH5A 1CQZA 1AKEA 1J7KA 1NMYA 1T2NA 1W4CA 3CCBA 3FLMA 3U4HA 3ND6A 4F2DA 4OTZA 4L4YA 5BRJA 1E2LA 4FHFA 1W4AA 5DIZA 1EJ0A 4KXYA 1K0UA 2NAPA 2NVBA 2WAAA 3AKEA 3GZNA 3NB0A 5A6SA 3LYHA 3PQEA 4DV2B 5KNCA 1N5MA 4UEJA 4L4SA 4UULA 5AICA 4Q7QA 1NN5A 3WIDA 5BV7A 2RI0A 2QN1A 3AK4A 5K2OA 2WZBA 4URZR 1BCRB 1NR1A 4E09A 1VMKA 3NV7A 1K89A 5CT8A 3HRIA 2IHUA 3O90A 3SYMA 5WRFA 4MKGA 3H4VA 4JODA 3E9YA 4KVGA 1NPDA 1UT8A 2GTIA 4M4SA 1NRJB 2GXQA 4I50A 5AKIA 5EOVA 1M2OB 3D8HA 3AJAA 2J8ZA 2WJVA 4BFVA 2X4GA 3U3OA 5F51A 5E7MA 4Z4FA 1E7QA 1J9EA 4YRPA 4J0JA 5FPTA 6PFKA 2J9RA 4M1YA 5EJ6A 5JPDA 3I9V1 1WXFA 1WIWA 1BYUA 4MRAA 4A2QA 4EG5A 1ODTC 2BGMA 1EZ4A 1MF7A 2B37A 3IPAA 4LF6B 1AZTA 2PX0A 3WJ7A 4Q3NA 3FKJA 3PEEA 5TX7A 1AS3A 2CMDA 4KZKA 4O4IA 3KQUA 1B2RA 1V7ZA 4UVDA 4HAWA 1B73A 3RNOA 3IRUA 4FNAA 1XCLA 1PZHA 3U7FB 3DLBA 1TYCA 2CVFA 4E70A 2FZ5A 4ALJA 1ENOA 2ZANA 3QLUA 4JR1A 5FLXA 3EPLA 4HQKA 4JXXA 3H5RA 3OTQA 1WL8A 1OZFA 1T9CA 2VF4X 2V97A 5L4LA 3HB1A 4RKQA 2WFMA 2VJQA 3GOHA 2JASA 3NVMB 5F77A 5C1PA 1UOOA 1A8SA 4A0RA 4F04A 1L4FA 4L8WB 2BPOA 3NIBA 2Z5LA 4UOZA 1NW4A 5ALVA 2RHLA 2H5LA 2ID9A 1W47A 4RK0A 1JH9A 2EAUA 3SX4A 1W0JD 2PN1A 1H2HA 4MYUA 1SUDA 2QN3A 2J3KA 3RS3A 4N0PA 3V1TC 4EYSA 3DULA 3UBMA 3W4JA 1KMQA 3QA9A 4W6ZA 4K8OA 4EG0A 3TNDA 3RI3A 3IO3A 5A4FS 4XPIB 4UTNA 3AUSA 5JISA 1G20E 1A2QA 2QLMA 3PF8A 4UTVA 4KR6A 4KVZA 3GEIA 2KWIA 4R2WA 1E1LA 2IUFA 2NACA 3E53A 1K2VN 1KYXA 5T57A 4CLRA 2F3QA 3PGJA 3PRHA 1YU9A 4X1OA 3ZHVA 1MHPA 3GNSA 2PVPA 1T6BY 3K0HA 4X1KB 3SIWA 4BLQA 2A88A 2WFAA 1P62B 3D8RA 2V3VA 3EN0A 4M99A 4F3YA 1CY8A 3QU4A 5K3OA 3A2LA 4BVJA 1WB6A 3LKVA 2VR1A 3B6EA 1QOQB 4KWEA 4JOSA 4L6CA 2M6LA 3S3TA 2RMKA 2BELA 3UXHA 3C6QA 3PQCA 4TX1A 3EWSA 2BH2A 1I2DA 3DQPA 1V8BA 3NBFA 1AVTA 5F9MA 2Y0BA 4PF1A 4CUJA 3AG5A 4LSMA 1W36D 5DBHX 3AGPA 4L51A 4ZT2A 2HZ7A 4JYBA 4PSKA 3TLCA 2G9UA 2ZBVA 3L05A 3KSZO 1FBTA 2IXTA 2X9QA 4JJFA 3QE9Y 2AX3A 4HNGA 5IWAB 1H2ZA 1XWWA 1PBTA 5EJFA 1NNLA 3MHPA 2GCEA 5LC1A 1U0JA 1Z2CA 3ZK9A 3WAJA 5B7PA 3KOZA 2WUEA 3TQRA 3TQSA 1ZXXA 1CQPA 4B6GA 1D2AA 1VKHA 2VQDA 4CM4A 1EXDA 1QQ7A 4NCXA 1ZGAA 4B3FX 4B6FA 3WFZA 4AXXA 1S8NA 4DS3A 3TLKA 4EB0A 2DHQA 2P5SA 4DR2B 5ALWA 3JVDA 3ZGYA 5JCOA 1VHDA 4PGMA 1X1SA 2DC1A 3KZNA 1IAQA 2XCIA 3HU3A 3JTMA 4H60A 3TKAA 2QUBA 4RULA 1OJ7A 4XGKA 1RC1A 1X1AA 2M2IA 5JS2A 2IBTA 2IEDA 4NG5A 4HX9A 1SN7A 2PKRA 1PR5A 2DPYA 3OQOA 3DLIA 2AWNA 3IAHA 1UR5A 4YRRA 1H2EA 1DUVG 1HTBA 3Q10A 1N7GA 5CTAA 5CBPB 2E48A 5JSYA 3T35A 3HMQA 1P2VA 5KSYA 1T4GA 1QQBA 2I8AA 3N7TA 3N8DA 3RDPA 3G8BA 2QE6A 2IVFA 5DI3A 5TV2A 1VI6A 1DHTA 1II8B 4DRXA 1IEWA 1FXWA 5ANRB 1SUSA 5I7HA 4O02B 721PA 4Y2SA 1YR3A 1ISRA 4J49A 1NONA 5FTLA 1MAUA 1BHQ1 3I83A 3DZIA 3KTAB 2JBAB 4S0XA 2VSOA 5CT4A 5DZSA 4C4SA 4DILA 4TVSA 2X0JA 1QRTA 2NUTA 2J6HA 2NUAA 3FN4A 2ZJ1A 4PIPA 3KLMX 2EIXA 1UMCA 2QR5A 3FUXA 5JTUA 3ZN2A 4DIFA 1C4KA 1JR4A 4UTXA 2QAGB 2R7NA 2I66A 3V1YA 4YCDA 5BSFA 5CJPA 1KY5A 3X44A 1N8TA 1S4QA 4KKVA 2PLRA 4LXUA 3ER8A 4ERNA 3ZU4A 3V55A 4V0MA 3LUFA 5T4FA 4HB2A 1V5EA 4QFMA 3V4RA 3OSUA 3FPLA 1JTFA 2EQBA 3I34X 1W1IA 4M9CA 4CPDA 3VSDA 1II0A 2XSZA 2IYXA 4TXMA 2BEVA 1W9MA 2OLEA 2XGMA 4CIAA 2OQRA 2WD7B 4Y6RA 1J0BA 5AWFC 3OJFA 1JBQA 1ODCA 2HK9A 3RYFA 2ZB3A 2WILA 1JKMA 2WWTA 3ZY6A 3HJFA 1NBWB 1IY1A 4XIFA 3J81k 1DINA 1YFKA 2VH2A 3KD2A 3NEPX 4IHJB 1P75A 3MF4A 1GNRA 2XVZA 1ML4A 1S2IA 2XGSA 1EGAA 1V71A 1KJJA 1XTBA 2J33A 3LBFA 3QV1A 4GPEA 3GRFA 3VC3A 4F1JA 2DUJA 3HDVA 1QHSA 2PMKA 3R77A 1QONA 2FP3A 1FFHA 4BLOA 4RHYA 1BW9B 1GD1O 1MUUA 5B4UA 2ZB8A 1NQTA 2FLVA 5JYDA 2WWFA 1QE0A 3ZKWB 5HE9A 4ZEOA 2D4HA 2GEFA 2NT3A 4GPTA 1T6XA 3RS9A 3ETJA 4R8RA 4V24A 3LO8A 5DGHA 5EKDA 3FPBA 1E94E 3AU8A 4KUGA 3WRXA 1HEUA 1IMOA 2A2ZA 2IIVA 4NCAA 2V9ZA 4H0CA 2WTEA 3K0EA 4G4SO 4BNHA 5CA1B 3T34A 4B0PA 3GELA 1ULSA 2Y1OA 2WR8A 3KO8A 3BGOS 1JKFA 1H2AS 3RQIA 4QTTB 2H51A 1L1FA 1Y3AA 1Z4QA 4GYJA 3LUBA 3G13A 2VPYA 3DGEC 1W5AA 1A2KC 2O1XA 1GZ4A 3AM3A 3GUCA 4J0KA 5C0OE 1YQ9A 4BLRA 4EF6A 4AU1A 4PTLA 2OWDA 2E85A 2G4LA 5IFKA 5KNCD 2FZLA 5CLQA 5LLDA 1ML3A 4C5BA 3RHZA 3RARA 1Y7HA 3B60A 3UJ8A 4WBSA 1BXZA 1Z6YA 3ICOA 2Z9DA 2IHZA 4OMFG 1AT1A 3O95A 4AY2A 1EP9A 4I2NA 3TF5A 3PQ5A 1S2DA 3KZVA 5AHXA 1SCKA 1SVUA 5KJFA 3W3ZB 1CRZA 1CZHA 3OIWA 3C74A 2JKYA 3EIEA 3ZE0B 1NZDA 4BX0A 1JFRA 1WW3A 1W88A 1OBVA 4QAQA 4YQEA 4N47A 3K32A 3TFWA 4YGYA 1UDCA 1QP0A 1C3OB 2W2MA 4ILEA 2JBHA 1ODKA 3UT0A 1CR1A 3V8BA 2B20A 2X86A 2VP9A 4FB5A 4R31A 5LMZA 4YRGA 3LHSA 1S2GA 3UAXA 2ZI5A 4O2AB 4BNNA 1KQ3A 2ZS9A 1FRZA 3NHZA 2GK6A 3QPDA 4DLSA 4HDRA 4F2HA 4DV1B 1JE1A 2XTNA 4P7KA 1XTPA 1P6QA 1AXGA 2XH8A 3F1KA 4KO8A 4ZK2A 5BVGB 3KLNA 3PXXA 4RA6B 5TR9A 3C3PA 1JFSA 4JI7B 1RKVA 3GP5A 3A3NA 3AHCA 3C39A 1F4PA 2CN1A 1E3EA 4JEIA 2FGJA 4LBYA 2O3TA 4A6DA 4WK6A 2FDCA 4ETWA 1JQ5A 1CF2O 3COYA 4BNKA 5DNVA 1GYPA 4Y2JA 1E2KA 3K0FA 3C85A 1I32A 1ODSA 3OZGA 1MA3A 3A1DA 4LYAA 5E7JA 1IBRA 2V1UA 3BIWA 2I91A 4JQZA 1JDZA 2NSJA 2FQYA 3CLTC 3PHLA 4MQ6A 4IMJB 1OFUA 3MS7A 4G67A 4UAGA 2MSLA 4GM1A 4O2BF 5A2GA 1XDDA 3DTVA 4ALNA 3GRRA 1NVDA 3P26A 2FN7A 4GMFA 4TYNA 3LHIA 5FJIA 3PUWA 3WICA 4H0NA 3VZDA 1JBKA 3OEHA 5FOTA 3U81A 4F6RA 4G41A 5DMHA 4I1OA 2LBPA 4YWJA 3VNVA 2Y3IA 2GN9A 3HY3A 2GLTA 1P6XA 3EISA 2B4YA 1OW3B 2PZEA 4D79A 3G7NA 3KEQA 4ZU3A 2PSHA 4BQQA 5L51A 5I48A 5ISMA 4MQMA 2VJLA 4IWNA 4ROTA 3NLLA 1Z37A 1P7VA 1MTOA 3GJYA 2ZBDA 4XVHA 2WNIA 5D7BA 3T7IA 3RSHA 1Y1QA 2NPFA 2XNSA 1QVWA 4RELA 1G21B 1KERA 3K9LA 4ZREA 5LQKA 3FVTA 3I6BA 4QUKA 5TGZA 3DMDA 4TPKA 5DK6A 2C9ZA 3SS7X 5K01A 1YTLA 1UJCA 1X7YB 4PLPA 2ZG6A 4M1MA 1W4RA 3QENA 1KI4A 2B98A 2OO7A 4QELA 4KQMA 3RUDA 1SPXA 3UB2A 4DMCA 3VHLB 5C8ZA 4MHSA 1A77A 3HJTA 5KYXB 1M1NB 1TK9A 1TM7E 2GT1A 4PC3A 4ZQEA 4QOSA 1DAKA 1TJPB 2C97A 2H2FA 3FW1A 4IYJA 4N6OA 4MUBA 4XGRA 1PJBA 3L0DA 4M7WA 1RU3A 4BFTA 4CF5A 1GNPA 2IPOA 4S2UA 1PYOA 1FP7A 1SUPA 3MJTA 3D4LA 1LC3A 2R87A 3HXKA 4QOFA 1THMA 1XZ8A 4OI2A 2JFOA 1YDGA 4ZGGA 1N8KA 1VB3A 3H2BA 1IVYA 1YFJA 1BMQA 3LRXA 3ZZUA 1OZAA 2E87A 4WZ6A 5DYNA 3BD7A 4E5VA 1ADYA 5GJCA 1JHPA 1N9KA 1V48A 5B64A 3IV9A 1FSGA 2GK3A 2IBSA 1VBMA 1QC5A 2FHSA 2WA1A 4RK5A 5IMBA 4UPEA 5ARBA 3I30X 1XHLA 1GZSA 1E6MA 1LGYA 2CNWD 3F5DA 3C6YA 3W2IA 2GBLA 2XZLA 5J63A 1X0VA 1S2NA 3IJ5A 2XQGA 4G63A 3RFUA 3U17A 5EE5B 3ZE7A 3A7EA 1P7ZA 2WVAA 3GDFA 3QZUA 3RADC 1ZM4A 4F92B 5IM4A 1L5NA 2BC9A 3BWCA 2IV7A 2RH8A 1PQWA 4B75A 4YRDA 2VTBB 1D1PA 1X7GA 2XBUA 3DDNA 1KS2A 2C92A 4JEHA 4YRQA 4HZGA 3ZYZA 2UUPA 1CRQA 4AUKA 4KHZA 4JUDX 4XUEA 3VR5D 3O8RA 2DWOA 2O8BB 4NABA 3WKEA 3B2EA 2XHEA 2JH9A 3R24A 5IDVA 2ZTLA 3OSZA 3ZVRA 3SEAA 2BTQA 1G8GA 4MUMA 4WKCA 4PYQA 1PR3A 1NUSA 1X7WB 2QRLA 3SDBA 1GKKA 2AZMA 1YBHA 3AP1A 1FE8A 2H4HA 2QVXX 2J41A 2PFKA 1O5IA 1YQGA 1REQB 4QXPA 1FX0A 1U0BB 5LBIA 1HDIA 1QH0A 4BVEA 3ITKA 3O9VA 4KQGA 3GC6A 1XCPA 2VZLA 4WNAB 3BSWA 1US8B 4IVRA 1Q50A 4DC1A 1NRWA 4X8LA 2R8PA 1HQKA 1FLVA 3IJPA 1EVJA 3H3XA 1XTSA 4GI2A 4LOJA 1DTWB 1KO1A 2A3NA 3D6MA 3T1QA 1HUQA 4JBIA 3OMWA 3G88A 4DM7A 2BI8A 4LUCA 1Z75A 4QRIA 2YIMA 3FLAA 4O4LB 3FSRA 4TTPA 1JHUA 2VH1A 1VJDA 3I01A 4G1UC 1Q0UA 4HK4A 4U2EA 3CLUC 2PS9A 1IPFA 5CCXA 4MI6A 4Z1MA 2YMQA 2Q5FA 1QMPA 2ZSEA 3HKDA 4G8DA 4KK4A 2VYFA 1XZAA 1U2DA 3WKAA 3H11A 2PH3A 4YMUA 1D2HA 3MLAA 1I94B 4AO7A 4RV9A 1S5PA 4S3MA 1Q74A 1WAMA 4MPDA 2QN6A 1T2FA 4ZZ0A 1D8TA 3WTBA 4DA7A 1IZZA 4U2FA 3CLTD 3QVSA 1A71A 4Q02A 7ABPA 5T4HA 2C2ZA 5DX8A 1EVKA 1VKNA 2GPTA 1TGVA 3CPEA 1VE9A 3QPWA 5HDBB 4B3MB 3BZUA 1BEEA 1V8DA 3QKRB 4TOIA 2QRUA 3GL9A 1C9YA 3JRWA 3AM1A 1FDTA 1ZX1A 4GC5A 2WTMA 4JJAA 2HTEA 4ID3A 1L7DA 1ZD2P 5CNIA 4Z53A 4XGIA 4JSRA 1OTYA 2HMUA 1KK2A 4WDRA 3TW8A 4FMBB 4BZPA 2WRZA 3R6DA 2Z9BA 1KSGA 1YWGO 3KAQA 2R00A 3T15A 1YB5A 1KZHA 5DYIA 3TSCA 3UATA 4IXNA 3QUSA 4CN8A 1KQOA 4Z6KA 4GX5A 3Q6NA 4OI1A 1GQRA 2AYYA 3AR9A 3DMTA 3P0JA 4HAUA 1SVWA 4QFBA 1KDYA 3FB1A 4ER6A 4Z4QA 2DPGA 1HDYA 2PT9A 2OHIA 4GMDA 4X1IB 2P4UA 1KI7A 2JC3A 3HXQA 3KYCA 2QSUA 1AKNA 2JFGA 1H0KA 3WNDA 5BSUA 1VYHA 3L7OA 4MVXA 1N1DA 1TMGE 5CX4A 5BN5A 3T3IA 5AW9A 3TPZA 4WE3A 1TTHA 4MW0A 1BEUB 2AC7A 1B23P 1P74A 3F67A 3L8GA 2JGIA 3BK1A 5HZGA 3H84A 3EXHB 3R0VA 2VPPA 4RK7A 4PZYA 5LZ7A 2PX4A 2BGKA 2XX3A 3LVRE 2B3TA 5FR2A 2NYVA 4DARA 2P3QA 2Y1CA 4DWJA 5F78A 3GLIA 1QX3A 3HHEA 3WHLA 3BHMA 4MVJI 3G82C 4GPD1 1FU7A 3DEHA 3QBTA 4X90A 2Y1XA 2ONZA 3M5CA 1GTSA 4TZ0A 4EBBA 3K15A 4URVR 4MKIA 1ZUIA 2IZ6A 2V54A 3KEFA 4HNQA 4YJGA 3SFZA 5BMVF 2E37A 1WPXA 1HE8B 4OGFA 2WT4A 4H15A 3X1DA 3PXCX 5JS6A 2XYQA 2BEKA 1XJQA 5J5AA 1DLJA 1FTYA 3SJBA 3D43A 1ZITA 2GZDA 2PBRA 3BUSA 3DOIA 3GYBA 3L8DA 4IXDA 1QZTA 3FJOA 1F6WA 1G60A 1Y8QB 5EZYB 1CUWA 3ADOA 4R4JA 4M7PA 1DCKA 3UYLA 5CNMA 4NOMA 2JCVA 3UJAA 3RS5A 1CUXA 1E2GA 3V9AA 5BYKA 1PGPA 5K8JB 4W9MC 5IUKC 1H6CA 1OH5A 2GBPA 4FOOA 1PWXA 1M6YA 2UKDA 3DUFA 2OCIA 4EYOA 2YMLA 3AF5A 3PD1A 2FZCA 3KHSA 3LHDA 3HVJA 2PRSA 4GE0A 3DEKA 5K0JA 2Y0PA 4HPXB 4OHRA 3NWBA 1UBRS 3P7MA 2BFFB 4TS9A 4EI2A 4NE9A 1JKXA 2RBEA 3CT6A 4BV8A 3ETHA 1G4HA 4WN9A 1RFLA 1QYXA 2FLWA 3BQ9A 1Q0ZA 4LK2A 4Y30A 4DKXA 3FB4A 2ODWA 1RQRA 2JI9A 4NBRA 4AUEA 3BCRA 5HQJA 4WK2B 5F7OA 3OEHD 3LD9A 1FY2A 3VR6D 4F1WA 5EG5A 4Q9DA 4LXHA 5G2OA 2RH5A 3TSAA 5HKKA 3ZDZB 2Z1NA 3LYAA 4DA8A 2VYCA 2WP0A 4U02A 1AKMA 5GJWC 1CLUA 1ZK3A 4MKRA 4KKXB 5LDHA 1TCVA 3SX2A 3K8QA 3TXXA 3R4CA 4MQEB 3RTEA 2R7MA 4YP0A 5HTOA 1IBKB 4EVRA 1DCMA 1UAYA 3T8YA 4OMDA 2XWQA 4ARIA 3JWHA 3HRHA 2V59A 1WR8A 1AM4D 3FTCA 4GOMD 4C6TA 4LJ6A 3AF0A 3GEBA 5CVTA 5LOVA 4X85A 4BNFA 1RWQA 3LUJA 1AO0A 1TK2A 1ZOOA 1Y6JA 2D1RA 1NJ1A 2QRGA 3PE4A 3JATA 1JX6A 3W8EA 621PA 4G36A 4FNGA 3MINB 4MUKA 3KWLA 1L3IA 2ZS8A 5DGTA 1IEXA 2P65A 3P9NA 4PPNA 1V16A 5EXDA 3WL3A 2FR8A 4KFTA 1W48A 1HT3A 4DNQA 3AB7A 1L5OA 1JMVA 4LI3X 4YYEA 2H2IA 3V8NA 5EJ5A 5IKEA 4EZBA 4HN4B 2GK7A 2NU9B 4Z3OA 3L7LA 1VM6A 4FSDA 1XO1A 4EJMA 1N2GA 1LSOA 1N2OA 1SQ5A 2Z8YM 4HQNA 4LCEA 5B1EA 3I2HA 2JDIA 5JRZA 3B8EA 5KJ6A 3CZCA 4IDOA 4JJ8A 1NQXA 4XVQA 4BEBA 4FFBA 2VDKB 1P7PA 4NHOA 4UU8A 3CRNA 3SGLA 4DADA 1Z7BA 4Z0NA 3WMGA 2R79A 2JA2A 5CB0A 2OHFA 1OLSA 2OXRA 5EE1A 3EG9B 1G63A 3D7NA 1WUHS 3NDPA 1NUPA 3QKUA 5C3MA 3SQWA 3ZDCA 2YHBA 3VJRA 3EEFA 1CIPA 1ZK0A 2CXUA 4F5YA 4DCPA 4LC9A 3MJCA 2VP4A 2JGLA 4EUNA 4Z9XA 3OIVA 1USIA 4OHVA 1XZJA 3TWOA 3DZKA 4L74A 1VQ1A 3NVDA 2W6JD 5P8WA 1OXKB 4QJ3A 4GAEA 3FSEA 4MVJF 4PZZA 2QB5A 4R1SA 3FM9A 1DO8A 1WCYA 1C3EA 4IGFA 1P9LA 4ER0A 3FMIA 1QMGA 3FPAA 3RFFA 3II6X 2O8CB 1BA3A 4Y2RA 1GLVA 3JALB 1SKYE 4X71A 6ABPA 3T5GA 3I23A 4UE2A 1UKAA 2HXYA 4DLNA 3G89A 2D5BA 4K87A 3PTAA 3KL4A 3JQDA 4E46A 2DAPA 4R51A 4WCFC 5E9AA 1OYVA 4V1CB 4ZCLA 7REQB 3VAAA 2XYVA 1EIZA 4GLLA 3L5OA 1R6XA 3DVQX 4QJIA 2YQ5A 5B57C 4TTTS 3GF4A 2AF4C 1MA0A 1PD1A 2HGZA 1FDWA 5FFMA 5KJCA 4BTLA 3LK6A 4M0MA 5FTJA 1UJ4A 3CO5A 4RA9A 4WGFA 4RH0A 3ENVA 3OF5A 3OPYI 5CITA 1IOLA 1D7OA 4DV6B 2FK7A 3TUIC 2QRZA 3PEFA 2FEAA 4H1TA 5JCJA 5H70A 3DMNA 1G3RA 1KIMA 4KR9A 2RGXA 5AKXA 1XRLA 5U4QA 3GJ3A 2A57A 1VA5A 3WIEA 5E3HA 1XZDA 1UC9A 3HKEA 3Q87B 1BMFA 4G8BA 3CF0A 1ZRSA 4QX6A 1CRPA 2AFHE 3NVKI 1YK1A 1T2DA 4DUPA 4FYYA 2P79A 2DHEA 2YVQA 4ZVOA 4G01B 1P2TA 2WWIA 2IEYA 3IT1A 2O2XA 1NBAA 1P7WA 1XF9A 2PTHA 4H3SA 2DETA 3JQPA 4YV7A 5I7OA 4OL9A 1EGVB 3DSRA 2HK8A 5EIOA 5A9TA 2AKAB 3ZCVA 4UEQA 1O0CA 2FPPA 4L4ZA 1T5TA 2H9IA 2FOLA 1PJCA 3VHXA 4J7CA 1U31A 1TM1E 1V7CA 1QYRA 4C2TA 1R0WA 5KAMA 1ZKDA 2W9XA 4I5DA 4JT9A 3RFTA 2G8LA 3MILA 4ENTA 2LRHA 4EDHA 3FUTA 2P35A 2REXB 1G3UA 3ESRA 4J4HA 1U3GA 3FCYA 2ES4A 2VJMB 4ZJPA 4BEVA 1YKGA 3DEZA 3M89A 2Z4TA 1EGMB 4NLLA 4P08A 4RD6A 4BAZA 4K9OA 4ZRDA 1O57A 3FJYA 2VF2A 4LMAA 4PAQA 2ZJYA 4MRMB 4BGUA 1NT2A 4OM7A 4WFKA 3L40A 4D74A 3QNWA 1IG0A 4BXOB 3KWJA 3TINA 3U3JA 4ZHSA 2R5FA 2N75A 4O8CA 4BMSA 1ICEA 2NZXA 1IEQA 2UVPB 3A26A 2HM7A 2YHIB 4NOLA 5AJTA 3ZW9A 2RGRA 1CVRA 5JSUA 3GPDG 4MSUA 5ALFA 3BFJA 2AE1A 4FUTA 4KJXA 2GNPA 3PT9A 2XRMA 2FUCA 4JS0A 2J9XB 1U6JA 2IYZA 3RS4A 4PS0A 3IT0A 3QBEA 3PC3A 5E7IA 1N6HA 5F2NA 1H2BA 5TPWA 3K6SA 5T64A 3I39X 1KOFA 1BKSB 1M6VB 2E2WA 2Z1DA 1SUAA 2AZTA 3TIVA 4IH1A 4EENA 3U0VA 4D9HA 1L7OA 3E1GA 4K03A 5JHGB 2VJBA 1TUBB 3VJLA 2OZEA 2IPLA 1HPLA 4JQOA 5EJMA 1PNVA 2QG6A 3K1TA 3CEMA 4A10A 5A3JA 8ADHA 3UAWA 2O6LA 5DSXA 3VC2A 4EELA 4A15A 1QPGA 3LY8A 4UMDA 1ZW1A 4FZVA 3T3OA 3OJWA 1N25A 1SG6A 2IZZA 2XIQA 3PYMA 1J6UA 1C41A 5JEEA 2VSYA 3WP1B 5H9VA 3BWDD 4MI9A 4DNFA 3GPLA 3A3KA 2BBTA 4DREA 2CDRA 2P27A 5JXWA 2TRSB 3TSOA 5IM4F 2CD9A 2PZFA 1GZ3A 5BQPA 4DT1B 1RM0A 4EPYA 1CDZA 2D1SA 2LV8A 4GGOA 3OI7A 1CY6A 3QI2A 5TQVA 5EIXA 3FNRA 4BRSA 3OJ0A 1GILA 2OHVA 1G6OA 5J1SB 3KKZA 3PJRA 3B9BA 4U5QA 3LLVA 1NI5A 1G55A 4EI8A 2FQXA 2J0EA 1PDWA 3PGVA 3Q3CA 1GUZA 4QVGA 1G64A 3VR1A 4HGNA 1JVNA 1XFDA 2C4MA 1X1EA 3IDAA 4PX9A 4HGQA 2WTXA 1SIWA 4MWEA 4QUBA 1GL3A 1K66A 3G0BA 3HU1A 3KQWA 3GR6A 2LDXA 3O4JA 4MVYA 4MRRA 3WJ1A 3WLOA 1ATZA 4F5DA 5MDHA 2BEWB 3MD9A 3E5MA 3R5FA 3ZUPA 5BW8A 2WM3A 2PX3A 3EVTA 4HAIA 4BMYA 3QG5A 3F9RA 2F55A 5K0CA 5JRJA 5KNBD 4NH4A 1UOPA 3ZVMA 4P36A 3TQQA 1J1ZA 1ZQ1A 2W2KA 3K05A 3QUBA 3FBGA 5B36A 3SBXA 2ZT8A 2X41A 2ZQZA 1FX1A 3IIJA 5J2UF 1LDGA 4PZLA 3BWYA 1IHUA 4HRXA 3W05A 2YMPA 2DHCA 2O54A 1DEHA 2QTAA 1NUAA 5HKKD 3IV6A 3QYJA 3LM8A 1PD0A 2ZR7A 1XYVA 3ONNA 4TYYA 1XNRB 1GKUB 4G0VA 1KQPA 2BMJA 5FPKA 1DUIA 2Q3HA 1ENYA 3RF7A 1EP2B 1LVUA 2GARA 3A6JA 4C4TA 1N1GA 1NYLA 2JZOA 1RKQA 3L8FA 1RPAA 1JLRA 1GAEO 3A37A 2G9QA 4HDSA 1E5VA 2EARA 1QP4A 1A4RA 4BNYA 1EH5A 2NN3C 2BFPA 1CUSA 5K4AA 1CUIA 1Q0HA 4M3NA 3CUWA 4MCHA 1J5PA 1QG6A 4J9UE 4RIHA 2Y67A 5TC4A 3W3AD 3L1UA 2ORVA 3UH0A 4G9BA 3EOBI 4KIFA 3VISA 1W4BA 2QVCA 4IV0A 1GTL1 3HXMA 2W2TA 5AXAA 4MS1A 2JIDA 4KGVA 5FBQB 2XXJA 4DQLA 1UMKA 5AKLA 1Y1RA 4MB2A 2GZMA 3I92A 4NE2A 4EK9A 1JZTA 1QCDA 1BH2A 2H63A 3OZWA 3S1LA 1NY5A 3SKVA 1SZCA 4KPUB 3G9UA 4AKGA 1PYDA 2F4NA 1PFQA 1DTSA 1RPJA 2SKCA 3QE2A 4O1IA 5E3JA 3O26A 5JXHA 3KXPA 3N53A 4F3RA 2PFGA 2V1XA 3BMCA 3WK5A 3QTLA 3WDLA 4IH9A 2GCGA 2VCYA 4JI6B 3A7DA 1JR3E 1XPJA 2W2VA 1TECE 4HN2A 4JJEA 4HKTA 4NHEA 3UWDA 4RDHA 4DDUA 1E9BA 2HXGA 4IHQA 4X61A 2CXPA 5BNWA 4W5HA 3E7XA 2C58A 5K05A 3P45A 3CJQA 1YIDA 2AOTA 2OG1A 1HX7A 3FNGA 4AUNA 4NYJQ 3E03A 3TTVA 4H9GA 4CYMA 3AYZB 2YJ5A 3PR1A 4HFJA 4WFJA 5IC5A 5GINE 1BA2A 1O6CA 4N5HX 3O8LA 2OVBA 2EJBA 2RBKA 5CYFA 4TRMA 3OT5A 4Y6SA 5AVXA 3OEWA 2FFAA 2FPIB 2EYQA 3OQIB 1SBNE 4BWGA 2ERCA 2EX1A 1P9OA 1RCTE 3MMXA 4JITA 1RHUA 4NMWA 3GLHA 3WADA 3WYFA 1QDLB 1ESMA 1QS0B 5TQ0B 5KOHB 3B5EA 3VSEA 1T8WA 2BLNA 2HF9A 1W8IA 4MYSA 1G9SA 2XCQA 2VHXA 3PZRA 2DH5A 3IUPA 3U2QA 4C7VA 1DWPA 3U16A 3VO1A 5E2BA 3B48A 5JE8A 1J39A 1HDGO 2O0KA 1YQWA 4RLQA 5TQ2B 2QEQA 1IWPB 1BVUA 2FX2A 4ND6A 4ZT6A 4UNQA 3PC2A 5B6IA 5DYWA 1YV9A 1VE5A 1H8HD 3THXB 1I1NA 3UHAA 3BE5A 4J1SA 5IMSA 3K53A 4XCVA 3HVIA 2QTVB 3FVQA 2XHZA 3ZZ0A 2GBGA 3LWBA 4K28A 4MKHA 2OV6A 2VAMA 3U4MA 2ZT7A 2R1ZA 2R4QA 1MV5A 3VC7A 1MB9A 5KTSA 4YLEA 4BTVA 1MOQA 3L6BA 2XW6A 1DBVO 1JEEA 2DWPA 4YMIA 2PT7A 4WINA 5DGIA 4P7JA 5HMLA 3OESA 1MVLA 1KBOA 1ZOIA 5KVVA 4OV6B 4RZ2A 5CM8B 5EKSA 4UMVA 3TMYA 1EPUA 3ZNQA 1UK7A 3N6RA 4DR7B 3N0WA 4U6SA 2OQVA 3KYJB 1WY5A 2VXYA 4LV5B 3LUPA 4QQ8A 5A5FA 3ZDAA 3R0ZA 4L0QA 2X5JO 4H6XA 2BRUC 4QOIA 5L53A 1CX9B 2X13A 1DKPA 2ZITA 3CEJA 4TS4A 3VVMA 3R4VA 4UCFA 4BVLA 4DANA 1SWWA 4URXR 4TQAA 4F6CA 1IH8A 2HMTA 4F46A 4JGBA 3UANA 3UAGA 4BE9A 3FJ1A 2O3SA 5EKUA 1KEWA 1AGYA 1FRFS 2HBQA 3BXPA 3E9RA 4EFDA 3HDHA 4GD3Q 4I9FA 5LP6A 5FNVF 2OUKA 3PSHA 3QYFA 4LQDA 3JQ9A 3GJQA 3PCTA 1QUFA 4H1VA 4DIKA 2AOXA 3MGCA 1DJLA 5BSRA 5E6SA 4RADA 1VSTA 3W1EA 4DDWA 3SVLA 4CMIA 1FP1D 5JSKA 1TADA 3BTVA 3DCJA 5KKCA 3R40A 3BXXA 5KWSA 4UNSA 4DDKA 3FWHA 4MW1A 1NP7A 3OZ7A 2Y6UA 5MGNA 1V6AA 2ATIA 3FI0A 3UT5A 2G8NA 2VAVA 2QYOA 4KR0A 2DTDA 5IPFA 3WA6A 1ZN2A 2XXBA 5JZBA 1K5PA 1PBNA 2FETA 2HSGA 1AH2A 5F2KA 2C5HA 1BDMA 4FEEA 2HY7A 4WOJA 4ZP1A 3MOSA 3BULA 4U7PB 3OZDA 1H4VB 3ND7A 1KQNA 5DO9A 4M49A 2WWVD 2EFCB 2V5AA 1E89A 3GFTA 3H2YA 2ZAMA 3WDKA 5IYZA 1QH9A 1Q20A 1PNRA 1Y9EA 3BN3A 3HEBA 4DCMA 4QPDA 3OLZA 2E4AA 1ZQ9A 3OFVA 1R4MA 4R84A 2LPMA 3OICA 4TSFD 1DHRA 5IBPA 2ZXUA 3WMFA 5HIMA 2QRVA 5EVJA 2IXGA 4PQYA 4R0VA 3KEGA 3LP5A 4JR0A 1A96A 1Q1ZA 4UUPA 3EF1A 4DMUB 2DCUA 4EFKA 1P2DA 2AFIA 1ZJYA 1FYXA 1P3DA 1ENZA 3TLZA 3AXTA 1UFKA 3AI3A 1V41E 1GU1A 2OV2A 1KI9A 4UHJA 1A9SA 5AQEA 3UJHA 3SXUA 1V8PA 1YFZA 4UATA 3T9DA 4PBRA 3F5QA 3HBFA 2IWRA 1WDLA 4JI2B 4JSTA 2Q4TA 3D3WA 1RMQA 4WBNA 1T1RA 1ILEA 1W9HA 4ZKDA 1QYWA 1WHSB 1QTNA 5JAUA 4I8DA 3AEUB 1SHUX 4ZVTA 1KH1A 4Q1FA 4CU5A 3EMDA 4DAEA 1LBSA 3DQZA 2O2HA 3NYRA 4ZV4A 4A23A 3JQAA 4GMKA 1H23A 3PXGA 4CR7A 3ICEA 2QY9A 1QHHB 4GNRA 4N5IX 2PY6A 2H7CA 4W82A 3KP1A 5BPHA 1JT2A 4UMEA 4AIIA 4F21A 1RYZA 1R9NA 5DM1A 2X8WA 3HJUA 1YVEI 5ALXA 1CWUA 4QQKA 4YK7A 1CG6A 2CHFA 3HADA 1ZD5A 1GGJA 2JAPA 2OL4A 2GN2A 1NAIA 5THKA 1J25A 1ILWA 5I51A 2B4KA 3KS9A 1SUWA 5DBFA 3S2ZA 1L7XA 2XVXA 4LBVA 1RQ7A 4BNIA 2Z04A 3KQVA 2AZXA 1YD7A 5TMEA 1UBJS 4JV5B 3I9KA 3EC1A 2H3EA 3AF3A 3ISJA 2ZI4A 2YZMA 4DSZA 4JBYA 1CBUA 1HEYA 3K1YA 4JIMA 2PMDA 1KVUA 3NOVA 3VM6A 4BUCA 3U4QB 3T41A 3D0QA 5HDQA 1KI2A 3I5MA 3TEMA 2QTTA 2ZUFA 1A5AB 5JCPA 1I51A 3TOCA 3U80A 3ZCSA 3FCEA 1Z7YA 4FD3A 5JZ9A 3AR2A 2NXNA 1T36B 3BOSA 1EUDA 1NQUA 2P2NA 2RHHA 4BV9A 1U0SY 1K6EA 3EZ2A 3H9UA 5ENDA 1ZJ6A 4O25A 2WV9A 1ANKA 3PUJA 3I8XA 3QW2A 1ZEMA 3GLUA 5C35A 4I1IA 4N0QA 5DHPA 3WQRA 5HM6A 4KSCA 4RVDA 3G02A 1EWTA 4IWXA 5DOZA 3T06B 2BCEA 6ADHA 4ZYWA 1FNMA 3HLKA 1AN9A 1NI4A 1NURA 2A9OA 3HN2A 4KTTE 4CKWB 5HXAA 1MDBA 1X8LA 5TEWA 1L7VC 2J5KA 2GD1O 4CM9A 2WDPA 5BWOA 1HYBA 1C9EA 1Z5ZA 4N0DA 3D6AA 3F96A 1J4AA 3HY6A 3L7YA 4JP8A 1NW7A 3B70A 2YHUA 3M4XA 1NVVQ 1ZXBA 3SBDA 4BQRA 2HLHA 1AQIA 1KO7A 2HQOA 2PH1A 1YGPA 4BB6A 4L85A 4D8XA 5I47A 2NVUB 5JECA 5LVAA 3MTJA 4LX0A 4NYJR 1GP2A 2VWPA 1T2AA 2J4DA 2CL0X 5IULC 3K09C 5B3LA 3WYEA 3VR2D 4D92A 1EFPA 3RCBA 4FFOA 3OT1B 4O6VA 4LJRA 1GA4A 2AFVA 3U6KA 1CFJA 2AKYA 3PVSA 3R7FA 2YX1A 4CTJA 5FA8A 4UDXX 2FMTA 4YBZA 2JI8A 3VC1A 5IF9A 4P9NA 4FD2A 5EJGA 1E9FA 4I8XA 4WEQA 4MCIA 4I99A 3ITEA 4YQYA 3K6JA 4R05A 2CDBA 4AN4A 5KNDA 1B93A 3TH5A 3TPCA 2WQZA 1BGWA 1E6WA 5ADUS 1PAUA 2X4LA 5C9ZA 5I4KA 4RTLA 2VBFA 3DUWA 2VNKA 5CVDA 3WGLA 3C16C 4GSKA 4ETMA 2OFXA 4L9WA 3HGMA 5L95A 1JSLA 4YA6A 4RNDB 4HWTA 1NVMB 1GKYA 2ZIAA 4CF6A 5DJ5A 3IBSA 1GLGA 1NMQA 2JK1A 1DC6A 3RIMA 3TLEA 1MGPA 1P80A 1QTIA 3MPOA 4X3PA 1JHMA 1TT5A 3GT0A 1XLTA 4OO3A 4RK6A 1NNI1 5J43A 4GR4A 4KDFA 1D6JA 3E4DA 4GECA 1L5SA 5HQ3A 3AVXA 1OFHA 2GPNA 3ZDDA 3PGA1 4UEOA 3CLVA 2NNLD 1T0IA 2WVJA 1X92A 2ZTVA 5B2FA 2ZIWB 4QJBA 1L7AA 3I9MA 1SB8A 5CG1A 1M6HA 3BX1A 3I4CA 4I81A 3K0AA 3GDHA 1F0NA 4B6OA 2X0NA 4GKBA 1KHTA 3WQSB 2IOYA 1U1CA 1Y8AA 3QVGA 5DHRA 2EX0A 4R2IA 1X87A 2VEDA 4AX4A 1G38A 3EXIA 2ZE5A 3KK0A 3QRWA 4YRBA 2VL7A 1AKWA 1T29A 2H7YA 3W2HA 4WBXC 2ZWAA 3DNFA 5E4TA 3FZGA 1ZD1A 3QF4A 4C0QC 4XKJA 1A8QA 4GKJB 1JG6A 4EO9A 1WF6A 5KPDA 1TLFA 2NZ8A 1RNLA 3PB3A 3RYCA 1L4LA 4WLEA 3WLFA 4UM5A 5H59A 4D0SA 1ONSA 5G0UA 3PPYA 3V7UA 1QIHA 1O08A 4QUEA 5FUBA 2VDJA 1Y1SA 2VJDA 2X9VA 3G7UA 1PWZA 3MXOA 1MPTA 4FKMA 3UHJA 3VKWA 1KTIA 3I6QA 3CU5A 4D9BA 5IHXA 1RQGA 3JQ8A 4BQIA 2CDNA 5AK3A 3GZJA 5FUVA 4HNUA 4ZC8A 5KC8A 2PUBA 4N5NA 1TJ5A 2F8LA 4BYMA 4GP6A 4PPYA 5GADl 4E5SA 2JIMA 2YJTD 2Z8YA 4ALMA 4OQXA 5HF6A 3EA4A 4A8JA 3E8MA 1BN7A 2ZCUA 2DSTA 4IUCS 1EWKA 5FRDA 2ACEA 4PYLA 3AINA 3FMVA 3IVXA 1X70A 1CUZA 4FWIB 3K4PA 1RVV1 2H06A 2IFTA 3OQHA 1TU3A 4IEIA 4RETA 4E88A 2V74B 1X9HA 3AV3A 1QG0A 3GCXA 1U6IA 3U1VA 1T4MA 2NSDA 1PGQA 1SXHA 2EEPA 5KVAA 2Y0EA 1UCFA 4ZAFA 4XUCA 1PNQA 4DY4A 2WKPA 4PG5A 4ZJZA 4A0FA 4PR3A 1K98A 4AY5A 3IOMA 4M0KA 1QGAA 5B4VA 4AZSA 3HJGA 4PHCA 5H81A 3PUYA 1R0KA 4KLRA 4BMPB 3K1AB 2BD0A 1R6UA 2OOKA 3LX6A 1TT7A 3PUVA 3VVBA 4KQWA 1NLMA 2AJCA 1MFZA 1FPMA 2HRRA 4J0FA 4O59O 1J5EB 5LIPA 4FP9A 3JZAA 5LXTF 1QIFA 1XZBA 1M2EA 3FVRA 2ZYTX 4IV8A 2XWPA 1C7EA 1PJZA 2CJPA 4CNQA 3CZMA 1KY4A 1NF9A 1M8PA 1PWYE 3VNRA 1RWKA 1M1YA 1Q7TA 2QNIA 2WIFA 3BJZA 3GUZA 5TT0A 3VGJA 1OILA 2WF9A 4Q9IA 3MFQA 2D3WA 3IAAA 2HWXA 3C3JA 8MHTA 1U8CB 2OK8A 2XIJA 3QELA 4U7GA 2GSDA 3CRVA 4V3BA 1IB6A 1GZ7A 1AU9A 1P77A 4A9AA 2DR3A 1Y0BA 1WVGA 2CF6A 2FPGB 2AK2A 5KUTA 2IYNA 3DCIA 2GVNA 3PE6A 1G2IA 3QQ5A 3W7AA 4HV4A 2H1CA 2G6BA 2HJVA 4RE5A 1PFVA 5AT1A 3VAZA 3A9WA 3G59A 3MWJA 1ZNWA 2ZI6A 2HQBA 5FD8A 3ONVA 4LOHA 4CI9A 1CS0A 2HCJB 4UAJA 3ZCRA 1YNOA 5KYYB 1MP0A 5KSPA 3C5WP 3DPSA 2WABA 3N70A 3GP3A 3FROA 2O8DA 5ARDA 5DNUA 4KAJA 3WLIA 2QD5A 5CMLA 2BEJA 1QCZA 4DLBA 4Q7MB 1XKTA 5IDYA 1KY3A 3KHKA 4J29A 4O2BB 4YP1A 5KWVA 5EEGA 2PBZA 3O84A 5TJ9A 3ZIUA 4CQMD 3K70B 4P4TA 1ZIYA 1DRUA 5H83A 2WIDA 4XVUA 3R41A 4DLUA 1XZPA 1W1WA 1GDTA 2NAFA 5LJIA 2XZOA 1EWYA 3SNHA 3T3MB 1VG0B 3AV0B 3OZTA 3HHPA 4KVAA 4NZYA 5E4FA 1NNSA 1L4HA 1W2GA 1RI1A 2XUDA 2JCXA 4I50F 3H8JA 3T9EA 4ZI7F 1Y4ZA 2Q8NA 3PSAA 3K0CC 3E84A 4Y2VA 3X1JA 4INPA 4N18A 3DFFA 2G36A 3PYXA 1ZD3A 4I08A 4V0QA 2PZBA 2GAIA 4J8PA 2RCNA 4XJXA 5DHAA 5K3BA 3TZCA 4MR9B 5CLFA 3OBBA 3E7FA 5HS4A 3QEAZ 4Z3DA 5L6LB 2RGBA 4P35A 2DVMA 2O8FA 3MWEA 2Q7DA 1V1MA 4JOBA 3V8EA 2EBHX 3B5IA 1GSAA 4NMMA 4ZARA 4EMSA 1Z47A 2ZIXA 2KHZA 5JBQA 2RGAA 3EGDA 3IODA 1DXYA 1EDEA 1OT5A 3THSA 3CN9A 3C5HA 3HDTA 4TGLA 1FDVA 2BGIA 2C2GA 4DCUA 2V45A 2OUIA 4YQZA 4YJ3A 4EJSA 3ORFA 1MB2A 1NVVR 2BEUA 5FT9A 4MHOA 2ZYAA 3ZTYA 1VGVA 4JR2A 4Z49A 1S3IA 3NFRA 3ZWPA 3DDWA 5DDIP 5DHUA 3EXFB 4DOMA 2CEAA 4R6WA 3NNDA 5HCNA 2P9QA 1J20A 1JALA 4AJNA 1KP3A 1JJBA 4F11A 4F2WA 2I6UA 1JILA 1Q83A 5IT0A 3W7BA 3D64A 3TCNA 2ZYIA 4IG4A 4UMFA 3OCXA 2GS9A 2EG9A 3DVAA 3L1JA 4P3KA 4QASA 5MFZA 4RVFA 1ZUNB 2UXCB 2I2XB 2E4YA 3RT9A 3LBHA 5JBNA 1S9HA 1MC5A 2FJ0A 5C5DA 3ER6A 3C41J 1J22A 4MOWA 5HUQA 1WUKS 3AW8A 5KBYA 3ZNPA 1Q22A 2FG6C 3D1JA 1CU1A 2R1TB 2ZAGA 4V0KA 4YI3A 5L3ZA 3RRFA 1XGKA 2G4VA 1R4AA 1YQDA 3P9SA 5E0OA 1EQUA 2IVZA 3P9CA 1YUNA 3NIGB 5ECDA 2GHRA 2GUWA 2PX2A 1ORDA 1R5JA 3HVUA 3MRSA 1U7HA 2O1SA 4FBMA 4FZ3A 4XUGB 4M8KA 2FN8A 5JH7F 4EKEA 2Y05A 3QWAA 3BXHA 2E9SA 3SC6A 2ID4A 4R8VA 2FVXA 3U09A 1JB1A 2BCGY 3M34A 1Q0PA 1HZZA 4KR7A 2WWRA 2ZVDA 3BFVA 3MGAA 5KIAA 2OBBA 3L0SA 1OB5A 2Z2JA 3FFWA 2HJSA 4UNRA 2A5GA 1VDZA 3K35A 4QDXA 1G4UR 4CFZA 5JASA 1OGIA 2QGZA 4ZCIA 3CSDA 3OM8A 2IODA 1UEJA 2JLVA 3USCS 1B0UA 2C88A 1TMOA 3P9KA 1CJTC 1K63A 3H6HA 2OSVA 2ZT6A 2ZJOA 1EAYA 1AKVA 4UZFA 4HEA6 3KT3A 4WZAE 1NL3A 2PWAA 1P4AA 2OR3A 5TSDA 2MSKA 4A2CA 3BWVA 2VSNA 1EX7A 2ZJ5A 1MABA 2IYAA 3PL1A 5IKXA 2ETXA 1XCJA 3F3SA 1S8FA 4I55F 4MZDA 3B7WA 3UPUA 1E0JA 4J07A 3W2FA 4GVLA 3AVUA 2Q7XA 5KYUA 3ZU5A 4CL8A 3NRBA 3AP2A 2TYSB 1PJ2A 3ZHYA 2NU8A 1QGDA 1P7CA 1CUVA 1XEWY 2H29A 2L69A 5F4BA 4BFWA 5I7EA 1F3OA 2C83A 1D6MA 2Z2ZA 5REQA 3GUYA 3N39C 1LNZA 1CK4A 4RJIA 1JDJA 1XLUA 1YQXA 1ZHHA 2QZ4A 1NA5A 1GJRA 1CS4C 1C30B 3IMEA 4KCGA 5CNKA 2BFMA 3N74A 4B3IA 2FWMX 3CLRC 2PGOA 2CW5A 3D6JA 4D97A 4ZDWA 1O4VA 1RZ3A 1YRLA 2AQ8A 2EBUA 2IDMA 2PKQO 1GZ6A 2XMBA 3D31A 3O3MB 1TJNA 3S5UA 3SF0A 4D9CA 4Z4IA 1J70A 2ZR0A 3LYUA 4Z4HA 3THYA 1IFXA 5KVQA 1RMYA 5HVNA 1DJOA 4N40A 5DTIA 3WK4A 1U8FO 3NYIA 3TQTA 1CB7A 2GHIA 1NC1A 1Z0DA 2ID7A 2ECPA 3EFHA 1HZJA 1X8JA 2JJ2A 2QJTA 2IPAB 1RQ2A 1MAVA 1CUFA 2G1UA 2XKBA 2VK1A 3ANSA 2X14A 3KTFA 4UVGA 3WL7A 5HJ5A 4CR6A 2IH5A 2P78A 3QVJA 4K6MA 2YVKA 4MRNA 1UXHA 3D8SA 4J76A 3S2IA 3MCZA 4JC4A 5E2IA 1W52X 2HMSA 4ESHA 4QT4A 2JLYA 1L1EA 2HA6A 1BQ4A 3M6UA 3K0KA 4CHGA 2QJRA 4MHTA 3ZW8A 3QKSB 1KL7A 1QRSA 3LCCA 1F7UA 3IEVA 4G4GA 3STWA 1T5DX 3KPJA 3L4BA 4IDFA 2D5CA 2XMSA 1IM8A 3L6RA 3LKBA 4V38A 9GPBA 2XA2A 1FOEB 1K8QA 1SC1A 2G83A 3C15C 4HADA 1JG7A 5AI8A 5HCUA 4B4VA 4ENWA 1NXSA 1SCIA 1NGSA 1R16A 1T5SA 1LUAA 1WLYA 3M6VA 3MRXA 4C2AA 1Y7LA 3B1WA 2GEVA 5J2TF 3L0BA 4DVJA 1SC9A 5DYTA 3MAJA 3RC2A 5EQFA 5LD2C 3GI1A 4O4JA 1ZAKA 2RBGA 4AJPA 3L4JA 1M2NA 1P0QA 1Z2PX 1HDCA 1K7XB 2B9EA 2I29A 2VDQB 2CXQA 3CH4B 1N4DA 3O1HB 3MYYA 4CLEA 1IN4A 1HY3A 3BQMB 4Q1AA 3S5JA 5JNTA 1X8XA 5LMCA 1DOHA 1IUPA 1N2BA 2LR0A 3N2GB 1XZGA 4NESA 4P4SB 2BFEB 3O0DA 1Q2XA 2G67A 2ZBPA 5KNLA 3PHJA 1KVSA 2ZIGA 4FHZA 4JVSB 4YLYA 4X1YA 4G2TA 1E5DA 4K6CA 4ENSA 3H99A 1MXFA 1KGDA 1M54A 1QHXA 3KKEA 2HMYB 4M1SA 5H80A 1SKMA 1P1CA 1CIVA 1L5HB 4HQRA 3AP3A 4L76A 1R5NA 2OCXA 4BKRA 3RU3A 3SHQA 1GTVA 1DV1A 3GNTA 1CUBA 4C04A 5LYJF 3IBTA 4Y9SA 1RM4A 3X1ZA 1CZKA 1MKYA 5D6NA 3GHHA 2BDTA 2OZKA 4MV6A 4OY3A 2W58A 3I5UA 2AW5A 4UDOA 3C3CA 1W19A 4W8HA 5DP1A 3W4IA 4I1RA 3KKLA 1NBEA 1SB9A 4XYGA 2IS2A 1JWAB 1LV8A 1JJIA 1AK2A 2HJ9A 2I3DA 2N1BA 3VI4B 4LZJA 3CE6A 3ZIDA 4ER3A 1ZC3A 5DGXA 3RSOA 4Y0AA 5KX5B 2R6AA 1TKAA 1H3EA 1Q17A 2JJYA 1E7WA 1HSOA 2FMIA 2Y8EA 3IPRA 5LCXA 4A5SA 4BQOA 2J3HA 2MU1A 2WIKA 5BYBA 5BMOA 4CM8A 3ZWOA 2WMYA 3OCYA 5GQSA 3ORQA 2W2QA 2GD0A 3DTNA 4ZOEA 4IOJA 4EW6A 3DDUA 2FRDC 3H1PA 4OK3A 2EDCA 1UMDA 3FGOA 4FZRA 4TMFA 1C14A 3S1AB 4ZK6A 2B5WA 1JEQB 2I03A 5K7SA 3BZBA 3MJFA 4YJHA 2O3JA 1Q7GA 1USGA 3P2YA 2XEDA 4G3XA 3FF4A 4HB3A 2R68A 3AH8A 1XYGA 4EHDA 4X7MA 3MJDA 1QIMA 4LECA 5KVCA 4Y9DA 3P9XA 1XK7A 2X4IA 1V43A 3COZA 1UZAA 4FKBA 5JAZA 5BR8B 3AVWA 5E9QA 2VYQA 5TY0A 4H3HB 3EOZA 1GXSB 1M7GA 4NBWA 3W1VA 4K2HA 4FTWA 2PL3A 2VJAA 1UBFA 2WFZA 1P19A 1XL1A 1ZVQA 3GQBA 4IAOA 1ONPA 3O83A 2QZJA 3OFNA 4QU5A 1CZLA 2QTMA 1GG5A 4KRYA 3SM3A 2G5PA 1WUYA 2EJCA 1JHXA 1LFAA 5AM3A 1Q95A 1YO6A 2X8JB 4YRCA 2CLSA 2IU0A 4RW0A 2RD2A 2VCHA 3WBJA 3OCJA 2EJUA 3FNHA 3HE3A 1YDEA 4PC1A 5B1DA 1ZVJA 2D06A 3ONFA 2MSEB 4MNTA 4WJLA 2AG5A 3IC5A 3G79A 4G5HA 4C0LA 4DFDA 4DLXA 1UXGA 5DHSA 4HY3A 1YL5A 4R2MA 3NGLA 1SXJC 1DPFA 2B0CA 4GUAA 1FC0A 1PZXA 1XALA 2GR9A 4G9GA 5GJBA 2ZAYA 2E5FA 4RMJA 3JQFC 3LLSA 5ETJA 1E18A 5B53A 3SFTA 3R3HA 3W5IA 5MHTA 2XMPA 4M8SA 4QDKA 4U9HS 4YQFA 2IUEA 5K3SA 3WTCA 3WRYC 2A0UA 2CWDA 3DTTA 1F6BA 3GY0A 1A95A 3OEEA 1RM5A 5C4MA 4GBGA 2Q1WA 3H75A 4KACA 4J1QA 2CJWA 2ZB7A 3TL2A 1WSDA 2XE8A 5D00A 4RTOA 3Q7EA 2E18A 1UIMA 3O82A 1X0XA 4J0DA 4XDGA 1TM3E 1YTUA 3C6XA 3LLUA 5C4IA 3HCCA 1GGFA 3OTHA 3DZJA 1JQKA 4OGWA 3WYCA 2OD7A 4BRWA 1VPTA 5ICSA 4URUR 3NR2A 3RVKA 4KK3A 2I7VA 2P2CA 3M1YA 3ZZNA 3DGFC 4US2R 1F2UB 2JIBA 1G5QA 1LX7A 3GUHA 3IEXA 1ZZGA 5ER6A 4DN6A 4EY6A 1K9VF 1W30A 3H1BA 4LQ4A 4CLHA 5JXIA 5KYGA 1HURA 2CJFA 2ZREA 4TLDA 3PC8C 5D87A 1HKUA 1E5LA 1DMRA 4G5FA 3TTUA 2KSQA 1SELA 3T9FA 2I2CA 3CTPA 1XRPA 2O5CA 1JPVA 5P21A 5C46F 4XYBA 2LCIA 2RFLA 4X64B 4CUZA 4GKKB 3V7NA 4TM8A 3RVLA 1T15A 1UF9A 3NTXA 1ZJJA 5T7BA 4J0HA 1Z12A 3F5SA 1KETA 2OCAA 2VT6A 2ZJ0A 3FNBA 1ZMRA 1E6UA 1HG1A 3GJXC 2C4NA 4JBLA 4AWBA 1M2VB 4FMPA 2OPBA 5BWCA 4G84A 3EFEA 1VSVA 4LHSA 4Q9NA 3NGXA 4KXQA 4PNHA 4UCXA 3F4LA 4RHCA 4WY5A 1Y3FE 6GPBA 1ID1A 1BDJA 1Z0UA 5DM4A 2O3RA 4L08A 1MX3A 3OQMA 1MGOA 3H65A 3REQA 2QN7A 1HKHA 1GU7A 3NALA 4JB0A 4WL0A 1W49A 1TZCA 2BJVA 3Q8XB 1SVSA 2BZGA 3UEOA 1WHTB 1V2GA 1XCOA 2IZ5A 2QMZA 3JWEA 2BWJA 1TIPA 4KEAA 4M83A 4MTCA 4IZHA 3X1YA 3ZBUA 3W5VA 2G06A 3IQDB 3K71B 2BGWA 4RV4A 3DQQA 3H9CA 4JJGA 4QYIB 1E2BA 4JLBA 2RCYA 2ZJ7A 2Q4DA 4B9AA 4KRFA 5CH8A 3EFBA 1RDFA 3Q12A 1LK0A 4C05A 1COZA 1LBHA 2GB4A 3Q7IA 3O1LA 5EPEA 4CMBA 1EFLA 3RSZA 4D43A 5M5BA 4KQ2A 1NMXA 3MUNA 5BNTA 1PR1A 1GRRA 1CR4A 1YZQA 3ZWBA 1TF5A 1QIIA 1CSEE 3ZQKA 2P6MA 4AKTA 4D0RA 1SRRA 3BMOB 1KE1A 2G63A 2BI7A 1U02A 4G07A 2GFIA 4I14A 2B4AA 4RXTA 3JCZA 5AKZA 3OUUA 1XVUA 4BO6A 2CK3D 3I8OA 2E82A 5AKJA 5AJUA 4O33A 4EY3A 1U3CA 4QREA 3AFNA 1SVNA 5E6RB 5AIAA 2VDPB 4J16A 3VVCA 2DH6A 5U9CA 5F3WB 4PCAA 1I4DD 4ZTUB 2QV0A 4HGRA 1JJ7A 1D0IA 4YXWD 4CKBA 1KAQA 3DE3X 2CC2A 4NCIA 2YJNA 2X0EA 2VRCD 1VTKA 2ENUA 2O2ZA 1DFHA 4MW2A 5HEKA 3Q9UA 5HF5A 4E07A 2O8DB 2AE2A 1RXEA 4L5BA 1TOAA 3ZV6A 5AW7A 3VSCA 2C7PA 2CB0A 1DMSA 4LWZA 2W37A 3G8CA 1E32A 2QT1A 1F17A 4A7PA 4JKYA 3A9RA 5AW3A 3F3YA 2ZVJA 4FR5A 3LRTA 2GBFA 1U0HC 2C98A 1EWQA 3TJRA 3AFHA 1GNSA 1I2CA 1P2BA 1Z82A 2QY6A 1SPBS 1UWCA 1GZ5A 3MUEA 3PS9A 1AV7A 1U9CA 1Y9ZA 2WJ6A 4L78A 3IDQA 1BKYA 3F5MA 3AB8A 1DELA 2AW3A 4LF5B 3HA5A 3B6MA 5A06A 1JXMA 2VHUA 3PXUA 4X92A 1DAIA 4PFKA 2QM0A 4MWCA 1K92A 5AP9A 3DYIA 1M34B 4ENQA 2F3SA 3ICQB 4L9AA 3EQ6A 4FBLA 4BFZA 4IIXA 1I4EB 3HY4A 4XOIA 5CHYA 4BC0A 4YRFA 5IVIA 4IM7A 2UYYA 2DHDA 3FOWA 4C0BA 1J06A 1BCSA 1Q1AA 1KP2A 2XUKA 1TM2A 1CIJA 3PUXA 5LQSA 1JTEA 4OPMA 1ZI8A 3R7NA 1IDN1 2VG8A 3NXSA 1KRWA 1TZJA 2VNSA 5I6DA 4WACA 3TYXA 3ZR4B 4PFJA 4HFNA 4B44A 3ACCA 4G2NA 4XQGA 2Y2UA 2JCSA 3PX2A 1MHTA 3BVPA 3U44B 5CXUA 3ZLTA 4ZEVA 3IP8A 5JPCA 3KSDO 3OWXA 3ZE6A 4BQSA 1XZIA 1VHTA 4C0XA 4DWWA 2GCPA 2W6NA 2A1IA 1YE5A 4TKVB 1XZFA 1E4OA 4EHNA 5A9SB 3KOYA 3FCAA 1JP7A 1PIWA 2EFGA 5LQAA 3U7JA 5JZVA 1P6UA 2VLIA 4RIFA 1E6KA 4LPSA 4LHEA 1I5OA 3LA6A 3KUDA 1PQPA 3QVOA 3KQQA 4YRSA 3E22A 3JQBA 3FETA 5AM4A 4XASA 2VDWA 2Z3ZA 5IK2A 3Q5GA 4IG9A 4AS3A 4LF7B 3IFSA 1HDZA 4D8VA 3MUOA 4D4IA 1LW6E 2FZWA 1GAXA 3FFBA 1VBFA 5AUQA 5TDHA 1I7DA 2Q41A 3IYLW 5J2UB 1KP9A 3WKBA 4RKYA 1VKJA 3L7KA 5JI2E 3EARA 3K6KA 3Q85A 4MJ3A 4QAJA 3TZHA 1CPYA 1NW5A 4X6LA 5SYNA 1I0ZA 3TUJC 4DQXA 1Y8CA 3FTNA 3UGKA 5CB6A 1WABA 2G82A 2G77B 2P7IA 5FP0A 2PBFA 4KGXA 3AY0A 5LIRA 3KKMA 1SCJA 1F8GA 1FFYA 3V4FA 2JARA 1V1RB 2HPHA 4YV0A 3EUWA 4G0WA 3FUUA 3FWYA 3GVCA 4WCFA 1G9XA 1YCGA 3FKSD 5EJ2A 5IXSA 1EVYA 3KKKA 4I3HA 3K0SA 3LG2A 1T1GA 3MGGA 2WUGA 1WCIA 1LJ8A 3UMRA 2CT8A 4L8YA 3N2LA 1BTOA 3W5AA 1R18A 1E63A 1YOVB 2AIRA 1N6LA 2EKDA 3DZCA 1K7FB 1TDJA 3N0VA 3C0KA 2EG5A 2VJNA 3O4FA 2CWWA 3RANA 1T13A 1RRMA 3B51X 3AR6A 3G0DA 3JWIA 2BMFA 1L1RA 2P6UA 1PUIA 1PZFA 1SQSA 2A7QA 2QJWA 1V95A 2FEXA 2EGGA 3RTCA 4RTRA 2GPBA 4F3TA 4POOA 1J8FA 2ONJA 3UOGA 4LVCA 2CUNA 1EU1A 2VTVA 4S1OA 3UWPA 4L5AA 3LC1O 2P2YA 4Q6WA 4W8OA 1DAMA 1CYEA 5LBUA 4D4JA 3WGTA 4Y1FA 4OHBA 1P0CA 4XAQA 4BGVA 1A7KA 1NF3A 3KFLA 4NY1A 5K3FB 3OEED 3PXBA 2OGSA 3BEDA 1HNXB 1TYAE 2ZWPA 2PANA 2HWKA 3EXG2 3FOBA 5DKFA 3AGQA 4BKQA 4TLCA 3TGLA 1SGWA 4KQFA 3B3GA 1IWBB 2NW6A 2NZVG 4N6NA 4F45A 1E9RA 4X84A 1W0CA 3SZRA 5IG2A 3EDCA 2X0KA 3U7EB 2R2GA 4KRXA 3NT2A 4UFNA 4EVQA 1YA6A 2C7RA 4KXVA 3G8DA 4M38A 4XDYA 1SRQA 1VMIA 1VRCA 5JLAA 5TARA 5AUNB 3A06A 2GXSA 3L02A 1GT6A 1IJKA 2HD4A 4Q37A 4QLAA 3TLGA 3NYQA 3O7WA 2AFRA 3PJGA 4PXSA 1TUIA 4LK3A 1BFDA 5TJHA 1GPLA 5C8YB 1Z39A 3LC0A 3N8NA 3P9PA 2HT6A 4UUOA 1QFSA 1VLHA 1OWLA 1B0AA 1JLKA 2CLOB 2P68A 4BMNA 2LKCA 4FGSA 1HG0A 4OFWA 4Q34A 3FMPB 1HTTA 1RJGA 3Q11A 1C4OA 4RJJA 2AS0A 3KJEA 3DKPA 3J81A 2SKDA 4BATA 3OZEA 1BEZA 1ZYUA 3EGWA 1JUDA 3B3AA 4GS5A 3ZEAA 1T5OA 1A72A 2XDWA 1J8YF 1IK6A 5E8JA 2WUVA 1W29A 1C3VA 1KYTA 4FMDF 1WMAA 2P9GA 5FWYB 1JDPA 1LX6A 1GFSA 4ZVNA 2JLUA 1CRLA 3K2BA 1ZFNA 1LBIA 1NV8A 4DABA 4YRMA 3SQNA 2OCDA 2ZBRA 4MS3B 4NP6A 2EW8A 2QMOA 2D8MA 2VPIA 4PX5A 5HF8A 1JQDA 2OO5C 2QI9F 2R8OA 4IIBA 4UXHA 4DBVO 4F4HA 5ITSA 2ZB4A 3PLNA 1ZICA 4MUFA 5IBQA 3Q7TA 1F4LA 3DKVA 1L7RA 2RARA 3N1UA 4PWZA 1NFFA 2X4DA 3I8SA 5AXDA 3U13A 4UM9B 3JU3A 4B48A 1NBHA 4KQCA 1GR1A 1U0OC 1WMEA 4JD5A 4P81A 1SXPA 3JS5A 1J0DA 1Z74A 4GU5A 2F62A 1BGVA 1XP5A 3A05A 3DHWC 3PDCA 4OQQA 2XB2A 4GRAA 4JI1B 3UCXA 3ZBTA 1SZDA 2PQ0A 5L8VA 1YCHA 3GD5A 3P2MA 4UU0A 2I6SA 3RLFA 3TNJA 2G0NA 4FFWA 1NHWA 1UBOS 5MGBA 1WM1A 3M9XA 3OE5A 3U5TA 2V6MA 2A92A 5IANA 1UZNA 4PNPA 1X7XA 2QXUA 4KP7A 3SAJA 3LT1A 1DU4A 5FNVB 2A5LA 3B85A 1WVMA 1YXMA 1NFQA 4B8YA 1TJ4A 3LZDA 1PDVA 2ECFA 2G71A 4ZT3A 3TFOA 3K5IA 1QQTA 3LIPA 1Y5RA 3E3LA 3FNEA 3R3ZA 4IQGA 4FYWA 4QPCA 1X94A 1OD6A 3WIBA 2UYGA 3N2EA 4N3GA 1HDEA 3L01A 1K3TA 2IYQA 2K87A 1ST2A 5AK4A 5E2AA 4WVLA 4KV7A 4DQKA 1KIAA 3P32A 3EULA 3DJYA 4HC4A 2GXUA 2EKBA 3N8IA 1B0PA 3SJUA 2FP4A 1X7HA 4EYEA 1JG2A 1K7SN 1ADCA 1YR9A 2Q29A 1UJMA 5DX1A 4ZVRA 1DS6A 3EIOA 3H8SA 1SCQA 4PY2A 4JGIA 1EFVA 4C5CA 3JAWB 1ORRA 2C9YA 5EHQA 1N2EA 3L84A 2H9AA 2UYOA 2QX9A 3KLBA 4WAUA 3JVUA 2R6DA 4Y1RA 1W2WB 3C1OA 3R0JA 2OC4A 2XAUA 4TLEA 1YZLA 4D3FA 2AB0A 2RHTA 4N9QA 4MIKA 1DTEA 2PMEA 3EF0A 1T3GA 2YCBA 4ARVA 2CSXA 1FPQA 3EB9A 2OGWA 3MZ0A 1S7CA 1B1CA 2HRQA 1B15A 3P52A 4H3KB 4WY2A 3AI7A 1O77A 4E32A 2ZKIA 3IALA 4TWZA 4G5OA 1SBYA 4B85A 1AA9A 4XWOA 5CDTA 4OSEA 4DCOA 1F06A 2G7MC 2GZSA 4PC7A 4ZIRA 2PZAA 3JQ7B 1P4GA 2P3OA 5L9AA 1VCHA 3W2TA 1XF1A 4DJJA 4BLTA 3KVOA 5AOBA 2NYUA 1OFTA 2QVGA 3U19A 4JELA 1SHJA 2ZE6A 5FEMA 2V7BA 4Q39A 1Q12A 1PT5A 3LKDA 4JOCA 2NTNA 1Z0ZA 1XAHA 2QSYA 2QMQA 1AB5A 2BGGA 4R2HA 4HTFB 4M76B 3PP8A 1NM5C 4G0YA 1V7QA 2X9NA 3WGKA 3OQVA 1QFZA 1BWRA 1XAJA 3H97A 3SE0A 2CE7A 2FEOA 3GRCA 3L0YA 4HGZA 3VZQA 5COBA 1JKJA 2YINC 1E9EA 1A8PA 4QG3A 2CLKB 3LLMA 1B16A 2JGRA 1M66A 2A1TS 2QLBA 3AILA 1JLLB 1FLNA 2YNMC 2P8SA 1CJVC 1D2NA 1Q15A 2FX5A 3ANLA 1U5BA 3UF0A 3QU5A 1MEJA 1ZD4A 3C6KA 1WJGA 1WULS 4DPLA 1CHNA 5KTYA 2V5UA 4HX2A 2ASEA 1YL6A 1ZU4A 3T4PA 1C2TA 5DF1A 4KAAA 5JFTA 1WO8A 3IP1A 3VKFA 1RC0A 2L82A 1OXUA 4L8GA 3DNMA 2ZRNA 3R6WA 4AK9A 4RD1A 3TQOA 3T0IA 3DKIA 1F9AA 2H1SA 2DP4E 1MPXA 5CLLA 2C42A 3MCVA 1NBMA 3QVXA 2R8ZA 2QU7A 3RJTA 3KM0A 3LT2A 3GLGA 3HDGA 3ZGXA 3I2YX 2JFXA 2QTGA 3G1TA 2G5TA 3G9XA 3F73A 4EECA 2J0UA 4FC7A 3DLHA 4P3OA 3JQRA 3JV7A 1NYRA 3KDSE 3RVRA 1Y33E 3WKDA 4C01A 1MO6A 2FWBA 2J7PA 2WQ7A